Sequence alignment for CL0053

PF00726

IL10_BOVIN/5-174-------------------ALLCCLVFLAGVAASRDASTLSDSSC-------IHLPTSLPHMLRELRAAFGKVKTFF---
IL10H_EBVB9/7-167-------------------VTLQCLVLL.........YLAPECGG-------TDQCDNFPQMLRDLRDAFSRVKTFF---
G3HB01_CRIGR/14-174-------------------.........AGVGPSRGQYTQQENNC-------THFPVSQTHMLRELRTAFSQVKTFF---

PF14565

IL22_HUMAN/40-178--------------------------------------------C-------RLDKSNFQQPYITNRT-FMLAKEAS---
E1C1U2_CHICK/46-184--------------------------------------------C-------RLRKINFQQPYIRNRT-YTLAEMAR---

PF05337

CSF1_HUMAN/41-180-----------------------------------------HMIG-------SGHLQSLQRLIDSQMETSCQITFEF---
Q3TLQ6_MOUSE/41-180-----------------------------------------HMIG-------NGHLKVLQQLIDSQMETSCQIAFEF---
O77709_BOVIN/41-180-----------------------------------------HMIG-------NGHLLFLQQLIDSQMETSCQISFEF---
O77710_BOVIN/41-180-----------------------------------------HMIG-------NGHLLFLQQLIDSQMETSCQISFEF---
Q64129_9MURI/41-180-----------------------------------------HMIG-------NGHLKVLQQLIDSQMETSCQIAFEF---

PF15036

IL34_MOUSE/28-184-------------------------------------TLTQDKEC-------DLTGYLRGKLQYKNRLQY--MKHYF---
R4GIU3_CHICK/19-177-------------------------------------.VAALGEC-------ELARLLQDKLRYEMRLQY--MKHNF---
F7EA00_CALJA/29-185-------------------------------------PLTQSKEC-------TVTGFLRDKLQYRNRLQY--MYVSF---
H0WFN4_OTOGA/28-184-------------------------------------SLTQSQEC-------TVTSSLRDKLQYRNRLRY--MKHYF---
M3ZVZ0_XIPMA/24-191-------------------------------------ASTPASMC-------TPLKTLNDSLSH..RRRY--MKHNF---
U3JY35_FICAL/18-179-------------------------------------EAAAPGEC-------ELTRLLQDKLQYEMRLQY--MKHYF---
L9KJY3_TUPCH/28-184-------------------------------------PVTQSKEC-------AVTGFLREKLQYRNRLQY--MKHYF---
G3T3A6_LOXAF/28-182-------------------------------------PLTQGEEC-------TFTGYLRDKLQYKNRLQY--MKYNF---
F6W3U1_MONDO/15-167-------------------------------------...QNKEC-------IITGILRDKLQYRHRLRY--MKHYF---
I3JZ08_ORENI/24-192-------------------------------------.PTHSSMC-------TPLRTINDSLSH..RRQY--MKHNF---
L5MCR9_MYODS/28-182-------------------------------------PLTQSKEC-------ALTGILRNKLQYRNRLLY--MKQYF---
B3DLJ8_DANRE/23-195-------------------------------------SSAAPDLC-------GPLKTVQDSLNATLRRRY--MKMHF---
IL34_BOVIN/28-183-------------------------------------PLTRSDEC-------AITGFLRDKLQYRNRLQY--MKHYF---

PF00714

IFNG_HORSE/15-152--------------------------------------ILGSSTY-------YCQAAFFKEIEN--------LKEYF---
H0WPL1_OTOGA/15-151--------------------------------------LLGSSAF-------YCRVTSSAEIDQ--------LKEYF---
Q8CGS0_CAVPO/15-154--------------------------------------ILSFSSY-------YCQSRFTNEIRI--------LKNYF---
B9VS86_CALJA/15-152--------------------------------------VLGSLGC-------YCQDPYVKEAEN--------LKKYF---
G3SUC6_LOXAF/15-152--------------------------------------ILGSSSC-------YCQATFLKEIQN--------LKEYL---
G3GY20_CRIGR/2-135--------------------------------------....SGC-------YCQRTLIEEIEN--------LKKYF---
I3MNV6_ICTTR/15-152--------------------------------------ILGSSSY-------YSQDIVNKEIEA--------LKEYF---
L5LME8_MYODS/15-153--------------------------------------ILGFSSC-------YSQSTIFNETQK--------LKRYF---
G5BGB5_HETGA/15-152--------------------------------------ILGFSTY-------YCESRFTKEINI--------LKDYF---
G3WQJ9_SARHA/15-153--------------------------------------ILSSSGC-------LSQVNLREDMQT--------LHNYF---
IFNG_SHEEP/15-152--------------------------------------LLGFSGS-------YGQGPFFKEIEN--------LKEYF---
IFNG_RAT/14-151--------------------------------------LMALSGC-------YCQGTLIESLES--------LKNYF---
IFNG_RABIT/15-152--------------------------------------ILGSYGC-------YCQDTLTRETEH--------LKAYL---
L9KVU0_TUPCH/51-188--------------------------------------ILGSSSC-------YCQAPFMKEVQN--------LKNYF---
IFNG_FELCA/15-153--------------------------------------ILCSSGY-------YCQAMFFKEIEE--------LKGYF---

PF02404

R4GD07_ANOCA/1-283--------------------------------------MKTAQTW-------IITCFYLQLLLLHPL-----VKTQS---
SCF_CHICK/1-287--------------------------------------MKKAQTW-------IITCFCLQLLLLNPL-----VKAQS---
SCF_RAT/1-273--------------------------------------MKKTQTW-------IITCIYLQLLLFNPL-----VKTQE---
G1NWC8_MYOLU/1-272--------------------------------------..KTQTW-------IITCIYLQLLLFNHL-----VRTTG---
F7EP53_MONDO/1-273--------------------------------------MKKTQTW-------IITCIYLQLLLFNPL-----VKTKG---
F7C5I3_ORNAN/1-273--------------------------------------MKKTQTW-------IITCIYLQLLLFIPL-----IRAQK---
F7G0W2_CALJA/1-273--------------------------------------MKKTQTW-------ILTCIYLQLFLFNPF-----VKTEG---

PF00143

G5E7E1_LOXAF/9-168----------------------LQKKHT-LTSKK.TFVVL.DQMR-------...RLSPFSCLKERKDFRF.PQEMV...
IFNE_MOUSE/27-185----------------------IPFQLW-.MNRE.SLQLL.KPLP-------...SSSVQQCLAHRKNFLL.PQQPV...
G3I0H8_CRIGR/26-185----------------------LPQTHN-IRNRK.PLTLL.AQMR-------...RLSPLSCLKDRKDFAF.PLENM...
H0VF99_CAVPO/28-187----------------------LQQQQQ-RSSLA.CLKLL.RQVK-------...GKPE.NCHQDRIDFKF.PEEIL...
L5KKJ7_PTEAL/25-192----------------------..NLLN-RVTWQ.NLKLL.SSMR-------...NSFPKDCLRENKAFEM.PQEIL...
G1U0Q8_RABIT/26-185----------------------LPHNSV-PLSRK.TLVLL.GQMR-------...RVSPVLCLKDRRDFQF.PREVV...
F6YZB3_ORNAN/25-183----------------------..RPLQ-TADVEQSLNRL.DRMK-------...GKSLLSCLEHRKDFQF.PRAVV...
I3MY95_ICTTR/32-186----------------------LSLETS-EKNEEGALNLL.KEMR-------...RIPTSSCLNDRKDFAF.PQKLL...
V8NNB8_OPHHA/15-183----------------------LQRKLL-KANKD.NSNLLSSNIR-------...PTTPLQCMRSFVELSL.EDIGKKIM
C8CKA7_PIG/26-185----------------------PVQTHS-LAHTR.ALRLL.AQMR-------...RISPFSCLDHRRDFGF.PQEAL...
H0W7G8_CAVPO/26-185----------------------LPQTHS-QRNAR.ALLLL.EQMK-------...RISTFSCLKHRQDFGL.AQLNF...
G3GXU9_CRIGR/27-182----------------------LELKQR-KCNSE.CLEVL.RQLH-------...GPL...CLNHRMDFKI.PMEVK...
H0XSG1_OTOGA/26-185----------------------LPQSHS-LGNRR.ALKVL.AQMR-------...RISPFSCLKDRSDFGI.PQEKL...
G1KX99_ANOCA/25-184----------------------LRSRLR-QASQV.YLELLNSKMN-------STISTIPQQCFEDVFNFS..PKMYL...
G3I0I6_CRIGR/27-185----------------------ILFQSR-.MKRE.SLHLL.KTLP-------...ISSVYQCLAHRKNFQL.PWQSV...
IFNT4_SHEEP/26-185----------------------LSQRLM-LDARE.NLKLL.DRMN-------...RLSPHSCLQDRKDFGL.PQEMV...
L8Y4J0_TUPCH/27-186----------------------FLFQQR-RVNRE.SFKLL.NTLR-------...SSSIQQCLPHRKNFLL.PHKSV...
F7B527_HORSE/26-183----------------------PPLRQR-..NQE.TITLL.SQME-------...RISTLLCLKDRADFRF.PQILV...
G1Q950_MYOLU/27-184----------------------LRFQQS-SSNSA.CQKLL.WQLI-------...TSPQ.HCLDDRMDFQI.PREVE...
M3WTR1_FELCA/26-186----------------------LPGSHA-QVSRD.NLVLL.GQMR-------...RLSPFLCLRARKDFRF.PREML...
G5CB66_HETGA/27-185----------------------LQAQQR-SSSLA.CGELL.KQLK-------...GKPE.YCLKDRMDFKF.PEEIK...
L9L941_TUPCH/27-198----------------------LNVHLR-RVTWQ.NLRLL.SSMS-------...NSFPVECLRENKAFEL.PQEIL...
D2H9N6_AILME/27-184----------------------LRFQLS-SSSVE.CQNLL.LQLN-------...GTTK.DCIKDRMNFKF.PEEIE...
D3Z919_RAT/26-179----------------------LPRTH.-......NLTVL.KQMS-------...RQSPVSCLKDIQYFEL.PLEKV...
C8CKB9_PIG/24-176----------------------FSGIHR-LENRE.IFMLL.RQMK-------...RTSSQACLKDRTDFQF.PWRGG...
A8E6F6_XENTR/27-179----------------------LHPKQE-YLNTQ.ILKAF.NEMM-------PL.KETEEICEEHPTDLPN.TESTY...
L8Y906_TUPCH/26-185----------------------LPQSLD-SGKQE.TLTAL.AQMG-------...TISFLSCLKDRTDFKF.PQEQL...
H9L1C3_CHICK/28-183----------------------LPLQQR-RVIES.SLQLL.DKMG-------...RRFPQQCLREKMSFRF.PEQVL...
L5KWM8_PTEAL/106-263----------------------LSQDHV-QVSKE.NIAIL.HQMQ-------.....NSFSCWKDTKNFRF.PLEMV...
G3WZJ8_SARHA/27-182----------------------LTQGLQ-E.....DFSFL.NQIS-------...VFSLLPCLKDRTNFTF.PKEAM...
G3UCD2_LOXAF/26-187----------------------LPQSHR-LANRR.TLILL.EQMR-------...RISPSSCLKDRNDFGF.PQEEL...
K7GQJ6_PIG/17-164----------------------CQQ...-....K.NLALL.CQIR-------...RISPSFCLKDRKDFGF.PQEMV...
G3I0H3_CRIGR/26-178----------------------LSLTPK-PGEKT.ALTLL.KEMM-------...RLSPFSCLKDRKDFAS.PVEKV...
H0VYK7_CAVPO/28-181----------------------LQQQQR-SSNSA.CLKLL.RQVK-------...GKPE.HCQQDRMDFKF.PEEIK...
I3N7K4_ICTTR/33-202----------------------LEVHLD-MSTSE.NLMLL.TNLS-------...NSIPVQCFREIHNFEL.PEEIL...
L5K635_PTEAL/26-185----------------------LSQSLD-LGKQE.TSTAL.NQMQ-------...RISSFLCQKDRKDFRF.PRKMV...
H0W3G0_CAVPO/26-185----------------------LPQNSV-LLCKK.TFVLL.GQIR-------...KMPRSLCLKDRSNFLL.PQKMM...
W5JYQ9_ASTMX/23-179----------------------VKCSLQ-RRLVQTCHHLL.DSMG-------...GAFPFRCLDDYVLVPF.PKAAF...
G3SI98_GORGO/28-185----------------------.NVHLR-RVTWQ.NLRHL.SSMS-------...NSFPVECLRENIAFEL.PQEFL...
H0Y0D2_OTOGA/28-187----------------------LPKSPI-LNTAV.TLKIL.AQMR-------...RIHPFLCLKDRRYLGF.PQEEF...
IFN_ANAPL/34-190----------------------LRLHDS-AFAWD.SLQLL.RNMA-------...PSPTQPCPQQHAPCSF.PDTLL...
G3UJX3_LOXAF/27-185----------------------LQFQQR-SSNLA.CQKLL.WKLN-------...GAPE.SCLEDRMDFKI.PEEIK...
G5C259_HETGA/26-185----------------------LPRTHS-QGNRR.ALTLL.EQMR-------...RISTFSCLKDREDFGL.PHQEF...
G3WZF5_SARHA/26-185----------------------LRFYQR-RTNKS.SIYLL.KKMI-------...GELHPECQKDRMDFQI.PKEIL...
IFNE_PIG/27-186----------------------VLSQQR-RVNRE.SLKLL.NKLQ-------...TSSIQQCLPHRKNFLL.PQKSM...
W5N6G4_LEPOC/27-185----------------------LEHQLG-NINEK.SIQAL.KEMG-------...GGFPVECVSQIIT.TF.PVDAF...
H9KYA4_CALJA/26-185----------------------LPQAHS-LSNRR.ASILL.AQMR-------...RISPFSCLKDRQDFVF.PQEVF...
D2HTQ4_AILME/33-205----------------------LHFHLR-KVTWQ.NLRLL.SSTS-------...SSFPVECLRETKAFEL.PQEIL...
IFNB_HUMAN/27-185----------------------LGFLQR-SSNFQ.CQKLL.WQLN-------...GRLE.YCLKDRMNFDI.PEEIK...
G1NR05_MELGA/32-188----------------------LRHQDA-NFSWK.SLQLL.QKAA-------...PPPPQNCPQQDVTYPF.PETVL...
F7BVP5_ORNAN/23-181----------------------LYSHQW-LNNWQ.SLHLL.DEMG-------...GQFPLHCLKERMKFKL.PAEMV...
F7G875_MONDO/27-182----------------------LRFHQR-RTNQR.SLMFL.NKMI-------...GKLHPECLQERMDFQI.PREIV...
C8CKC3_PIG/33-205----------------------LNAHLR-RVSWQ.NLRLL.SRMS-------...HSFPIECLTESKAFEL.PQEIL...
I3MVD7_ICTTR/34-186----------------------.LETPD-GNEEG.ALTLL.EKMR-------...RIPTFSCLNYRKDFAF.PQEQL...
F7A317_HORSE/26-184----------------------LPHTHS-LGNTR.VLMLL.GQMR-------...RISPFSCLKDRNDFGF.PQEVF...
G1KU56_ANOCA/28-182----------------------LRKHLL-DDNKE.NLAVLKSQLG-------...SVFPLQCLNDVISFSSQPEEEN..I
L5KBH2_PTEAL/26-185----------------------LSQDHV-QVSKE.NIALL.HQMQ-------...RISSFRCRKDRKNFGF.LREMV...
L5K909_PTEAL/26-185----------------------LPQTHS-LVNRR.ALMLL.GQMR-------...RISPFSCLKDREDFGF.PQEAF...
I3N5Z0_ICTTR/23-179----------------------VLLQQR-.IKEE.NLQLL.NNLQ-------...TSSIQQCLPYRKNFRL.PQNSV...
F7GHL9_MONDO/26-181----------------------LTQGLQ-K.....DFSLL.NQMS-------...TSSLVPCLKEWTNFSF.PKEAL...
IFNE_HUMAN/27-186----------------------IIFQQR-QVNQE.SLKLL.NKLQ-------...TLSIQQCLPHRKNFLL.PQKSL...
I3LBU7_PIG/26-179----------------------LSQNHV-HVSRK.NLVLL.CQMR-------...RISPSFCLKGRKDFGF.PQEMV...
G3UK87_LOXAF/27-184----------------------LPQILG-LGKQE.TFTPL.GQMR-------...R...FFCLKERKDFRF.PR.MV...
L9LC61_TUPCH/27-185----------------------LRFQLS-GSSLA.CKKFL.QQLG-------...GVPE.DCLKDRMSFEV.PEEIQ...
IFNB_RAT/27-182----------------------LQFRQS-TSIRT.CQKLL.RQLN-------...GRLN...LSYRTDFKI.PMEVM...
H0XMZ9_OTOGA/27-186----------------------VLFQQR-RVNRE.SIKLL.NELQ-------...TSSVQQCLPHRKNFLL.PEKPV...
G3VDC6_SARHA/27-182----------------------LTQGLQ-E.....DVSLL.YQMS-------...TFSLLSCLKDRTDFKF.PEEAV...
I3JM36_ORENI/26-182----------------------MDDKFK-QHNEE.TLKLL.DTMA-------....NNSTNITEVEVTVPF.PNHLY...
L5LKN9_MYODS/27-186----------------------VLFQQR-RVNRE.SSELL.KKWQ-------...PSSIRQCLPHRKDFLL.PQEAG...
G1TYS8_RABIT/29-195----------------------LNVNLN-RVIRK.NMKLL.RNVS-------...HSFPIECLREIKDFEL.PQEIL...
I3UJJ8_FELCA/27-185----------------------ALFQQR-.VNRE.SLKLL.STLQ-------...SSSIQQCLPHRKNFLL.PQRSV...
C8CKA9_PIG/26-183----------------------LPQSHD-..NPE.IFTLL.RQMG-------...RLSILSCLKDRTDFRF.PRTLV...
IFNT2_BOVIN/3-162----------------------LSEDHM-LGARE.NLRLL.ARMN-------...RLSPHPCLQDRKDFGL.PQEMV...
H0W510_CAVPO/26-186----------------------LPQTHS-QGNMR.ALILL.GQRR-------...RISAFSCLKHRQDFGL.AGLEF...
M3Z729_MUSPF/26-183----------------------LPQDHG-LLHWR.ALMLL.RQMK-------...RVSAFSCLRDRNDFAF.PQEVF...
IFNA1_MOUSE/26-185----------------------LPQTHN-LRNKR.ALTLL.VQMR-------...RLSPLSCLKDRKDFGF.PQEKV...
G3TTC1_LOXAF/26-185----------------------LPQNHT-VASEK.TVDLL.DQMQ-------...RCPTFFCLDDRKDFRF.PQEMV...
G1PDS6_MYOLU/29-199----------------------..IHLR-RITWQ.NVELL.TNMS-------...KSLPLECLRENKAFEL.PREVL...
F7ABU5_MONDO/27-182----------------------LTLGLQ-E.....DFSLL.NQMS-------...TSSLVPCLKDGINFNF.PKEAM...
G1TTX4_RABIT/27-180----------------------LQIQLW-HGSLT.CAKLL.LQLN-------...GTTE.DCLNERINFKV.PKEIK...
H0XRP5_OTOGA/26-185----------------------LPQSHS-LGNRR.ALIPL.VHMR-------...RISPFSCLKDRSDFRF.PREEM...
H0WK94_OTOGA/33-202----------------------LNVHLR-RVTLQ.NLRLL.SSMS-------...NSFPRECLKENKDFEL.PQEIL...
G1KYL3_ANOCA/23-176----------------------LLTRLR-EANQA.NLDVLHRNMG-------...PSISQQCIDDVFSFS..HREAL...
G3WZQ8_SARHA/26-181----------------------LTQGLQ-E.....DFSLL.NQMS-------...TFFLLPCLKDRTNFNF.PKEAV...
H2R6R8_PANTR/26-185----------------------LPQTHN-LGNRR.ALILL.AQMG-------...RISPFSCLKDRHDFGF.PQEEF...
H0YTY6_TAEGU/34-188----------------------LWTHDD-SFPGD.ALRLL.QDMA-------...PSHTQPCHLQEPPF.F.PDTLL...
I3MXH1_ICTTR/27-185----------------------LRLQQF-NSSVE.CQKLL.EQLN-------...GRPA.DCLSDRMDFKI.PKEIK...
M3WRV1_FELCA/26-184----------------------LPQTHG-LLNRR.ALTLL.GQMR-------...RLPASSCQKDRNDFAF.PQDVF...
H0W4H8_CAVPO/23-182----------------------LAVFQQ-RMNRL.SLQLL.NNLR-------...TSLVQQCLLHKKSFLI.PQKSV...
R4GKJ6_CHICK/35-191----------------------LRPQDA-TFSHD.SLQLL.RDMA-------...PTLPQLCPQHNASCSF.NDTIL...
A3FBE8_MUSPF/27-184----------------------LRFQLS-SSSVE.CQELL.LQLN-------...GTSK.DCLKDRMNFKI.PEEIQ...
G1KWE0_ANOCA/28-180----------------------LCSWLR-QANQA.NLELLNSKMG-------...STIPQQCIEDVFSFS..PKEDL...
G7PS89_MACFA/26-185----------------------LPQTHS-LGYRR.PLVLL.AQMR-------...RISPFSCLKDRHDFEL.PQEEF...
G1Q880_MYOLU/26-185----------------------LPQDHI-LLSRE.NLELL.SQMS-------...TISPFFCLKDRKDFRF.PRATV...
IFNB_MOUSE/27-180----------------------LQLQER-TNIRK.CQELL.EQLN-------...GKIN...LTYRADFKI.PMEMT...
IFNB2_BOVIN/27-184----------------------LRFQQR-RSLAL.CQKLL.RQLP-------...STPQ.HCLEARMDFQM.PEEMK...
G1SJC4_RABIT/26-185----------------------LPQTHS-LSDRR.SSMLL.GQMR-------...RVSPLSCLQDRHDFEC.PLEEL...
W5PG31_SHEEP/26-185----------------------LPHTHS-LANRR.VLTLL.RQLR-------...RVSPSSCLQDRKDFAF.PQEAL...
IFNA3_CANLF/26-183----------------------LPDTHS-LRNWR.VLTLL.GQMR-------...RLSASSCDHYTTDFAF.PKELF...
G5BPX2_HETGA/27-199----------------------QNVRLS-TVTKE.NVRLL.SSVS-------...NPLPLRCLREIKAFGL.PQNIL...
IFNW2_HORSE/26-185----------------------LPQNHI-LVSRK.NFVLL.GQMS-------...RISSAICLKDRKDFRF.PQDMA...
G3N2A8_BOVIN/26-185----------------------LSQNHM-LVGRK.NLRLL.GQMR-------...RLSSRFCLQDRKDFTF.PQEMV...
H0XKS8_OTOGA/27-185----------------------LQFQQR-RSTLG.CQKLL.RQLN-------...GKPE.GCLKDRMNFEI.PKEIK...
H0VUV7_CAVPO/26-185----------------------LPLTYM-QGNTT.ALSLL.EQMR-------...RTFTFSCLKHRQDFGL.ALLDF...
Q29412_PIG/27-184----------------------LRYQQR-SSNLA.CQKLL.GQLP-------...GTPQ.YCLEDRMNFEV.PEEIM...
G7PS88_MACFA/26-185----------------------LPETHS-LDNRR.TMMLL.KQMS-------...RISPSSCLMDRHDFGF.PQQEF...
M3WZS7_FELCA/26-181----------------------LRPS..-..NPE.TFTLL.SQME-------...RVSILSCLKDRTDFNF.PQILV...
H9GZR7_HORSE/26-185----------------------LPASLD-LRKQE.TLRVL.DQME-------...TISPPSCLKHRTDFKF.PQEQL...
F1LVL8_RAT/26-184----------------------ILFQSR-.RNRE.SLQLL.KALP-------...SSSVQLCLAHRKNFLL.PQQSV...
M3YX13_MUSPF/27-179----------------------ALFQQR-.VNRE..LKLL.NKFP-------...KSSVQPCLPHRTNFLL.SQQSV...
G1L8G2_AILME/26-185----------------------LPQNHG-LFAWR.ALTLL.SQME-------...RISILSCLKDRTDFSF.PQMLV...
IFNB_HORSE/27-184----------------------LRSQLR-SSNSA.CLMLL.RQLN-------...GAPQ.RCPEDTMNFQV.PEEIE...
H0W289_CAVPO/26-190----------------------LPQNFI-LLSRK.ILELL.DQMR-------...RISTFLCLKDRRDFRF.PKEMM...
A8E6E8_MONDO/27-182----------------------LTQGLQ-E.....DFSLL.NQMS-------...TFSLVPCLKDRTSFNL.PKEAL...
I3N788_ICTTR/27-185----------------------LRLQQS-SSSLE.CQKLL.QQLN-------...GRPE.DCLSDRMDFKI.PKEIK...
G1L8I1_AILME/26-183----------------------LPQNHG-LFAWR.ALTLL.GQMK-------...RMTAFSCLKDRNDFAF.PKEVV...
IFNB_FELCA/27-184----------------------LGFQLR-SSSLE.CQELL.VNLN-------...RTSK.YCLKDRMNFEV.PEEIK...
H0VXI5_CAVPO/26-181----------------------LSQTHS-QGNTR.ALILL.GQMR-------...RISTFSCLKDRQGFDL.....F...
G3TS29_LOXAF/26-179----------------------LPLSHS-..NQE.TFTLL.NQME-------...RISLLSCLKDRTDFRF.PQILM...
W5PZ39_SHEEP/26-184----------------------LNVHLR-RVTWQ.NLRLL.SRMS-------...NSFPIECLQERKAFEL.PQEIL...
G3I0H6_CRIGR/26-178----------------------LSPSPK-PGNKT.ALTLL.KEMR-------...RLSPFSCLKDRKVFAS.PVEKV...
I3L756_PIG/26-180----------------------LSQNHV-HVSRK.NLVLL.HQMR-------...RLSPSFCLKDRKDFGF.PQEMV...
M3Z715_MUSPF/26-183----------------------LPRDHS-LLHWR.ALMLL.RQMK-------...RISLIFCDKYINDFAF.PKKVF...
M3VXI8_FELCA/33-205----------------------LHLHLR-EVTWQ.NLRLL.NSMS-------...NSFPVECLRESRAFEL.PQDIQ...
G3R8Q7_GORGO/26-185----------------------LPQNHG-LLSRN.TLVLL.HQMR-------...RISPFLCLKDRRDFRF.PQEMV...
A8E6F5_XENTR/51-202----------------------LQPKQE-YLNRQ.TLKTF.EEMN-------PP.EDYDESCQYDSIELPN.IDEIY...

PF02947

FLT3L_MOUSE/30-162-------------------DCYFSHSPI.SSNFKVKFRELTDHLL----------KDYPVTVAVNLQD............
F6T7S9_ORNAN/28-157-------------------ACAFRYSPV.SSMFGLHIHNLAQYLL----------QDYPVSVVTNLQT............
H9GP84_ANOCA/29-165-------------------GCIFGSVPIDTSDFPSIVKNLKKLLL----------LDYPVPVPVNLKQ............
F6TPW7_MONDO/34-163-------------------SCTFPDSPI.SSTFLQAIGRLSDYLL----------TDYPVEVPDNLQ.............
G5B8P0_HETGA/20-150-------------------SCSFSHNPI.SSDFKIKFSTLSDYLL----------KDYPVTVAANLQD............
G1M637_AILME/29-159-------------------DCAFSHSPI.SSTFSVTIHKLSDYLL----------QDYPVTVASNLQD............
L9JA37_TUPCH/769-910-------------------....QGSPI.ASTFADRIDQLSDYLL----------LDYPVTMASNLQDPGTGPPRLQRAW
G3VSA3_SARHA/79-209-------------------PCSFPDSPI.SSIYPGIISTLSDFML----------GDYPVDVPENLRV............
G1QZC3_NOMLE/30-160-------------------DCSFQHSPI.SSDFAVKIRELSDYLL----------QDYPVTVASNLQD............

PF06875

Q5BNQ4_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSADSLLPTY-LSFQGAP---
Q5BNQ2_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSADSLLPTY-LSFQGAP---

PF01110

CNTF_CHICK/1-194--------------------MAAADTPSATLRH----HDLCSRGI-------RLARKMRSDVTDLLDIY-VERQGL----
G3VWZ5_SARHA/1-195--------------------MAFPENTPLTPHH----RDLCTRSI-------WLARKIRSDLTSLLESY-VEYQGL----
E1BFH9_BOVIN/1-193--------------------MAFAEHSLLPPHR----RDLCSRSI-------WLARKIRSDLTALVDSY-MKHQGL----
G5AP46_HETGA/1-192--------------------MAFAELSPLTPHR----RDLCSRSI-------WLARKIRSDLTALMDSY-VKHQGL----
H0Z9U1_TAEGU/1-188--------------------MAASESPSAALRR----RDLCSRGI-------RLAGKMRADVVDLLDAY-VEQQGL----
CNTF_HUMAN/1-194--------------------MAFTEHSPLTPHR----RDLCSRSI-------WLARKIRSDLTALTESY-VKHQGL----

PF01291

LIF_MOUSE/44-203--------------------------------------NLMNQIK-------NQLAQLNGSANALFISY-YTAQGEP---
LIF_BOVIN/43-202--------------------------------------NLMNQIR-------NQLGQLNSSANSLFILY-YTAQGEP---
ONCM_HUMAN/37-209--------------------------------------VLLGQLQ-------KQTDLMQDTS.RLLDPY-IRIQGLD---
ONCM_MOUSE/34-194--------------------------------------QLLSQLQ-------NQANLTGNTE.SLLEPY-IRLQNLN---
ONCM_BOVIN/34-194--------------------------------------ELLLQLQ-------RQADLMQDPS.TLLDPY-IHLQGLH---

PF03039

IL12A_MOUSE/6-215YLLFLATLAL...LNHLSLARVIPVSGP......ARCLSQSRNLL-------KTTDDMVKTAREKLKHYSCTAEDID---
G3VQT1_SARHA/40-247..FLIAILIG...LSQVNWVKSIPVIQSEPSM..HQYLRGSKNLL-------GTVTETLQQARQKLELYSCSLEEID---
F6T5A8_MONDO/5-202HIFLIATLIG...LSQIHWATSLPVPQPEPSM..PQCLTASKNLV-------EATNEILQKSRKILELYPCSLEEID---
IL12A_PIG/6-222NLLLVATLVLLNHLDHLSLGRSLPATTAGPGM..FKCLNHSQNLL-------KAVSNTLQKAKQTLEFYSCTSEEID---
L8YEA2_TUPCH/1-213.LLLAATLVL...LHHGTLARNLPTAMPGPGK..FGCLSHSQNLL-------TAISNTLQKARKNLEFYSCTSEEID---
H0X861_OTOGA/6-217SLLLVAILVL...LDHLSLARNLPRPTPEPGR....CHQHSQKLL-------EAVSTTLQKARETLNSSSHTSEEID---
G1QWH2_NOMLE/40-254SLLLVATLVL...LDHLSLARNLPVATPGPGM..FPCLHHSQNLL-------RAVSNMLQKARQTLEFYPCTSEEID---
I3MN91_ICTTR/4-220GLLLLASLVL...LEHLGSARNLPRSTPVPAVS.QECHNLSQTLL-------STVDSALQNAIEILEHYPCSAEEVN---
Q924V6_CAVPO/6-221KCLLLTSLVL...LVSCSLARNLPRASPAPVTEPVQCFNHSQTLL-------RAVNSELHKAIQMLAVYSCTPEEID---

PF02024

H3AP27_LATCH/26-169-----------------------------------------------------.IEKVKSDARNLTRII-----------
G3WWV6_SARHA/23-167-----------------------------------------------------PIRKVQDDTKTLTKTI-----------
F6PLK2_ORNAN/23-167-----------------------------------------------------SIEKIQADTKTLTKTI-----------
F7HGW1_CALJA/23-167-----------------------------------------------------PIQRVQDDTKTLIKTI-----------
G5BHA4_HETGA/23-167-----------------------------------------------------PIQKVQDDTKTLIKTI-----------
W5NER9_LEPOC/28-172-----------------------------------------------------...RVKNDARLLAQTT-----------
H0V7C6_CAVPO/23-165-----------------------------------------------------PMQKLQDDAKFLIKTI-----------
LEP_HUMAN/23-167-----------------------------------------------------PIQKVQDDTKTLIKTI-----------

PF00489

IL6_BOVIN/27-208------------------PTPGPLGEDFKNDTTPGRLLLTTPEKT-------EALIKRMVDKISAMRKE---ICEKN---
M3X721_FELCA/27-208------------------PTPGPLGGD....ATSNRLPLTSADKM-------EELIKYILGKISALKKE---MCDNY---
IL6_HORSE/27-208------------------PTPLPLGED...ETTSNGPLLTTADKT-------KQHIKYILGKISALKNE---MCNNF---
G3UHF3_LOXAF/20-205------------------PNPKPLEGDSKDDAASNRPSLTSPDKT-------EELIRFILAEISVLRKK---MCDKY---
L5KPK4_PTEAL/20-202------------------PIPVPSGEDSKDDTNSNRPQLTSPNQT-------ENLIKSIFLEISEVRNK---MCGND---
F7HV62_CALJA/27-212------------------PAPVPLGEDSKEVAAPNRQLLTSTERI-------DKHIRYILDGISALRKE---ICNKS---
IL6_MOUSE/26-210------------------PTSQVRRGDFTEDTTPNRPVYTTS.QV-------GGLITHVLWEIVEMRKE---LCNGN---

PF16647

CSF3_BOVIN/42-190-------------------------------------------------------VRKIQADGAELQER...LCAAH---
CSF3_HUMAN/51-202-------------------------------------------------------VRKIQGDGAALQEKLVSECATY---
CSF3_MOUSE/57-205-------------------------------------------------------VRKIQASGSVLLEQ...LCATY---

PF02372

IL15_PIG/33-160VFILGCISAGLPKT----EAT...WQ----------------...-------.....HVISDLKKI--------------
IL15_CAVPO/33-160VFVWGCISAGLPKT----EAS...WH----------------...-------.....DVIYDLKRI--------------
IL15_FELCA/33-160VFILSCINAGLPKT----EAN...WQ----------------...-------.....DVISDLKII--------------
IL15_SHEEP/33-160VFILGCISAGLPKT----EAN...WQ----------------...-------.....SVIHDLKTI--------------
F1NZN5_CHICK/55-183.FFL.C..AYVPKT----EANHCKWS----------------...-------.....DVLKDLELI--------------
G1NDP6_MELGA/5-137VLIFSCISVALLMT----TAYGASLS----------------PEK-------LEILPALIKDLEIL--------------
O73883_CHICK/5-138VLIFGCISVAMLMT----TAYGASLS----------------SAK-------RKPLQTLIKDLEIL--------------
Q8JFF4_ANAPL/4-134VLIFSCLSVLMLMT----TAYGAPLS----------------EKD-------.NTLKTLIKDLENL--------------

PF00715

I3MQX6_ICTTR/7-151---LSCLALTLALL----AHGAPTSGSA..............EET-------RQQLEHLLLDLQVLSR----GVSNQ---
G5C793_HETGA/7-149---LSCIALTLALI----TSSAPTSSST..............RET-------QEQLEQLLLDLQVILK----GVT..---
G1PJ32_MYOLU/7-147---LSCIALTLAFI----ADGAPTSSSS..............QET-------QQQLEHLILDMQRLLN----GVSNY---
B1AB81_HORSE/7-146---LACIALTLAVL----ANSAPTSSSK..............RET-------QQQLKQLQMDLKLLLE----GVNNN---
G3HTL8_CRIGR/7-150---ASCLALTLALL----VNSAPTSSSK..............KET-------QQHLEQLLLDLQVLLK----GINNN---
IL2_MACMU/7-151---LSCIALSLALV----TNSAPTSSST..............KKT-------QLQLEHLLLDLQMILN----GINNY---
H0Y254_OTOGA/7-149---LTCIALTFALV----TNSAPISSST..............KET-------RQQLEQLLLDLQMVLN----GVNNN---
IL2_MOUSE/7-165---ASCVTLTLVLL----VNSAPTSSSTSSSTAEAQQQQQQQQQQ-------QQHLEQLLMDLQELLS----RMENY---
G3SU90_LOXAF/7-147---LSCIALTLALV----ANSAPTSSST..............KET-------QQQLEQLLLDLQMLLI----RVKNY---
IL2_PIG/7-151---LCCIALTLALM----ANGAPTSSST..............KNT-------KKQLEPLLLDLQLLLK----EVKNY---
IL2_FELCA/7-151---LSCIALTLILV----TNSAPASSST..............KET-------QQQLEQLLLDLRLLLN----GVNNP---
L5K7D9_PTEAL/7-149---LSCIALTLALV----ADGAPTSSSR..............KET-------QQQLEHLLKDLQRLLE----TVNNY---
IL2_BOVIN/7-152---LSCIALTLALV----ANGAPTSSST..............GNT-------MKEVKSLLLDLQLLLE----KVKNP---
H0VBY4_CAVPO/7-149---LSCLALTLALL----TSSAPTSSSP..............KQT-------QDRLELLLRDLQTLLE----GVT..---

PF00103

PLRP1_BOVIN/26-238---LLMSNLLLCQ.....GKSCPSCGPDVFVSLRKSFTDRFMNAA-------SLSHDFYNLSTIMFNE----FDEKY---
CSH2_BOVIN/26-238---LVVSNLLLCQ.....GISCPSCGPDMFVSLQKSLIDVFINAA-------SLSHDFHNLSTIMFNE----FDEKY---
PLRP3_BOVIN/1-213---MVMSNLLLCQ.....VNSCPSCCPDVFDIPLESLTHLFLNAS-------RLSHDIVNHTTIMFHE----FDEKY---
PR4A1_RAT/17-227---LLVSNLLLWEN....TASAMRAKLL.NVHNYTSYGDTWNQAI-------KISQDMNQYISDLSTH----VKIFY---
CSH1_BOVIN/26-236---LVVSNLLLCQGVEDYAPYCKNQPGN....CRIPLQSLFERAT-------LVASNNYRLAREMFNE----FNKQF---
PLRP4_BOVIN/26-239---LVMSNLLLCQ.....GILCPSLCPDGDDVCRASLIDLFVHAS-------VLSTGMYNTSVKMFTD----FDEQY---
PR3D4_RAT/16-223---LLVSNLLLWEN....MASKPTVLVS........TEDLYHRLV-------EQSHNTFIKAADVYRE----FDINF---
PR2C2_MOUSE/16-224---LLVNSSLLWKN....VASFPMCAMR.NGRCFMSFEDTFELAG-------SLSHNISIEVSELFTE----FEKHY---
SOM2_HUMAN/9-215---LLLAFGLLCLSWLQEGSAFPTIP..........LSRLFDNAM-------LRARRLYQLAYDTYQE----FEEAY---
PR8A5_RAT/17-238---LVVSNLLLWEK....AASIPACMVE.DGGCWDPLREAFNSAT-------QRAETLRNLSDQLYVE----FFQNQ---
PR6A1_RAT/20-234---LLMSNILLWEN....VASVPRHASGAGRG.EMSLHGLLDHAI-------ILAHNVTELIAEMNSV----FLEDV---
PR7D1_MOUSE/17-240---LLMSNLFLWEK....VSSAPINAS...EAVLSDLKDLFDNAT-------VLSGEMSKLGVIMRKE----FFMNS---
CSH2_HUMAN/9-215---LLLAFALLCLP...WLQEAGAVQ.......TVPLSRLFDHAM-------LQAHRAHQLAIDTYQE----FEETY---

PF01109

CSF2_RAT/18-139------------------APTRSPNPVT---------RP--WKHV-------DA.IKEALSLLNDMRA----LENEK---
CSF2_MOUSE/18-136------------------APTRSPITVT---------RP--WKHV-------EA.IKEALNLLD...D----MPVTL---
CSF2_BOVIN/18-138------------------APTRPPNTAT---------RP--WQHV-------DA.IKEALSLLNHSSD----TDAVM---
CSF2_CAVPO/18-140------------------APTDLLSPVT---------QS--WKHV-------DATINEALSLLNHTSD----PAAVM---
CSF2_PIG/18-139------------------APTRPPSPVT---------RP--WQHV-------DA.IKEALSLLNNSND----TAAVM---
CSF2_HUMAN/18-139------------------APARSPSPST---------QP--WEHV-------NA.IQEARRLLNLSRD----TAAEM---
CSF2_CANLF/18-139------------------APTRSPTLVT---------RP--SQHV-------DA.IQEALSLLNNSND----VTAVM---

PF02025

G1RQD7_NOMLE/22-133----------------------TEIPTS---------AL----------------VKETLALLSTHRT----L--LI---
IL5_CAVPO/23-134----------------------QSATLR---------AL----------------VRETLTLLSTHRT----L--LK---
J9NWP5_CANLF/22-132----------------------VENPMN---------RL----------------VAETLTLLSTHRT----W--LI---
IL5_MOUSE/21-132----------------------MEIPMS---------TV----------------VKETLTQLSAHRA----L--LT---
G3WAR7_SARHA/25-134----------------------..NPVT---------EL----------------ISETLSLITAHRT----L--LI---
IL5_HORSE/22-133----------------------VESPMN---------RL----------------VAETLTLLSTHRT----L--LI---
B5FW65_OTOGA/22-133----------------------IEISMS---------TL----------------VKETLALLSTHQT----L--LI---
I3MDT8_ICTTR/23-134----------------------LEIPMS---------TL----------------VKETLTLLSTHQT----V--LI---
G3T4B0_LOXAF/23-133----------------------IEIPVH---------RL----------------VAETLALLSTHRT----L--LI---
G1SL79_RABIT/22-133----------------------TEIRMS---------TV----------------VKETLTLLSTYQS----L--LI---

PF02059

IL3_CANLF/19-132------------------.PQAQGRP.F---------STDLPKQY-------FTMINEIMEMLNKSPS----PSE..---
IL3_MOUSE/27-138------------------ASI.SGRDTH---------RLTRTLNC-------SSIVKEIIGKLPEPEL----KTD..---
IL3_BOVIN/18-132------------------APQAKGLPVV---------TSRTP..Y-------SMLMKEIMDDLKKITP----SPE..---
G3UC30_LOXAF/22-133------------------..KAQGMP.V---------TA..PQHY-------SVMINEIKEILQKSPP----LNS..---
G1MH15_AILME/18-131------------------APMAQGRS.L---------STYQPKQY-------FEMISEIMDILNNSPS----PSE..---
F1RJV6_PIG/18-131------------------APQAQGMP.T---------TTLQPKNY-------LAMIQEITRSLENLTV----TSN..---
G1RQ11_NOMLE/20-137------------------APMTQTTSLK---------TS..WVNC-------SNMIDEIITHLKQPPL----PLLDF---
IL3_CALJA/19-136------------------AAPTQTMPLK---------TT..QVNC-------SNLREEIVTLLNQPPL----ASSNF---
F1LS41_RAT/29-138------------------GSA......H---------RLLRTLDC-------RTIALEILVKLPYPQV----SGL..---

PF07400

IL11_HUMAN/22-199------------------PGPPPGPPRV---------SPDPRAEL-------DSTVLLTRSLLADTRQ----LAAQL---

PF00758

G3TYQ1_LOXAF/25-173------------------PPACDPRLLN---------KLLRDSHI-------LHSRLSQCPDFNPLST----PVPLP---
W5K758_ASTMX/26-175------------------RPICDLRVLD---------HFIKEAWD-------AEATMRVCKEDCSIGV----PLMVP---
B1N8Y2_DANRE/15-168------------------RPICDLRVLD---------HFIKEAWD-------AEAAMRTCKDDCSIAT----NVTVP---
F7DTH0_CALJA/31-193------------------HLICDSGVLE---------RYVLEGKE-------AENVTMGCAESCSLNE----NITVP---
M3XJ62_LATCH/27-177------------------RPVCDTSVMD---------KFIEDAKD-------AESFVNGCTEACELPV----DMTLP---
G3W289_SARHA/30-190------------------.PFCESHILE---------RYILEAKE-------AQNATVACLEDCSLGE----NITVP---
F6WUU2_MONDO/31-191------------------.PFCDSHILE---------RYILEAKE-------AQNATVRLHPRRNIVL----AFSNT---
G3VW20_SARHA/26-175------------------APVCDPRLFN---------KLLRDSAA-------LHSRLSQCSDLGPLPI----PVLLP---
G1PF99_MYOLU/45-207------------------RLICDSRVLE---------RYILEARE-------AENVTMGCAEGCSFSE----NITVP---
TPO_CANLF/25-176------------------PPACDPRLLN---------KMLRDSHV-------LHSRLSQCPDIYPLST----PVLLP---
F7G570_MONDO/26-177------------------APVCDPRLFN---------KLLRDSAA-------LHSRLSQCSDLSPLPI----PVLLP---
H0W023_CAVPO/30-191------------------RLICDSTVLE---------RYIVEAKD-------AENVTMSCTEGCSLGE----NITVP---
H2LEX3_ORYLA/33-182------------------RPICDLRVLN---------HFIQEARD-------AEVAMRSCREGCGLTQ----TVSVP---

PF03487

G1SCQ2_RABIT/16-144-------------------------------------------AL-------WWAVAIAVTCLGSLVS----PGPVP---
IL13_HUMAN/16-144-------------------------------------------AL-------LLTTVIALTCLGGFAS----PGPVP---
IL13_RAT/2-130-------------------------------------------AL-------WVTAVLALACLGGLAT----PGPVR---
F7DGH7_MACMU/16-151-------------------------------------------AL-------LLTMVIALTCLGGFAS----PSPVP---
L5M5Z7_MYODS/2-128-------------------------------------------AL-------WLTLVIVLTCFGGLAS----PGPVR---
G5ASP9_HETGA/2-130-------------------------------------------AL-------WVTVVLALTCLSALTA----PGPVP---
B3GDZ5_PIG/2-130-------------------------------------------AL-------WLTLVIALTCFGGLAS----PGPVP---
L8YAP6_TUPCH/2-128-------------------------------------------AL-------WLTVVIALTCLGGLAS----PASVP---
IL13_BOVIN/2-130-------------------------------------------AL-------LLTAVIVLICFGGLTS----PSPVP---
IL13_MOUSE/2-130-------------------------------------------AL-------WVTAVLALACLGGLAA----PGPVP---
H0W834_CAVPO/16-149-------------------------------------------AF-------WVTVVLALACLGGLTA----PGPVP---
F6WQF3_ORNAN/2-128-------------------------------------------TV-------VLLAVFWIDCI....S----AKPVT---
G3T2N9_LOXAF/2-133-------------------------------------------AL-------WLTVVIALTCIGGLAS----PVPVY---
M3YGH3_MUSPF/2-126-------------------------------------------AL-------WLTVIIAFICLSGLAS----PGPVH---
B5FW67_OTOGA/2-129-------------------------------------------AL-------WLTMVIALTCLGGLAS----PGPVP---
I3MAR4_ICTTR/2-131-------------------------------------------AL-------WLTVVLTLACLGGLAA----PGPVP---
IL13_CANLF/2-129-------------------------------------------AL-------WLTVVIALTCLGGLAS----PSPVT---

PF00727

IL4_FELCA/26-131-------------------------------------------NF-------NNTLKEIIKTLNILT.----.ARND---
H0XDE1_OTOGA/26-149-------------------------------------------KR-------GIVLKECIKALNILT.----.ENKT---
IL4_MOUSE/27-140-------------------------------------------..-------KNHLREIIGILNEVT.----.GEGT---
G3T4B8_LOXAF/26-132-------------------------------------------TC-------GNILREIIKTLNFLT.----.EKKH---
IL4_RABIT/28-143-------------------------------------------..-------DIILPEVIKTLNILT.----.ERKT---
G5ASQ0_HETGA/25-138-------------------------------------------.C-------NDALQEIINDLNVLS.----.SQKT---
F6U5N6_HORSE/26-135-------------------------------------------KY-------DITLQEIIKTLNNLTD----GKGKN---
IL4_BOVIN/26-133-------------------------------------------KC-------DITLAEIIKTLNILT.----.TRKN---
G3QSC0_GORGO/26-149-------------------------------------------KC-------DIALQEIIKTLNSLT.----.EQKT---
A3FBF0_MUSPF/26-130-------------------------------------------NF-------SIAIKEIIKTLNILT.----.ARND---
IL4_RAT/27-139-------------------------------------------..-------DSPLREIINTLNQVT.----.EKGT---
G3WEJ0_SARHA/28-149-------------------------------------------NC-------RSTVREIILSASSLT.----.TKKF---
I3MAS4_ICTTR/24-141-------------------------------------------GC-------DVTLEEIIKTLNTLS.----.GKKT---
IL4_PIG/26-131-------------------------------------------KC-------DITLQEIIKTLNILT.----.ARKN---

PF00726

IL10_BOVIN/5-174-QMKDQ-------------------LHSLLLTQSLLDDFKGY--------------------------LGCQALSEMIQF
IL10H_EBVB9/7-167-QTKDE-------------------VDNLLLKESLLEDFKGY--------------------------LGCQALSEMIQF
G3HB01_CRIGR/14-174-QKKDQ-------------------LDNILLTDSLVQDFEGY--------------------------LGCQTLSEMIQF

PF14565

IL22_HUMAN/40-178-LADNN-------------------TDVRLIGEKLFHGVSMS--------------------------ERCYLMKQVLNF
E1C1U2_CHICK/46-184-LSDQD-------------------TDNRLIGQQIYVNIREN--------------------------NRCYMMKRITEI

PF05337

CSF1_HUMAN/41-180-VDQEQ-------------------LKDPV----------------------------------------CYLKKAF--L
Q3TLQ6_MOUSE/41-180-VDQEQ-------------------LDDPV----------------------------------------CYLKKAF--F
O77709_BOVIN/41-180-VDQEQ-------------------LDDPV----------------------------------------CYLKKAF--L
O77710_BOVIN/41-180-VDQEQ-------------------LDDPV----------------------------------------CYLKKAF--L
Q64129_9MURI/41-180-VDQEQ-------------------LDDPV----------------------------------------CYLKKAF--F

PF15036

IL34_MOUSE/28-184-PINYR-------------------IAVPYEGVLRVANITRL....--------------------..QKAHVSERELRY
R4GIU3_CHICK/19-177-PIDYT-------------------LRVQHEEVLRTANVTRL....--------------------..RDGKVSEASLRY
F7EA00_CALJA/29-185-KINYL-------------------LKLXQQAMFHHTQLDVL....--------------------..QRARVSERELRY
H0WFN4_OTOGA/28-184-PINYM-------------------ISVPYEGVFRIANITKL....--------------------..HRARVSERELRY
M3ZVZ0_XIPMA/24-191-PINYA-------------------IRVHHEEIFKLSNISKMKLKV--------------------EGLDELV....LQR
U3JY35_FICAL/18-179-PIDYT-------------------VQVQYEEVLRPSNITRL....--------------------..RNGTVSEAALRY
L9KJY3_TUPCH/28-184-PINYR-------------------IGVPYEGVLRAANITRL....--------------------..RRARMSERELRY
G3T3A6_LOXAF/28-182-PINYR-------------------ISVPYEAVLRVANITRL....--------------------..QRAQVSEQELRY
F6W3U1_MONDO/15-167-PIDYR-------------------IRVPYEGVLRLANITRL....--------------------..QQAEVSQPNLRY
I3JZ08_ORENI/24-192-PIEYT-------------------IKVHNREIFRLSNISRMRLRT--------------------EGLNELV....LQR
L5MCR9_MYODS/28-182-PIGYR-------------------VSMPYEGVLRAANVTRL....--------------------..QRARVSQQELRH
B3DLJ8_DANRE/23-195-PINYT-------------------VQVRYEEVFRLRNISRL.VNT--------------------SNEEEPVLPRDLQD
IL34_BOVIN/28-183-PINYR-------------------VSVPYEGVLRTANVTRL....--------------------..QRAQVSQQELRY

PF00714

IFNG_HORSE/15-152---NAS-------------------NPDVGDGGPLFLDILKNWKE.--------------------DSDKKIIQSQIVSF
H0WPL1_OTOGA/15-151---NTS-------------------STDTAGGGILFLDILKNWEK.--------------------ESD.KIIQSQIVSF
Q8CGS0_CAVPO/15-154---NAD-------------------NSDVGDNGTLFVGILKNCQE.--------------------ESERKIFQSQIVSF
B9VS86_CALJA/15-152---NAG-------------------DSDVADNGTLFLDILRTWRE.--------------------EGDRKIMQSQIISF
G3SUC6_LOXAF/15-152---NAT-------------------DSDVADGGPLFIDILKNWKE.--------------------DSDKKIIQSQIVSF
G3GY20_CRIGR/2-135---NSS-------------------SEDVGNGGDLVFNTLMNWQK.--------------------DGDTKIIQSQIVSF
I3MNV6_ICTTR/15-152---NAS-------------------NSNVSDGGSLFLDILDRWEE.--------------------ESDKKVIQSQIVSF
L5LME8_MYODS/15-153---NAT-------------------SSDVGNGGHLFLDILMNWKG.--------------------ESDIKIIQSQIISF
G5BGB5_HETGA/15-152---NAS-------------------SSDVGDNGTLFVGILKNCQE.--------------------ESDKKIFQSQIVSF
G3WQJ9_SARHA/15-153---NAT-------------------KSDVSDGSSLFMDMMKTWKEG--------------------NCDKKILMSHVVAV
IFNG_SHEEP/15-152---NAS-------------------NPDVAKGGPLFSEILKNWKE.--------------------ESDKKIIQSQIVSF
IFNG_RAT/14-151---NSS-------------------SMDAMEGKSLLLDIWRNWQK.--------------------DGNTKILESQIISF
IFNG_RABIT/15-152---KAN-------------------TSDVANGGPLFLNILRNWKE.--------------------ESDNKIIQSQIVSF
L9KVU0_TUPCH/51-188---NAT-------------------DPGVGDTGRLFVDILKNWTE.--------------------ESDKKIFQSQIVSF
IFNG_FELCA/15-153---NAS-------------------NPDVADGGSLFVDILKNWKE.--------------------ESDKTIIQSQIVSF

PF02404

R4GD07_ANOCA/1-283-PCGNP-------------------VTDDVNDIAKLVGNLPNDYMI--------------------ALKYVRKMDTLPNH
SCF_CHICK/1-287-SCGNP-------------------VTDDVNDIAKLVGNLPNDYLI--------------------TLKYVPKMDSLPNH
SCF_RAT/1-273-ICRNP-------------------VTDNVKDITKLVANLPNDYMI--------------------TLNYVAGMDVLPSH
G1NWC8_MYOLU/1-272-ICTNR-------------------VTDDVKDVTKLVANLPKDYKI--------------------GLKYVPGMDVLPSH
F7EP53_MONDO/1-273-ICGNP-------------------VTDDVKEITTLVANLPNDYMI--------------------PLKYVPDMELLPNH
F7C5I3_ORNAN/1-273-NCGNP-------------------VTDDVKDITKLVGNLPNDYMI--------------------ALKYVPEMDGLPNH
F7G0W2_CALJA/1-273-VCRNR-------------------VTNNVKDVTKLVANLPKDYMI--------------------TLKYVPGMDVLPSH

PF00143

G5E7E1_LOXAF/9-168.DGSQL-------------------.QKAQ.VISVLHEMLQQIFNL--------------------FHTK.DSSAAW.NT
IFNE_MOUSE/27-185.SPHQY-------------------.QEGQ.VLAVVHEILQQIFTL--------------------LQTH.GTMGIW.EE
G3I0H8_CRIGR/26-185.DAQHI-------------------.QKAQ.AIPILQELIQQVLIL--------------------FSSK.DSSATW.ET
H0VF99_CAVPO/28-187.QPQQF-------------------.QKEK.AALVIQEMLQNVLGI--------------------FRKN.ISTTVW.NE
L5KKJ7_PTEAL/25-192.YSTQL-------------------.LKRD.IKEAFYEISLQAFNI--------------------FSQY.TFQSTW.KK
G1U0Q8_RABIT/26-185.NGSQF-------------------.QKNQ.AVSVLHEMLQQIFNL--------------------LHTA.RSSAAW.NN
F6YZB3_ORNAN/25-183.EAGLL-------------------.QKGN.RAVVVHELLQQIFTV--------------------FSQT.LSQTGW.DQ
I3MY95_ICTTR/32-186.EGEKV-------------------.PRAQ.AVAALQEMTRKILDL--------------------FGTQ.EAFAAW.NK
V8NNB8_OPHHA/15-183IDMNDE-------------------CQVDI.AKTAVKEILQQIDVI--------------------FRQN.HTELVW.HE
C8CKA7_PIG/26-185.GGNQV-------------------.QKAQ.AMALVHEMLQQTFQL--------------------FSTE.GSAAAW.DE
H0W7G8_CAVPO/26-185.DGKQV-------------------.QEAQ.AFSVLHEMARQTFNI--------------------FTSE.DSSAAW.NQ
G3GXU9_CRIGR/27-182.HPGQM-------------------.EKRN.VALIIEEMLQNIFIV--------------------FNSN.YSSTGW.NK
H0XSG1_OTOGA/26-185.NGNQL-------------------.QKAQ.AISVLHDMTQQTFNL--------------------FSTK.DSSEAW.NK
G1KX99_ANOCA/25-184.KNLDV-------------------SEEEN.AKVVIQEVLQQTGHI--------------------FRQN.YTEMPW.DE
G3I0I6_CRIGR/27-185.SRHQY-------------------.QKGH.VLAVLHELLQQIFSL--------------------FQAH.VSRGIW.EE
IFNT4_SHEEP/26-185.EGDQL-------------------.QKDQ.AFPVLYEMLQQSFNL--------------------FYTE.HSSAAW.DT
L8Y4J0_TUPCH/27-186.NPQQF-------------------.QKRH.TLAILHEMLQQIFNL--------------------FSAN.VSPDDW.EE
F7B527_HORSE/26-183.DGDQL-------------------.GKTQ.ATAVLHEMLQHTFHL--------------------FSTT.GSRAAW.DE
G1Q950_MYOLU/27-184.QPQQV-------------------.RKEE.AMVVMHEMLQQIFSI--------------------FRRG.FSNAGW.NE
M3WTR1_FELCA/26-186.EGGQL-------------------.REAQAAAAVLRELLQQTFNL--------------------LHTE.RSSAAW.SP
G5CB66_HETGA/27-185.QPQHF-------------------.RKEN.AALVIQEMLQNILDI--------------------VRKN.FSNTVW.NE
L9L941_TUPCH/27-198.SSTQP-------------------.VKRD.IKEVFYEISMQAFNI--------------------FSQD.TFKSTW.EQ
D2H9N6_AILME/27-184.KPQQV-------------------.QKEA.LLLVTLDMFQKTSDI--------------------FRKN.LSSTGW.NE
D3Z919_RAT/26-179.DAQQI-------------------.QKSQ.AISVLETLTQQVLTL--------------------FESE.ESRAAW.NE
C8CKB9_PIG/24-176.KTTRT-------------------.QTSQ.GTCFHPLMLQQIINL--------------------FNTE.NSRAAW.NN
A8E6F6_XENTR/27-179.SVSQV-------------------.EA...GALAVREVLNETMRF--------------------YMKH.HESMGC.KQ
L8Y906_TUPCH/26-185.DGRQL-------------------.QKTQ.ALRVLHGMLQQIFNL--------------------FSSE.GSSATW.EE
H9L1C3_CHICK/28-183.KPR..-------------------.QKET.VKVAIEEILQHIFYI--------------------FSKN.LTLAAW.DG
L5KWM8_PTEAL/106-263.DGSQV-------------------.QEAQ.AISVLHEMLQETFDV--------------------FCTE.HSSAAW.NT
G3WZJ8_SARHA/27-182.EGSQL-------------------.QREN.TTVMVHETLQQIFTI--------------------FSLN.TTPAAW.NQ
G3UCD2_LOXAF/26-187.EGNKF-------------------.QKAQ.AISVHHEMIQQIFNL--------------------FSLQ.ASSAAW.DQ
K7GQJ6_PIG/17-164.EGSQL-------------------.QKVQ.AISVFHEMLQQTFLL--------------------FHIE.RSSAAW.DS
G3I0H3_CRIGR/26-178.DAQHI-------------------.QKAQ.AMSVLQELTQQALIL--------------------FSSN.ESSAAW.ET
H0VYK7_CAVPO/28-181.QPRPF-------------------.QKEM.AALVIQEMLQNIFVI--------------------IRKE.FSTTVW.NK
I3N7K4_ICTTR/33-202.SSTQP-------------------.EKTN.IKYVFYETYTQAINI--------------------FSQN.TFNSSW.DE
L5K635_PTEAL/26-185.DGSQV-------------------.QKAQ.AISVLHEMLQQTFDV--------------------FGTK.QSSAAW.NT
H0W3G0_CAVPO/26-185.TSSKL-------------------.QKAQ.MVSVLQGTLQQILTL--------------------FNTQ.LSSAAW.NA
W5JYQ9_ASTMX/23-179.ESNTR-------------------KQTVA.LEKSIYITLEYINSM--------------------LNDH.ELPDQWTSQ
G3SI98_GORGO/28-185.QDTQP-------------------.MKRD.IKKAFYEMSLQAFNI--------------------FSQH.TFK.YW.KE
H0Y0D2_OTOGA/28-187.KNKQP-------------------.EKNQ.AITVLYVVVQHIFSL--------------------FSTT.ESSDAW.NK
IFN_ANAPL/34-190.DTN..-------------------.DTQQ.AAHTALHLLQHLFDT--------------------LSSP.STPAHW.LH
G3UJX3_LOXAF/27-185.QPGQL-------------------.QKED.AALVIYEMLLQIFDI--------------------FLGN.FSHTGW.DE
G5C259_HETGA/26-185.DGKQI-------------------.QKAQ.AISVLHEMTSQTFNL--------------------FSTQ.DSSAAW.NN
G3WZF5_SARHA/26-185.QPKQY-------------------.QKEN.ATMVIHEMLQQIFLL--------------------FSSK.NASLGV.NN
IFNE_PIG/27-186.NPHQY-------------------.QKQQ.ALAILHEMLQQIFSL--------------------FRAV.ISLDGW.EE
W5N6G4_LEPOC/27-185.KTAEN-------------------AKNED.IVLTGLETMRCVHNI--------------------FNKT.GHPATW.EI
H9KYA4_CALJA/26-185.FGDHF-------------------.QKAQ.AIFILHEMIQQTFNL--------------------FSTK.DSSVTW.DA
D2HTQ4_AILME/33-205.SHTQP-------------------.AKRY.IKEAFYEMSIQAFNI--------------------FSQY.TFTSTW.EK
IFNB_HUMAN/27-185.QLQQF-------------------.QKED.AALTIYEMLQNIFAI--------------------FRQD.SSSTGW.NE
G1NR05_MELGA/32-188.ESK..-------------------.DKKQ.AAIITLHILQQLFNI--------------------LSSP.HTPAHW.ID
F7BVP5_ORNAN/23-181.HPHQF-------------------.QQEN.ATEAIHDLLQHIFNV--------------------FSRN.HSQTGW.DE
F7G875_MONDO/27-182.QPRQC-------------------.QREN.ATMIIHEMLQQTLIL--------------------FSSK.NACPDV.ND
C8CKC3_PIG/33-205.SHTQP-------------------.LKRD.IQEAFYEMSIRAFNI--------------------FTQD.TFKATW.EE
I3MVD7_ICTTR/34-186.EGEQV-------------------.QKAQ.AVAVLHQMTQQVFNL--------------------FSTQ.EAFAAW.NQ
F7A317_HORSE/26-184.DGNQF-------------------.RKAQ.AISAVHETIQQIFHL--------------------FSTD.GSSAAW.DE
G1KU56_ANOCA/28-182QSIFEL-------------------.QKEN.AAVALHEILQQILCL--------------------YIQN.HTKLPW.DE
L5KBH2_PTEAL/26-185.DGSHM-------------------.QKAQ.AISVLQEMLQEISNV--------------------FGTQ.QSSGAW.NT
L5K909_PTEAL/26-185.SGNQF-------------------.QEAQ.AITVIHEVTWQTFLL--------------------FCTE.ASSTAW.DE
I3N5Z0_ICTTR/23-179.NFHQY-------------------.PKGH.VLAILHEMLQQIFNL--------------------FKKN.ISLGSR.EE
F7GHL9_MONDO/26-181.DGSQL-------------------.QKEN.ATVVVLEMVQQIFNL--------------------FSQN.AMPATW.NQ
IFNE_HUMAN/27-186.SPQQY-------------------.QKGH.TLAILHEMLQQIFSL--------------------FRAN.ISLDGW.EE
I3LBU7_PIG/26-179.ERSHL-------------------.QKAQ.AIFVLHKMLQQTFLL--------------------FHTE.HSSAA..DS
G3UK87_LOXAF/27-184.YGSHL-------------------.QKAQ.AVFILHKMLQQIFNL--------------------FRTK.EPSTAW.NT
L9LC61_TUPCH/27-185.RPQQF-------------------.QKEN.ATLVIHEMLQNIFGV--------------------FRRN.FSSTGW.ND
IFNB_RAT/27-182.HPSQM-------------------.EKSY.TAFAIQVMLQNVFLV--------------------FRSN.FSSTGW.NE
H0XMZ9_OTOGA/27-186.SPQHY-------------------.QEGH.ALALLHETLQQIFNL--------------------FRAN.ISVDGW.EE
G3VDC6_SARHA/27-182.EGSQL-------------------.QREN.AIVIVNETLQQIFNI--------------------FSLN.TTPAEW.NQ
I3JM36_ORENI/26-182RQVSKS-------------------.SDED.KLAFTVQVLEEVAAL--------------------FEED.HSSASW.ED
L5LKN9_MYODS/27-186.NPHQD-------------------.QKGS.ALTILHEMLQQIFSL--------------------FQAN.TSLEGW.KE
G1TYS8_RABIT/29-195.SHSQM-------------------.EKRD.IKEAWYEISTQAFCI--------------------FMGH.AFQTTW.EE
I3UJJ8_FELCA/27-185.NPRQY-------------------.QKGQ.ALAILHEMLQQIFNL--------------------FRAN.TSSDGW.EE
C8CKA9_PIG/26-183.DGNQV-------------------.EKTQ.AVAVAHEMLQQIFRL--------------------FSTR.GSPSSW.DE
IFNT2_BOVIN/3-162.EGNQL-------------------.QKDQ.AISVLHEMLQQCFNL--------------------FYTE.HSSAAW.NT
H0W510_CAVPO/26-186.EGKQV-------------------.QKAQ.ALSVLHEMTRQTFIL--------------------FTSQ.YSCPPW.NQ
M3Z729_MUSPF/26-183.DGKQL-------------------.QKAQ.AISVLHVTNQKTFHL--------------------FCTE.ASPAPW.NT
IFNA1_MOUSE/26-185.DAQQI-------------------.KKAQ.AIPVLSELTQQILNI--------------------FTSK.DSSAAW.NT
G3TTC1_LOXAF/26-185.DGSQL-------------------.QKAQ.AIAFLHEMLQQIFDL--------------------FRTM.DSFAAW.NT
G1PDS6_MYOLU/29-199.AYSQP-------------------LLHRD.IKGTFYEMYMLAFSI--------------------FTQS.TFQSTG.EE
F7ABU5_MONDO/27-182.DRSQL-------------------.QKEN.ATVIVLEMVQQIFTL--------------------FSQN.TTPATW.NQ
G1TTX4_RABIT/27-180.EPQQL-------------------.QKED.TTLVIFEMLNNIFDI--------------------FRKN.FSSTGW.NE
H0XRP5_OTOGA/26-185.RGKQL-------------------.QKAQ.AISVLHEMTQQTFNL--------------------FSTN.DSSEAW.NK
H0WK94_OTOGA/33-202.SHTQT-------------------.VKRG.LREAFYEVSIQAFHI--------------------FSQY.TFEPTW.KL
G1KYL3_ANOCA/23-176.GNINV-------------------SEEGN.AKAAIQEVLQQTGHI--------------------FKQN.YTEMPW.DE
G3WZQ8_SARHA/26-181.EVNQL-------------------.QREN.ATAIVYEMLQQIFTI--------------------FSLN.TTPATW.SQ
H2R6R8_PANTR/26-185.DGNQF-------------------.QKTQ.AISVLHEMIQQTFNL--------------------FSTE.DSSAAW.EQ
H0YTY6_TAEGU/34-188.HPNL.-------------------.HPHQ.AAATALRILQHLFHT--------------------LSSN.STRQHW.PS
I3MXH1_ICTTR/27-185.HPQQF-------------------.QKEH.AAFVIYEMLKDIFHV--------------------FKKG.YSNPDW.NN
M3WRV1_FELCA/26-184.GGDQS-------------------.HKAQ.ALSVVHVANQKIFHF--------------------FCTEASSSAAW.NT
H0W4H8_CAVPO/23-182.GSKPC-------------------.QKDH.ALVSEHLHLEQTFNL--------------------FISE.DSSAAW.NK
R4GKJ6_CHICK/35-191.DTS..-------------------.NTQQ.ADKTTHDILQHLFKI--------------------LSSP.STPAHW.ND
A3FBE8_MUSPF/27-184.KSQKF-------------------.QKED.IVLVTLEMFQKTSDI--------------------FRRN.LSSTGW.NE
G1KWE0_ANOCA/28-180.RNLDV-------------------SEEEN.AKVAIQEVLQQTGHI--------------------FRQN.RTEMLW.DE
G7PS89_MACFA/26-185.DDKNF-------------------.QKAQ.AISVLHEIIQQTFNL--------------------FNTK.NSSAAF.NE
G1Q880_MYOLU/26-185.DGSQV-------------------.QKAQ.AIAVLHEMLQQVSNL--------------------LSTE.NSSVTW.NT
IFNB_MOUSE/27-180...EKM-------------------.QKSY.TAFAIQEMLQNVFLV--------------------FRNN.FSSTGW.NE
IFNB2_BOVIN/27-184.QAQQF-------------------.QKED.AILVIYEMLQQIFNI--------------------LTRD.FSSTGW.SE
G1SJC4_RABIT/26-185.GGHQA-------------------.QRTQ.AISVLHEMTQQLLNL--------------------FSTK.EASAAW.DK
W5PG31_SHEEP/26-185.GGSQL-------------------.QKAQ.AISVLHEVTQHTFQL--------------------FSTE.SSAAAW.DQ
IFNA3_CANLF/26-183.DGQRL-------------------.QEAQ.ALSVVHVMTQKVFHL--------------------FCTN.TSSAPW.NM
G5BPX2_HETGA/27-199.SYSQH-------------------.VERD.IKEVFYDIIIQAFNI--------------------FSRH.TSDSTW.KE
IFNW2_HORSE/26-185.DGRQF-------------------.PEAQ.AASVLHEMLQQIFSL--------------------FHTE.RSSAAW.NT
G3N2A8_BOVIN/26-185.EGSQL-------------------.QEAQ.AISVLHEMLQQTFNL--------------------FHTE.RSSAAW.DT
H0XKS8_OTOGA/27-185.QPQHL-------------------.QKED.AMLFIYEMLQNIFRI--------------------LRRD.FSSTGW.NE
H0VUV7_CAVPO/26-185.DGKQV-------------------.QKTQ.ALSFLHEMTTQTLIL--------------------FSSQ.NSHAAW.NQ
Q29412_PIG/27-184.QPPQF-------------------.QKED.AVLIIHEMLQQIFGI--------------------LRRN.FSSTGW.NE
G7PS88_MACFA/26-185.DGNQF-------------------.QKAP.AISVLHELIQQTFNL--------------------FTTK.DSSAAW.DE
M3WZS7_FELCA/26-181.AGNQL-------------------.EKTQ.VTAVVHEMLQQIFNL--------------------FSKS.DSFVAW.DE
H9GZR7_HORSE/26-185.DGRQF-------------------.PEAQ.ATSVLHEMLQQIVNL--------------------FHTE.RSSAAW.NT
F1LVL8_RAT/26-184.SPHQH-------------------.QEGH.VLAVLHEILQQIFVL--------------------FQTH.SSRGVW.EE
M3YX13_MUSPF/27-179.NRRRS-------------------.QSGQ.ALAILHEMLLQTFSL--------------------FRAG.ISLDGW.EE
G1L8G2_AILME/26-185.DGSKF-------------------.EKTE.ATGVMHEMFRQIFNL--------------------FSQS.GSFVAW.DE
IFNB_HORSE/27-184.QAQQF-------------------.QKED.AALVIYEMLQHTWRI--------------------FRRN.FASTGW.NE
H0W289_CAVPO/26-190.TGNQV-------------------.QEAQ.AIWVLHGMLQQILTL--------------------FYTE.HASAAW.NG
A8E6E8_MONDO/27-182.EDNKL-------------------.QRGD.ALIIFHEMLQQKFTL--------------------FSQN.AAPVAW.NQ
I3N788_ICTTR/27-185.HPQQL-------------------.QKEH.AAFVIYEMLQDIFVI--------------------FTRN.FSNTGW.NE
G1L8I1_AILME/26-183.DGKQL-------------------.QKAQ.ALSVVHVMDQKIFHV--------------------FCTE.PSSAAW.NR
IFNB_FELCA/27-184.KSQRF-------------------.QKEE.AILVINEMFQKIFNI--------------------FSRS.TSSTGW.NE
H0VXI5_CAVPO/26-181.DGKQV-------------------.QKAQ.ALSVLHEMTRQTFNL--------------------FTSE.DSSAAW.DK
G3TS29_LOXAF/26-179.DMNQL-------------------.EKTQ.AAVLLYEMLQQTFNL--------------------FSRS.DSLEAW.DE
W5PZ39_SHEEP/26-184.SYTQP-------------------.LMRN.IKEAFYEMTRQAFHI--------------------FTQD.TFQSTW.EG
G3I0H6_CRIGR/26-178.DAQHI-------------------.QKAQ.AMSVLQELTQQALIL--------------------FSSN.KSSAAW.EK
I3L756_PIG/26-180.EGSQL-------------------.QKTQ.AISVLHEMLQQTFLL--------------------FHTE.RSSAAW.DS
M3Z715_MUSPF/26-183.HSKQL-------------------.QKAQ.ALSVVHVTKQNIFHL--------------------FCTE.ASPAPW.NT
M3VXI8_FELCA/33-205.SHTPP-------------------.GKRY.LKEAFYEMSTQAFNI--------------------FRES.TTKSTW.KK
G3R8Q7_GORGO/26-185.KGSQL-------------------.QKAQ.VMSVLHEMLQQIFSL--------------------FHTE.RSSAAW.NM
A8E6F5_XENTR/51-202.SISQM-------------------.EE...MVLAVRGVLNETMRF--------------------YMKH.HESMGC.KQ

PF02947

FLT3L_MOUSE/30-162...EKH--------------------CKALWSLFLAQRWIEQLKTV--------------------------------AG
F6T7S9_ORNAN/28-157...DEL--------------------CWELWHLSVAEDRLKHLERM--------------------------------SG
H9GP84_ANOCA/29-165...DEF--------------------CKELWHVHLIHRNLNRMINV--------------------------------SG
F6TPW7_MONDO/34-163...DER--------------------CRALWHLFLAKKTLDRLELV--------------------------------AG
G5B8P0_HETGA/20-150...EQF--------------------CAKLWHLVLAQRWMERLKTV--------------------------------AG
G1M637_AILME/29-159...DEL--------------------CGPFWHLVLAQRWMGQLKAV--------------------------------AG
L9JA37_TUPCH/769-910SPQEEL--------------------CGALWRLVLAQRWMERLKTV--------------------------------AG
G3VSA3_SARHA/79-209...DEQ--------------------CWALWHLALAKETLDRLKLV--------------------------------AG
G1QZC3_NOMLE/30-160...EEL--------------------CGALWRLVLAQRWMERLKTV--------------------------------AG

PF06875

Q5BNQ4_9SALA/2-215-LSDPD-------------------YQLPHIKVVNLPTAAMD----------YDTFIRQTDETRLKNNLYFYSAIVEFLK
Q5BNQ2_9SALA/2-215-LSDPD-------------------YQLPHIKVANLPTAAMD----------YDTFMKQTDETRLNNNLYFYSAIVEFLK

PF01110

CNTF_CHICK/1-194-----D-------------------ASISVAAVDGVPTAAV------------ERWAEQTGTQRLLDNLAAYRAFRTLLA
G3VWZ5_SARHA/1-195-----N-------------------KDVDLDSMDGVPTAST------------DRWSELTEAERLQANLHAYRTFHVLLT
E1BFH9_BOVIN/1-193-----N-------------------GNMNLDTLEGVPTASS------------SRWSELTEAERLQENLQAYRAFHGMLA
G5AP46_HETGA/1-192-----S-------------------ENVSLDAVGGVPAASI------------AQWSELTEAERLQENLHAYRTFHVLLA
H0Z9U1_TAEGU/1-188-----D-------------------ASASVAAMEGVPLAAV------------ERWDEQTGTQRLLENLAAYRAFRTLLA
CNTF_HUMAN/1-194-----N-------------------KNINLDSADGMPVAST------------DQWSELTEAERLQENLQAYRTFHVLLA

PF01291

LIF_MOUSE/44-203-FPNNV-------------------EKLCAPNMTDFPSFHG----------------NGTEKTKLVELYRMVAYLSASLT
LIF_BOVIN/43-202-FPNNL-------------------DKLCSPNVTDFPPFHA----------------NGTEKARLVELYRIIAYLGASLG
ONCM_HUMAN/37-209-VP.KL-------------------REHCRERPGAFP.SEE----------------TLRGLGRRGFLQTLNATLGCVLH
ONCM_MOUSE/34-194-TP.DL-------------------RAACTQHSVAFP.SED----------------TLRQLSKPHFLSTVYTTLDRVLY
ONCM_BOVIN/34-194-SP.VL-------------------QEHCRERPGDFP.SED----------------ALWRLSRQDFLQTLNTTLGLILR

PF03039

IL12A_MOUSE/6-215-HEDIT-------------------RDQTSTLKTCLPLELHK.NESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSI.Y
G3VQT1_SARHA/40-247-HEDIT-------------------E..SNTGRVCLPPELIKKNFISNPTGKIFIINNGSCLDSKEKLSVKQLCLKSI.Y
F6T5A8_MONDO/5-202-HEDIT-------------------KGRSDTVRACLPPEFIK...............NGSCLVSTETLFIKDLCLRSI.Y
IL12A_PIG/6-222-HEDIT-------------------KDKTSTVEACLPLELAT.NESCLAARETSLITNGNCLTSGKTSFMTTLCLSSI.Y
L8YEA2_TUPCH/1-213-HEDIT-------------------KDKTSTVKACLPLELIT.NESCLASRETSFKTNGSCLAPEKTSHMMTLCLSSI.Y
H0X861_OTOGA/6-217-HEDIT-------------------KDKTSTVRACIPLELTK.NESCLASRETSFIPNGKCLTSRKTSSMMTLCLSSI.Y
G1QWH2_NOMLE/40-254-HEDIT-------------------KDKTSTVEACLPLELTK.NESCLNSRETSFITCQRMLSSRQLYHLTPLCLSFLQY
I3MN91_ICTTR/4-220-HEDIT-------------------KNRTNTVKACLPQELAQ.NENCLASRETSFIIKGSSLTSGRTSWNTTLCFSSI.Y
Q924V6_CAVPO/6-221-HEDIT-------------------KDKTSTVKACVPLELVK.NESCLASGHISFTTNGSCLASGKTSFMMALCLNSI.Y

PF02024

H3AP27_LATCH/26-169----IT-------------------RIQQHPNQFLLPLNLK---------------VSGLEFIP...AERPLESLGSM-D
G3WWV6_SARHA/23-167----IT-------------------RINDISHMYSISAKQR---------------VTGLDFIP...GLHPFQSLSDM-D
F6PLK2_ORNAN/23-167----IT-------------------RIIQLSNRNGVSTDQR---------------VSGLDFIP...GNQQFQNLADM-D
F7HGW1_CALJA/23-167----IA-------------------RINDLSHTQSVSPRQR---------------VTGLEFIP...GFHSDLSFSKM-D
G5BHA4_HETGA/23-167----VS-------------------RINDISHMQSVSSKHK---------------VTGLDFIP....LYPDLSFSKM-D
W5NER9_LEPOC/28-172----VI-------------------RIQKHTNESKMSPNLV---------------FSGLELIPDALNDKTLEGLSTV-E
H0V7C6_CAVPO/23-165----IN-------------------RIRNISHLQSVSSKHK---------------VTGFDFIP....LSPYLSLPKM-D
LEP_HUMAN/23-167----VT-------------------RINDISHTQSVSSKQK---------------VTGLDFIP...GLHPILTLSKM-D

PF00489

IL6_BOVIN/27-208-DECES------------------SKETLAENKLNLPKMEEKDGCFQSG-----------------FNQAICLIRTTAGL
M3X721_FELCA/27-208-NKCED------------------SKEALAENNLNLPKLAEKDGCFQSG-----------------FNQETCLTRITTGL
IL6_HORSE/27-208-SKCEN------------------SKEVLAENNLNLPKMAEKDGCFQSG-----------------FNQETCLMKITTGL
G3UHF3_LOXAF/20-205-DKCEN------------------SREALAGNNLKLPQMTEEDGCFHSG-----------------FNKETCLMKIITGL
L5KPK4_PTEAL/20-202-DSCKN------------------SKEVLTENNLNLPKMAEKDGCFQSG-----------------FNQETCLMKITTGL
F7HV62_CALJA/27-212-NMCES------------------SKEALAENNLNLPKMAEKDGCFQSG-----------------FNEETCLLKITTGL
IL6_MOUSE/26-210-SDCMN------------------NDDALAENNLKLPEIQRNDGCYQTG-----------------YNQEICLLKISSGL

PF16647

CSF3_BOVIN/42-190-KLCHP------------------EELMLLRHSLGIPQ-APLSSCSSQS-----------------LQLTSCLNQLHGGL
CSF3_HUMAN/51-202-KLCHP------------------EELVLLGHSLGIPW-APLSSCPSQA-----------------LQLAGCLSQLHSGL
CSF3_MOUSE/57-205-KLCHP------------------EELVLLGHSLGIPK-ASLSGCSSQA-----------------LQQTQCLSQLHSGL

PF02372

IL15_PIG/33-160-EDLIR-------------------SIHMDATLYT.ES-DAHPNCK--------------------VTAMKCFLLELRVI
IL15_CAVPO/33-160-ENLIQ-------------------SIHIDATLYT.ES-DVHPNCK--------------------ITAMKCFLLELRVI
IL15_FELCA/33-160-DKIIQ-------------------SLHIDATLYT.ES-DVHPNCK--------------------VTAMKCFLLELHVI
IL15_SHEEP/33-160-EHLIQ-------------------SMHMDATLYT.ES-DAHPNCK--------------------VTALQCFLLELRVI
F1NZN5_CHICK/55-183-K...T-------------------SEDIDVSLYTANT-YEDIECQ--------------------EPVMRCFFLEMNVI
G1NDP6_MELGA/5-137-EESKN-------------------KIHVV..LYT.PN-EIK.ECS--------------------QQTLQCYLEEM.VM
O73883_CHICK/5-138-ENIKN-------------------KIHLE..LYT.PT-ETQ.ECT--------------------QQTLQCYLGEV.VT
Q8JFF4_ANAPL/4-134-GTSMN-------------------GIDLE..LYT.PN-DTK.ECS--------------------WQTLQCYLKEI.VT

PF00715

I3MQX6_ICTTR/7-151-ENSTL-------------------TRMLKFKFYM-PK.KAT---D--------------------LEHLQCLEEELKPL
G5C793_HETGA/7-149-RNPKL-------------------SKMLKPKLYF-PN.KPS---E--------------------LQHLQCLEEELKPL
G1PJ32_MYOLU/7-147-KNSKL-------------------PMMLTFKFYM-PR.NAT---E--------------------LKHLQCLVDELKPL
B1AB81_HORSE/7-146-KNPKL-------------------SKMLTFKINM-PK.KAT---E--------------------LKHLQCLEEELKPL
G3HTL8_CRIGR/7-150-KNPKL-------------------PMMLTFKFYM-PK.KAT---E--------------------LKHLQCLEEELGAL
IL2_MACMU/7-151-KNPKL-------------------TRMLTFKFYM-PK.KAT---E--------------------LKHLQCLEEELKPL
H0Y254_OTOGA/7-149-KNPKL-------------------SRMLTLKLYV-PK.KAT---E--------------------LKHLQCLEEELGPL
IL2_MOUSE/7-165-RNLKL-------------------PRMLTFKFYL-PK.QAT---E--------------------LKDLQCLEDELGPL
G3SU90_LOXAF/7-147-ETRRL-------------------SMIFTFKFNM-PK.EVT---E--------------------LKHLQCLVDELKPL
IL2_PIG/7-151-ENADL-------------------SRMLTFKFYM-PK.QAT---E--------------------LKHLQCLVEELKAL
IL2_FELCA/7-151-ENPKL-------------------SRMLTFKFYV-PK.KAT---E--------------------LTHLQCLVEELKPL
L5K7D9_PTEAL/7-149-KNHEL-------------------SSMLTFKFYM-P..NAT---E--------------------LNHLQCLVDELKPL
IL2_BOVIN/7-152-ENLKL-------------------SRMHTFDFYV-PKVNAT---E--------------------LKHLKCLLEELKLL
H0VBY4_CAVPO/7-149-SNPRL-------------------PKMLKLKLYP-PK.MVS---E--------------------LQHLQCLEEELRAV

PF00103

PLRP1_BOVIN/26-238-AQGKL......YYINVT.......KSCHTNSFHA-PE-ERDIVQQ--------------------TNIEDLSKWTLVLL
CSH2_BOVIN/26-238-AQGKL......YYINAT.......KSCHTNSFHT-PE-ERDKAQQ--------------------MNNEDLSKWTLVLL
PLRP3_BOVIN/1-213-AQNQP......YTINAT.......KSCHTNSLHT-PQ-EREKALR--------------------MNNEDLSKWILMLL
PR4A1_RAT/17-227-AQGRG.......FERRT.......TRCHTSSLSS-PE-NKEQAQQ--------------------FQLEVLLGLSHSLL
CSH1_BOVIN/26-236-GEGKN.......FTSKV......INSCHTEFMTT-PN-NKEAAAN--------------------TEDEALLRLVISLL
PLRP4_BOVIN/26-239-AQGKE......YFINVS.......DKCHTNSLHL-PE-DMQHNPT--------------------DEQKGLIMWILMLL
PR3D4_RAT/16-223-AKRSW......MKDRIL.......PLCHTASIHV-PE-NREEVHE--------------------IKTEDLLRSIINIS
PR2C2_MOUSE/16-224-SNVSG......LRDKSP.......MRCNTSFLPT-PE-NKEQARL--------------------THYSALLKSGAMIL
SOM2_HUMAN/9-215-ILKEQK....YSFLQNPQ.....TSLCFSESIPT-PS-NRVKTQQ--------------------KSNLELLRISLLLI
PR8A5_RAT/17-238-FSSRQFADLSSQLIRKDETVLKAGTYCHSNRAK.-PK-SR..GVN--------------------IDIEEYLKMSINFC
PR6A1_RAT/20-234-LYKPG.....RWFPERD......LTACHRSPFTI-AV-SKEGTQQ--------------------RLGVFLVKEMIGML
PR7D1_MOUSE/17-240-FSSETFNKIILDLHKSTENITKAFNSCHTVPINV-PE-TVEDVRK--------------------TSFEEFLKMVLHML
CSH2_HUMAN/9-215-IPKDQKY..SFLHDSQT.......SFCFSDSIPT-PS-NMEETQQ--------------------KSNLELLRISLLLI

PF01109

CSF2_RAT/18-139----------------------------NE.DVDIISNEFSI---------------------------------QRPTC
CSF2_MOUSE/18-136----------------------------N.EEVEVVSNEFSF---------------------------------KKLTC
CSF2_BOVIN/18-138----------------------------N..DTEVVSEKFDS---------------------------------QEPTC
CSF2_CAVPO/18-140----------------------------NE.TVEVVYDQFEP---------------------------------QEPTC
CSF2_PIG/18-139----------------------------NE.TVDVVCEMFDP---------------------------------QEPTC
CSF2_HUMAN/18-139----------------------------NE.TVEVISEMFDL---------------------------------QEPTC
CSF2_CANLF/18-139----------------------------NK.AVKVVSEVFDP---------------------------------EGPTC

PF02025

G1RQD7_NOMLE/22-133----------------------------AN-ETLRIPVPVHK---------------------------------NHQLC
IL5_CAVPO/23-134----------------------------GN-ETLRISVPAHK---------------------------------NHQLC
J9NWP5_CANLF/22-132----------------------------GD-GVIFFLIPTVF---------------------------------KHQLC
IL5_MOUSE/21-132----------------------------SN-ETMRLPVPTHK---------------------------------NHQLC
G3WAR7_SARHA/25-134----------------------------GN-GTLRISIPDPK---------------------------------NHPLC
IL5_HORSE/22-133----------------------------GD-GNLMIPTPEHK---------------------------------NHQLC
B5FW65_OTOGA/22-133----------------------------HN-ETLRIPVPVHK---------------------------------NHQLC
I3MDT8_ICTTR/23-134----------------------------GN-ETLRIPVPAHK---------------------------------NHQLC
G3T4B0_LOXAF/23-133----------------------------GD-GTPRILTPVHE---------------------------------NHQLC
G1SL79_RABIT/22-133----------------------------GN-ETLMIPVPVHK---------------------------------NHHLC

PF02059

IL3_CANLF/19-132----------------------------EPLDSNEKETLLED---------------------------------TLLRP
IL3_MOUSE/27-138----------------------------.....DEGPSLRNK---------------------------------SFRRV
IL3_BOVIN/18-132----------------------------GSLNSDEKNFLTKE---------------------------------SLLQA
G3UC30_LOXAF/22-133----------------------------ATPSDTEKTILRDR---------------------------------ASLKP
G1MH15_AILME/18-131----------------------------ETLDPNETSTLLNT---------------------------------TLLRP
F1RJV6_PIG/18-131----------------------------KSLTLNE..LETNN---------------------------------TLLRP
G1RQ11_NOMLE/20-137----------------------------NNLNGEDQDILMEN---------------------------------NLRRP
IL3_CALJA/19-136----------------------------NNLNREDQRILMKP---------------------------------NLRKP
F1LS41_RAT/29-138----------------------------..NNSDDKANLRNS---------------------------------TLRRV

PF07400

IL11_HUMAN/22-199-R-DKF-------------------PADGDHNLDSLPTLAMSAGAL--------------------GALQLPGVLTRLRA

PF00758

G3TYQ1_LOXAF/25-173-T-VDF-------------------SLGEWKTQTEQNKAQDVLGAV--------------------TLLLEGVMAARRQV
W5K758_ASTMX/26-175-L-TRV-------------------DIGVWEKKNMEEQAQEVQTGL--------------------WLLNRAFISLHTSI
B1N8Y2_DANRE/15-168-L-TRV-------------------DFEVWEAMNIEEQAQEVQSGL--------------------HMLNEAIGSLQISN
F7DTH0_CALJA/31-193-D-TKV-------------------NFYAWKKMEFGQQAVDIWQGL--------------------TLLSEAVLRGQALL
M3XJ62_LATCH/27-177-A-TKV-------------------NIKEWNEMDNKIKEREIWAGI--------------------NLFTHTFKTVRDFI
G3W289_SARHA/30-190-D-TRV-------------------NFHTWKKMEVGQKAGEVWQGL--------------------TLLSEAVLKGQALL
F6WUU2_MONDO/31-191-S-CLI-------------------NIYFAINSNVGQKAGEVWQGL--------------------TLLSEAVLKGQALL
G3VW20_SARHA/26-175-T-VDF-------------------SLREWRAKTERFKCTQLSPTR--------------------NSLTKG....GGSP
G1PF99_MYOLU/45-207-D-TKV-------------------NFYAWKRMEVEQQALEVWQGL--------------------ALLSEAILRGQALL
TPO_CANLF/25-176-A-VDF-------------------SLGEWKTQKEQTKAQDVWGAV--------------------ALLLDGVLAARGQL
F7G570_MONDO/26-177-T-VDF-------------------SLREWRAKTEQTKGQEVLGAV--------------------TLLLEGAIAARGQL
H0W023_CAVPO/30-191-D-TKV-------------------NFCAWEKMGVGQQAAEVWQGL--------------------VLLSEAMLQGQALL
H2LEX3_ORYLA/33-182-Q-TTV-------------------NFEDWEKKNALEQAEEVQTGL--------------------WLLQQALGSFGPSV

PF03487

G1SCQ2_RABIT/16-144-P.PT.-------------------..SLKELIEELVNITHNQ..K--------------------APLCNGTMV-WSVN
IL13_HUMAN/16-144-P.ST.-------------------..ALRELIEELVNITQNQ..K--------------------APLCNGSMV-WSIN
IL13_RAT/2-130-RSTSP-------------------PVALRELIEELSNITQDQ..K--------------------TSLCNSSMV-WSVD
F7DGH7_MACMU/16-151-P.ST.-------------------..ALKELIEELVNITQNQ..K--------------------APLCNGSMV-WSIN
L5M5Z7_MYODS/2-128-P.LT.-------------------..VVKELIEELDNITQ....K--------------------APLCNGSMV-WSVN
G5ASP9_HETGA/2-130-S.SA.-------------------..ALRELIEELANVTQNH..K--------------------TPLCSGSMV-WSVN
B3GDZ5_PIG/2-130-PHST.-------------------..ALKELIEELVNITQNQ..K--------------------TPLCNGSMV-WSVN
L8YAP6_TUPCH/2-128-S.IR.-------------------..ALKELIEELDNVTQNQ..K--------------------AQLCNGSMV-WSVN
IL13_BOVIN/2-130-S.AT.-------------------..ALKELIEELVNITQNQ..K--------------------VPLCNGSMV-WSLN
IL13_MOUSE/2-130-RSVSL-------------------PLTLKELIEELSNITQDQ...--------------------TPLCNGSMV-WSVD
H0W834_CAVPO/16-149-VSSTV-------------------AVSIKELLGELVNITQDQ..K--------------------TPLCNSSMV-WSVN
F6WQF3_ORNAN/2-128-R.SKE-------------------NARLEELISYLSSLNLPN..K--------------------QSLCNGSMV-WKVN
G3T2N9_LOXAF/2-133-..NRH-------------------IWVLRELIGELINITQNQLPQ--------------------ASLCNGSMV-WNVN
M3YGH3_MUSPF/2-126-N.LT.-------------------..TTKELIEELANITQNQ...--------------------ASLCNGSMV-WSVN
B5FW67_OTOGA/2-129-R.LT.-------------------..KLKELIEELDNITQNQ..R--------------------APLCNGSMV-WSVN
I3MAR4_ICTTR/2-131-PPSP.-------------------..AFRELIEELVNITQDQ..K--------------------APLCNGSMV-WSVN
IL13_CANLF/2-129-P.SP.-------------------..TLKELIEELVNITQNQ...--------------------ASLCNGSMV-WSVN

PF00727

IL4_FELCA/26-131-S-------------------------CMELTVMDVLAAPKNTSDK....................EIFCRATTVLRQIY
H0XDE1_OTOGA/26-149-P-------------------------CDELTVADIFAASKNTTEK....................EIFCRAATVLRQVY
IL4_MOUSE/27-140-P-------------------------CTEMDVPNVLTATKNTTES....................ELVCRASKVLRIFY
G3T4B8_LOXAF/26-132-A-------------------------CTELTVADAFAAPKNTTEK....................ETFCRATTVLWQVS
IL4_RABIT/28-143-P-------------------------CTKLMIADALAVPKNTTER....................EAVCRAATALRQFY
G5ASQ0_HETGA/25-138-P-------------------------CAELAAADVFAAPKDTAEK......................LCQAVTVLHRTS
F6U5N6_HORSE/26-135-S-------------------------CMELTVADAFAGPKNTDGK....................E.ICRAAKVLQQLY
IL4_BOVIN/26-133-S-------------------------CMELPVADVFAAPKNTTEK....................ETFCRVGIELRRIY
G3QSC0_GORGO/26-149-L-------------------------CTELTVTDIFAASKNTTEK....................ETFCRAATVLRQFY
A3FBF0_MUSPF/26-130-S-------------------------CMELTVTEVFSAPKNTSEK....................EIFCRAATVLQQLS
IL4_RAT/27-139-P-------------------------CTEMFVPDVLTATRNTTEN....................ELICRASRVLRKFY
G3WEJ0_SARHA/28-149-L-------------------------CSEMEVLDIFEDTKKNSSTRKLLPEMSSCSQLAMTVNDFETLCRAVTVLQQAS
I3MAS4_ICTTR/24-141-T-------------------------CMELMVADVFAVPKNTTEK....................EILCRATTVLRQTY
IL4_PIG/26-131-S-------------------------CMELPVTDVFAAPENTTEK....................ETFCRASTVLRHIY

PF00726

IL10_BOVIN/5-174YLEEVM-PQAENHGPD--------IK-EHVNSLGEK------------LK--TLRLRLRRC--HRFLPCENKSKAVE---
IL10H_EBVB9/7-167YLEEVM-PQAENQDPE--------AK-DHVNSLGEN------------LK--TLRLRLRRC--HRFLPCENKSKAVE---
G3HB01_CRIGR/14-174YLVEVM-PQAENHGPE--------IK-EHLNSLGEK------------LK--TLRRQLQRC--HRFLPCENKSKAVE---

PF14565

IL22_HUMAN/40-178TLEEVLFPQSDRFQPY--------MQ-EVVPFLA------------------RLSNRLSTC--HIEGDDLHIQRNVQ---
E1C1U2_CHICK/46-184IVKDVLLTEAKERYPY--------AE-DVAQFLA------------------SLTSELSRC--KYSGNREHIEKNLE---

PF05337

CSF1_HUMAN/41-180LVQDIM-EDTMRFRDN--------TP-NAIAIVQ--------------LQ--ELSLRLKSC--FTKDYEEHDKACVRTFY
Q3TLQ6_MOUSE/41-180LVQDII-DETMRFKDN--------TP-NANATER--------------LQ--ELSNNLNSC--FTKDYEEQNKACVRTFH
O77709_BOVIN/41-180LVQDIM-EDTMRFKDN--------TP-NAKVIVQ--------------LQ--ELSLRLKSC--FTMDYDEQDKACVRTFH
O77710_BOVIN/41-180LVQDIM-EDTMRFKDN--------TP-NAKVIVQ--------------LQ--ELSLRLKSC--FTMDYDEQDKACVRTFH
Q64129_9MURI/41-180LVQDII-DETMRFKDN--------TP-NRNATER--------------LQ--ELSNNLNSC--FTKDYEEQNKACVRTFH

PF15036

IL34_MOUSE/28-184LWVLVSLNATESVMDV--------LL-EGHPS.WKY------------LQ--EVQTLLENV...QRSLMD.........V
R4GIU3_CHICK/19-177LWFHACSQAVLHILEV--------LP-EKHPS.RGY------------TQ--ELSQLLDALGVEYSGYRQ.........S
F7EA00_CALJA/29-185LWVLVSLSATESVQDV--------LL-EGHPS.WKY------------LQ--EVQTLLLDV...QRGLTD.........V
H0WFN4_OTOGA/28-184LWVLVSLSATESVQDV--------LL-EGHPS.WSY------------LQ--EVQRLLLDV...HQGFKD.........M
M3ZVZ0_XIPMA/24-191LWFQVNQGVLKKIIRV--------LP-ERHPS.RPY------------TA--ELERRFRDA...EGVFVQ.SHPAEVFQQ
U3JY35_FICAL/18-179LWFHVSSQAVLRIREV--------LP-EKHPS.WKY------------TQ--ELCQLFDALGEEYSKYRQ.........T
L9KJY3_TUPCH/28-184LWVLVSLSAAESVQDV--------LL-EGHPS.WQY------------LQ--DVQTLLQNV...QEGLTD.........V
G3T3A6_LOXAF/28-182LWVLVSLSATESVQDV--------LL-KNHPS.WKY------------LD--EVQTLLVTI...QQGLMD.........V
F6W3U1_MONDO/15-167LWAALNCNTMEIIQNV--------LL-EDHPS.RNY------------IK--EIHELLIYV...QEIAKD.........L
I3JZ08_ORENI/24-192LWFQVYQGVLKKILWV--------LP-TRHPS.RPY------------TA--ELERRFKDA...QAVFMQ.SHPAQVFQE
L5MCR9_MYODS/28-182LWVSVSLGATEAVQGV--------LL-EGHPS.WKY------------LK--DIHSLLVDV...QQALGD.........V
B3DLJ8_DANRE/23-195LWLYVSQQGIKKVLRV--------LP-ERHPTRRKY------------LS--DLENLFKKF...ETVFKEGNHEDQENVR
IL34_BOVIN/28-183LWVLVSLSATEWVQEV--------LL-EGHPS.WKY------------LE--EVHTLLLDV...KQGLGG.........V

PF00714

IFNG_HORSE/15-152YF---------KLFEN--------LK-.DNQVIQKS------------MD--TIKEDLFVK--FFNSSTS----------
H0WPL1_OTOGA/15-151YF---------KLFEQ--------HK-.DNQTIKKS------------IE--TIKEEIIAK--FFNSSYS----------
Q8CGS0_CAVPO/15-154YF---------KLFEK--------HF-TDNQTVQNS------------MN--TIKEQIITK--FFKDNSS----------
B9VS86_CALJA/15-152YF---------KLFKN--------FK-.DNQSIQKS------------ME--TIKEDMNVK--FFNSNKR----------
G3SUC6_LOXAF/15-152YL---------KIFDN--------LK-.DNQVIQES------------VK--TLEEDLFVK--FFNSSSS----------
G3GY20_CRIGR/2-135YF---------KLFEA--------LK-.DNQAIQRS------------ID--TIKADLFAN--FFNSSME----------
I3MNV6_ICTTR/15-152YF---------KLFEH--------LT-.DNKIIQGS------------IN--TIREDLSAK--FFNSNCI----------
L5LME8_MYODS/15-153YF---------KLFEN--------IE-.DNKTIQNS------------LD--IIKEELRVK--VFNSSNS----------
G5BGB5_HETGA/15-152YF---------KLFEK--------SG-.GNQIVQKS------------MD--TIKEDIIAK--FFHSNSS----------
G3WQJ9_SARHA/15-153YF---------KIFEI--------FK-.NNSIVKRS------------ME--HIREDMIMK--LFPNNTA----------
IFNG_SHEEP/15-152YF---------KLFEN--------LK-.DNQVIQRS------------MD--IIKQDMFQK--FLNGSSE----------
IFNG_RAT/14-151YL---------RLFEV--------LK-.DNQAISNN------------IS--VIESHLITN--FFSNSKA----------
IFNG_RABIT/15-152YF---------KLFDN--------LK-.DHEVIKKS------------ME--SIKEDIFVK--FFNSNLT----------
L9KVU0_TUPCH/51-188YF---------KLFES--------FK-.DNQVIKKS------------VD--IIKEDMIDK--FFNSSPT----------
IFNG_FELCA/15-153YL---------KMFEN--------LK-DDDQRIQRS------------MD--TIKEDMLDK--LLNTSSS----------

PF02404

R4GD07_ANOCA/1-283CWLHLMVPELSKSLSN--------LL-NKFTEFSDMPDVLSNYSIINNLR--RIINDLMEC--LSSTKYRNFRQHHDHLY
SCF_CHICK/1-287CWLHLMVPEFSRSLHN--------LL-QKFSDISDMSDVLSNYSIINNLT--RIINDLMAC--LAFDKNKDFIKENGHLY
SCF_RAT/1-273CWLRDMVTHLSVSLTT--------LL-DKFSNISEG...LSNYSIIDKLG--KIVDDLVAC--MEENAPKN.VKESLKKP
G1NWC8_MYOLU/1-272CWISKMVEQLSVSLTD--------LL-DKFSNISEG...LSNYSIIDKLV--KIVDDLVEC--MEEHALEN.VKKSSNSL
F7EP53_MONDO/1-273CWLHLMVPELARSLNN--------LL-DKFSKISSS...LSNYSIIDKLI--KIIDDLMGC--LEE.KNKNFRKQNIHIY
F7C5I3_ORNAN/1-273CWLHLMVPELAKSLNN--------LL-QKFSEISES...LSNYSIINNLT--RIIDDLMAC--LASDKNKHFVQRNIHLY
F7G0W2_CALJA/1-273CWISEMVVQLSSSLTD--------LL-DKFSNISEG...LSNYSIIDKLV--NIVDDLVEC--VKENSSKD.LKKPFKSP

PF00143

G5E7E1_LOXAF/9-168TLLDQLHSGLYLQLED--------LE.ACLVQAMEE-----------EES..VLAIES...........SAL.....AVK
IFNE_MOUSE/27-185NHIEKVLAALHRQLEY--------VE.SLGGLNAAQ-----------KSG..GSSAQN...........LRL.....QIK
G3I0H8_CRIGR/26-185TLLDTFCTGLHQQLSD--------LQ.ACLMQQVGE-----------QEP..PLSQED...........SLV.....AVR
H0VF99_CAVPO/28-187TIVENLTDELHQQMDH--------LKSTILQERLED-----------KNM..TMRDTM...........TTL.....RLK
L5KKJ7_PTEAL/25-192KYLKRIQIGLHRQLQY--------LE.QCLEEEEKE-----------NEDMKEMEEDESKYPGAMVSQLTNL.....ELK
G1U0Q8_RABIT/26-185TLLEELHTALHQQLQG--------LE.TCLVQAMGE-----------EDS..VLTADS...........PTL.....MLK
F6YZB3_ORNAN/25-183AEVENFLHGLHRQLEE--------LE.VCLEEDTDP-----------SQA..SVGSGI...........LRL.....RLK
I3MY95_ICTTR/32-186ILLDIFLSGLNQQYQD--------LK.ACVTHQVWR-----------QKP...................LGI.....TVK
V8NNB8_OPHHA/15-183GSLRDFHIGLDQQIKM--------LE.TCGNAELEQ-----------VIT..SPRNRK........LQLTRL.....RIK
C8CKA7_PIG/26-185SLLHQFCTGLDQQLRD--------LE.ACVMQEVGL-----------EGT..PLLEEG...........SIL.....AVR
H0W7G8_CAVPO/26-185SLLDTFCTGLHQQLND--------LQ.ACLTQDTGL-----------EEP..SLLHED...........SRL.....AVR
G3GXU9_CRIGR/27-182TIVESFLDKLYKQIDF--------LK.KILKEMPKN-----------ESL..TTRD.S...........TIP.....RLK
H0XSG1_OTOGA/26-185TLLDQFRSGLYQQLNE--------LE.ACLMQEVGV-----------GEA..ALMNQD...........SML.....AIR
G1KX99_ANOCA/25-184DSLRVFHAGLDQQSEN--------LK.SCLSESPRS-----------QRI.................QLTRL.....KVK
G3I0I6_CRIGR/27-185NHIERVLGALHQQLEY--------VE.LLAGLKAES-----------KSG..GLSAQS...........LRL.....QIK
IFNT4_SHEEP/26-185TLLDQLCTGLQQQLDH--------LD.TCRDQVMGE-----------KDS..ELGNMD...........PIV.....TVK
L8Y4J0_TUPCH/27-186HYKEKFLIELHEQLDY--------LE.GLMELEAEQ-----------KND..ALDSED...........RRL.....HVK
F7B527_HORSE/26-183TLLDKFLLGLYQQLDD--------LE.TCLGKETKV-----------EQS..ALGSEI...........STL.....AVK
G1Q950_MYOLU/27-184TIVENLLEELDGQMDR--------LE.TALEEITKE-----------GKF..PWEN.R...........TVL.....RLK
M3WTR1_FELCA/26-186APLHGLRSGLHRQLEA--------LD.ACLLQATGE-----------GER..APGMHG...........PVL.....AIK
G5CB66_HETGA/27-185TIVENLLVELHQQMDS--------LK.TLLQEILEK-----------KDI..TWEDTM...........IIP.....RLK
L9L941_TUPCH/27-198KHLKQIQMGLHQQVEY--------LE.QCLEEEENE-----------N.DWEKMEEDEMEHSGAAVPQLGNL.....ELK
D2H9N6_AILME/27-184IIVNNLLEKIHWQIEH--------LE.EILEKIKEE-----------ENF..TWDD.R...........TLL.....PLK
D3Z919_RAT/26-179TLRLSFCNYLYQQLKD--------LE.ACQNQQVGV-----------QEV..PLTQEP...........SWL.....AVR
C8CKB9_PIG/24-176ALLDHLLSRLDHGLDR--------LE..........-----------.....QMEGDN...........LACAYLGSVVR
A8E6F6_XENTR/27-179QAWERFQQLLYYQIHQ--------LE.ACVSQTEEN-----------DLLKE.........................SIS
L8Y906_TUPCH/26-185ALLDKLLAGLHQQLED--------LE.TCLVQGVGE-----------EPS..ALETDS...........TTL.....ALR
H9L1C3_CHICK/28-183AALEQFQNGLYQQIEK--------LE.ACIIKKQTQ-----------Y....FWSKEV...........NRL.....KLK
L5KWM8_PTEAL/106-263TLQHGLLTGLHRQLED--------LG.ICLVPEMKE-----------VES..ALGMED...........PTL.....AVK
G3WZJ8_SARHA/27-182TQLRQLLIGLDQQLEQ--------LE.QCVGQEAEQ-----------EEP..SLGSEN...........PIL.....VLK
G3UCD2_LOXAF/26-187TLLDKLFAALDQQLND--------LE.VCLMQETGV-----------EETPVPVINED...........SML.....AVR
K7GQJ6_PIG/17-164TLLDKLCSGLHQQLED--------LD.PCLVQVMGE-----------QAS..SLG................M.....AVK
G3I0H3_CRIGR/26-178TLLDTFCDELHQLLSD--------QQ.ACLKQQVVM-----------Q.........D...........SLM.....AVR
H0VYK7_CAVPO/28-181TIVDDLLDKLHQQMDR--------LKSTILQERPED-----------TNM...................TTL.....RLK
I3N7K4_ICTTR/33-202EQLVQLQSNLYEQVEY--------LK.QCWGKENKE-----------KED...VKADEKKHSEAGVLPLGNL.....KLR
L5K635_PTEAL/26-185TLLHGLLSGLHRQLED--------LG.TCLVPEMKE-----------VES..VLGTED...........PTL.....AMK
H0W3G0_CAVPO/26-185TILHKLHTVLHQQLEV--------MK.TCLVQVLRE-----------EGC..VLAIQN...........PIL.....ALR
W5JYQ9_ASTMX/23-179EKLDYFLHIVFRLIEE--------NK.CVMSKTQDS-----------LDD..FLKREA...................SLR
G3SI98_GORGO/28-185RHFKQIQIGLDQQAEY--------LN.QCLEEDENE-----------NEDMKEMK.............LSSL.....ELR
H0Y0D2_OTOGA/28-187TLLDQLRTNLGWQLQE--------LE.SCLMSLGEE-----------EGT..PLMNQG...........PTL.....AVR
IFN_ANAPL/34-190TARHDLLNQLQHHIHH--------LE.RCFPADAAR-----------LHRRGPRN..............LHL.....SIN
G3UJX3_LOXAF/27-185TVIENLLAELSQQRDR--------LV.TILEESMEE-----------ENP..TSRNIM...........TIL.....HLK
G5C259_HETGA/26-185GLLDTFCTGLHQQLSD--------LE.ACLTQEVGQ-----------EEV..PISHED...........SRL.....AVR
G3WZF5_SARHA/26-185TIIETFLNIIFQQMEH--------LE.MALKEEMNQ-----------VNS..TRLNEE...........SIQ.....HLN
IFNE_PIG/27-186SHMEEFLVELHQQLEY--------LE.ALMRLQAEQ-----------KSD..TLCSEN...........LTL.....QVK
W5N6G4_LEPOC/27-185SELERFQGLLYRQIRQ--------LT.LCAGSEMKF-----------SGEPNRLGVSV...................VLK
H9KYA4_CALJA/26-185TLLDTFYTELYKQLNY--------LE.ACVMQRIGV-----------EGT..PLMNAD...........SIL.....AVR
D2HTQ4_AILME/33-205DYLKQIQIGLDQQLQY--------LE.QCLEEEEKE-----------KEDSKELEEDGMNWSGALVPQLSNL.....ELR
IFNB_HUMAN/27-185TIVENLLANVYHQINH--------LK.TVLEEKLEK-----------EDF..TRGKLM...........SSL.....HLK
G1NR05_MELGA/32-188HAHHSLLNQMQHYIHH--------LE.QCFVDQGTR-----------SQKQGPRN..............SHL.....SIN
F7BVP5_ORNAN/23-181ATVEKFLHGVHKEMMR--------LE.VFLEEEMGW-----------ENS..TLRRD............ISL.....HIK
F7G875_MONDO/27-182TIIEPFLSGIYQQMLH--------LE.....EEMDQ-----------ANS..SWESLE...........SIL.....RLK
C8CKC3_PIG/33-205KLLRQVQMGLDQQLQV--------LE.QCLQEEEEE-----------NEDIKEMDEVERKPSGATVPPSHSL.....ELR
I3MVD7_ICTTR/34-186TLLNTFLTGLHQQLDD--------LK.ACGTQQVGV-----------EEA..PLR......................AVR
F7A317_HORSE/26-184SLLDKLYTGLYQQLTE--------LE.ACLSQEVGV-----------EET..PLMNED...........SLL.....AVR
G1KU56_ANOCA/28-182NSIGILKVGLKQEIAK--------LT.PCLSEDKQE-----------IRE...........................DVK
L5KBH2_PTEAL/26-185TLLHGLLSGLHWQLED--------LG.TCLVPEMKE-----------AES..ALGMED...........PAL.....AVK
L5K909_PTEAL/26-185TLLGRFCTGLYQQLNH--------LE.ACQTQEVGT-----------EET..PLLDED...........STV.....AVR
I3N5Z0_ICTTR/23-179NHIPIFLTDLHQQLEY--------LE.TLLGLEAEQ-----------KSH..AQGSKN...........LRL.....QVK
F7GHL9_MONDO/26-181TQVIELRIGLDHQLGQ--------LE.SCLGQDAEW-----------EVP..SLGSEN...........PMM.....ALK
IFNE_HUMAN/27-186NHTEKFLIQLHQQLEY--------LE.ALMGLEAEK-----------LSG..TLGSDN...........LRL.....QVK
I3LBU7_PIG/26-179TRLDKLCSGLHQQMED--------LD.SCLVQVRGE-----------QVS..ALG................I.....VVW
G3UK87_LOXAF/27-184TLPDQLHNGLYQQLED--------LE.TCSMQAVGE-----------GSV...LAIEG...........PVL.....AVK
L9LC61_TUPCH/27-185TIVEHLLAQLFWQMDH--------LE.TMLEEKLEE-----------ENV..TWGNSM...........SVM.....HLK
IFNB_RAT/27-182TIVESLLDELHQQTEL--------LE.IILKEK.QE-----------ERL..TWVTST...........TTL.....GLK
H0XMZ9_OTOGA/27-186SHVEKFLIELHQQLEY--------LE.ALTGLEAEQ-----------RSG..TVGIEK...........LRL.....QVK
G3VDC6_SARHA/27-182TQLIQLLMGLDQQLEQ--------LK.SCVGQEVEW-----------KEH...LKSEN...........PRIQ....ALQ
I3JM36_ORENI/26-182STVRNFLNIVNKQAEE--------LH.SCIGSHSHK-----------KKN...................SQLYF...KTE
L5LKN9_MYODS/27-186SRMERFLIELHQQLEY--------LE.TLRGLQTDQ-----------KSS..TVGREK...........LRL.....QVK
G1TYS8_RABIT/29-195THLTQIQNGLYEQVAY--------LE.QCLMEDIHE-----------TKE......EEMKYSGTGRFLLNNL.....ELR
I3UJJ8_FELCA/27-185SHVEKFLTELHQQLEY--------LE.ELTGPEAEQ-----------DSC..ILGSEN...........VRL.....QIK
C8CKA9_PIG/26-183TLLIKFLSGLYQQLDD--------LE.KCLREGKKV-----------EQS..PPGGEN...........SIL.....AVK
IFNT2_BOVIN/3-162TLLEQLCTGLQQQLED--------LD.ACLGQVMEE-----------KDS..DMGRMG...........PIL.....TVK
H0W510_CAVPO/26-186SLLDSFCTGLYELLKA--------LQ.ACLTQEAGL-----------QEP..LLMHED...........SRL.....AVR
M3Z729_MUSPF/26-183TLLEELCSGLSEQMSH--------LE.ACPLQEAGV-----------EEK..PLVNRD...........SIL.......R
IFNA1_MOUSE/26-185TLLDSFCNDLHQQLND--------LQ.GCLMQQVGV-----------QEF..PLTQED...........ALL.....AVR
G3TTC1_LOXAF/26-185TLLNQLLNGLPEQQED--------LE.TCFMQAMEE-----------GKS..ALPIEG...........PAL.....AVK
G1PDS6_MYOLU/29-199KHLGQIQTGLDRQLQY--------LE.QCLKEE.KG-----------NEDKEEMEEDERRHPGARTPQPSNL.....ELR
F7ABU5_MONDO/27-182TQVIQLLIRLDQQLEQ--------LE.RCLGQNVKW-----------EEF..SLRSEK...........TRF.....ALK
G1TTX4_RABIT/27-180TLVENLLGETHLQIHH--------LK.SKINKKV..-----------.....TLESIR...........MNL.....RLK
H0XRP5_OTOGA/26-185TLLDQFRTGLYQQLNE--------LE.ACLMPDEGV-----------EDT..APMGED...........PVL.....ALR
H0WK94_OTOGA/33-202KHLNQIQMGLDKQLEY--------LE.QCLQEEENE-----------NAD...VKEAAMKYSGAQGPQVHNL.....ELR
G1KYL3_ANOCA/23-176DSLRAFHAGLDQQSEN--------LK.SCLSASPR.-----------...................IQLTRL.....RVK
G3WZQ8_SARHA/26-181TQLKQLLIGLDQQLDQ--------LE.QCLGQDVER-----------EEP..SLGSEN...........PSL.....VLK
H2R6R8_PANTR/26-185SLLEKFSTELYQQLND--------LE.ACVIQEVGV-----------EET..PLMNED...........SIL.....AVR
H0YTY6_TAEGU/34-188HARNLLLNKLQHHIHH--------LE.QCLPDNALL-----------FKG..PRN..............PLL.....TIN
I3MXH1_ICTTR/27-185TIVTDLLSELHQQMDL--------LN.TTVVEKLGE-----------ENK..RQAYSM...........IIL.....RLK
M3WRV1_FELCA/26-184TLLEEFCTGLDRQLTR--------LE.ACVVQEVGE-----------GEA..PLTNED...........SLL.......R
H0W4H8_CAVPO/23-182SLLHSFCTGLHQQLND--------LE.ACLTQETGL-----------EEP..PLMHED...........SRL.....VVR
R4GKJ6_CHICK/35-191SQRQSLLNRIHRYTQH--------LE.QCLDSSDTR-----------SRTRWPRN..............LHL.....TIK
A3FBE8_MUSPF/27-184SIVENLLATLHWQKEH--------LE.EILEDIMQE-----------ENV..TWDH.R...........TLL.....HLK
G1KWE0_ANOCA/28-180DSLRAFHAGLDQQSEN--------LK.SCLSASPRS-----------QRI.................QLTSL.....RVK
G7PS89_MACFA/26-185TLLDEFYIELDQQLND--------LE.SCVMQEVGV-----------TET..HLMYED...........SIL.....AVK
G1Q880_MYOLU/26-185TLVDQLRSGLHRQLED--------LE.ACLVEEMGE-----------EGS..ALAMEG...........PTL.....ALK
IFNB_MOUSE/27-180TIVVRLLDELHQQTVF--------LK.TVLEEK.QE-----------ERL..TWEMSS...........TAL.....HLK
IFNB2_BOVIN/27-184TIIEDLLEELYEQMNH--------LE.PIQKEIMQK-----------QNS..TMGD.T...........TVL.....HLR
G1SJC4_RABIT/26-185ALLDRLCTGLFEQQSD--------LE.VCMMQGAGA-----------EEM..PLKHED...........SAW.....AVR
W5PG31_SHEEP/26-185SLLDKLCAALDQQLTD--------LQ.ACLRQEEGL-----------RGA..PLLKED...........SSL.....AVR
IFNA3_CANLF/26-183TLLEELCSGLSEQLDD--------LD.ACPLQEAGL-----------AET..PLMHED...........STL.......R
G5BPX2_HETGA/27-199EYLTQIKSELAEQREY--------LE.QCLKEEKKE-----------NKGMQEMKTHELEHSGVQVVQQSKL.....ALR
IFNW2_HORSE/26-185TLLDELCTGLLRQLED--------LD.TCLEQEMGE-----------EES..ALGTVR...........PTL.....AVK
G3N2A8_BOVIN/26-185TLLEQLHTGLHQQLDD--------LD.ACLGQVMGE-----------EDS..ALGRMG...........PTL.....AMK
H0XKS8_OTOGA/27-185TIVDALLANFHQQMDS--------LE.TTLDEKLED-----------KNF..IGGKVT...........NIL.....HLK
H0VUV7_CAVPO/26-185SLRRTFCDALRDQMND--------LK.ACLTKETGL-----------EDP..SLWHED...........SRN.....AVK
Q29412_PIG/27-184TVIKTILVELDGQMDD--------LE.TILEEIMEE-----------ENF..PRGD.M...........TIL.....HLK
G7PS88_MACFA/26-185DLLDKFCTELYQQLND--------LE.ACVMQQERV-----------GET..PLMNAD...........STL.....AVK
M3WZS7_FELCA/26-181MLLDRFLVGLYQQLDD--------LE.TCLREEMNM-----------EQL..PLGNEN...........SRL.....AVK
H9GZR7_HORSE/26-185TLLDRLLTGLHQQLED--------LN.TCLDEQTGE-----------EES..ALGTVG...........PTL.....AVK
F1LVL8_RAT/26-184NHIEEVLAALHRQLGY--------LE.SLGGLKAER-----------KSG..GLSVKD...........LRL.....QIK
M3YX13_MUSPF/27-179IRVE.FLTELHQQLEY--------LG.ALRGLGAEQ-----------NSG..VLSGGN...........SRM.....QVK
G1L8G2_AILME/26-185TLLDKFLAGLHQQLED--------LE.TCLEEEKNV-----------EQL..LLGSEN...........SRL.....AVK
IFNB_HORSE/27-184TIVKNLLVEVHLQMDR--------LE.TNLEEIMEE-----------ESS..TWGN.T...........TIL.....RLK
H0W289_CAVPO/26-190ALLDQLHSLLYQQLEA--------MK.ICMVQEAGG-----------EES..ALATED...........LTLNHSWRTLM
A8E6E8_MONDO/27-182TQLMQLLIGLDQQIEQ--------LE.RCLTQDVEQ-----------DEP..SLGREN...........PLM.....ALK
I3N788_ICTTR/27-185TIVKDLLVELHQQMDL--------LE.TILEKKLGE-----------ENK..SWGNSR...........TIL.....HLK
G1L8I1_AILME/26-183TLLEEFCSGLSEQLSV--------LE.ACPMQAAGV-----------GET..PVRNVD...........SIL.......R
IFNB_FELCA/27-184TTVENLLATLHWQKEH--------LE.TILEEIMEE-----------ENF..TWDN.T...........TLL.....NLK
H0VXI5_CAVPO/26-181SLLSYFCTGLHQHLKH--------LH.ACLTQEVGL-----------QEP..PLMHED...........SRQ.....AVR
G3TS29_LOXAF/26-179TFLDKFLLGLYQQLND--------LE.ICFEKERKV-----------EQI..PLGTEN...................SVK
W5PZ39_SHEEP/26-184KQLRQIQIGLDHQLQY--------LE.QCLEEEER.-----------.............PSGAPVLQPSNL.....ELR
G3I0H6_CRIGR/26-178TLLKPFCNSLLQQFNA--------LK.ACLMHQVGM-----------Q.........D...........SQV.....AMK
I3L756_PIG/26-180TLLDKLCSGLHQQLED--------LD.PCLVQEMEE-----------QTF..ALG................M.....AVK
M3Z715_MUSPF/26-183TLLEELCSGIYQQVND--------LQ.ACLMQEAGV-----------EEM..ALVNGD...........SIL.......R
M3VXI8_FELCA/33-205KNLKQIQIRLDWQMHH--------LE.KCFEEEEKG-----------KEDSKQREEDGMDFSGAMVSQVSSL.....ELR
G3R8Q7_GORGO/26-185TLLDQLHTGLHQQLQH--------LE.TCLLQVMGE-----------GES..AGTIRS...........PAL.....TLR
A8E6F5_XENTR/51-202QAWERFQQLLYYQINQ--------LE.ACIPETAEN-----------PVFNQ.........................TIS

PF02947

FLT3L_MOUSE/30-162SKMQTLLEDVNTEIHF--------VT-SCTFQPLPE-----------CLRFVQTNISH-----------LLK-----DTC
F6T7S9_ORNAN/28-157PRLRELVHKVQAEVDF--------VN-DCGFQRPQK-----------CARFQQINISQ-----------FLG-----DVS
H9GP84_ANOCA/29-165SELEKSIRKLMIHTTF--------VE-MCDIN..DS-----------CVKFITTNISE-----------FLE-----PIP
F6TPW7_MONDO/34-163KELKKLLDKVCTEISF--------VR-KCFSEALPG-----------CLHFRKANISH-----------LLL-----DIS
G5B8P0_HETGA/20-150LKIRELLETVDTEIHF--------VT-SCAFQPLPS-----------CLRFVQTNISH-----------LLQ-----DTV
G1M637_AILME/29-159SQMQILLEAVNTEIHF--------VT-LCALQPLPS-----------CLRFVQTNISH-----------LLQ-----DTS
L9JA37_TUPCH/769-910PQIQDLLEKVNTEIHF--------VT-SCDFQPLPS-----------CLRFVQTNISD-----------LLQ-----DTS
G3VSA3_SARHA/79-209SKLQEPLEAVYAEIDF--------VG-QCVNQSFPS-----------CLRFRKANISH-----------LLL-----EVS
G1QZC3_NOMLE/30-160SKMQGLLERVNTEIHF--------VT-KCAFQPPPS-----------CLRFVQTNISR-----------LLQ-----ETS

PF06875

Q5BNQ4_9SALA/2-215EAMTEQ-EDLNPAELA--------LK-AK-FEEAMA-----------NSN--TLISKISDIMTQMGMSV-----------
Q5BNQ2_9SALA/2-215EAMTEQ-EDLNPAELS--------LK-AK-FEEAMA-----------NSN--TLISKISDIMTQMGMSV-----------

PF01110

CNTF_CHICK/1-194QMLEEQRELLGDTDAE--------LG-PA-LAAMLL-----------QVS--AFVYHLEELLELESRGA-----------
G3VWZ5_SARHA/1-195EVLEDQRAQFTPTERD--------FH-QN-IHRVLL-----------QVA--AFAYEMEELMALLGHQA-----------
E1BFH9_BOVIN/1-193RLLEDQRAHFTPAEED--------FH-QA-IHAVLL-----------QVA--AFAYQLEELMALLEHRV-----------
G5AP46_HETGA/1-192RLLEDQQVHFTPTESD--------FH-QA-IRSLGL-----------QVS--AFAYQLEELMVLLEHEI-----------
H0Z9U1_TAEGU/1-188QMLEEQREQLGEADAG--------LG-RA-LAAVLL-----------QVS--AFAYHLEELLRLESRGI-----------
CNTF_HUMAN/1-194RLLEDQQVHFTPTEGD--------FH-QA-IHTLLL-----------QVA--AFAYQIEELMILLEYKI-----------

PF01291

LIF_MOUSE/44-203NITRDQ-KVLNPTAVS........LQ-VK-LNATID-----------VMR--GLLSNVLCRLCNKYRVG...-----.HV
LIF_BOVIN/43-202NITRDQ-KVLNPYAHG........LH-SK-LSTTAD-----------VLR--GLLSNVLCRLCSKYHVS...-----.HV
ONCM_HUMAN/37-209RLADLE-QRLPKAQDLERSGLNIEDL-EK-LQMARP-----------NIL--GLRNNIYCMAQLLDNSD...-----TAE
ONCM_MOUSE/34-194QLDALR-QKFLKTPAFP.........-.K-LDSARH-----------NIL--GIRNNVFCMARLLNHSL..E-----IPE
ONCM_BOVIN/34-194MLSALQ-QDLPEAAH...........-..-.QQAEM-----------NVR--GFGNNIHCMAQLLRGSSDPK-----AAE

PF03039

IL12A_MOUSE/6-215EDLKMYQTEFQAINAA--------LQ-NH-NHQQII-----------LDK--GMLVAIDELMQSLNHNG--------ETL
G3VQT1_SARHA/40-247KDLETYKTEFKVVEET--------LA-KD-PTRQIS-----------LDQ--NMLAAIDEMMQALNFSS--------ENM
F6T5A8_MONDO/5-202EDLETYKAEFNVIKKT--------LT-KD-PAKQIS-----------VDL--NMLAAIEEMMQALNFNS--------KNV
IL12A_PIG/6-222EDLKMYHVEFQAMNAK--------LL-MD-PKRQIF-----------LDQ--NMLTAITELMQALNFNS--------ETV
L8YEA2_TUPCH/1-213EDLKMYQVEFKAINAQ--------LW-MD-PERQIL-----------LDQ--NMLTAIDELMQALNFNS--------DTV
H0X861_OTOGA/6-217EDLKMYQVEFKAMNEV--------LS-MY-PINQTI-----------LDQ--NLLTVMEKLMQDLNSTS--------ETV
G1QWH2_NOMLE/40-254ESIYSSRVQIKQASHR--------RC-MC-LENEYF-----------FSQ--VLRTELQALRHALNFNS--------ETV
I3MN91_ICTTR/4-220EDLKMYQLELKAINEK--------LL-MD-PKGQIY-----------EDK--ALLAAVDYLMQAVNVNN--------ETV
Q924V6_CAVPO/6-221EDLKLYQLEFKNMNAQ--------LL-MD-PQRQIF-----------LDQ--NMLSAIDELIQALNGSD--------VTV

PF02024

H3AP27_LATCH/26-169ETLEIFHWILSSLP----------V.-DD-VTQILW-----------DIE--NLRALLQTLATTMGCEL-----------
G3WWV6_SARHA/23-167QTLAIYQQILSNLS----------S.-RN-MVQISN-----------DLE--NLRDLLHLLGSLKSCPF-----------
F6PLK2_ORNAN/23-167QTLAVYQQILSSLP----------M.-PD-RTQISN-----------DLE--NLRSLFALLATLKNCPF-----------
F7HGW1_CALJA/23-167EILATYQQIVISLP----------S.-GN-MIQISN-----------DLE--NLRALLHLLAASKSCHL-----------
G5BHA4_HETGA/23-167QTLAVYQQIISNLP----------SR-RN-MVQISN-----------DLD--NLQNLVHMLASSKGCPL-----------
W5NER9_LEPOC/28-172DNLHTFQEILSSLP----------M.-EE-MDQILA-----------DIF--NLRMIIKSLATSVNCAP-----------
H0V7C6_CAVPO/23-165QTLTLYQKVITTLS----------S.-SH-TAQISN-----------DLE--NLQSLVQMMASSKGCPL-----------
LEP_HUMAN/23-167QTLAVYQQILTSMP----------S.-RN-VIQISN-----------DLE--NLRDLLHVLAFSKSCHL-----------

PF00489

IL6_BOVIN/27-208LEYQIYLDYLQNEYEG--------NQ-EN.VRDLRK-----------NIR--TLIQILKQKIADL..ITT..-----PAT
M3X721_FELCA/27-208QEFQIYLKFLQDKYEG--------DK-EN.AKSVYT-----------STN--VLLQMLKRKGKNQDEVTIPV-----PTV
IL6_HORSE/27-208SEFQIYLEYLQNEFKG--------EK-EN.IKTMQI-----------STK--VLVQILMQKMKNP.EVTTPD-----PTA
G3UHF3_LOXAF/20-205SEFQIYLDYLQNKFEG--------SK-AN.VIVVQN-----------STK--ALVQILKQKIKNPEDVTTPD-----PTA
L5KPK4_PTEAL/20-202LEFQIYLDYLQNKFE.--------..-EN.AKAMQM-----------RTK--ALVQVLKQKVKNPNEITTPD-----PTT
F7HV62_CALJA/27-212LEFEVYLEYLQNRFES--------SK-EQ.AGAVQM-----------STK--GLIQSLQKKAKNLSAIATPD-----PAT
IL6_MOUSE/26-210LEYHSYLEYMKNNLKD--------NK-KDKARVLQR-----------DTE--TLIHIFNQEVKDLHKIVLPT-----PIS

PF16647

CSF3_BOVIN/42-190FLYQGLLQALAGISPE--------LA-PT-LDTLQL-----------DVT--DFATNIWLQMEDLGAAPAVQ-----PTQ
CSF3_HUMAN/51-202FLYQGLLQALEGISPE--------LG-PT-LDTLQL-----------DVA--DFATTIWQQMEELGMAPALQ-----PTQ
CSF3_MOUSE/57-205CLYQGLLQALSGISPA--------LA-PT-LDLLQL-----------DVA--NFATTIWQQMENLGVAPTVQ-----PTQ

PF02372

IL15_PIG/33-160---------LQES..R--------NS-DI-SDTVEN-----------LII--LANSSLSS..IEYKTESGCK-----E--
IL15_CAVPO/33-160---------LHES..R--------NE-DI-HETITN-----------LII--LANSSLNS..NGNVTESGCK-----E--
IL15_FELCA/33-160---------SLES..K--------NE-TI-HQTVEN-----------III--LANSGLSS..NRNITETGCK-----E--
IL15_SHEEP/33-160---------LHES..K--------NA-AI-YEIIEN-----------LTM--LADRNLSS..IENKTELGCK-----E--
F1NZN5_CHICK/55-183---------LHECGIK--------KC-SR-KHDVRN-----------ILK--NGNARFATYQLNSTTSKKCK-----E--
G1NDP6_MELGA/5-137---------LEKEIED--------EP-EI-KNEFKN-----------ALQ--NIKKNLHRLKDLSPTGGECK-----I--
O73883_CHICK/5-138---------LKKETED--------DT-EI-KEEFVT-----------AIQ--NIEKNLKSLTGLNHTGSECK-----I--
Q8JFF4_ANAPL/4-134---------LEEEIED--------ED-EI-EDEKVS-----------SVR--NIKMNLQKLMDLIPPGTGCN-----I--

PF00715

I3MQX6_ICTTR/7-151-----------QEVLN--------VP-QS-KNFHLK-----------DTR--NFISNINVTVLKLKGSATTF-----T--
G5C793_HETGA/7-149-----------EQVLN--------LA-EH-KHFPLI-----------NTK--DFISNINVTVWKLKGSKTTL-----K--
G1PJ32_MYOLU/7-147-----------EEVLK--------LE-KS-....LS-----------NIT--ELMSNVNVLVQNLKGPKTRF-----E--
B1AB81_HORSE/7-146-----------EEML.--------..-..-KNFLSK-----------DIK--ELMSNINVTVLGLKGSETRF-----T--
G3HTL8_CRIGR/7-150-----------QSVLD--------LA-QS-KSFQLE-----------DTE--NFISNIRVTVVKLKGSENTF-----T--
IL2_MACMU/7-151-----------EEVLN--------LA-QS-KNFHLR-----------DTK--DLISNINVIVLELKGSETTL-----M--
H0Y254_OTOGA/7-149-----------EKVLD--------LG-QS-KNFHLG-----------DTR--EVIGNINVTVLELKGSET.F-----I--
IL2_MOUSE/7-165-----------RHVLD--------LT-QS-KSFQLE-----------DAE--NFISNIRVTVVKLKGSDNTF-----E--
G3SU90_LOXAF/7-147-----------EDVLN--------VA-PS-K....Q-----------NTR--ELISNINVTALELQGSETTF-----M--
IL2_PIG/7-151-----------EGVLN--------LG-QS-KNSDSA-----------NIK--ESMNNINVTVLELKGSETSF-----K--
IL2_FELCA/7-151-----------EEVLY--------LA-QS-KNFHLN-----------HIK--ELMSNINVTVLKLKGSETRF-----T--
L5K7D9_PTEAL/7-149-----------EEVLT--------IA-QS-KNSH.S-----------DIK--ESVSNINVTAQKLKGPETKY-----T--
IL2_BOVIN/7-152-----------EEVLN--------LA-PS-KNLNPR-----------EIK--DSMDNIKRIVLELQGSETRF-----T--
H0VBY4_CAVPO/7-149-----------EQVLN--------LA-EH-KNFPLI-----------HTK--DFISNINVTVLSLKGSETAF-----V--

PF00103

PLRP1_BOVIN/26-238YSWNNPLHHLVTELQH--------MK-EL-SNAFLS-----------SAT--RFENMSEKLQAFIERQFSKI-----IVP
CSH2_BOVIN/26-238YSWNNPLYYLLLELRN--------MK-NL-SEAVIS-----------SAM--EIENMSEKLQAFIESQFRKI-----IVP
PLRP3_BOVIN/1-213YSWHRPLYLLVKDLQS--------MK-EV-SDTILS-----------SAK--ENMRKIEELQAFIERQFSQV-----IYP
PR4A1_RAT/17-227QAWLNPLHHLWAEMCD--------RL-GS-TPPTLY-----------KAL--MLKESNIKLLDAIKNIAKKG-----NF.
CSH1_BOVIN/26-236HSWDEPLHQAVTELLH--------RN-GA-SPDILA-----------RAK--EIEDKTKVLLEGVEMIQKRV-----H.P
PLRP4_BOVIN/26-239YSWQRPLYQLVTDLRS--------MK-EV-SNTILS-----------SAR--ENVKKLKELQALIERPFSQV-----IFT
PR3D4_RAT/16-223VSWKEPLKHFVSAVTD--------LP-GA-SASMRK-----------KAV--DMKDKNLIILEGLQKIFNRT-----QTK
PR2C2_MOUSE/16-224DAWESPLDDLVSELST--------IK-NV-PDIIIS-----------KAT--DIKKKINAVRNGVNALMSTM-----LQ.
SOM2_HUMAN/9-215QSWLEPVQLLR....S--------VF-AN-SLVYGA-----------SDS--NVYRHLKDLEEGIQTLMWRL-----EDG
PR8A5_RAT/17-238GFMDQPLFHLVIELSA--------ME-GV-PETILS-----------KAK--DLEENNRQLLDDLRWILTKV-----F..
PR6A1_RAT/20-234ETWTFSLYHIANEMSH--------ME-EP-PDEIIS-----------RAK--NIEEKIKELMDVLKGILNKI-----Q..
PR7D1_MOUSE/17-240LAWKEPLKHLVTELSA--------LP-EC-PYRILS-----------KAE--AIEAKNKDLLEYIIRIISKV-----N..
CSH2_HUMAN/9-215ESWLEPVRFLR....S--------MF-AN-NLVYDT-----------SDS--DDYHLLKDLEEGIQTLMGRL-----EDG

PF01109

CSF2_RAT/18-139VQTRLK----LYKQGL--------RG-N--LTKLNG-----------ALT--MIAS---------------------HYQ
CSF2_MOUSE/18-136VQTRLK----IFEQGL--------RG-N--FTKLKG-----------ALN--MTAS---------------------YYQ
CSF2_BOVIN/18-138LQTRLK----LYKNGL--------QG-S--LTSLMG-----------SLT--MMAT---------------------HYE
CSF2_CAVPO/18-140LQTRLA----LFMKGL--------RG-N--LTRLEG-----------SLT--LMAN---------------------FYK
CSF2_PIG/18-139VQTRLN----LYKQGL--------RG-S--LTRLKS-----------PLT--LLAK---------------------HYE
CSF2_HUMAN/18-139LQTRLE----LYKQGL--------RG-S--LTKLKG-----------PLT--MMAS---------------------HYK
CSF2_CANLF/18-139LETRLQ----LYKEGL--------QG-S--LTSLKN-----------PLT--MMAN---------------------HYK

PF02025

G1RQD7_NOMLE/22-133TEEIFQGIGTLESQTV--------QG-GT-VERLFK-----------NLS--LIKK---------------------YID
IL5_CAVPO/23-134IEEIFQGIDTLKNQTT--------QG-EA-LATLFQ-----------NLS--LIKK---------------------HID
J9NWP5_CANLF/22-132IKEVFQGIDTLKNQTA--------HG-EA-VDKLFQ-----------NLS--LIKE---------------------HIE
IL5_MOUSE/21-132IGEIFQGLDILKNQTV--------RG-GT-VEMLFQ-----------NLS--LIKK---------------------YID
G3WAR7_SARHA/25-134IEEIFQGIETLKNQTA--------ED-NV-VERIFQ-----------NFS--SLKE---------------------HIT
IL5_HORSE/22-133IEEVFQGIDTLKNQTV--------QG-DA-VAKLFQ-----------NLS--LIKG---------------------YID
B5FW65_OTOGA/22-133TEEIFHGLDTLRNQTA--------HE-DG-VEQLFQ-----------NLS--LIKK---------------------YID
I3MDT8_ICTTR/23-134IEEIFQGIDTLKNQTT--------QG-DA-VERLFQ-----------NLS--LMKK---------------------YID
G3T4B0_LOXAF/23-133TEEIFQGIDTLKNQTV--------QD-DA-VGKLFK-----------NLS--LLKE---------------------YID
G1SL79_RABIT/22-133IEETFRGVDTLKAQIV--------QG-EA-MDNLFQ-----------NLY--LIKK---------------------YID

PF02059

IL3_CANLF/19-132NLDVFL----NASSKF--------.H-KN-GLLIWN-----------NLK--EFLP---------------------LLP
IL3_MOUSE/27-138NLSKFV----ESQGEV--------DP-ED-RYVIKS-----------NLQ--KLNC---------------------CLP
IL3_BOVIN/18-132NLKVFM----TFATDT--------.F-GS-DSKIMK-----------NLK--EFQP---------------------VLP
G3UC30_LOXAF/22-133NLDAFL----KATENF--------KE-KG-GSSISK-----------NLR--KFHP---------------------CLP
G1MH15_AILME/18-131NLEAFL----NATKNF--------.Y-NS-ESLIWK-----------NLK--EFLP---------------------LLP
F1RJV6_PIG/18-131NLEAFV----TFAENH--------.L-KN-ISGIKK-----------NLE--KFRP---------------------ILP
G1RQ11_NOMLE/20-137NLEAFN----KAVKSL--------..-QN-ASAIES-----------ILK--NLPP---------------------CLP
IL3_CALJA/19-136NLEAFQ----KAVKSL--------..-QN-AAAIES-----------NLK--DLPV---------------------CLP
F1LS41_RAT/29-138NLDEFL----KSQEEF--------DS-QD-TMDIKS-----------KLQ--KLKC---------------------CIP

PF07400

IL11_HUMAN/22-199DLLSYL-RHVQWLRRA--------GG-SS-LKTLEP-----------ELG--TLQARLDRLLRRLQLLMSRL-----ALP

PF00758

G3TYQ1_LOXAF/25-173GPTCLSSLLEQL..SG--------QV-RL-L..LGA-----------LQG--LLGTQL...----------------.PP
W5K758_ASTMX/26-175SNSA.....LHSHIDA--------SV-RN-IASIGQ-----------VLR--SLSIQD...----------------YVP
B1N8Y2_DANRE/15-168QTEV.....LQSHIDA--------SI-RN-IASIRQ-----------VLR--SLSIPE...----------------YVP
F7DTH0_CALJA/31-193ANSSQPREPLQLHMDR--------AV-SG-LRSLTT-----------LLR--ALGAQKEAT----------------SPP
M3XJ62_LATCH/27-177RDSV.....TVYHITK--------SY-SN-TRSTAQ-----------ILK--RLHTQE..I----------------PVP
G3W289_SARHA/30-190ANSSQTPVALKLFVDK--------AV-SS-LRSLRF-----------LLR--GLGTQEEAI----------------FVP
F6WUU2_MONDO/31-191ANSSQTPAALKLFVDK--------AV-SS-LRSLRF-----------LLR--GLRTQEETV----------------SLP
G3VW20_SARHA/26-175LPAWEAALVLSLCRSG--------WA-GD-M..ISG-----------LGP--VLCPQS...----------------.LP
G1PF99_MYOLU/45-207ANSSQTSETLQLHVDK--------AI-SG-LRSLTS-----------LLR--ALGSQKEAI----------------SLP
TPO_CANLF/25-176GPSCLSSLLGQL..SG--------QV-RL-L..LGA-----------LQG--LLGTQL...----------------.PP
F7G570_MONDO/26-177NPSCLSSLLGQL..SA--------QT-HS-L..LGA-----------LQG--LLGTPS...----------------.LP
H0W023_CAVPO/30-191ANSSQQSETLQLHLDK--------AV-SG-LRSLTS-----------LLH--LLGAQKAPI----------------LPP
H2LEX3_ORYLA/33-182TNTA.....LNNHIDN--------TA-RN-LVSINA-----------VLR--SLNFQE...----------------YTP

PF03487

G1SCQ2_RABIT/16-144LTGSV.Y-CAALESLV--------NV-SG-CNAIQRTQR........MLS--GLCT---------------------D.K
IL13_HUMAN/16-144LTAGM.Y-CAALESLI--------NV-SG-CSAIEKTQR........MLS--GFCP---------------------H.K
IL13_RAT/2-130LTAGG.F-CAALESLT--------NI-SS-CNAIHRTQR........ILN--GLCN---------------------Q.K
F7DGH7_MACMU/16-151LTAGV..-.......V--------RT-FS-LGTSVRTERDSPWKAPGLCG--PFCP---------------------L.A
L5M5Z7_MYODS/2-128LTAGS.Y-CAAFESLM--------NV-SD-CPAIQRTQR........MLS--ALCP---------------------R.Q
G5ASP9_HETGA/2-130LTAGVWY-CAARESLI--------NV-SS-CSALQRTQK........ILS--SLCQ---------------------H.R
B3GDZ5_PIG/2-130LTTSM.Y-CAALESLI--------NI-SD-CSAIQKTQR........MLS--ALCS---------------------H.K
L8YAP6_TUPCH/2-128LTTDV.C-CVALESLT--------NV-SG-CSTLQRTLR........LLN--GLCT---------------------S.K
IL13_BOVIN/2-130LTSSM.Y-CAALDSLI--------SI-SN-CSVIQRTKR........MLN--ALCP---------------------H.K
IL13_MOUSE/2-130LAAGG.F-CVALDSLT--------NI-SN-CNAIYRTQR........ILH--GLCN---------------------R.K
H0W834_CAVPO/16-149LTAGLWY-CAARESLI--------NV-SN-CSALQRTQK........ILS--GLCQ---------------------H.K
F6WQF3_ORNAN/2-128FDWEKAQ-KEAESQRN--------NI-SD-CETIQDILR........IMQ--R..P---------------------QPP
G3T2N9_LOXAF/2-133LTTNV.Y-CAAMEALS--------NV-SD-CRAIEKTKR........NLS--GACE---------------------QYK
M3YGH3_MUSPF/2-126RTTSM.Y-CAALESLT--------SV-SN-CSAIHRTQR........LLK--SLCH---------------------Q.D
B5FW67_OTOGA/2-129LTTDI.Y-CAALESLI--------NV-SS-CSAIQRTQR........ILG--GLCK---------------------Q.K
I3MAR4_ICTTR/2-131LTAGE.Y-CAALDSLI--------KV-SN-CSAIQKTQR........MLS--GLCT---------------------H.K
IL13_CANLF/2-129LTAGM.Y-CAALESLI--------NV-SD-CSAIQRTQR........MLK--ALCS---------------------Q.K

PF00727

IL4_FELCA/26-131THHN....CST.....--------..-..-.....K-----------FLK--GLDR---------------------NLS
H0XDE1_OTOGA/26-149SHHQKEP.CRGATERQ--------QL-YR-HQQVIR-----------FLK--GLDR---------------------NLC
IL4_MOUSE/27-140LKHGKTP.CLK.....--------..-.K-NSSVLM-----------ELQ--RLFR---------------------AFR
G3T4B8_LOXAF/26-132KRHE....CFT.....--------..-..-.....K-----------YLR--GLSR---------------------SLS
IL4_RABIT/28-143LHHKVSW.CFK.....--------.E-HG-ELGDLR-----------LLR--GLDR---------------------NLC
G5ASQ0_HETGA/25-138YLGVGLS.CLN.....--------.R-HR-ESVFLV-----------LLK--KVYR---------------------NLR
F6U5N6_HORSE/26-135KRHDRS..LIK.....--------..-..-.....E-----------CLS--GLDR---------------------NLK
IL4_BOVIN/26-133RSHT....CLN.....--------..-..-.....K-----------FLG--GLDR---------------------NLN
G3QSC0_GORGO/26-149SHHEKDTRCLGATA.Q--------QF-HR-HKQLIR-----------FLK--RLDR---------------------NLW
A3FBF0_MUSPF/26-130THN.....CSN.....--------..-..-.....R-----------LLR--GLHR---------------------NLR
IL4_RAT/27-139FPRDVPP.CLK.....--------..-.N-KSGVLG-----------ELR--KLCR---------------------GVS
G3WEJ0_SARHA/28-149NS......CPR.....--------..-..-.....Q-----------ELK--KMCR---------------------NLM
I3MAS4_ICTTR/24-141QDHPVSR.CLN.....--------.K-NG-KLDILK-----------LLR--GLYR---------------------NLR
IL4_PIG/26-131RHHT....CMK.....--------..-..-.....S-----------LLS--GLDR---------------------NLS

PF00726

IL10_BOVIN/5-174----KVKRVFSEL-------QERGVY------------------------------------------------------
IL10H_EBVB9/7-167----QIKNAFNKL-------QEKGIY------------------------------------------------------
G3HB01_CRIGR/14-174----KVKSDFNKL-------QEKGVY------------------------------------------------------

PF14565

IL22_HUMAN/40-178----KLKDTVKKL-------GESGEI------------------------------------------------------
E1C1U2_CHICK/46-184----EMKSKMKEL-------GENGKN------------------------------------------------------

PF05337

CSF1_HUMAN/41-180ETPLQLLEKVKNV-------FNETKN------------------------------------------------------
Q3TLQ6_MOUSE/41-180ETPLQLLEKIKNF-------FNETKN------------------------------------------------------
O77709_BOVIN/41-180ETPLQLLEKIKNV-------FNETKN------------------------------------------------------
O77710_BOVIN/41-180ETPLQLLEKIKNV-------FNETKN------------------------------------------------------
Q64129_9MURI/41-180ETPLQLLEKIKNF-------FNETKN------------------------------------------------------

PF15036

IL34_MOUSE/28-184EIGPHVEAVLSLL-------STPGLS.....-------------------------------------------------
R4GIU3_CHICK/19-177DVDAVVADLVKQL-------HSGDSR.....-------------------------------------------------
F7EA00_CALJA/29-185EVSPKVESVLSLL-------NAPGPN.....-------------------------------------------------
H0WFN4_OTOGA/28-184EVSPKVEAVLSLL-------NAPGLS.....-------------------------------------------------
M3ZVZ0_XIPMA/24-191ELPETIQDIWDQL-------TEEPDRVPESS-------------------------------------------------
U3JY35_FICAL/18-179DVETVVADVVKLI-------HSAGAE...SR-------------------------------------------------
L9KJY3_TUPCH/28-184EVSPKVEAVLSHL-------NTPGLI.....-------------------------------------------------
G3T3A6_LOXAF/28-182EASPEVEAVLSLL-------SAPG.......-------------------------------------------------
F6W3U1_MONDO/15-167QVHPQVEKILTLA-------NS.GRD.....-------------------------------------------------
I3JZ08_ORENI/24-192DLPEKIHDIWDSL-------TEKPENMPESS-------------------------------------------------
L5MCR9_MYODS/28-182KLSPPVDAVLSLP-------SDRRLS.....-------------------------------------------------
B3DLJ8_DANRE/23-195ERPESLQTIWDHL-------TEQDYK....G-------------------------------------------------
IL34_BOVIN/28-183EVSPQVEAVLNLL-------SAPG.S.....-------------------------------------------------

PF00714

IFNG_HORSE/15-152----.KLEDFQKL-------IQIPVN------------------------------------------------------
H0WPL1_OTOGA/15-151----.KAEAFQNL-------LRISVH------------------------------------------------------
Q8CGS0_CAVPO/15-154----NKVQAFKNL-------IQISVN------------------------------------------------------
B9VS86_CALJA/15-152----.KQDDFERL-------TNYSVN------------------------------------------------------
G3SUC6_LOXAF/15-152----.KRDDFLKV-------MQTPVN------------------------------------------------------
G3GY20_CRIGR/2-135----.KLNDFVRI-------TKIPVN------------------------------------------------------
I3MNV6_ICTTR/15-152----.KREDFLKV-------SQFQVN------------------------------------------------------
L5LME8_MYODS/15-153----.KMEDFKKL-------IQTPVN------------------------------------------------------
G5BGB5_HETGA/15-152----.KLDVFQSL-------TRISVD------------------------------------------------------
G3WQJ9_SARHA/15-153----SSVDDFEAL-------INTQVN------------------------------------------------------
IFNG_SHEEP/15-152----.KLEDFKRL-------IQIPVD------------------------------------------------------
IFNG_RAT/14-151----.KKDAFMSI-------AKFEVN------------------------------------------------------
IFNG_RABIT/15-152----.KMDDFQNL-------TRISVD------------------------------------------------------
L9KVU0_TUPCH/51-188----.KLDVFLNL-------TRISVN------------------------------------------------------
IFNG_FELCA/15-153----.KRDDFLKL-------IQIPVN------------------------------------------------------

PF02404

R4GD07_ANOCA/1-283EEGRFIPEEFFKH-------FSNTVESYKIL.AKTPVQSDCVLPSTTETPPNDSRLSVTKSFLSYPFAASHLKNDSSG..
SCF_CHICK/1-287EEDRFIPENFFRL-------FNSTIEVYKEF.ADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSN
SCF_RAT/1-273ETRNFTPEEFFSI-------FNRSIDAFKDF.MVASDTSDCVLS.STLGPEKDSRVSVTKPFMLPPVAASSLRNDS....
G1NWC8_MYOLU/1-272ELKMLTPEEFFRI-------FNRSINAFKDLEMVSSKTSECVFS.STLSPGNDSRVSVTKPFMLPPVAANSLRNDS....
F7EP53_MONDO/1-273KRDSFNPEDFFRF-------FNKSIDAFKEY.EETSEHSNCVLP.STIGPERDSRVNVTKPFLLPPVAASSLRNDS....
F7C5I3_ORNAN/1-273KKGSFIPKEFFGY-------FNRSIEAFRDF...QAEHSDCIFPTTTLMPEKDSRVSVTKPFLLPPVAASSLKNDS....
F7G0W2_CALJA/1-273EPRLFTPEEFFRI-------FNRSIDAFKDF.VVASETSDCMAS.STLSPEKDSRVSVTKPFMLPSVAANSLRNDS....

PF00143

G5E7E1_LOXAF/9-168RYFQGIH.SYLKE-------KEYSDC------------------------------------------------------
IFNE_MOUSE/27-185AYFRRIH.DYLEN-------QRYSSC------------------------------------------------------
G3I0H8_CRIGR/26-185KYFHRIT.AYLRE-------KNHSPC------------------------------------------------------
H0VF99_CAVPO/28-187SYYWRIS.KYLRA-------KKNSIC------------------------------------------------------
L5KKJ7_PTEAL/25-192RYFHRIS.SFLKD-------KKYSHC------------------------------------------------------
G1U0Q8_RABIT/26-185RYFQRIR.LYLDE-------KKHSGC------------------------------------------------------
F6YZB3_ORNAN/25-183SYFRGIS.LYLRD-------KEYSSC------------------------------------------------------
I3MY95_ICTTR/32-186KCFQRIT.DYLKE-------KEYRPC------------------------------------------------------
V8NNB8_OPHHA/15-183RYFQRLS.DFLKN-------KKYSLC------------------------------------------------------
C8CKA7_PIG/26-185KYFHRLT.LYLQE-------KSYSPC------------------------------------------------------
H0W7G8_CAVPO/26-185KYFHRIA.VYLKE-------KSYSPC------------------------------------------------------
G3GXU9_CRIGR/27-182SYYERMQ.RYLED-------NGHSSC------------------------------------------------------
H0XSG1_OTOGA/26-185SYFQRIT.LYLKE-------KKYSSC------------------------------------------------------
G1KX99_ANOCA/25-184KYFRSLS.DLLKE-------KGYSRC------------------------------------------------------
G3I0I6_CRIGR/27-185SYFRRIH.DYLEN-------QRYSSC------------------------------------------------------
IFNT4_SHEEP/26-185KYFQGIH.DYLQE-------KGYSDC------------------------------------------------------
L8Y4J0_TUPCH/27-186KYFRRIR.NYLEN-------HKYSSC------------------------------------------------------
F7B527_HORSE/26-183RYFRRIS.LYLKE-------KDYSGC------------------------------------------------------
G1Q950_MYOLU/27-184TYYLGIF.QYLKG-------KSYSRC------------------------------------------------------
M3WTR1_FELCA/26-186RYFQDIR.VYLED-------EGYSDC------------------------------------------------------
G5CB66_HETGA/27-185GYYWRIR.RHMKA-------KDNSIC------------------------------------------------------
L9L941_TUPCH/27-198RYFNRIK.NFLKD-------KKYSRC------------------------------------------------------
D2H9N6_AILME/27-184RYYLRIV.RYLKA-------KVYSIC------------------------------------------------------
D3Z919_RAT/26-179EYFGRIT.MYLKQ-------KKHSPC------------------------------------------------------
C8CKB9_PIG/24-176KYFQRIH.RYLKK-------KEYSSC------------------------------------------------------
A8E6F6_XENTR/27-179EEFNLLE.TMVLE-------KDNSAC------------------------------------------------------
L8Y906_TUPCH/26-185GYFQGLH.LYLEK-------KNFSDC------------------------------------------------------
H9L1C3_CHICK/28-183KYFQKID.SFLKE-------KQHNLC------------------------------------------------------
L5KWM8_PTEAL/106-263RYFQGIR.LYLKE-------KRYSDC------------------------------------------------------
G3WZJ8_SARHA/27-182SYFQGIR.AYLQG-------KEYSRC------------------------------------------------------
G3UCD2_LOXAF/26-187KYFQRIT.VYLTE-------KKYSPC------------------------------------------------------
K7GQJ6_PIG/17-164RYFERIH.LFLKE-------KKYSDC------------------------------------------------------
G3I0H3_CRIGR/26-178KYFHRIT.VYLRE-------KNHSPC------------------------------------------------------
H0VYK7_CAVPO/28-181SYYWRIS.RYLTA-------RENSIC------------------------------------------------------
I3N7K4_ICTTR/33-202RYFSRIY.NFLKD-------KTYSRC------------------------------------------------------
L5K635_PTEAL/26-185RYFQGIH.LYLEE-------KQYSDC------------------------------------------------------
H0W3G0_CAVPO/26-185RYFLGIR.LYLED-------KKYSDC------------------------------------------------------
W5JYQ9_ASTMX/23-179AYFQNIT.AVLIE-------KDYQYC------------------------------------------------------
G3SI98_GORGO/28-185RYFHRID.NFLKE-------KKYSDC------------------------------------------------------
H0Y0D2_OTOGA/28-187SYFQRLI.LYLQE-------KKYSLC------------------------------------------------------
IFN_ANAPL/34-190KYFGCIQ.HFLQN-------HTYSPC------------------------------------------------------
G3UJX3_LOXAF/27-185NYYLGIG.QYLEA-------KDYSSC------------------------------------------------------
G5C259_HETGA/26-185KYFHRIT.LYLKE-------KRYSPC------------------------------------------------------
G3WZF5_SARHA/26-185NYYQRIM.NYLEN-------KKYSSC------------------------------------------------------
IFNE_PIG/27-186MYFQRIR.DYLEN-------QDYSSC------------------------------------------------------
W5N6G4_LEPOC/27-185TSFAKLE.KVLRD-------KDYSYC------------------------------------------------------
H9KYA4_CALJA/26-185KYFERIT.LYLTE-------KKHSPC------------------------------------------------------
D2HTQ4_AILME/33-205RYFNRID.NFLKE-------KKYSHC------------------------------------------------------
IFNB_HUMAN/27-185RYYGRIL.HYLKA-------KEYSHC------------------------------------------------------
G1NR05_MELGA/32-188KYFRSIH.NFLQR-------NNYSAC------------------------------------------------------
F7BVP5_ORNAN/23-181SYFKRMM.DYLKG-------RNYSSC------------------------------------------------------
F7G875_MONDO/27-182NYYQGIT.NYLKN-------KEYSSC------------------------------------------------------
C8CKC3_PIG/33-205RYFNRID.KFLKD-------KEHSHC------------------------------------------------------
I3MVD7_ICTTR/34-186KYFHRIT.VYLKE-------KKYLPC------------------------------------------------------
F7A317_HORSE/26-184RYFQRIA.LYLQE-------KKYSPC------------------------------------------------------
G1KU56_ANOCA/28-182KYFERIH.TFLKD-------GEYNEC------------------------------------------------------
L5KBH2_PTEAL/26-185KYFQGIR.LYLKE-------KEYSVC------------------------------------------------------
L5K909_PTEAL/26-185KYFQRIT.LYLQE-------KKHSPC------------------------------------------------------
I3N5Z0_ICTTR/23-179AYFRRIH.NYLES-------QRHSSC------------------------------------------------------
F7GHL9_MONDO/26-181SYFQGIS.RYLQG-------KGYSRC------------------------------------------------------
IFNE_HUMAN/27-186MYFRRIH.DYLEN-------QDYSTC------------------------------------------------------
I3LBU7_PIG/26-179KYFQRIH.RYLKE-------KSYSPC------------------------------------------------------
G3UK87_LOXAF/27-184RYFQEI..LYLKE-------KEHSDC------------------------------------------------------
L9LC61_TUPCH/27-185SYYLRIT.QYLKA-------KEYSSC------------------------------------------------------
IFNB_RAT/27-182SYYWRVQ.RYLKD-------KKYNSY------------------------------------------------------
H0XMZ9_OTOGA/27-186MYFRRIR.EYLEN-------QEYSSC------------------------------------------------------
G3VDC6_SARHA/27-182TYFQGIN.QYLQD-------KEYSRC------------------------------------------------------
I3JM36_ORENI/26-182MYFKRLSDDVLKK-------KGHSAE------------------------------------------------------
L5LKN9_MYODS/27-186MYFRRIR.DYLEN-------QKYSGC------------------------------------------------------
G1TYS8_RABIT/29-195KYFYRMN.NFLED-------KKYSYC------------------------------------------------------
I3UJJ8_FELCA/27-185MYFQRIH.DYLES-------QEYSSC------------------------------------------------------
C8CKA9_PIG/26-183TYFQGIS.LYLKE-------KEYSHC------------------------------------------------------
IFNT2_BOVIN/3-162KYFQGIH.VYLKE-------KEYSDC------------------------------------------------------
H0W510_CAVPO/26-186KYFHRIT.VYLKE-------KSYSPC------------------------------------------------------
M3Z729_MUSPF/26-183NYFQRIS.LYLQE-------KQYSPC------------------------------------------------------
IFNA1_MOUSE/26-185KYFHRIT.VYLRE-------KKHSPC------------------------------------------------------
G3TTC1_LOXAF/26-185EYFEGIR.FYLKE-------KEYSDC------------------------------------------------------
G1PDS6_MYOLU/29-199RYFHRIS.SFLQD-------KQYSHC------------------------------------------------------
F7ABU5_MONDO/27-182SYFQGIS.QYLQG-------KEYSPC------------------------------------------------------
G1TTX4_RABIT/27-180SYYWRIM.DYLET-------KQYSNC------------------------------------------------------
H0XRP5_OTOGA/26-185SYFHRIT.LYLKE-------KKYTPC------------------------------------------------------
H0WK94_OTOGA/33-202RYFNKMH.NFLKE-------KKYSHC------------------------------------------------------
G1KYL3_ANOCA/23-176KYFRSLS.NLLKE-------KEYSRC------------------------------------------------------
G3WZQ8_SARHA/26-181SYFQGIN.QYLQD-------KEYSRC------------------------------------------------------
H2R6R8_PANTR/26-185KYFQRIT.LYLTE-------KKYSPC------------------------------------------------------
H0YTY6_TAEGU/34-188KYFRDIH.LFLHA-------HNHSAC------------------------------------------------------
I3MXH1_ICTTR/27-185SYYVRIR.MYLEA-------KLYSSC------------------------------------------------------
M3WRV1_FELCA/26-184NYFQRLS.LYLQE-------KKYSPC------------------------------------------------------
H0W4H8_CAVPO/23-182KYFHRIA.VYLKE-------KSYSPC------------------------------------------------------
R4GKJ6_CHICK/35-191KHFSCLH.TFLQD-------NDYSAC------------------------------------------------------
A3FBE8_MUSPF/27-184RYYLRIV.RYLKA-------KEFSVC------------------------------------------------------
G1KWE0_ANOCA/28-180RYFRSLN.DFLKE-------KEYSRC------------------------------------------------------
G7PS89_MACFA/26-185KYFRRIT.LYLTE-------KKYSPC------------------------------------------------------
G1Q880_MYOLU/26-185RYFQGIR.LYLKE-------KKYSDC------------------------------------------------------
IFNB_MOUSE/27-180SYYWRVQ.RYLKL-------MKYNSY------------------------------------------------------
IFNB2_BOVIN/27-184KYYFNLV.QYLKS-------KEYNRC------------------------------------------------------
G1SJC4_RABIT/26-185KYFQGIA.VYLAE-------KQYSPC------------------------------------------------------
W5PG31_SHEEP/26-185KYFHRVT.LYLQE-------KGHSPC------------------------------------------------------
IFNA3_CANLF/26-183TYFQRIS.LYLQD-------RNHSPC------------------------------------------------------
G5BPX2_HETGA/27-199GYFQRIE.NYLKD-------KKYSYC------------------------------------------------------
IFNW2_HORSE/26-185RYFRGIH.LYLKE-------KKYSDC------------------------------------------------------
G3N2A8_BOVIN/26-185RYFQGIH.VYLKE-------KEYSDC------------------------------------------------------
H0XKS8_OTOGA/27-185SYYFRIT.WYLKA-------KRYSSC------------------------------------------------------
H0VUV7_CAVPO/26-185KYFHGIT.DYLKE-------KSYSPC------------------------------------------------------
Q29412_PIG/27-184KYYLSIL.QYLKS-------KEYRSC------------------------------------------------------
G7PS88_MACFA/26-185KYFRRIT.LYLTE-------KKYSPC------------------------------------------------------
M3WZS7_FELCA/26-181RYFQGIS.LYLKE-------KEYSHC------------------------------------------------------
H9GZR7_HORSE/26-185RYFRRIR.LYLTE-------KKYSDC------------------------------------------------------
F1LVL8_RAT/26-184AYFRRIH.DYLEN-------HRYSTC------------------------------------------------------
M3YX13_MUSPF/27-179KYFRRIH.NYLEN-------QEYNSC------------------------------------------------------
G1L8G2_AILME/26-185RYFHGIG.LYLEK-------KKYSRC------------------------------------------------------
IFNB_HORSE/27-184KYYGRIS.QYLKA-------KKYSHC------------------------------------------------------
H0W289_CAVPO/26-190KYFQGIS.LYLEE-------KKYSDC------------------------------------------------------
A8E6E8_MONDO/27-182NYFQGIS.QYLQG-------KGYSHC------------------------------------------------------
I3N788_ICTTR/27-185SYYWRIL.RYLKA-------KQYSSC------------------------------------------------------
G1L8I1_AILME/26-183NYFQRIS.LYLQE-------KQYSPC------------------------------------------------------
IFNB_FELCA/27-184KYYLRIV.RYLKA-------KEYSVC------------------------------------------------------
H0VXI5_CAVPO/26-181KYFHRIA.VYLKE-------KSYSPC------------------------------------------------------
G3TS29_LOXAF/26-179SYFQGIG.LYLKE-------KEHSLC------------------------------------------------------
W5PZ39_SHEEP/26-184RYFNRID.RFLKD-------KKHSHC------------------------------------------------------
G3I0H6_CRIGR/26-178NYFDRIT.AYLGE-------KNHSPC------------------------------------------------------
I3L756_PIG/26-180RYFEGIH.LYLKE-------KKYSDC------------------------------------------------------
M3Z715_MUSPF/26-183NYFQRIS.LYLQE-------KQYSPC------------------------------------------------------
M3VXI8_FELCA/33-205RYFYRMY.NFLKD-------KKYSPC------------------------------------------------------
G3R8Q7_GORGO/26-185RYFQGIR.VYLKE-------KKYSDC------------------------------------------------------
A8E6F5_XENTR/51-202DQYQALE.QILQE-------KN.TAC------------------------------------------------------

PF02947

FLT3L_MOUSE/30-162TQLLALK-PCIGK.....ACQNFSRC------------------------------------------------------
F6T7S9_ORNAN/28-157QHLTSLR-PKITS.......LNFSSC------------------------------------------------------
H9GP84_ANOCA/29-165SYLSDLR-KKMEEFEAHDVPANFSNC------------------------------------------------------
F6TPW7_MONDO/34-163SHLEALQ-PLISS.......QDFGPC------------------------------------------------------
G5B8P0_HETGA/20-150AQLEAMK-PWITH.......RNFSQC------------------------------------------------------
G1M637_AILME/29-159KHLAALK-PRITR.......RNFSGC------------------------------------------------------
L9JA37_TUPCH/769-910AQLLALK-PRITR.......RNFSRC------------------------------------------------------
G3VSA3_SARHA/79-209NHLGALR-PLITQ.......QNFQPC------------------------------------------------------
G1QZC3_NOMLE/30-160EQLVALK-PWITR.......QNFSRC------------------------------------------------------

PF06875

Q5BNQ4_9SALA/2-215TITLPKP----LV-------VPFKGS------------------------------------------------------
Q5BNQ2_9SALA/2-215TITLPKP----LV-------VPFEGS------------------------------------------------------

PF01110

CNTF_CHICK/1-194PAEEGSE----PP-------A.PPRL------------------------------------------------------
G3VWZ5_SARHA/1-195PSQETDS----GP-------VGGSHR------------------------------------------------------
E1BFH9_BOVIN/1-193PPREAGG----PP-------LLPGDA------------------------------------------------------
G5AP46_HETGA/1-192PPNETSG----VP-------L..GEG------------------------------------------------------
H0Z9U1_TAEGU/1-188PGEEGDG----PP-------P.PPRL------------------------------------------------------
CNTF_HUMAN/1-194PRNEADG----MP-------INVGDG------------------------------------------------------

PF01291

LIF_MOUSE/44-203DVP....-...PV-------PDHSDK------------------------------------------------------
LIF_BOVIN/43-202DVT....-...YG-------PDTSGK------------------------------------------------------
ONCM_HUMAN/37-209PTKAGRG-ASQPP-------TPTPAS------------------------------------------------------
ONCM_MOUSE/34-194PTQTDSG-...AS-------RSTTTP------------------------------------------------------
ONCM_BOVIN/34-194PTQPGPG-PT.PL-------PPTPPS------------------------------------------------------

PF03039

IL12A_MOUSE/6-215RQK--------PP-------VG..EA------------------------------------------------------
G3VQT1_SARHA/40-247TVT--------PS-------PK..EP------------------------------------------------------
F6T5A8_MONDO/5-202PLI--------SS-------PK..ES------------------------------------------------------
IL12A_PIG/6-222PQK--------PS-------LE..EL------------------------------------------------------
L8YEA2_TUPCH/1-213PRS--------YS-------LE..EP------------------------------------------------------
H0X861_OTOGA/6-217MHP--------SS-------HE..ET------------------------------------------------------
G1QWH2_NOMLE/40-254PQK--------SS-------LE..EP------------------------------------------------------
I3MN91_ICTTR/4-220PQT--------PS-------PEAPSP------------------------------------------------------
Q924V6_CAVPO/6-221PQK--------LS-------LE..EP------------------------------------------------------

PF02024

H3AP27_LATCH/26-169HQTTELE-TLKDL-------AKEHST------------------------------------------------------
G3WWV6_SARHA/23-167DEADGLS-ALGNL-------EGVMEA------------------------------------------------------
F6PLK2_ORNAN/23-167TRSDGLD-TMEIW-------GGIVEE------------------------------------------------------
F7HGW1_CALJA/23-167PWASGLE-NLANL-------GGVLEV------------------------------------------------------
G5BHA4_HETGA/23-167PQTRGPE-LLENL-------GGALKE------------------------------------------------------
W5NER9_LEPOC/28-172LKSSNMS-HLESF-------LKTNAA------------------------------------------------------
H0V7C6_CAVPO/23-165PHTTEPE-.LQDL-------ESTLKE------------------------------------------------------
LEP_HUMAN/23-167PWASGLE-TLDSL-------GGVLEA------------------------------------------------------

PF00489

IL6_BOVIN/27-208NTDLLEK-MQSSN-------EWVKNA------------------------------------------------------
M3X721_FELCA/27-208EVGLQAK-LQSQE-------EWLRHT------------------------------------------------------
IL6_HORSE/27-208KSSLLAK-LHSQN-------EWLKNT------------------------------------------------------
G3UHF3_LOXAF/20-205NASLLSK-LQLQT-------EWLKNT------------------------------------------------------
L5KPK4_PTEAL/20-202NSSLLAK-LQSQS-------EWLQTT------------------------------------------------------
F7HV62_CALJA/27-212NASLLTK-LQAQD-------QWLQGV------------------------------------------------------
IL6_MOUSE/26-210NALLTDK-LESQK-------EWLRTK------------------------------------------------------

PF16647

CSF3_BOVIN/42-190GAMPT-----FTS-------AFQRRA------------------------------------------------------
CSF3_HUMAN/51-202GAMPA-----FAS-------AFQRRA------------------------------------------------------
CSF3_MOUSE/57-205SAMPA-----FTS-------AFQRRA------------------------------------------------------

PF02372

IL15_PIG/33-160-------------------------C------------------------------------------------------
IL15_CAVPO/33-160-------------------------C------------------------------------------------------
IL15_FELCA/33-160-------------------------C------------------------------------------------------
IL15_SHEEP/33-160-------------------------C------------------------------------------------------
F1NZN5_CHICK/55-183-------------------------C------------------------------------------------------
G1NDP6_MELGA/5-137-------------------------C------------------------------------------------------
O73883_CHICK/5-138-------------------------C------------------------------------------------------
Q8JFF4_ANAPL/4-134-------------------------C------------------------------------------------------

PF00715

I3MQX6_ICTTR/7-151-------------------------C------------------------------------------------------
G5C793_HETGA/7-149-------------------------C------------------------------------------------------
G1PJ32_MYOLU/7-147-------------------------C------------------------------------------------------
B1AB81_HORSE/7-146-------------------------C------------------------------------------------------
G3HTL8_CRIGR/7-150-------------------------C------------------------------------------------------
IL2_MACMU/7-151-------------------------C------------------------------------------------------
H0Y254_OTOGA/7-149-------------------------C------------------------------------------------------
IL2_MOUSE/7-165-------------------------C------------------------------------------------------
G3SU90_LOXAF/7-147-------------------------C------------------------------------------------------
IL2_PIG/7-151-------------------------C------------------------------------------------------
IL2_FELCA/7-151-------------------------C------------------------------------------------------
L5K7D9_PTEAL/7-149-------------------------C------------------------------------------------------
IL2_BOVIN/7-152-------------------------C------------------------------------------------------
H0VBY4_CAVPO/7-149-------------------------C------------------------------------------------------

PF00103

PLRP1_BOVIN/26-238VLNTMIQ-ARSSW-------TGLPSL------------------------------------------------------
CSH2_BOVIN/26-238VLKMIHE-VSDTW-------SRFSSM------------------------------------------------------
PLRP3_BOVIN/1-213VIRTIFK-ARIYW-------SGLASL------------------------------------------------------
PR4A1_RAT/17-227.EINEKA-NYTAW-------SELGFL------------------------------------------------------
CSH1_BOVIN/26-236GEKKNEP-YPVWS-------EKSS.L------------------------------------------------------
PLRP4_BOVIN/26-239ARRKMYI-ARIYW-------FGLRSL------------------------------------------------------
PR3D4_RAT/16-223VEENENF-DYPAW-------SGLKDL------------------------------------------------------
PR2C2_MOUSE/16-224.NGDEEK-KNPAW-------FLQS..------------------------------------------------------
SOM2_HUMAN/9-215SPRTGQI-FNQSY-------SKFD..------------------------------------------------------
PR8A5_RAT/17-238PTAEIKE-EFPSW-------DYLSFL------------------------------------------------------
PR6A1_RAT/20-234PGSPQNE-RFPMW-------NELAYL------------------------------------------------------
PR7D1_MOUSE/17-240PAIKENE-DYPTW-------SDLDSL------------------------------------------------------
CSH2_HUMAN/9-215SRRTGQI-LKQTY-------SKFD..------------------------------------------------------

PF01109

CSF2_RAT/18-139TN--------CPP-------TPETDC------------------------------------------------------
CSF2_MOUSE/18-136TY--------CPP-------TPETDC------------------------------------------------------
CSF2_BOVIN/18-138KH--------CPP-------TPETSC------------------------------------------------------
CSF2_CAVPO/18-140QH--------CPP-------TPETSC------------------------------------------------------
CSF2_PIG/18-139QH--------CPL-------TEETSC------------------------------------------------------
CSF2_HUMAN/18-139QH--------CPP-------TPETSC------------------------------------------------------
CSF2_CANLF/18-139QH--------CPP-------TPESPC------------------------------------------------------

PF02025

G1RQD7_NOMLE/22-133GQ--------------------KKKC------------------------------------------------------
IL5_CAVPO/23-134LQ--------------------KQKC------------------------------------------------------
J9NWP5_CANLF/22-132RQ--------------------KKRC------------------------------------------------------
IL5_MOUSE/21-132RQ--------------------KEKC------------------------------------------------------
G3WAR7_SARHA/25-134TK--------------------EKQC------------------------------------------------------
IL5_HORSE/22-133LQ--------------------KKKC------------------------------------------------------
B5FW65_OTOGA/22-133RQ--------------------KKRC------------------------------------------------------
I3MDT8_ICTTR/23-134IQ--------------------KKKC------------------------------------------------------
G3T4B0_LOXAF/23-133LQ--------------------KKKC------------------------------------------------------
G1SL79_RABIT/22-133LQ--------------------KKKC------------------------------------------------------

PF02059

IL3_CANLF/19-132TP--------T..-------PRGEPI------------------------------------------------------
IL3_MOUSE/27-138TS--------A..-------NDSALP------------------------------------------------------
IL3_BOVIN/18-132TA--------T..-------PTEDPI------------------------------------------------------
G3UC30_LOXAF/22-133KA--------K..-------PQTASI------------------------------------------------------
G1MH15_AILME/18-131TP--------T..-------PRGQPI------------------------------------------------------
F1RJV6_PIG/18-131TS--------M..-------STEEPI------------------------------------------------------
G1RQ11_NOMLE/20-137MA--------TAA-------PTRHPI------------------------------------------------------
IL3_CALJA/19-136TA--------TNA-------ATQHPI------------------------------------------------------
F1LS41_RAT/29-138AA--------A..-------SDSVLP------------------------------------------------------

PF07400

IL11_HUMAN/22-199QP--------PPD-------PPAPPL------------------------------------------------------

PF00758

G3TYQ1_LOXAF/25-173QG.....-..RTT-------AHKDPN------------------------------------------------------
W5K758_ASTMX/26-175TV.SGID-LQETW-------QVSSAP------------------------------------------------------
B1N8Y2_DANRE/15-168PT.SSGE-DKETQ-------KISSIS------------------------------------------------------
F7DTH0_CALJA/31-193DAAPSAV-PLQTI-------TADTFS------------------------------------------------------
M3XJ62_LATCH/27-177DS....P-PQKTV-------VVRTLG------------------------------------------------------
G3W289_SARHA/30-190NA.PTAV-PLRTF-------TVGTMD------------------------------------------------------
F6WUU2_MONDO/31-191DA.PTAA-PFRTF-------TVGTMD------------------------------------------------------
G3VW20_SARHA/26-175KG.....-..QTA-------AHREPT------------------------------------------------------
G1PF99_MYOLU/45-207DATASAI-PLRTF-------TVDTLC------------------------------------------------------
TPO_CANLF/25-176QG.....-..RTT-------THKDPN------------------------------------------------------
F7G570_MONDO/26-177KG.....-..QTI-------AHREPT------------------------------------------------------
H0W023_CAVPO/30-191DA.ASPA-PLRTF-------PVDTLC------------------------------------------------------
H2LEX3_ORYLA/33-182PA.NASS-LDGTW-------TVSSAT------------------------------------------------------

PF03487

G1SCQ2_RABIT/16-144AVA....-...KQ-------VTSVQA------------------------------------------------------
IL13_HUMAN/16-144VSA....-...GQ-------FSSLHV------------------------------------------------------
IL13_RAT/2-130ASD....-....V-------ASSPP.------------------------------------------------------
F7DGH7_MACMU/16-151SHSRAGL-FVLQQ-------FSSLRV------------------------------------------------------
L5M5Z7_MYODS/2-128PSA....-...GP-------ASSPPV------------------------------------------------------
G5ASP9_HETGA/2-130AVA....-....K-------VSSFHN------------------------------------------------------
B3GDZ5_PIG/2-130PPS....-...EQ-------VPGKHI------------------------------------------------------
L8YAP6_TUPCH/2-128SSA....-...EQ-------VSSLPT------------------------------------------------------
IL13_BOVIN/2-130PSA....-...KQ-------VSSEYV------------------------------------------------------
IL13_MOUSE/2-130APT....-....T-------VSSLP.------------------------------------------------------
H0W834_CAVPO/16-149ASA....-...GQ-------VSSLRS------------------------------------------------------
F6WQF3_ORNAN/2-128PLS....-...LQ-------VHCEVN------------------------------------------------------
G3T2N9_LOXAF/2-133APA....-...SQ-------VSSLQV------------------------------------------------------
M3YGH3_MUSPF/2-126TSA....-...GQ-------ISS...------------------------------------------------------
B5FW67_OTOGA/2-129DLP....-...G.-------VPSSHI------------------------------------------------------
I3MAR4_ICTTR/2-131NTA....-...KQ-------ASTVPI------------------------------------------------------
IL13_CANLF/2-129PAA....-...GQ-------ISSERS------------------------------------------------------

PF00727

IL4_FELCA/26-131SMA--------NR-------.TCSVN------------------------------------------------------
H0XDE1_OTOGA/26-149SLA--------NS-------RYCPVN------------------------------------------------------
IL4_MOUSE/27-140CLD--------SS-------ISCTMN------------------------------------------------------
G3T4B8_LOXAF/26-132SMT--------NL-------DYCPVN------------------------------------------------------
IL4_RABIT/28-143SMA--------KL-------SNCPGK------------------------------------------------------
G5ASQ0_HETGA/25-138SMV--------QP-------.NCSVS------------------------------------------------------
F6U5N6_HORSE/26-135GMA--------NG-------TCCTVN------------------------------------------------------
IL4_BOVIN/26-133SLA--------SK-------.TCSVN------------------------------------------------------
G3QSC0_GORGO/26-149GLA--------GL-------NSCPVK------------------------------------------------------
A3FBF0_MUSPF/26-130NMA--------NM-------.TCSVN------------------------------------------------------
IL4_RAT/27-139GLN--------SL-------RSCTVN------------------------------------------------------
G3WEJ0_SARHA/28-149HLV--------NQ-------TKCPVN------------------------------------------------------
I3MAS4_ICTTR/24-141SMA--------QL-------HNSPAS------------------------------------------------------
IL4_PIG/26-131SMA--------NM-------.TCSVH------------------------------------------------------

PF00726

IL10_BOVIN/5-174-------------------KAMSEFDIFINYIETY--------MTT----------------------------------
IL10H_EBVB9/7-167-------------------KAMSEFDIFINYIEAY--------MTI----------------------------------
G3HB01_CRIGR/14-174-------------------KAMNEFDIFINCIETY--------MTI----------------------------------

PF14565

IL22_HUMAN/40-178-------------------KAIGELDLLFMSLRNA--------C------------------------------------
E1C1U2_CHICK/46-184-------------------KAIGELDLLFDYIENA--------C------------------------------------

PF05337

CSF1_HUMAN/41-180-------------------LLDKDWNIFSKNCNNS----F-AECSS----------------------------------
Q3TLQ6_MOUSE/41-180-------------------LLEKDWNIFTKNCNNS----F-AKCSS----------------------------------
O77709_BOVIN/41-180-------------------LLKKDWNIFSKNCNNS----F-AKCSS----------------------------------
O77710_BOVIN/41-180-------------------LLKKDWNIFSKNCNNS----F-AKCSS----------------------------------
Q64129_9MURI/41-180-------------------LLEKDWNIFTKNCNNS----F-AKCSS----------------------------------

PF15036

IL34_MOUSE/28-184---------------LKLVRPKALLDNCFRVMELL----Y-CSCCKQSP-------------------------------
R4GIU3_CHICK/19-177---------------QKAVRPKALLDNCLKVLRML----F-GAHCRWDS-------------------------------
F7EA00_CALJA/29-185---------------LKLVRPKALLDNCFRVMELL----Y-CSCCKQSS-------------------------------
H0WFN4_OTOGA/28-184---------------RKLVRPKALLDNCFRVMELL----Y-CSCCKQSS-------------------------------
M3ZVZ0_XIPMA/24-191---------------WRFASPKSLVDNLCHTMCCL----F-WECFS..S-------------------------------
U3JY35_FICAL/18-179---------------SKAVRPKALLDNCLKVMRML----Y-GVPCRWES-------------------------------
L9KJY3_TUPCH/28-184---------------LKLVRPKALLDNCFRVMELL----Y-CPCCKHNS-------------------------------
G3T3A6_LOXAF/28-182---------------LKLVRPKALLDNCFRVMDLL----Y-CSCCKQSS-------------------------------
F6W3U1_MONDO/15-167---------------QKLVRPKALLDNCYKVMDLL----Y-CLCCKESN-------------------------------
I3JZ08_ORENI/24-192---------------WRFATPKSLLDNLCRTMYCL----F-SECFSNAD-------------------------------
L5MCR9_MYODS/28-182---------------LKLVRPKALLDNCFRVMELL----H-CSCCKE..-------------------------------
B3DLJ8_DANRE/23-195---------------WKSVTPKSILDNCYRTMLCL----F-KECFTKED-------------------------------
IL34_BOVIN/28-183---------------LKLVRPKALLDNCFRVMQLL----Y-CPCCKESS-------------------------------

PF00714

IFNG_HORSE/15-152----------------DLKVQRKAISELIKVMNDL----S.PKANLRKR-------------------------------
H0WPL1_OTOGA/15-151----------------DLQVQRKAISELYEVIVSL----V.PGTPLRKR-------------------------------
Q8CGS0_CAVPO/15-154----------------DEHVQRQAIIELKKVIDDL----S.PNQRKRRR-------------------------------
B9VS86_CALJA/15-152----------------DLNVQRKAIHELIQVMAEL----S.PAPKIGKR-------------------------------
G3SUC6_LOXAF/15-152----------------DRNIQRKAISELAKVMNDL----S.HRSTGSKR-------------------------------
G3GY20_CRIGR/2-135----------------DVQVQRKAVNELISVMPLL----S.PKLSLRKR-------------------------------
I3MNV6_ICTTR/15-152----------------DLKIQRKAVRELKKVMNDL----L.PHSTLRKR-------------------------------
L5LME8_MYODS/15-153----------------DQRVQRKAISELYNVITEL----SKSNSKMRKR-------------------------------
G5BGB5_HETGA/15-152----------------NVDFQRRAIIELKKVMDDL----S.PNQRKRRR-------------------------------
G3WQJ9_SARHA/15-153----------------DLKVQRKAMFELVYVFRNL----S.PKPHLTG.-------------------------------
IFNG_SHEEP/15-152----------------DLQIQRKAINELIKVMNDL----S.PKSNLRKR-------------------------------
IFNG_RAT/14-151----------------NPQIQHKAVNELIRVIHQL----S.PESSLRKR-------------------------------
IFNG_RABIT/15-152----------------DRLVQRKAVSELSNVLNFL----S.PKSNLKKR-------------------------------
L9KVU0_TUPCH/51-188----------------DVQVQRKAIYELLNVMIDL----T.PKSNQKKR-------------------------------
IFNG_FELCA/15-153----------------DLQVQRKAINELFKVMNDL----S.PRSNLRKR-------------------------------

PF02404

R4GD07_ANOCA/1-283..NHNNEAALGFLGSPGMQGLSIALTSLVTLFIGF----ILGAVCWKKTARKHILESNPTTQANICQEDNEISMLQQKDK
SCF_CHICK/1-287TSSNSNKEALGFISSSSLQGISIALTSLLSLLIGF----ILGAIYWKKTHPKSRPESNETIQCHGCQEENEISMLQQKEK
SCF_RAT/1-273..SSSNRKAAKSPEDPGLQWTAMALPALISLVIGF----AFGALYWKKKQSSLTRAV.ENIQIN..EEDNEISMLQQKER
G1NWC8_MYOLU/1-272..SSSNRKALNSIGDSKLQWAAMTLPAFFSLLVGF----GFGALYWKKKQPNLTRAV.ENIQIN..EEDNEISMLQEKER
F7EP53_MONDO/1-273..SSSNRKAAGSTKDPSVQWVAIVLPSLFSLVLGF----VLGALYWKKKQMNLKMEV.ENIETS..EEDNEISMLQENDG
F7C5I3_ORNAN/1-273..TSSNREAFGYISSSSLQWISIAVPSIFSLVIGF----ILGAIYWKKKHPKHSVEV.ENIQGN..EEDNEISMLQERER
F7G0W2_CALJA/1-273..SSSNRKAKNPPGDSGLHWAAMALPALFSLIIGF----AFGALYWKKRQPSLTRTV.ENIQIN..EEDNEISMLQEKER

PF00143

G5E7E1_LOXAF/9-168----------------AWEIVRVEIKRSFSSSTNL....QE.RL------------------------------------
IFNE_MOUSE/27-185----------------AWIIVQTEIHRCMFFVFRF....TT.WL------------------------------------
G3I0H8_CRIGR/26-185----------------AWEVVRAEVWRALSSSANL....LA.RL------------------------------------
H0VF99_CAVPO/28-187----------------AWTVVQAELIRNFSIINRL....TN.YF------------------------------------
L5KKJ7_PTEAL/25-192----------------AWEIVRVEIRRCFCYF.......TA.LL------------------------------------
G1U0Q8_RABIT/26-185----------------AWELVRMEIRRAFSSTADL....QE.SL------------------------------------
F6YZB3_ORNAN/25-183----------------AWEIVRAEIRRSFEYSVVL....SP.GL------------------------------------
I3MY95_ICTTR/32-186----------------AWEVVRTEVVKFVSSSPKL....YE.RL------------------------------------
V8NNB8_OPHHA/15-183----------------AWEIVQIQIEACFQLINHY....IQ.RI------------------------------------
C8CKA7_PIG/26-185----------------AWEIIRAEVMRAFSSSTNL....QD.RL------------------------------------
H0W7G8_CAVPO/26-185----------------AWEVVRAEIVRCFSSSEEL....LR.KM------------------------------------
G3GXU9_CRIGR/27-182----------------AWMVTQAEVLRNFMFIKRL....TR.IF------------------------------------
H0XSG1_OTOGA/26-185----------------AWEVVRAEIMRAFSSSTRL....QE.RL------------------------------------
G1KX99_ANOCA/25-184----------------AWEIVHIQVKYHLSASSVL....GW.KL------------------------------------
G3I0I6_CRIGR/27-185----------------AWIVVQVEINRCMFFVFRL....TA.WL------------------------------------
IFNT4_SHEEP/26-185----------------AWEIVRVEMMRALTVSTTL....QK.RL------------------------------------
L8Y4J0_TUPCH/27-186----------------AWTIVQVEIKRCLFLVLRL....IG.KL------------------------------------
F7B527_HORSE/26-183----------------AWEVVRVEIRRCLLFMNKL....TG.KL------------------------------------
G1Q950_MYOLU/27-184----------------AWTVVQAEILRNFSFLNRL....IG.AL------------------------------------
M3WTR1_FELCA/26-186----------------AWEIVRLEIMRALSSSATL....QD.SL------------------------------------
G5CB66_HETGA/27-185----------------AWTVVQVELSRNFSFINRL....TD.YF------------------------------------
L9L941_TUPCH/27-198----------------AWEIIRMEIRRCFHYFQKF....TE.LL------------------------------------
D2H9N6_AILME/27-184----------------AWKIVRAEMLRSFFFLDKF....TN.YL------------------------------------
D3Z919_RAT/26-179----------------AWEVVRVEVGRALIYSDMF....LA.KL------------------------------------
C8CKB9_PIG/24-176----------------AWEVVRVETEVCLSLMQQL....ST.KS------------------------------------
A8E6F6_XENTR/27-179----------------VWDFIHLETRRNLQQVLQL....SS.RL------------------------------------
L8Y906_TUPCH/26-185----------------AWEVVRVEIRKCFLFINKL....IR.KL------------------------------------
H9L1C3_CHICK/28-183----------------SWEISRAEMRRCLQLIDKV....IR.KL------------------------------------
L5KWM8_PTEAL/106-263----------------AWEVVRVEIKEILLFINKL....TK.KV------------------------------------
G3WZJ8_SARHA/27-182----------------AWEIVRVEIRRIFLFMSKL....TK.KL------------------------------------
G3UCD2_LOXAF/26-187----------------AWEIVRAEIMRSFSASTNW....QE.RL------------------------------------
K7GQJ6_PIG/17-164----------------VWEIVRVEIMKPLSSLNSF....AR.KV------------------------------------
G3I0H3_CRIGR/26-178----------------AWEVVRAEVWRALSSSVNL....LA.RL------------------------------------
H0VYK7_CAVPO/28-181----------------AWTVVQAELISKFPIINSL....TD.YF------------------------------------
I3N7K4_ICTTR/33-202----------------AWEIVRVEITRYFLYLKKF....IT.LH------------------------------------
L5K635_PTEAL/26-185----------------AWEVVRVEIRRYLFVVNKF....TR.KE------------------------------------
H0W3G0_CAVPO/26-185----------------AWEIVRVEIMRAFSLSAKL....QE.KI------------------------------------
W5JYQ9_ASTMX/23-179----------------AWEFARFEILHALQFI.......LI.NL------------------------------------
G3SI98_GORGO/28-185----------------AWEIVRVEIRRCLYYFYKF....TA.LF------------------------------------
H0Y0D2_OTOGA/28-187----------------AWEIVRTEIMRSYSYSKHL....QN.TL------------------------------------
IFN_ANAPL/34-190----------------AWDHVRLEAHACFQRIHRL....TR.TM------------------------------------
G3UJX3_LOXAF/27-185----------------AWTVVQVEILRNFSFISGL....TD.YL------------------------------------
G5C259_HETGA/26-185----------------AWEVVRAEIMRSFSSSEKL....AR.KV------------------------------------
G3WZF5_SARHA/26-185----------------SWKIVQVETRLNFIFLYKL....TE.RL------------------------------------
IFNE_PIG/27-186----------------AWTIVRVEINRCLFFVFQL....TG.KL------------------------------------
W5N6G4_LEPOC/27-185----------------AWESVRRDLRRALEQFQEF....LE.SN------------------------------------
H9KYA4_CALJA/26-185----------------AWEVVRAEIMRSFSLLTSL....QE.RL------------------------------------
D2HTQ4_AILME/33-205----------------AWEIIRVEIRRCFYYFQKF....AA.LL------------------------------------
IFNB_HUMAN/27-185----------------AWTIVRVEILRNFYFINRL....TG.YL------------------------------------
G1NR05_MELGA/32-188----------------SWDHVRLHARTCFQNVDTL....IQ.QM------------------------------------
F7BVP5_ORNAN/23-181----------------AWEVIRMKTKRCFLVIYRL....TR.KL------------------------------------
F7G875_MONDO/27-182----------------ACKIVQVETRRNFSFLYKL....TE.YL------------------------------------
C8CKC3_PIG/33-205----------------AWEIVRVEIRRCFYFFQKF....TA.LL------------------------------------
I3MVD7_ICTTR/34-186----------------AWEVVRAEIMKSFSSSANL....YA.RL------------------------------------
F7A317_HORSE/26-184----------------AWEIVRAEIMRCFSSSTNL....QQ.S.------------------------------------
G1KU56_ANOCA/28-182----------------AWEVAQIEVSRFFMVMEQL....IR.TL------------------------------------
L5KBH2_PTEAL/26-185----------------AWEVVRVEIRKAFSLSTNL....LD.RL------------------------------------
L5K909_PTEAL/26-185----------------AWEIVRAEIMRSYSLSTHL....KE.KS------------------------------------
I3N5Z0_ICTTR/23-179----------------AWTIVHAEINRCLVFVFRL....IR...------------------------------------
F7GHL9_MONDO/26-181----------------AWEFTRIEIRRCILFMSNL....TR.KF------------------------------------
IFNE_HUMAN/27-186----------------AWAIVQVEISRCLFFVFSL....TE.KL------------------------------------
I3LBU7_PIG/26-179----------------AWEIVRAEVMRAFSSSTNL....QD.RL------------------------------------
G3UK87_LOXAF/27-184----------------VWEVIRVEISKLIYVSTNLGSSGQK.RL------------------------------------
L9LC61_TUPCH/27-185----------------AWTIVRVEILRNFLFINRL....ID.YL------------------------------------
IFNB_RAT/27-182----------------AWMVVRAEVFRNFSIILRL....NR.NF------------------------------------
H0XMZ9_OTOGA/27-186----------------ARTIVQVEINRCLLFVFRL....TE.KL------------------------------------
G3VDC6_SARHA/27-182----------------AWEMVRIEIRRIFLFMDKP....IR.KL------------------------------------
I3JM36_ORENI/26-182----------------AWEVIRKETKAHLMRAEQL....AS.SL------------------------------------
L5LKN9_MYODS/27-186----------------AWTVVQVEVNRCLFFVLPL....TG.KL------------------------------------
G1TYS8_RABIT/29-195----------------AREIVRVEITRCFSYFYRF....TA.FL------------------------------------
I3UJJ8_FELCA/27-185----------------AWTIVRVEINRCLFFALQL....IR.KI------------------------------------
C8CKA9_PIG/26-183----------------AWEVVRVETRKCLLFINNL....VG.KL------------------------------------
IFNT2_BOVIN/3-162----------------AWEIIRMEMMRALSSSTTL....QK.RL------------------------------------
H0W510_CAVPO/26-186----------------AWEVVRAEIRRSFSFSATL....KTPKI------------------------------------
M3Z729_MUSPF/26-183----------------AWEMVRAEIMKPLYASTAL....HK.RL------------------------------------
IFNA1_MOUSE/26-185----------------AWEVVRAEVWRALSSSANV....LG.RL------------------------------------
G3TTC1_LOXAF/26-185----------------AWEFVRVEIRRSFSSSTAL....QE.RL------------------------------------
G1PDS6_MYOLU/29-199----------------AWKIVQVEIRRCFYYFQTL....IE.LL------------------------------------
F7ABU5_MONDO/27-182----------------AWEIVRVEIRRLFLFMSKL....AR.KL------------------------------------
G1TTX4_RABIT/27-180----------------AWKIVQLEIFRNFSFIIML....ID.YL------------------------------------
H0XRP5_OTOGA/26-185----------------AWEVVKAEILRSFSSTTSL....QE.RL------------------------------------
H0WK94_OTOGA/33-202----------------AWDIVQVEIRRCIYYFYQF....TA.LL------------------------------------
G1KYL3_ANOCA/23-176----------------AWEIIQIQVKQCFLWIEKI....IQ.EI------------------------------------
G3WZQ8_SARHA/26-181----------------AWEIVRIEIRKMFLFMNKF....TR.NL------------------------------------
H2R6R8_PANTR/26-185----------------AWEVVRAEIMRSLSFSTNL....QK.RL------------------------------------
H0YTY6_TAEGU/34-188----------------AWDHVRLEARASLRHLHNL....TR.AR------------------------------------
I3MXH1_ICTTR/27-185----------------AWTVVRDELYWNFSFINRL....TD.KF------------------------------------
M3WRV1_FELCA/26-184----------------AWEIVRAEIMRSLYSSTAL....QK.RL------------------------------------
H0W4H8_CAVPO/23-182----------------AWEVVRAQIVRSLSASEKL....AR.KM------------------------------------
R4GKJ6_CHICK/35-191----------------AWEHVRLQARAWFLHIHNL....TG.NT------------------------------------
A3FBE8_MUSPF/27-184----------------AWTIVQAEILRSFFFLDKL....TD.SL------------------------------------
G1KWE0_ANOCA/28-180----------------AWEIVQIQVKQCFLWIEKL.........------------------------------------
G7PS89_MACFA/26-185----------------AWEVVRAEIMRSFSLSINL....QK.RL------------------------------------
G1Q880_MYOLU/26-185----------------AWEVVRVEIMRSFSSTRAL....QE.RL------------------------------------
IFNB_MOUSE/27-180----------------AWMVVRAEIFRNFLIIRRL....TR.NF------------------------------------
IFNB2_BOVIN/27-184----------------AWTVVRVQILRNFSFLTRL....TG.YL------------------------------------
G1SJC4_RABIT/26-185----------------AWEVVRAEARRAVSLSRIL....QE.RI------------------------------------
W5PG31_SHEEP/26-185----------------AWEVVRAEVMRAFSSSTNL....QE.RF------------------------------------
IFNA3_CANLF/26-183----------------AWEMVRAEIGRSFFSLTIL....QE.RV------------------------------------
G5BPX2_HETGA/27-199----------------AWKIVQVEIKRCFFYFLKF....IK.LP------------------------------------
IFNW2_HORSE/26-185----------------AWEIVRMEIMRSFSSSANL....QG.RL------------------------------------
G3N2A8_BOVIN/26-185----------------AWEIVRLEIMRALSSSTSL....QE.RL------------------------------------
H0XKS8_OTOGA/27-185----------------AWTVVREEILRNLFFINRL....TG.YL------------------------------------
H0VUV7_CAVPO/26-185----------------AWEVVRAEFFRSFSSSEEL....LR.KM------------------------------------
Q29412_PIG/27-184----------------AWTVVQVEILRNFSFLNRL....TD.YL------------------------------------
G7PS88_MACFA/26-185----------------AWEVVRAEIMRSFSLSTNL....QE.RL------------------------------------
M3WZS7_FELCA/26-181----------------AWEVVRVEIRRCLLVINKL....TG.TF------------------------------------
H9GZR7_HORSE/26-185----------------AWEIVRVDIMRSFSSSANL....QG.RL------------------------------------
F1LVL8_RAT/26-184----------------AWIIVQIEVNRCMFFVSRL....AR.RL------------------------------------
M3YX13_MUSPF/27-179----------------AWR....EINRCLFFAFQL....VR.KL------------------------------------
G1L8G2_AILME/26-185----------------AWEVVRVEIRRCLFFVNEL....AG.KL------------------------------------
IFNB_HORSE/27-184----------------AWTVVQAEMLRNLAFLNGL....TD.YL------------------------------------
H0W289_CAVPO/26-190----------------AWEIVRVEIRRVVSFSLRL....QQ.RL------------------------------------
A8E6E8_MONDO/27-182----------------AWEVTRVEIRRCFLFLSKL....SR.KF------------------------------------
I3N788_ICTTR/27-185----------------AWTVIRMELFQNFSFINRL....MD.HF------------------------------------
G1L8I1_AILME/26-183----------------AWETVRAEITKPLFSSTIL....QE.GL------------------------------------
IFNB_FELCA/27-184----------------AWTVVHAEILRNFFFLERL....TD.YL------------------------------------
H0VXI5_CAVPO/26-181----------------AWEVVRAEIVRCFSSSETM....QK.NI------------------------------------
G3TS29_LOXAF/26-179----------------.WEVVRVEIRKCFLFINML....TV.QI------------------------------------
W5PZ39_SHEEP/26-184----------------AWEIVRVEIRRCFYFFQKL....TA.LL------------------------------------
G3I0H6_CRIGR/26-178----------------AWEVVRAEVWRAMSASANL....LA.TL------------------------------------
I3L756_PIG/26-180----------------AWETVRVEIVRALSSTTNL....QE.RL------------------------------------
M3Z715_MUSPF/26-183----------------AWEIVRAEIMKPLYASMIL....QE.RL------------------------------------
M3VXI8_FELCA/33-205----------------AWEIIRVELRRCFYYFYKL....TL.LL------------------------------------
G3R8Q7_GORGO/26-185----------------AWEVVRMEIMKSLFLSTNM....QE.RL------------------------------------
A8E6F5_XENTR/51-202----------------TRDIIQSEIRGNLQLVGQL....AS.RA------------------------------------

PF02947

FLT3L_MOUSE/30-162----------------------LEVQ-------------CQ---------------------------------------
F6T7S9_ORNAN/28-157----------------------LELR-------------C.---------------------------------------
H9GP84_ANOCA/29-165----------------------TVIH-------------CQ---------------------------------------
F6TPW7_MONDO/34-163----------------------RRLR-------------CQ---------------------------------------
G5B8P0_HETGA/20-150----------------------LELR-------------CQ---------------------------------------
G1M637_AILME/29-159----------------------LELR-------------CQ---------------------------------------
L9JA37_TUPCH/769-910----------------------LELR-------------CQ---------------------------------------
G3VSA3_SARHA/79-209----------------------QQYR-------------CQ---------------------------------------
G1QZC3_NOMLE/30-160----------------------LELQ-------------CQ---------------------------------------

PF06875

Q5BNQ4_9SALA/2-215----------------AYFSKKLRGGVVCKEYKER----VF-LTKRDFMLLAEKYQGPL---------------------
Q5BNQ2_9SALA/2-215----------------AYFRKKLRGGVVCKEYKER----VL-LTKRDFEFLAKKYQGHL---------------------

PF01110

CNTF_CHICK/1-194----------------SLFEQKLRGLRVLRELAQW----AV-RSVRDLRQLSKHGPGSGAALGLPES-------------
G3VWZ5_SARHA/1-195----------------TFLEKKLWGLKVLQELMQW----TV-RSIHDLRLISSPGQNRVPARGGQQL-------------
E1BFH9_BOVIN/1-193----------------GLFEKKLWGLKVLQELSRW----TV-RSVHDLRTISR..QSGVPACGSRCA-------------
G5AP46_HETGA/1-192----------------GLFEKKLWGLKVLQELSQW----TV-RSIRDLRLISSQ.PAGIPADESRYF-------------
H0Z9U1_TAEGU/1-188----------------SLFEQKLRGLGVLRELAQW----AV-RSVRDLRQLGKPSSAAGTA......-------------
CNTF_HUMAN/1-194----------------GLFEKKLWGLKVLQELSQW----TV-RSIHDLRFISSH.QTGIPARGSHYI-------------

PF01291

LIF_MOUSE/44-203----------------EAFQRKKLGCQLLGTYKQV----IS-VVVQAF--------------------------------
LIF_BOVIN/43-202----------------DVFQKKKLGCQLLGKYKQV----IA-VLAQAF--------------------------------
ONCM_HUMAN/37-209----------------DAFQRKLEGCRFLHGYHRF----MH-SVGRVF--------------------------------
ONCM_MOUSE/34-194----------------DVFNTKIGSCGFLWGYHRF----MG-SVGRVF--------------------------------
ONCM_BOVIN/34-194----------------STFQRKLRNCGFLRGYHRF----MR-TAGQVL--------------------------------

PF03039

IL12A_MOUSE/6-215----------------DPYRVKMKLCILLHAFSTR----VV-TINRVMGYLSSA--------------------------
G3VQT1_SARHA/40-247----------------DFYKAKVKLCLLLHAFRIR----VV-TIDRMRNYL...--------------------------
F6T5A8_MONDO/5-202----------------DFYKTKVKLCVLLHAFQTR----TV-TIDRMMNYL..A--------------------------
IL12A_PIG/6-222----------------DFYKTKIKLCILLHAFRIR----AV-TIDRMMSYLNSS--------------------------
L8YEA2_TUPCH/1-213----------------DFYKTKIKLCILLHAFRVR----AV-TIDRVMSYLNTS--------------------------
H0X861_OTOGA/6-217----------------NFYKTKVKLFVLLHAFRIR----AV-TIDRVMSYLNSS--------------------------
G1QWH2_NOMLE/40-254----------------DFYKTKIKLCILLHAFRIR----AV-TIDRVMSYLNAS--------------------------
I3MN91_ICTTR/4-220----------------NLYRTKTKLCILLHALRIR----AV-TIDRVMSYLNSS--------------------------
Q924V6_CAVPO/6-221----------------DFYKIKMKLCILLHAFRIR----AV-TIDRVMSYLTSS--------------------------

PF02024

H3AP27_LATCH/26-169----------------SPYTTEK---VALDRLQKC----LL-TMVKELEQIKDC--------------------------
G3WWV6_SARHA/23-167----------------SLYSTEV---VTLSRLQKS----LY-GMLQQLDLIHGC--------------------------
F6PLK2_ORNAN/23-167----------------SLYSTEV---VTLDRLRKS----LK-NIEKQLDHIQGC--------------------------
F7HGW1_CALJA/23-167----------------SLYSTEV---VALSRLRGT----LK-DILQQLDLGPAC--------------------------
G5BHA4_HETGA/23-167----------------SIYSTEV---VALSRLQRF----LQ-EMLLQLDHNTMC--------------------------
W5NER9_LEPOC/28-172----------------FHVTIGN---VALERLQKY----LL-KLIRNLDQLKNC--------------------------
H0V7C6_CAVPO/23-165----------------SRYSIEV---VVLRRMKRF----LL-EMLRQLELGIVC--------------------------
LEP_HUMAN/23-167----------------SGYSTEV---VALSRLQGS----LQ-DMLWQLDLSPGC--------------------------

PF00489

IL6_BOVIN/27-208----------------KIILILRNLENFLQFSLRA----IR-MK------------------------------------
M3X721_FELCA/27-208----------------TIHLTLRRLEDFLQFSLRA----VR-IM------------------------------------
IL6_HORSE/27-208----------------TTHLILRSLEDFLQFSLRA----VR-IM------------------------------------
G3UHF3_LOXAF/20-205----------------TINLILRSLDDFMQFSLRA----VR-IM------------------------------------
L5KPK4_PTEAL/20-202----------------TIHLILRSLEDFLQFTQRA----VR-IM------------------------------------
F7HV62_CALJA/27-212----------------TTHLILRSFKDFLQNSLRA----LR-QM------------------------------------
IL6_MOUSE/26-210----------------TIQFILKSLEEFLKVTLRS----TR-Q.------------------------------------

PF16647

CSF3_BOVIN/42-190----------------GGVLVASQLHRFLELAYRG----LR---------------------------------------
CSF3_HUMAN/51-202----------------GGVLVASHLQSFLEVSYRV----LR---------------------------------------
CSF3_MOUSE/57-205----------------GGVLAISYLQGFLETARLA----LH---------------------------------------

PF02372

IL15_PIG/33-160----------------E-ELEEKNINEFLKSFIHI--------------------VQMFIN-------------------
IL15_CAVPO/33-160----------------E-ELEEKSIAEFLQSFVHI--------------------VQMFIN-------------------
IL15_FELCA/33-160----------------E-ELEEKNIKEFLQSFVHI--------------------VQMFIN-------------------
IL15_SHEEP/33-160----------------E-ELEKKSIKEFLKSFVHI--------------------VQMFIN-------------------
F1NZN5_CHICK/55-183----------------E-EYEEKNFTEFIQSFVKV--------------------IQRECK-------------------
G1NDP6_MELGA/5-137----------------E-ANDKKNFPDFLQQLTNL--------------------......-------------------
O73883_CHICK/5-138----------------E-ANNKKKFPDFLHELTNF--------------------V.....-------------------
Q8JFF4_ANAPL/4-134----------------E-A.NANNFPEFRQELTN.--------------------...F..-------------------

PF00715

I3MQX6_ICTTR/7-151----------------EYAQETANIVEFLNTWITF--------------------CQSIIS-------------------
G5C793_HETGA/7-149----------------DLNDEEANIVQFLKGWIAF--------------------CQKIIS-------------------
G1PJ32_MYOLU/7-147----------------DYDDETVTIVEFLNKWITF--------------------CQRIFS-------------------
B1AB81_HORSE/7-146----------------EYDDETGTIVEFLNKWITF--------------------CQSIFS-------------------
G3HTL8_CRIGR/7-150----------------EFDDETVTVVEFLSRWITF--------------------CQSII.-------------------
IL2_MACMU/7-151----------------EYADETATIVEFLNRWITF--------------------CQSIIS-------------------
H0Y254_OTOGA/7-149----------------E.DNETATIVEFLNRWITF--------------------CQSIIS-------------------
IL2_MOUSE/7-165----------------QFDDESATVVDFLRRWIAF--------------------CQSIIS-------------------
G3SU90_LOXAF/7-147----------------EYDDHAATIEEFLNKWIVF--------------------CQSIIS-------------------
IL2_PIG/7-151----------------EYDDETVTAVEFLNKWITF--------------------CQSIYS-------------------
IL2_FELCA/7-151----------------NYDDETATIVEFLNKWITF--------------------CQSIFS-------------------
L5K7D9_PTEAL/7-149----------------VYNDESANVKEFLNKWITF--------------------CQSILS-------------------
IL2_BOVIN/7-152----------------EYDDATVNAVEFLNKWITF--------------------CQSIYS-------------------
H0VBY4_CAVPO/7-149----------------DLEDESVNIVEFLKRWIAF--------------------CQKIMS-------------------

PF00103

PLRP1_BOVIN/26-238----------------MSSDEDRRHSEFYNLFYCL----RR-DSRKVDMYIKILTCRTHKT...C---------------
CSH2_BOVIN/26-238----------------TFSDEDRSISEYYNLFYCL----RR-DSRKVDMYIKILTCRTRKT...C---------------
PLRP3_BOVIN/1-213----------------VSNDEDVRHSAFYKLFMCL----YR-DSRKLDMYTEILACRITNT...C---------------
PR4A1_RAT/17-227----------------QSPNRDTRYFAFYNLFHCL----KK-DSNNVEMYLKLLKCRLIRS..KC---------------
CSH1_BOVIN/26-236----------------TADDEDVRQTAFYRMFHCL----HR-DSSKISTYINLLKCR.FTP...C---------------
PLRP4_BOVIN/26-239----------------LSSNEDRRHSAFYSLFFCL----RR-DTRKLDIYTKFVACRLIYK..KC---------------
PR3D4_RAT/16-223----------------QSSDEDTHLFAIYNLCRCF----KS-DIHKIDTYLKVLRCRVVFKN.EC---------------
PR2C2_MOUSE/16-224----------------..DNEDARIHSLYGMISCL----DN-DFKKVDIYLNVLKCYMLKIDN.C---------------
SOM2_HUMAN/9-215----------------TKSHNDDALLKNYGLLYCF----RK-DMDKVETFLRIVQCR.SVEG.SC---------------
PR8A5_RAT/17-238----------------KSSNKNHKFLAIFNLSSCL----DY-DTQVHYTLSQILNCLITGKD..C---------------
PR6A1_RAT/20-234----------------RSPDEERRHFAFTNLFQCL----LQ-DSRKFDSKVRLLKCRLIYNR.DC---------------
PR7D1_MOUSE/17-240----------------KSADKETQFFALYMFSFCL----RI-DLETVDFLVNFLKCLLLYDD.VC---------------
CSH2_HUMAN/9-215----------------TNSHNHDALLKNYGLLYCF----RK-DMDKVETFLRMVQCR.SVEG.SC---------------

PF01109

CSF2_RAT/18-139----------------EIE--VTTFEDFIKNLKGF----LF-DIPFDCW-------------------------------
CSF2_MOUSE/18-136----------------ETQ--VTTYADFIDSLKTF----LT-DIPFECK-------------------------------
CSF2_BOVIN/18-138----------------GTQ--FISFKNFKEDLKEF----LF-IIPFDCW-------------------------------
CSF2_CAVPO/18-140----------------MTQ--IITFKSFKENLKRF----LF-AIPFDCW-------------------------------
CSF2_PIG/18-139----------------ETQ--SITFKSFKDSLNKF----LF-TIPFDCW-------------------------------
CSF2_HUMAN/18-139----------------ATQ--IITFESFKENLKDF----LL-VIPFDCW-------------------------------
CSF2_CANLF/18-139----------------ATQ--NINFKSFKENLKDF----LF-NIPFDCW-------------------------------

PF02025

G1RQD7_NOMLE/22-133----------------GEE--RRRVNQFLDYLQEF----LG-VMNTE-WIIE----------------------------
IL5_CAVPO/23-134----------------GEE--RRRVKQFLDYLQEF----LA-VINTE-WTIE----------------------------
J9NWP5_CANLF/22-132----------------AGE--RWRVTKFLDYLQVF----LG-VINTE-WTP.----------------------------
IL5_MOUSE/21-132----------------GEE--RRRTRQFLDYLQEF----LG-VMSTE-WAME----------------------------
G3WAR7_SARHA/25-134----------------GGE--RRKVEQFLDYLEEF----LQ-TVNTE-WTVE----------------------------
IL5_HORSE/22-133----------------GGE--RWRVKQFLDYLQEF----LG-VINTE-WTIE----------------------------
B5FW65_OTOGA/22-133----------------GEE--RRKVKQFLDYLQEF----LG-IINTE-WTME----------------------------
I3MDT8_ICTTR/23-134----------------GQE--RRRVKQFLEYLQEF----LG-VINTE-WMME----------------------------
G3T4B0_LOXAF/23-133----------------GGE--RRKVKQFLDYLEEF----LG-VISTD-WMI.----------------------------
G1SL79_RABIT/22-133----------------GEE--RRGVKHFLDYLQEF----LG-VINTE-WTME----------------------------

PF02059

IL3_CANLF/19-132----------------SIM--ENNWGDFQRKLKKY----LE-A.------------------------------------
IL3_MOUSE/27-138----------------GVF--IRDLDDFRKKLRFY----MV-HL------------------------------------
IL3_BOVIN/18-132----------------FIE--NKNLGDFRMKLEEY----LV-II------------------------------------
G3UC30_LOXAF/22-133----------------VI.--QNDWEDFRGKLYPY----LE-TL------------------------------------
G1MH15_AILME/18-131----------------SI.--ENNLGDFQKKLKKY----LE-A.------------------------------------
F1RJV6_PIG/18-131----------------SIE--EGDLGDFRAKLMEY----LV-VL------------------------------------
G1RQ11_NOMLE/20-137----------------RIK--DGDWNEFRRKLKFY----LK-TL------------------------------------
IL3_CALJA/19-136----------------RIK--DGDWNDFQMKLKFY----LK-TL------------------------------------
F1LS41_RAT/29-138----------------GVY--NKDLDDFKKKLRFY----VI-HL------------------------------------

PF07400

IL11_HUMAN/22-199----------------APP--SSAWGGIRAAHAIL----GG-LHLTLDWAVRGLLLLKTRL-------------------

PF00758

G3TYQ1_LOXAF/25-173----------------AIF--PEFPT...AALSFL----LL-VVGLTLCARRA---------------------------
W5K758_ASTMX/26-175----------------ELF--QVHINFLRGKVRLL----LA-NA....P....---------------------------
B1N8Y2_DANRE/15-168----------------ELF--QVHVNFLRGKARLL----LA-NA....PVCRQ---------------------------
F7DTH0_CALJA/31-193----------------KLF--QVYSNFIRGKLKLY----AG-EA....CRTED---------------------------
M3XJ62_LATCH/27-177----------------ELF--HIHVNFLRGKVKLF----IS-DA....CSMQ.---------------------------
G3W289_SARHA/30-190----------------KLF--RIYSNFLRGKLKLF----WR-EA....CQSQE---------------------------
F6WUU2_MONDO/31-191----------------KLF--RIYSNFLRGKLKLF----LR-EA....CQSEE---------------------------
G3VW20_SARHA/26-175----------------AIF--LSFQQLLRGKVRFL----LH-ALRPILCARQD---------------------------
G1PF99_MYOLU/45-207----------------KFF--RIYSNFLRGKLKLY----TG-EA....CRRGD---------------------------
TPO_CANLF/25-176----------------AIF--LSFQQLLRGKVRFL----LL-VAGPTLCAKQS---------------------------
F7G570_MONDO/26-177----------------AIF--LSFQQLLRGKVRFL----LH-AVRPLLCARQD---------------------------
H0W023_CAVPO/30-191----------------KLF--QVYSNFLRGKLKLY----TG-MA....CRRGD---------------------------
H2LEX3_ORYLA/33-182----------------ELL--QVHVNFLRGKVRLL----LM-DA....P....---------------------------

PF03487

G1SCQ2_RABIT/16-144----------------RDT--KIELLQFLKELRRH----LQ-MLYRLGK-------------------------------
IL13_HUMAN/16-144----------------RDT--KIEVAQFVKDLLLH----LK-KLFREGR-------------------------------
IL13_RAT/2-130----------------.DT--KIEVAQFISKLLNY----SK-QLFRYG.-------------------------------
F7DGH7_MACMU/16-151----------------RDT--KIEVAQFVKDLLVH----LK-KLFREGQ-------------------------------
L5M5Z7_MYODS/2-128----------------RDT--KVEVTRLAKDLLQQ----LR-KGVRQGK-------------------------------
G5ASP9_HETGA/2-130----------------RDT--KIEVAQFVQTLLRY----LQ-SLYRHGN-------------------------------
B3GDZ5_PIG/2-130----------------RDT--KIEVAQFVKDLLKH----LR-MIFRHG.-------------------------------
L8YAP6_TUPCH/2-128----------------RDT--KIEVAQFVKDLLRH----LK-RLYRH..-------------------------------
IL13_BOVIN/2-130----------------RDT--KIEVAQFLKDLLRH----SR-IVFRNER-------------------------------
IL13_MOUSE/2-130----------------.DT--KIEVAHFITKLLSY----TK-QLFRHGP-------------------------------
H0W834_CAVPO/16-149----------------PDT--KIEVAEFVKKLRIH----VQ-CLYRHGK-------------------------------
F6WQF3_ORNAN/2-128----------------QET--QVELLMFLKKMLPF----YQ-KIFRDT.-------------------------------
G3T2N9_LOXAF/2-133----------------RDT--KIELITFMKNLLDH----LR-RIYRY..-------------------------------
M3YGH3_MUSPF/2-126----------------KDT--KIEVIQLVKNLLTY----AR-SVFRHGN-------------------------------
B5FW67_OTOGA/2-129----------------RDT--KIEVAQFIKDLLRH----LK-KRFRDAN-------------------------------
I3MAR4_ICTTR/2-131----------------PDT--KIEVGQFVKKLLSH----LR-CLLRHGK-------------------------------
IL13_CANLF/2-129----------------RDT--KIEVIQLVKNLLTY----VR-GVYRHGN-------------------------------

PF00727

IL4_FELCA/26-131----------------EVK..KCTLKDFLERLKAI----MQ-KKYS----------------------------------
H0XDE1_OTOGA/26-149----------------DAM..QSTLKDFLERLKTT----MK-EKYS----------------------------------
IL4_MOUSE/27-140----------------ESK..STSLKDFLESLKSI----MQ-MDYS----------------------------------
G3T4B8_LOXAF/26-132----------------EDRNLFKTAR.VIEKLKTI----YY-TKF.----------------------------------
IL4_RABIT/28-143----------------EAR..QTTLEDFLDRLKTA----MQ-EKYS----------------------------------
G5ASQ0_HETGA/25-138----------------ELK..QTTLKDFLENLKTI----LK-KKYS----------------------------------
F6U5N6_HORSE/26-135----------------EAK..KSTLKDFLERLKTI----MK-EKYS----------------------------------
IL4_BOVIN/26-133----------------EAKTSTSTLKDLLERLKTI----MK-EKYS----------------------------------
G3QSC0_GORGO/26-149----------------EAN..QSTLEDFLERLKTI----MR-EKYS----------------------------------
A3FBF0_MUSPF/26-130----------------EVK..KSTLKDFLERLKVI----MQ-QKYY----------------------------------
IL4_RAT/27-139----------------EST..LTTLKDFLESLKSI----LR-GKY.----------------------------------
G3WEJ0_SARHA/28-149----------------ETK..ITKLQDFLSKLKTI----NQ-K...----------------------------------
I3MAS4_ICTTR/24-141----------------ESK..QRTLKDFLESLKTT----MQ-KKYS----------------------------------
IL4_PIG/26-131----------------EAK..KSTLKDFLERLKTI----MK-EKYS----------------------------------

PF00726

IL10_BOVIN/5-174-----
IL10H_EBVB9/7-167-----
G3HB01_CRIGR/14-174-----

PF14565

IL22_HUMAN/40-178-----
E1C1U2_CHICK/46-184-----

PF05337

CSF1_HUMAN/41-180-----
Q3TLQ6_MOUSE/41-180-----
O77709_BOVIN/41-180-----
O77710_BOVIN/41-180-----
Q64129_9MURI/41-180-----

PF15036

IL34_MOUSE/28-184-----
R4GIU3_CHICK/19-177-----
F7EA00_CALJA/29-185-----
H0WFN4_OTOGA/28-184-----
M3ZVZ0_XIPMA/24-191-----
U3JY35_FICAL/18-179-----
L9KJY3_TUPCH/28-184-----
G3T3A6_LOXAF/28-182-----
F6W3U1_MONDO/15-167-----
I3JZ08_ORENI/24-192-----
L5MCR9_MYODS/28-182-----
B3DLJ8_DANRE/23-195-----
IL34_BOVIN/28-183-----

PF00714

IFNG_HORSE/15-152-----
H0WPL1_OTOGA/15-151-----
Q8CGS0_CAVPO/15-154-----
B9VS86_CALJA/15-152-----
G3SUC6_LOXAF/15-152-----
G3GY20_CRIGR/2-135-----
I3MNV6_ICTTR/15-152-----
L5LME8_MYODS/15-153-----
G5BGB5_HETGA/15-152-----
G3WQJ9_SARHA/15-153-----
IFNG_SHEEP/15-152-----
IFNG_RAT/14-151-----
IFNG_RABIT/15-152-----
L9KVU0_TUPCH/51-188-----
IFNG_FELCA/15-153-----

PF02404

R4GD07_ANOCA/1-283SLLQV
SCF_CHICK/1-287EHLQV
SCF_RAT/1-273EFQEV
G1NWC8_MYOLU/1-272EFQEV
F7EP53_MONDO/1-273EFQEV
F7C5I3_ORNAN/1-273ELQEV
F7G0W2_CALJA/1-273EFQEV

PF00143

G5E7E1_LOXAF/9-168-----
IFNE_MOUSE/27-185-----
G3I0H8_CRIGR/26-185-----
H0VF99_CAVPO/28-187-----
L5KKJ7_PTEAL/25-192-----
G1U0Q8_RABIT/26-185-----
F6YZB3_ORNAN/25-183-----
I3MY95_ICTTR/32-186-----
V8NNB8_OPHHA/15-183-----
C8CKA7_PIG/26-185-----
H0W7G8_CAVPO/26-185-----
G3GXU9_CRIGR/27-182-----
H0XSG1_OTOGA/26-185-----
G1KX99_ANOCA/25-184-----
G3I0I6_CRIGR/27-185-----
IFNT4_SHEEP/26-185-----
L8Y4J0_TUPCH/27-186-----
F7B527_HORSE/26-183-----
G1Q950_MYOLU/27-184-----
M3WTR1_FELCA/26-186-----
G5CB66_HETGA/27-185-----
L9L941_TUPCH/27-198-----
D2H9N6_AILME/27-184-----
D3Z919_RAT/26-179-----
C8CKB9_PIG/24-176-----
A8E6F6_XENTR/27-179-----
L8Y906_TUPCH/26-185-----
H9L1C3_CHICK/28-183-----
L5KWM8_PTEAL/106-263-----
G3WZJ8_SARHA/27-182-----
G3UCD2_LOXAF/26-187-----
K7GQJ6_PIG/17-164-----
G3I0H3_CRIGR/26-178-----
H0VYK7_CAVPO/28-181-----
I3N7K4_ICTTR/33-202-----
L5K635_PTEAL/26-185-----
H0W3G0_CAVPO/26-185-----
W5JYQ9_ASTMX/23-179-----
G3SI98_GORGO/28-185-----
H0Y0D2_OTOGA/28-187-----
IFN_ANAPL/34-190-----
G3UJX3_LOXAF/27-185-----
G5C259_HETGA/26-185-----
G3WZF5_SARHA/26-185-----
IFNE_PIG/27-186-----
W5N6G4_LEPOC/27-185-----
H9KYA4_CALJA/26-185-----
D2HTQ4_AILME/33-205-----
IFNB_HUMAN/27-185-----
G1NR05_MELGA/32-188-----
F7BVP5_ORNAN/23-181-----
F7G875_MONDO/27-182-----
C8CKC3_PIG/33-205-----
I3MVD7_ICTTR/34-186-----
F7A317_HORSE/26-184-----
G1KU56_ANOCA/28-182-----
L5KBH2_PTEAL/26-185-----
L5K909_PTEAL/26-185-----
I3N5Z0_ICTTR/23-179-----
F7GHL9_MONDO/26-181-----
IFNE_HUMAN/27-186-----
I3LBU7_PIG/26-179-----
G3UK87_LOXAF/27-184-----
L9LC61_TUPCH/27-185-----
IFNB_RAT/27-182-----
H0XMZ9_OTOGA/27-186-----
G3VDC6_SARHA/27-182-----
I3JM36_ORENI/26-182-----
L5LKN9_MYODS/27-186-----
G1TYS8_RABIT/29-195-----
I3UJJ8_FELCA/27-185-----
C8CKA9_PIG/26-183-----
IFNT2_BOVIN/3-162-----
H0W510_CAVPO/26-186-----
M3Z729_MUSPF/26-183-----
IFNA1_MOUSE/26-185-----
G3TTC1_LOXAF/26-185-----
G1PDS6_MYOLU/29-199-----
F7ABU5_MONDO/27-182-----
G1TTX4_RABIT/27-180-----
H0XRP5_OTOGA/26-185-----
H0WK94_OTOGA/33-202-----
G1KYL3_ANOCA/23-176-----
G3WZQ8_SARHA/26-181-----
H2R6R8_PANTR/26-185-----
H0YTY6_TAEGU/34-188-----
I3MXH1_ICTTR/27-185-----
M3WRV1_FELCA/26-184-----
H0W4H8_CAVPO/23-182-----
R4GKJ6_CHICK/35-191-----
A3FBE8_MUSPF/27-184-----
G1KWE0_ANOCA/28-180-----
G7PS89_MACFA/26-185-----
G1Q880_MYOLU/26-185-----
IFNB_MOUSE/27-180-----
IFNB2_BOVIN/27-184-----
G1SJC4_RABIT/26-185-----
W5PG31_SHEEP/26-185-----
IFNA3_CANLF/26-183-----
G5BPX2_HETGA/27-199-----
IFNW2_HORSE/26-185-----
G3N2A8_BOVIN/26-185-----
H0XKS8_OTOGA/27-185-----
H0VUV7_CAVPO/26-185-----
Q29412_PIG/27-184-----
G7PS88_MACFA/26-185-----
M3WZS7_FELCA/26-181-----
H9GZR7_HORSE/26-185-----
F1LVL8_RAT/26-184-----
M3YX13_MUSPF/27-179-----
G1L8G2_AILME/26-185-----
IFNB_HORSE/27-184-----
H0W289_CAVPO/26-190-----
A8E6E8_MONDO/27-182-----
I3N788_ICTTR/27-185-----
G1L8I1_AILME/26-183-----
IFNB_FELCA/27-184-----
H0VXI5_CAVPO/26-181-----
G3TS29_LOXAF/26-179-----
W5PZ39_SHEEP/26-184-----
G3I0H6_CRIGR/26-178-----
I3L756_PIG/26-180-----
M3Z715_MUSPF/26-183-----
M3VXI8_FELCA/33-205-----
G3R8Q7_GORGO/26-185-----
A8E6F5_XENTR/51-202-----

PF02947

FLT3L_MOUSE/30-162-----
F6T7S9_ORNAN/28-157-----
H9GP84_ANOCA/29-165-----
F6TPW7_MONDO/34-163-----
G5B8P0_HETGA/20-150-----
G1M637_AILME/29-159-----
L9JA37_TUPCH/769-910-----
G3VSA3_SARHA/79-209-----
G1QZC3_NOMLE/30-160-----

PF06875

Q5BNQ4_9SALA/2-215-----
Q5BNQ2_9SALA/2-215-----

PF01110

CNTF_CHICK/1-194-----
G3VWZ5_SARHA/1-195-----
E1BFH9_BOVIN/1-193-----
G5AP46_HETGA/1-192-----
H0Z9U1_TAEGU/1-188-----
CNTF_HUMAN/1-194-----

PF01291

LIF_MOUSE/44-203-----
LIF_BOVIN/43-202-----
ONCM_HUMAN/37-209-----
ONCM_MOUSE/34-194-----
ONCM_BOVIN/34-194-----

PF03039

IL12A_MOUSE/6-215-----
G3VQT1_SARHA/40-247-----
F6T5A8_MONDO/5-202-----
IL12A_PIG/6-222-----
L8YEA2_TUPCH/1-213-----
H0X861_OTOGA/6-217-----
G1QWH2_NOMLE/40-254-----
I3MN91_ICTTR/4-220-----
Q924V6_CAVPO/6-221-----

PF02024

H3AP27_LATCH/26-169-----
G3WWV6_SARHA/23-167-----
F6PLK2_ORNAN/23-167-----
F7HGW1_CALJA/23-167-----
G5BHA4_HETGA/23-167-----
W5NER9_LEPOC/28-172-----
H0V7C6_CAVPO/23-165-----
LEP_HUMAN/23-167-----

PF00489

IL6_BOVIN/27-208-----
M3X721_FELCA/27-208-----
IL6_HORSE/27-208-----
G3UHF3_LOXAF/20-205-----
L5KPK4_PTEAL/20-202-----
F7HV62_CALJA/27-212-----
IL6_MOUSE/26-210-----

PF16647

CSF3_BOVIN/42-190-----
CSF3_HUMAN/51-202-----
CSF3_MOUSE/57-205-----

PF02372

IL15_PIG/33-160-----
IL15_CAVPO/33-160-----
IL15_FELCA/33-160-----
IL15_SHEEP/33-160-----
F1NZN5_CHICK/55-183-----
G1NDP6_MELGA/5-137-----
O73883_CHICK/5-138-----
Q8JFF4_ANAPL/4-134-----

PF00715

I3MQX6_ICTTR/7-151-----
G5C793_HETGA/7-149-----
G1PJ32_MYOLU/7-147-----
B1AB81_HORSE/7-146-----
G3HTL8_CRIGR/7-150-----
IL2_MACMU/7-151-----
H0Y254_OTOGA/7-149-----
IL2_MOUSE/7-165-----
G3SU90_LOXAF/7-147-----
IL2_PIG/7-151-----
IL2_FELCA/7-151-----
L5K7D9_PTEAL/7-149-----
IL2_BOVIN/7-152-----
H0VBY4_CAVPO/7-149-----

PF00103

PLRP1_BOVIN/26-238-----
CSH2_BOVIN/26-238-----
PLRP3_BOVIN/1-213-----
PR4A1_RAT/17-227-----
CSH1_BOVIN/26-236-----
PLRP4_BOVIN/26-239-----
PR3D4_RAT/16-223-----
PR2C2_MOUSE/16-224-----
SOM2_HUMAN/9-215-----
PR8A5_RAT/17-238-----
PR6A1_RAT/20-234-----
PR7D1_MOUSE/17-240-----
CSH2_HUMAN/9-215-----

PF01109

CSF2_RAT/18-139-----
CSF2_MOUSE/18-136-----
CSF2_BOVIN/18-138-----
CSF2_CAVPO/18-140-----
CSF2_PIG/18-139-----
CSF2_HUMAN/18-139-----
CSF2_CANLF/18-139-----

PF02025

G1RQD7_NOMLE/22-133-----
IL5_CAVPO/23-134-----
J9NWP5_CANLF/22-132-----
IL5_MOUSE/21-132-----
G3WAR7_SARHA/25-134-----
IL5_HORSE/22-133-----
B5FW65_OTOGA/22-133-----
I3MDT8_ICTTR/23-134-----
G3T4B0_LOXAF/23-133-----
G1SL79_RABIT/22-133-----

PF02059

IL3_CANLF/19-132-----
IL3_MOUSE/27-138-----
IL3_BOVIN/18-132-----
G3UC30_LOXAF/22-133-----
G1MH15_AILME/18-131-----
F1RJV6_PIG/18-131-----
G1RQ11_NOMLE/20-137-----
IL3_CALJA/19-136-----
F1LS41_RAT/29-138-----

PF07400

IL11_HUMAN/22-199-----

PF00758

G3TYQ1_LOXAF/25-173-----
W5K758_ASTMX/26-175-----
B1N8Y2_DANRE/15-168-----
F7DTH0_CALJA/31-193-----
M3XJ62_LATCH/27-177-----
G3W289_SARHA/30-190-----
F6WUU2_MONDO/31-191-----
G3VW20_SARHA/26-175-----
G1PF99_MYOLU/45-207-----
TPO_CANLF/25-176-----
F7G570_MONDO/26-177-----
H0W023_CAVPO/30-191-----
H2LEX3_ORYLA/33-182-----

PF03487

G1SCQ2_RABIT/16-144-----
IL13_HUMAN/16-144-----
IL13_RAT/2-130-----
F7DGH7_MACMU/16-151-----
L5M5Z7_MYODS/2-128-----
G5ASP9_HETGA/2-130-----
B3GDZ5_PIG/2-130-----
L8YAP6_TUPCH/2-128-----
IL13_BOVIN/2-130-----
IL13_MOUSE/2-130-----
H0W834_CAVPO/16-149-----
F6WQF3_ORNAN/2-128-----
G3T2N9_LOXAF/2-133-----
M3YGH3_MUSPF/2-126-----
B5FW67_OTOGA/2-129-----
I3MAR4_ICTTR/2-131-----
IL13_CANLF/2-129-----

PF00727

IL4_FELCA/26-131-----
H0XDE1_OTOGA/26-149-----
IL4_MOUSE/27-140-----
G3T4B8_LOXAF/26-132-----
IL4_RABIT/28-143-----
G5ASQ0_HETGA/25-138-----
F6U5N6_HORSE/26-135-----
IL4_BOVIN/26-133-----
G3QSC0_GORGO/26-149-----
A3FBF0_MUSPF/26-130-----
IL4_RAT/27-139-----
G3WEJ0_SARHA/28-149-----
I3MAS4_ICTTR/24-141-----
IL4_PIG/26-131-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window