Sequence alignment for CL0053

PF00143

G5E7E1_LOXAF/9-168------------------------------------------------------------LQK----------KHT-LTS
IFNE_MOUSE/27-185------------------------------------------------------------IPF----------QLW-.MN
G3I0H8_CRIGR/26-185------------------------------------------------------------LPQ----------THN-IRN
H0VF99_CAVPO/28-187------------------------------------------------------------LQQ----------QQQ-RSS
L5KKJ7_PTEAL/25-192------------------------------------------------------------..N----------LLN-RVT
G1U0Q8_RABIT/26-185------------------------------------------------------------LPH----------NSV-PLS
F6YZB3_ORNAN/25-183------------------------------------------------------------..R----------PLQ-TAD
I3MY95_ICTTR/32-186------------------------------------------------------------LSL----------ETS-EKN
V8NNB8_OPHHA/15-183------------------------------------------------------------LQR----------KLL-KAN
C8CKA7_PIG/26-185------------------------------------------------------------PVQ----------THS-LAH
H0W7G8_CAVPO/26-185------------------------------------------------------------LPQ----------THS-QRN
G3GXU9_CRIGR/27-182------------------------------------------------------------LEL----------KQR-KCN
H0XSG1_OTOGA/26-185------------------------------------------------------------LPQ----------SHS-LGN
G1KX99_ANOCA/25-184------------------------------------------------------------LRS----------RLR-QAS
G3I0I6_CRIGR/27-185------------------------------------------------------------ILF----------QSR-.MK
IFNT4_SHEEP/26-185------------------------------------------------------------LSQ----------RLM-LDA
L8Y4J0_TUPCH/27-186------------------------------------------------------------FLF----------QQR-RVN
F7B527_HORSE/26-183------------------------------------------------------------PPL----------RQR-..N
G1Q950_MYOLU/27-184------------------------------------------------------------LRF----------QQS-SSN
M3WTR1_FELCA/26-186------------------------------------------------------------LPG----------SHA-QVS
G5CB66_HETGA/27-185------------------------------------------------------------LQA----------QQR-SSS
L9L941_TUPCH/27-198------------------------------------------------------------LNV----------HLR-RVT
D2H9N6_AILME/27-184------------------------------------------------------------LRF----------QLS-SSS
D3Z919_RAT/26-179------------------------------------------------------------LPR----------TH.-...
C8CKB9_PIG/24-176------------------------------------------------------------FSG----------IHR-LEN
A8E6F6_XENTR/27-179------------------------------------------------------------LHP----------KQE-YLN
L8Y906_TUPCH/26-185------------------------------------------------------------LPQ----------SLD-SGK
H9L1C3_CHICK/28-183------------------------------------------------------------LPL----------QQR-RVI
L5KWM8_PTEAL/106-263------------------------------------------------------------LSQ----------DHV-QVS
G3WZJ8_SARHA/27-182------------------------------------------------------------LTQ----------GLQ-E..
G3UCD2_LOXAF/26-187------------------------------------------------------------LPQ----------SHR-LAN
K7GQJ6_PIG/17-164------------------------------------------------------------CQQ----------...-...
G3I0H3_CRIGR/26-178------------------------------------------------------------LSL----------TPK-PGE
H0VYK7_CAVPO/28-181------------------------------------------------------------LQQ----------QQR-SSN
I3N7K4_ICTTR/33-202------------------------------------------------------------LEV----------HLD-MST
L5K635_PTEAL/26-185------------------------------------------------------------LSQ----------SLD-LGK
H0W3G0_CAVPO/26-185------------------------------------------------------------LPQ----------NSV-LLC
W5JYQ9_ASTMX/23-179------------------------------------------------------------VKC----------SLQ-RRL
G3SI98_GORGO/28-185------------------------------------------------------------.NV----------HLR-RVT
H0Y0D2_OTOGA/28-187------------------------------------------------------------LPK----------SPI-LNT
IFN_ANAPL/34-190------------------------------------------------------------LRL----------HDS-AFA
G3UJX3_LOXAF/27-185------------------------------------------------------------LQF----------QQR-SSN
G5C259_HETGA/26-185------------------------------------------------------------LPR----------THS-QGN
G3WZF5_SARHA/26-185------------------------------------------------------------LRF----------YQR-RTN
IFNE_PIG/27-186------------------------------------------------------------VLS----------QQR-RVN
W5N6G4_LEPOC/27-185------------------------------------------------------------LEH----------QLG-NIN
H9KYA4_CALJA/26-185------------------------------------------------------------LPQ----------AHS-LSN
D2HTQ4_AILME/33-205------------------------------------------------------------LHF----------HLR-KVT
IFNB_HUMAN/27-185------------------------------------------------------------LGF----------LQR-SSN
G1NR05_MELGA/32-188------------------------------------------------------------LRH----------QDA-NFS
F7BVP5_ORNAN/23-181------------------------------------------------------------LYS----------HQW-LNN
F7G875_MONDO/27-182------------------------------------------------------------LRF----------HQR-RTN
C8CKC3_PIG/33-205------------------------------------------------------------LNA----------HLR-RVS
I3MVD7_ICTTR/34-186------------------------------------------------------------.LE----------TPD-GNE
F7A317_HORSE/26-184------------------------------------------------------------LPH----------THS-LGN
G1KU56_ANOCA/28-182------------------------------------------------------------LRK----------HLL-DDN
L5KBH2_PTEAL/26-185------------------------------------------------------------LSQ----------DHV-QVS
L5K909_PTEAL/26-185------------------------------------------------------------LPQ----------THS-LVN
I3N5Z0_ICTTR/23-179------------------------------------------------------------VLL----------QQR-.IK
F7GHL9_MONDO/26-181------------------------------------------------------------LTQ----------GLQ-K..
IFNE_HUMAN/27-186------------------------------------------------------------IIF----------QQR-QVN
I3LBU7_PIG/26-179------------------------------------------------------------LSQ----------NHV-HVS
G3UK87_LOXAF/27-184------------------------------------------------------------LPQ----------ILG-LGK
L9LC61_TUPCH/27-185------------------------------------------------------------LRF----------QLS-GSS
IFNB_RAT/27-182------------------------------------------------------------LQF----------RQS-TSI
H0XMZ9_OTOGA/27-186------------------------------------------------------------VLF----------QQR-RVN
G3VDC6_SARHA/27-182------------------------------------------------------------LTQ----------GLQ-E..
I3JM36_ORENI/26-182------------------------------------------------------------MDD----------KFK-QHN
L5LKN9_MYODS/27-186------------------------------------------------------------VLF----------QQR-RVN
G1TYS8_RABIT/29-195------------------------------------------------------------LNV----------NLN-RVI
I3UJJ8_FELCA/27-185------------------------------------------------------------ALF----------QQR-.VN
C8CKA9_PIG/26-183------------------------------------------------------------LPQ----------SHD-..N
IFNT2_BOVIN/3-162------------------------------------------------------------LSE----------DHM-LGA
H0W510_CAVPO/26-186------------------------------------------------------------LPQ----------THS-QGN
M3Z729_MUSPF/26-183------------------------------------------------------------LPQ----------DHG-LLH
IFNA1_MOUSE/26-185------------------------------------------------------------LPQ----------THN-LRN
G3TTC1_LOXAF/26-185------------------------------------------------------------LPQ----------NHT-VAS
G1PDS6_MYOLU/29-199------------------------------------------------------------..I----------HLR-RIT
F7ABU5_MONDO/27-182------------------------------------------------------------LTL----------GLQ-E..
G1TTX4_RABIT/27-180------------------------------------------------------------LQI----------QLW-HGS
H0XRP5_OTOGA/26-185------------------------------------------------------------LPQ----------SHS-LGN
H0WK94_OTOGA/33-202------------------------------------------------------------LNV----------HLR-RVT
G1KYL3_ANOCA/23-176------------------------------------------------------------LLT----------RLR-EAN
G3WZQ8_SARHA/26-181------------------------------------------------------------LTQ----------GLQ-E..
H2R6R8_PANTR/26-185------------------------------------------------------------LPQ----------THN-LGN
H0YTY6_TAEGU/34-188------------------------------------------------------------LWT----------HDD-SFP
I3MXH1_ICTTR/27-185------------------------------------------------------------LRL----------QQF-NSS
M3WRV1_FELCA/26-184------------------------------------------------------------LPQ----------THG-LLN
H0W4H8_CAVPO/23-182------------------------------------------------------------LAV----------FQQ-RMN
R4GKJ6_CHICK/35-191------------------------------------------------------------LRP----------QDA-TFS
A3FBE8_MUSPF/27-184------------------------------------------------------------LRF----------QLS-SSS
G1KWE0_ANOCA/28-180------------------------------------------------------------LCS----------WLR-QAN
G7PS89_MACFA/26-185------------------------------------------------------------LPQ----------THS-LGY
G1Q880_MYOLU/26-185------------------------------------------------------------LPQ----------DHI-LLS
IFNB_MOUSE/27-180------------------------------------------------------------LQL----------QER-TNI
IFNB2_BOVIN/27-184------------------------------------------------------------LRF----------QQR-RSL
G1SJC4_RABIT/26-185------------------------------------------------------------LPQ----------THS-LSD
W5PG31_SHEEP/26-185------------------------------------------------------------LPH----------THS-LAN
IFNA3_CANLF/26-183------------------------------------------------------------LPD----------THS-LRN
G5BPX2_HETGA/27-199------------------------------------------------------------QNV----------RLS-TVT
IFNW2_HORSE/26-185------------------------------------------------------------LPQ----------NHI-LVS
G3N2A8_BOVIN/26-185------------------------------------------------------------LSQ----------NHM-LVG
H0XKS8_OTOGA/27-185------------------------------------------------------------LQF----------QQR-RST
H0VUV7_CAVPO/26-185------------------------------------------------------------LPL----------TYM-QGN
Q29412_PIG/27-184------------------------------------------------------------LRY----------QQR-SSN
G7PS88_MACFA/26-185------------------------------------------------------------LPE----------THS-LDN
M3WZS7_FELCA/26-181------------------------------------------------------------LRP----------S..-..N
H9GZR7_HORSE/26-185------------------------------------------------------------LPA----------SLD-LRK
F1LVL8_RAT/26-184------------------------------------------------------------ILF----------QSR-.RN
M3YX13_MUSPF/27-179------------------------------------------------------------ALF----------QQR-.VN
G1L8G2_AILME/26-185------------------------------------------------------------LPQ----------NHG-LFA
IFNB_HORSE/27-184------------------------------------------------------------LRS----------QLR-SSN
H0W289_CAVPO/26-190------------------------------------------------------------LPQ----------NFI-LLS
A8E6E8_MONDO/27-182------------------------------------------------------------LTQ----------GLQ-E..
I3N788_ICTTR/27-185------------------------------------------------------------LRL----------QQS-SSS
G1L8I1_AILME/26-183------------------------------------------------------------LPQ----------NHG-LFA
IFNB_FELCA/27-184------------------------------------------------------------LGF----------QLR-SSS
H0VXI5_CAVPO/26-181------------------------------------------------------------LSQ----------THS-QGN
G3TS29_LOXAF/26-179------------------------------------------------------------LPL----------SHS-..N
W5PZ39_SHEEP/26-184------------------------------------------------------------LNV----------HLR-RVT
G3I0H6_CRIGR/26-178------------------------------------------------------------LSP----------SPK-PGN
I3L756_PIG/26-180------------------------------------------------------------LSQ----------NHV-HVS
M3Z715_MUSPF/26-183------------------------------------------------------------LPR----------DHS-LLH
M3VXI8_FELCA/33-205------------------------------------------------------------LHL----------HLR-EVT
G3R8Q7_GORGO/26-185------------------------------------------------------------LPQ----------NHG-LLS
A8E6F5_XENTR/51-202------------------------------------------------------------LQP----------KQE-YLN

PF02947

FLT3L_MOUSE/30-162---------------------------------------------------------DCYFSH----------SPI.SSN
F6T7S9_ORNAN/28-157---------------------------------------------------------ACAFRY----------SPV.SSM
H9GP84_ANOCA/29-165---------------------------------------------------------GCIFGS----------VPIDTSD
F6TPW7_MONDO/34-163---------------------------------------------------------SCTFPD----------SPI.SST
G5B8P0_HETGA/20-150---------------------------------------------------------SCSFSH----------NPI.SSD
G1M637_AILME/29-159---------------------------------------------------------DCAFSH----------SPI.SST
L9JA37_TUPCH/769-910---------------------------------------------------------....QG----------SPI.AST
G3VSA3_SARHA/79-209---------------------------------------------------------PCSFPD----------SPI.SSI
G1QZC3_NOMLE/30-160---------------------------------------------------------DCSFQH----------SPI.SSD

PF03487

G1SCQ2_RABIT/16-144-------------------------------------------------------ALWWAVAI----------AVTCLGS
IL13_HUMAN/16-144-------------------------------------------------------ALLLTTVI----------ALTCLGG
IL13_RAT/2-130-------------------------------------------------------ALWVTAVL----------ALACLGG
F7DGH7_MACMU/16-151-------------------------------------------------------ALLLTMVI----------ALTCLGG
L5M5Z7_MYODS/2-128-------------------------------------------------------ALWLTLVI----------VLTCFGG
G5ASP9_HETGA/2-130-------------------------------------------------------ALWVTVVL----------ALTCLSA
B3GDZ5_PIG/2-130-------------------------------------------------------ALWLTLVI----------ALTCFGG
L8YAP6_TUPCH/2-128-------------------------------------------------------ALWLTVVI----------ALTCLGG
IL13_BOVIN/2-130-------------------------------------------------------ALLLTAVI----------VLICFGG
IL13_MOUSE/2-130-------------------------------------------------------ALWVTAVL----------ALACLGG
H0W834_CAVPO/16-149-------------------------------------------------------AFWVTVVL----------ALACLGG
F6WQF3_ORNAN/2-128-------------------------------------------------------TVVLLAVF----------WIDCI..
G3T2N9_LOXAF/2-133-------------------------------------------------------ALWLTVVI----------ALTCIGG
M3YGH3_MUSPF/2-126-------------------------------------------------------ALWLTVII----------AFICLSG
B5FW67_OTOGA/2-129-------------------------------------------------------ALWLTMVI----------ALTCLGG
I3MAR4_ICTTR/2-131-------------------------------------------------------ALWLTVVL----------TLACLGG
IL13_CANLF/2-129-------------------------------------------------------ALWLTVVI----------ALTCLGG

PF00727

IL4_FELCA/26-131-------------------------------------------------------NFNNTLKE----------IIKTLNI
H0XDE1_OTOGA/26-149-------------------------------------------------------KRGIVLKE----------CIKALNI
IL4_MOUSE/27-140-------------------------------------------------------..KNHLRE----------IIGILNE
G3T4B8_LOXAF/26-132-------------------------------------------------------TCGNILRE----------IIKTLNF
IL4_RABIT/28-143-------------------------------------------------------..DIILPE----------VIKTLNI
G5ASQ0_HETGA/25-138-------------------------------------------------------.CNDALQE----------IINDLNV
F6U5N6_HORSE/26-135-------------------------------------------------------KYDITLQE----------IIKTLNN
IL4_BOVIN/26-133-------------------------------------------------------KCDITLAE----------IIKTLNI
G3QSC0_GORGO/26-149-------------------------------------------------------KCDIALQE----------IIKTLNS
A3FBF0_MUSPF/26-130-------------------------------------------------------NFSIAIKE----------IIKTLNI
IL4_RAT/27-139-------------------------------------------------------..DSPLRE----------IINTLNQ
G3WEJ0_SARHA/28-149-------------------------------------------------------NCRSTVRE----------IILSASS
I3MAS4_ICTTR/24-141-------------------------------------------------------GCDVTLEE----------IIKTLNT
IL4_PIG/26-131-------------------------------------------------------KCDITLQE----------IIKTLNI

PF00726

IL10_BOVIN/5-174----------------------------------ALLCCLVFLAGVAASRDASTLSDSSCIHL----------PTSLPHM
IL10H_EBVB9/7-167----------------------------------VTLQCLVLL.........YLAPECGGTDQ----------CDNFPQM
G3HB01_CRIGR/14-174----------------------------------.........AGVGPSRGQYTQQENNCTHF----------PVSQTHM

PF14565

IL22_HUMAN/40-178-----------------------------------------------------------CRLD----------KSNFQQP
E1C1U2_CHICK/46-184-----------------------------------------------------------CRLR----------KINFQQP

PF15177

IFNL3_CHICK/28-182--------------------------------------------------------KKSCSLS----------KYQFPAP
F1M3K4_RAT/31-188--------------------------------------------------------AKDCNIA----------QFKSLSP
I3MK89_ICTTR/34-194--------------------------------------------------------ARDCDMA----------QFKTLAP
F1PY54_CANLF/31-186--------------------------------------------------------RRGCHMD----------RFQSLSP
H0XRJ1_OTOGA/35-191--------------------------------------------------------WRGCHIG----------TFKSLSP
M3W3J2_FELCA/32-181--------------------------------------------------------AGGCHLA----------QFKSLSP
F6PNH9_HORSE/31-184--------------------------------------------------------QRSCDIG----------RFKSLSP
D2DJP5_XENTR/23-178--------------------------------------------------------RRHCHMS----------RYRSVSP
G3TQK4_LOXAF/32-188--------------------------------------------------------ARGCRID----------QFKSLSP
F7DXI8_HORSE/34-187--------------------------------------------------------ARGCHIA----------QYKSLSP
F6W920_MONDO/30-184--------------------------------------------------------EKSCQIP----------QFKSLSP
U3KED0_FICAL/27-186--------------------------------------------------------RKGCRLS----------KYQNIAH
H0VBN4_CAVPO/39-195--------------------------------------------------------TKECHMA----------KFKSLSP
IFNL4_HUMAN/25-174--------------------------------------------------------.RRCLLS----------HYRSLEP
IFNL2_MOUSE/32-189--------------------------------------------------------AKDCHIA----------QFKSLSP
G3N0M3_BOVIN/37-192--------------------------------------------------------ARGCHMA----------QFKSLSP
G1LPU9_AILME/37-191--------------------------------------------------------WKGCDIG----------RFKSLSP
L5LZZ9_MYODS/163-319--------------------------------------------------------ARGCHMG----------QFKSLSP
IFNL3_HUMAN/34-192--------------------------------------------------------ARGCHIA----------QFKSLSP
F6R8C9_XENTR/23-177--------------------------------------------------------RRHCHMS----------RYRSVSP
G3VJ97_SARHA/12-167--------------------------------------------------------ERSCQIS----------QFKSLSP
H0XJU8_OTOGA/36-192--------------------------------------------------------AKGCHLA----------QFKSFSP
G3HJD0_CRIGR/30-187--------------------------------------------------------AKDCHIA----------RFKSLSP
G1LPW2_AILME/34-190--------------------------------------------------------ARGCPLA----------QFQSLSP
L5L378_PTEAL/33-182--------------------------------------------------------GRSCNIG----------KFKSLPP
G1T4B0_RABIT/34-188--------------------------------------------------------GRDCRID----------SFKSLSP
U3IYH6_ANAPL/34-185--------------------------------------------------------KKSCRLS----------QYGSPAY
L9LBW1_TUPCH/31-181--------------------------------------------------------GRSCNMS----------RFKSLSP
D0FHA1_PIG/36-191--------------------------------------------------------ARGCHLA----------QFKSLSP

PF05337

CSF1_HUMAN/41-180------------------------------------------------------HMIGSGHLQ----------SLQRLID
Q3TLQ6_MOUSE/41-180------------------------------------------------------HMIGNGHLK----------VLQQLID
O77709_BOVIN/41-180------------------------------------------------------HMIGNGHLL----------FLQQLID
O77710_BOVIN/41-180------------------------------------------------------HMIGNGHLL----------FLQQLID
Q64129_9MURI/41-180------------------------------------------------------HMIGNGHLK----------VLQQLID

PF15036

IL34_MOUSE/28-184----------------------------------------------------TLTQDKECDLT----------GYLRGKL
R4GIU3_CHICK/19-177----------------------------------------------------.VAALGECELA----------RLLQDKL
F7EA00_CALJA/29-185----------------------------------------------------PLTQSKECTVT----------GFLRDKL
H0WFN4_OTOGA/28-184----------------------------------------------------SLTQSQECTVT----------SSLRDKL
M3ZVZ0_XIPMA/24-191----------------------------------------------------ASTPASMCTPL----------KTLNDSL
U3JY35_FICAL/18-179----------------------------------------------------EAAAPGECELT----------RLLQDKL
L9KJY3_TUPCH/28-184----------------------------------------------------PVTQSKECAVT----------GFLREKL
G3T3A6_LOXAF/28-182----------------------------------------------------PLTQGEECTFT----------GYLRDKL
F6W3U1_MONDO/15-167----------------------------------------------------...QNKECIIT----------GILRDKL
I3JZ08_ORENI/24-192----------------------------------------------------.PTHSSMCTPL----------RTINDSL
L5MCR9_MYODS/28-182----------------------------------------------------PLTQSKECALT----------GILRNKL
B3DLJ8_DANRE/23-195----------------------------------------------------SSAAPDLCGPL----------KTVQDSL
IL34_BOVIN/28-183----------------------------------------------------PLTRSDECAIT----------GFLRDKL

PF00714

IFNG_HORSE/15-152---------------------------------------------------------ILGSST----------YYCQAAF
H0WPL1_OTOGA/15-151---------------------------------------------------------LLGSSA----------FYCRVTS
Q8CGS0_CAVPO/15-154---------------------------------------------------------ILSFSS----------YYCQSRF
B9VS86_CALJA/15-152---------------------------------------------------------VLGSLG----------CYCQDPY
G3SUC6_LOXAF/15-152---------------------------------------------------------ILGSSS----------CYCQATF
G3GY20_CRIGR/2-135---------------------------------------------------------....SG----------CYCQRTL
I3MNV6_ICTTR/15-152---------------------------------------------------------ILGSSS----------YYSQDIV
L5LME8_MYODS/15-153---------------------------------------------------------ILGFSS----------CYSQSTI
G5BGB5_HETGA/15-152---------------------------------------------------------ILGFST----------YYCESRF
G3WQJ9_SARHA/15-153---------------------------------------------------------ILSSSG----------CLSQVNL
IFNG_SHEEP/15-152---------------------------------------------------------LLGFSG----------SYGQGPF
IFNG_RAT/14-151---------------------------------------------------------LMALSG----------CYCQGTL
IFNG_RABIT/15-152---------------------------------------------------------ILGSYG----------CYCQDTL
L9KVU0_TUPCH/51-188---------------------------------------------------------ILGSSS----------CYCQAPF
IFNG_FELCA/15-153---------------------------------------------------------ILCSSG----------YYCQAMF

PF02404

R4GD07_ANOCA/1-283-------------------------------------------------MKTAQTWIITCFYL----------QLLLLHP
SCF_CHICK/1-287-------------------------------------------------MKKAQTWIITCFCL----------QLLLLNP
SCF_RAT/1-273-------------------------------------------------MKKTQTWIITCIYL----------QLLLFNP
G1NWC8_MYOLU/1-272-------------------------------------------------..KTQTWIITCIYL----------QLLLFNH
F7EP53_MONDO/1-273-------------------------------------------------MKKTQTWIITCIYL----------QLLLFNP
F7C5I3_ORNAN/1-273-------------------------------------------------MKKTQTWIITCIYL----------QLLLFIP
F7G0W2_CALJA/1-273-------------------------------------------------MKKTQTWILTCIYL----------QLFLFNP

PF02372

IL15_PIG/33-160-----------------------------------VFILGCISAGLPKT----EAT...WQ----------------...
IL15_CAVPO/33-160-----------------------------------VFVWGCISAGLPKT----EAS...WH----------------...
IL15_FELCA/33-160-----------------------------------VFILSCINAGLPKT----EAN...WQ----------------...
IL15_SHEEP/33-160-----------------------------------VFILGCISAGLPKT----EAN...WQ----------------...
F1NZN5_CHICK/55-183-----------------------------------.FFL.C..AYVPKT----EANHCKWS----------------...
G1NDP6_MELGA/5-137-----------------------------------VLIFSCISVALLMT----TAYGASLS----------------PEK
O73883_CHICK/5-138-----------------------------------VLIFGCISVAMLMT----TAYGASLS----------------SAK
Q8JFF4_ANAPL/4-134-----------------------------------VLIFSCLSVLMLMT----TAYGAPLS----------------EKD

PF00715

I3MQX6_ICTTR/7-151--------------------------------------LSCLALTLALL----AHGAPTSGSA..............EET
G5C793_HETGA/7-149--------------------------------------LSCIALTLALI----TSSAPTSSST..............RET
G1PJ32_MYOLU/7-147--------------------------------------LSCIALTLAFI----ADGAPTSSSS..............QET
B1AB81_HORSE/7-146--------------------------------------LACIALTLAVL----ANSAPTSSSK..............RET
G3HTL8_CRIGR/7-150--------------------------------------ASCLALTLALL----VNSAPTSSSK..............KET
IL2_MACMU/7-151--------------------------------------LSCIALSLALV----TNSAPTSSST..............KKT
H0Y254_OTOGA/7-149--------------------------------------LTCIALTFALV----TNSAPISSST..............KET
IL2_MOUSE/7-165--------------------------------------ASCVTLTLVLL----VNSAPTSSSTSSSTAEAQQQQQQQQQQ
G3SU90_LOXAF/7-147--------------------------------------LSCIALTLALV----ANSAPTSSST..............KET
IL2_PIG/7-151--------------------------------------LCCIALTLALM----ANGAPTSSST..............KNT
IL2_FELCA/7-151--------------------------------------LSCIALTLILV----TNSAPASSST..............KET
L5K7D9_PTEAL/7-149--------------------------------------LSCIALTLALV----ADGAPTSSSR..............KET
IL2_BOVIN/7-152--------------------------------------LSCIALTLALV----ANGAPTSSST..............GNT
H0VBY4_CAVPO/7-149--------------------------------------LSCLALTLALL----TSSAPTSSSP..............KQT

PF01415

H0X0U6_OTOGA/15-141----------------------------------------------SVD----GQGCSTHMGI-----------------
G1QNL2_NOMLE/28-172----------------------------------------------DIE----GKDGKQYESV-----------------
IL7_BOVIN/28-171----------------------------------------------DIS----GKDGGAYQNV-----------------
H0VFS1_CAVPO/31-152----------------------------------------------.LK----DKEGKGYKNV-----------------
F1PA23_CANLF/29-154----------------------------------------------DIE----GKDGREYQHV-----------------
M3WJR8_FELCA/15-139----------------------------------------------SVA----SQRCSTLSGI-----------------
IL9_MOUSE/15-141----------------------------------------------SVL----GQRCSTTWGI-----------------
U3KN10_RABIT/31-153----------------------------------------------KI.----.KHGKEYENV-----------------
A0MZ91_PIG/18-138----------------------------------------------S..----.QGCMTLTGI-----------------
K7E262_MONDO/59-200----------------------------------------------...----.....DYIHL-----------------
E1BF10_BOVIN/18-141----------------------------------------------S..----.QGCFTLTGI-----------------
F6PLW3_HORSE/15-136----------------------------------------------SVA----GQGCSTMAGI-----------------
IL9_HUMAN/15-141----------------------------------------------SVA----GQGCPTLAGI-----------------
IL7_MOUSE/28-151----------------------------------------------HIK----DKEGKAYESV-----------------
G5BX09_HETGA/15-141----------------------------------------------SVA----GQRCSTSSGI-----------------
L8Y4N8_TUPCH/15-141----------------------------------------------SVA----SQECSTSEGI-----------------
D4A8I9_RAT/15-141----------------------------------------------SVL----GQRCSTSWGI-----------------
G3TKQ6_LOXAF/16-136----------------------------------------------.MA----GKTCFSSWGT-----------------
M3YEX7_MUSPF/16-137----------------------------------------------SVT----SKSCPTFIGI-----------------
G1NXN3_MYOLU/28-153----------------------------------------------EIE----GKSGEEYQHV-----------------

PF00103

PLRP1_BOVIN/26-238--------------------------------------LLMSNLLLCQ.....GKSCPSCGPDVFVSLRKSFTDRFMNAA
CSH2_BOVIN/26-238--------------------------------------LVVSNLLLCQ.....GISCPSCGPDMFVSLQKSLIDVFINAA
PLRP3_BOVIN/1-213--------------------------------------MVMSNLLLCQ.....VNSCPSCCPDVFDIPLESLTHLFLNAS
PR4A1_RAT/17-227--------------------------------------LLVSNLLLWEN....TASAMRAKLL.NVHNYTSYGDTWNQAI
CSH1_BOVIN/26-236--------------------------------------LVVSNLLLCQGVEDYAPYCKNQPGN....CRIPLQSLFERAT
PLRP4_BOVIN/26-239--------------------------------------LVMSNLLLCQ.....GILCPSLCPDGDDVCRASLIDLFVHAS
PR3D4_RAT/16-223--------------------------------------LLVSNLLLWEN....MASKPTVLVS........TEDLYHRLV
PR2C2_MOUSE/16-224--------------------------------------LLVNSSLLWKN....VASFPMCAMR.NGRCFMSFEDTFELAG
SOM2_HUMAN/9-215--------------------------------------LLLAFGLLCLSWLQEGSAFPTIP..........LSRLFDNAM
PR8A5_RAT/17-238--------------------------------------LVVSNLLLWEK....AASIPACMVE.DGGCWDPLREAFNSAT
PR6A1_RAT/20-234--------------------------------------LLMSNILLWEN....VASVPRHASGAGRG.EMSLHGLLDHAI
PR7D1_MOUSE/17-240--------------------------------------LLMSNLFLWEK....VSSAPINAS...EAVLSDLKDLFDNAT
CSH2_HUMAN/9-215--------------------------------------LLLAFALLCLP...WLQEAGAVQ.......TVPLSRLFDHAM

PF06875

Q5BNQ4_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSAD----------SLLPTY-
Q5BNQ2_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSAD----------SLLPTY-

PF01110

CNTF_CHICK/1-194--------------------MAAADTPSATLRH----HDLCSRGI-------RLARKMRSDVT----------DLLDIY-
G3VWZ5_SARHA/1-195--------------------MAFPENTPLTPHH----RDLCTRSI-------WLARKIRSDLT----------SLLESY-
E1BFH9_BOVIN/1-193--------------------MAFAEHSLLPPHR----RDLCSRSI-------WLARKIRSDLT----------ALVDSY-
G5AP46_HETGA/1-192--------------------MAFAELSPLTPHR----RDLCSRSI-------WLARKIRSDLT----------ALMDSY-
H0Z9U1_TAEGU/1-188--------------------MAASESPSAALRR----RDLCSRGI-------RLAGKMRADVV----------DLLDAY-
CNTF_HUMAN/1-194--------------------MAFTEHSPLTPHR----RDLCSRSI-------WLARKIRSDLT----------ALTESY-

PF01291

LIF_MOUSE/44-203--------------------------------------NLMNQIK-------NQLAQLNGSAN----------ALFISY-
LIF_BOVIN/43-202--------------------------------------NLMNQIR-------NQLGQLNSSAN----------SLFILY-
ONCM_HUMAN/37-209--------------------------------------VLLGQLQ-------KQTDLMQDTS.----------RLLDPY-
ONCM_MOUSE/34-194--------------------------------------QLLSQLQ-------NQANLTGNTE.----------SLLEPY-
ONCM_BOVIN/34-194--------------------------------------ELLLQLQ-------RQADLMQDPS.----------TLLDPY-

PF03039

IL12A_MOUSE/6-215YLLFLATLAL...LNHLSLARVIPVSGP......ARCLSQSRNLL-------KTTDDMVKTAR----------EKLKHYS
G3VQT1_SARHA/40-247..FLIAILIG...LSQVNWVKSIPVIQSEPSM..HQYLRGSKNLL-------GTVTETLQQAR----------QKLELYS
F6T5A8_MONDO/5-202HIFLIATLIG...LSQIHWATSLPVPQPEPSM..PQCLTASKNLV-------EATNEILQKSR----------KILELYP
IL12A_PIG/6-222NLLLVATLVLLNHLDHLSLGRSLPATTAGPGM..FKCLNHSQNLL-------KAVSNTLQKAK----------QTLEFYS
L8YEA2_TUPCH/1-213.LLLAATLVL...LHHGTLARNLPTAMPGPGK..FGCLSHSQNLL-------TAISNTLQKAR----------KNLEFYS
H0X861_OTOGA/6-217SLLLVAILVL...LDHLSLARNLPRPTPEPGR....CHQHSQKLL-------EAVSTTLQKAR----------ETLNSSS
G1QWH2_NOMLE/40-254SLLLVATLVL...LDHLSLARNLPVATPGPGM..FPCLHHSQNLL-------RAVSNMLQKAR----------QTLEFYP
I3MN91_ICTTR/4-220GLLLLASLVL...LEHLGSARNLPRSTPVPAVS.QECHNLSQTLL-------STVDSALQNAI----------EILEHYP
Q924V6_CAVPO/6-221KCLLLTSLVL...LVSCSLARNLPRASPAPVTEPVQCFNHSQTLL-------RAVNSELHKAI----------QMLAVYS

PF02024

H3AP27_LATCH/26-169-----------------------------------------------------.IEKVKSDAR----------NLTRII-
G3WWV6_SARHA/23-167-----------------------------------------------------PIRKVQDDTK----------TLTKTI-
F6PLK2_ORNAN/23-167-----------------------------------------------------SIEKIQADTK----------TLTKTI-
F7HGW1_CALJA/23-167-----------------------------------------------------PIQRVQDDTK----------TLIKTI-
G5BHA4_HETGA/23-167-----------------------------------------------------PIQKVQDDTK----------TLIKTI-
W5NER9_LEPOC/28-172-----------------------------------------------------...RVKNDAR----------LLAQTT-
H0V7C6_CAVPO/23-165-----------------------------------------------------PMQKLQDDAK----------FLIKTI-
LEP_HUMAN/23-167-----------------------------------------------------PIQKVQDDTK----------TLIKTI-

PF15216

M3WGC3_FELCA/29-153------------------------------------------------------YNFTDCDFG----------KIRKKY-
G3QQC8_GORGO/29-153------------------------------------------------------YDFTNCDFE----------KIKAAY-
F7I7D5_CALJA/29-153------------------------------------------------------YDFTNCDFT----------KIKKEY-
F1RLI5_PIG/17-138------------------------------------------------------YNFTDCDFE----------RIQDIF-
K7E5V9_MONDO/34-162------------------------------------------------------YNFSSCNHY----------QMASDY-
L8YGS5_TUPCH/5-129------------------------------------------------------YNFTNCDFT----------KIKEDY-
J9P5I8_CANLF/29-154------------------------------------------------------YNFIDCDFE----------KIRWKY-
TSLP_MOUSE/20-137------------------------------------------------------YNFSNCNFT----------SITKIY-

PF01109

CSF2_RAT/18-139--------------------------------------------------------APTRSPN----------PVTRP--
CSF2_MOUSE/18-136--------------------------------------------------------APTRSPI----------TVTRP--
CSF2_BOVIN/18-138--------------------------------------------------------APTRPPN----------TATRP--
CSF2_CAVPO/18-140--------------------------------------------------------APTDLLS----------PVTQS--
CSF2_PIG/18-139--------------------------------------------------------APTRPPS----------PVTRP--
CSF2_HUMAN/18-139--------------------------------------------------------APARSPS----------PSTQP--
CSF2_CANLF/18-139--------------------------------------------------------APTRSPT----------LVTRP--

PF02025

G1RQD7_NOMLE/22-133------------------------------------------------------------TEI----------PTSAL--
IL5_CAVPO/23-134------------------------------------------------------------QSA----------TLRAL--
J9NWP5_CANLF/22-132------------------------------------------------------------VEN----------PMNRL--
IL5_MOUSE/21-132------------------------------------------------------------MEI----------PMSTV--
G3WAR7_SARHA/25-134------------------------------------------------------------..N----------PVTEL--
IL5_HORSE/22-133------------------------------------------------------------VES----------PMNRL--
B5FW65_OTOGA/22-133------------------------------------------------------------IEI----------SMSTL--
I3MDT8_ICTTR/23-134------------------------------------------------------------LEI----------PMSTL--
G3T4B0_LOXAF/23-133------------------------------------------------------------IEI----------PVHRL--
G1SL79_RABIT/22-133------------------------------------------------------------TEI----------RMSTV--

PF02059

IL3_CANLF/19-132--------------------------------------------------------.PQAQGR----------P.FSTDL
IL3_MOUSE/27-138--------------------------------------------------------ASI.SGR----------DTHRLTR
IL3_BOVIN/18-132--------------------------------------------------------APQAKGL----------PVVTSRT
G3UC30_LOXAF/22-133--------------------------------------------------------..KAQGM----------P.VTA..
G1MH15_AILME/18-131--------------------------------------------------------APMAQGR----------S.LSTYQ
F1RJV6_PIG/18-131--------------------------------------------------------APQAQGM----------P.TTTLQ
G1RQ11_NOMLE/20-137--------------------------------------------------------APMTQTT----------SLKTS..
IL3_CALJA/19-136--------------------------------------------------------AAPTQTM----------PLKTT..
F1LS41_RAT/29-138--------------------------------------------------------GSA....----------..HRLLR

PF07400

IL11_HUMAN/22-199--------------------------------------------------------PGPPPGP----------PRVSPDP

PF00758

G3TYQ1_LOXAF/25-173--------------------------------------------------------PPACDPR----------LLNKLLR
W5K758_ASTMX/26-175--------------------------------------------------------RPICDLR----------VLDHFIK
B1N8Y2_DANRE/15-168--------------------------------------------------------RPICDLR----------VLDHFIK
F7DTH0_CALJA/31-193--------------------------------------------------------HLICDSG----------VLERYVL
M3XJ62_LATCH/27-177--------------------------------------------------------RPVCDTS----------VMDKFIE
G3W289_SARHA/30-190--------------------------------------------------------.PFCESH----------ILERYIL
F6WUU2_MONDO/31-191--------------------------------------------------------.PFCDSH----------ILERYIL
G3VW20_SARHA/26-175--------------------------------------------------------APVCDPR----------LFNKLLR
G1PF99_MYOLU/45-207--------------------------------------------------------RLICDSR----------VLERYIL
TPO_CANLF/25-176--------------------------------------------------------PPACDPR----------LLNKMLR
F7G570_MONDO/26-177--------------------------------------------------------APVCDPR----------LFNKLLR
H0W023_CAVPO/30-191--------------------------------------------------------RLICDST----------VLERYIV
H2LEX3_ORYLA/33-182--------------------------------------------------------RPICDLR----------VLNHFIQ

PF00489

IL6_BOVIN/27-208--------------------------------------PTPGPLGEDFKNDTTPGRLLLTTPE----------KTEALIK
M3X721_FELCA/27-208--------------------------------------PTPGPLGGD....ATSNRLPLTSAD----------KMEELIK
IL6_HORSE/27-208--------------------------------------PTPLPLGED...ETTSNGPLLTTAD----------KTKQHIK
G3UHF3_LOXAF/20-205--------------------------------------PNPKPLEGDSKDDAASNRPSLTSPD----------KTEELIR
L5KPK4_PTEAL/20-202--------------------------------------PIPVPSGEDSKDDTNSNRPQLTSPN----------QTENLIK
F7HV62_CALJA/27-212--------------------------------------PAPVPLGEDSKEVAAPNRQLLTSTE----------RIDKHIR
IL6_MOUSE/26-210--------------------------------------PTSQVRRGDFTEDTTPNRPVYTTS.----------QVGGLIT

PF16647

CSF3_BOVIN/42-190------------------------------------------------------------------------------VR
CSF3_HUMAN/51-202------------------------------------------------------------------------------VR
CSF3_MOUSE/57-205------------------------------------------------------------------------------VR

PF16649

IL23A_MOUSE/28-185--------------------------------------------------------PDWAQCQ----------QLSRNLC
F7HQI5_MACMU/28-184--------------------------------------------------------PAWAQCQ----------QLSQKLC
F1MSN4_BOVIN/35-192--------------------------------------------------------PAWTRGQ----------QLSQQLC
IL23A_CAVPO/28-184--------------------------------------------------------PSWTQCQ----------QLSQKLC
G3VET0_SARHA/31-186--------------------------------------------------------VAWDLCQ----------ELSQNVT

PF00143

G5E7E1_LOXAF/9-168KK.TFVVL.D--------------QMR...RLSPFSCLKERKD------------------FRF.PQEMV....DGSQL.
IFNE_MOUSE/27-185RE.SLQLL.K--------------PLP...SSSVQQCLAHRKN------------------FLL.PQQPV....SPHQY.
G3I0H8_CRIGR/26-185RK.PLTLL.A--------------QMR...RLSPLSCLKDRKD------------------FAF.PLENM....DAQHI.
H0VF99_CAVPO/28-187LA.CLKLL.R--------------QVK...GKPE.NCHQDRID------------------FKF.PEEIL....QPQQF.
L5KKJ7_PTEAL/25-192WQ.NLKLL.S--------------SMR...NSFPKDCLRENKA------------------FEM.PQEIL....YSTQL.
G1U0Q8_RABIT/26-185RK.TLVLL.G--------------QMR...RVSPVLCLKDRRD------------------FQF.PREVV....NGSQF.
F6YZB3_ORNAN/25-183VEQSLNRL.D--------------RMK...GKSLLSCLEHRKD------------------FQF.PRAVV....EAGLL.
I3MY95_ICTTR/32-186EEGALNLL.K--------------EMR...RIPTSSCLNDRKD------------------FAF.PQKLL....EGEKV.
V8NNB8_OPHHA/15-183KD.NSNLLSS--------------NIR...PTTPLQCMRSFVE------------------LSL.EDIGKKIMIDMNDEC
C8CKA7_PIG/26-185TR.ALRLL.A--------------QMR...RISPFSCLDHRRD------------------FGF.PQEAL....GGNQV.
H0W7G8_CAVPO/26-185AR.ALLLL.E--------------QMK...RISTFSCLKHRQD------------------FGL.AQLNF....DGKQV.
G3GXU9_CRIGR/27-182SE.CLEVL.R--------------QLH...GPL...CLNHRMD------------------FKI.PMEVK....HPGQM.
H0XSG1_OTOGA/26-185RR.ALKVL.A--------------QMR...RISPFSCLKDRSD------------------FGI.PQEKL....NGNQL.
G1KX99_ANOCA/25-184QV.YLELLNS--------------KMNSTISTIPQQCFEDVFN------------------FS..PKMYL....KNLDVS
G3I0I6_CRIGR/27-185RE.SLHLL.K--------------TLP...ISSVYQCLAHRKN------------------FQL.PWQSV....SRHQY.
IFNT4_SHEEP/26-185RE.NLKLL.D--------------RMN...RLSPHSCLQDRKD------------------FGL.PQEMV....EGDQL.
L8Y4J0_TUPCH/27-186RE.SFKLL.N--------------TLR...SSSIQQCLPHRKN------------------FLL.PHKSV....NPQQF.
F7B527_HORSE/26-183QE.TITLL.S--------------QME...RISTLLCLKDRAD------------------FRF.PQILV....DGDQL.
G1Q950_MYOLU/27-184SA.CQKLL.W--------------QLI...TSPQ.HCLDDRMD------------------FQI.PREVE....QPQQV.
M3WTR1_FELCA/26-186RD.NLVLL.G--------------QMR...RLSPFLCLRARKD------------------FRF.PREML....EGGQL.
G5CB66_HETGA/27-185LA.CGELL.K--------------QLK...GKPE.YCLKDRMD------------------FKF.PEEIK....QPQHF.
L9L941_TUPCH/27-198WQ.NLRLL.S--------------SMS...NSFPVECLRENKA------------------FEL.PQEIL....SSTQP.
D2H9N6_AILME/27-184VE.CQNLL.L--------------QLN...GTTK.DCIKDRMN------------------FKF.PEEIE....KPQQV.
D3Z919_RAT/26-179...NLTVL.K--------------QMS...RQSPVSCLKDIQY------------------FEL.PLEKV....DAQQI.
C8CKB9_PIG/24-176RE.IFMLL.R--------------QMK...RTSSQACLKDRTD------------------FQF.PWRGG....KTTRT.
A8E6F6_XENTR/27-179TQ.ILKAF.N--------------EMMPL.KETEEICEEHPTD------------------LPN.TESTY....SVSQV.
L8Y906_TUPCH/26-185QE.TLTAL.A--------------QMG...TISFLSCLKDRTD------------------FKF.PQEQL....DGRQL.
H9L1C3_CHICK/28-183ES.SLQLL.D--------------KMG...RRFPQQCLREKMS------------------FRF.PEQVL....KPR...
L5KWM8_PTEAL/106-263KE.NIAIL.H--------------QMQ.....NSFSCWKDTKN------------------FRF.PLEMV....DGSQV.
G3WZJ8_SARHA/27-182...DFSFL.N--------------QIS...VFSLLPCLKDRTN------------------FTF.PKEAM....EGSQL.
G3UCD2_LOXAF/26-187RR.TLILL.E--------------QMR...RISPSSCLKDRND------------------FGF.PQEEL....EGNKF.
K7GQJ6_PIG/17-164.K.NLALL.C--------------QIR...RISPSFCLKDRKD------------------FGF.PQEMV....EGSQL.
G3I0H3_CRIGR/26-178KT.ALTLL.K--------------EMM...RLSPFSCLKDRKD------------------FAS.PVEKV....DAQHI.
H0VYK7_CAVPO/28-181SA.CLKLL.R--------------QVK...GKPE.HCQQDRMD------------------FKF.PEEIK....QPRPF.
I3N7K4_ICTTR/33-202SE.NLMLL.T--------------NLS...NSIPVQCFREIHN------------------FEL.PEEIL....SSTQP.
L5K635_PTEAL/26-185QE.TSTAL.N--------------QMQ...RISSFLCQKDRKD------------------FRF.PRKMV....DGSQV.
H0W3G0_CAVPO/26-185KK.TFVLL.G--------------QIR...KMPRSLCLKDRSN------------------FLL.PQKMM....TSSKL.
W5JYQ9_ASTMX/23-179VQTCHHLL.D--------------SMG...GAFPFRCLDDYVL------------------VPF.PKAAF....ESNTRK
G3SI98_GORGO/28-185WQ.NLRHL.S--------------SMS...NSFPVECLRENIA------------------FEL.PQEFL....QDTQP.
H0Y0D2_OTOGA/28-187AV.TLKIL.A--------------QMR...RIHPFLCLKDRRY------------------LGF.PQEEF....KNKQP.
IFN_ANAPL/34-190WD.SLQLL.R--------------NMA...PSPTQPCPQQHAP------------------CSF.PDTLL....DTN...
G3UJX3_LOXAF/27-185LA.CQKLL.W--------------KLN...GAPE.SCLEDRMD------------------FKI.PEEIK....QPGQL.
G5C259_HETGA/26-185RR.ALTLL.E--------------QMR...RISTFSCLKDRED------------------FGL.PHQEF....DGKQI.
G3WZF5_SARHA/26-185KS.SIYLL.K--------------KMI...GELHPECQKDRMD------------------FQI.PKEIL....QPKQY.
IFNE_PIG/27-186RE.SLKLL.N--------------KLQ...TSSIQQCLPHRKN------------------FLL.PQKSM....NPHQY.
W5N6G4_LEPOC/27-185EK.SIQAL.K--------------EMG...GGFPVECVSQIIT------------------.TF.PVDAF....KTAENA
H9KYA4_CALJA/26-185RR.ASILL.A--------------QMR...RISPFSCLKDRQD------------------FVF.PQEVF....FGDHF.
D2HTQ4_AILME/33-205WQ.NLRLL.S--------------STS...SSFPVECLRETKA------------------FEL.PQEIL....SHTQP.
IFNB_HUMAN/27-185FQ.CQKLL.W--------------QLN...GRLE.YCLKDRMN------------------FDI.PEEIK....QLQQF.
G1NR05_MELGA/32-188WK.SLQLL.Q--------------KAA...PPPPQNCPQQDVT------------------YPF.PETVL....ESK...
F7BVP5_ORNAN/23-181WQ.SLHLL.D--------------EMG...GQFPLHCLKERMK------------------FKL.PAEMV....HPHQF.
F7G875_MONDO/27-182QR.SLMFL.N--------------KMI...GKLHPECLQERMD------------------FQI.PREIV....QPRQC.
C8CKC3_PIG/33-205WQ.NLRLL.S--------------RMS...HSFPIECLTESKA------------------FEL.PQEIL....SHTQP.
I3MVD7_ICTTR/34-186EG.ALTLL.E--------------KMR...RIPTFSCLNYRKD------------------FAF.PQEQL....EGEQV.
F7A317_HORSE/26-184TR.VLMLL.G--------------QMR...RISPFSCLKDRND------------------FGF.PQEVF....DGNQF.
G1KU56_ANOCA/28-182KE.NLAVLKS--------------QLG...SVFPLQCLNDVIS------------------FSSQPEEEN..IQSIFEL.
L5KBH2_PTEAL/26-185KE.NIALL.H--------------QMQ...RISSFRCRKDRKN------------------FGF.LREMV....DGSHM.
L5K909_PTEAL/26-185RR.ALMLL.G--------------QMR...RISPFSCLKDRED------------------FGF.PQEAF....SGNQF.
I3N5Z0_ICTTR/23-179EE.NLQLL.N--------------NLQ...TSSIQQCLPYRKN------------------FRL.PQNSV....NFHQY.
F7GHL9_MONDO/26-181...DFSLL.N--------------QMS...TSSLVPCLKEWTN------------------FSF.PKEAL....DGSQL.
IFNE_HUMAN/27-186QE.SLKLL.N--------------KLQ...TLSIQQCLPHRKN------------------FLL.PQKSL....SPQQY.
I3LBU7_PIG/26-179RK.NLVLL.C--------------QMR...RISPSFCLKGRKD------------------FGF.PQEMV....ERSHL.
G3UK87_LOXAF/27-184QE.TFTPL.G--------------QMR...R...FFCLKERKD------------------FRF.PR.MV....YGSHL.
L9LC61_TUPCH/27-185LA.CKKFL.Q--------------QLG...GVPE.DCLKDRMS------------------FEV.PEEIQ....RPQQF.
IFNB_RAT/27-182RT.CQKLL.R--------------QLN...GRLN...LSYRTD------------------FKI.PMEVM....HPSQM.
H0XMZ9_OTOGA/27-186RE.SIKLL.N--------------ELQ...TSSVQQCLPHRKN------------------FLL.PEKPV....SPQHY.
G3VDC6_SARHA/27-182...DVSLL.Y--------------QMS...TFSLLSCLKDRTD------------------FKF.PEEAV....EGSQL.
I3JM36_ORENI/26-182EE.TLKLL.D--------------TMA....NNSTNITEVEVT------------------VPF.PNHLY...RQVSKS.
L5LKN9_MYODS/27-186RE.SSELL.K--------------KWQ...PSSIRQCLPHRKD------------------FLL.PQEAG....NPHQD.
G1TYS8_RABIT/29-195RK.NMKLL.R--------------NVS...HSFPIECLREIKD------------------FEL.PQEIL....SHSQM.
I3UJJ8_FELCA/27-185RE.SLKLL.S--------------TLQ...SSSIQQCLPHRKN------------------FLL.PQRSV....NPRQY.
C8CKA9_PIG/26-183PE.IFTLL.R--------------QMG...RLSILSCLKDRTD------------------FRF.PRTLV....DGNQV.
IFNT2_BOVIN/3-162RE.NLRLL.A--------------RMN...RLSPHPCLQDRKD------------------FGL.PQEMV....EGNQL.
H0W510_CAVPO/26-186MR.ALILL.G--------------QRR...RISAFSCLKHRQD------------------FGL.AGLEF....EGKQV.
M3Z729_MUSPF/26-183WR.ALMLL.R--------------QMK...RVSAFSCLRDRND------------------FAF.PQEVF....DGKQL.
IFNA1_MOUSE/26-185KR.ALTLL.V--------------QMR...RLSPLSCLKDRKD------------------FGF.PQEKV....DAQQI.
G3TTC1_LOXAF/26-185EK.TVDLL.D--------------QMQ...RCPTFFCLDDRKD------------------FRF.PQEMV....DGSQL.
G1PDS6_MYOLU/29-199WQ.NVELL.T--------------NMS...KSLPLECLRENKA------------------FEL.PREVL....AYSQPL
F7ABU5_MONDO/27-182...DFSLL.N--------------QMS...TSSLVPCLKDGIN------------------FNF.PKEAM....DRSQL.
G1TTX4_RABIT/27-180LT.CAKLL.L--------------QLN...GTTE.DCLNERIN------------------FKV.PKEIK....EPQQL.
H0XRP5_OTOGA/26-185RR.ALIPL.V--------------HMR...RISPFSCLKDRSD------------------FRF.PREEM....RGKQL.
H0WK94_OTOGA/33-202LQ.NLRLL.S--------------SMS...NSFPRECLKENKD------------------FEL.PQEIL....SHTQT.
G1KYL3_ANOCA/23-176QA.NLDVLHR--------------NMG...PSISQQCIDDVFS------------------FS..HREAL....GNINVS
G3WZQ8_SARHA/26-181...DFSLL.N--------------QMS...TFFLLPCLKDRTN------------------FNF.PKEAV....EVNQL.
H2R6R8_PANTR/26-185RR.ALILL.A--------------QMG...RISPFSCLKDRHD------------------FGF.PQEEF....DGNQF.
H0YTY6_TAEGU/34-188GD.ALRLL.Q--------------DMA...PSHTQPCHLQEPP------------------F.F.PDTLL....HPNL..
I3MXH1_ICTTR/27-185VE.CQKLL.E--------------QLN...GRPA.DCLSDRMD------------------FKI.PKEIK....HPQQF.
M3WRV1_FELCA/26-184RR.ALTLL.G--------------QMR...RLPASSCQKDRND------------------FAF.PQDVF....GGDQS.
H0W4H8_CAVPO/23-182RL.SLQLL.N--------------NLR...TSLVQQCLLHKKS------------------FLI.PQKSV....GSKPC.
R4GKJ6_CHICK/35-191HD.SLQLL.R--------------DMA...PTLPQLCPQHNAS------------------CSF.NDTIL....DTS...
A3FBE8_MUSPF/27-184VE.CQELL.L--------------QLN...GTSK.DCLKDRMN------------------FKI.PEEIQ....KSQKF.
G1KWE0_ANOCA/28-180QA.NLELLNS--------------KMG...STIPQQCIEDVFS------------------FS..PKEDL....RNLDVS
G7PS89_MACFA/26-185RR.PLVLL.A--------------QMR...RISPFSCLKDRHD------------------FEL.PQEEF....DDKNF.
G1Q880_MYOLU/26-185RE.NLELL.S--------------QMS...TISPFFCLKDRKD------------------FRF.PRATV....DGSQV.
IFNB_MOUSE/27-180RK.CQELL.E--------------QLN...GKIN...LTYRAD------------------FKI.PMEMT......EKM.
IFNB2_BOVIN/27-184AL.CQKLL.R--------------QLP...STPQ.HCLEARMD------------------FQM.PEEMK....QAQQF.
G1SJC4_RABIT/26-185RR.SSMLL.G--------------QMR...RVSPLSCLQDRHD------------------FEC.PLEEL....GGHQA.
W5PG31_SHEEP/26-185RR.VLTLL.R--------------QLR...RVSPSSCLQDRKD------------------FAF.PQEAL....GGSQL.
IFNA3_CANLF/26-183WR.VLTLL.G--------------QMR...RLSASSCDHYTTD------------------FAF.PKELF....DGQRL.
G5BPX2_HETGA/27-199KE.NVRLL.S--------------SVS...NPLPLRCLREIKA------------------FGL.PQNIL....SYSQH.
IFNW2_HORSE/26-185RK.NFVLL.G--------------QMS...RISSAICLKDRKD------------------FRF.PQDMA....DGRQF.
G3N2A8_BOVIN/26-185RK.NLRLL.G--------------QMR...RLSSRFCLQDRKD------------------FTF.PQEMV....EGSQL.
H0XKS8_OTOGA/27-185LG.CQKLL.R--------------QLN...GKPE.GCLKDRMN------------------FEI.PKEIK....QPQHL.
H0VUV7_CAVPO/26-185TT.ALSLL.E--------------QMR...RTFTFSCLKHRQD------------------FGL.ALLDF....DGKQV.
Q29412_PIG/27-184LA.CQKLL.G--------------QLP...GTPQ.YCLEDRMN------------------FEV.PEEIM....QPPQF.
G7PS88_MACFA/26-185RR.TMMLL.K--------------QMS...RISPSSCLMDRHD------------------FGF.PQQEF....DGNQF.
M3WZS7_FELCA/26-181PE.TFTLL.S--------------QME...RVSILSCLKDRTD------------------FNF.PQILV....AGNQL.
H9GZR7_HORSE/26-185QE.TLRVL.D--------------QME...TISPPSCLKHRTD------------------FKF.PQEQL....DGRQF.
F1LVL8_RAT/26-184RE.SLQLL.K--------------ALP...SSSVQLCLAHRKN------------------FLL.PQQSV....SPHQH.
M3YX13_MUSPF/27-179RE..LKLL.N--------------KFP...KSSVQPCLPHRTN------------------FLL.SQQSV....NRRRS.
G1L8G2_AILME/26-185WR.ALTLL.S--------------QME...RISILSCLKDRTD------------------FSF.PQMLV....DGSKF.
IFNB_HORSE/27-184SA.CLMLL.R--------------QLN...GAPQ.RCPEDTMN------------------FQV.PEEIE....QAQQF.
H0W289_CAVPO/26-190RK.ILELL.D--------------QMR...RISTFLCLKDRRD------------------FRF.PKEMM....TGNQV.
A8E6E8_MONDO/27-182...DFSLL.N--------------QMS...TFSLVPCLKDRTS------------------FNL.PKEAL....EDNKL.
I3N788_ICTTR/27-185LE.CQKLL.Q--------------QLN...GRPE.DCLSDRMD------------------FKI.PKEIK....HPQQL.
G1L8I1_AILME/26-183WR.ALTLL.G--------------QMK...RMTAFSCLKDRND------------------FAF.PKEVV....DGKQL.
IFNB_FELCA/27-184LE.CQELL.V--------------NLN...RTSK.YCLKDRMN------------------FEV.PEEIK....KSQRF.
H0VXI5_CAVPO/26-181TR.ALILL.G--------------QMR...RISTFSCLKDRQG------------------FDL.....F....DGKQV.
G3TS29_LOXAF/26-179QE.TFTLL.N--------------QME...RISLLSCLKDRTD------------------FRF.PQILM....DMNQL.
W5PZ39_SHEEP/26-184WQ.NLRLL.S--------------RMS...NSFPIECLQERKA------------------FEL.PQEIL....SYTQP.
G3I0H6_CRIGR/26-178KT.ALTLL.K--------------EMR...RLSPFSCLKDRKV------------------FAS.PVEKV....DAQHI.
I3L756_PIG/26-180RK.NLVLL.H--------------QMR...RLSPSFCLKDRKD------------------FGF.PQEMV....EGSQL.
M3Z715_MUSPF/26-183WR.ALMLL.R--------------QMK...RISLIFCDKYIND------------------FAF.PKKVF....HSKQL.
M3VXI8_FELCA/33-205WQ.NLRLL.N--------------SMS...NSFPVECLRESRA------------------FEL.PQDIQ....SHTPP.
G3R8Q7_GORGO/26-185RN.TLVLL.H--------------QMR...RISPFLCLKDRRD------------------FRF.PQEMV....KGSQL.
A8E6F5_XENTR/51-202RQ.TLKTF.E--------------EMNPP.EDYDESCQYDSIE------------------LPN.IDEIY....SISQM.

PF02947

FLT3L_MOUSE/30-162FKVKFRELTD--------------HLL---KDYPVTVAVNLQD------------------...............EKH-
F6T7S9_ORNAN/28-157FGLHIHNLAQ--------------YLL---QDYPVSVVTNLQT------------------...............DEL-
H9GP84_ANOCA/29-165FPSIVKNLKK--------------LLL---LDYPVPVPVNLKQ------------------...............DEF-
F6TPW7_MONDO/34-163FLQAIGRLSD--------------YLL---TDYPVEVPDNLQ.------------------...............DER-
G5B8P0_HETGA/20-150FKIKFSTLSD--------------YLL---KDYPVTVAANLQD------------------...............EQF-
G1M637_AILME/29-159FSVTIHKLSD--------------YLL---QDYPVTVASNLQD------------------...............DEL-
L9JA37_TUPCH/769-910FADRIDQLSD--------------YLL---LDYPVTMASNLQD------------------PGTGPPRLQRAWSPQEEL-
G3VSA3_SARHA/79-209YPGIISTLSD--------------FML---GDYPVDVPENLRV------------------...............DEQ-
G1QZC3_NOMLE/30-160FAVKIRELSD--------------YLL---QDYPVTVASNLQD------------------...............EEL-

PF03487

G1SCQ2_RABIT/16-144LVSPGPVPP.PT...SL-------KEL---IEELVNITHNQ..K---------------------APLCNGTMV-WSVN-
IL13_HUMAN/16-144FASPGPVPP.ST...AL-------REL---IEELVNITQNQ..K---------------------APLCNGSMV-WSIN-
IL13_RAT/2-130LATPGPVRRSTSPPVAL-------REL---IEELSNITQDQ..K---------------------TSLCNSSMV-WSVD-
F7DGH7_MACMU/16-151FASPSPVPP.ST...AL-------KEL---IEELVNITQNQ..K---------------------APLCNGSMV-WSIN-
L5M5Z7_MYODS/2-128LASPGPVRP.LT...VV-------KEL---IEELDNITQ....K---------------------APLCNGSMV-WSVN-
G5ASP9_HETGA/2-130LTAPGPVPS.SA...AL-------REL---IEELANVTQNH..K---------------------TPLCSGSMV-WSVN-
B3GDZ5_PIG/2-130LASPGPVPPHST...AL-------KEL---IEELVNITQNQ..K---------------------TPLCNGSMV-WSVN-
L8YAP6_TUPCH/2-128LASPASVPS.IR...AL-------KEL---IEELDNVTQNQ..K---------------------AQLCNGSMV-WSVN-
IL13_BOVIN/2-130LTSPSPVPS.AT...AL-------KEL---IEELVNITQNQ..K---------------------VPLCNGSMV-WSLN-
IL13_MOUSE/2-130LAAPGPVPRSVSLPLTL-------KEL---IEELSNITQDQ...---------------------TPLCNGSMV-WSVD-
H0W834_CAVPO/16-149LTAPGPVPVSSTVAVSI-------KEL---LGELVNITQDQ..K---------------------TPLCNSSMV-WSVN-
F6WQF3_ORNAN/2-128..SAKPVTR.SKENARL-------EEL---ISYLSSLNLPN..K---------------------QSLCNGSMV-WKVN-
G3T2N9_LOXAF/2-133LASPVPVY..NRHIWVL-------REL---IGELINITQNQLPQ---------------------ASLCNGSMV-WNVN-
M3YGH3_MUSPF/2-126LASPGPVHN.LT...TT-------KEL---IEELANITQNQ...---------------------ASLCNGSMV-WSVN-
B5FW67_OTOGA/2-129LASPGPVPR.LT...KL-------KEL---IEELDNITQNQ..R---------------------APLCNGSMV-WSVN-
I3MAR4_ICTTR/2-131LAAPGPVPPPSP...AF-------REL---IEELVNITQDQ..K---------------------APLCNGSMV-WSVN-
IL13_CANLF/2-129LASPSPVTP.SP...TL-------KEL---IEELVNITQNQ...---------------------ASLCNGSMV-WSVN-

PF00727

IL4_FELCA/26-131LT..ARNDS------CM-------ELT---VMDVLAAPKNTSDK....................-EIFCRATTVLRQIY-
H0XDE1_OTOGA/26-149LT..ENKTP------CD-------ELT---VADIFAASKNTTEK....................-EIFCRAATVLRQVY-
IL4_MOUSE/27-140VT..GEGTP------CT-------EMD---VPNVLTATKNTTES....................-ELVCRASKVLRIFY-
G3T4B8_LOXAF/26-132LT..EKKHA------CT-------ELT---VADAFAAPKNTTEK....................-ETFCRATTVLWQVS-
IL4_RABIT/28-143LT..ERKTP------CT-------KLM---IADALAVPKNTTER....................-EAVCRAATALRQFY-
G5ASQ0_HETGA/25-138LS..SQKTP------CA-------ELA---AADVFAAPKDTAEK....................-..LCQAVTVLHRTS-
F6U5N6_HORSE/26-135LTDGKGKNS------CM-------ELT---VADAFAGPKNTDGK....................-E.ICRAAKVLQQLY-
IL4_BOVIN/26-133LT..TRKNS------CM-------ELP---VADVFAAPKNTTEK....................-ETFCRVGIELRRIY-
G3QSC0_GORGO/26-149LT..EQKTL------CT-------ELT---VTDIFAASKNTTEK....................-ETFCRAATVLRQFY-
A3FBF0_MUSPF/26-130LT..ARNDS------CM-------ELT---VTEVFSAPKNTSEK....................-EIFCRAATVLQQLS-
IL4_RAT/27-139VT..EKGTP------CT-------EMF---VPDVLTATRNTTEN....................-ELICRASRVLRKFY-
G3WEJ0_SARHA/28-149LT..TKKFL------CS-------EME---VLDIFEDTKKNSSTRKLLPEMSSCSQLAMTVNDF-ETLCRAVTVLQQAS-
I3MAS4_ICTTR/24-141LS..GKKTT------CM-------ELM---VADVFAVPKNTTEK....................-EILCRATTVLRQTY-
IL4_PIG/26-131LT..ARKNS------CM-------ELP---VTDVFAAPENTTEK....................-ETFCRASTVLRHIY-

PF00726

IL10_BOVIN/5-174LRELRAAFGK-----VK-------TFF---------QMKDQLH------------------SLL-LTQS------L-LD-
IL10H_EBVB9/7-167LRDLRDAFSR-----VK-------TFF---------QTKDEVD------------------NLL-LKES------L-LE-
G3HB01_CRIGR/14-174LRELRTAFSQ-----VK-------TFF---------QKKDQLD------------------NIL-LTDS------L-VQ-

PF14565

IL22_HUMAN/40-178YITNRT-FML-----AK-------EAS---------LADNNTD------------------VRL-IGEK------L-FH-
E1C1U2_CHICK/46-184YIRNRT-YTL-----AE-------MAR---------LSDQDTD------------------NRL-IGQQ------I-YV-

PF15177

IFNL3_CHICK/28-182-LELKA-VWR-----MK-------EQF---.EDIMLLTNRKCN------------------TRL-FHRK------WDIA-
F1M3K4_RAT/31-188-QELQA-FRK-----AK-------DAI---.EEGLLPKDVRRA------------------SRL-LPRD------GNLQ-
I3MK89_ICTTR/34-194-QELQA-FRK-----AR-------DAF---.EDSHLPKDHNCP------------------SPL-FPRP------WDLR-
F1PY54_CANLF/31-186-RELEA-FKK-----AK-------DAL---.EESLSWKNWSCS------------------SRL-FPRS------RDLR-
H0XRJ1_OTOGA/35-191-QEVET-FKK-----AK-------DAL---.ENSLSQINWSCS------------------SRF-FPRP------WDLR-
M3W3J2_FELCA/32-181-QELRA-RRV-----TR-------PAG---.......PDLTPR------------------PRL-FPRT------WDLR-
F6PNH9_HORSE/31-184-SELEA-FKK-----AK-------DAL---.ENSL..ENWTCR------------------SPV-FPTT------WDLR-
D2DJP5_XENTR/23-178-SDIRA-VRR-----LH-------NEH---.EKSPFSDGIKCY------------------RKM-LRQK------PSVC-
G3TQK4_LOXAF/32-188-RELQA-FQR-----AK-------DAF---.EESLLLKDGSCS------------------SLL-FPRT------WDLR-
F7DXI8_HORSE/34-187-GERLA-FKN-----AT-------DAF---.EESFWLKNHTCR------------------SRP-FPRT------WDLR-
F6W920_MONDO/30-184-REMEA-FTM-----AK-------DTY---.EKSMLQKKRKCS------------------SKF-FHRG------WDFR-
U3KED0_FICAL/27-186-EEQKA-VDK-----MR-------LSL---.GSCLQVNNHKCN------------------TRL-FHRK------WNAV-
H0VBN4_CAVPO/39-195-QELQA-FKT-----AK-------DAF---.EEQLLLKDSRCS------------------LRL-FPRT------WDLG-
IFNL4_HUMAN/25-174-RTLAA-AKA-----LR-------DRY---EEEALSWGQRNCS------------------...-FRPR------RDPP-
IFNL2_MOUSE/32-189-KELQA-FKK-----AK-------DAI---.EKRLLEKDLRCS------------------SHL-FPRA------WDLK-
G3N0M3_BOVIN/37-192-QELQA-FKT-----AR-------DAF---.EDSFLPKDWDCS------------------THL-FPRT------RDLK-
G1LPU9_AILME/37-191-RELEA-FRK-----AK-------DAL---.ENSL..KNWSCS------------------SRL-FPRN------RDLR-
L5LZZ9_MYODS/163-319-QEMKA-FKR-----VK-------DAL---.EESLLLKNWSCG------------------SRP-LPRT------RDLR-
IFNL3_HUMAN/34-192-QELQA-FKR-----AK-------DAL---.EESLLLKDCKCR------------------SRL-FPRT------WDLR-
F6R8C9_XENTR/23-177-SDIRA-VRR-----LH-------NEN---.PISVFLRDIVFY------------------LSL-FGSL------LQIC-
G3VJ97_SARHA/12-167-RELET-FKV-----AK-------DAY---.EKAMLQTERKCS------------------SRF-FHRN------WDLR-
H0XJU8_OTOGA/36-192-KELQA-FKR-----IK-------DVF---.EESLLPEDCRGS------------------SHL-FPRP------WSLR-
G3HJD0_CRIGR/30-187-QEREA-FLK-----AT-------DAI---.EKWLLNKDVRCS------------------SRL-FPKA------WDLK-
G1LPW2_AILME/34-190-QELQA-FKK-----AK-------DIF---.EESLSLKAWSCR------------------PRL-FPRT------WDLQ-
L5L378_PTEAL/33-182-TEWKA-FKK-----AK-------DAL---.ENSL..KNQSCS------------------FSL-FPRN------WKLT-
G1T4B0_RABIT/34-188-RELEA-FKT-----AR-------DAL---.EESLLLKSRRHP------------------SSL-TSQE------W...-
U3IYH6_ANAPL/34-185-SELAE-VLK-----FK-------KYY---.ENIT.SKDSKCS------------------TRL-FNRK------WTPN-
L9LBW1_TUPCH/31-181-RELEA-FKK-----AK-------DAL---.EKSLSLKKYSCK------------------FRL-FPRD------WHPR-
D0FHA1_PIG/36-191-QALQA-FKR-----AK-------DAF---.EESLL.EDWNCS------------------SRI-FPRS------RDLK-

PF05337

CSF1_HUMAN/41-180-SQMET-SCQ-----IT-------FEF----VDQEQLKDPVCY------------------LK-----------------
Q3TLQ6_MOUSE/41-180-SQMET-SCQ-----IA-------FEF----VDQEQLDDPVCY------------------LK-----------------
O77709_BOVIN/41-180-SQMET-SCQ-----IS-------FEF----VDQEQLDDPVCY------------------LK-----------------
O77710_BOVIN/41-180-SQMET-SCQ-----IS-------FEF----VDQEQLDDPVCY------------------LK-----------------
Q64129_9MURI/41-180-SQMET-SCQ-----IA-------FEF----VDQEQLDDPVCY------------------LK-----------------

PF15036

IL34_MOUSE/28-184QYKNRLQYMK-----HY-------FPI---NYRIAVPYEGVLR------------------VAN-ITRL......QKAH-
R4GIU3_CHICK/19-177RYEMRLQYMK-----HN-------FPI---DYTLRVQHEEVLR------------------TAN-VTRL......RDGK-
F7EA00_CALJA/29-185QYRNRLQYMY-----VS-------FKI---NYLLKLXQQAMFH------------------HTQ-LDVL......QRAR-
H0WFN4_OTOGA/28-184QYRNRLRYMK-----HY-------FPI---NYMISVPYEGVFR------------------IAN-ITKL......HRAR-
M3ZVZ0_XIPMA/24-191SH..RRRYMK-----HN-------FPI---NYAIRVHHEEIFK------------------LSN-ISKMKLKVEGLDEL-
U3JY35_FICAL/18-179QYEMRLQYMK-----HY-------FPI---DYTVQVQYEEVLR------------------PSN-ITRL......RNGT-
L9KJY3_TUPCH/28-184QYRNRLQYMK-----HY-------FPI---NYRIGVPYEGVLR------------------AAN-ITRL......RRAR-
G3T3A6_LOXAF/28-182QYKNRLQYMK-----YN-------FPI---NYRISVPYEAVLR------------------VAN-ITRL......QRAQ-
F6W3U1_MONDO/15-167QYRHRLRYMK-----HY-------FPI---DYRIRVPYEGVLR------------------LAN-ITRL......QQAE-
I3JZ08_ORENI/24-192SH..RRQYMK-----HN-------FPI---EYTIKVHNREIFR------------------LSN-ISRMRLRTEGLNEL-
L5MCR9_MYODS/28-182QYRNRLLYMK-----QY-------FPI---GYRVSMPYEGVLR------------------AAN-VTRL......QRAR-
B3DLJ8_DANRE/23-195NATLRRRYMK-----MH-------FPI---NYTVQVRYEEVFR------------------LRN-ISRL.VNTSNEEEP-
IL34_BOVIN/28-183QYRNRLQYMK-----HY-------FPI---NYRVSVPYEGVLR------------------TAN-VTRL......QRAQ-

PF00714

IFNG_HORSE/15-152FKEIEN---------LK-------EYF---NASNPDVGDGGPL------------------FLD-ILKN------WKE.-
H0WPL1_OTOGA/15-151SAEIDQ---------LK-------EYF---NTSSTDTAGGGIL------------------FLD-ILKN------WEK.-
Q8CGS0_CAVPO/15-154TNEIRI---------LK-------NYF---NADNSDVGDNGTL------------------FVG-ILKN------CQE.-
B9VS86_CALJA/15-152VKEAEN---------LK-------KYF---NAGDSDVADNGTL------------------FLD-ILRT------WRE.-
G3SUC6_LOXAF/15-152LKEIQN---------LK-------EYL---NATDSDVADGGPL------------------FID-ILKN------WKE.-
G3GY20_CRIGR/2-135IEEIEN---------LK-------KYF---NSSSEDVGNGGDL------------------VFN-TLMN------WQK.-
I3MNV6_ICTTR/15-152NKEIEA---------LK-------EYF---NASNSNVSDGGSL------------------FLD-ILDR------WEE.-
L5LME8_MYODS/15-153FNETQK---------LK-------RYF---NATSSDVGNGGHL------------------FLD-ILMN------WKG.-
G5BGB5_HETGA/15-152TKEINI---------LK-------DYF---NASSSDVGDNGTL------------------FVG-ILKN------CQE.-
G3WQJ9_SARHA/15-153REDMQT---------LH-------NYF---NATKSDVSDGSSL------------------FMD-MMKT------WKEG-
IFNG_SHEEP/15-152FKEIEN---------LK-------EYF---NASNPDVAKGGPL------------------FSE-ILKN------WKE.-
IFNG_RAT/14-151IESLES---------LK-------NYF---NSSSMDAMEGKSL------------------LLD-IWRN------WQK.-
IFNG_RABIT/15-152TRETEH---------LK-------AYL---KANTSDVANGGPL------------------FLN-ILRN------WKE.-
L9KVU0_TUPCH/51-188MKEVQN---------LK-------NYF---NATDPGVGDTGRL------------------FVD-ILKN------WTE.-
IFNG_FELCA/15-153FKEIEE---------LK-------GYF---NASNPDVADGGSL------------------FVD-ILKN------WKE.-

PF02404

R4GD07_ANOCA/1-283LVKTQSPCGNPVTDDVN-------DIA---KLVGNLPNDYMIA------------------LKY-VRKM-------DTL-
SCF_CHICK/1-287LVKAQSSCGNPVTDDVN-------DIA---KLVGNLPNDYLIT------------------LKY-VPKM-------DSL-
SCF_RAT/1-273LVKTQEICRNPVTDNVK-------DIT---KLVANLPNDYMIT------------------LNY-VAGM-------DVL-
G1NWC8_MYOLU/1-272LVRTTGICTNRVTDDVK-------DVT---KLVANLPKDYKIG------------------LKY-VPGM-------DVL-
F7EP53_MONDO/1-273LVKTKGICGNPVTDDVK-------EIT---TLVANLPNDYMIP------------------LKY-VPDM-------ELL-
F7C5I3_ORNAN/1-273LIRAQKNCGNPVTDDVK-------DIT---KLVGNLPNDYMIA------------------LKY-VPEM-------DGL-
F7G0W2_CALJA/1-273FVKTEGVCRNRVTNNVK-------DVT---KLVANLPKDYMIT------------------LKY-VPGM-------DVL-

PF02372

IL15_PIG/33-160.....HVISD------L-------KKI----------EDLIR-------------------SIH-MDATLYT.ES-DAH-
IL15_CAVPO/33-160.....DVIYD------L-------KRI----------ENLIQ-------------------SIH-IDATLYT.ES-DVH-
IL15_FELCA/33-160.....DVISD------L-------KII----------DKIIQ-------------------SLH-IDATLYT.ES-DVH-
IL15_SHEEP/33-160.....SVIHD------L-------KTI----------EHLIQ-------------------SMH-MDATLYT.ES-DAH-
F1NZN5_CHICK/55-183.....DVLKD------L-------ELI----------K...T-------------------SED-IDVSLYTANT-YED-
G1NDP6_MELGA/5-137LEILPALIKD------L-------EIL----------EESKN-------------------KIH-VV..LYT.PN-EIK-
O73883_CHICK/5-138RKPLQTLIKD------L-------EIL----------ENIKN-------------------KIH-LE..LYT.PT-ETQ-
Q8JFF4_ANAPL/4-134.NTLKTLIKD------L-------ENL----------GTSMN-------------------GID-LE..LYT.PN-DTK-

PF00715

I3MQX6_ICTTR/7-151RQQLEHLLLD------L-------QVL---SRGVSNQENSTL-------------------TRM-LKFKFYM-PK.KAT-
G5C793_HETGA/7-149QEQLEQLLLD------L-------QVI---LKGVT..RNPKL-------------------SKM-LKPKLYF-PN.KPS-
G1PJ32_MYOLU/7-147QQQLEHLILD------M-------QRL---LNGVSNYKNSKL-------------------PMM-LTFKFYM-PR.NAT-
B1AB81_HORSE/7-146QQQLKQLQMD------L-------KLL---LEGVNNNKNPKL-------------------SKM-LTFKINM-PK.KAT-
G3HTL8_CRIGR/7-150QQHLEQLLLD------L-------QVL---LKGINNNKNPKL-------------------PMM-LTFKFYM-PK.KAT-
IL2_MACMU/7-151QLQLEHLLLD------L-------QMI---LNGINNYKNPKL-------------------TRM-LTFKFYM-PK.KAT-
H0Y254_OTOGA/7-149RQQLEQLLLD------L-------QMV---LNGVNNNKNPKL-------------------SRM-LTLKLYV-PK.KAT-
IL2_MOUSE/7-165QQHLEQLLMD------L-------QEL---LSRMENYRNLKL-------------------PRM-LTFKFYL-PK.QAT-
G3SU90_LOXAF/7-147QQQLEQLLLD------L-------QML---LIRVKNYETRRL-------------------SMI-FTFKFNM-PK.EVT-
IL2_PIG/7-151KKQLEPLLLD------L-------QLL---LKEVKNYENADL-------------------SRM-LTFKFYM-PK.QAT-
IL2_FELCA/7-151QQQLEQLLLD------L-------RLL---LNGVNNPENPKL-------------------SRM-LTFKFYV-PK.KAT-
L5K7D9_PTEAL/7-149QQQLEHLLKD------L-------QRL---LETVNNYKNHEL-------------------SSM-LTFKFYM-P..NAT-
IL2_BOVIN/7-152MKEVKSLLLD------L-------QLL---LEKVKNPENLKL-------------------SRM-HTFDFYV-PKVNAT-
H0VBY4_CAVPO/7-149QDRLELLLRD------L-------QTL---LEGVT..SNPRL-------------------PKM-LKLKLYP-PK.MVS-

PF01415

H0X0U6_OTOGA/15-141-LDINFLINK-----.L-------QTD---LSSKCSCS.SNV-------------------TSC-L..CLPI-PS-----
G1QNL2_NOMLE/28-172-LMVS..IDQ-----LL-------DSM---KEIGSNCL.NNE-------------------FNF-F...KRH-IC-----
IL7_BOVIN/28-171-LMVN..IDD-----.L-------DNM---INFDSNCL.NNE-------------------PNF-F...KKH-SC-----
H0VFS1_CAVPO/31-152-ILVS..IDE-----.L-------DKM---LHIDSNCL.KKE-------------------PNY-F...KKH-SC-----
F1PA23_CANLF/29-154-LMIS..IND-----.L-------DIM---IKNRTNCS.NNE-------------------PNI-L...KKH-AC-----
M3WJR8_FELCA/15-139-QDVTYLINK-----.L-------QEH---PPSKCDCG.TNV-------------------TDC-L..CLPI-PS-----
IL9_MOUSE/15-141-RDTNYLIEN-----.L-------KDD---PPSKCSCS.GNV-------------------TSC-L..CLSV-PT-----
U3KN10_RABIT/31-153-LMIS..INE-----.L-------DKM---IEIGSNCL.NNE-------------------SNF-F...KKH-SC-----
A0MZ91_PIG/18-138-KNVEHLINN-----.L-------QKH---PPAKCSCS.PNV-------------------TDC-L..CLPI-PS-----
K7E262_MONDO/59-200-LHEG..IEI-----.L-------EKA---INF.ANCS.SKE-------------------YSS-L...KNH-TC-----
E1BF10_BOVIN/18-141-RNAVYLIDN-----.L-------QKD---TSSKCSCS.TNA-------------------TDC-L..CLPI-SS-----
F6PLW3_HORSE/15-136-MDVKYLIDN-----.L-------QVS---FREG.....AAV-------------------SEC-FLSILII-YQ-----
IL9_HUMAN/15-141-LDINFLINK-----.M-------QED---PASKCHCS.ANV-------------------TSC-L..CLGI-PS-----
IL7_MOUSE/28-151-LMIS..IDE-----.L-------DKM---TGTDSNCP.NNE-------------------PNF-F...RKH-VC-----
G5BX09_HETGA/15-141-RYINYLISN-----.L-------QKD---PLSTCSCS.ANV-------------------TSC-L..CLPI-PS-----
L8Y4N8_TUPCH/15-141-WNLNSLIQK-----.W-------QEE---PSAKCNCS.ANV-------------------TSC-L..CLPI-PS-----
D4A8I9_RAT/15-141-QHTSYLIEN-----.L-------KDD---PSSKCSCS.ANV-------------------TSC-L..CLPI-PS-----
G3TKQ6_LOXAF/16-136-KDVNYLIQK-----.L-------QEH---PPSKCECS.GNV-------------------TDC-L..CLPI-PS-----
M3YEX7_MUSPF/16-137-RDVTHLIDK-----.L-------QEH---PASKCNCSRANV-------------------TDC-L..CPTI-PS-----
G1NXN3_MYOLU/28-153-IMVS..LND-----.L-------DRI---RENDSNCL.NNE-------------------PNF-F...KKH-SC-----

PF00103

PLRP1_BOVIN/26-238SLSHDFYNLS------T-------IMF---NEFDEKYAQGKL......YYINVT.......KSC-HTNSFHA-PEERDI-
CSH2_BOVIN/26-238SLSHDFHNLS------T-------IMF---NEFDEKYAQGKL......YYINAT.......KSC-HTNSFHT-PEERDK-
PLRP3_BOVIN/1-213RLSHDIVNHT------T-------IMF---HEFDEKYAQNQP......YTINAT.......KSC-HTNSLHT-PQEREK-
PR4A1_RAT/17-227KISQDMNQYI------S-------DLS---THVKIFYAQGRG.......FERRT.......TRC-HTSSLSS-PENKEQ-
CSH1_BOVIN/26-236LVASNNYRLA------R-------EMF---NEFNKQFGEGKN.......FTSKV......INSC-HTEFMTT-PNNKEA-
PLRP4_BOVIN/26-239VLSTGMYNTS------V-------KMF---TDFDEQYAQGKE......YFINVS.......DKC-HTNSLHL-PEDMQH-
PR3D4_RAT/16-223EQSHNTFIKA------A-------DVY---REFDINFAKRSW......MKDRIL.......PLC-HTASIHV-PENREE-
PR2C2_MOUSE/16-224SLSHNISIEV------S-------ELF---TEFEKHYSNVSG......LRDKSP.......MRC-NTSFLPT-PENKEQ-
SOM2_HUMAN/9-215LRARRLYQLA------Y-------DTY---QEFEEAYILKEQK....YSFLQNPQ.....TSLC-FSESIPT-PSNRVK-
PR8A5_RAT/17-238QRAETLRNLS------D-------QLY---VEFFQNQFSSRQFADLSSQLIRKDETVLKAGTYC-HSNRAK.-PKSR..-
PR6A1_RAT/20-234ILAHNVTELI------A-------EMN---SVFLEDVLYKPG.....RWFPERD......LTAC-HRSPFTI-AVSKEG-
PR7D1_MOUSE/17-240VLSGEMSKLG------V-------IMR---KEFFMNSFSSETFNKIILDLHKSTENITKAFNSC-HTVPINV-PETVED-
CSH2_HUMAN/9-215LQAHRAHQLA------I-------DTY---QEFEETYIPKDQKY..SFLHDSQT.......SFC-FSDSIPT-PSNMEE-

PF06875

Q5BNQ4_9SALA/2-215LSFQGAPLSD-----PD-------YQL---PHIKVVNLPTAAMD-----------------YDT-FIRQTDE-TRLKNN-
Q5BNQ2_9SALA/2-215LSFQGAPLSD-----PD-------YQL---PHIKVANLPTAAMD-----------------YDT-FMKQTDE-TRLNNN-

PF01110

CNTF_CHICK/1-194VERQGL----------D-------ASI---SVAAVDGVPTAAV-------------------ER-WAEQTGT-QRLLDN-
G3VWZ5_SARHA/1-195VEYQGL----------N-------KDV---DLDSMDGVPTAST-------------------DR-WSELTEA-ERLQAN-
E1BFH9_BOVIN/1-193MKHQGL----------N-------GNM---NLDTLEGVPTASS-------------------SR-WSELTEA-ERLQEN-
G5AP46_HETGA/1-192VKHQGL----------S-------ENV---SLDAVGGVPAASI-------------------AQ-WSELTEA-ERLQEN-
H0Z9U1_TAEGU/1-188VEQQGL----------D-------ASA---SVAAMEGVPLAAV-------------------ER-WDEQTGT-QRLLEN-
CNTF_HUMAN/1-194VKHQGL----------N-------KNI---NLDSADGMPVAST-------------------DQ-WSELTEA-ERLQEN-

PF01291

LIF_MOUSE/44-203YTAQGEPFPN-----NV-------EKL---CAPNMTDFPSFHG------------------------NGTEK-TKLVEL-
LIF_BOVIN/43-202YTAQGEPFPN-----NL-------DKL---CSPNVTDFPPFHA------------------------NGTEK-ARLVEL-
ONCM_HUMAN/37-209IRIQGLDVP.-----KL-------REH---CRERPGAFP.SEE------------------------TLRGL-GRRGFL-
ONCM_MOUSE/34-194IRLQNLNTP.-----DL-------RAA---CTQHSVAFP.SED------------------------TLRQL-SKPHFL-
ONCM_BOVIN/34-194IHLQGLHSP.-----VL-------QEH---CRERPGDFP.SED------------------------ALWRL-SRQDFL-

PF03039

IL12A_MOUSE/6-215CTAEDIDHED-----IT-------RDQ---TSTLKTCLPLELHK.NESCLATRE-------TSS-TTRGSCL-PPQKTS-
G3VQT1_SARHA/40-247CSLEEIDHED-----IT-------E..---SNTGRVCLPPELIKKNFISNPTGK-------IFI-INNGSCL-DSKEKL-
F6T5A8_MONDO/5-202CSLEEIDHED-----IT-------KGR---SDTVRACLPPEFIK..........-------...-..NGSCL-VSTETL-
IL12A_PIG/6-222CTSEEIDHED-----IT-------KDK---TSTVEACLPLELAT.NESCLAARE-------TSL-ITNGNCL-TSGKTS-
L8YEA2_TUPCH/1-213CTSEEIDHED-----IT-------KDK---TSTVKACLPLELIT.NESCLASRE-------TSF-KTNGSCL-APEKTS-
H0X861_OTOGA/6-217HTSEEIDHED-----IT-------KDK---TSTVRACIPLELTK.NESCLASRE-------TSF-IPNGKCL-TSRKTS-
G1QWH2_NOMLE/40-254CTSEEIDHED-----IT-------KDK---TSTVEACLPLELTK.NESCLNSRE-------TSF-ITCQRML-SSRQLY-
I3MN91_ICTTR/4-220CSAEEVNHED-----IT-------KNR---TNTVKACLPQELAQ.NENCLASRE-------TSF-IIKGSSL-TSGRTS-
Q924V6_CAVPO/6-221CTPEEIDHED-----IT-------KDK---TSTVKACVPLELVK.NESCLASGH-------ISF-TTNGSCL-ASGKTS-

PF02024

H3AP27_LATCH/26-169---------------IT-------RIQ---QHPNQFLLPLNLK-----------------------VSGLEF-IP...A-
G3WWV6_SARHA/23-167---------------IT-------RIN---DISHMYSISAKQR-----------------------VTGLDF-IP...G-
F6PLK2_ORNAN/23-167---------------IT-------RII---QLSNRNGVSTDQR-----------------------VSGLDF-IP...G-
F7HGW1_CALJA/23-167---------------IA-------RIN---DLSHTQSVSPRQR-----------------------VTGLEF-IP...G-
G5BHA4_HETGA/23-167---------------VS-------RIN---DISHMQSVSSKHK-----------------------VTGLDF-IP....-
W5NER9_LEPOC/28-172---------------VI-------RIQ---KHTNESKMSPNLV-----------------------FSGLEL-IPDALN-
H0V7C6_CAVPO/23-165---------------IN-------RIR---NISHLQSVSSKHK-----------------------VTGFDF-IP....-
LEP_HUMAN/23-167---------------VT-------RIN---DISHTQSVSSKQK-----------------------VTGLDF-IP...G-

PF15216

M3WGC3_FELCA/29-153----------------Q-------EVI---YQA.LNKYMNGV.------------------------KSTEF-NNYIYC-
G3QQC8_GORGO/29-153----------------L-------STI---SKD.LITYMSGT.------------------------KSTEF-NNTVSC-
F7I7D5_CALJA/29-153----------------C-------RTI---LED.LLTYMIGT.------------------------KSTEF-NNTIFC-
F1RLI5_PIG/17-138----------------E-------EVI---HHE.LKTYINGT.------------------------KSIEF-NKFVYC-
K7E5V9_MONDO/34-162----------------E-------NII---YNEKLESLYNSEM------------------------PSSED-SN.LFC-
L8YGS5_TUPCH/5-129----------------E-------KLI---VGD.FQTYINGT.------------------------KSTQS-SNYIFC-
J9P5I8_CANLF/29-154----------------Q-------EVI---YQA.LEKYMDGVN------------------------RSTEF-SHPVYC-
TSLP_MOUSE/20-137----------------C-------NII---FHD.L....TGDL------------------------KGAKF-EQIEDC-

PF01109

CSF2_RAT/18-139WKHVDA.IKE-----AL-------SLL---NDMRALENEK---------------------------NE.DV-DIISNE-
CSF2_MOUSE/18-136WKHVEA.IKE-----AL-------NLL---D...DMPVTL---------------------------N.EEV-EVVSNE-
CSF2_BOVIN/18-138WQHVDA.IKE-----AL-------SLL---NHSSDTDAVM---------------------------N..DT-EVVSEK-
CSF2_CAVPO/18-140WKHVDATINE-----AL-------SLL---NHTSDPAAVM---------------------------NE.TV-EVVYDQ-
CSF2_PIG/18-139WQHVDA.IKE-----AL-------SLL---NNSNDTAAVM---------------------------NE.TV-DVVCEM-
CSF2_HUMAN/18-139WEHVNA.IQE-----AR-------RLL---NLSRDTAAEM---------------------------NE.TV-EVISEM-
CSF2_CANLF/18-139SQHVDA.IQE-----AL-------SLL---NNSNDVTAVM---------------------------NK.AV-KVVSEV-

PF02025

G1RQD7_NOMLE/22-133-------VKE-----TL-------ALL---STHRTL--LI---------------------------AN-ET-LRIPVP-
IL5_CAVPO/23-134-------VRE-----TL-------TLL---STHRTL--LK---------------------------GN-ET-LRISVP-
J9NWP5_CANLF/22-132-------VAE-----TL-------TLL---STHRTW--LI---------------------------GD-GV-IFFLIP-
IL5_MOUSE/21-132-------VKE-----TL-------TQL---SAHRAL--LT---------------------------SN-ET-MRLPVP-
G3WAR7_SARHA/25-134-------ISE-----TL-------SLI---TAHRTL--LI---------------------------GN-GT-LRISIP-
IL5_HORSE/22-133-------VAE-----TL-------TLL---STHRTL--LI---------------------------GD-GN-LMIPTP-
B5FW65_OTOGA/22-133-------VKE-----TL-------ALL---STHQTL--LI---------------------------HN-ET-LRIPVP-
I3MDT8_ICTTR/23-134-------VKE-----TL-------TLL---STHQTV--LI---------------------------GN-ET-LRIPVP-
G3T4B0_LOXAF/23-133-------VAE-----TL-------ALL---STHRTL--LI---------------------------GD-GT-PRILTP-
G1SL79_RABIT/22-133-------VKE-----TL-------TLL---STYQSL--LI---------------------------GN-ET-LMIPVP-

PF02059

IL3_CANLF/19-132PKQYFTMINE-----IM-------EML---NKSPSPSE..---------------------------EPLDS-NEKETL-
IL3_MOUSE/27-138TLNCSSIVKE-----II-------GKL---PEPELKTD..---------------------------.....-DEGPSL-
IL3_BOVIN/18-132P..YSMLMKE-----IM-------DDL---KKITPSPE..---------------------------GSLNS-DEKNFL-
G3UC30_LOXAF/22-133PQHYSVMINE-----IK-------EIL---QKSPPLNS..---------------------------ATPSD-TEKTIL-
G1MH15_AILME/18-131PKQYFEMISE-----IM-------DIL---NNSPSPSE..---------------------------ETLDP-NETSTL-
F1RJV6_PIG/18-131PKNYLAMIQE-----IT-------RSL---ENLTVTSN..---------------------------KSLTL-NE..LE-
G1RQ11_NOMLE/20-137WVNCSNMIDE-----II-------THL---KQPPLPLLDF---------------------------NNLNG-EDQDIL-
IL3_CALJA/19-136QVNCSNLREE-----IV-------TLL---NQPPLASSNF---------------------------NNLNR-EDQRIL-
F1LS41_RAT/29-138TLDCRTIALE-----IL-------VKL---PYPQVSGL..---------------------------..NNS-DDKANL-

PF07400

IL11_HUMAN/22-199RAELDSTVLL-----TR-------SLL---ADTRQLAAQLRDK-------------------FP-ADGDHNL-DSLPTL-

PF00758

G3TYQ1_LOXAF/25-173DSHILHSRLS-----QC-------PDF---NPLSTPVPLPTVD-------------------FS-LGEWKTQ-TEQNKA-
W5K758_ASTMX/26-175EAWDAEATMR-----VC-------KED---CSIGVPLMVPLTR-------------------VD-IGVWEKK-NMEEQA-
B1N8Y2_DANRE/15-168EAWDAEAAMR-----TC-------KDD---CSIATNVTVPLTR-------------------VD-FEVWEAM-NIEEQA-
F7DTH0_CALJA/31-193EGKEAENVTM-----GC-------AES---CSLNENITVPDTK-------------------VN-FYAWKKM-EFGQQA-
M3XJ62_LATCH/27-177DAKDAESFVN-----GC-------TEA---CELPVDMTLPATK-------------------VN-IKEWNEM-DNKIKE-
G3W289_SARHA/30-190EAKEAQNATV-----AC-------LED---CSLGENITVPDTR-------------------VN-FHTWKKM-EVGQKA-
F6WUU2_MONDO/31-191EAKEAQNATV-----RL-------HPR---RNIVLAFSNTSCL-------------------IN-IYFAINS-NVGQKA-
G3VW20_SARHA/26-175DSAALHSRLS-----QC-------SDL---GPLPIPVLLPTVD-------------------FS-LREWRAK-TERFKC-
G1PF99_MYOLU/45-207EAREAENVTM-----GC-------AEG---CSFSENITVPDTK-------------------VN-FYAWKRM-EVEQQA-
TPO_CANLF/25-176DSHVLHSRLS-----QC-------PDI---YPLSTPVLLPAVD-------------------FS-LGEWKTQ-KEQTKA-
F7G570_MONDO/26-177DSAALHSRLS-----QC-------SDL---SPLPIPVLLPTVD-------------------FS-LREWRAK-TEQTKG-
H0W023_CAVPO/30-191EAKDAENVTM-----SC-------TEG---CSLGENITVPDTK-------------------VN-FCAWEKM-GVGQQA-
H2LEX3_ORYLA/33-182EARDAEVAMR-----SC-------REG---CGLTQTVSVPQTT-------------------VN-FEDWEKK-NALEQA-

PF00489

IL6_BOVIN/27-208RMVDKISAMR-----KE---ICEKNDE---CESSKETLAENKL-------------------NL-PKMEEKD-GCFQSG-
M3X721_FELCA/27-208YILGKISALK-----KE---MCDNYNK---CEDSKEALAENNL-------------------NL-PKLAEKD-GCFQSG-
IL6_HORSE/27-208YILGKISALK-----NE---MCNNFSK---CENSKEVLAENNL-------------------NL-PKMAEKD-GCFQSG-
G3UHF3_LOXAF/20-205FILAEISVLR-----KK---MCDKYDK---CENSREALAGNNL-------------------KL-PQMTEED-GCFHSG-
L5KPK4_PTEAL/20-202SIFLEISEVR-----NK---MCGNDDS---CKNSKEVLTENNL-------------------NL-PKMAEKD-GCFQSG-
F7HV62_CALJA/27-212YILDGISALR-----KE---ICNKSNM---CESSKEALAENNL-------------------NL-PKMAEKD-GCFQSG-
IL6_MOUSE/26-210HVLWEIVEMR-----KE---LCNGNSD---CMNNDDALAENNL-------------------KL-PEIQRND-GCYQTG-

PF16647

CSF3_BOVIN/42-190KIQADGAELQ-----ER...LCAAHKL---CHPEELMLLRHSL-------------------GI-PQ-APLS-SCSSQS-
CSF3_HUMAN/51-202KIQGDGAALQ-----EKLVSECATYKL---CHPEELVLLGHSL-------------------GI-PW-APLS-SCPSQA-
CSF3_MOUSE/57-205KIQASGSVLL-----EQ...LCATYKL---CHPEELVLLGHSL-------------------GI-PK-ASLS-GCSSQA-

PF16649

IL23A_MOUSE/28-185MLAWNAHAPA-----GH---------M---NLLREEEDEETKN-------------------NV-PRIQCED-GCDPQG-
F7HQI5_MACMU/28-184TLAWSAHPLV-----GH---------M---DL.REEGDEETTN-------------------DV-PHIQCGD-GCDPQG-
F1MSN4_BOVIN/35-192MLAWSAHLPM-----GH---------V---DLPREEGGDKTTD-------------------DV-PRIQCED-GCDPQG-
IL23A_CAVPO/28-184TLAWSAHPSV-----GH---------V---EPPREEADEETTD-------------------YV-PHILCGD-GCDPQG-
G3VET0_SARHA/31-186ALAWGIHPEM-----GN---------L---ELPREEGTGEAVD-------------------DV-PHIQCGD-GCDHQS-

PF00143

G5E7E1_LOXAF/9-168QKAQ.VISVLHEMLQQIFNLFHTK.DSSA---------------------------------------------------
IFNE_MOUSE/27-185QEGQ.VLAVVHEILQQIFTLLQTH.GTMG---------------------------------------------------
G3I0H8_CRIGR/26-185QKAQ.AIPILQELIQQVLILFSSK.DSSA---------------------------------------------------
H0VF99_CAVPO/28-187QKEK.AALVIQEMLQNVLGIFRKN.ISTT---------------------------------------------------
L5KKJ7_PTEAL/25-192LKRD.IKEAFYEISLQAFNIFSQY.TFQS---------------------------------------------------
G1U0Q8_RABIT/26-185QKNQ.AVSVLHEMLQQIFNLLHTA.RSSA---------------------------------------------------
F6YZB3_ORNAN/25-183QKGN.RAVVVHELLQQIFTVFSQT.LSQT---------------------------------------------------
I3MY95_ICTTR/32-186PRAQ.AVAALQEMTRKILDLFGTQ.EAFA---------------------------------------------------
V8NNB8_OPHHA/15-183QVDI.AKTAVKEILQQIDVIFRQN.HTEL---------------------------------------------------
C8CKA7_PIG/26-185QKAQ.AMALVHEMLQQTFQLFSTE.GSAA---------------------------------------------------
H0W7G8_CAVPO/26-185QEAQ.AFSVLHEMARQTFNIFTSE.DSSA---------------------------------------------------
G3GXU9_CRIGR/27-182EKRN.VALIIEEMLQNIFIVFNSN.YSST---------------------------------------------------
H0XSG1_OTOGA/26-185QKAQ.AISVLHDMTQQTFNLFSTK.DSSE---------------------------------------------------
G1KX99_ANOCA/25-184EEEN.AKVVIQEVLQQTGHIFRQN.YTEM---------------------------------------------------
G3I0I6_CRIGR/27-185QKGH.VLAVLHELLQQIFSLFQAH.VSRG---------------------------------------------------
IFNT4_SHEEP/26-185QKDQ.AFPVLYEMLQQSFNLFYTE.HSSA---------------------------------------------------
L8Y4J0_TUPCH/27-186QKRH.TLAILHEMLQQIFNLFSAN.VSPD---------------------------------------------------
F7B527_HORSE/26-183GKTQ.ATAVLHEMLQHTFHLFSTT.GSRA---------------------------------------------------
G1Q950_MYOLU/27-184RKEE.AMVVMHEMLQQIFSIFRRG.FSNA---------------------------------------------------
M3WTR1_FELCA/26-186REAQAAAAVLRELLQQTFNLLHTE.RSSA---------------------------------------------------
G5CB66_HETGA/27-185RKEN.AALVIQEMLQNILDIVRKN.FSNT---------------------------------------------------
L9L941_TUPCH/27-198VKRD.IKEVFYEISMQAFNIFSQD.TFKS---------------------------------------------------
D2H9N6_AILME/27-184QKEA.LLLVTLDMFQKTSDIFRKN.LSST---------------------------------------------------
D3Z919_RAT/26-179QKSQ.AISVLETLTQQVLTLFESE.ESRA---------------------------------------------------
C8CKB9_PIG/24-176QTSQ.GTCFHPLMLQQIINLFNTE.NSRA---------------------------------------------------
A8E6F6_XENTR/27-179EA...GALAVREVLNETMRFYMKH.HESM---------------------------------------------------
L8Y906_TUPCH/26-185QKTQ.ALRVLHGMLQQIFNLFSSE.GSSA---------------------------------------------------
H9L1C3_CHICK/28-183QKET.VKVAIEEILQHIFYIFSKN.LTLA---------------------------------------------------
L5KWM8_PTEAL/106-263QEAQ.AISVLHEMLQETFDVFCTE.HSSA---------------------------------------------------
G3WZJ8_SARHA/27-182QREN.TTVMVHETLQQIFTIFSLN.TTPA---------------------------------------------------
G3UCD2_LOXAF/26-187QKAQ.AISVHHEMIQQIFNLFSLQ.ASSA---------------------------------------------------
K7GQJ6_PIG/17-164QKVQ.AISVFHEMLQQTFLLFHIE.RSSA---------------------------------------------------
G3I0H3_CRIGR/26-178QKAQ.AMSVLQELTQQALILFSSN.ESSA---------------------------------------------------
H0VYK7_CAVPO/28-181QKEM.AALVIQEMLQNIFVIIRKE.FSTT---------------------------------------------------
I3N7K4_ICTTR/33-202EKTN.IKYVFYETYTQAINIFSQN.TFNS---------------------------------------------------
L5K635_PTEAL/26-185QKAQ.AISVLHEMLQQTFDVFGTK.QSSA---------------------------------------------------
H0W3G0_CAVPO/26-185QKAQ.MVSVLQGTLQQILTLFNTQ.LSSA---------------------------------------------------
W5JYQ9_ASTMX/23-179QTVA.LEKSIYITLEYINSMLNDH.ELPD---------------------------------------------------
G3SI98_GORGO/28-185MKRD.IKKAFYEMSLQAFNIFSQH.TFK.---------------------------------------------------
H0Y0D2_OTOGA/28-187EKNQ.AITVLYVVVQHIFSLFSTT.ESSD---------------------------------------------------
IFN_ANAPL/34-190DTQQ.AAHTALHLLQHLFDTLSSP.STPA---------------------------------------------------
G3UJX3_LOXAF/27-185QKED.AALVIYEMLLQIFDIFLGN.FSHT---------------------------------------------------
G5C259_HETGA/26-185QKAQ.AISVLHEMTSQTFNLFSTQ.DSSA---------------------------------------------------
G3WZF5_SARHA/26-185QKEN.ATMVIHEMLQQIFLLFSSK.NASL---------------------------------------------------
IFNE_PIG/27-186QKQQ.ALAILHEMLQQIFSLFRAV.ISLD---------------------------------------------------
W5N6G4_LEPOC/27-185KNED.IVLTGLETMRCVHNIFNKT.GHPA---------------------------------------------------
H9KYA4_CALJA/26-185QKAQ.AIFILHEMIQQTFNLFSTK.DSSV---------------------------------------------------
D2HTQ4_AILME/33-205AKRY.IKEAFYEMSIQAFNIFSQY.TFTS---------------------------------------------------
IFNB_HUMAN/27-185QKED.AALTIYEMLQNIFAIFRQD.SSST---------------------------------------------------
G1NR05_MELGA/32-188DKKQ.AAIITLHILQQLFNILSSP.HTPA---------------------------------------------------
F7BVP5_ORNAN/23-181QQEN.ATEAIHDLLQHIFNVFSRN.HSQT---------------------------------------------------
F7G875_MONDO/27-182QREN.ATMIIHEMLQQTLILFSSK.NACP---------------------------------------------------
C8CKC3_PIG/33-205LKRD.IQEAFYEMSIRAFNIFTQD.TFKA---------------------------------------------------
I3MVD7_ICTTR/34-186QKAQ.AVAVLHQMTQQVFNLFSTQ.EAFA---------------------------------------------------
F7A317_HORSE/26-184RKAQ.AISAVHETIQQIFHLFSTD.GSSA---------------------------------------------------
G1KU56_ANOCA/28-182QKEN.AAVALHEILQQILCLYIQN.HTKL---------------------------------------------------
L5KBH2_PTEAL/26-185QKAQ.AISVLQEMLQEISNVFGTQ.QSSG---------------------------------------------------
L5K909_PTEAL/26-185QEAQ.AITVIHEVTWQTFLLFCTE.ASST---------------------------------------------------
I3N5Z0_ICTTR/23-179PKGH.VLAILHEMLQQIFNLFKKN.ISLG---------------------------------------------------
F7GHL9_MONDO/26-181QKEN.ATVVVLEMVQQIFNLFSQN.AMPA---------------------------------------------------
IFNE_HUMAN/27-186QKGH.TLAILHEMLQQIFSLFRAN.ISLD---------------------------------------------------
I3LBU7_PIG/26-179QKAQ.AIFVLHKMLQQTFLLFHTE.HSSA---------------------------------------------------
G3UK87_LOXAF/27-184QKAQ.AVFILHKMLQQIFNLFRTK.EPST---------------------------------------------------
L9LC61_TUPCH/27-185QKEN.ATLVIHEMLQNIFGVFRRN.FSST---------------------------------------------------
IFNB_RAT/27-182EKSY.TAFAIQVMLQNVFLVFRSN.FSST---------------------------------------------------
H0XMZ9_OTOGA/27-186QEGH.ALALLHETLQQIFNLFRAN.ISVD---------------------------------------------------
G3VDC6_SARHA/27-182QREN.AIVIVNETLQQIFNIFSLN.TTPA---------------------------------------------------
I3JM36_ORENI/26-182SDED.KLAFTVQVLEEVAALFEED.HSSA---------------------------------------------------
L5LKN9_MYODS/27-186QKGS.ALTILHEMLQQIFSLFQAN.TSLE---------------------------------------------------
G1TYS8_RABIT/29-195EKRD.IKEAWYEISTQAFCIFMGH.AFQT---------------------------------------------------
I3UJJ8_FELCA/27-185QKGQ.ALAILHEMLQQIFNLFRAN.TSSD---------------------------------------------------
C8CKA9_PIG/26-183EKTQ.AVAVAHEMLQQIFRLFSTR.GSPS---------------------------------------------------
IFNT2_BOVIN/3-162QKDQ.AISVLHEMLQQCFNLFYTE.HSSA---------------------------------------------------
H0W510_CAVPO/26-186QKAQ.ALSVLHEMTRQTFILFTSQ.YSCP---------------------------------------------------
M3Z729_MUSPF/26-183QKAQ.AISVLHVTNQKTFHLFCTE.ASPA---------------------------------------------------
IFNA1_MOUSE/26-185KKAQ.AIPVLSELTQQILNIFTSK.DSSA---------------------------------------------------
G3TTC1_LOXAF/26-185QKAQ.AIAFLHEMLQQIFDLFRTM.DSFA---------------------------------------------------
G1PDS6_MYOLU/29-199LHRD.IKGTFYEMYMLAFSIFTQS.TFQS---------------------------------------------------
F7ABU5_MONDO/27-182QKEN.ATVIVLEMVQQIFTLFSQN.TTPA---------------------------------------------------
G1TTX4_RABIT/27-180QKED.TTLVIFEMLNNIFDIFRKN.FSST---------------------------------------------------
H0XRP5_OTOGA/26-185QKAQ.AISVLHEMTQQTFNLFSTN.DSSE---------------------------------------------------
H0WK94_OTOGA/33-202VKRG.LREAFYEVSIQAFHIFSQY.TFEP---------------------------------------------------
G1KYL3_ANOCA/23-176EEGN.AKAAIQEVLQQTGHIFKQN.YTEM---------------------------------------------------
G3WZQ8_SARHA/26-181QREN.ATAIVYEMLQQIFTIFSLN.TTPA---------------------------------------------------
H2R6R8_PANTR/26-185QKTQ.AISVLHEMIQQTFNLFSTE.DSSA---------------------------------------------------
H0YTY6_TAEGU/34-188HPHQ.AAATALRILQHLFHTLSSN.STRQ---------------------------------------------------
I3MXH1_ICTTR/27-185QKEH.AAFVIYEMLKDIFHVFKKG.YSNP---------------------------------------------------
M3WRV1_FELCA/26-184HKAQ.ALSVVHVANQKIFHFFCTEASSSA---------------------------------------------------
H0W4H8_CAVPO/23-182QKDH.ALVSEHLHLEQTFNLFISE.DSSA---------------------------------------------------
R4GKJ6_CHICK/35-191NTQQ.ADKTTHDILQHLFKILSSP.STPA---------------------------------------------------
A3FBE8_MUSPF/27-184QKED.IVLVTLEMFQKTSDIFRRN.LSST---------------------------------------------------
G1KWE0_ANOCA/28-180EEEN.AKVAIQEVLQQTGHIFRQN.RTEM---------------------------------------------------
G7PS89_MACFA/26-185QKAQ.AISVLHEIIQQTFNLFNTK.NSSA---------------------------------------------------
G1Q880_MYOLU/26-185QKAQ.AIAVLHEMLQQVSNLLSTE.NSSV---------------------------------------------------
IFNB_MOUSE/27-180QKSY.TAFAIQEMLQNVFLVFRNN.FSST---------------------------------------------------
IFNB2_BOVIN/27-184QKED.AILVIYEMLQQIFNILTRD.FSST---------------------------------------------------
G1SJC4_RABIT/26-185QRTQ.AISVLHEMTQQLLNLFSTK.EASA---------------------------------------------------
W5PG31_SHEEP/26-185QKAQ.AISVLHEVTQHTFQLFSTE.SSAA---------------------------------------------------
IFNA3_CANLF/26-183QEAQ.ALSVVHVMTQKVFHLFCTN.TSSA---------------------------------------------------
G5BPX2_HETGA/27-199VERD.IKEVFYDIIIQAFNIFSRH.TSDS---------------------------------------------------
IFNW2_HORSE/26-185PEAQ.AASVLHEMLQQIFSLFHTE.RSSA---------------------------------------------------
G3N2A8_BOVIN/26-185QEAQ.AISVLHEMLQQTFNLFHTE.RSSA---------------------------------------------------
H0XKS8_OTOGA/27-185QKED.AMLFIYEMLQNIFRILRRD.FSST---------------------------------------------------
H0VUV7_CAVPO/26-185QKTQ.ALSFLHEMTTQTLILFSSQ.NSHA---------------------------------------------------
Q29412_PIG/27-184QKED.AVLIIHEMLQQIFGILRRN.FSST---------------------------------------------------
G7PS88_MACFA/26-185QKAP.AISVLHELIQQTFNLFTTK.DSSA---------------------------------------------------
M3WZS7_FELCA/26-181EKTQ.VTAVVHEMLQQIFNLFSKS.DSFV---------------------------------------------------
H9GZR7_HORSE/26-185PEAQ.ATSVLHEMLQQIVNLFHTE.RSSA---------------------------------------------------
F1LVL8_RAT/26-184QEGH.VLAVLHEILQQIFVLFQTH.SSRG---------------------------------------------------
M3YX13_MUSPF/27-179QSGQ.ALAILHEMLLQTFSLFRAG.ISLD---------------------------------------------------
G1L8G2_AILME/26-185EKTE.ATGVMHEMFRQIFNLFSQS.GSFV---------------------------------------------------
IFNB_HORSE/27-184QKED.AALVIYEMLQHTWRIFRRN.FAST---------------------------------------------------
H0W289_CAVPO/26-190QEAQ.AIWVLHGMLQQILTLFYTE.HASA---------------------------------------------------
A8E6E8_MONDO/27-182QRGD.ALIIFHEMLQQKFTLFSQN.AAPV---------------------------------------------------
I3N788_ICTTR/27-185QKEH.AAFVIYEMLQDIFVIFTRN.FSNT---------------------------------------------------
G1L8I1_AILME/26-183QKAQ.ALSVVHVMDQKIFHVFCTE.PSSA---------------------------------------------------
IFNB_FELCA/27-184QKEE.AILVINEMFQKIFNIFSRS.TSST---------------------------------------------------
H0VXI5_CAVPO/26-181QKAQ.ALSVLHEMTRQTFNLFTSE.DSSA---------------------------------------------------
G3TS29_LOXAF/26-179EKTQ.AAVLLYEMLQQTFNLFSRS.DSLE---------------------------------------------------
W5PZ39_SHEEP/26-184LMRN.IKEAFYEMTRQAFHIFTQD.TFQS---------------------------------------------------
G3I0H6_CRIGR/26-178QKAQ.AMSVLQELTQQALILFSSN.KSSA---------------------------------------------------
I3L756_PIG/26-180QKTQ.AISVLHEMLQQTFLLFHTE.RSSA---------------------------------------------------
M3Z715_MUSPF/26-183QKAQ.ALSVVHVTKQNIFHLFCTE.ASPA---------------------------------------------------
M3VXI8_FELCA/33-205GKRY.LKEAFYEMSTQAFNIFRES.TTKS---------------------------------------------------
G3R8Q7_GORGO/26-185QKAQ.VMSVLHEMLQQIFSLFHTE.RSSA---------------------------------------------------
A8E6F5_XENTR/51-202EE...MVLAVRGVLNETMRFYMKH.HESM---------------------------------------------------

PF02947

FLT3L_MOUSE/30-162CKALWSLFLAQRWIEQLKTV------------------------------------------------------------
F6T7S9_ORNAN/28-157CWELWHLSVAEDRLKHLERM------------------------------------------------------------
H9GP84_ANOCA/29-165CKELWHVHLIHRNLNRMINV------------------------------------------------------------
F6TPW7_MONDO/34-163CRALWHLFLAKKTLDRLELV------------------------------------------------------------
G5B8P0_HETGA/20-150CAKLWHLVLAQRWMERLKTV------------------------------------------------------------
G1M637_AILME/29-159CGPFWHLVLAQRWMGQLKAV------------------------------------------------------------
L9JA37_TUPCH/769-910CGALWRLVLAQRWMERLKTV------------------------------------------------------------
G3VSA3_SARHA/79-209CWALWHLALAKETLDRLKLV------------------------------------------------------------
G1QZC3_NOMLE/30-160CGALWRLVLAQRWMERLKTV------------------------------------------------------------

PF03487

G1SCQ2_RABIT/16-144LTGSV.Y-CAALESLVNVSGCNAIQRT-----------------------------------------------------
IL13_HUMAN/16-144LTAGM.Y-CAALESLINVSGCSAIEKT-----------------------------------------------------
IL13_RAT/2-130LTAGG.F-CAALESLTNISSCNAIHRT-----------------------------------------------------
F7DGH7_MACMU/16-151LTAGV..-.......VRTFSLGTSVRT-----------------------------------------------------
L5M5Z7_MYODS/2-128LTAGS.Y-CAAFESLMNVSDCPAIQRT-----------------------------------------------------
G5ASP9_HETGA/2-130LTAGVWY-CAARESLINVSSCSALQRT-----------------------------------------------------
B3GDZ5_PIG/2-130LTTSM.Y-CAALESLINISDCSAIQKT-----------------------------------------------------
L8YAP6_TUPCH/2-128LTTDV.C-CVALESLTNVSGCSTLQRT-----------------------------------------------------
IL13_BOVIN/2-130LTSSM.Y-CAALDSLISISNCSVIQRT-----------------------------------------------------
IL13_MOUSE/2-130LAAGG.F-CVALDSLTNISNCNAIYRT-----------------------------------------------------
H0W834_CAVPO/16-149LTAGLWY-CAARESLINVSNCSALQRT-----------------------------------------------------
F6WQF3_ORNAN/2-128FDWEKAQ-KEAESQRNNISDCETIQDI-----------------------------------------------------
G3T2N9_LOXAF/2-133LTTNV.Y-CAAMEALSNVSDCRAIEKT-----------------------------------------------------
M3YGH3_MUSPF/2-126RTTSM.Y-CAALESLTSVSNCSAIHRT-----------------------------------------------------
B5FW67_OTOGA/2-129LTTDI.Y-CAALESLINVSSCSAIQRT-----------------------------------------------------
I3MAR4_ICTTR/2-131LTAGE.Y-CAALDSLIKVSNCSAIQKT-----------------------------------------------------
IL13_CANLF/2-129LTAGM.Y-CAALESLINVSDCSAIQRT-----------------------------------------------------

PF00727

IL4_FELCA/26-131THHN....CST..............K------------------------------------------------------
H0XDE1_OTOGA/26-149SHHQKEP.CRGATERQQLYRHQQVIR------------------------------------------------------
IL4_MOUSE/27-140LKHGKTP.CLK........KNSSVLM------------------------------------------------------
G3T4B8_LOXAF/26-132KRHE....CFT..............K------------------------------------------------------
IL4_RABIT/28-143LHHKVSW.CFK......EHGELGDLR------------------------------------------------------
G5ASQ0_HETGA/25-138YLGVGLS.CLN......RHRESVFLV------------------------------------------------------
F6U5N6_HORSE/26-135KRHDRS..LIK..............E------------------------------------------------------
IL4_BOVIN/26-133RSHT....CLN..............K------------------------------------------------------
G3QSC0_GORGO/26-149SHHEKDTRCLGATA.QQFHRHKQLIR------------------------------------------------------
A3FBF0_MUSPF/26-130THN.....CSN..............R------------------------------------------------------
IL4_RAT/27-139FPRDVPP.CLK........NKSGVLG------------------------------------------------------
G3WEJ0_SARHA/28-149NS......CPR..............Q------------------------------------------------------
I3MAS4_ICTTR/24-141QDHPVSR.CLN......KNGKLDILK------------------------------------------------------
IL4_PIG/26-131RHHT....CMK..............S------------------------------------------------------

PF00726

IL10_BOVIN/5-174DFKGYLG-CQA--LSEMIQFYLEEVM-PQAE------------------------------------------------N
IL10H_EBVB9/7-167DFKGYLG-CQA--LSEMIQFYLEEVM-PQAE------------------------------------------------N
G3HB01_CRIGR/14-174DFEGYLG-CQT--LSEMIQFYLVEVM-PQAE------------------------------------------------N

PF14565

IL22_HUMAN/40-178GVSMSER-CYL--MKQVLNFTLEEVLFPQSD------------------------------------------------R
E1C1U2_CHICK/46-184NIRENNR-CYM--MKRITEIIVKDVLLTEAK------------------------------------------------E

PF15177

IFNL3_CHICK/28-182ELSVPDR-ITL--VEAELDLTITVLTNPTTQ----------------------------------------------..R
F1M3K4_RAT/31-188QLQVQER-QKA--LQAEVALTLKVLGNMTDP----------------------------------------------..A
I3MK89_ICTTR/34-194QLQVWER-PVA--LQAELALTLRVLGTMANS----------------------------------------------..T
F1PY54_CANLF/31-186LLQAWER-PVA--LEAELDLTLKVLENMTDS----------------------------------------------..S
H0XRJ1_OTOGA/35-191QLQVWER-PVA--LEAELALTLKVLEAVTNE----------------------------------------------..A
M3W3J2_FELCA/32-181QLQVWER-PVA--LEAELALTLKVLGTVADA----------------------------------------------..S
F6PNH9_HORSE/31-184QLQVWER-PVA--LEAELALTLKILAMVADS----------------------------------------------..S
D2DJP5_XENTR/23-178DLQASDR-LIL--TLERVTLAVDVLTNMTES----------------------------------------------..P
G3TQK4_LOXAF/32-188QLQVWER-PMA--LEAELALTVKVLRTMSDS----------------------------------------------..A
F7DXI8_HORSE/34-187QLQVWER-PVA--LEAELNLTLRVL...ANS----------------------------------------------..S
F6W920_MONDO/30-184QLQLADR-PIV--LEAELKLTLEVLKGIQNP----------------------------------------------..E
U3KED0_FICAL/27-186DLPMSDR-VLL--VAAELNLTMAMLELPAAP----------------------------------------------..S
H0VBN4_CAVPO/39-195QLQVWER-PLA--LQAELALTLKVLGTVTDP----------------------------------------------..A
IFNL4_HUMAN/25-174RPSSCAR-LRH--VARGIADAQAVLSGLHRS----------------------------------------------..E
IFNL2_MOUSE/32-189QLQVQER-PKA--LQAEVALTLKVWENMTDS----------------------------------------------..A
G3N0M3_BOVIN/37-192HLQVWER-PVA--LEAELALTLTVLEAMANS----------------------------------------------..S
G1LPU9_AILME/37-191QLQVWER-PVA--LEAELILTLKVLETMADR----------------------------------------------..S
L5LZZ9_MYODS/163-319QLQVWER-PVA--LEAELALTLKVLGTLKNS----------------------------------------------..T
IFNL3_HUMAN/34-192QLQVRER-PVA--LEAELALTLKVLEATADT----------------------------------------------DPA
F6R8C9_XENTR/23-177S.KASDR-IIL--TLERVTMAVDVLTNITES----------------------------------------------..P
G3VJ97_SARHA/12-167QLPVSVR-PVV--LQAELKLTLEVLKAVTKP----------------------------------------------..E
H0XJU8_OTOGA/36-192QLQVWER-PVT--LEAELALTLKVLEAVTKE----------------------------------------------..A
G3HJD0_CRIGR/30-187LLQVQER-LKA--LQAELHLTLQVLENVTDS----------------------------------------------..A
G1LPW2_AILME/34-190QLQVWER-PVA--LEAELALTMKVLETMADS----------------------------------------------..S
L5L378_PTEAL/33-182ELQVWER-PMA--LEAELALTLKVLETKADS----------------------------------------------..S
G1T4B0_RABIT/34-188.....ER-PEA--LEAELFMSLKVLEAMEDS----------------------------------------------..A
U3IYH6_ANAPL/34-185ELSVPDR-LLL--VEAELDLTIAVLAHPTVD----------------------------------------------..K
L9LBW1_TUPCH/31-181HLQMWER-LMA--LEAELALTLRVLGSVADS----------------------------------------------..A
D0FHA1_PIG/36-191QLQVWER-PVA--LEAEVALTLSVLGSLANS----------------------------------------------..S

PF05337

CSF1_HUMAN/41-180-----KA-FLL--VQDIMEDTMRFRDNTPNA-------------------------------------------------
Q3TLQ6_MOUSE/41-180-----KA-FFL--VQDIIDETMRFKDNTPNA-------------------------------------------------
O77709_BOVIN/41-180-----KA-FLL--VQDIMEDTMRFKDNTPNA-------------------------------------------------
O77710_BOVIN/41-180-----KA-FLL--VQDIMEDTMRFKDNTPNA-------------------------------------------------
Q64129_9MURI/41-180-----KA-FFL--VQDIIDETMRFKDNTPNR-------------------------------------------------

PF15036

IL34_MOUSE/28-184VSERELR-YLW--VLVSLNATESVMDVLLEG----------------------------------------------HPS
R4GIU3_CHICK/19-177VSEASLR-YLW--FHACSQAVLHILEVLPEK----------------------------------------------HPS
F7EA00_CALJA/29-185VSERELR-YLW--VLVSLSATESVQDVLLEG----------------------------------------------HPS
H0WFN4_OTOGA/28-184VSERELR-YLW--VLVSLSATESVQDVLLEG----------------------------------------------HPS
M3ZVZ0_XIPMA/24-191V....LQ-RLW--FQVNQGVLKKIIRVLPER----------------------------------------------HPS
U3JY35_FICAL/18-179VSEAALR-YLW--FHVSSQAVLRIREVLPEK----------------------------------------------HPS
L9KJY3_TUPCH/28-184MSERELR-YLW--VLVSLSAAESVQDVLLEG----------------------------------------------HPS
G3T3A6_LOXAF/28-182VSEQELR-YLW--VLVSLSATESVQDVLLKN----------------------------------------------HPS
F6W3U1_MONDO/15-167VSQPNLR-YLW--AALNCNTMEIIQNVLLED----------------------------------------------HPS
I3JZ08_ORENI/24-192V....LQ-RLW--FQVYQGVLKKILWVLPTR----------------------------------------------HPS
L5MCR9_MYODS/28-182VSQQELR-HLW--VSVSLGATEAVQGVLLEG----------------------------------------------HPS
B3DLJ8_DANRE/23-195VLPRDLQ-DLW--LYVSQQGIKKVLRVLPER----------------------------------------------HPT
IL34_BOVIN/28-183VSQQELR-YLW--VLVSLSATEWVQEVLLEG----------------------------------------------HPS

PF00714

IFNG_HORSE/15-152D---SDK-KII--QSQIVSFYFKLFENLK.D-------------------------------------------------
H0WPL1_OTOGA/15-151E---SD.-KII--QSQIVSFYFKLFEQHK.D-------------------------------------------------
Q8CGS0_CAVPO/15-154E---SER-KIF--QSQIVSFYFKLFEKHFTD-------------------------------------------------
B9VS86_CALJA/15-152E---GDR-KIM--QSQIISFYFKLFKNFK.D-------------------------------------------------
G3SUC6_LOXAF/15-152D---SDK-KII--QSQIVSFYLKIFDNLK.D-------------------------------------------------
G3GY20_CRIGR/2-135D---GDT-KII--QSQIVSFYFKLFEALK.D-------------------------------------------------
I3MNV6_ICTTR/15-152E---SDK-KVI--QSQIVSFYFKLFEHLT.D-------------------------------------------------
L5LME8_MYODS/15-153E---SDI-KII--QSQIISFYFKLFENIE.D-------------------------------------------------
G5BGB5_HETGA/15-152E---SDK-KIF--QSQIVSFYFKLFEKSG.G-------------------------------------------------
G3WQJ9_SARHA/15-153N---CDK-KIL--MSHVVAVYFKIFEIFK.N-------------------------------------------------
IFNG_SHEEP/15-152E---SDK-KII--QSQIVSFYFKLFENLK.D-------------------------------------------------
IFNG_RAT/14-151D---GNT-KIL--ESQIISFYLRLFEVLK.D-------------------------------------------------
IFNG_RABIT/15-152E---SDN-KII--QSQIVSFYFKLFDNLK.D-------------------------------------------------
L9KVU0_TUPCH/51-188E---SDK-KIF--QSQIVSFYFKLFESFK.D-------------------------------------------------
IFNG_FELCA/15-153E---SDK-TII--QSQIVSFYLKMFENLKDD-------------------------------------------------

PF02404

R4GD07_ANOCA/1-283PNHCWLH-LMVPELSKSLSNLLNKFTEFSDMPDVLSNYSIINNLRRIINDLMECLSSTKYRNFRQHHDHLYEEGRFIPEE
SCF_CHICK/1-287PNHCWLH-LMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPEN
SCF_RAT/1-273PSHCWLR-DMVTHLSVSLTTLLDKFSNISEG...LSNYSIIDKLGKIVDDLVACMEENAPKN.VKESLKKPETRNFTPEE
G1NWC8_MYOLU/1-272PSHCWIS-KMVEQLSVSLTDLLDKFSNISEG...LSNYSIIDKLVKIVDDLVECMEEHALEN.VKKSSNSLELKMLTPEE
F7EP53_MONDO/1-273PNHCWLH-LMVPELARSLNNLLDKFSKISSS...LSNYSIIDKLIKIIDDLMGCLEE.KNKNFRKQNIHIYKRDSFNPED
F7C5I3_ORNAN/1-273PNHCWLH-LMVPELAKSLNNLLQKFSEISES...LSNYSIINNLTRIIDDLMACLASDKNKHFVQRNIHLYKKGSFIPKE
F7G0W2_CALJA/1-273PSHCWIS-EMVVQLSSSLTDLLDKFSNISEG...LSNYSIIDKLVNIVDDLVECVKENSSKD.LKKPFKSPEPRLFTPEE

PF02372

IL15_PIG/33-160PNCKVTA----------MKCFLLELRVILQE-------------------------------------------------
IL15_CAVPO/33-160PNCKITA----------MKCFLLELRVILHE-------------------------------------------------
IL15_FELCA/33-160PNCKVTA----------MKCFLLELHVISLE-------------------------------------------------
IL15_SHEEP/33-160PNCKVTA----------LQCFLLELRVILHE-------------------------------------------------
F1NZN5_CHICK/55-183IECQEPV----------MRCFFLEMNVILHE-------------------------------------------------
G1NDP6_MELGA/5-137.ECSQQT----------LQCYLEEM.VMLEK-------------------------------------------------
O73883_CHICK/5-138.ECTQQT----------LQCYLGEV.VTLKK-------------------------------------------------
Q8JFF4_ANAPL/4-134.ECSWQT----------LQCYLKEI.VTLEE-------------------------------------------------

PF00715

I3MQX6_ICTTR/7-151---DLEH----------LQCLEEELKPL--Q-------------------------------------------------
G5C793_HETGA/7-149---ELQH----------LQCLEEELKPL--E-------------------------------------------------
G1PJ32_MYOLU/7-147---ELKH----------LQCLVDELKPL--E-------------------------------------------------
B1AB81_HORSE/7-146---ELKH----------LQCLEEELKPL--E-------------------------------------------------
G3HTL8_CRIGR/7-150---ELKH----------LQCLEEELGAL--Q-------------------------------------------------
IL2_MACMU/7-151---ELKH----------LQCLEEELKPL--E-------------------------------------------------
H0Y254_OTOGA/7-149---ELKH----------LQCLEEELGPL--E-------------------------------------------------
IL2_MOUSE/7-165---ELKD----------LQCLEDELGPL--R-------------------------------------------------
G3SU90_LOXAF/7-147---ELKH----------LQCLVDELKPL--E-------------------------------------------------
IL2_PIG/7-151---ELKH----------LQCLVEELKAL--E-------------------------------------------------
IL2_FELCA/7-151---ELTH----------LQCLVEELKPL--E-------------------------------------------------
L5K7D9_PTEAL/7-149---ELNH----------LQCLVDELKPL--E-------------------------------------------------
IL2_BOVIN/7-152---ELKH----------LKCLLEELKLL--E-------------------------------------------------
H0VBY4_CAVPO/7-149---ELQH----------LQCLEEELRAV--E-------------------------------------------------

PF01415

H0X0U6_OTOGA/15-141---DNCT----------RPCF....QEGLSQ-------------------------------------------------
G1QNL2_NOMLE/28-172---DANK----------EGMFLFRAARKLRQ-------------------------------------------------
IL7_BOVIN/28-171---DDNK----------EASFLNRASRKLRQ-------------------------------------------------
H0VFS1_CAVPO/31-152---ADKK----------EAAFLNRAAYKLEQ-------------------------------------------------
F1PA23_CANLF/29-154---DDNK----------EGMFLYRAAHKLKQ-------------------------------------------------
M3WJR8_FELCA/15-139---DDCT----------TPCF....QEGLSQ-------------------------------------------------
IL9_MOUSE/15-141---DDCT----------TPCY....REGLLQ-------------------------------------------------
U3KN10_RABIT/31-153---DDNK----------EADFLERAARKLDQ-------------------------------------------------
A0MZ91_PIG/18-138---DDCT----------TACF....QEGLSK-------------------------------------------------
K7E262_MONDO/59-200---DD.K----------EVTFIVHVTCKLKQ-------------------------------------------------
E1BF10_BOVIN/18-141---GDCS----------TACF....QEGLSQ-------------------------------------------------
F6PLW3_HORSE/15-136---DDCT----------TACF....QEGLSQ-------------------------------------------------
IL9_HUMAN/15-141---DNCT----------RPCF....SERLSQ-------------------------------------------------
IL7_MOUSE/28-151---DDTK----------EAAFLNRAARKLKQ-------------------------------------------------
G5BX09_HETGA/15-141---DNCT----------MPCF....QEGLSQ-------------------------------------------------
L8Y4N8_TUPCH/15-141---DNCT----------TPCF....QEGLAQ-------------------------------------------------
D4A8I9_RAT/15-141---DDCT----------TPCF....QEGMSQ-------------------------------------------------
G3TKQ6_LOXAF/16-136---DDCT----------TPCF....QEGLSQ-------------------------------------------------
M3YEX7_MUSPF/16-137---DSCT----------TPCF....QEGLSQ-------------------------------------------------
G1NXN3_MYOLU/28-153---DDDK----------EATFLKTAARKLKQ-------------------------------------------------

PF00103

PLRP1_BOVIN/26-238VQQTNIE-DLSKWTLVLLYSWNNPLHHLVTE-------------------------------------------------
CSH2_BOVIN/26-238AQQMNNE-DLSKWTLVLLYSWNNPLYYLLLE-------------------------------------------------
PLRP3_BOVIN/1-213ALRMNNE-DLSKWILMLLYSWHRPLYLLVKD-------------------------------------------------
PR4A1_RAT/17-227AQQFQLE-VLLGLSHSLLQAWLNPLHHLWAE-------------------------------------------------
CSH1_BOVIN/26-236AANTEDE-ALLRLVISLLHSWDEPLHQAVTE-------------------------------------------------
PLRP4_BOVIN/26-239NPTDEQK-GLIMWILMLLYSWQRPLYQLVTD-------------------------------------------------
PR3D4_RAT/16-223VHEIKTE-DLLRSIINISVSWKEPLKHFVSA-------------------------------------------------
PR2C2_MOUSE/16-224ARLTHYS-ALLKSGAMILDAWESPLDDLVSE-------------------------------------------------
SOM2_HUMAN/9-215TQQKSNL-ELLRISLLLIQSWLEPVQLLR..-------------------------------------------------
PR8A5_RAT/17-238GVNIDIE-EYLKMSINFCGFMDQPLFHLVIE-------------------------------------------------
PR6A1_RAT/20-234TQQRLGV-FLVKEMIGMLETWTFSLYHIANE-------------------------------------------------
PR7D1_MOUSE/17-240VRKTSFE-EFLKMVLHMLLAWKEPLKHLVTE-------------------------------------------------
CSH2_HUMAN/9-215TQQKSNL-ELLRISLLLIESWLEPVRFLR..-------------------------------------------------

PF06875

Q5BNQ4_9SALA/2-215L--YFYS-AIVEFLKEAMTEQ-EDLNPAELA-------------------------------------------------
Q5BNQ2_9SALA/2-215L--YFYS-AIVEFLKEAMTEQ-EDLNPAELS-------------------------------------------------

PF01110

CNTF_CHICK/1-194L--AAYR-AFRTLLAQMLEEQRELLGDTDAE-------------------------------------------------
G3VWZ5_SARHA/1-195L--HAYR-TFHVLLTEVLEDQRAQFTPTERD-------------------------------------------------
E1BFH9_BOVIN/1-193L--QAYR-AFHGMLARLLEDQRAHFTPAEED-------------------------------------------------
G5AP46_HETGA/1-192L--HAYR-TFHVLLARLLEDQQVHFTPTESD-------------------------------------------------
H0Z9U1_TAEGU/1-188L--AAYR-AFRTLLAQMLEEQREQLGEADAG-------------------------------------------------
CNTF_HUMAN/1-194L--QAYR-TFHVLLARLLEDQQVHFTPTEGD-------------------------------------------------

PF01291

LIF_MOUSE/44-203Y--RMVA-YLSASLTNITRDQ-KVLNPTAVS-----------------------------------------........
LIF_BOVIN/43-202Y--RIIA-YLGASLGNITRDQ-KVLNPYAHG-----------------------------------------........
ONCM_HUMAN/37-209Q--TLNA-TLGCVLHRLADLE-QRLPKAQDL-----------------------------------------ERSGLNIE
ONCM_MOUSE/34-194S--TVYT-TLDRVLYQLDALR-QKFLKTPAF-----------------------------------------P.......
ONCM_BOVIN/34-194Q--TLNT-TLGLILRMLSALQ-QDLPEAAH.-----------------------------------------........

PF03039

IL12A_MOUSE/6-215L--MMTL-CLGSI.YEDLKMYQTEFQAINAA-------------------------------------------------
G3VQT1_SARHA/40-247S--VKQL-CLKSI.YKDLETYKTEFKVVEET-------------------------------------------------
F6T5A8_MONDO/5-202F--IKDL-CLRSI.YEDLETYKAEFNVIKKT-------------------------------------------------
IL12A_PIG/6-222F--MTTL-CLSSI.YEDLKMYHVEFQAMNAK-------------------------------------------------
L8YEA2_TUPCH/1-213H--MMTL-CLSSI.YEDLKMYQVEFKAINAQ-------------------------------------------------
H0X861_OTOGA/6-217S--MMTL-CLSSI.YEDLKMYQVEFKAMNEV-------------------------------------------------
G1QWH2_NOMLE/40-254H--LTPL-CLSFLQYESIYSSRVQIKQASHR-------------------------------------------------
I3MN91_ICTTR/4-220W--NTTL-CFSSI.YEDLKMYQLELKAINEK-------------------------------------------------
Q924V6_CAVPO/6-221F--MMAL-CLNSI.YEDLKLYQLEFKNMNAQ-------------------------------------------------

PF02024

H3AP27_LATCH/26-169E--RPLE-SLGSM-DETLEIFHWILSSLP---------------------------------------------------
G3WWV6_SARHA/23-167L--HPFQ-SLSDM-DQTLAIYQQILSNLS---------------------------------------------------
F6PLK2_ORNAN/23-167N--QQFQ-NLADM-DQTLAVYQQILSSLP---------------------------------------------------
F7HGW1_CALJA/23-167F--HSDL-SFSKM-DEILATYQQIVISLP---------------------------------------------------
G5BHA4_HETGA/23-167L--YPDL-SFSKM-DQTLAVYQQIISNLP---------------------------------------------------
W5NER9_LEPOC/28-172D--KTLE-GLSTV-EDNLHTFQEILSSLP---------------------------------------------------
H0V7C6_CAVPO/23-165L--SPYL-SLPKM-DQTLTLYQKVITTLS---------------------------------------------------
LEP_HUMAN/23-167L--HPIL-TLSKM-DQTLAVYQQILTSMP---------------------------------------------------

PF15216

M3WGC3_FELCA/29-153E--DPPD-CLAKI-------DLITFYPTH---------------------------------------------------
G3QQC8_GORGO/29-153S--NRPH-CLTEI-------QSLTFNPTA---------------------------------------------------
F7I7D5_CALJA/29-153N--NRSH-CLTEI-------QRLTFDPTP---------------------------------------------------
F1RLI5_PIG/17-138D--DRPD-CLTKI-------ELFTFKPVH---------------------------------------------------
K7E5V9_MONDO/34-162E--TKSD-CLTVI-------EQLARNWSN---------------------------------------------------
L8YGS5_TUPCH/5-129S--NQSD-CLAKI-------ESLTFGTHA---------------------------------------------------
J9P5I8_CANLF/29-154A--YPPD-CLARI-------ERLTLHRIR---------------------------------------------------
TSLP_MOUSE/20-137E--SKPA-CLLKI-------EYYTLNPIP---------------------------------------------------

PF01109

CSF2_RAT/18-139F--SI--------------QRPTCVQTRL---------------------------------------------------
CSF2_MOUSE/18-136F--SF--------------KKLTCVQTRL---------------------------------------------------
CSF2_BOVIN/18-138F--DS--------------QEPTCLQTRL---------------------------------------------------
CSF2_CAVPO/18-140F--EP--------------QEPTCLQTRL---------------------------------------------------
CSF2_PIG/18-139F--DP--------------QEPTCVQTRL---------------------------------------------------
CSF2_HUMAN/18-139F--DL--------------QEPTCLQTRL---------------------------------------------------
CSF2_CANLF/18-139F--DP--------------EGPTCLETRL---------------------------------------------------

PF02025

G1RQD7_NOMLE/22-133V--HK--------------NHQLCTEEIF---------------------------------------------------
IL5_CAVPO/23-134A--HK--------------NHQLCIEEIF---------------------------------------------------
J9NWP5_CANLF/22-132T--VF--------------KHQLCIKEVF---------------------------------------------------
IL5_MOUSE/21-132T--HK--------------NHQLCIGEIF---------------------------------------------------
G3WAR7_SARHA/25-134D--PK--------------NHPLCIEEIF---------------------------------------------------
IL5_HORSE/22-133E--HK--------------NHQLCIEEVF---------------------------------------------------
B5FW65_OTOGA/22-133V--HK--------------NHQLCTEEIF---------------------------------------------------
I3MDT8_ICTTR/23-134A--HK--------------NHQLCIEEIF---------------------------------------------------
G3T4B0_LOXAF/23-133V--HE--------------NHQLCTEEIF---------------------------------------------------
G1SL79_RABIT/22-133V--HK--------------NHHLCIEETF---------------------------------------------------

PF02059

IL3_CANLF/19-132L--ED--------------TLLRPNLDVF---------------------------------------------------
IL3_MOUSE/27-138R--NK--------------SFRRVNLSKF---------------------------------------------------
IL3_BOVIN/18-132T--KE--------------SLLQANLKVF---------------------------------------------------
G3UC30_LOXAF/22-133R--DR--------------ASLKPNLDAF---------------------------------------------------
G1MH15_AILME/18-131L--NT--------------TLLRPNLEAF---------------------------------------------------
F1RJV6_PIG/18-131T--NN--------------TLLRPNLEAF---------------------------------------------------
G1RQ11_NOMLE/20-137M--EN--------------NLRRPNLEAF---------------------------------------------------
IL3_CALJA/19-136M--KP--------------NLRKPNLEAF---------------------------------------------------
F1LS41_RAT/29-138R--NS--------------TLRRVNLDEF---------------------------------------------------

PF07400

IL11_HUMAN/22-199A--MSAG-ALGALQLPGVLTRLRADLLSY---------------------------------------------------

PF00758

G3TYQ1_LOXAF/25-173Q--DVLG-AVTLLLEGVMAARRQVGPTCL---------------------------------------------------
W5K758_ASTMX/26-175Q--EVQT-GLWLLNRAFISLHTSISNSA.---------------------------------------------------
B1N8Y2_DANRE/15-168Q--EVQS-GLHMLNEAIGSLQISNQTEV.---------------------------------------------------
F7DTH0_CALJA/31-193V--DIWQ-GLTLLSEAVLRGQALLANSSQ---------------------------------------------------
M3XJ62_LATCH/27-177R--EIWA-GINLFTHTFKTVRDFIRDSV.---------------------------------------------------
G3W289_SARHA/30-190G--EVWQ-GLTLLSEAVLKGQALLANSSQ---------------------------------------------------
F6WUU2_MONDO/31-191G--EVWQ-GLTLLSEAVLKGQALLANSSQ---------------------------------------------------
G3VW20_SARHA/26-175T--QLSP-TRNSLTKG....GGSPLPAWE---------------------------------------------------
G1PF99_MYOLU/45-207L--EVWQ-GLALLSEAILRGQALLANSSQ---------------------------------------------------
TPO_CANLF/25-176Q--DVWG-AVALLLDGVLAARGQLGPSCL---------------------------------------------------
F7G570_MONDO/26-177Q--EVLG-AVTLLLEGAIAARGQLNPSCL---------------------------------------------------
H0W023_CAVPO/30-191A--EVWQ-GLVLLSEAMLQGQALLANSSQ---------------------------------------------------
H2LEX3_ORYLA/33-182E--EVQT-GLWLLQQALGSFGPSVTNTA.---------------------------------------------------

PF00489

IL6_BOVIN/27-208F--NQAI-CLIRTTAGLLEYQIYL--DYL---------------------------------------------------
M3X721_FELCA/27-208F--NQET-CLTRITTGLQEFQIYL--KFL---------------------------------------------------
IL6_HORSE/27-208F--NQET-CLMKITTGLSEFQIYL--EYL---------------------------------------------------
G3UHF3_LOXAF/20-205F--NKET-CLMKIITGLSEFQIYL--DYL---------------------------------------------------
L5KPK4_PTEAL/20-202F--NQET-CLMKITTGLLEFQIYL--DYL---------------------------------------------------
F7HV62_CALJA/27-212F--NEET-CLLKITTGLLEFEVYL--EYL---------------------------------------------------
IL6_MOUSE/26-210Y--NQEI-CLLKISSGLLEYHSYL--EYM---------------------------------------------------

PF16647

CSF3_BOVIN/42-190L--QLTS-CLNQLHGGLFLYQGLL--QAL---------------------------------------------------
CSF3_HUMAN/51-202L--QLAG-CLSQLHSGLFLYQGLL--QAL---------------------------------------------------
CSF3_MOUSE/57-205L--QQTQ-CLSQLHSGLCLYQGLL--QAL---------------------------------------------------

PF16649

IL23A_MOUSE/28-185LKDNSQF-CLQRIRQGLAFYKHLLDSDIF---------------------------------------------------
F7HQI5_MACMU/28-184LRDNSQF-CLQRIRQGLIFYEKLLGSDIF---------------------------------------------------
F1MSN4_BOVIN/35-192LRDNSQS-CLQRIHRGLVFYEKLLGSDIF---------------------------------------------------
IL23A_CAVPO/28-184LKDNSQF-CLQRIYQGLVFYQNLLGSDIF---------------------------------------------------
G3VET0_SARHA/31-186LNDNSQL-CLQQIHRGLIFYGHLLNSDIF---------------------------------------------------

PF00143

G5E7E1_LOXAF/9-168AW.NTTLLDQLHS----GLYLQLEDLE-------.ACLVQAMEEEES..VLAIES...........SAL.....AVKRYF
IFNE_MOUSE/27-185IW.EENHIEKVLA----ALHRQLEYVE-------.SLGGLNAAQKSG..GSSAQN...........LRL.....QIKAYF
G3I0H8_CRIGR/26-185TW.ETTLLDTFCT----GLHQQLSDLQ-------.ACLMQQVGEQEP..PLSQED...........SLV.....AVRKYF
H0VF99_CAVPO/28-187VW.NETIVENLTD----ELHQQMDHLK-------STILQERLEDKNM..TMRDTM...........TTL.....RLKSYY
L5KKJ7_PTEAL/25-192TW.KKKYLKRIQI----GLHRQLQYLE-------.QCLEEEEKENEDMKEMEEDESKYPGAMVSQLTNL.....ELKRYF
G1U0Q8_RABIT/26-185AW.NNTLLEELHT----ALHQQLQGLE-------.TCLVQAMGEEDS..VLTADS...........PTL.....MLKRYF
F6YZB3_ORNAN/25-183GW.DQAEVENFLH----GLHRQLEELE-------.VCLEEDTDPSQA..SVGSGI...........LRL.....RLKSYF
I3MY95_ICTTR/32-186AW.NKILLDIFLS----GLNQQYQDLK-------.ACVTHQVWRQKP...................LGI.....TVKKCF
V8NNB8_OPHHA/15-183VW.HEGSLRDFHI----GLDQQIKMLE-------.TCGNAELEQVIT..SPRNRK........LQLTRL.....RIKRYF
C8CKA7_PIG/26-185AW.DESLLHQFCT----GLDQQLRDLE-------.ACVMQEVGLEGT..PLLEEG...........SIL.....AVRKYF
H0W7G8_CAVPO/26-185AW.NQSLLDTFCT----GLHQQLNDLQ-------.ACLTQDTGLEEP..SLLHED...........SRL.....AVRKYF
G3GXU9_CRIGR/27-182GW.NKTIVESFLD----KLYKQIDFLK-------.KILKEMPKNESL..TTRD.S...........TIP.....RLKSYY
H0XSG1_OTOGA/26-185AW.NKTLLDQFRS----GLYQQLNELE-------.ACLMQEVGVGEA..ALMNQD...........SML.....AIRSYF
G1KX99_ANOCA/25-184PW.DEDSLRVFHA----GLDQQSENLK-------.SCLSESPRSQRI.................QLTRL.....KVKKYF
G3I0I6_CRIGR/27-185IW.EENHIERVLG----ALHQQLEYVE-------.LLAGLKAESKSG..GLSAQS...........LRL.....QIKSYF
IFNT4_SHEEP/26-185AW.DTTLLDQLCT----GLQQQLDHLD-------.TCRDQVMGEKDS..ELGNMD...........PIV.....TVKKYF
L8Y4J0_TUPCH/27-186DW.EEHYKEKFLI----ELHEQLDYLE-------.GLMELEAEQKND..ALDSED...........RRL.....HVKKYF
F7B527_HORSE/26-183AW.DETLLDKFLL----GLYQQLDDLE-------.TCLGKETKVEQS..ALGSEI...........STL.....AVKRYF
G1Q950_MYOLU/27-184GW.NETIVENLLE----ELDGQMDRLE-------.TALEEITKEGKF..PWEN.R...........TVL.....RLKTYY
M3WTR1_FELCA/26-186AW.SPAPLHGLRS----GLHRQLEALD-------.ACLLQATGEGER..APGMHG...........PVL.....AIKRYF
G5CB66_HETGA/27-185VW.NETIVENLLV----ELHQQMDSLK-------.TLLQEILEKKDI..TWEDTM...........IIP.....RLKGYY
L9L941_TUPCH/27-198TW.EQKHLKQIQM----GLHQQVEYLE-------.QCLEEEENEN.DWEKMEEDEMEHSGAAVPQLGNL.....ELKRYF
D2H9N6_AILME/27-184GW.NEIIVNNLLE----KIHWQIEHLE-------.EILEKIKEEENF..TWDD.R...........TLL.....PLKRYY
D3Z919_RAT/26-179AW.NETLRLSFCN----YLYQQLKDLE-------.ACQNQQVGVQEV..PLTQEP...........SWL.....AVREYF
C8CKB9_PIG/24-176AW.NNALLDHLLS----RLDHGLDRLE-------...............QMEGDN...........LACAYLGSVVRKYF
A8E6F6_XENTR/27-179GC.KQQAWERFQQ----LLYYQIHQLE-------.ACVSQTEENDLLKE.........................SISEEF
L8Y906_TUPCH/26-185TW.EEALLDKLLA----GLHQQLEDLE-------.TCLVQGVGEEPS..ALETDS...........TTL.....ALRGYF
H9L1C3_CHICK/28-183AW.DGAALEQFQN----GLYQQIEKLE-------.ACIIKKQTQY....FWSKEV...........NRL.....KLKKYF
L5KWM8_PTEAL/106-263AW.NTTLQHGLLT----GLHRQLEDLG-------.ICLVPEMKEVES..ALGMED...........PTL.....AVKRYF
G3WZJ8_SARHA/27-182AW.NQTQLRQLLI----GLDQQLEQLE-------.QCVGQEAEQEEP..SLGSEN...........PIL.....VLKSYF
G3UCD2_LOXAF/26-187AW.DQTLLDKLFA----ALDQQLNDLE-------.VCLMQETGVEETPVPVINED...........SML.....AVRKYF
K7GQJ6_PIG/17-164AW.DSTLLDKLCS----GLHQQLEDLD-------.PCLVQVMGEQAS..SLG................M.....AVKRYF
G3I0H3_CRIGR/26-178AW.ETTLLDTFCD----ELHQLLSDQQ-------.ACLKQQVVMQ.........D...........SLM.....AVRKYF
H0VYK7_CAVPO/28-181VW.NKTIVDDLLD----KLHQQMDRLK-------STILQERPEDTNM...................TTL.....RLKSYY
I3N7K4_ICTTR/33-202SW.DEEQLVQLQS----NLYEQVEYLK-------.QCWGKENKEKED...VKADEKKHSEAGVLPLGNL.....KLRRYF
L5K635_PTEAL/26-185AW.NTTLLHGLLS----GLHRQLEDLG-------.TCLVPEMKEVES..VLGTED...........PTL.....AMKRYF
H0W3G0_CAVPO/26-185AW.NATILHKLHT----VLHQQLEVMK-------.TCLVQVLREEGC..VLAIQN...........PIL.....ALRRYF
W5JYQ9_ASTMX/23-179QWTSQEKLDYFLH----IVFRLIEENK-------.CVMSKTQDSLDD..FLKREA...................SLRAYF
G3SI98_GORGO/28-185YW.KERHFKQIQI----GLDQQAEYLN-------.QCLEEDENENEDMKEMK.............LSSL.....ELRRYF
H0Y0D2_OTOGA/28-187AW.NKTLLDQLRT----NLGWQLQELE-------.SCLMSLGEEEGT..PLMNQG...........PTL.....AVRSYF
IFN_ANAPL/34-190HW.LHTARHDLLN----QLQHHIHHLE-------.RCFPADAARLHRRGPRN..............LHL.....SINKYF
G3UJX3_LOXAF/27-185GW.DETVIENLLA----ELSQQRDRLV-------.TILEESMEEENP..TSRNIM...........TIL.....HLKNYY
G5C259_HETGA/26-185AW.NNGLLDTFCT----GLHQQLSDLE-------.ACLTQEVGQEEV..PISHED...........SRL.....AVRKYF
G3WZF5_SARHA/26-185GV.NNTIIETFLN----IIFQQMEHLE-------.MALKEEMNQVNS..TRLNEE...........SIQ.....HLNNYY
IFNE_PIG/27-186GW.EESHMEEFLV----ELHQQLEYLE-------.ALMRLQAEQKSD..TLCSEN...........LTL.....QVKMYF
W5N6G4_LEPOC/27-185TW.EISELERFQG----LLYRQIRQLT-------.LCAGSEMKFSGEPNRLGVSV...................VLKTSF
H9KYA4_CALJA/26-185TW.DATLLDTFYT----ELYKQLNYLE-------.ACVMQRIGVEGT..PLMNAD...........SIL.....AVRKYF
D2HTQ4_AILME/33-205TW.EKDYLKQIQI----GLDQQLQYLE-------.QCLEEEEKEKEDSKELEEDGMNWSGALVPQLSNL.....ELRRYF
IFNB_HUMAN/27-185GW.NETIVENLLA----NVYHQINHLK-------.TVLEEKLEKEDF..TRGKLM...........SSL.....HLKRYY
G1NR05_MELGA/32-188HW.IDHAHHSLLN----QMQHYIHHLE-------.QCFVDQGTRSQKQGPRN..............SHL.....SINKYF
F7BVP5_ORNAN/23-181GW.DEATVEKFLH----GVHKEMMRLE-------.VFLEEEMGWENS..TLRRD............ISL.....HIKSYF
F7G875_MONDO/27-182DV.NDTIIEPFLS----GIYQQMLHLE-------.....EEMDQANS..SWESLE...........SIL.....RLKNYY
C8CKC3_PIG/33-205TW.EEKLLRQVQM----GLDQQLQVLE-------.QCLQEEEEENEDIKEMDEVERKPSGATVPPSHSL.....ELRRYF
I3MVD7_ICTTR/34-186AW.NQTLLNTFLT----GLHQQLDDLK-------.ACGTQQVGVEEA..PLR......................AVRKYF
F7A317_HORSE/26-184AW.DESLLDKLYT----GLYQQLTELE-------.ACLSQEVGVEET..PLMNED...........SLL.....AVRRYF
G1KU56_ANOCA/28-182PW.DENSIGILKV----GLKQEIAKLT-------.PCLSEDKQEIRE...........................DVKKYF
L5KBH2_PTEAL/26-185AW.NTTLLHGLLS----GLHWQLEDLG-------.TCLVPEMKEAES..ALGMED...........PAL.....AVKKYF
L5K909_PTEAL/26-185AW.DETLLGRFCT----GLYQQLNHLE-------.ACQTQEVGTEET..PLLDED...........STV.....AVRKYF
I3N5Z0_ICTTR/23-179SR.EENHIPIFLT----DLHQQLEYLE-------.TLLGLEAEQKSH..AQGSKN...........LRL.....QVKAYF
F7GHL9_MONDO/26-181TW.NQTQVIELRI----GLDHQLGQLE-------.SCLGQDAEWEVP..SLGSEN...........PMM.....ALKSYF
IFNE_HUMAN/27-186GW.EENHTEKFLI----QLHQQLEYLE-------.ALMGLEAEKLSG..TLGSDN...........LRL.....QVKMYF
I3LBU7_PIG/26-179A..DSTRLDKLCS----GLHQQMEDLD-------.SCLVQVRGEQVS..ALG................I.....VVWKYF
G3UK87_LOXAF/27-184AW.NTTLPDQLHN----GLYQQLEDLE-------.TCSMQAVGEGSV...LAIEG...........PVL.....AVKRYF
L9LC61_TUPCH/27-185GW.NDTIVEHLLA----QLFWQMDHLE-------.TMLEEKLEEENV..TWGNSM...........SVM.....HLKSYY
IFNB_RAT/27-182GW.NETIVESLLD----ELHQQTELLE-------.IILKEK.QEERL..TWVTST...........TTL.....GLKSYY
H0XMZ9_OTOGA/27-186GW.EESHVEKFLI----ELHQQLEYLE-------.ALTGLEAEQRSG..TVGIEK...........LRL.....QVKMYF
G3VDC6_SARHA/27-182EW.NQTQLIQLLM----GLDQQLEQLK-------.SCVGQEVEWKEH...LKSEN...........PRIQ....ALQTYF
I3JM36_ORENI/26-182SW.EDSTVRNFLN----IVNKQAEELH-------.SCIGSHSHKKKN...................SQLYF...KTEMYF
L5LKN9_MYODS/27-186GW.KESRMERFLI----ELHQQLEYLE-------.TLRGLQTDQKSS..TVGREK...........LRL.....QVKMYF
G1TYS8_RABIT/29-195TW.EETHLTQIQN----GLYEQVAYLE-------.QCLMEDIHETKE......EEMKYSGTGRFLLNNL.....ELRKYF
I3UJJ8_FELCA/27-185GW.EESHVEKFLT----ELHQQLEYLE-------.ELTGPEAEQDSC..ILGSEN...........VRL.....QIKMYF
C8CKA9_PIG/26-183SW.DETLLIKFLS----GLYQQLDDLE-------.KCLREGKKVEQS..PPGGEN...........SIL.....AVKTYF
IFNT2_BOVIN/3-162AW.NTTLLEQLCT----GLQQQLEDLD-------.ACLGQVMEEKDS..DMGRMG...........PIL.....TVKKYF
H0W510_CAVPO/26-186PW.NQSLLDSFCT----GLYELLKALQ-------.ACLTQEAGLQEP..LLMHED...........SRL.....AVRKYF
M3Z729_MUSPF/26-183PW.NTTLLEELCS----GLSEQMSHLE-------.ACPLQEAGVEEK..PLVNRD...........SIL.......RNYF
IFNA1_MOUSE/26-185AW.NTTLLDSFCN----DLHQQLNDLQ-------.GCLMQQVGVQEF..PLTQED...........ALL.....AVRKYF
G3TTC1_LOXAF/26-185AW.NTTLLNQLLN----GLPEQQEDLE-------.TCFMQAMEEGKS..ALPIEG...........PAL.....AVKEYF
G1PDS6_MYOLU/29-199TG.EEKHLGQIQT----GLDRQLQYLE-------.QCLKEE.KGNEDKEEMEEDERRHPGARTPQPSNL.....ELRRYF
F7ABU5_MONDO/27-182TW.NQTQVIQLLI----RLDQQLEQLE-------.RCLGQNVKWEEF..SLRSEK...........TRF.....ALKSYF
G1TTX4_RABIT/27-180GW.NETLVENLLG----ETHLQIHHLK-------.SKINKKV.......TLESIR...........MNL.....RLKSYY
H0XRP5_OTOGA/26-185AW.NKTLLDQFRT----GLYQQLNELE-------.ACLMPDEGVEDT..APMGED...........PVL.....ALRSYF
H0WK94_OTOGA/33-202TW.KLKHLNQIQM----GLDKQLEYLE-------.QCLQEEENENAD...VKEAAMKYSGAQGPQVHNL.....ELRRYF
G1KYL3_ANOCA/23-176PW.DEDSLRAFHA----GLDQQSENLK-------.SCLSASPR....................IQLTRL.....RVKKYF
G3WZQ8_SARHA/26-181TW.SQTQLKQLLI----GLDQQLDQLE-------.QCLGQDVEREEP..SLGSEN...........PSL.....VLKSYF
H2R6R8_PANTR/26-185AW.EQSLLEKFST----ELYQQLNDLE-------.ACVIQEVGVEET..PLMNED...........SIL.....AVRKYF
H0YTY6_TAEGU/34-188HW.PSHARNLLLN----KLQHHIHHLE-------.QCLPDNALLFKG..PRN..............PLL.....TINKYF
I3MXH1_ICTTR/27-185DW.NNTIVTDLLS----ELHQQMDLLN-------.TTVVEKLGEENK..RQAYSM...........IIL.....RLKSYY
M3WRV1_FELCA/26-184AW.NTTLLEEFCT----GLDRQLTRLE-------.ACVVQEVGEGEA..PLTNED...........SLL.......RNYF
H0W4H8_CAVPO/23-182AW.NKSLLHSFCT----GLHQQLNDLE-------.ACLTQETGLEEP..PLMHED...........SRL.....VVRKYF
R4GKJ6_CHICK/35-191HW.NDSQRQSLLN----RIHRYTQHLE-------.QCLDSSDTRSRTRWPRN..............LHL.....TIKKHF
A3FBE8_MUSPF/27-184GW.NESIVENLLA----TLHWQKEHLE-------.EILEDIMQEENV..TWDH.R...........TLL.....HLKRYY
G1KWE0_ANOCA/28-180LW.DEDSLRAFHA----GLDQQSENLK-------.SCLSASPRSQRI.................QLTSL.....RVKRYF
G7PS89_MACFA/26-185AF.NETLLDEFYI----ELDQQLNDLE-------.SCVMQEVGVTET..HLMYED...........SIL.....AVKKYF
G1Q880_MYOLU/26-185TW.NTTLVDQLRS----GLHRQLEDLE-------.ACLVEEMGEEGS..ALAMEG...........PTL.....ALKRYF
IFNB_MOUSE/27-180GW.NETIVVRLLD----ELHQQTVFLK-------.TVLEEK.QEERL..TWEMSS...........TAL.....HLKSYY
IFNB2_BOVIN/27-184GW.SETIIEDLLE----ELYEQMNHLE-------.PIQKEIMQKQNS..TMGD.T...........TVL.....HLRKYY
G1SJC4_RABIT/26-185AW.DKALLDRLCT----GLFEQQSDLE-------.VCMMQGAGAEEM..PLKHED...........SAW.....AVRKYF
W5PG31_SHEEP/26-185AW.DQSLLDKLCA----ALDQQLTDLQ-------.ACLRQEEGLRGA..PLLKED...........SSL.....AVRKYF
IFNA3_CANLF/26-183PW.NMTLLEELCS----GLSEQLDDLD-------.ACPLQEAGLAET..PLMHED...........STL.......RTYF
G5BPX2_HETGA/27-199TW.KEEYLTQIKS----ELAEQREYLE-------.QCLKEEKKENKGMQEMKTHELEHSGVQVVQQSKL.....ALRGYF
IFNW2_HORSE/26-185AW.NTTLLDELCT----GLLRQLEDLD-------.TCLEQEMGEEES..ALGTVR...........PTL.....AVKRYF
G3N2A8_BOVIN/26-185AW.DTTLLEQLHT----GLHQQLDDLD-------.ACLGQVMGEEDS..ALGRMG...........PTL.....AMKRYF
H0XKS8_OTOGA/27-185GW.NETIVDALLA----NFHQQMDSLE-------.TTLDEKLEDKNF..IGGKVT...........NIL.....HLKSYY
H0VUV7_CAVPO/26-185AW.NQSLRRTFCD----ALRDQMNDLK-------.ACLTKETGLEDP..SLWHED...........SRN.....AVKKYF
Q29412_PIG/27-184GW.NETVIKTILV----ELDGQMDDLE-------.TILEEIMEEENF..PRGD.M...........TIL.....HLKKYY
G7PS88_MACFA/26-185AW.DEDLLDKFCT----ELYQQLNDLE-------.ACVMQQERVGET..PLMNAD...........STL.....AVKKYF
M3WZS7_FELCA/26-181AW.DEMLLDRFLV----GLYQQLDDLE-------.TCLREEMNMEQL..PLGNEN...........SRL.....AVKRYF
H9GZR7_HORSE/26-185AW.NTTLLDRLLT----GLHQQLEDLN-------.TCLDEQTGEEES..ALGTVG...........PTL.....AVKRYF
F1LVL8_RAT/26-184VW.EENHIEEVLA----ALHRQLGYLE-------.SLGGLKAERKSG..GLSVKD...........LRL.....QIKAYF
M3YX13_MUSPF/27-179GW.EEIRVE.FLT----ELHQQLEYLG-------.ALRGLGAEQNSG..VLSGGN...........SRM.....QVKKYF
G1L8G2_AILME/26-185AW.DETLLDKFLA----GLHQQLEDLE-------.TCLEEEKNVEQL..LLGSEN...........SRL.....AVKRYF
IFNB_HORSE/27-184GW.NETIVKNLLV----EVHLQMDRLE-------.TNLEEIMEEESS..TWGN.T...........TIL.....RLKKYY
H0W289_CAVPO/26-190AW.NGALLDQLHS----LLYQQLEAMK-------.ICMVQEAGGEES..ALATED...........LTLNHSWRTLMKYF
A8E6E8_MONDO/27-182AW.NQTQLMQLLI----GLDQQIEQLE-------.RCLTQDVEQDEP..SLGREN...........PLM.....ALKNYF
I3N788_ICTTR/27-185GW.NETIVKDLLV----ELHQQMDLLE-------.TILEKKLGEENK..SWGNSR...........TIL.....HLKSYY
G1L8I1_AILME/26-183AW.NRTLLEEFCS----GLSEQLSVLE-------.ACPMQAAGVGET..PVRNVD...........SIL.......RNYF
IFNB_FELCA/27-184GW.NETTVENLLA----TLHWQKEHLE-------.TILEEIMEEENF..TWDN.T...........TLL.....NLKKYY
H0VXI5_CAVPO/26-181AW.DKSLLSYFCT----GLHQHLKHLH-------.ACLTQEVGLQEP..PLMHED...........SRQ.....AVRKYF
G3TS29_LOXAF/26-179AW.DETFLDKFLL----GLYQQLNDLE-------.ICFEKERKVEQI..PLGTEN...................SVKSYF
W5PZ39_SHEEP/26-184TW.EGKQLRQIQI----GLDHQLQYLE-------.QCLEEEER..............PSGAPVLQPSNL.....ELRRYF
G3I0H6_CRIGR/26-178AW.EKTLLKPFCN----SLLQQFNALK-------.ACLMHQVGMQ.........D...........SQV.....AMKNYF
I3L756_PIG/26-180AW.DSTLLDKLCS----GLHQQLEDLD-------.PCLVQEMEEQTF..ALG................M.....AVKRYF
M3Z715_MUSPF/26-183PW.NTTLLEELCS----GIYQQVNDLQ-------.ACLMQEAGVEEM..ALVNGD...........SIL.......RNYF
M3VXI8_FELCA/33-205TW.KKKNLKQIQI----RLDWQMHHLE-------.KCFEEEEKGKEDSKQREEDGMDFSGAMVSQVSSL.....ELRRYF
G3R8Q7_GORGO/26-185AW.NMTLLDQLHT----GLHQQLQHLE-------.TCLLQVMGEGES..AGTIRS...........PAL.....TLRRYF
A8E6F5_XENTR/51-202GC.KQQAWERFQQ----LLYYQINQLE-------.ACIPETAENPVFNQ.........................TISDQY

PF02947

FLT3L_MOUSE/30-162---AGSKMQTLLE----DVNTEIHFVT--------SCTFQPLPECLRFVQTNISH-----------LLK-----DTCTQL
F6T7S9_ORNAN/28-157---SGPRLRELVH----KVQAEVDFVN--------DCGFQRPQKCARFQQINISQ-----------FLG-----DVSQHL
H9GP84_ANOCA/29-165---SGSELEKSIR----KLMIHTTFVE--------MCDIN..DSCVKFITTNISE-----------FLE-----PIPSYL
F6TPW7_MONDO/34-163---AGKELKKLLD----KVCTEISFVR--------KCFSEALPGCLHFRKANISH-----------LLL-----DISSHL
G5B8P0_HETGA/20-150---AGLKIRELLE----TVDTEIHFVT--------SCAFQPLPSCLRFVQTNISH-----------LLQ-----DTVAQL
G1M637_AILME/29-159---AGSQMQILLE----AVNTEIHFVT--------LCALQPLPSCLRFVQTNISH-----------LLQ-----DTSKHL
L9JA37_TUPCH/769-910---AGPQIQDLLE----KVNTEIHFVT--------SCDFQPLPSCLRFVQTNISD-----------LLQ-----DTSAQL
G3VSA3_SARHA/79-209---AGSKLQEPLE----AVYAEIDFVG--------QCVNQSFPSCLRFRKANISH-----------LLL-----EVSNHL
G1QZC3_NOMLE/30-160---AGSKMQGLLE----RVNTEIHFVT--------KCAFQPPPSCLRFVQTNISR-----------LLQ-----ETSEQL

PF03487

G1SCQ2_RABIT/16-144QR........MLS----GLCTD.KAVA.......KQVTSVQ---------------------------------------
IL13_HUMAN/16-144QR........MLS----GFCPH.KVSA.......GQFSSLH---------------------------------------
IL13_RAT/2-130QR........ILN----GLCNQ.KASD........VASSPP---------------------------------------
F7DGH7_MACMU/16-151ERDSPWKAPGLCG----PFCPL.ASHSRAGLFVLQQFSSLR---------------------------------------
L5M5Z7_MYODS/2-128QR........MLS----ALCPR.QPSA.......GPASSPP---------------------------------------
G5ASP9_HETGA/2-130QK........ILS----SLCQH.RAVA........KVSSFH---------------------------------------
B3GDZ5_PIG/2-130QR........MLS----ALCSH.KPPS.......EQVPGKH---------------------------------------
L8YAP6_TUPCH/2-128LR........LLN----GLCTS.KSSA.......EQVSSLP---------------------------------------
IL13_BOVIN/2-130KR........MLN----ALCPH.KPSA.......KQVSSEY---------------------------------------
IL13_MOUSE/2-130QR........ILH----GLCNR.KAPT........TVSSLP---------------------------------------
H0W834_CAVPO/16-149QK........ILS----GLCQH.KASA.......GQVSSLR---------------------------------------
F6WQF3_ORNAN/2-128LR........IMQ----R..PQPPPLS.......LQVHCEV---------------------------------------
G3T2N9_LOXAF/2-133KR........NLS----GACEQYKAPA.......SQVSSLQ---------------------------------------
M3YGH3_MUSPF/2-126QR........LLK----SLCHQ.DTSA.......GQISS..---------------------------------------
B5FW67_OTOGA/2-129QR........ILG----GLCKQ.KDLP.......G.VPSSH---------------------------------------
I3MAR4_ICTTR/2-131QR........MLS----GLCTH.KNTA.......KQASTVP---------------------------------------
IL13_CANLF/2-129QR........MLK----ALCSQ.KPAA.......GQISSER---------------------------------------

PF00727

IL4_FELCA/26-131----------FLK----GLDRNLSSMA-------NR.TCSV---------------------------------------
H0XDE1_OTOGA/26-149----------FLK----GLDRNLCSLA-------NSRYCPV---------------------------------------
IL4_MOUSE/27-140----------ELQ----RLFRAFRCLD-------SSISCTM---------------------------------------
G3T4B8_LOXAF/26-132----------YLR----GLSRSLSSMT-------NLDYCPV---------------------------------------
IL4_RABIT/28-143----------LLR----GLDRNLCSMA-------KLSNCPG---------------------------------------
G5ASQ0_HETGA/25-138----------LLK----KVYRNLRSMV-------QP.NCSV---------------------------------------
F6U5N6_HORSE/26-135----------CLS----GLDRNLKGMA-------NGTCCTV---------------------------------------
IL4_BOVIN/26-133----------FLG----GLDRNLNSLA-------SK.TCSV---------------------------------------
G3QSC0_GORGO/26-149----------FLK----RLDRNLWGLA-------GLNSCPV---------------------------------------
A3FBF0_MUSPF/26-130----------LLR----GLHRNLRNMA-------NM.TCSV---------------------------------------
IL4_RAT/27-139----------ELR----KLCRGVSGLN-------SLRSCTV---------------------------------------
G3WEJ0_SARHA/28-149----------ELK----KMCRNLMHLV-------NQTKCPV---------------------------------------
I3MAS4_ICTTR/24-141----------LLR----GLYRNLRSMA-------QLHNSPA---------------------------------------
IL4_PIG/26-131----------LLS----GLDRNLSSMA-------NM.TCSV---------------------------------------

PF00726

IL10_BOVIN/5-174HGPDIKEHVNSLGEKLKTL---RLRLR-------RCHRFLPCENKSKAVE------------------------KVKRVF
IL10H_EBVB9/7-167QDPEAKDHVNSLGENLKTL---RLRLR-------RCHRFLPCENKSKAVE------------------------QIKNAF
G3HB01_CRIGR/14-174HGPEIKEHLNSLGEKLKTL---RRQLQ-------RCHRFLPCENKSKAVE------------------------KVKSDF

PF14565

IL22_HUMAN/40-178FQPYMQEVVPFLA----RL---SNRLS-------TCHIEGDDLHIQRNVQ------------------------KLKDTV
E1C1U2_CHICK/46-184RYPYAEDVAQFLA----SL---TSELS-------RCKYSGNREHIEKNLE------------------------EMKSKM

PF15177

IFNL3_CHICK/28-182LAETCQQPLAFLT----QV---QEDLR-------DCLALE...APSHQPSG....-------------------KLRHWL
F1M3K4_RAT/31-188LVTILGQPLHTLS----HI---HSQLQ-------TCTEPQPTAEPT..PQSR...-------------------LLSRWL
I3MK89_ICTTR/34-194LGDVLDQPLHTLG----HI---QSQLQ-------ACAPAQPTAGPR..PQGRHRH-------------------RLSHWL
F1PY54_CANLF/31-186LGVTLDQPLRTLH----HI---HSELQ-------ACVPAQPTADPR..PHG....-------------------RLHHWL
H0XRJ1_OTOGA/35-191LRDVLDQPLHTLR----HI---QSQLQ-------ACGSAQPTAGPM..PRG....-------------------RLRNWL
M3W3J2_FELCA/32-181QGDILDQPLHTLR----HM---HSELQ-------AVVSAQSEAGPR..PQG....-------------------RLHHRV
F6PNH9_HORSE/31-184LADILDRPLHTLR----HI---HSELQ-------ACVPARPTAGPG..PRG....-------------------RLHQWL
D2DJP5_XENTR/23-178LAKLLSLPLTMLL----SL---EDDLK-------ICRKSPLYSDP...PSE....-------------------QLMPWL
G3TQK4_LOXAF/32-188LGAVLDQPLHTLH----HI---HSKLR-------ACVSAQPTSGPR..PQS....-------------------RLHRWL
F7DXI8_HORSE/34-187LGDVLDQPLGTLS----HI---HSELQ-------ACVAAQPTEGPR..PRG....-------------------RLHQWL
F6W920_MONDO/30-184LQDVLIQPLQTLS----HI---YREIQ-------SCVTPLPSRGHR..LPG....-------------------RPNNWL
U3KED0_FICAL/27-186FAEVRRRPLEFFA----QA---REDVR-------GCVSACPSVDPAHQPSG....-------------------RLRHWL
H0VBN4_CAVPO/39-195LGDVLEQPLHMLR----HI---HAQLQ-------ACVPTLRTAAPR..PVSR...-------------------RLSHWL
IFNL4_HUMAN/25-174LLPGAGPILELLA----AA---GRDVA-------ACLELARPGSSRKVPGA....-------------------QKRR..
IFNL2_MOUSE/32-189LATILGQPLHTLS----HI---HSQLQ-------TCTQLQATAEPR..SPSR...-------------------RLSRWL
G3N0M3_BOVIN/37-192LGHSLEQPLLTLQ----NI---HSKLQ-------ACVPAQPTASSR..PRG....-------------------RLHHWL
G1LPU9_AILME/37-191QGGILDQPLHTLR----HI---HSELQ-------ACVEAQPTAGPQ..PRG....-------------------RLHHWL
L5LZZ9_MYODS/163-319LGDILDQPLHTLH----HI---HSKLQ-------ACAPAQATAGPR..PRG....-------------------LLRQWL
IFNL3_HUMAN/34-192LGDVLDQPLHTLH----HI---LSQLR-------ACIQPQPTAGPR..TRG....-------------------RLHHWL
F6R8C9_XENTR/23-177LSEFVSQPLEFFR----SL---EDDLK-------HCRKSPLYSDP...PSQ....-------------------QLMPWL
G3VJ97_SARHA/12-167LDSVLAQPLQTLS----HI---HQEIQ-------SCVTSQTSKEHK..LPG....-------------------RLKNWL
H0XJU8_OTOGA/36-192LRDILDQPLHTLR----HI---QSQLQ-------ACGRVQPTAGPR..LRG....-------------------RLRNWL
G3HJD0_CRIGR/30-187LYPILEQPLHTLS----NI---HSQLQ-------ACIQPEPAAEPR..PPSH...-------------------RLSRWL
G1LPW2_AILME/34-190LGDILDQPLHTLG----HI---HSELQ-------ACVEAQPPAGPR..PRG....-------------------RLQHWL
L5L378_PTEAL/33-182LGDILDQPLHTLR----HI---HSELQ-------ACVSPQPTASPR..PHG....-------------------RLHHWL
G1T4B0_RABIT/34-188RGHVLEQPLRTLR----HI---HTQLR-------G.LSPQQTASAHHPPVP....-------------------KRRGRL
U3IYH6_ANAPL/34-185LAEKSQQPLAFFT----QA---REDLR-------GCVAAE...APSHQPSG....-------------------KLRHWL
L9LBW1_TUPCH/31-181LGDVLDQPLHVLR----HI---HSLLQ-------ACVPAQ........PQG....-------------------HLPSWL
D0FHA1_PIG/36-191LHSSLDQPLHTLR----HI---HAQLQ-------ACVPAQPMAGPR..PRG....-------------------RLHHWL

PF05337

CSF1_HUMAN/41-180------IAIVQLQ----EL---SLRLK-------SCFTKDYEEHDKACVRT-----------------------FYETPL
Q3TLQ6_MOUSE/41-180------NATERLQ----EL---SNNLN-------SCFTKDYEEQNKACVRT-----------------------FHETPL
O77709_BOVIN/41-180------KVIVQLQ----EL---SLRLK-------SCFTMDYDEQDKACVRT-----------------------FHETPL
O77710_BOVIN/41-180------KVIVQLQ----EL---SLRLK-------SCFTMDYDEQDKACVRT-----------------------FHETPL
Q64129_9MURI/41-180------NATERLQ----EL---SNNLN-------SCFTKDYEEQNKACVRT-----------------------FHETPL

PF15036

IL34_MOUSE/28-184.WKYLQEVQTLLE----NV...QRSLM-------D.........VEIGP-------------------------HVEAVL
R4GIU3_CHICK/19-177.RGYTQELSQLLD----ALGVEYSGYR-------Q.........SDVDA-------------------------VVADLV
F7EA00_CALJA/29-185.WKYLQEVQTLLL----DV...QRGLT-------D.........VEVSP-------------------------KVESVL
H0WFN4_OTOGA/28-184.WSYLQEVQRLLL----DV...HQGFK-------D.........MEVSP-------------------------KVEAVL
M3ZVZ0_XIPMA/24-191.RPYTAELERRFR----DA...EGVFV-------Q.SHPAEVFQQELPE-------------------------TIQDIW
U3JY35_FICAL/18-179.WKYTQELCQLFD----ALGEEYSKYR-------Q.........TDVET-------------------------VVADVV
L9KJY3_TUPCH/28-184.WQYLQDVQTLLQ----NV...QEGLT-------D.........VEVSP-------------------------KVEAVL
G3T3A6_LOXAF/28-182.WKYLDEVQTLLV----TI...QQGLM-------D.........VEASP-------------------------EVEAVL
F6W3U1_MONDO/15-167.RNYIKEIHELLI----YV...QEIAK-------D.........LQVHP-------------------------QVEKIL
I3JZ08_ORENI/24-192.RPYTAELERRFK----DA...QAVFM-------Q.SHPAQVFQEDLPE-------------------------KIHDIW
L5MCR9_MYODS/28-182.WKYLKDIHSLLV----DV...QQALG-------D.........VKLSP-------------------------PVDAVL
B3DLJ8_DANRE/23-195RRKYLSDLENLFK----KF...ETVFK-------EGNHEDQENVRERPE-------------------------SLQTIW
IL34_BOVIN/28-183.WKYLEEVHTLLL----DV...KQGLG-------G.........VEVSP-------------------------QVEAVL

PF00714

IFNG_HORSE/15-152-NQVIQKSMDTIK---------EDLFV-------KFFNSSTS.-------------------------------KLEDFQ
H0WPL1_OTOGA/15-151-NQTIKKSIETIK---------EEIIA-------KFFNSSYS.-------------------------------KAEAFQ
Q8CGS0_CAVPO/15-154-NQTVQNSMNTIK---------EQIIT-------KFFKDNSSN-------------------------------KVQAFK
B9VS86_CALJA/15-152-NQSIQKSMETIK---------EDMNV-------KFFNSNKR.-------------------------------KQDDFE
G3SUC6_LOXAF/15-152-NQVIQESVKTLE---------EDLFV-------KFFNSSSS.-------------------------------KRDDFL
G3GY20_CRIGR/2-135-NQAIQRSIDTIK---------ADLFA-------NFFNSSME.-------------------------------KLNDFV
I3MNV6_ICTTR/15-152-NKIIQGSINTIR---------EDLSA-------KFFNSNCI.-------------------------------KREDFL
L5LME8_MYODS/15-153-NKTIQNSLDIIK---------EELRV-------KVFNSSNS.-------------------------------KMEDFK
G5BGB5_HETGA/15-152-NQIVQKSMDTIK---------EDIIA-------KFFHSNSS.-------------------------------KLDVFQ
G3WQJ9_SARHA/15-153-NSIVKRSMEHIR---------EDMIM-------KLFPNNTAS-------------------------------SVDDFE
IFNG_SHEEP/15-152-NQVIQRSMDIIK---------QDMFQ-------KFLNGSSE.-------------------------------KLEDFK
IFNG_RAT/14-151-NQAISNNISVIE---------SHLIT-------NFFSNSKA.-------------------------------KKDAFM
IFNG_RABIT/15-152-HEVIKKSMESIK---------EDIFV-------KFFNSNLT.-------------------------------KMDDFQ
L9KVU0_TUPCH/51-188-NQVIKKSVDIIK---------EDMID-------KFFNSSPT.-------------------------------KLDVFL
IFNG_FELCA/15-153-DQRIQRSMDTIK---------EDMLD-------KLLNTSSS.-------------------------------KRDDFL

PF02404

R4GD07_ANOCA/1-283FFKHFSNTVESYK----IL.AKTPVQS-------DCVLPSTTETPPNDSRL-----------------------SVTKSF
SCF_CHICK/1-287FFRLFNSTIEVYK----EF.ADSLDKN-------DCIMPSTVETPENDSRV-----------------------AVTKTI
SCF_RAT/1-273FFSIFNRSIDAFK----DF.MVASDTS-------DCVLS.STLGPEKDSRV-----------------------SVTKPF
G1NWC8_MYOLU/1-272FFRIFNRSINAFK----DLEMVSSKTS-------ECVFS.STLSPGNDSRV-----------------------SVTKPF
F7EP53_MONDO/1-273FFRFFNKSIDAFK----EY.EETSEHS-------NCVLP.STIGPERDSRV-----------------------NVTKPF
F7C5I3_ORNAN/1-273FFGYFNRSIEAFR----DF...QAEHS-------DCIFPTTTLMPEKDSRV-----------------------SVTKPF
F7G0W2_CALJA/1-273FFRIFNRSIDAFK----DF.VVASETS-------DCMAS.STLSPEKDSRV-----------------------SVTKPF

PF02372

IL15_PIG/33-160S..RNSDISDTVE----NLIILANSSL-------SS..IEYKTESGC---------------------------------
IL15_CAVPO/33-160S..RNEDIHETIT----NLIILANSSL-------NS..NGNVTESGC---------------------------------
IL15_FELCA/33-160S..KNETIHQTVE----NIIILANSGL-------SS..NRNITETGC---------------------------------
IL15_SHEEP/33-160S..KNAAIYEIIE----NLTMLADRNL-------SS..IENKTELGC---------------------------------
F1NZN5_CHICK/55-183CGIKKCSRKHDVR----NILKNGNARF-------ATYQLNSTTSKKC---------------------------------
G1NDP6_MELGA/5-137EIEDEPEIKNEFK----NALQNIKKNL-------HRLKDLSPTGGEC---------------------------------
O73883_CHICK/5-138ETEDDTEIKEEFV----TAIQNIEKNL-------KSLTGLNHTGSEC---------------------------------
Q8JFF4_ANAPL/4-134EIEDEDEIEDEKV----SSVRNIKMNL-------QKLMDLIPPGTGC---------------------------------

PF00715

I3MQX6_ICTTR/7-151EVLNVPQSKNFHL----KDTRNFISNI-------NVTVLKLKGSATT---------------------------------
G5C793_HETGA/7-149QVLNLAEHKHFPL----INTKDFISNI-------NVTVWKLKGSKTT---------------------------------
G1PJ32_MYOLU/7-147EVLKLEKS....L----SNITELMSNV-------NVLVQNLKGPKTR---------------------------------
B1AB81_HORSE/7-146EML.....KNFLS----KDIKELMSNI-------NVTVLGLKGSETR---------------------------------
G3HTL8_CRIGR/7-150SVLDLAQSKSFQL----EDTENFISNI-------RVTVVKLKGSENT---------------------------------
IL2_MACMU/7-151EVLNLAQSKNFHL----RDTKDLISNI-------NVIVLELKGSETT---------------------------------
H0Y254_OTOGA/7-149KVLDLGQSKNFHL----GDTREVIGNI-------NVTVLELKGSET.---------------------------------
IL2_MOUSE/7-165HVLDLTQSKSFQL----EDAENFISNI-------RVTVVKLKGSDNT---------------------------------
G3SU90_LOXAF/7-147DVLNVAPSK....----QNTRELISNI-------NVTALELQGSETT---------------------------------
IL2_PIG/7-151GVLNLGQSKNSDS----ANIKESMNNI-------NVTVLELKGSETS---------------------------------
IL2_FELCA/7-151EVLYLAQSKNFHL----NHIKELMSNI-------NVTVLKLKGSETR---------------------------------
L5K7D9_PTEAL/7-149EVLTIAQSKNSH.----SDIKESVSNI-------NVTAQKLKGPETK---------------------------------
IL2_BOVIN/7-152EVLNLAPSKNLNP----REIKDSMDNI-------KRIVLELQGSETR---------------------------------
H0VBY4_CAVPO/7-149QVLNLAEHKNFPL----IHTKDFISNI-------NVTVLSLKGSETA---------------------------------

PF01415

H0X0U6_OTOGA/15-141MTNS.TVHTEHPQ----IFNRVKK.TV-------AALKNNKCPFFSC........-------------------......
G1QNL2_NOMLE/28-172FLKM.NSTGDFDL----HLLKVSEGTT-------ILL........NCTGQVKGRK-------------------PAALGE
IL7_BOVIN/28-171FLKM.NISDDFKL----HLSTVSQGTL-------TLL........NCTSKGKGRK-------------------PPSLSE
H0VFS1_CAVPO/31-152FVKM.NITADFEL----HLLKVSQGTL-------KLI........NCT.......-------------------......
F1PA23_CANLF/29-154FVKV.NNSEDFNL----HLSRVSQGTL-------QLL........NCTPK.....-------------------......
M3WJR8_FELCA/15-139MTNS.TVQTSFPL----IFNRLKR.NV-------KDLKSSKCQFFSC........-------------------......
IL9_MOUSE/15-141LTNA.TQKSRLLP----VFHRVKR.IV-------EVLKNITCPSFSC........-------------------......
U3KN10_RABIT/31-153FHDM.SINEDFQN----HLERVSKGTL-------TLV........NCTGK.....-------------------......
A0MZ91_PIG/18-138MSNT.TAKPELSL----IFSKVKK.TI-------EALKNNKCGDFSC........-------------------......
K7E262_MONDO/59-200LVKANNIPENLSH----SLEVYSHHAL-------GILKGCKCDEVNGTEK.KAGG-------------------PCFFVE
E1BF10_BOVIN/18-141MSSS.TVSTRFHL----IVNQLKK.IV-------VTLKSNKCGSFAC........-------------------......
F6PLW3_HORSE/15-136MTNT.TVKTRFAL----IFNRVKK.TV-------AALKNNKCQLFSC........-------------------......
IL9_HUMAN/15-141MTNT.TMQTRYPL----IFSRVKK.SV-------EVLKNNKCPYFSC........-------------------......
IL7_MOUSE/28-151FLKM.NISEEFNV----HLLTVSQGTQ-------TLV........NCTSK.....-------------------......
G5BX09_HETGA/15-141MTNI.TQKTKFSL----TFNQVKR.TV-------EVLKNNKCPSFSC........-------------------......
L8Y4N8_TUPCH/15-141MTHV.MANTASSL----IFYKVKR.TV-------QGLKNNKCPFFSC........-------------------......
D4A8I9_RAT/15-141VTNA.TQQSKFSP----FFFRVKR.IV-------ETLKSNKCQFFSC........-------------------......
G3TKQ6_LOXAF/16-136LTDK.TVQSEFTL----SFNRVKK.TV-------EDLQRKNCRTFSC........-------------------......
M3YEX7_MUSPF/16-137MTNS.TVGTRYPL----IFNRVKR.TV-------QDLKKNKCQFFSC........-------------------......
G1NXN3_MYOLU/28-153FLKM.NIHEEFKL----HLSIVSQGTL-------KLL........NCTRK.....-------------------......

PF00103

PLRP1_BOVIN/26-238LQHMKELSNAFLS----SATRFENMSE-------KLQAFIERQFSKI---IVPVL-------------------NTMIQA
CSH2_BOVIN/26-238LRNMKNLSEAVIS----SAMEIENMSE-------KLQAFIESQFRKI---IVPVL-------------------KMIHEV
PLRP3_BOVIN/1-213LQSMKEVSDTILS----SAKENMRKIE-------ELQAFIERQFSQV---IYPVI-------------------RTIFKA
PR4A1_RAT/17-227MCDRLGSTPPTLY----KALMLKESNI-------KLLDAIKNIAKKG---NF..E-------------------INEKAN
CSH1_BOVIN/26-236LLHRNGASPDILA----RAKEIEDKTK-------VLLEGVEMIQKRV---H.PGE-------------------KKNEPY
PLRP4_BOVIN/26-239LRSMKEVSNTILS----SARENVKKLK-------ELQALIERPFSQV---IFTAR-------------------RKMYIA
PR3D4_RAT/16-223VTDLPGASASMRK----KAVDMKDKNL-------IILEGLQKIFNRT---QTKVE-------------------ENENFD
PR2C2_MOUSE/16-224LSTIKNVPDIIIS----KATDIKKKIN-------AVRNGVNALMSTM---LQ..N-------------------GDEEKK
SOM2_HUMAN/9-215..SVFANSLVYGA----SDSNVYRHLK-------DLEEGIQTLMWRL---EDGSP-------------------RTGQIF
PR8A5_RAT/17-238LSAMEGVPETILS----KAKDLEENNR-------QLLDDLRWILTKV---F..PT-------------------AEIKEE
PR6A1_RAT/20-234MSHMEEPPDEIIS----RAKNIEEKIK-------ELMDVLKGILNKI---Q..PG-------------------SPQNER
PR7D1_MOUSE/17-240LSALPECPYRILS----KAEAIEAKNK-------DLLEYIIRIISKV---N..PA-------------------IKENED
CSH2_HUMAN/9-215..SMFANNLVYDT----SDSDDYHLLK-------DLEEGIQTLMGRL---EDGSR-------------------RTGQIL

PF06875

Q5BNQ4_9SALA/2-215LKAKFEEAMANSN----TLISKISDIM-------TQMGMSV---------------------------------TITLPK
Q5BNQ2_9SALA/2-215LKAKFEEAMANSN----TLISKISDIM-------TQMGMSV---------------------------------TITLPK

PF01110

CNTF_CHICK/1-194LGPALAAMLLQVS----AFVYHLEELL-------ELESRGA---------------------------------PAEEGS
G3VWZ5_SARHA/1-195FHQNIHRVLLQVA----AFAYEMEELM-------ALLGHQA---------------------------------PSQETD
E1BFH9_BOVIN/1-193FHQAIHAVLLQVA----AFAYQLEELM-------ALLEHRV---------------------------------PPREAG
G5AP46_HETGA/1-192FHQAIRSLGLQVS----AFAYQLEELM-------VLLEHEI---------------------------------PPNETS
H0Z9U1_TAEGU/1-188LGRALAAVLLQVS----AFAYHLEELL-------RLESRGI---------------------------------PGEEGD
CNTF_HUMAN/1-194FHQAIHTLLLQVA----AFAYQIEELM-------ILLEYKI---------------------------------PRNEAD

PF01291

LIF_MOUSE/44-203LQVKLNATIDVMR----GLLSNVLCRL-------CNKYRVG....HV---------------------------DVP...
LIF_BOVIN/43-202LHSKLSTTADVLR----GLLSNVLCRL-------CSKYHVS....HV---------------------------DVT...
ONCM_HUMAN/37-209DLEKLQMARPNIL----GLRNNIYCMA-------QLLDNSD...TAE---------------------------PTKAGR
ONCM_MOUSE/34-194...KLDSARHNIL----GIRNNVFCMA-------RLLNHSL..EIPE---------------------------PTQTDS
ONCM_BOVIN/34-194.....QQAEMNVR----GFGNNIHCMA-------QLLRGSSDPKAAE---------------------------PTQPGP

PF03039

IL12A_MOUSE/6-215LQNHNHQQIILDK----GMLVAIDELM-------QSLNHNG---ETL---------------------------RQK---
G3VQT1_SARHA/40-247LAKDPTRQISLDQ----NMLAAIDEMM-------QALNFSS---ENM---------------------------TVT---
F6T5A8_MONDO/5-202LTKDPAKQISVDL----NMLAAIEEMM-------QALNFNS---KNV---------------------------PLI---
IL12A_PIG/6-222LLMDPKRQIFLDQ----NMLTAITELM-------QALNFNS---ETV---------------------------PQK---
L8YEA2_TUPCH/1-213LWMDPERQILLDQ----NMLTAIDELM-------QALNFNS---DTV---------------------------PRS---
H0X861_OTOGA/6-217LSMYPINQTILDQ----NLLTVMEKLM-------QDLNSTS---ETV---------------------------MHP---
G1QWH2_NOMLE/40-254RCMCLENEYFFSQ----VLRTELQALR-------HALNFNS---ETV---------------------------PQK---
I3MN91_ICTTR/4-220LLMDPKGQIYEDK----ALLAAVDYLM-------QAVNVNN---ETV---------------------------PQT---
Q924V6_CAVPO/6-221LLMDPQRQIFLDQ----NMLSAIDELI-------QALNGSD---VTV---------------------------PQK---

PF02024

H3AP27_LATCH/26-169V.DDVTQILWDIE----NLRALLQTLA-------TTMGCEL---------------------------------HQTTEL
G3WWV6_SARHA/23-167S.RNMVQISNDLE----NLRDLLHLLG-------SLKSCPF---------------------------------DEADGL
F6PLK2_ORNAN/23-167M.PDRTQISNDLE----NLRSLFALLA-------TLKNCPF---------------------------------TRSDGL
F7HGW1_CALJA/23-167S.GNMIQISNDLE----NLRALLHLLA-------ASKSCHL---------------------------------PWASGL
G5BHA4_HETGA/23-167SRRNMVQISNDLD----NLQNLVHMLA-------SSKGCPL---------------------------------PQTRGP
W5NER9_LEPOC/28-172M.EEMDQILADIF----NLRMIIKSLA-------TSVNCAP---------------------------------LKSSNM
H0V7C6_CAVPO/23-165S.SHTAQISNDLE----NLQSLVQMMA-------SSKGCPL---------------------------------PHTTEP
LEP_HUMAN/23-167S.RNVIQISNDLE----NLRDLLHVLA-------FSKSCHL---------------------------------PWASGL

PF15216

M3WGC3_FELCA/29-153GCTTLAKEI...F----AIRTNATLTL-------QCPGYSG---------------------------------------
G3QQC8_GORGO/29-153GCASLAKEM...F----AMKTKAALAI-------WCPGYSE---------------------------------------
F7I7D5_CALJA/29-153GCAALAKEL...F----AVRTNATLAL-------WCPGYSE---------------------------------------
F1RLI5_PIG/17-138GCTSLAKEE...F----AKRTKAAFAL-------QCSGYSG---------------------------------------
K7E5V9_MONDO/34-162NCSSEMGETLEAF----VNRTRIALKS-------YCPVFQG---------------------------------------
L8YGS5_TUPCH/5-129GCGSLSKEM...F----ACRTKATFAH-------RCPDYPR---------------------------------------
J9P5I8_CANLF/29-154GCASGAREA...F----AEGTVAALAA-------ECPGYAA---------------------------------------
TSLP_MOUSE/20-137GCPSLPDKT...F----ARRTREALND-------HCPGYPE---------------------------------------

PF01109

CSF2_RAT/18-139K----LYKQGLRG----N-LTKLNGAL-------TMIAS-----------------------------------HYQTN-
CSF2_MOUSE/18-136K----IFEQGLRG----N-FTKLKGAL-------NMTAS-----------------------------------YYQTY-
CSF2_BOVIN/18-138K----LYKNGLQG----S-LTSLMGSL-------TMMAT-----------------------------------HYEKH-
CSF2_CAVPO/18-140A----LFMKGLRG----N-LTRLEGSL-------TLMAN-----------------------------------FYKQH-
CSF2_PIG/18-139N----LYKQGLRG----S-LTRLKSPL-------TLLAK-----------------------------------HYEQH-
CSF2_HUMAN/18-139E----LYKQGLRG----S-LTKLKGPL-------TMMAS-----------------------------------HYKQH-
CSF2_CANLF/18-139Q----LYKEGLQG----S-LTSLKNPL-------TMMAN-----------------------------------HYKQH-

PF02025

G1RQD7_NOMLE/22-133QGIGTLESQTVQG----GTVERLFKNL-------SLIKK-----------------------------------YIDGQ-
IL5_CAVPO/23-134QGIDTLKNQTTQG----EALATLFQNL-------SLIKK-----------------------------------HIDLQ-
J9NWP5_CANLF/22-132QGIDTLKNQTAHG----EAVDKLFQNL-------SLIKE-----------------------------------HIERQ-
IL5_MOUSE/21-132QGLDILKNQTVRG----GTVEMLFQNL-------SLIKK-----------------------------------YIDRQ-
G3WAR7_SARHA/25-134QGIETLKNQTAED----NVVERIFQNF-------SSLKE-----------------------------------HITTK-
IL5_HORSE/22-133QGIDTLKNQTVQG----DAVAKLFQNL-------SLIKG-----------------------------------YIDLQ-
B5FW65_OTOGA/22-133HGLDTLRNQTAHE----DGVEQLFQNL-------SLIKK-----------------------------------YIDRQ-
I3MDT8_ICTTR/23-134QGIDTLKNQTTQG----DAVERLFQNL-------SLMKK-----------------------------------YIDIQ-
G3T4B0_LOXAF/23-133QGIDTLKNQTVQD----DAVGKLFKNL-------SLLKE-----------------------------------YIDLQ-
G1SL79_RABIT/22-133RGVDTLKAQIVQG----EAMDNLFQNL-------YLIKK-----------------------------------YIDLQ-

PF02059

IL3_CANLF/19-132L----NASSKF.H----KNGLLIWNNL-------KEFLP-----------------------------------LLPTP-
IL3_MOUSE/27-138V----ESQGEVDP----EDRYVIKSNL-------QKLNC-----------------------------------CLPTS-
IL3_BOVIN/18-132M----TFATDT.F----GSDSKIMKNL-------KEFQP-----------------------------------VLPTA-
G3UC30_LOXAF/22-133L----KATENFKE----KGGSSISKNL-------RKFHP-----------------------------------CLPKA-
G1MH15_AILME/18-131L----NATKNF.Y----NSESLIWKNL-------KEFLP-----------------------------------LLPTP-
F1RJV6_PIG/18-131V----TFAENH.L----KNISGIKKNL-------EKFRP-----------------------------------ILPTS-
G1RQ11_NOMLE/20-137N----KAVKSL..----QNASAIESIL-------KNLPP-----------------------------------CLPMA-
IL3_CALJA/19-136Q----KAVKSL..----QNAAAIESNL-------KDLPV-----------------------------------CLPTA-
F1LS41_RAT/29-138L----KSQEEFDS----QDTMDIKSKL-------QKLKC-----------------------------------CIPAA-

PF07400

IL11_HUMAN/22-199L-RHVQWLRRAGG----SSLKTLEPEL-------GTLQARLDRLLRRLQLLMSRL-------------------ALPQP-

PF00758

G3TYQ1_LOXAF/25-173SSLLEQL..SGQV----RLL..LGALQ-------GLLGTQL...------------------------------.PPQG.
W5K758_ASTMX/26-175....LHSHIDASV----RNIASIGQVL-------RSLSIQD...------------------------------YVPTV.
B1N8Y2_DANRE/15-168....LQSHIDASI----RNIASIRQVL-------RSLSIPE...------------------------------YVPPT.
F7DTH0_CALJA/31-193PREPLQLHMDRAV----SGLRSLTTLL-------RALGAQKEAT------------------------------SPPDAA
M3XJ62_LATCH/27-177....TVYHITKSY----SNTRSTAQIL-------KRLHTQE..I------------------------------PVPDS.
G3W289_SARHA/30-190TPVALKLFVDKAV----SSLRSLRFLL-------RGLGTQEEAI------------------------------FVPNA.
F6WUU2_MONDO/31-191TPAALKLFVDKAV----SSLRSLRFLL-------RGLRTQEETV------------------------------SLPDA.
G3VW20_SARHA/26-175AALVLSLCRSGWA----GDM..ISGLG-------PVLCPQS...------------------------------.LPKG.
G1PF99_MYOLU/45-207TSETLQLHVDKAI----SGLRSLTSLL-------RALGSQKEAI------------------------------SLPDAT
TPO_CANLF/25-176SSLLGQL..SGQV----RLL..LGALQ-------GLLGTQL...------------------------------.PPQG.
F7G570_MONDO/26-177SSLLGQL..SAQT----HSL..LGALQ-------GLLGTPS...------------------------------.LPKG.
H0W023_CAVPO/30-191QSETLQLHLDKAV----SGLRSLTSLL-------HLLGAQKAPI------------------------------LPPDA.
H2LEX3_ORYLA/33-182....LNNHIDNTA----RNLVSINAVL-------RSLNFQE...------------------------------YTPPA.

PF00489

IL6_BOVIN/27-208QNEYEGNQEN.VR----DLRKNIRTLI-------QILKQKIADL..I---------------------------TT..P-
M3X721_FELCA/27-208QDKYEGDKEN.AK----SVYTSTNVLL-------QMLKRKGKNQDEV---------------------------TIPVP-
IL6_HORSE/27-208QNEFKGEKEN.IK----TMQISTKVLV-------QILMQKMKNP.EV---------------------------TTPDP-
G3UHF3_LOXAF/20-205QNKFEGSKAN.VI----VVQNSTKALV-------QILKQKIKNPEDV---------------------------TTPDP-
L5KPK4_PTEAL/20-202QNKFE...EN.AK----AMQMRTKALV-------QVLKQKVKNPNEI---------------------------TTPDP-
F7HV62_CALJA/27-212QNRFESSKEQ.AG----AVQMSTKGLI-------QSLQKKAKNLSAI---------------------------ATPDP-
IL6_MOUSE/26-210KNNLKDNKKDKAR----VLQRDTETLI-------HIFNQEVKDLHKI---------------------------VLPTP-

PF16647

CSF3_BOVIN/42-190AGISPELAPT-LD----TLQLDVTDFA-------TNIWLQMEDLGAA---------------------------PAVQP-
CSF3_HUMAN/51-202EGISPELGPT-LD----TLQLDVADFA-------TTIWQQMEELGMA---------------------------PALQP-
CSF3_MOUSE/57-205SGISPALAPT-LD----LLQLDVANFA-------TTIWQQMENLGVA---------------------------PTVQP-

PF16649

IL23A_MOUSE/28-185KGEPALLPDSPME----QLHTSLLGLS-------QLLQPEDHPRETQ---------------------------QMPSL-
F7HQI5_MACMU/28-184TGEPSLLPDSPVG----QLHASLLGLS-------QLLQPEGHHWETQ---------------------------QIPSP-
F1MSN4_BOVIN/35-192TGEPSLLPNGPVD----QLHASILGLR-------ELLQPKGHHWETE---------------------------QTPSP-
IL23A_CAVPO/28-184TGEPPLFPDGPVS----QLHASLLGLS-------QLLQPEVHQWE.P---------------------------QIPSL-
G3VET0_SARHA/31-186KGEPSLLQDGPVG----QLHSSLLGLS-------QLLQPKDHSWKKQ---------------------------QVPS.-

PF00143

G5E7E1_LOXAF/9-168QGIH.SYLKE-------KEYS------------------------DCAW--EIVRVEIKRSFSSSTNL....QE.RL---
IFNE_MOUSE/27-185RRIH.DYLEN-------QRYS------------------------SCAW--IIVQTEIHRCMFFVFRF....TT.WL---
G3I0H8_CRIGR/26-185HRIT.AYLRE-------KNHS------------------------PCAW--EVVRAEVWRALSSSANL....LA.RL---
H0VF99_CAVPO/28-187WRIS.KYLRA-------KKNS------------------------ICAW--TVVQAELIRNFSIINRL....TN.YF---
L5KKJ7_PTEAL/25-192HRIS.SFLKD-------KKYS------------------------HCAW--EIVRVEIRRCFCYF.......TA.LL---
G1U0Q8_RABIT/26-185QRIR.LYLDE-------KKHS------------------------GCAW--ELVRMEIRRAFSSTADL....QE.SL---
F6YZB3_ORNAN/25-183RGIS.LYLRD-------KEYS------------------------SCAW--EIVRAEIRRSFEYSVVL....SP.GL---
I3MY95_ICTTR/32-186QRIT.DYLKE-------KEYR------------------------PCAW--EVVRTEVVKFVSSSPKL....YE.RL---
V8NNB8_OPHHA/15-183QRLS.DFLKN-------KKYS------------------------LCAW--EIVQIQIEACFQLINHY....IQ.RI---
C8CKA7_PIG/26-185HRLT.LYLQE-------KSYS------------------------PCAW--EIIRAEVMRAFSSSTNL....QD.RL---
H0W7G8_CAVPO/26-185HRIA.VYLKE-------KSYS------------------------PCAW--EVVRAEIVRCFSSSEEL....LR.KM---
G3GXU9_CRIGR/27-182ERMQ.RYLED-------NGHS------------------------SCAW--MVTQAEVLRNFMFIKRL....TR.IF---
H0XSG1_OTOGA/26-185QRIT.LYLKE-------KKYS------------------------SCAW--EVVRAEIMRAFSSSTRL....QE.RL---
G1KX99_ANOCA/25-184RSLS.DLLKE-------KGYS------------------------RCAW--EIVHIQVKYHLSASSVL....GW.KL---
G3I0I6_CRIGR/27-185RRIH.DYLEN-------QRYS------------------------SCAW--IVVQVEINRCMFFVFRL....TA.WL---
IFNT4_SHEEP/26-185QGIH.DYLQE-------KGYS------------------------DCAW--EIVRVEMMRALTVSTTL....QK.RL---
L8Y4J0_TUPCH/27-186RRIR.NYLEN-------HKYS------------------------SCAW--TIVQVEIKRCLFLVLRL....IG.KL---
F7B527_HORSE/26-183RRIS.LYLKE-------KDYS------------------------GCAW--EVVRVEIRRCLLFMNKL....TG.KL---
G1Q950_MYOLU/27-184LGIF.QYLKG-------KSYS------------------------RCAW--TVVQAEILRNFSFLNRL....IG.AL---
M3WTR1_FELCA/26-186QDIR.VYLED-------EGYS------------------------DCAW--EIVRLEIMRALSSSATL....QD.SL---
G5CB66_HETGA/27-185WRIR.RHMKA-------KDNS------------------------ICAW--TVVQVELSRNFSFINRL....TD.YF---
L9L941_TUPCH/27-198NRIK.NFLKD-------KKYS------------------------RCAW--EIIRMEIRRCFHYFQKF....TE.LL---
D2H9N6_AILME/27-184LRIV.RYLKA-------KVYS------------------------ICAW--KIVRAEMLRSFFFLDKF....TN.YL---
D3Z919_RAT/26-179GRIT.MYLKQ-------KKHS------------------------PCAW--EVVRVEVGRALIYSDMF....LA.KL---
C8CKB9_PIG/24-176QRIH.RYLKK-------KEYS------------------------SCAW--EVVRVETEVCLSLMQQL....ST.KS---
A8E6F6_XENTR/27-179NLLE.TMVLE-------KDNS------------------------ACVW--DFIHLETRRNLQQVLQL....SS.RL---
L8Y906_TUPCH/26-185QGLH.LYLEK-------KNFS------------------------DCAW--EVVRVEIRKCFLFINKL....IR.KL---
H9L1C3_CHICK/28-183QKID.SFLKE-------KQHN------------------------LCSW--EISRAEMRRCLQLIDKV....IR.KL---
L5KWM8_PTEAL/106-263QGIR.LYLKE-------KRYS------------------------DCAW--EVVRVEIKEILLFINKL....TK.KV---
G3WZJ8_SARHA/27-182QGIR.AYLQG-------KEYS------------------------RCAW--EIVRVEIRRIFLFMSKL....TK.KL---
G3UCD2_LOXAF/26-187QRIT.VYLTE-------KKYS------------------------PCAW--EIVRAEIMRSFSASTNW....QE.RL---
K7GQJ6_PIG/17-164ERIH.LFLKE-------KKYS------------------------DCVW--EIVRVEIMKPLSSLNSF....AR.KV---
G3I0H3_CRIGR/26-178HRIT.VYLRE-------KNHS------------------------PCAW--EVVRAEVWRALSSSVNL....LA.RL---
H0VYK7_CAVPO/28-181WRIS.RYLTA-------RENS------------------------ICAW--TVVQAELISKFPIINSL....TD.YF---
I3N7K4_ICTTR/33-202SRIY.NFLKD-------KTYS------------------------RCAW--EIVRVEITRYFLYLKKF....IT.LH---
L5K635_PTEAL/26-185QGIH.LYLEE-------KQYS------------------------DCAW--EVVRVEIRRYLFVVNKF....TR.KE---
H0W3G0_CAVPO/26-185LGIR.LYLED-------KKYS------------------------DCAW--EIVRVEIMRAFSLSAKL....QE.KI---
W5JYQ9_ASTMX/23-179QNIT.AVLIE-------KDYQ------------------------YCAW--EFARFEILHALQFI.......LI.NL---
G3SI98_GORGO/28-185HRID.NFLKE-------KKYS------------------------DCAW--EIVRVEIRRCLYYFYKF....TA.LF---
H0Y0D2_OTOGA/28-187QRLI.LYLQE-------KKYS------------------------LCAW--EIVRTEIMRSYSYSKHL....QN.TL---
IFN_ANAPL/34-190GCIQ.HFLQN-------HTYS------------------------PCAW--DHVRLEAHACFQRIHRL....TR.TM---
G3UJX3_LOXAF/27-185LGIG.QYLEA-------KDYS------------------------SCAW--TVVQVEILRNFSFISGL....TD.YL---
G5C259_HETGA/26-185HRIT.LYLKE-------KRYS------------------------PCAW--EVVRAEIMRSFSSSEKL....AR.KV---
G3WZF5_SARHA/26-185QRIM.NYLEN-------KKYS------------------------SCSW--KIVQVETRLNFIFLYKL....TE.RL---
IFNE_PIG/27-186QRIR.DYLEN-------QDYS------------------------SCAW--TIVRVEINRCLFFVFQL....TG.KL---
W5N6G4_LEPOC/27-185AKLE.KVLRD-------KDYS------------------------YCAW--ESVRRDLRRALEQFQEF....LE.SN---
H9KYA4_CALJA/26-185ERIT.LYLTE-------KKHS------------------------PCAW--EVVRAEIMRSFSLLTSL....QE.RL---
D2HTQ4_AILME/33-205NRID.NFLKE-------KKYS------------------------HCAW--EIIRVEIRRCFYYFQKF....AA.LL---
IFNB_HUMAN/27-185GRIL.HYLKA-------KEYS------------------------HCAW--TIVRVEILRNFYFINRL....TG.YL---
G1NR05_MELGA/32-188RSIH.NFLQR-------NNYS------------------------ACSW--DHVRLHARTCFQNVDTL....IQ.QM---
F7BVP5_ORNAN/23-181KRMM.DYLKG-------RNYS------------------------SCAW--EVIRMKTKRCFLVIYRL....TR.KL---
F7G875_MONDO/27-182QGIT.NYLKN-------KEYS------------------------SCAC--KIVQVETRRNFSFLYKL....TE.YL---
C8CKC3_PIG/33-205NRID.KFLKD-------KEHS------------------------HCAW--EIVRVEIRRCFYFFQKF....TA.LL---
I3MVD7_ICTTR/34-186HRIT.VYLKE-------KKYL------------------------PCAW--EVVRAEIMKSFSSSANL....YA.RL---
F7A317_HORSE/26-184QRIA.LYLQE-------KKYS------------------------PCAW--EIVRAEIMRCFSSSTNL....QQ.S.---
G1KU56_ANOCA/28-182ERIH.TFLKD-------GEYN------------------------ECAW--EVAQIEVSRFFMVMEQL....IR.TL---
L5KBH2_PTEAL/26-185QGIR.LYLKE-------KEYS------------------------VCAW--EVVRVEIRKAFSLSTNL....LD.RL---
L5K909_PTEAL/26-185QRIT.LYLQE-------KKHS------------------------PCAW--EIVRAEIMRSYSLSTHL....KE.KS---
I3N5Z0_ICTTR/23-179RRIH.NYLES-------QRHS------------------------SCAW--TIVHAEINRCLVFVFRL....IR...---
F7GHL9_MONDO/26-181QGIS.RYLQG-------KGYS------------------------RCAW--EFTRIEIRRCILFMSNL....TR.KF---
IFNE_HUMAN/27-186RRIH.DYLEN-------QDYS------------------------TCAW--AIVQVEISRCLFFVFSL....TE.KL---
I3LBU7_PIG/26-179QRIH.RYLKE-------KSYS------------------------PCAW--EIVRAEVMRAFSSSTNL....QD.RL---
G3UK87_LOXAF/27-184QEI..LYLKE-------KEHS------------------------DCVW--EVIRVEISKLIYVSTNLGSSGQK.RL---
L9LC61_TUPCH/27-185LRIT.QYLKA-------KEYS------------------------SCAW--TIVRVEILRNFLFINRL....ID.YL---
IFNB_RAT/27-182WRVQ.RYLKD-------KKYN------------------------SYAW--MVVRAEVFRNFSIILRL....NR.NF---
H0XMZ9_OTOGA/27-186RRIR.EYLEN-------QEYS------------------------SCAR--TIVQVEINRCLLFVFRL....TE.KL---
G3VDC6_SARHA/27-182QGIN.QYLQD-------KEYS------------------------RCAW--EMVRIEIRRIFLFMDKP....IR.KL---
I3JM36_ORENI/26-182KRLSDDVLKK-------KGHS------------------------AEAW--EVIRKETKAHLMRAEQL....AS.SL---
L5LKN9_MYODS/27-186RRIR.DYLEN-------QKYS------------------------GCAW--TVVQVEVNRCLFFVLPL....TG.KL---
G1TYS8_RABIT/29-195YRMN.NFLED-------KKYS------------------------YCAR--EIVRVEITRCFSYFYRF....TA.FL---
I3UJJ8_FELCA/27-185QRIH.DYLES-------QEYS------------------------SCAW--TIVRVEINRCLFFALQL....IR.KI---
C8CKA9_PIG/26-183QGIS.LYLKE-------KEYS------------------------HCAW--EVVRVETRKCLLFINNL....VG.KL---
IFNT2_BOVIN/3-162QGIH.VYLKE-------KEYS------------------------DCAW--EIIRMEMMRALSSSTTL....QK.RL---
H0W510_CAVPO/26-186HRIT.VYLKE-------KSYS------------------------PCAW--EVVRAEIRRSFSFSATL....KTPKI---
M3Z729_MUSPF/26-183QRIS.LYLQE-------KQYS------------------------PCAW--EMVRAEIMKPLYASTAL....HK.RL---
IFNA1_MOUSE/26-185HRIT.VYLRE-------KKHS------------------------PCAW--EVVRAEVWRALSSSANV....LG.RL---
G3TTC1_LOXAF/26-185EGIR.FYLKE-------KEYS------------------------DCAW--EFVRVEIRRSFSSSTAL....QE.RL---
G1PDS6_MYOLU/29-199HRIS.SFLQD-------KQYS------------------------HCAW--KIVQVEIRRCFYYFQTL....IE.LL---
F7ABU5_MONDO/27-182QGIS.QYLQG-------KEYS------------------------PCAW--EIVRVEIRRLFLFMSKL....AR.KL---
G1TTX4_RABIT/27-180WRIM.DYLET-------KQYS------------------------NCAW--KIVQLEIFRNFSFIIML....ID.YL---
H0XRP5_OTOGA/26-185HRIT.LYLKE-------KKYT------------------------PCAW--EVVKAEILRSFSSTTSL....QE.RL---
H0WK94_OTOGA/33-202NKMH.NFLKE-------KKYS------------------------HCAW--DIVQVEIRRCIYYFYQF....TA.LL---
G1KYL3_ANOCA/23-176RSLS.NLLKE-------KEYS------------------------RCAW--EIIQIQVKQCFLWIEKI....IQ.EI---
G3WZQ8_SARHA/26-181QGIN.QYLQD-------KEYS------------------------RCAW--EIVRIEIRKMFLFMNKF....TR.NL---
H2R6R8_PANTR/26-185QRIT.LYLTE-------KKYS------------------------PCAW--EVVRAEIMRSLSFSTNL....QK.RL---
H0YTY6_TAEGU/34-188RDIH.LFLHA-------HNHS------------------------ACAW--DHVRLEARASLRHLHNL....TR.AR---
I3MXH1_ICTTR/27-185VRIR.MYLEA-------KLYS------------------------SCAW--TVVRDELYWNFSFINRL....TD.KF---
M3WRV1_FELCA/26-184QRLS.LYLQE-------KKYS------------------------PCAW--EIVRAEIMRSLYSSTAL....QK.RL---
H0W4H8_CAVPO/23-182HRIA.VYLKE-------KSYS------------------------PCAW--EVVRAQIVRSLSASEKL....AR.KM---
R4GKJ6_CHICK/35-191SCLH.TFLQD-------NDYS------------------------ACAW--EHVRLQARAWFLHIHNL....TG.NT---
A3FBE8_MUSPF/27-184LRIV.RYLKA-------KEFS------------------------VCAW--TIVQAEILRSFFFLDKL....TD.SL---
G1KWE0_ANOCA/28-180RSLN.DFLKE-------KEYS------------------------RCAW--EIVQIQVKQCFLWIEKL.........---
G7PS89_MACFA/26-185RRIT.LYLTE-------KKYS------------------------PCAW--EVVRAEIMRSFSLSINL....QK.RL---
G1Q880_MYOLU/26-185QGIR.LYLKE-------KKYS------------------------DCAW--EVVRVEIMRSFSSTRAL....QE.RL---
IFNB_MOUSE/27-180WRVQ.RYLKL-------MKYN------------------------SYAW--MVVRAEIFRNFLIIRRL....TR.NF---
IFNB2_BOVIN/27-184FNLV.QYLKS-------KEYN------------------------RCAW--TVVRVQILRNFSFLTRL....TG.YL---
G1SJC4_RABIT/26-185QGIA.VYLAE-------KQYS------------------------PCAW--EVVRAEARRAVSLSRIL....QE.RI---
W5PG31_SHEEP/26-185HRVT.LYLQE-------KGHS------------------------PCAW--EVVRAEVMRAFSSSTNL....QE.RF---
IFNA3_CANLF/26-183QRIS.LYLQD-------RNHS------------------------PCAW--EMVRAEIGRSFFSLTIL....QE.RV---
G5BPX2_HETGA/27-199QRIE.NYLKD-------KKYS------------------------YCAW--KIVQVEIKRCFFYFLKF....IK.LP---
IFNW2_HORSE/26-185RGIH.LYLKE-------KKYS------------------------DCAW--EIVRMEIMRSFSSSANL....QG.RL---
G3N2A8_BOVIN/26-185QGIH.VYLKE-------KEYS------------------------DCAW--EIVRLEIMRALSSSTSL....QE.RL---
H0XKS8_OTOGA/27-185FRIT.WYLKA-------KRYS------------------------SCAW--TVVREEILRNLFFINRL....TG.YL---
H0VUV7_CAVPO/26-185HGIT.DYLKE-------KSYS------------------------PCAW--EVVRAEFFRSFSSSEEL....LR.KM---
Q29412_PIG/27-184LSIL.QYLKS-------KEYR------------------------SCAW--TVVQVEILRNFSFLNRL....TD.YL---
G7PS88_MACFA/26-185RRIT.LYLTE-------KKYS------------------------PCAW--EVVRAEIMRSFSLSTNL....QE.RL---
M3WZS7_FELCA/26-181QGIS.LYLKE-------KEYS------------------------HCAW--EVVRVEIRRCLLVINKL....TG.TF---
H9GZR7_HORSE/26-185RRIR.LYLTE-------KKYS------------------------DCAW--EIVRVDIMRSFSSSANL....QG.RL---
F1LVL8_RAT/26-184RRIH.DYLEN-------HRYS------------------------TCAW--IIVQIEVNRCMFFVSRL....AR.RL---
M3YX13_MUSPF/27-179RRIH.NYLEN-------QEYN------------------------SCAW--R....EINRCLFFAFQL....VR.KL---
G1L8G2_AILME/26-185HGIG.LYLEK-------KKYS------------------------RCAW--EVVRVEIRRCLFFVNEL....AG.KL---
IFNB_HORSE/27-184GRIS.QYLKA-------KKYS------------------------HCAW--TVVQAEMLRNLAFLNGL....TD.YL---
H0W289_CAVPO/26-190QGIS.LYLEE-------KKYS------------------------DCAW--EIVRVEIRRVVSFSLRL....QQ.RL---
A8E6E8_MONDO/27-182QGIS.QYLQG-------KGYS------------------------HCAW--EVTRVEIRRCFLFLSKL....SR.KF---
I3N788_ICTTR/27-185WRIL.RYLKA-------KQYS------------------------SCAW--TVIRMELFQNFSFINRL....MD.HF---
G1L8I1_AILME/26-183QRIS.LYLQE-------KQYS------------------------PCAW--ETVRAEITKPLFSSTIL....QE.GL---
IFNB_FELCA/27-184LRIV.RYLKA-------KEYS------------------------VCAW--TVVHAEILRNFFFLERL....TD.YL---
H0VXI5_CAVPO/26-181HRIA.VYLKE-------KSYS------------------------PCAW--EVVRAEIVRCFSSSETM....QK.NI---
G3TS29_LOXAF/26-179QGIG.LYLKE-------KEHS------------------------LC.W--EVVRVEIRKCFLFINML....TV.QI---
W5PZ39_SHEEP/26-184NRID.RFLKD-------KKHS------------------------HCAW--EIVRVEIRRCFYFFQKL....TA.LL---
G3I0H6_CRIGR/26-178DRIT.AYLGE-------KNHS------------------------PCAW--EVVRAEVWRAMSASANL....LA.TL---
I3L756_PIG/26-180EGIH.LYLKE-------KKYS------------------------DCAW--ETVRVEIVRALSSTTNL....QE.RL---
M3Z715_MUSPF/26-183QRIS.LYLQE-------KQYS------------------------PCAW--EIVRAEIMKPLYASMIL....QE.RL---
M3VXI8_FELCA/33-205YRMY.NFLKD-------KKYS------------------------PCAW--EIIRVELRRCFYYFYKL....TL.LL---
G3R8Q7_GORGO/26-185QGIR.VYLKE-------KKYS------------------------DCAW--EVVRMEIMKSLFLSTNM....QE.RL---
A8E6F5_XENTR/51-202QALE.QILQE-------KN.T------------------------ACTR--DIIQSEIRGNLQLVGQL....AS.RA---

PF02947

FLT3L_MOUSE/30-162LALK-PCIGK.....ACQNFS------------------------RC--------LEVQ-------------CQ------
F6T7S9_ORNAN/28-157TSLR-PKITS.......LNFS------------------------SC--------LELR-------------C.------
H9GP84_ANOCA/29-165SDLR-KKMEEFEAHDVPANFS------------------------NC--------TVIH-------------CQ------
F6TPW7_MONDO/34-163EALQ-PLISS.......QDFG------------------------PC--------RRLR-------------CQ------
G5B8P0_HETGA/20-150EAMK-PWITH.......RNFS------------------------QC--------LELR-------------CQ------
G1M637_AILME/29-159AALK-PRITR.......RNFS------------------------GC--------LELR-------------CQ------
L9JA37_TUPCH/769-910LALK-PRITR.......RNFS------------------------RC--------LELR-------------CQ------
G3VSA3_SARHA/79-209GALR-PLITQ.......QNFQ------------------------PC--------QQYR-------------CQ------
G1QZC3_NOMLE/30-160VALK-PWITR.......QNFS------------------------RC--------LELQ-------------CQ------

PF03487

G1SCQ2_RABIT/16-144---------------------------------------------ARDT--KIELLQFLKELRRHLQM----LY-RLGK-
IL13_HUMAN/16-144---------------------------------------------VRDT--KIEVAQFVKDLLLHLKK----LF-REGR-
IL13_RAT/2-130---------------------------------------------..DT--KIEVAQFISKLLNYSKQ----LF-RYG.-
F7DGH7_MACMU/16-151---------------------------------------------VRDT--KIEVAQFVKDLLVHLKK----LF-REGQ-
L5M5Z7_MYODS/2-128---------------------------------------------VRDT--KVEVTRLAKDLLQQLRK----GV-RQGK-
G5ASP9_HETGA/2-130---------------------------------------------NRDT--KIEVAQFVQTLLRYLQS----LY-RHGN-
B3GDZ5_PIG/2-130---------------------------------------------IRDT--KIEVAQFVKDLLKHLRM----IF-RHG.-
L8YAP6_TUPCH/2-128---------------------------------------------TRDT--KIEVAQFVKDLLRHLKR----LY-RH..-
IL13_BOVIN/2-130---------------------------------------------VRDT--KIEVAQFLKDLLRHSRI----VF-RNER-
IL13_MOUSE/2-130---------------------------------------------..DT--KIEVAHFITKLLSYTKQ----LF-RHGP-
H0W834_CAVPO/16-149---------------------------------------------SPDT--KIEVAEFVKKLRIHVQC----LY-RHGK-
F6WQF3_ORNAN/2-128---------------------------------------------NQET--QVELLMFLKKMLPFYQK----IF-RDT.-
G3T2N9_LOXAF/2-133---------------------------------------------VRDT--KIELITFMKNLLDHLRR----IY-RY..-
M3YGH3_MUSPF/2-126---------------------------------------------.KDT--KIEVIQLVKNLLTYARS----VF-RHGN-
B5FW67_OTOGA/2-129---------------------------------------------IRDT--KIEVAQFIKDLLRHLKK----RF-RDAN-
I3MAR4_ICTTR/2-131---------------------------------------------IPDT--KIEVGQFVKKLLSHLRC----LL-RHGK-
IL13_CANLF/2-129---------------------------------------------SRDT--KIEVIQLVKNLLTYVRG----VY-RHGN-

PF00727

IL4_FELCA/26-131---------------------------------------------NEVK..KCTLKDFLERLKAIMQK----KY-S----
H0XDE1_OTOGA/26-149---------------------------------------------NDAM..QSTLKDFLERLKTTMKE----KY-S----
IL4_MOUSE/27-140---------------------------------------------NESK..STSLKDFLESLKSIMQM----DY-S----
G3T4B8_LOXAF/26-132---------------------------------------------NEDRNLFKTAR.VIEKLKTIYYT----KF-.----
IL4_RABIT/28-143---------------------------------------------KEAR..QTTLEDFLDRLKTAMQE----KY-S----
G5ASQ0_HETGA/25-138---------------------------------------------SELK..QTTLKDFLENLKTILKK----KY-S----
F6U5N6_HORSE/26-135---------------------------------------------NEAK..KSTLKDFLERLKTIMKE----KY-S----
IL4_BOVIN/26-133---------------------------------------------NEAKTSTSTLKDLLERLKTIMKE----KY-S----
G3QSC0_GORGO/26-149---------------------------------------------KEAN..QSTLEDFLERLKTIMRE----KY-S----
A3FBF0_MUSPF/26-130---------------------------------------------NEVK..KSTLKDFLERLKVIMQQ----KY-Y----
IL4_RAT/27-139---------------------------------------------NEST..LTTLKDFLESLKSILRG----KY-.----
G3WEJ0_SARHA/28-149---------------------------------------------NETK..ITKLQDFLSKLKTINQK----..-.----
I3MAS4_ICTTR/24-141---------------------------------------------SESK..QRTLKDFLESLKTTMQK----KY-S----
IL4_PIG/26-131---------------------------------------------HEAK..KSTLKDFLERLKTIMKE----KY-S----

PF00726

IL10_BOVIN/5-174SEL-----QE-------R---------------------------GVYK--AMSEFDIFINYIETYMT----T-------
IL10H_EBVB9/7-167NKL-----QE-------K---------------------------GIYK--AMSEFDIFINYIEAYMT----I-------
G3HB01_CRIGR/14-174NKL-----QE-------K---------------------------GVYK--AMNEFDIFINCIETYMT----I-------

PF14565

IL22_HUMAN/40-178KKL-----GE-------S---------------------------GEIK--AIGELDLLFMSLRNAC-------------
E1C1U2_CHICK/46-184KEL-----GE-------N---------------------------GKNK--AIGELDLLFDYIENAC-------------

PF15177

IFNL3_CHICK/28-182QKL.....KT-------AKKK------------------ETA...GCLE--ASAILHIFQVL.NDLRC----AA-QR---
F1M3K4_RAT/31-188HRL.....QE-------AQNK------------------ETP...GCLK--AYVTLNLFRLLTRDLKC----VA-SG---
I3MK89_ICTTR/34-194QRL.....QQ-------APEK------------------ESP...ACLQ--ASVTFNLLRLLVRDLKC----VA-SG---
F1PY54_CANLF/31-186HRL.....QK-------AP.K------------------ESQ...GCLE--ASITFNLFRLLTRDLKC----VA-SR---
H0XRJ1_OTOGA/35-191HRL.....QK-------APKK------------------ESP...GCLE--ASVTFNLFRLLTRDLKC----VA-SG---
M3W3J2_FELCA/32-181QCL.....HE-------APKK------------------ESL...GCLE--ASVLFNLFRLL.RDQKC----VA-SG---
F6PNH9_HORSE/31-184RQL.....HE-------VQKK------------------.SW...GCLE--ASVTFNLFRLLTRDLNC----VA-SG---
D2DJP5_XENTR/23-178HHL.....KH-------FREK------------------VSS...ECVQ--DAVLLSLTQLLIEDIMC----WA-NN---
G3TQK4_LOXAF/32-188HRL.....QK-------ATKK------------------ESQ...SCLE--ASVMFNLFRLLTRDLKC----VA-SG---
F7DXI8_HORSE/34-187HRL.....HK-------APKK------------------EPW...GCLE--ASVMFNLFRLLTKDLTC----VA-SG---
F6W920_MONDO/30-184HRL.....TE-------A.GK------------------ESQ...SCLE--ASVMLTLPRLPDTDLRC----VA-Y.---
U3KED0_FICAL/27-186HKL.....QA-------AMRT------------------ESPESTACLR--ATTILHVLQVL.GNLRC----AA-L.---
H0VBN4_CAVPO/39-195QRL.....NQ-------ASKK------------------ASP...GCLQ--ESVTFNLLRLLTRDLRC----VA-R.---
IFNL4_HUMAN/25-174........HK-------PRRA------------------DSP...RCRK--ASVVFNLLRLLTWELRL----AA-H.---
IFNL2_MOUSE/32-189HRL.....QE-------AQSK------------------ETP...GCLE--ASVTSNLFRLLTRDLKC----VA-NG---
G3N0M3_BOVIN/37-192HRL.....QE-------A.RK------------------ESQ...DCLE--ASVMFNLLRLLTRDLKC----VA-SG---
G1LPU9_AILME/37-191HRL.....SE-------ASKK------------------ESQ...GCLE--ASVLFNLFRLLKKDLEC----VA-SG---
L5LZZ9_MYODS/163-319HRL.....WE-------AGKK------------------ESQ...GCLE--ASVTLNLFRLLTRDLRC----VA-AG---
IFNL3_HUMAN/34-192HRL.....QE-------APKK------------------ESP...GCLE--ASVTFNLFRLLTRDLNC----VA-SG---
F6R8C9_XENTR/23-177NHL.....KH-------FRER------------------VSS...QCVQ--DAMLLSLTQLLIEDVMC----WA-NK---
G3VJ97_SARHA/12-167NKL.....SE-------A.RK------------------EPQ...NCLE--ASIMLNLFRLLTQDLRC----VA-YG---
H0XJU8_OTOGA/36-192HQL.....QE-------APKK------------------ESP...GCLE--ASVIFNLFRLLTWDLKC----VA-SG---
G3HJD0_CRIGR/30-187HRL.....RE-------AQEK------------------ETP...GCLE--ISVTSNLFRMLLRDLPC----VA-RG---
G1LPW2_AILME/34-190HRL.....HE-------APKK------------------ESL...GCLE--ASVMFNLFRLLTRDLKC----VA-SG---
L5L378_PTEAL/33-182HRL.....QK-------APKK------------------VSQ...DCLE--STVTFNLFRLLTRDLK.----..-..---
G1T4B0_RABIT/34-188HPLATPGSQE-------APKK------------------EAP...ACLE--ASVIFILFRLLTRDLKC----VA-SG---
U3IYH6_ANAPL/34-185QKL.....ET-------AKKT------------------ETA...SCLE--YSTIVHLFQVL.HDLGC----VA-..---
L9LBW1_TUPCH/31-181LQL.....QE-------VEKK------------------KSP...GCLK--AAATFNLFRLLNQNLKC----VA-SE---
D0FHA1_PIG/36-191HRL.....QE-------AQKK------------------EPQ...SCLE--ASVMFNLFRLLTRDLKC----VA-SG---

PF05337

CSF1_HUMAN/41-180QLL-----EK-------VKNV------------------FNE---TKNL--LDKDWNIFSKNCNNSFA----EC-SS---
Q3TLQ6_MOUSE/41-180QLL-----EK-------IKNF------------------FNE---TKNL--LEKDWNIFTKNCNNSFA----KC-SS---
O77709_BOVIN/41-180QLL-----EK-------IKNV------------------FNE---TKNL--LKKDWNIFSKNCNNSFA----KC-SS---
O77710_BOVIN/41-180QLL-----EK-------IKNV------------------FNE---TKNL--LKKDWNIFSKNCNNSFA----KC-SS---
Q64129_9MURI/41-180QLL-----EK-------IKNF------------------FNE---TKNL--LEKDWNIFTKNCNNSFA----KC-SS---

PF15036

IL34_MOUSE/28-184SLL-----ST-------PGLS------------------.....LKLVR--PKALLDNCFRVMELLYC----SC-CKQSP
R4GIU3_CHICK/19-177KQL-----HS-------GDSR------------------.....QKAVR--PKALLDNCLKVLRMLFG----AH-CRWDS
F7EA00_CALJA/29-185SLL-----NA-------PGPN------------------.....LKLVR--PKALLDNCFRVMELLYC----SC-CKQSS
H0WFN4_OTOGA/28-184SLL-----NA-------PGLS------------------.....RKLVR--PKALLDNCFRVMELLYC----SC-CKQSS
M3ZVZ0_XIPMA/24-191DQL-----TE-------EPDR------------------VPESSWRFAS--PKSLVDNLCHTMCCLFW----EC-FS..S
U3JY35_FICAL/18-179KLI-----HS-------AGAE------------------...SRSKAVR--PKALLDNCLKVMRMLYG----VP-CRWES
L9KJY3_TUPCH/28-184SHL-----NT-------PGLI------------------.....LKLVR--PKALLDNCFRVMELLYC----PC-CKHNS
G3T3A6_LOXAF/28-182SLL-----SA-------PG..------------------.....LKLVR--PKALLDNCFRVMDLLYC----SC-CKQSS
F6W3U1_MONDO/15-167TLA-----NS-------.GRD------------------.....QKLVR--PKALLDNCYKVMDLLYC----LC-CKESN
I3JZ08_ORENI/24-192DSL-----TE-------KPEN------------------MPESSWRFAT--PKSLLDNLCRTMYCLFS----EC-FSNAD
L5MCR9_MYODS/28-182SLP-----SD-------RRLS------------------.....LKLVR--PKALLDNCFRVMELLHC----SC-CKE..
B3DLJ8_DANRE/23-195DHL-----TE-------QDYK------------------....GWKSVT--PKSILDNCYRTMLCLFK----EC-FTKED
IL34_BOVIN/28-183NLL-----SA-------PG.S------------------.....LKLVR--PKALLDNCFRVMQLLYC----PC-CKESS

PF00714

IFNG_HORSE/15-152KLI-----QI-------PVND------------------------LKVQ--RKAISELIKVMNDLS.P----KA-NLRKR
H0WPL1_OTOGA/15-151NLL-----RI-------SVHD------------------------LQVQ--RKAISELYEVIVSLV.P----GT-PLRKR
Q8CGS0_CAVPO/15-154NLI-----QI-------SVND------------------------EHVQ--RQAIIELKKVIDDLS.P----NQ-RKRRR
B9VS86_CALJA/15-152RLT-----NY-------SVND------------------------LNVQ--RKAIHELIQVMAELS.P----AP-KIGKR
G3SUC6_LOXAF/15-152KVM-----QT-------PVND------------------------RNIQ--RKAISELAKVMNDLS.H----RS-TGSKR
G3GY20_CRIGR/2-135RIT-----KI-------PVND------------------------VQVQ--RKAVNELISVMPLLS.P----KL-SLRKR
I3MNV6_ICTTR/15-152KVS-----QF-------QVND------------------------LKIQ--RKAVRELKKVMNDLL.P----HS-TLRKR
L5LME8_MYODS/15-153KLI-----QT-------PVND------------------------QRVQ--RKAISELYNVITELSKS----NS-KMRKR
G5BGB5_HETGA/15-152SLT-----RI-------SVDN------------------------VDFQ--RRAIIELKKVMDDLS.P----NQ-RKRRR
G3WQJ9_SARHA/15-153ALI-----NT-------QVND------------------------LKVQ--RKAMFELVYVFRNLS.P----KP-HLTG.
IFNG_SHEEP/15-152RLI-----QI-------PVDD------------------------LQIQ--RKAINELIKVMNDLS.P----KS-NLRKR
IFNG_RAT/14-151SIA-----KF-------EVNN------------------------PQIQ--HKAVNELIRVIHQLS.P----ES-SLRKR
IFNG_RABIT/15-152NLT-----RI-------SVDD------------------------RLVQ--RKAVSELSNVLNFLS.P----KS-NLKKR
L9KVU0_TUPCH/51-188NLT-----RI-------SVND------------------------VQVQ--RKAIYELLNVMIDLT.P----KS-NQKKR
IFNG_FELCA/15-153KLI-----QI-------PVND------------------------LQVQ--RKAINELFKVMNDLS.P----RS-NLRKR

PF02404

R4GD07_ANOCA/1-283LSYPFAASHL-------KNDSSG....NHNNEAALGFLGSPGMQGLSIA--LTSLVTLFIGFILGAVC----WK-KTARK
SCF_CHICK/1-287SFPPVAASSL-------RNDSIGSNTSSNSNKEALGFISSSSLQGISIA--LTSLLSLLIGFILGAIY----WK-KTHPK
SCF_RAT/1-273MLPPVAASSL-------RNDS......SSSNRKAAKSPEDPGLQWTAMA--LPALISLVIGFAFGALY----WK-KKQSS
G1NWC8_MYOLU/1-272MLPPVAANSL-------RNDS......SSSNRKALNSIGDSKLQWAAMT--LPAFFSLLVGFGFGALY----WK-KKQPN
F7EP53_MONDO/1-273LLPPVAASSL-------RNDS......SSSNRKAAGSTKDPSVQWVAIV--LPSLFSLVLGFVLGALY----WK-KKQMN
F7C5I3_ORNAN/1-273LLPPVAASSL-------KNDS......TSSNREAFGYISSSSLQWISIA--VPSIFSLVIGFILGAIY----WK-KKHPK
F7G0W2_CALJA/1-273MLPSVAANSL-------RNDS......SSSNRKAKNPPGDSGLHWAAMA--LPALFSLIIGFAFGALY----WK-KRQPS

PF02372

IL15_PIG/33-160-----------------KECE-------------------------ELE--EKNINEFLKSFIHIVQM----FI-N----
IL15_CAVPO/33-160-----------------KECE-------------------------ELE--EKSIAEFLQSFVHIVQM----FI-N----
IL15_FELCA/33-160-----------------KECE-------------------------ELE--EKNIKEFLQSFVHIVQM----FI-N----
IL15_SHEEP/33-160-----------------KECE-------------------------ELE--KKSIKEFLKSFVHIVQM----FI-N----
F1NZN5_CHICK/55-183-----------------KECE-------------------------EYE--EKNFTEFIQSFVKVIQR----EC-K----
G1NDP6_MELGA/5-137-----------------KICE-------------------------AND--KKNFPDFLQQLTNL...----..-.----
O73883_CHICK/5-138-----------------KICE-------------------------ANN--KKKFPDFLHELTNFV..----..-.----
Q8JFF4_ANAPL/4-134-----------------NICE-------------------------A.N--ANNFPEFRQELTN....----F.-.----

PF00715

I3MQX6_ICTTR/7-151-----------------FTCE------------------------YAQE--TANIVEFLNTWITFCQS----II-S----
G5C793_HETGA/7-149-----------------LKCD------------------------LNDE--EANIVQFLKGWIAFCQK----II-S----
G1PJ32_MYOLU/7-147-----------------FECD------------------------YDDE--TVTIVEFLNKWITFCQR----IF-S----
B1AB81_HORSE/7-146-----------------FTCE------------------------YDDE--TGTIVEFLNKWITFCQS----IF-S----
G3HTL8_CRIGR/7-150-----------------FTCE------------------------FDDE--TVTVVEFLSRWITFCQS----II-.----
IL2_MACMU/7-151-----------------LMCE------------------------YADE--TATIVEFLNRWITFCQS----II-S----
H0Y254_OTOGA/7-149-----------------FICE------------------------.DNE--TATIVEFLNRWITFCQS----II-S----
IL2_MOUSE/7-165-----------------FECQ------------------------FDDE--SATVVDFLRRWIAFCQS----II-S----
G3SU90_LOXAF/7-147-----------------FMCE------------------------YDDH--AATIEEFLNKWIVFCQS----II-S----
IL2_PIG/7-151-----------------FKCE------------------------YDDE--TVTAVEFLNKWITFCQS----IY-S----
IL2_FELCA/7-151-----------------FTCN------------------------YDDE--TATIVEFLNKWITFCQS----IF-S----
L5K7D9_PTEAL/7-149-----------------YTCV------------------------YNDE--SANVKEFLNKWITFCQS----IL-S----
IL2_BOVIN/7-152-----------------FTCE------------------------YDDA--TVNAVEFLNKWITFCQS----IY-S----
H0VBY4_CAVPO/7-149-----------------FVCD------------------------LEDE--SVNIVEFLKRWIAFCQK----IM-S----

PF01415

H0X0U6_OTOGA/15-141.........E-------QPCN------------------------QTTA--GNT.LTFLQSLLEIFQK----EN-MRQMM
G1QNL2_NOMLE/28-172AQPTKSLEEN-------KSLK------------------------EQKK--LND.LCFLKRLLQEIKT----CW-NKILM
IL7_BOVIN/28-171AQPTKNLEEN-------KSSK------------------------EQKK--QND.LCFLKILLQKIKT----CW-NKILR
H0VFS1_CAVPO/31-152.......KEE-------TVSK------------------------EPKK--.ND.QCFLKTLLQKIKT----CW-NKILR
F1PA23_CANLF/29-154.......EDN-------KSLK------------------------EQRK--QKS.LCSLGILLQKIKT----CW-NKILR
M3WJR8_FELCA/15-139.........E-------QPCN------------------------QTAT--GNV.LTFLKSLQEILQK----ER-VKG..
IL9_MOUSE/15-141.........E-------KPCN------------------------QTMA--GNT.LSFLKSLLGTFQK----TE-MQRQK
U3KN10_RABIT/31-153.......EEK-------KPLK------------------------DQKK--.NG.RCFLKKLLQKIKT----CW-NKILR
A0MZ91_PIG/18-138.........E-------QPCN------------------------RTTV--GNT.LIFLRSLLESFQK----ER-MR...
K7E262_MONDO/59-200NDPNKN.PGE-------KSAK------------------------EQKK--ERKCKCLIKKMVSDVKN----CW-RKFLM
E1BF10_BOVIN/18-141.........E-------QPCN------------------------RTTT--GNT.LTFLKALLESFQN----DR-MRGKR
F6PLW3_HORSE/15-136.........E-------QPCN------------------------QTTR--GNT.VTFLKSLLEIFQK----KR-IR...
IL9_HUMAN/15-141.........E-------QPCN------------------------QTTA--GNA.LTFLKSLLEIFQK----EK-MRGMR
IL7_MOUSE/28-151........EE-------KNVK------------------------EQKK--.ND.ACFLKRLLREIKT----CW-NKILK
G5BX09_HETGA/15-141.........E-------QPCN------------------------QTTA--GNT.VTFLRNLLELFQR----ET-MKGMR
L8Y4N8_TUPCH/15-141.........E-------QPCN------------------------QTTA--GNM.LTFLKSLLEVFQK----EN-VRKMR
D4A8I9_RAT/15-141.........E-------KPCN------------------------QTTA--GNT.VSFLKSLLKTFQK----TE-VQVQR
G3TKQ6_LOXAF/16-136.........E-------QPCN------------------------QTTT--GNT.LTFLKRLLDTFQK----EY-.....
M3YEX7_MUSPF/16-137.........E-------QPCN------------------------QTTT--GNT.LTFLRSLQETLQK----Q.-.....
G1NXN3_MYOLU/28-153.......EEK-------KSSK------------------------GQKK--QDE.MCFLMILLEKIKT----CW-NKILS

PF00103

PLRP1_BOVIN/26-238RSSWTGLPSL-------MSSD------------------------EDRR--HSEFYNLFYCLRRDSRK----VD-MYIKI
CSH2_BOVIN/26-238SDTWSRFSSM-------TFSD------------------------EDRS--ISEYYNLFYCLRRDSRK----VD-MYIKI
PLRP3_BOVIN/1-213RIYWSGLASL-------VSND------------------------EDVR--HSAFYKLFMCLYRDSRK----LD-MYTEI
PR4A1_RAT/17-227YTAWSELGFL-------QSPN------------------------RDTR--YFAFYNLFHCLKKDSNN----VE-MYLKL
CSH1_BOVIN/26-236PVWSEKSS.L-------TADD------------------------EDVR--QTAFYRMFHCLHRDSSK----IS-TYINL
PLRP4_BOVIN/26-239RIYWFGLRSL-------LSSN------------------------EDRR--HSAFYSLFFCLRRDTRK----LD-IYTKF
PR3D4_RAT/16-223YPAWSGLKDL-------QSSD------------------------EDTH--LFAIYNLCRCFKSDIHK----ID-TYLKV
PR2C2_MOUSE/16-224NPAWFLQS..-------..DN------------------------EDAR--IHSLYGMISCLDNDFKK----VD-IYLNV
SOM2_HUMAN/9-215NQSYSKFD..-------TKSH------------------------NDDA--LLKNYGLLYCFRKDMDK----VE-TFLRI
PR8A5_RAT/17-238FPSWDYLSFL-------KSSN------------------------KNHK--FLAIFNLSSCLDYDTQV----HY-TLSQI
PR6A1_RAT/20-234FPMWNELAYL-------RSPD------------------------EERR--HFAFTNLFQCLLQDSRK----FD-SKVRL
PR7D1_MOUSE/17-240YPTWSDLDSL-------KSAD------------------------KETQ--FFALYMFSFCLRIDLET----VD-FLVNF
CSH2_HUMAN/9-215KQTYSKFD..-------TNSH------------------------NHDA--LLKNYGLLYCFRKDMDK----VE-TFLRM

PF06875

Q5BNQ4_9SALA/2-215P---LVVPFK-------G-SA------------------------YFSK--KLRGGVVCKEYKERVFL----TK-RDFML
Q5BNQ2_9SALA/2-215P---LVVPFE-------G-SA------------------------YFRK--KLRGGVVCKEYKERVLL----TK-RDFEF

PF01110

CNTF_CHICK/1-194E---PPA.PP-------R-LS------------------------LFEQ--KLRGLRVLRELAQWAVR----SV-RDLRQ
G3VWZ5_SARHA/1-195S---GPVGGS-------H-RT------------------------FLEK--KLWGLKVLQELMQWTVR----SI-HDLRL
E1BFH9_BOVIN/1-193G---PPLLPG-------D-AG------------------------LFEK--KLWGLKVLQELSRWTVR----SV-HDLRT
G5AP46_HETGA/1-192G---VPL..G-------E-GG------------------------LFEK--KLWGLKVLQELSQWTVR----SI-RDLRL
H0Z9U1_TAEGU/1-188G---PPP.PP-------R-LS------------------------LFEQ--KLRGLGVLRELAQWAVR----SV-RDLRQ
CNTF_HUMAN/1-194G---MPINVG-------D-GG------------------------LFEK--KLWGLKVLQELSQWTVR----SI-HDLRF

PF01291

LIF_MOUSE/44-203....PVPDHS-------D-KE------------------------AFQR--KKLGCQLLGTYKQVISV----VV-QAF--
LIF_BOVIN/43-202....YGPDTS-------G-KD------------------------VFQK--KKLGCQLLGKYKQVIAV----LA-QAF--
ONCM_HUMAN/37-209GASQPPTPTP-------A-SD------------------------AFQR--KLEGCRFLHGYHRFMHS----VG-RVF--
ONCM_MOUSE/34-194G...ASRSTT-------T-PD------------------------VFNT--KIGSCGFLWGYHRFMGS----VG-RVF--
ONCM_BOVIN/34-194GPT.PLPPTP-------P-SS------------------------TFQR--KLRNCGFLRGYHRFMRT----AG-QVL--

PF03039

IL12A_MOUSE/6-215----PPVG..-------E-AD------------------------PYRV--KMKLCILLHAFSTRVVT----IN-RVMGY
G3VQT1_SARHA/40-247----PSPK..-------E-PD------------------------FYKA--KVKLCLLLHAFRIRVVT----ID-RMRNY
F6T5A8_MONDO/5-202----SSPK..-------E-SD------------------------FYKT--KVKLCVLLHAFQTRTVT----ID-RMMNY
IL12A_PIG/6-222----PSLE..-------E-LD------------------------FYKT--KIKLCILLHAFRIRAVT----ID-RMMSY
L8YEA2_TUPCH/1-213----YSLE..-------E-PD------------------------FYKT--KIKLCILLHAFRVRAVT----ID-RVMSY
H0X861_OTOGA/6-217----SSHE..-------E-TN------------------------FYKT--KVKLFVLLHAFRIRAVT----ID-RVMSY
G1QWH2_NOMLE/40-254----SSLE..-------E-PD------------------------FYKT--KIKLCILLHAFRIRAVT----ID-RVMSY
I3MN91_ICTTR/4-220----PSPEAP-------S-PN------------------------LYRT--KTKLCILLHALRIRAVT----ID-RVMSY
Q924V6_CAVPO/6-221----LSLE..-------E-PD------------------------FYKI--KMKLCILLHAFRIRAVT----ID-RVMSY

PF02024

H3AP27_LATCH/26-169ETLKDLAKEH-------S-TS------------------------PYTT--EK---VALDRLQKCLLT----MV-KELEQ
G3WWV6_SARHA/23-167SALGNLEGVM-------E-AS------------------------LYST--EV---VTLSRLQKSLYG----ML-QQLDL
F6PLK2_ORNAN/23-167DTMEIWGGIV-------E-ES------------------------LYST--EV---VTLDRLRKSLKN----IE-KQLDH
F7HGW1_CALJA/23-167ENLANLGGVL-------E-VS------------------------LYST--EV---VALSRLRGTLKD----IL-QQLDL
G5BHA4_HETGA/23-167ELLENLGGAL-------K-ES------------------------IYST--EV---VALSRLQRFLQE----ML-LQLDH
W5NER9_LEPOC/28-172SHLESFLKTN-------A-AF------------------------HVTI--GN---VALERLQKYLLK----LI-RNLDQ
H0V7C6_CAVPO/23-165E.LQDLESTL-------K-ES------------------------RYSI--EV---VVLRRMKRFLLE----ML-RQLEL
LEP_HUMAN/23-167ETLDSLGGVL-------E-AS------------------------GYST--EV---VALSRLQGSLQD----ML-WQLDL

PF15216

M3WGC3_FELCA/29-153------TQIN-------N.TQ------------------------AKKK--RKKRQVTTNKCREQVSH----LM-ELWRR
G3QQC8_GORGO/29-153------TQIN-------A.TQ------------------------AMKK--RRKRKVTTNKCLEQVSQ----LQ-GLWRR
F7I7D5_CALJA/29-153------TQIN-------A.TQ------------------------EMKK--RKKRKVTTNKCLEQVSQ----LS-GLWRR
F1RLI5_PIG/17-138------IQIN-------N.TQ------------------------AMR.--..KREVKANKCLEQVSY----LL-ELWRR
K7E5V9_MONDO/34-162------NQTN-------N.MQ------------------------TTKN--NMEEGIKKMTCPEIARN----LL-DIWRE
L8YGS5_TUPCH/5-129------VKVN-------N.TQ------------------------AMKK--RKKREDTAKECLKHVLR----LQ-GLWRR
J9P5I8_CANLF/29-154------APIN-------N.TQ------------------------AKKK--RKKRGVTTNKCREQVAH----LI-GLWRR
TSLP_MOUSE/20-137------TERN-------DGTQ------------------------EMAQ--EVQ.....NICLNQTSQ----IL-RLWYS

PF01109

CSF2_RAT/18-139------CPPT-------PETD------------------------CEIE--VTTFEDFIKNLKGFLFD----IP-FDCW-
CSF2_MOUSE/18-136------CPPT-------PETD------------------------CETQ--VTTYADFIDSLKTFLTD----IP-FECK-
CSF2_BOVIN/18-138------CPPT-------PETS------------------------CGTQ--FISFKNFKEDLKEFLFI----IP-FDCW-
CSF2_CAVPO/18-140------CPPT-------PETS------------------------CMTQ--IITFKSFKENLKRFLFA----IP-FDCW-
CSF2_PIG/18-139------CPLT-------EETS------------------------CETQ--SITFKSFKDSLNKFLFT----IP-FDCW-
CSF2_HUMAN/18-139------CPPT-------PETS------------------------CATQ--IITFESFKENLKDFLLV----IP-FDCW-
CSF2_CANLF/18-139------CPPT-------PESP------------------------CATQ--NINFKSFKENLKDFLFN----IP-FDCW-

PF02025

G1RQD7_NOMLE/22-133------------------KKK------------------------CGEE--RRRVNQFLDYLQEFLGV----MN-TE-WI
IL5_CAVPO/23-134------------------KQK------------------------CGEE--RRRVKQFLDYLQEFLAV----IN-TE-WT
J9NWP5_CANLF/22-132------------------KKR------------------------CAGE--RWRVTKFLDYLQVFLGV----IN-TE-WT
IL5_MOUSE/21-132------------------KEK------------------------CGEE--RRRTRQFLDYLQEFLGV----MS-TE-WA
G3WAR7_SARHA/25-134------------------EKQ------------------------CGGE--RRKVEQFLDYLEEFLQT----VN-TE-WT
IL5_HORSE/22-133------------------KKK------------------------CGGE--RWRVKQFLDYLQEFLGV----IN-TE-WT
B5FW65_OTOGA/22-133------------------KKR------------------------CGEE--RRKVKQFLDYLQEFLGI----IN-TE-WT
I3MDT8_ICTTR/23-134------------------KKK------------------------CGQE--RRRVKQFLEYLQEFLGV----IN-TE-WM
G3T4B0_LOXAF/23-133------------------KKK------------------------CGGE--RRKVKQFLDYLEEFLGV----IS-TD-WM
G1SL79_RABIT/22-133------------------KKK------------------------CGEE--RRGVKHFLDYLQEFLGV----IN-TE-WT

PF02059

IL3_CANLF/19-132------T..P-------RGEP------------------------ISIM--ENNWGDFQRKLKKYLEA----.-------
IL3_MOUSE/27-138------A..N-------DSAL------------------------PGVF--IRDLDDFRKKLRFYMVH----L-------
IL3_BOVIN/18-132------T..P-------TEDP------------------------IFIE--NKNLGDFRMKLEEYLVI----I-------
G3UC30_LOXAF/22-133------K..P-------QTAS------------------------IVI.--QNDWEDFRGKLYPYLET----L-------
G1MH15_AILME/18-131------T..P-------RGQP------------------------ISI.--ENNLGDFQKKLKKYLEA----.-------
F1RJV6_PIG/18-131------M..S-------TEEP------------------------ISIE--EGDLGDFRAKLMEYLVV----L-------
G1RQ11_NOMLE/20-137------TAAP-------TRHP------------------------IRIK--DGDWNEFRRKLKFYLKT----L-------
IL3_CALJA/19-136------TNAA-------TQHP------------------------IRIK--DGDWNDFQMKLKFYLKT----L-------
F1LS41_RAT/29-138------A..S-------DSVL------------------------PGVY--NKDLDDFKKKLRFYVIH----L-------

PF07400

IL11_HUMAN/22-199------PPDP-------PAPP------------------------LAPP--SSAWGGIRAAHAILGGL----HL-TLDWA

PF00758

G3TYQ1_LOXAF/25-173......RTTA-------HKDP------------------------NAIF--PEFPT...AALSFLLLV----VG-LTLCA
W5K758_ASTMX/26-175SGIDLQETWQ-------VSSA------------------------PELF--QVHINFLRGKVRLLLAN----A.-...P.
B1N8Y2_DANRE/15-168SSGEDKETQK-------ISSI------------------------SELF--QVHVNFLRGKARLLLAN----A.-...PV
F7DTH0_CALJA/31-193PSAVPLQTIT-------ADTF------------------------SKLF--QVYSNFIRGKLKLYAGE----A.-...CR
M3XJ62_LATCH/27-177...PPQKTVV-------VRTL------------------------GELF--HIHVNFLRGKVKLFISD----A.-...CS
G3W289_SARHA/30-190PTAVPLRTFT-------VGTM------------------------DKLF--RIYSNFLRGKLKLFWRE----A.-...CQ
F6WUU2_MONDO/31-191PTAAPFRTFT-------VGTM------------------------DKLF--RIYSNFLRGKLKLFLRE----A.-...CQ
G3VW20_SARHA/26-175......QTAA-------HREP------------------------TAIF--LSFQQLLRGKVRFLLHA----LR-PILCA
G1PF99_MYOLU/45-207ASAIPLRTFT-------VDTL------------------------CKFF--RIYSNFLRGKLKLYTGE----A.-...CR
TPO_CANLF/25-176......RTTT-------HKDP------------------------NAIF--LSFQQLLRGKVRFLLLV----AG-PTLCA
F7G570_MONDO/26-177......QTIA-------HREP------------------------TAIF--LSFQQLLRGKVRFLLHA----VR-PLLCA
H0W023_CAVPO/30-191ASPAPLRTFP-------VDTL------------------------CKLF--QVYSNFLRGKLKLYTGM----A.-...CR
H2LEX3_ORYLA/33-182NASSLDGTWT-------VSSA------------------------TELL--QVHVNFLRGKVRLLLMD----A.-...P.

PF00489

IL6_BOVIN/27-208ATNTDLLEKM-------QSSN------------------------EWVK--NAKIILILRNLENFLQF----SL-RAIRM
M3X721_FELCA/27-208TVEVGLQAKL-------QSQE------------------------EWLR--HTTIHLTLRRLEDFLQF----SL-RAVRI
IL6_HORSE/27-208TAKSSLLAKL-------HSQN------------------------EWLK--NTTTHLILRSLEDFLQF----SL-RAVRI
G3UHF3_LOXAF/20-205TANASLLSKL-------QLQT------------------------EWLK--NTTINLILRSLDDFMQF----SL-RAVRI
L5KPK4_PTEAL/20-202TTNSSLLAKL-------QSQS------------------------EWLQ--TTTIHLILRSLEDFLQF----TQ-RAVRI
F7HV62_CALJA/27-212ATNASLLTKL-------QAQD------------------------QWLQ--GVTTHLILRSFKDFLQN----SL-RALRQ
IL6_MOUSE/26-210ISNALLTDKL-------ESQK------------------------EWLR--TKTIQFILKSLEEFLKV----TL-RSTRQ

PF16647

CSF3_BOVIN/42-190TQGAMPT-----------FTS------------------------AFQR--RAGGVLVASQLHRFLEL----AY-RGLR-
CSF3_HUMAN/51-202TQGAMPA-----------FAS------------------------AFQR--RAGGVLVASHLQSFLEV----SY-RVLR-
CSF3_MOUSE/57-205TQSAMPA-----------FTS------------------------AFQR--RAGGVLAISYLQGFLET----AR-LALH-

PF16649

IL23A_MOUSE/28-185S-----------------SSQ------------------------QWQR--PLLRSKILRSLQAFLAI----AA-RVFAH
F7HQI5_MACMU/28-184S-----------------PSQ------------------------PWQR--LLLRFKILRSLQAFVAV----AA-RVFAH
F1MSN4_BOVIN/35-192I-----------------PSQ------------------------PWQR--LLLRLKILRSLQAFVAV----AA-RVFAH
IL23A_CAVPO/28-184S-----------------PNQ------------------------PWQR--LLLRIKILRSFQAFVAV----AA-RVFGH
G3VET0_SARHA/31-186.-----------------PSE------------------------PWQR--LLLRPKILQRLRAFAAI----AA-RVFTH

PF00143

G5E7E1_LOXAF/9-168---------------------------------
IFNE_MOUSE/27-185---------------------------------
G3I0H8_CRIGR/26-185---------------------------------
H0VF99_CAVPO/28-187---------------------------------
L5KKJ7_PTEAL/25-192---------------------------------
G1U0Q8_RABIT/26-185---------------------------------
F6YZB3_ORNAN/25-183---------------------------------
I3MY95_ICTTR/32-186---------------------------------
V8NNB8_OPHHA/15-183---------------------------------
C8CKA7_PIG/26-185---------------------------------
H0W7G8_CAVPO/26-185---------------------------------
G3GXU9_CRIGR/27-182---------------------------------
H0XSG1_OTOGA/26-185---------------------------------
G1KX99_ANOCA/25-184---------------------------------
G3I0I6_CRIGR/27-185---------------------------------
IFNT4_SHEEP/26-185---------------------------------
L8Y4J0_TUPCH/27-186---------------------------------
F7B527_HORSE/26-183---------------------------------
G1Q950_MYOLU/27-184---------------------------------
M3WTR1_FELCA/26-186---------------------------------
G5CB66_HETGA/27-185---------------------------------
L9L941_TUPCH/27-198---------------------------------
D2H9N6_AILME/27-184---------------------------------
D3Z919_RAT/26-179---------------------------------
C8CKB9_PIG/24-176---------------------------------
A8E6F6_XENTR/27-179---------------------------------
L8Y906_TUPCH/26-185---------------------------------
H9L1C3_CHICK/28-183---------------------------------
L5KWM8_PTEAL/106-263---------------------------------
G3WZJ8_SARHA/27-182---------------------------------
G3UCD2_LOXAF/26-187---------------------------------
K7GQJ6_PIG/17-164---------------------------------
G3I0H3_CRIGR/26-178---------------------------------
H0VYK7_CAVPO/28-181---------------------------------
I3N7K4_ICTTR/33-202---------------------------------
L5K635_PTEAL/26-185---------------------------------
H0W3G0_CAVPO/26-185---------------------------------
W5JYQ9_ASTMX/23-179---------------------------------
G3SI98_GORGO/28-185---------------------------------
H0Y0D2_OTOGA/28-187---------------------------------
IFN_ANAPL/34-190---------------------------------
G3UJX3_LOXAF/27-185---------------------------------
G5C259_HETGA/26-185---------------------------------
G3WZF5_SARHA/26-185---------------------------------
IFNE_PIG/27-186---------------------------------
W5N6G4_LEPOC/27-185---------------------------------
H9KYA4_CALJA/26-185---------------------------------
D2HTQ4_AILME/33-205---------------------------------
IFNB_HUMAN/27-185---------------------------------
G1NR05_MELGA/32-188---------------------------------
F7BVP5_ORNAN/23-181---------------------------------
F7G875_MONDO/27-182---------------------------------
C8CKC3_PIG/33-205---------------------------------
I3MVD7_ICTTR/34-186---------------------------------
F7A317_HORSE/26-184---------------------------------
G1KU56_ANOCA/28-182---------------------------------
L5KBH2_PTEAL/26-185---------------------------------
L5K909_PTEAL/26-185---------------------------------
I3N5Z0_ICTTR/23-179---------------------------------
F7GHL9_MONDO/26-181---------------------------------
IFNE_HUMAN/27-186---------------------------------
I3LBU7_PIG/26-179---------------------------------
G3UK87_LOXAF/27-184---------------------------------
L9LC61_TUPCH/27-185---------------------------------
IFNB_RAT/27-182---------------------------------
H0XMZ9_OTOGA/27-186---------------------------------
G3VDC6_SARHA/27-182---------------------------------
I3JM36_ORENI/26-182---------------------------------
L5LKN9_MYODS/27-186---------------------------------
G1TYS8_RABIT/29-195---------------------------------
I3UJJ8_FELCA/27-185---------------------------------
C8CKA9_PIG/26-183---------------------------------
IFNT2_BOVIN/3-162---------------------------------
H0W510_CAVPO/26-186---------------------------------
M3Z729_MUSPF/26-183---------------------------------
IFNA1_MOUSE/26-185---------------------------------
G3TTC1_LOXAF/26-185---------------------------------
G1PDS6_MYOLU/29-199---------------------------------
F7ABU5_MONDO/27-182---------------------------------
G1TTX4_RABIT/27-180---------------------------------
H0XRP5_OTOGA/26-185---------------------------------
H0WK94_OTOGA/33-202---------------------------------
G1KYL3_ANOCA/23-176---------------------------------
G3WZQ8_SARHA/26-181---------------------------------
H2R6R8_PANTR/26-185---------------------------------
H0YTY6_TAEGU/34-188---------------------------------
I3MXH1_ICTTR/27-185---------------------------------
M3WRV1_FELCA/26-184---------------------------------
H0W4H8_CAVPO/23-182---------------------------------
R4GKJ6_CHICK/35-191---------------------------------
A3FBE8_MUSPF/27-184---------------------------------
G1KWE0_ANOCA/28-180---------------------------------
G7PS89_MACFA/26-185---------------------------------
G1Q880_MYOLU/26-185---------------------------------
IFNB_MOUSE/27-180---------------------------------
IFNB2_BOVIN/27-184---------------------------------
G1SJC4_RABIT/26-185---------------------------------
W5PG31_SHEEP/26-185---------------------------------
IFNA3_CANLF/26-183---------------------------------
G5BPX2_HETGA/27-199---------------------------------
IFNW2_HORSE/26-185---------------------------------
G3N2A8_BOVIN/26-185---------------------------------
H0XKS8_OTOGA/27-185---------------------------------
H0VUV7_CAVPO/26-185---------------------------------
Q29412_PIG/27-184---------------------------------
G7PS88_MACFA/26-185---------------------------------
M3WZS7_FELCA/26-181---------------------------------
H9GZR7_HORSE/26-185---------------------------------
F1LVL8_RAT/26-184---------------------------------
M3YX13_MUSPF/27-179---------------------------------
G1L8G2_AILME/26-185---------------------------------
IFNB_HORSE/27-184---------------------------------
H0W289_CAVPO/26-190---------------------------------
A8E6E8_MONDO/27-182---------------------------------
I3N788_ICTTR/27-185---------------------------------
G1L8I1_AILME/26-183---------------------------------
IFNB_FELCA/27-184---------------------------------
H0VXI5_CAVPO/26-181---------------------------------
G3TS29_LOXAF/26-179---------------------------------
W5PZ39_SHEEP/26-184---------------------------------
G3I0H6_CRIGR/26-178---------------------------------
I3L756_PIG/26-180---------------------------------
M3Z715_MUSPF/26-183---------------------------------
M3VXI8_FELCA/33-205---------------------------------
G3R8Q7_GORGO/26-185---------------------------------
A8E6F5_XENTR/51-202---------------------------------

PF02947

FLT3L_MOUSE/30-162---------------------------------
F6T7S9_ORNAN/28-157---------------------------------
H9GP84_ANOCA/29-165---------------------------------
F6TPW7_MONDO/34-163---------------------------------
G5B8P0_HETGA/20-150---------------------------------
G1M637_AILME/29-159---------------------------------
L9JA37_TUPCH/769-910---------------------------------
G3VSA3_SARHA/79-209---------------------------------
G1QZC3_NOMLE/30-160---------------------------------

PF03487

G1SCQ2_RABIT/16-144---------------------------------
IL13_HUMAN/16-144---------------------------------
IL13_RAT/2-130---------------------------------
F7DGH7_MACMU/16-151---------------------------------
L5M5Z7_MYODS/2-128---------------------------------
G5ASP9_HETGA/2-130---------------------------------
B3GDZ5_PIG/2-130---------------------------------
L8YAP6_TUPCH/2-128---------------------------------
IL13_BOVIN/2-130---------------------------------
IL13_MOUSE/2-130---------------------------------
H0W834_CAVPO/16-149---------------------------------
F6WQF3_ORNAN/2-128---------------------------------
G3T2N9_LOXAF/2-133---------------------------------
M3YGH3_MUSPF/2-126---------------------------------
B5FW67_OTOGA/2-129---------------------------------
I3MAR4_ICTTR/2-131---------------------------------
IL13_CANLF/2-129---------------------------------

PF00727

IL4_FELCA/26-131---------------------------------
H0XDE1_OTOGA/26-149---------------------------------
IL4_MOUSE/27-140---------------------------------
G3T4B8_LOXAF/26-132---------------------------------
IL4_RABIT/28-143---------------------------------
G5ASQ0_HETGA/25-138---------------------------------
F6U5N6_HORSE/26-135---------------------------------
IL4_BOVIN/26-133---------------------------------
G3QSC0_GORGO/26-149---------------------------------
A3FBF0_MUSPF/26-130---------------------------------
IL4_RAT/27-139---------------------------------
G3WEJ0_SARHA/28-149---------------------------------
I3MAS4_ICTTR/24-141---------------------------------
IL4_PIG/26-131---------------------------------

PF00726

IL10_BOVIN/5-174---------------------------------
IL10H_EBVB9/7-167---------------------------------
G3HB01_CRIGR/14-174---------------------------------

PF14565

IL22_HUMAN/40-178---------------------------------
E1C1U2_CHICK/46-184---------------------------------

PF15177

IFNL3_CHICK/28-182---------------------------------
F1M3K4_RAT/31-188---------------------------------
I3MK89_ICTTR/34-194---------------------------------
F1PY54_CANLF/31-186---------------------------------
H0XRJ1_OTOGA/35-191---------------------------------
M3W3J2_FELCA/32-181---------------------------------
F6PNH9_HORSE/31-184---------------------------------
D2DJP5_XENTR/23-178---------------------------------
G3TQK4_LOXAF/32-188---------------------------------
F7DXI8_HORSE/34-187---------------------------------
F6W920_MONDO/30-184---------------------------------
U3KED0_FICAL/27-186---------------------------------
H0VBN4_CAVPO/39-195---------------------------------
IFNL4_HUMAN/25-174---------------------------------
IFNL2_MOUSE/32-189---------------------------------
G3N0M3_BOVIN/37-192---------------------------------
G1LPU9_AILME/37-191---------------------------------
L5LZZ9_MYODS/163-319---------------------------------
IFNL3_HUMAN/34-192---------------------------------
F6R8C9_XENTR/23-177---------------------------------
G3VJ97_SARHA/12-167---------------------------------
H0XJU8_OTOGA/36-192---------------------------------
G3HJD0_CRIGR/30-187---------------------------------
G1LPW2_AILME/34-190---------------------------------
L5L378_PTEAL/33-182---------------------------------
G1T4B0_RABIT/34-188---------------------------------
U3IYH6_ANAPL/34-185---------------------------------
L9LBW1_TUPCH/31-181---------------------------------
D0FHA1_PIG/36-191---------------------------------

PF05337

CSF1_HUMAN/41-180---------------------------------
Q3TLQ6_MOUSE/41-180---------------------------------
O77709_BOVIN/41-180---------------------------------
O77710_BOVIN/41-180---------------------------------
Q64129_9MURI/41-180---------------------------------

PF15036

IL34_MOUSE/28-184---------------------------------
R4GIU3_CHICK/19-177---------------------------------
F7EA00_CALJA/29-185---------------------------------
H0WFN4_OTOGA/28-184---------------------------------
M3ZVZ0_XIPMA/24-191---------------------------------
U3JY35_FICAL/18-179---------------------------------
L9KJY3_TUPCH/28-184---------------------------------
G3T3A6_LOXAF/28-182---------------------------------
F6W3U1_MONDO/15-167---------------------------------
I3JZ08_ORENI/24-192---------------------------------
L5MCR9_MYODS/28-182---------------------------------
B3DLJ8_DANRE/23-195---------------------------------
IL34_BOVIN/28-183---------------------------------

PF00714

IFNG_HORSE/15-152---------------------------------
H0WPL1_OTOGA/15-151---------------------------------
Q8CGS0_CAVPO/15-154---------------------------------
B9VS86_CALJA/15-152---------------------------------
G3SUC6_LOXAF/15-152---------------------------------
G3GY20_CRIGR/2-135---------------------------------
I3MNV6_ICTTR/15-152---------------------------------
L5LME8_MYODS/15-153---------------------------------
G5BGB5_HETGA/15-152---------------------------------
G3WQJ9_SARHA/15-153---------------------------------
IFNG_SHEEP/15-152---------------------------------
IFNG_RAT/14-151---------------------------------
IFNG_RABIT/15-152---------------------------------
L9KVU0_TUPCH/51-188---------------------------------
IFNG_FELCA/15-153---------------------------------

PF02404

R4GD07_ANOCA/1-283HILESNPTTQANICQEDNEISMLQQKDKSLLQV
SCF_CHICK/1-287SRPESNETIQCHGCQEENEISMLQQKEKEHLQV
SCF_RAT/1-273LTRAV.ENIQIN..EEDNEISMLQQKEREFQEV
G1NWC8_MYOLU/1-272LTRAV.ENIQIN..EEDNEISMLQEKEREFQEV
F7EP53_MONDO/1-273LKMEV.ENIETS..EEDNEISMLQENDGEFQEV
F7C5I3_ORNAN/1-273HSVEV.ENIQGN..EEDNEISMLQERERELQEV
F7G0W2_CALJA/1-273LTRTV.ENIQIN..EEDNEISMLQEKEREFQEV

PF02372

IL15_PIG/33-160---------------------------------
IL15_CAVPO/33-160---------------------------------
IL15_FELCA/33-160---------------------------------
IL15_SHEEP/33-160---------------------------------
F1NZN5_CHICK/55-183---------------------------------
G1NDP6_MELGA/5-137---------------------------------
O73883_CHICK/5-138---------------------------------
Q8JFF4_ANAPL/4-134---------------------------------

PF00715

I3MQX6_ICTTR/7-151---------------------------------
G5C793_HETGA/7-149---------------------------------
G1PJ32_MYOLU/7-147---------------------------------
B1AB81_HORSE/7-146---------------------------------
G3HTL8_CRIGR/7-150---------------------------------
IL2_MACMU/7-151---------------------------------
H0Y254_OTOGA/7-149---------------------------------
IL2_MOUSE/7-165---------------------------------
G3SU90_LOXAF/7-147---------------------------------
IL2_PIG/7-151---------------------------------
IL2_FELCA/7-151---------------------------------
L5K7D9_PTEAL/7-149---------------------------------
IL2_BOVIN/7-152---------------------------------
H0VBY4_CAVPO/7-149---------------------------------

PF01415

H0X0U6_OTOGA/15-141---------------------------------
G1QNL2_NOMLE/28-172---------------------------------
IL7_BOVIN/28-171---------------------------------
H0VFS1_CAVPO/31-152---------------------------------
F1PA23_CANLF/29-154---------------------------------
M3WJR8_FELCA/15-139---------------------------------
IL9_MOUSE/15-141---------------------------------
U3KN10_RABIT/31-153---------------------------------
A0MZ91_PIG/18-138---------------------------------
K7E262_MONDO/59-200---------------------------------
E1BF10_BOVIN/18-141---------------------------------
F6PLW3_HORSE/15-136---------------------------------
IL9_HUMAN/15-141---------------------------------
IL7_MOUSE/28-151---------------------------------
G5BX09_HETGA/15-141---------------------------------
L8Y4N8_TUPCH/15-141---------------------------------
D4A8I9_RAT/15-141---------------------------------
G3TKQ6_LOXAF/16-136---------------------------------
M3YEX7_MUSPF/16-137---------------------------------
G1NXN3_MYOLU/28-153---------------------------------

PF00103

PLRP1_BOVIN/26-238LTCRTHKT...C---------------------
CSH2_BOVIN/26-238LTCRTRKT...C---------------------
PLRP3_BOVIN/1-213LACRITNT...C---------------------
PR4A1_RAT/17-227LKCRLIRS..KC---------------------
CSH1_BOVIN/26-236LKCR.FTP...C---------------------
PLRP4_BOVIN/26-239VACRLIYK..KC---------------------
PR3D4_RAT/16-223LRCRVVFKN.EC---------------------
PR2C2_MOUSE/16-224LKCYMLKIDN.C---------------------
SOM2_HUMAN/9-215VQCR.SVEG.SC---------------------
PR8A5_RAT/17-238LNCLITGKD..C---------------------
PR6A1_RAT/20-234LKCRLIYNR.DC---------------------
PR7D1_MOUSE/17-240LKCLLLYDD.VC---------------------
CSH2_HUMAN/9-215VQCR.SVEG.SC---------------------

PF06875

Q5BNQ4_9SALA/2-215LAEKYQGPL------------------------
Q5BNQ2_9SALA/2-215LAKKYQGHL------------------------

PF01110

CNTF_CHICK/1-194LSKHGPGSGAALGLPES----------------
G3VWZ5_SARHA/1-195ISSPGQNRVPARGGQQL----------------
E1BFH9_BOVIN/1-193ISR..QSGVPACGSRCA----------------
G5AP46_HETGA/1-192ISSQ.PAGIPADESRYF----------------
H0Z9U1_TAEGU/1-188LGKPSSAAGTA......----------------
CNTF_HUMAN/1-194ISSH.QTGIPARGSHYI----------------

PF01291

LIF_MOUSE/44-203---------------------------------
LIF_BOVIN/43-202---------------------------------
ONCM_HUMAN/37-209---------------------------------
ONCM_MOUSE/34-194---------------------------------
ONCM_BOVIN/34-194---------------------------------

PF03039

IL12A_MOUSE/6-215LSSA-----------------------------
G3VQT1_SARHA/40-247L...-----------------------------
F6T5A8_MONDO/5-202L..A-----------------------------
IL12A_PIG/6-222LNSS-----------------------------
L8YEA2_TUPCH/1-213LNTS-----------------------------
H0X861_OTOGA/6-217LNSS-----------------------------
G1QWH2_NOMLE/40-254LNAS-----------------------------
I3MN91_ICTTR/4-220LNSS-----------------------------
Q924V6_CAVPO/6-221LTSS-----------------------------

PF02024

H3AP27_LATCH/26-169IKDC-----------------------------
G3WWV6_SARHA/23-167IHGC-----------------------------
F6PLK2_ORNAN/23-167IQGC-----------------------------
F7HGW1_CALJA/23-167GPAC-----------------------------
G5BHA4_HETGA/23-167NTMC-----------------------------
W5NER9_LEPOC/28-172LKNC-----------------------------
H0V7C6_CAVPO/23-165GIVC-----------------------------
LEP_HUMAN/23-167SPGC-----------------------------

PF15216

M3WGC3_FELCA/29-153FSR------------------------------
G3QQC8_GORGO/29-153FNR------------------------------
F7I7D5_CALJA/29-153FIR------------------------------
F1RLI5_PIG/17-138FSR------------------------------
K7E5V9_MONDO/34-162YWK------------------------------
L8YGS5_TUPCH/5-129FTR------------------------------
J9P5I8_CANLF/29-154FSR------------------------------
TSLP_MOUSE/20-137FMQ------------------------------

PF01109

CSF2_RAT/18-139---------------------------------
CSF2_MOUSE/18-136---------------------------------
CSF2_BOVIN/18-138---------------------------------
CSF2_CAVPO/18-140---------------------------------
CSF2_PIG/18-139---------------------------------
CSF2_HUMAN/18-139---------------------------------
CSF2_CANLF/18-139---------------------------------

PF02025

G1RQD7_NOMLE/22-133IE-------------------------------
IL5_CAVPO/23-134IE-------------------------------
J9NWP5_CANLF/22-132P.-------------------------------
IL5_MOUSE/21-132ME-------------------------------
G3WAR7_SARHA/25-134VE-------------------------------
IL5_HORSE/22-133IE-------------------------------
B5FW65_OTOGA/22-133ME-------------------------------
I3MDT8_ICTTR/23-134ME-------------------------------
G3T4B0_LOXAF/23-133I.-------------------------------
G1SL79_RABIT/22-133ME-------------------------------

PF02059

IL3_CANLF/19-132---------------------------------
IL3_MOUSE/27-138---------------------------------
IL3_BOVIN/18-132---------------------------------
G3UC30_LOXAF/22-133---------------------------------
G1MH15_AILME/18-131---------------------------------
F1RJV6_PIG/18-131---------------------------------
G1RQ11_NOMLE/20-137---------------------------------
IL3_CALJA/19-136---------------------------------
F1LS41_RAT/29-138---------------------------------

PF07400

IL11_HUMAN/22-199VRGLLLLKTRL----------------------

PF00758

G3TYQ1_LOXAF/25-173RRA------------------------------
W5K758_ASTMX/26-175...------------------------------
B1N8Y2_DANRE/15-168CRQ------------------------------
F7DTH0_CALJA/31-193TED------------------------------
M3XJ62_LATCH/27-177MQ.------------------------------
G3W289_SARHA/30-190SQE------------------------------
F6WUU2_MONDO/31-191SEE------------------------------
G3VW20_SARHA/26-175RQD------------------------------
G1PF99_MYOLU/45-207RGD------------------------------
TPO_CANLF/25-176KQS------------------------------
F7G570_MONDO/26-177RQD------------------------------
H0W023_CAVPO/30-191RGD------------------------------
H2LEX3_ORYLA/33-182...------------------------------

PF00489

IL6_BOVIN/27-208K--------------------------------
M3X721_FELCA/27-208M--------------------------------
IL6_HORSE/27-208M--------------------------------
G3UHF3_LOXAF/20-205M--------------------------------
L5KPK4_PTEAL/20-202M--------------------------------
F7HV62_CALJA/27-212M--------------------------------
IL6_MOUSE/26-210.--------------------------------

PF16647

CSF3_BOVIN/42-190---------------------------------
CSF3_HUMAN/51-202---------------------------------
CSF3_MOUSE/57-205---------------------------------

PF16649

IL23A_MOUSE/28-185GA-------------------------------
F7HQI5_MACMU/28-184GA-------------------------------
F1MSN4_BOVIN/35-192GA-------------------------------
IL23A_CAVPO/28-184GA-------------------------------
G3VET0_SARHA/31-186GA-------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window