Sequence alignment for CL0053

PF02372

IL15_PIG/33-160----------------VFILGCISAGLPKT----EAT...WQ----------------........HVISDLKKI-----
IL15_CAVPO/33-160----------------VFVWGCISAGLPKT----EAS...WH----------------........DVIYDLKRI-----
IL15_FELCA/33-160----------------VFILSCINAGLPKT----EAN...WQ----------------........DVISDLKII-----
IL15_SHEEP/33-160----------------VFILGCISAGLPKT----EAN...WQ----------------........SVIHDLKTI-----
F1NZN5_CHICK/55-183----------------.FFL.C..AYVPKT----EANHCKWS----------------........DVLKDLELI-----
G1NDP6_MELGA/5-137----------------VLIFSCISVALLMT----TAYGASLS----------------PEKLEILPALIKDLEIL-----
O73883_CHICK/5-138----------------VLIFGCISVAMLMT----TAYGASLS----------------SAKRKPLQTLIKDLEIL-----
Q8JFF4_ANAPL/4-134----------------VLIFSCLSVLMLMT----TAYGAPLS----------------EKD.NTLKTLIKDLENL-----

PF00715

I3MQX6_SPETR/7-151-------------------LSCLALTLALL----AHGAPTSGSA..............EETRQQLEHLLLDLQVLSRGVS
G5C793_HETGA/7-149-------------------LSCIALTLALI----TSSAPTSSST..............RETQEQLEQLLLDLQVILKGVT
G1PJ32_MYOLU/7-147-------------------LSCIALTLAFI----ADGAPTSSSS..............QETQQQLEHLILDMQRLLNGVS
B1AB81_HORSE/7-146-------------------LACIALTLAVL----ANSAPTSSSK..............RETQQQLKQLQMDLKLLLEGVN
G3HTL8_CRIGR/7-150-------------------ASCLALTLALL----VNSAPTSSSK..............KETQQHLEQLLLDLQVLLKGIN
IL2_MACMU/7-151-------------------LSCIALSLALV----TNSAPTSSST..............KKTQLQLEHLLLDLQMILNGIN
H0Y254_OTOGA/7-149-------------------LTCIALTFALV----TNSAPISSST..............KETRQQLEQLLLDLQMVLNGVN
IL2_MOUSE/7-165-------------------ASCVTLTLVLL----VNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRME
G3SU90_LOXAF/7-147-------------------LSCIALTLALV----ANSAPTSSST..............KETQQQLEQLLLDLQMLLIRVK
IL2_PIG/7-151-------------------LCCIALTLALM----ANGAPTSSST..............KNTKKQLEPLLLDLQLLLKEVK
IL2_FELCA/7-151-------------------LSCIALTLILV----TNSAPASSST..............KETQQQLEQLLLDLRLLLNGVN
L5K7D9_PTEAL/7-149-------------------LSCIALTLALV----ADGAPTSSSR..............KETQQQLEHLLKDLQRLLETVN
IL2_BOVIN/7-152-------------------LSCIALTLALV----ANGAPTSSST..............GNTMKEVKSLLLDLQLLLEKVK
H0VBY4_CAVPO/7-149-------------------LSCLALTLALL----TSSAPTSSSP..............KQTQDRLELLLRDLQTLLEGVT

PF00103

PLRP1_BOVIN/26-238-------------------LLMSNLLLCQ.....GKSCPSCGPDVFVSLRKSFTDRFMNAASLSHDFYNLSTIMFNEFDE
CSH2_BOVIN/26-238-------------------LVVSNLLLCQ.....GISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDE
PLRP3_BOVIN/1-213-------------------MVMSNLLLCQ.....VNSCPSCCPDVFDIPLESLTHLFLNASRLSHDIVNHTTIMFHEFDE
PR4A1_RAT/17-227-------------------LLVSNLLLWEN....TASAMRAKLL.NVHNYTSYGDTWNQAIKISQDMNQYISDLSTHVKI
CSH1_BOVIN/26-236-------------------LVVSNLLLCQGVEDYAPYCKNQPGN....CRIPLQSLFERATLVASNNYRLAREMFNEFNK
PLRP4_BOVIN/26-239-------------------LVMSNLLLCQ.....GILCPSLCPDGDDVCRASLIDLFVHASVLSTGMYNTSVKMFTDFDE
PR3D4_RAT/16-223-------------------LLVSNLLLWEN....MASKPTVLVS........TEDLYHRLVEQSHNTFIKAADVYREFDI
PR2C2_MOUSE/16-224-------------------LLVNSSLLWKN....VASFPMCAMR.NGRCFMSFEDTFELAGSLSHNISIEVSELFTEFEK
SOM2_HUMAN/9-215-------------------LLLAFGLLCLSWLQEGSAFPTIP..........LSRLFDNAMLRARRLYQLAYDTYQEFEE
PR8A5_RAT/17-238-------------------LVVSNLLLWEK....AASIPACMVE.DGGCWDPLREAFNSATQRAETLRNLSDQLYVEFFQ
PR6A1_RAT/20-234-------------------LLMSNILLWEN....VASVPRHASGAGRG.EMSLHGLLDHAIILAHNVTELIAEMNSVFLE
PR7D1_MOUSE/17-240-------------------LLMSNLFLWEK....VSSAPINAS...EAVLSDLKDLFDNATVLSGEMSKLGVIMRKEFFM
CSH2_HUMAN/9-215-------------------LLLAFALLCLP...WLQEAGAVQ.......TVPLSRLFDHAMLQAHRAHQLAIDTYQEFEE

PF00726

IL10_BOVIN/5-174--------------------------------------ALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRA
IL10H_EBVB9/7-167--------------------------------------VTLQCLVLL.........YLAPECGGTDQCDNFPQMLRDLRD
G3HB01_CRIGR/14-174--------------------------------------.........AGVGPSRGQYTQQENNCTHFPVSQTHMLRELRT

PF14565

IL22_HUMAN/40-178---------------------------------------------------------------CRLDKSNFQQPYITNRT
E1C1U2_CHICK/46-184---------------------------------------------------------------CRLRKINFQQPYIRNRT

PF05337

CSF1_HUMAN/41-180------------------------------------------------------------HMIGSGHLQSLQRLIDSQME
Q3TLQ6_MOUSE/41-180------------------------------------------------------------HMIGNGHLKVLQQLIDSQME
O77709_BOVIN/41-180------------------------------------------------------------HMIGNGHLLFLQQLIDSQME
O77710_BOVIN/41-180------------------------------------------------------------HMIGNGHLLFLQQLIDSQME
Q64129_9MURI/41-180------------------------------------------------------------HMIGNGHLKVLQQLIDSQME

PF15036

IL34_MOUSE/28-184--------------------------------------------------------TLTQDKECDLTGYLRGKLQYKNRL
R4GIU3_CHICK/19-177--------------------------------------------------------.VAALGECELARLLQDKLRYEMRL
F7EA00_CALJA/29-185--------------------------------------------------------PLTQSKECTVTGFLRDKLQYRNRL
H0WFN4_OTOGA/28-184--------------------------------------------------------SLTQSQECTVTSSLRDKLQYRNRL
M3ZVZ0_XIPMA/24-191--------------------------------------------------------ASTPASMCTPLKTLNDSLSH..RR
U3JY35_FICAL/18-179--------------------------------------------------------EAAAPGECELTRLLQDKLQYEMRL
L9KJY3_TUPCH/28-184--------------------------------------------------------PVTQSKECAVTGFLREKLQYRNRL
G3T3A6_LOXAF/28-182--------------------------------------------------------PLTQGEECTFTGYLRDKLQYKNRL
F6W3U1_MONDO/15-167--------------------------------------------------------...QNKECIITGILRDKLQYRHRL
I3JZ08_ORENI/24-192--------------------------------------------------------.PTHSSMCTPLRTINDSLSH..RR
L5MCR9_MYODS/28-182--------------------------------------------------------PLTQSKECALTGILRNKLQYRNRL
B3DLJ8_DANRE/23-195--------------------------------------------------------SSAAPDLCGPLKTVQDSLNATLRR
IL34_BOVIN/28-183--------------------------------------------------------PLTRSDECAITGFLRDKLQYRNRL

PF00714

IFNG_HORSE/15-152---------------------------------------------------------ILGSSTYYCQAAFFKEIEN----
H0WPL1_OTOGA/15-151---------------------------------------------------------LLGSSAFYCRVTSSAEIDQ----
Q8CGS0_CAVPO/15-154---------------------------------------------------------ILSFSSYYCQSRFTNEIRI----
B9VS86_CALJA/15-152---------------------------------------------------------VLGSLGCYCQDPYVKEAEN----
G3SUC6_LOXAF/15-152---------------------------------------------------------ILGSSSCYCQATFLKEIQN----
G3GY20_CRIGR/2-135---------------------------------------------------------....SGCYCQRTLIEEIEN----
I3MNV6_SPETR/15-152---------------------------------------------------------ILGSSSYYSQDIVNKEIEA----
L5LME8_MYODS/15-153---------------------------------------------------------ILGFSSCYSQSTIFNETQK----
G5BGB5_HETGA/15-152---------------------------------------------------------ILGFSTYYCESRFTKEINI----
G3WQJ9_SARHA/15-153---------------------------------------------------------ILSSSGCLSQVNLREDMQT----
IFNG_SHEEP/15-152---------------------------------------------------------LLGFSGSYGQGPFFKEIEN----
IFNG_RAT/14-151---------------------------------------------------------LMALSGCYCQGTLIESLES----
IFNG_RABIT/15-152---------------------------------------------------------ILGSYGCYCQDTLTRETEH----
L9KVU0_TUPCH/51-188---------------------------------------------------------ILGSSSCYCQAPFMKEVQN----
IFNG_FELCA/15-153---------------------------------------------------------ILCSSGYYCQAMFFKEIEE----

PF02404

R4GD07_ANOCA/1-283---------------------------------------------------------MKTAQTWIITCFYLQLLLLHPL-
SCF_CHICK/1-287---------------------------------------------------------MKKAQTWIITCFCLQLLLLNPL-
SCF_RAT/1-273---------------------------------------------------------MKKTQTWIITCIYLQLLLFNPL-
G1NWC8_MYOLU/1-272---------------------------------------------------------..KTQTWIITCIYLQLLLFNHL-
F7EP53_MONDO/1-273---------------------------------------------------------MKKTQTWIITCIYLQLLLFNPL-
F7C5I3_ORNAN/1-273---------------------------------------------------------MKKTQTWIITCIYLQLLLFIPL-
F7G0W2_CALJA/1-273---------------------------------------------------------MKKTQTWILTCIYLQLFLFNPF-

PF03487

G1SCQ2_RABIT/16-144--------------------------------------------------------ALWWAVAIAVTCLGSLVSPGPVPP
IL13_HUMAN/16-144--------------------------------------------------------ALLLTTVIALTCLGGFASPGPVPP
IL13_RAT/2-130--------------------------------------------------------ALWVTAVLALACLGGLATPGPVRR
F7DGH7_MACMU/16-151--------------------------------------------------------ALLLTMVIALTCLGGFASPSPVPP
L5M5Z7_MYODS/2-128--------------------------------------------------------ALWLTLVIVLTCFGGLASPGPVRP
G5ASP9_HETGA/2-130--------------------------------------------------------ALWVTVVLALTCLSALTAPGPVPS
B3GDZ5_PIG/2-130--------------------------------------------------------ALWLTLVIALTCFGGLASPGPVPP
L8YAP6_TUPCH/2-128--------------------------------------------------------ALWLTVVIALTCLGGLASPASVPS
IL13_BOVIN/2-130--------------------------------------------------------ALLLTAVIVLICFGGLTSPSPVPS
IL13_MOUSE/2-130--------------------------------------------------------ALWVTAVLALACLGGLAAPGPVPR
H0W834_CAVPO/16-149--------------------------------------------------------AFWVTVVLALACLGGLTAPGPVPV
F6WQF3_ORNAN/2-128--------------------------------------------------------TVVLLAVFWIDCI....SAKPVTR
G3T2N9_LOXAF/2-133--------------------------------------------------------ALWLTVVIALTCIGGLASPVPVY.
M3YGH3_MUSPF/2-126--------------------------------------------------------ALWLTVIIAFICLSGLASPGPVHN
B5FW67_OTOGA/2-129--------------------------------------------------------ALWLTMVIALTCLGGLASPGPVPR
I3MAR4_SPETR/2-131--------------------------------------------------------ALWLTVVLTLACLGGLAAPGPVPP
IL13_CANFA/2-129--------------------------------------------------------ALWLTVVIALTCLGGLASPSPVTP

PF00727

IL4_FELCA/26-131--------------------------------------------------------NFNNTLKEIIKTLNILT..ARNDS
H0XDE1_OTOGA/26-149--------------------------------------------------------KRGIVLKECIKALNILT..ENKTP
IL4_MOUSE/27-140--------------------------------------------------------..KNHLREIIGILNEVT..GEGTP
G3T4B8_LOXAF/26-132--------------------------------------------------------TCGNILREIIKTLNFLT..EKKHA
IL4_RABIT/28-143--------------------------------------------------------..DIILPEVIKTLNILT..ERKTP
G5ASQ0_HETGA/25-138--------------------------------------------------------.CNDALQEIINDLNVLS..SQKTP
F6U5N6_HORSE/26-135--------------------------------------------------------KYDITLQEIIKTLNNLTDGKGKNS
IL4_BOVIN/26-133--------------------------------------------------------KCDITLAEIIKTLNILT..TRKNS
G3QSC0_GORGO/26-149--------------------------------------------------------KCDIALQEIIKTLNSLT..EQKTL
A3FBF0_MUSPF/26-130--------------------------------------------------------NFSIAIKEIIKTLNILT..ARNDS
IL4_RAT/27-139--------------------------------------------------------..DSPLREIINTLNQVT..EKGTP
G3WEJ0_SARHA/28-149--------------------------------------------------------NCRSTVREIILSASSLT..TKKFL
I3MAS4_SPETR/24-141--------------------------------------------------------GCDVTLEEIIKTLNTLS..GKKTT
IL4_PIG/26-131--------------------------------------------------------KCDITLQEIIKTLNILT..ARKNS

PF01109

CSF2_RAT/18-139------------------------------------------------------APTRSPNPVTRP--WKHVDA.IKEAL
CSF2_MOUSE/18-136------------------------------------------------------APTRSPITVTRP--WKHVEA.IKEAL
CSF2_BOVIN/18-138------------------------------------------------------APTRPPNTATRP--WQHVDA.IKEAL
CSF2_CAVPO/18-140------------------------------------------------------APTDLLSPVTQS--WKHVDATINEAL
CSF2_PIG/18-139------------------------------------------------------APTRPPSPVTRP--WQHVDA.IKEAL
CSF2_HUMAN/18-139------------------------------------------------------APARSPSPSTQP--WEHVNA.IQEAR
CSF2_CANFA/18-139------------------------------------------------------APTRSPTLVTRP--SQHVDA.IQEAL

PF02025

G1RQD7_NOMLE/22-133----------------------------------------------------------TEIPTSAL---------VKETL
IL5_CAVPO/23-134----------------------------------------------------------QSATLRAL---------VRETL
J9NWP5_CANFA/22-132----------------------------------------------------------VENPMNRL---------VAETL
IL5_MOUSE/21-132----------------------------------------------------------MEIPMSTV---------VKETL
G3WAR7_SARHA/25-134----------------------------------------------------------..NPVTEL---------ISETL
IL5_HORSE/22-133----------------------------------------------------------VESPMNRL---------VAETL
B5FW65_OTOGA/22-133----------------------------------------------------------IEISMSTL---------VKETL
I3MDT8_SPETR/23-134----------------------------------------------------------LEIPMSTL---------VKETL
G3T4B0_LOXAF/23-133----------------------------------------------------------IEIPVHRL---------VAETL
G1SL79_RABIT/22-133----------------------------------------------------------TEIRMSTV---------VKETL

PF02059

IL3_CANFA/19-132------------------------------------------------------.PQAQGRP.FSTDLPKQYFTMINEIM
IL3_MOUSE/27-138------------------------------------------------------ASI.SGRDTHRLTRTLNCSSIVKEII
IL3_BOVIN/18-132------------------------------------------------------APQAKGLPVVTSRTP..YSMLMKEIM
G3UC30_LOXAF/22-133------------------------------------------------------..KAQGMP.VTA..PQHYSVMINEIK
G1MH15_AILME/18-131------------------------------------------------------APMAQGRS.LSTYQPKQYFEMISEIM
F1RJV6_PIG/18-131------------------------------------------------------APQAQGMP.TTTLQPKNYLAMIQEIT
G1RQ11_NOMLE/20-137------------------------------------------------------APMTQTTSLKTS..WVNCSNMIDEII
IL3_CALJA/19-136------------------------------------------------------AAPTQTMPLKTT..QVNCSNLREEIV
F1LS41_RAT/29-138------------------------------------------------------GSA......HRLLRTLDCRTIALEIL

PF07400

IL11_HUMAN/22-199------------------------------------------------------PGPPPGPPRVSPDPRAELDSTVLLTR

PF00758

G3TYQ1_LOXAF/25-173------------------------------------------------------PPACDPRLLNKLLRDSHILHSRLSQC
W5K758_ASTMX/26-175------------------------------------------------------RPICDLRVLDHFIKEAWDAEATMRVC
B1N8Y2_DANRE/15-168------------------------------------------------------RPICDLRVLDHFIKEAWDAEAAMRTC
F7DTH0_CALJA/31-193------------------------------------------------------HLICDSGVLERYVLEGKEAENVTMGC
M3XJ62_LATCH/27-177------------------------------------------------------RPVCDTSVMDKFIEDAKDAESFVNGC
G3W289_SARHA/30-190------------------------------------------------------.PFCESHILERYILEAKEAQNATVAC
F6WUU2_MONDO/31-191------------------------------------------------------.PFCDSHILERYILEAKEAQNATVRL
G3VW20_SARHA/26-175------------------------------------------------------APVCDPRLFNKLLRDSAALHSRLSQC
G1PF99_MYOLU/45-207------------------------------------------------------RLICDSRVLERYILEAREAENVTMGC
TPO_CANFA/25-176------------------------------------------------------PPACDPRLLNKMLRDSHVLHSRLSQC
F7G570_MONDO/26-177------------------------------------------------------APVCDPRLFNKLLRDSAALHSRLSQC
H0W023_CAVPO/30-191------------------------------------------------------RLICDSTVLERYIVEAKDAENVTMSC
H2LEX3_ORYLA/33-182------------------------------------------------------RPICDLRVLNHFIQEARDAEVAMRSC

PF00143

G5E7E1_LOXAF/9-168---------------------------------------------------------LQKKHT-LTSKK.TFVVL.DQMR
IFNE_MOUSE/27-185---------------------------------------------------------IPFQLW-.MNRE.SLQLL.KPLP
G3I0H8_CRIGR/26-185---------------------------------------------------------LPQTHN-IRNRK.PLTLL.AQMR
H0VF99_CAVPO/28-187---------------------------------------------------------LQQQQQ-RSSLA.CLKLL.RQVK
L5KKJ7_PTEAL/25-192---------------------------------------------------------..NLLN-RVTWQ.NLKLL.SSMR
G1U0Q8_RABIT/26-185---------------------------------------------------------LPHNSV-PLSRK.TLVLL.GQMR
F6YZB3_ORNAN/25-183---------------------------------------------------------..RPLQ-TADVEQSLNRL.DRMK
I3MY95_SPETR/32-186---------------------------------------------------------LSLETS-EKNEEGALNLL.KEMR
V8NNB8_OPHHA/15-183---------------------------------------------------------LQRKLL-KANKD.NSNLLSSNIR
C8CKA7_PIG/26-185---------------------------------------------------------PVQTHS-LAHTR.ALRLL.AQMR
H0W7G8_CAVPO/26-185---------------------------------------------------------LPQTHS-QRNAR.ALLLL.EQMK
G3GXU9_CRIGR/27-182---------------------------------------------------------LELKQR-KCNSE.CLEVL.RQLH
H0XSG1_OTOGA/26-185---------------------------------------------------------LPQSHS-LGNRR.ALKVL.AQMR
G1KX99_ANOCA/25-184---------------------------------------------------------LRSRLR-QASQV.YLELLNSKMN
G3I0I6_CRIGR/27-185---------------------------------------------------------ILFQSR-.MKRE.SLHLL.KTLP
IFNT4_SHEEP/26-185---------------------------------------------------------LSQRLM-LDARE.NLKLL.DRMN
L8Y4J0_TUPCH/27-186---------------------------------------------------------FLFQQR-RVNRE.SFKLL.NTLR
F7B527_HORSE/26-183---------------------------------------------------------PPLRQR-..NQE.TITLL.SQME
G1Q950_MYOLU/27-184---------------------------------------------------------LRFQQS-SSNSA.CQKLL.WQLI
M3WTR1_FELCA/26-186---------------------------------------------------------LPGSHA-QVSRD.NLVLL.GQMR
G5CB66_HETGA/27-185---------------------------------------------------------LQAQQR-SSSLA.CGELL.KQLK
L9L941_TUPCH/27-198---------------------------------------------------------LNVHLR-RVTWQ.NLRLL.SSMS
D2H9N6_AILME/27-184---------------------------------------------------------LRFQLS-SSSVE.CQNLL.LQLN
D3Z919_RAT/26-179---------------------------------------------------------LPRTH.-......NLTVL.KQMS
C8CKB9_PIG/24-176---------------------------------------------------------FSGIHR-LENRE.IFMLL.RQMK
A8E6F6_XENTR/27-179---------------------------------------------------------LHPKQE-YLNTQ.ILKAF.NEMM
L8Y906_TUPCH/26-185---------------------------------------------------------LPQSLD-SGKQE.TLTAL.AQMG
H9L1C3_CHICK/28-183---------------------------------------------------------LPLQQR-RVIES.SLQLL.DKMG
L5KWM8_PTEAL/106-263---------------------------------------------------------LSQDHV-QVSKE.NIAIL.HQMQ
G3WZJ8_SARHA/27-182---------------------------------------------------------LTQGLQ-E.....DFSFL.NQIS
G3UCD2_LOXAF/26-187---------------------------------------------------------LPQSHR-LANRR.TLILL.EQMR
K7GQJ6_PIG/17-164---------------------------------------------------------CQQ...-....K.NLALL.CQIR
G3I0H3_CRIGR/26-178---------------------------------------------------------LSLTPK-PGEKT.ALTLL.KEMM
H0VYK7_CAVPO/28-181---------------------------------------------------------LQQQQR-SSNSA.CLKLL.RQVK
I3N7K4_SPETR/33-202---------------------------------------------------------LEVHLD-MSTSE.NLMLL.TNLS
L5K635_PTEAL/26-185---------------------------------------------------------LSQSLD-LGKQE.TSTAL.NQMQ
H0W3G0_CAVPO/26-185---------------------------------------------------------LPQNSV-LLCKK.TFVLL.GQIR
W5JYQ9_ASTMX/23-179---------------------------------------------------------VKCSLQ-RRLVQTCHHLL.DSMG
G3SI98_GORGO/28-185---------------------------------------------------------.NVHLR-RVTWQ.NLRHL.SSMS
H0Y0D2_OTOGA/28-187---------------------------------------------------------LPKSPI-LNTAV.TLKIL.AQMR
IFN_ANAPL/34-190---------------------------------------------------------LRLHDS-AFAWD.SLQLL.RNMA
G3UJX3_LOXAF/27-185---------------------------------------------------------LQFQQR-SSNLA.CQKLL.WKLN
G5C259_HETGA/26-185---------------------------------------------------------LPRTHS-QGNRR.ALTLL.EQMR
G3WZF5_SARHA/26-185---------------------------------------------------------LRFYQR-RTNKS.SIYLL.KKMI
IFNE_PIG/27-186---------------------------------------------------------VLSQQR-RVNRE.SLKLL.NKLQ
W5N6G4_LEPOC/27-185---------------------------------------------------------LEHQLG-NINEK.SIQAL.KEMG
H9KYA4_CALJA/26-185---------------------------------------------------------LPQAHS-LSNRR.ASILL.AQMR
D2HTQ4_AILME/33-205---------------------------------------------------------LHFHLR-KVTWQ.NLRLL.SSTS
IFNB_HUMAN/27-185---------------------------------------------------------LGFLQR-SSNFQ.CQKLL.WQLN
G1NR05_MELGA/32-188---------------------------------------------------------LRHQDA-NFSWK.SLQLL.QKAA
F7BVP5_ORNAN/23-181---------------------------------------------------------LYSHQW-LNNWQ.SLHLL.DEMG
F7G875_MONDO/27-182---------------------------------------------------------LRFHQR-RTNQR.SLMFL.NKMI
C8CKC3_PIG/33-205---------------------------------------------------------LNAHLR-RVSWQ.NLRLL.SRMS
I3MVD7_SPETR/34-186---------------------------------------------------------.LETPD-GNEEG.ALTLL.EKMR
F7A317_HORSE/26-184---------------------------------------------------------LPHTHS-LGNTR.VLMLL.GQMR
G1KU56_ANOCA/28-182---------------------------------------------------------LRKHLL-DDNKE.NLAVLKSQLG
L5KBH2_PTEAL/26-185---------------------------------------------------------LSQDHV-QVSKE.NIALL.HQMQ
L5K909_PTEAL/26-185---------------------------------------------------------LPQTHS-LVNRR.ALMLL.GQMR
I3N5Z0_SPETR/23-179---------------------------------------------------------VLLQQR-.IKEE.NLQLL.NNLQ
F7GHL9_MONDO/26-181---------------------------------------------------------LTQGLQ-K.....DFSLL.NQMS
IFNE_HUMAN/27-186---------------------------------------------------------IIFQQR-QVNQE.SLKLL.NKLQ
I3LBU7_PIG/26-179---------------------------------------------------------LSQNHV-HVSRK.NLVLL.CQMR
G3UK87_LOXAF/27-184---------------------------------------------------------LPQILG-LGKQE.TFTPL.GQMR
L9LC61_TUPCH/27-185---------------------------------------------------------LRFQLS-GSSLA.CKKFL.QQLG
IFNB_RAT/27-182---------------------------------------------------------LQFRQS-TSIRT.CQKLL.RQLN
H0XMZ9_OTOGA/27-186---------------------------------------------------------VLFQQR-RVNRE.SIKLL.NELQ
G3VDC6_SARHA/27-182---------------------------------------------------------LTQGLQ-E.....DVSLL.YQMS
I3JM36_ORENI/26-182---------------------------------------------------------MDDKFK-QHNEE.TLKLL.DTMA
L5LKN9_MYODS/27-186---------------------------------------------------------VLFQQR-RVNRE.SSELL.KKWQ
G1TYS8_RABIT/29-195---------------------------------------------------------LNVNLN-RVIRK.NMKLL.RNVS
I3UJJ8_FELCA/27-185---------------------------------------------------------ALFQQR-.VNRE.SLKLL.STLQ
C8CKA9_PIG/26-183---------------------------------------------------------LPQSHD-..NPE.IFTLL.RQMG
IFNT2_BOVIN/3-162---------------------------------------------------------LSEDHM-LGARE.NLRLL.ARMN
H0W510_CAVPO/26-186---------------------------------------------------------LPQTHS-QGNMR.ALILL.GQRR
M3Z729_MUSPF/26-183---------------------------------------------------------LPQDHG-LLHWR.ALMLL.RQMK
IFNA1_MOUSE/26-185---------------------------------------------------------LPQTHN-LRNKR.ALTLL.VQMR
G3TTC1_LOXAF/26-185---------------------------------------------------------LPQNHT-VASEK.TVDLL.DQMQ
G1PDS6_MYOLU/29-199---------------------------------------------------------..IHLR-RITWQ.NVELL.TNMS
F7ABU5_MONDO/27-182---------------------------------------------------------LTLGLQ-E.....DFSLL.NQMS
G1TTX4_RABIT/27-180---------------------------------------------------------LQIQLW-HGSLT.CAKLL.LQLN
H0XRP5_OTOGA/26-185---------------------------------------------------------LPQSHS-LGNRR.ALIPL.VHMR
H0WK94_OTOGA/33-202---------------------------------------------------------LNVHLR-RVTLQ.NLRLL.SSMS
G1KYL3_ANOCA/23-176---------------------------------------------------------LLTRLR-EANQA.NLDVLHRNMG
G3WZQ8_SARHA/26-181---------------------------------------------------------LTQGLQ-E.....DFSLL.NQMS
H2R6R8_PANTR/26-185---------------------------------------------------------LPQTHN-LGNRR.ALILL.AQMG
H0YTY6_TAEGU/34-188---------------------------------------------------------LWTHDD-SFPGD.ALRLL.QDMA
I3MXH1_SPETR/27-185---------------------------------------------------------LRLQQF-NSSVE.CQKLL.EQLN
M3WRV1_FELCA/26-184---------------------------------------------------------LPQTHG-LLNRR.ALTLL.GQMR
H0W4H8_CAVPO/23-182---------------------------------------------------------LAVFQQ-RMNRL.SLQLL.NNLR
R4GKJ6_CHICK/35-191---------------------------------------------------------LRPQDA-TFSHD.SLQLL.RDMA
A3FBE8_MUSPF/27-184---------------------------------------------------------LRFQLS-SSSVE.CQELL.LQLN
G1KWE0_ANOCA/28-180---------------------------------------------------------LCSWLR-QANQA.NLELLNSKMG
G7PS89_MACFA/26-185---------------------------------------------------------LPQTHS-LGYRR.PLVLL.AQMR
G1Q880_MYOLU/26-185---------------------------------------------------------LPQDHI-LLSRE.NLELL.SQMS
IFNB_MOUSE/27-180---------------------------------------------------------LQLQER-TNIRK.CQELL.EQLN
IFNB2_BOVIN/27-184---------------------------------------------------------LRFQQR-RSLAL.CQKLL.RQLP
G1SJC4_RABIT/26-185---------------------------------------------------------LPQTHS-LSDRR.SSMLL.GQMR
W5PG31_SHEEP/26-185---------------------------------------------------------LPHTHS-LANRR.VLTLL.RQLR
IFNA3_CANFA/26-183---------------------------------------------------------LPDTHS-LRNWR.VLTLL.GQMR
G5BPX2_HETGA/27-199---------------------------------------------------------QNVRLS-TVTKE.NVRLL.SSVS
IFNW2_HORSE/26-185---------------------------------------------------------LPQNHI-LVSRK.NFVLL.GQMS
G3N2A8_BOVIN/26-185---------------------------------------------------------LSQNHM-LVGRK.NLRLL.GQMR
H0XKS8_OTOGA/27-185---------------------------------------------------------LQFQQR-RSTLG.CQKLL.RQLN
H0VUV7_CAVPO/26-185---------------------------------------------------------LPLTYM-QGNTT.ALSLL.EQMR
Q29412_PIG/27-184---------------------------------------------------------LRYQQR-SSNLA.CQKLL.GQLP
G7PS88_MACFA/26-185---------------------------------------------------------LPETHS-LDNRR.TMMLL.KQMS
M3WZS7_FELCA/26-181---------------------------------------------------------LRPS..-..NPE.TFTLL.SQME
H9GZR7_HORSE/26-185---------------------------------------------------------LPASLD-LRKQE.TLRVL.DQME
F1LVL8_RAT/26-184---------------------------------------------------------ILFQSR-.RNRE.SLQLL.KALP
M3YX13_MUSPF/27-179---------------------------------------------------------ALFQQR-.VNRE..LKLL.NKFP
G1L8G2_AILME/26-185---------------------------------------------------------LPQNHG-LFAWR.ALTLL.SQME
IFNB_HORSE/27-184---------------------------------------------------------LRSQLR-SSNSA.CLMLL.RQLN
H0W289_CAVPO/26-190---------------------------------------------------------LPQNFI-LLSRK.ILELL.DQMR
A8E6E8_MONDO/27-182---------------------------------------------------------LTQGLQ-E.....DFSLL.NQMS
I3N788_SPETR/27-185---------------------------------------------------------LRLQQS-SSSLE.CQKLL.QQLN
G1L8I1_AILME/26-183---------------------------------------------------------LPQNHG-LFAWR.ALTLL.GQMK
IFNB_FELCA/27-184---------------------------------------------------------LGFQLR-SSSLE.CQELL.VNLN
H0VXI5_CAVPO/26-181---------------------------------------------------------LSQTHS-QGNTR.ALILL.GQMR
G3TS29_LOXAF/26-179---------------------------------------------------------LPLSHS-..NQE.TFTLL.NQME
W5PZ39_SHEEP/26-184---------------------------------------------------------LNVHLR-RVTWQ.NLRLL.SRMS
G3I0H6_CRIGR/26-178---------------------------------------------------------LSPSPK-PGNKT.ALTLL.KEMR
I3L756_PIG/26-180---------------------------------------------------------LSQNHV-HVSRK.NLVLL.HQMR
M3Z715_MUSPF/26-183---------------------------------------------------------LPRDHS-LLHWR.ALMLL.RQMK
M3VXI8_FELCA/33-205---------------------------------------------------------LHLHLR-EVTWQ.NLRLL.NSMS
G3R8Q7_GORGO/26-185---------------------------------------------------------LPQNHG-LLSRN.TLVLL.HQMR
A8E6F5_XENTR/51-202---------------------------------------------------------LQPKQE-YLNRQ.TLKTF.EEMN

PF02947

FLT3L_MOUSE/30-162------------------------------------------------------DCYFSHSPI.SSNFKVKFRELTDHLL
F6T7S9_ORNAN/28-157------------------------------------------------------ACAFRYSPV.SSMFGLHIHNLAQYLL
H9GP84_ANOCA/29-165------------------------------------------------------GCIFGSVPIDTSDFPSIVKNLKKLLL
F6TPW7_MONDO/34-163------------------------------------------------------SCTFPDSPI.SSTFLQAIGRLSDYLL
G5B8P0_HETGA/20-150------------------------------------------------------SCSFSHNPI.SSDFKIKFSTLSDYLL
G1M637_AILME/29-159------------------------------------------------------DCAFSHSPI.SSTFSVTIHKLSDYLL
L9JA37_TUPCH/769-910------------------------------------------------------....QGSPI.ASTFADRIDQLSDYLL
G3VSA3_SARHA/79-209------------------------------------------------------PCSFPDSPI.SSIYPGIISTLSDFML
G1QZC3_NOMLE/30-160------------------------------------------------------DCSFQHSPI.SSDFAVKIRELSDYLL

PF00489

IL6_BOVIN/27-208------------------------PTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRMVDKIS-AMRKE---ICEKNDEC
M3X721_FELCA/27-208------------------------PTPGPLGGD....ATSNRLPLTSADKMEELIKYILGKIS-ALKKE---MCDNYNKC
IL6_HORSE/27-208------------------------PTPLPLGED...ETTSNGPLLTTADKTKQHIKYILGKIS-ALKNE---MCNNFSKC
G3UHF3_LOXAF/20-205------------------------PNPKPLEGDSKDDAASNRPSLTSPDKTEELIRFILAEIS-VLRKK---MCDKYDKC
L5KPK4_PTEAL/20-202------------------------PIPVPSGEDSKDDTNSNRPQLTSPNQTENLIKSIFLEIS-EVRNK---MCGNDDSC
F7HV62_CALJA/27-212------------------------PAPVPLGEDSKEVAAPNRQLLTSTERIDKHIRYILDGIS-ALRKE---ICNKSNMC
IL6_MOUSE/26-210------------------------PTSQVRRGDFTEDTTPNRPVYTTS.QVGGLITHVLWEIV-EMRKE---LCNGNSDC

PF16647

CSF3_BOVIN/42-190------------------------------------------------------VRKIQADGA-ELQER...LCAAHKLC
CSF3_HUMAN/51-202------------------------------------------------------VRKIQGDGA-ALQEKLVSECATYKLC
CSF3_MOUSE/57-205------------------------------------------------------VRKIQASGS-VLLEQ...LCATYKLC

PF06875

Q5BNQ4_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSAD-SLLPTY-LSFQGAPLS
Q5BNQ2_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSAD-SLLPTY-LSFQGAPLS

PF01110

CNTF_CHICK/1-194--------------------MAAADTPSATLRH----HDLCSRGI-------RLARKMRSDVT-DLLDIY-VERQGL---
G3VWZ5_SARHA/1-195--------------------MAFPENTPLTPHH----RDLCTRSI-------WLARKIRSDLT-SLLESY-VEYQGL---
E1BFH9_BOVIN/1-193--------------------MAFAEHSLLPPHR----RDLCSRSI-------WLARKIRSDLT-ALVDSY-MKHQGL---
G5AP46_HETGA/1-192--------------------MAFAELSPLTPHR----RDLCSRSI-------WLARKIRSDLT-ALMDSY-VKHQGL---
H0Z9U1_TAEGU/1-188--------------------MAASESPSAALRR----RDLCSRGI-------RLAGKMRADVV-DLLDAY-VEQQGL---
CNTF_HUMAN/1-194--------------------MAFTEHSPLTPHR----RDLCSRSI-------WLARKIRSDLT-ALTESY-VKHQGL---

PF01291

LIF_MOUSE/44-203--------------------------------------NLMNQIK-------NQLAQLNGSAN-ALFISY-YTAQGEPFP
LIF_BOVIN/43-202--------------------------------------NLMNQIR-------NQLGQLNSSAN-SLFILY-YTAQGEPFP
ONCM_HUMAN/37-209--------------------------------------VLLGQLQ-------KQTDLMQDTS.-RLLDPY-IRIQGLDVP
ONCM_MOUSE/34-194--------------------------------------QLLSQLQ-------NQANLTGNTE.-SLLEPY-IRLQNLNTP
ONCM_BOVIN/34-194--------------------------------------ELLLQLQ-------RQADLMQDPS.-TLLDPY-IHLQGLHSP

PF03039

IL12A_MOUSE/6-215YLLFLATLAL...LNHLSLARVIPVSGP......ARCLSQSRNLL-------KTTDDMVKTAR-EKLKHYSCTAEDIDHE
G3VQT1_SARHA/40-247..FLIAILIG...LSQVNWVKSIPVIQSEPSM..HQYLRGSKNLL-------GTVTETLQQAR-QKLELYSCSLEEIDHE
F6T5A8_MONDO/5-202HIFLIATLIG...LSQIHWATSLPVPQPEPSM..PQCLTASKNLV-------EATNEILQKSR-KILELYPCSLEEIDHE
IL12A_PIG/6-222NLLLVATLVLLNHLDHLSLGRSLPATTAGPGM..FKCLNHSQNLL-------KAVSNTLQKAK-QTLEFYSCTSEEIDHE
L8YEA2_TUPCH/1-213.LLLAATLVL...LHHGTLARNLPTAMPGPGK..FGCLSHSQNLL-------TAISNTLQKAR-KNLEFYSCTSEEIDHE
H0X861_OTOGA/6-217SLLLVAILVL...LDHLSLARNLPRPTPEPGR....CHQHSQKLL-------EAVSTTLQKAR-ETLNSSSHTSEEIDHE
G1QWH2_NOMLE/40-254SLLLVATLVL...LDHLSLARNLPVATPGPGM..FPCLHHSQNLL-------RAVSNMLQKAR-QTLEFYPCTSEEIDHE
I3MN91_SPETR/4-220GLLLLASLVL...LEHLGSARNLPRSTPVPAVS.QECHNLSQTLL-------STVDSALQNAI-EILEHYPCSAEEVNHE
Q924V6_CAVPO/6-221KCLLLTSLVL...LVSCSLARNLPRASPAPVTEPVQCFNHSQTLL-------RAVNSELHKAI-QMLAVYSCTPEEIDHE

PF02024

H3AP27_LATCH/26-169-----------------------------------------------------.IEKVKSDAR-NLTRII----------
G3WWV6_SARHA/23-167-----------------------------------------------------PIRKVQDDTK-TLTKTI----------
F6PLK2_ORNAN/23-167-----------------------------------------------------SIEKIQADTK-TLTKTI----------
F7HGW1_CALJA/23-167-----------------------------------------------------PIQRVQDDTK-TLIKTI----------
G5BHA4_HETGA/23-167-----------------------------------------------------PIQKVQDDTK-TLIKTI----------
W5NER9_LEPOC/28-172-----------------------------------------------------...RVKNDAR-LLAQTT----------
H0V7C6_CAVPO/23-165-----------------------------------------------------PMQKLQDDAK-FLIKTI----------
LEP_HUMAN/23-167-----------------------------------------------------PIQKVQDDTK-TLIKTI----------

PF02372

IL15_PIG/33-160--EDLIR-------------------SIHMDATLYT.ES-DAHPN----------------CKV----TAM---------
IL15_CAVPO/33-160--ENLIQ-------------------SIHIDATLYT.ES-DVHPN----------------CKI----TAM---------
IL15_FELCA/33-160--DKIIQ-------------------SLHIDATLYT.ES-DVHPN----------------CKV----TAM---------
IL15_SHEEP/33-160--EHLIQ-------------------SMHMDATLYT.ES-DAHPN----------------CKV----TAL---------
F1NZN5_CHICK/55-183--K...T-------------------SEDIDVSLYTANT-YEDIE----------------CQE----PVM---------
G1NDP6_MELGA/5-137--EESKN-------------------KIHVV..LYT.PN-EIK.E----------------CSQ----QTL---------
O73883_CHICK/5-138--ENIKN-------------------KIHLE..LYT.PT-ETQ.E----------------CTQ----QTL---------
Q8JFF4_ANAPL/4-134--GTSMN-------------------GIDLE..LYT.PN-DTK.E----------------CSW----QTL---------

PF00715

I3MQX6_SPETR/7-151NQENSTL-------------------TRMLKFKFYM-PK.KAT-------------------DL----EHL---------
G5C793_HETGA/7-149..RNPKL-------------------SKMLKPKLYF-PN.KPS-------------------EL----QHL---------
G1PJ32_MYOLU/7-147NYKNSKL-------------------PMMLTFKFYM-PR.NAT-------------------EL----KHL---------
B1AB81_HORSE/7-146NNKNPKL-------------------SKMLTFKINM-PK.KAT-------------------EL----KHL---------
G3HTL8_CRIGR/7-150NNKNPKL-------------------PMMLTFKFYM-PK.KAT-------------------EL----KHL---------
IL2_MACMU/7-151NYKNPKL-------------------TRMLTFKFYM-PK.KAT-------------------EL----KHL---------
H0Y254_OTOGA/7-149NNKNPKL-------------------SRMLTLKLYV-PK.KAT-------------------EL----KHL---------
IL2_MOUSE/7-165NYRNLKL-------------------PRMLTFKFYL-PK.QAT-------------------EL----KDL---------
G3SU90_LOXAF/7-147NYETRRL-------------------SMIFTFKFNM-PK.EVT-------------------EL----KHL---------
IL2_PIG/7-151NYENADL-------------------SRMLTFKFYM-PK.QAT-------------------EL----KHL---------
IL2_FELCA/7-151NPENPKL-------------------SRMLTFKFYV-PK.KAT-------------------EL----THL---------
L5K7D9_PTEAL/7-149NYKNHEL-------------------SSMLTFKFYM-P..NAT-------------------EL----NHL---------
IL2_BOVIN/7-152NPENLKL-------------------SRMHTFDFYV-PKVNAT-------------------EL----KHL---------
H0VBY4_CAVPO/7-149..SNPRL-------------------PKMLKLKLYP-PK.MVS-------------------EL----QHL---------

PF00103

PLRP1_BOVIN/26-238KYAQGKL......YYINVT.......KSCHTNSFHA-PE-ERDIV----------------QQT----NIE---------
CSH2_BOVIN/26-238KYAQGKL......YYINAT.......KSCHTNSFHT-PE-ERDKA----------------QQM----NNE---------
PLRP3_BOVIN/1-213KYAQNQP......YTINAT.......KSCHTNSLHT-PQ-EREKA----------------LRM----NNE---------
PR4A1_RAT/17-227FYAQGRG.......FERRT.......TRCHTSSLSS-PE-NKEQA----------------QQF----QLE---------
CSH1_BOVIN/26-236QFGEGKN.......FTSKV......INSCHTEFMTT-PN-NKEAA----------------ANT----EDE---------
PLRP4_BOVIN/26-239QYAQGKE......YFINVS.......DKCHTNSLHL-PE-DMQHN----------------PTD----EQK---------
PR3D4_RAT/16-223NFAKRSW......MKDRIL.......PLCHTASIHV-PE-NREEV----------------HEI----KTE---------
PR2C2_MOUSE/16-224HYSNVSG......LRDKSP.......MRCNTSFLPT-PE-NKEQA----------------RLT----HYS---------
SOM2_HUMAN/9-215AYILKEQK....YSFLQNPQ.....TSLCFSESIPT-PS-NRVKT----------------QQK----SNL---------
PR8A5_RAT/17-238NQFSSRQFADLSSQLIRKDETVLKAGTYCHSNRAK.-PK-SR..G----------------VNI----DIE---------
PR6A1_RAT/20-234DVLYKPG.....RWFPERD......LTACHRSPFTI-AV-SKEGT----------------QQR----LGV---------
PR7D1_MOUSE/17-240NSFSSETFNKIILDLHKSTENITKAFNSCHTVPINV-PE-TVEDV----------------RKT----SFE---------
CSH2_HUMAN/9-215TYIPKDQKY..SFLHDSQT.......SFCFSDSIPT-PS-NMEET----------------QQK----SNL---------

PF00726

IL10_BOVIN/5-174AFGKVKT-------------------FFQMKDQLHS----LLLTQ----------------SLL----------------
IL10H_EBVB9/7-167AFSRVKT-------------------FFQTKDEVDN----LLLKE----------------SLL----------------
G3HB01_CRIGR/14-174AFSQVKT-------------------FFQKKDQLDN----ILLTD----------------SLV----------------

PF14565

IL22_HUMAN/40-178-FMLAKE-------------------ASLADNNTDV----RLIGE----------------KLF----------------
E1C1U2_CHICK/46-184-YTLAEM-------------------ARLSDQDTDN----RLIGQ----------------QIY----------------

PF05337

CSF1_HUMAN/41-180TSCQITF-------------------EFVDQEQLKD----PV--------------------------------------
Q3TLQ6_MOUSE/41-180TSCQIAF-------------------EFVDQEQLDD----PV--------------------------------------
O77709_BOVIN/41-180TSCQISF-------------------EFVDQEQLDD----PV--------------------------------------
O77710_BOVIN/41-180TSCQISF-------------------EFVDQEQLDD----PV--------------------------------------
Q64129_9MURI/41-180TSCQIAF-------------------EFVDQEQLDD----PV--------------------------------------

PF15036

IL34_MOUSE/28-184QY--MKH-------------------YFPINYRIAV----PYEGV----------------LRV----------------
R4GIU3_CHICK/19-177QY--MKH-------------------NFPIDYTLRV----QHEEV----------------LRT----------------
F7EA00_CALJA/29-185QY--MYV-------------------SFKINYLLKL----XQQAM----------------FHH----------------
H0WFN4_OTOGA/28-184RY--MKH-------------------YFPINYMISV----PYEGV----------------FRI----------------
M3ZVZ0_XIPMA/24-191RY--MKH-------------------NFPINYAIRV----HHEEI----------------FKL----------------
U3JY35_FICAL/18-179QY--MKH-------------------YFPIDYTVQV----QYEEV----------------LRP----------------
L9KJY3_TUPCH/28-184QY--MKH-------------------YFPINYRIGV----PYEGV----------------LRA----------------
G3T3A6_LOXAF/28-182QY--MKY-------------------NFPINYRISV----PYEAV----------------LRV----------------
F6W3U1_MONDO/15-167RY--MKH-------------------YFPIDYRIRV----PYEGV----------------LRL----------------
I3JZ08_ORENI/24-192QY--MKH-------------------NFPIEYTIKV----HNREI----------------FRL----------------
L5MCR9_MYODS/28-182LY--MKQ-------------------YFPIGYRVSM----PYEGV----------------LRA----------------
B3DLJ8_DANRE/23-195RY--MKM-------------------HFPINYTVQV----RYEEV----------------FRL----------------
IL34_BOVIN/28-183QY--MKH-------------------YFPINYRVSV----PYEGV----------------LRT----------------

PF00714

IFNG_HORSE/15-152----LKE-------------------YF--NASNPD----VGDGG----------------PLF----------------
H0WPL1_OTOGA/15-151----LKE-------------------YF--NTSSTD----TAGGG----------------ILF----------------
Q8CGS0_CAVPO/15-154----LKN-------------------YF--NADNSD----VGDNG----------------TLF----------------
B9VS86_CALJA/15-152----LKK-------------------YF--NAGDSD----VADNG----------------TLF----------------
G3SUC6_LOXAF/15-152----LKE-------------------YL--NATDSD----VADGG----------------PLF----------------
G3GY20_CRIGR/2-135----LKK-------------------YF--NSSSED----VGNGG----------------DLV----------------
I3MNV6_SPETR/15-152----LKE-------------------YF--NASNSN----VSDGG----------------SLF----------------
L5LME8_MYODS/15-153----LKR-------------------YF--NATSSD----VGNGG----------------HLF----------------
G5BGB5_HETGA/15-152----LKD-------------------YF--NASSSD----VGDNG----------------TLF----------------
G3WQJ9_SARHA/15-153----LHN-------------------YF--NATKSD----VSDGS----------------SLF----------------
IFNG_SHEEP/15-152----LKE-------------------YF--NASNPD----VAKGG----------------PLF----------------
IFNG_RAT/14-151----LKN-------------------YF--NSSSMD----AMEGK----------------SLL----------------
IFNG_RABIT/15-152----LKA-------------------YL--KANTSD----VANGG----------------PLF----------------
L9KVU0_TUPCH/51-188----LKN-------------------YF--NATDPG----VGDTG----------------RLF----------------
IFNG_FELCA/15-153----LKG-------------------YF--NASNPD----VADGG----------------SLF----------------

PF02404

R4GD07_ANOCA/1-283----VKT-------------------QSPCGNPVTD----DVNDI----------------AKL----------------
SCF_CHICK/1-287----VKA-------------------QSSCGNPVTD----DVNDI----------------AKL----------------
SCF_RAT/1-273----VKT-------------------QEICRNPVTD----NVKDI----------------TKL----------------
G1NWC8_MYOLU/1-272----VRT-------------------TGICTNRVTD----DVKDV----------------TKL----------------
F7EP53_MONDO/1-273----VKT-------------------KGICGNPVTD----DVKEI----------------TTL----------------
F7C5I3_ORNAN/1-273----IRA-------------------QKNCGNPVTD----DVKDI----------------TKL----------------
F7G0W2_CALJA/1-273----VKT-------------------EGVCRNRVTN----NVKDV----------------TKL----------------

PF03487

G1SCQ2_RABIT/16-144---.PT.-------------------..SLKELIEE----LVNIT----------------HNQ----..K---------
IL13_HUMAN/16-144---.ST.-------------------..ALRELIEE----LVNIT----------------QNQ----..K---------
IL13_RAT/2-130---STSP-------------------PVALRELIEE----LSNIT----------------QDQ----..K---------
F7DGH7_MACMU/16-151---.ST.-------------------..ALKELIEE----LVNIT----------------QNQ----..K---------
L5M5Z7_MYODS/2-128---.LT.-------------------..VVKELIEE----LDNIT----------------Q..----..K---------
G5ASP9_HETGA/2-130---.SA.-------------------..ALRELIEE----LANVT----------------QNH----..K---------
B3GDZ5_PIG/2-130---HST.-------------------..ALKELIEE----LVNIT----------------QNQ----..K---------
L8YAP6_TUPCH/2-128---.IR.-------------------..ALKELIEE----LDNVT----------------QNQ----..K---------
IL13_BOVIN/2-130---.AT.-------------------..ALKELIEE----LVNIT----------------QNQ----..K---------
IL13_MOUSE/2-130---SVSL-------------------PLTLKELIEE----LSNIT----------------QDQ----...---------
H0W834_CAVPO/16-149---SSTV-------------------AVSIKELLGE----LVNIT----------------QDQ----..K---------
F6WQF3_ORNAN/2-128---.SKE-------------------NARLEELISY----LSSLN----------------LPN----..K---------
G3T2N9_LOXAF/2-133---.NRH-------------------IWVLRELIGE----LINIT----------------QNQ----LPQ---------
M3YGH3_MUSPF/2-126---.LT.-------------------..TTKELIEE----LANIT----------------QNQ----...---------
B5FW67_OTOGA/2-129---.LT.-------------------..KLKELIEE----LDNIT----------------QNQ----..R---------
I3MAR4_SPETR/2-131---PSP.-------------------..AFRELIEE----LVNIT----------------QDQ----..K---------
IL13_CANFA/2-129---.SP.-------------------..TLKELIEE----LVNIT----------------QNQ----...---------

PF00727

IL4_FELCA/26-131----------------------------CMELTVMD----VLAAP----------------KNT----SDK.........
H0XDE1_OTOGA/26-149----------------------------CDELTVAD----IFAAS----------------KNT----TEK.........
IL4_MOUSE/27-140----------------------------CTEMDVPN----VLTAT----------------KNT----TES.........
G3T4B8_LOXAF/26-132----------------------------CTELTVAD----AFAAP----------------KNT----TEK.........
IL4_RABIT/28-143----------------------------CTKLMIAD----ALAVP----------------KNT----TER.........
G5ASQ0_HETGA/25-138----------------------------CAELAAAD----VFAAP----------------KDT----AEK.........
F6U5N6_HORSE/26-135----------------------------CMELTVAD----AFAGP----------------KNT----DGK.........
IL4_BOVIN/26-133----------------------------CMELPVAD----VFAAP----------------KNT----TEK.........
G3QSC0_GORGO/26-149----------------------------CTELTVTD----IFAAS----------------KNT----TEK.........
A3FBF0_MUSPF/26-130----------------------------CMELTVTE----VFSAP----------------KNT----SEK.........
IL4_RAT/27-139----------------------------CTEMFVPD----VLTAT----------------RNT----TEN.........
G3WEJ0_SARHA/28-149----------------------------CSEMEVLD----IFEDT----------------KKN----SSTRKLLPEMSS
I3MAS4_SPETR/24-141----------------------------CMELMVAD----VFAVP----------------KNT----TEK.........
IL4_PIG/26-131----------------------------CMELPVTD----VFAAP----------------ENT----TEK.........

PF01109

CSF2_RAT/18-139SLLNDMR-------------------ALENEK-----------NE----------------.DV----DII---------
CSF2_MOUSE/18-136NLLD...-------------------DMPVTL-----------N.----------------EEV----EVV---------
CSF2_BOVIN/18-138SLLNHSS-------------------DTDAVM-----------N.----------------.DT----EVV---------
CSF2_CAVPO/18-140SLLNHTS-------------------DPAAVM-----------NE----------------.TV----EVV---------
CSF2_PIG/18-139SLLNNSN-------------------DTAAVM-----------NE----------------.TV----DVV---------
CSF2_HUMAN/18-139RLLNLSR-------------------DTAAEM-----------NE----------------.TV----EVI---------
CSF2_CANFA/18-139SLLNNSN-------------------DVTAVM-----------NK----------------.AV----KVV---------

PF02025

G1RQD7_NOMLE/22-133ALLSTHR-------------------TL--LI-----------AN-----------------ET----LRI---------
IL5_CAVPO/23-134TLLSTHR-------------------TL--LK-----------GN-----------------ET----LRI---------
J9NWP5_CANFA/22-132TLLSTHR-------------------TW--LI-----------GD-----------------GV----IFF---------
IL5_MOUSE/21-132TQLSAHR-------------------AL--LT-----------SN-----------------ET----MRL---------
G3WAR7_SARHA/25-134SLITAHR-------------------TL--LI-----------GN-----------------GT----LRI---------
IL5_HORSE/22-133TLLSTHR-------------------TL--LI-----------GD-----------------GN----LMI---------
B5FW65_OTOGA/22-133ALLSTHQ-------------------TL--LI-----------HN-----------------ET----LRI---------
I3MDT8_SPETR/23-134TLLSTHQ-------------------TV--LI-----------GN-----------------ET----LRI---------
G3T4B0_LOXAF/23-133ALLSTHR-------------------TL--LI-----------GD-----------------GT----PRI---------
G1SL79_RABIT/22-133TLLSTYQ-------------------SL--LI-----------GN-----------------ET----LMI---------

PF02059

IL3_CANFA/19-132EMLNKSP-------------------SPSE..-----------EP----------------LDS----NEK---------
IL3_MOUSE/27-138GKLPEPE-------------------LKTD..-----------..----------------...----DEG---------
IL3_BOVIN/18-132DDLKKIT-------------------PSPE..-----------GS----------------LNS----DEK---------
G3UC30_LOXAF/22-133EILQKSP-------------------PLNS..-----------AT----------------PSD----TEK---------
G1MH15_AILME/18-131DILNNSP-------------------SPSE..-----------ET----------------LDP----NET---------
F1RJV6_PIG/18-131RSLENLT-------------------VTSN..-----------KS----------------LTL----NE.---------
G1RQ11_NOMLE/20-137THLKQPP-------------------LPLLDF-----------NN----------------LNG----EDQ---------
IL3_CALJA/19-136TLLNQPP-------------------LASSNF-----------NN----------------LNR----EDQ---------
F1LS41_RAT/29-138VKLPYPQ-------------------VSGL..-----------..----------------NNS----DDK---------

PF07400

IL11_HUMAN/22-199SLLADTR-------------------QLAAQLRDKF----PADGD----------------HNL----DSL---------

PF00758

G3TYQ1_LOXAF/25-173PDFNPLS-------------------TPVPLPTVDF----SLGEW----------------KTQ----TEQ---------
W5K758_ASTMX/26-175KEDCSIG-------------------VPLMVPLTRV----DIGVW----------------EKK----NME---------
B1N8Y2_DANRE/15-168KDDCSIA-------------------TNVTVPLTRV----DFEVW----------------EAM----NIE---------
F7DTH0_CALJA/31-193AESCSLN-------------------ENITVPDTKV----NFYAW----------------KKM----EFG---------
M3XJ62_LATCH/27-177TEACELP-------------------VDMTLPATKV----NIKEW----------------NEM----DNK---------
G3W289_SARHA/30-190LEDCSLG-------------------ENITVPDTRV----NFHTW----------------KKM----EVG---------
F6WUU2_MONDO/31-191HPRRNIV-------------------LAFSNTSCLI----NIYFA----------------INS----NVG---------
G3VW20_SARHA/26-175SDLGPLP-------------------IPVLLPTVDF----SLREW----------------RAK----TER---------
G1PF99_MYOLU/45-207AEGCSFS-------------------ENITVPDTKV----NFYAW----------------KRM----EVE---------
TPO_CANFA/25-176PDIYPLS-------------------TPVLLPAVDF----SLGEW----------------KTQ----KEQ---------
F7G570_MONDO/26-177SDLSPLP-------------------IPVLLPTVDF----SLREW----------------RAK----TEQ---------
H0W023_CAVPO/30-191TEGCSLG-------------------ENITVPDTKV----NFCAW----------------EKM----GVG---------
H2LEX3_ORYLA/33-182REGCGLT-------------------QTVSVPQTTV----NFEDW----------------EKK----NAL---------

PF00143

G5E7E1_LOXAF/9-168...RLSP-------------------FSCLKERKDF----RF.PQ----------------EMV....DGS---------
IFNE_MOUSE/27-185...SSSV-------------------QQCLAHRKNF----LL.PQ----------------QPV....SPH---------
G3I0H8_CRIGR/26-185...RLSP-------------------LSCLKDRKDF----AF.PL----------------ENM....DAQ---------
H0VF99_CAVPO/28-187...GKPE-------------------.NCHQDRIDF----KF.PE----------------EIL....QPQ---------
L5KKJ7_PTEAL/25-192...NSFP-------------------KDCLRENKAF----EM.PQ----------------EIL....YST---------
G1U0Q8_RABIT/26-185...RVSP-------------------VLCLKDRRDF----QF.PR----------------EVV....NGS---------
F6YZB3_ORNAN/25-183...GKSL-------------------LSCLEHRKDF----QF.PR----------------AVV....EAG---------
I3MY95_SPETR/32-186...RIPT-------------------SSCLNDRKDF----AF.PQ----------------KLL....EGE---------
V8NNB8_OPHHA/15-183...PTTP-------------------LQCMRSFVEL----SL.ED----------------IGKKIMIDMN---------
C8CKA7_PIG/26-185...RISP-------------------FSCLDHRRDF----GF.PQ----------------EAL....GGN---------
H0W7G8_CAVPO/26-185...RIST-------------------FSCLKHRQDF----GL.AQ----------------LNF....DGK---------
G3GXU9_CRIGR/27-182...GPL.-------------------..CLNHRMDF----KI.PM----------------EVK....HPG---------
H0XSG1_OTOGA/26-185...RISP-------------------FSCLKDRSDF----GI.PQ----------------EKL....NGN---------
G1KX99_ANOCA/25-184STISTIP-------------------QQCFEDVFNF----S..PK----------------MYL....KNL---------
G3I0I6_CRIGR/27-185...ISSV-------------------YQCLAHRKNF----QL.PW----------------QSV....SRH---------
IFNT4_SHEEP/26-185...RLSP-------------------HSCLQDRKDF----GL.PQ----------------EMV....EGD---------
L8Y4J0_TUPCH/27-186...SSSI-------------------QQCLPHRKNF----LL.PH----------------KSV....NPQ---------
F7B527_HORSE/26-183...RIST-------------------LLCLKDRADF----RF.PQ----------------ILV....DGD---------
G1Q950_MYOLU/27-184...TSPQ-------------------.HCLDDRMDF----QI.PR----------------EVE....QPQ---------
M3WTR1_FELCA/26-186...RLSP-------------------FLCLRARKDF----RF.PR----------------EML....EGG---------
G5CB66_HETGA/27-185...GKPE-------------------.YCLKDRMDF----KF.PE----------------EIK....QPQ---------
L9L941_TUPCH/27-198...NSFP-------------------VECLRENKAF----EL.PQ----------------EIL....SST---------
D2H9N6_AILME/27-184...GTTK-------------------.DCIKDRMNF----KF.PE----------------EIE....KPQ---------
D3Z919_RAT/26-179...RQSP-------------------VSCLKDIQYF----EL.PL----------------EKV....DAQ---------
C8CKB9_PIG/24-176...RTSS-------------------QACLKDRTDF----QF.PW----------------RGG....KTT---------
A8E6F6_XENTR/27-179PL.KETE-------------------EICEEHPTDL----PN.TE----------------STY....SVS---------
L8Y906_TUPCH/26-185...TISF-------------------LSCLKDRTDF----KF.PQ----------------EQL....DGR---------
H9L1C3_CHICK/28-183...RRFP-------------------QQCLREKMSF----RF.PE----------------QVL....KPR---------
L5KWM8_PTEAL/106-263.....NS-------------------FSCWKDTKNF----RF.PL----------------EMV....DGS---------
G3WZJ8_SARHA/27-182...VFSL-------------------LPCLKDRTNF----TF.PK----------------EAM....EGS---------
G3UCD2_LOXAF/26-187...RISP-------------------SSCLKDRNDF----GF.PQ----------------EEL....EGN---------
K7GQJ6_PIG/17-164...RISP-------------------SFCLKDRKDF----GF.PQ----------------EMV....EGS---------
G3I0H3_CRIGR/26-178...RLSP-------------------FSCLKDRKDF----AS.PV----------------EKV....DAQ---------
H0VYK7_CAVPO/28-181...GKPE-------------------.HCQQDRMDF----KF.PE----------------EIK....QPR---------
I3N7K4_SPETR/33-202...NSIP-------------------VQCFREIHNF----EL.PE----------------EIL....SST---------
L5K635_PTEAL/26-185...RISS-------------------FLCQKDRKDF----RF.PR----------------KMV....DGS---------
H0W3G0_CAVPO/26-185...KMPR-------------------SLCLKDRSNF----LL.PQ----------------KMM....TSS---------
W5JYQ9_ASTMX/23-179...GAFP-------------------FRCLDDYVLV----PF.PK----------------AAF....ESN---------
G3SI98_GORGO/28-185...NSFP-------------------VECLRENIAF----EL.PQ----------------EFL....QDT---------
H0Y0D2_OTOGA/28-187...RIHP-------------------FLCLKDRRYL----GF.PQ----------------EEF....KNK---------
IFN_ANAPL/34-190...PSPT-------------------QPCPQQHAPC----SF.PD----------------TLL....DTN---------
G3UJX3_LOXAF/27-185...GAPE-------------------.SCLEDRMDF----KI.PE----------------EIK....QPG---------
G5C259_HETGA/26-185...RIST-------------------FSCLKDREDF----GL.PH----------------QEF....DGK---------
G3WZF5_SARHA/26-185...GELH-------------------PECQKDRMDF----QI.PK----------------EIL....QPK---------
IFNE_PIG/27-186...TSSI-------------------QQCLPHRKNF----LL.PQ----------------KSM....NPH---------
W5N6G4_LEPOC/27-185...GGFP-------------------VECVSQIIT.----TF.PV----------------DAF....KTA---------
H9KYA4_CALJA/26-185...RISP-------------------FSCLKDRQDF----VF.PQ----------------EVF....FGD---------
D2HTQ4_AILME/33-205...SSFP-------------------VECLRETKAF----EL.PQ----------------EIL....SHT---------
IFNB_HUMAN/27-185...GRLE-------------------.YCLKDRMNF----DI.PE----------------EIK....QLQ---------
G1NR05_MELGA/32-188...PPPP-------------------QNCPQQDVTY----PF.PE----------------TVL....ESK---------
F7BVP5_ORNAN/23-181...GQFP-------------------LHCLKERMKF----KL.PA----------------EMV....HPH---------
F7G875_MONDO/27-182...GKLH-------------------PECLQERMDF----QI.PR----------------EIV....QPR---------
C8CKC3_PIG/33-205...HSFP-------------------IECLTESKAF----EL.PQ----------------EIL....SHT---------
I3MVD7_SPETR/34-186...RIPT-------------------FSCLNYRKDF----AF.PQ----------------EQL....EGE---------
F7A317_HORSE/26-184...RISP-------------------FSCLKDRNDF----GF.PQ----------------EVF....DGN---------
G1KU56_ANOCA/28-182...SVFP-------------------LQCLNDVISF----SSQPE----------------EEN..IQSIF---------
L5KBH2_PTEAL/26-185...RISS-------------------FRCRKDRKNF----GF.LR----------------EMV....DGS---------
L5K909_PTEAL/26-185...RISP-------------------FSCLKDREDF----GF.PQ----------------EAF....SGN---------
I3N5Z0_SPETR/23-179...TSSI-------------------QQCLPYRKNF----RL.PQ----------------NSV....NFH---------
F7GHL9_MONDO/26-181...TSSL-------------------VPCLKEWTNF----SF.PK----------------EAL....DGS---------
IFNE_HUMAN/27-186...TLSI-------------------QQCLPHRKNF----LL.PQ----------------KSL....SPQ---------
I3LBU7_PIG/26-179...RISP-------------------SFCLKGRKDF----GF.PQ----------------EMV....ERS---------
G3UK87_LOXAF/27-184...R...-------------------FFCLKERKDF----RF.PR----------------.MV....YGS---------
L9LC61_TUPCH/27-185...GVPE-------------------.DCLKDRMSF----EV.PE----------------EIQ....RPQ---------
IFNB_RAT/27-182...GRLN-------------------...LSYRTDF----KI.PM----------------EVM....HPS---------
H0XMZ9_OTOGA/27-186...TSSV-------------------QQCLPHRKNF----LL.PE----------------KPV....SPQ---------
G3VDC6_SARHA/27-182...TFSL-------------------LSCLKDRTDF----KF.PE----------------EAV....EGS---------
I3JM36_ORENI/26-182....NNS-------------------TNITEVEVTV----PF.PN----------------HLY...RQVS---------
L5LKN9_MYODS/27-186...PSSI-------------------RQCLPHRKDF----LL.PQ----------------EAG....NPH---------
G1TYS8_RABIT/29-195...HSFP-------------------IECLREIKDF----EL.PQ----------------EIL....SHS---------
I3UJJ8_FELCA/27-185...SSSI-------------------QQCLPHRKNF----LL.PQ----------------RSV....NPR---------
C8CKA9_PIG/26-183...RLSI-------------------LSCLKDRTDF----RF.PR----------------TLV....DGN---------
IFNT2_BOVIN/3-162...RLSP-------------------HPCLQDRKDF----GL.PQ----------------EMV....EGN---------
H0W510_CAVPO/26-186...RISA-------------------FSCLKHRQDF----GL.AG----------------LEF....EGK---------
M3Z729_MUSPF/26-183...RVSA-------------------FSCLRDRNDF----AF.PQ----------------EVF....DGK---------
IFNA1_MOUSE/26-185...RLSP-------------------LSCLKDRKDF----GF.PQ----------------EKV....DAQ---------
G3TTC1_LOXAF/26-185...RCPT-------------------FFCLDDRKDF----RF.PQ----------------EMV....DGS---------
G1PDS6_MYOLU/29-199...KSLP-------------------LECLRENKAF----EL.PR----------------EVL....AYS---------
F7ABU5_MONDO/27-182...TSSL-------------------VPCLKDGINF----NF.PK----------------EAM....DRS---------
G1TTX4_RABIT/27-180...GTTE-------------------.DCLNERINF----KV.PK----------------EIK....EPQ---------
H0XRP5_OTOGA/26-185...RISP-------------------FSCLKDRSDF----RF.PR----------------EEM....RGK---------
H0WK94_OTOGA/33-202...NSFP-------------------RECLKENKDF----EL.PQ----------------EIL....SHT---------
G1KYL3_ANOCA/23-176...PSIS-------------------QQCIDDVFSF----S..HR----------------EAL....GNI---------
G3WZQ8_SARHA/26-181...TFFL-------------------LPCLKDRTNF----NF.PK----------------EAV....EVN---------
H2R6R8_PANTR/26-185...RISP-------------------FSCLKDRHDF----GF.PQ----------------EEF....DGN---------
H0YTY6_TAEGU/34-188...PSHT-------------------QPCHLQEPPF----.F.PD----------------TLL....HPN---------
I3MXH1_SPETR/27-185...GRPA-------------------.DCLSDRMDF----KI.PK----------------EIK....HPQ---------
M3WRV1_FELCA/26-184...RLPA-------------------SSCQKDRNDF----AF.PQ----------------DVF....GGD---------
H0W4H8_CAVPO/23-182...TSLV-------------------QQCLLHKKSF----LI.PQ----------------KSV....GSK---------
R4GKJ6_CHICK/35-191...PTLP-------------------QLCPQHNASC----SF.ND----------------TIL....DTS---------
A3FBE8_MUSPF/27-184...GTSK-------------------.DCLKDRMNF----KI.PE----------------EIQ....KSQ---------
G1KWE0_ANOCA/28-180...STIP-------------------QQCIEDVFSF----S..PK----------------EDL....RNL---------
G7PS89_MACFA/26-185...RISP-------------------FSCLKDRHDF----EL.PQ----------------EEF....DDK---------
G1Q880_MYOLU/26-185...TISP-------------------FFCLKDRKDF----RF.PR----------------ATV....DGS---------
IFNB_MOUSE/27-180...GKIN-------------------...LTYRADF----KI.PM----------------EMT......E---------
IFNB2_BOVIN/27-184...STPQ-------------------.HCLEARMDF----QM.PE----------------EMK....QAQ---------
G1SJC4_RABIT/26-185...RVSP-------------------LSCLQDRHDF----EC.PL----------------EEL....GGH---------
W5PG31_SHEEP/26-185...RVSP-------------------SSCLQDRKDF----AF.PQ----------------EAL....GGS---------
IFNA3_CANFA/26-183...RLSA-------------------SSCDHYTTDF----AF.PK----------------ELF....DGQ---------
G5BPX2_HETGA/27-199...NPLP-------------------LRCLREIKAF----GL.PQ----------------NIL....SYS---------
IFNW2_HORSE/26-185...RISS-------------------AICLKDRKDF----RF.PQ----------------DMA....DGR---------
G3N2A8_BOVIN/26-185...RLSS-------------------RFCLQDRKDF----TF.PQ----------------EMV....EGS---------
H0XKS8_OTOGA/27-185...GKPE-------------------.GCLKDRMNF----EI.PK----------------EIK....QPQ---------
H0VUV7_CAVPO/26-185...RTFT-------------------FSCLKHRQDF----GL.AL----------------LDF....DGK---------
Q29412_PIG/27-184...GTPQ-------------------.YCLEDRMNF----EV.PE----------------EIM....QPP---------
G7PS88_MACFA/26-185...RISP-------------------SSCLMDRHDF----GF.PQ----------------QEF....DGN---------
M3WZS7_FELCA/26-181...RVSI-------------------LSCLKDRTDF----NF.PQ----------------ILV....AGN---------
H9GZR7_HORSE/26-185...TISP-------------------PSCLKHRTDF----KF.PQ----------------EQL....DGR---------
F1LVL8_RAT/26-184...SSSV-------------------QLCLAHRKNF----LL.PQ----------------QSV....SPH---------
M3YX13_MUSPF/27-179...KSSV-------------------QPCLPHRTNF----LL.SQ----------------QSV....NRR---------
G1L8G2_AILME/26-185...RISI-------------------LSCLKDRTDF----SF.PQ----------------MLV....DGS---------
IFNB_HORSE/27-184...GAPQ-------------------.RCPEDTMNF----QV.PE----------------EIE....QAQ---------
H0W289_CAVPO/26-190...RIST-------------------FLCLKDRRDF----RF.PK----------------EMM....TGN---------
A8E6E8_MONDO/27-182...TFSL-------------------VPCLKDRTSF----NL.PK----------------EAL....EDN---------
I3N788_SPETR/27-185...GRPE-------------------.DCLSDRMDF----KI.PK----------------EIK....HPQ---------
G1L8I1_AILME/26-183...RMTA-------------------FSCLKDRNDF----AF.PK----------------EVV....DGK---------
IFNB_FELCA/27-184...RTSK-------------------.YCLKDRMNF----EV.PE----------------EIK....KSQ---------
H0VXI5_CAVPO/26-181...RIST-------------------FSCLKDRQGF----DL...----------------..F....DGK---------
G3TS29_LOXAF/26-179...RISL-------------------LSCLKDRTDF----RF.PQ----------------ILM....DMN---------
W5PZ39_SHEEP/26-184...NSFP-------------------IECLQERKAF----EL.PQ----------------EIL....SYT---------
G3I0H6_CRIGR/26-178...RLSP-------------------FSCLKDRKVF----AS.PV----------------EKV....DAQ---------
I3L756_PIG/26-180...RLSP-------------------SFCLKDRKDF----GF.PQ----------------EMV....EGS---------
M3Z715_MUSPF/26-183...RISL-------------------IFCDKYINDF----AF.PK----------------KVF....HSK---------
M3VXI8_FELCA/33-205...NSFP-------------------VECLRESRAF----EL.PQ----------------DIQ....SHT---------
G3R8Q7_GORGO/26-185...RISP-------------------FLCLKDRRDF----RF.PQ----------------EMV....KGS---------
A8E6F5_XENTR/51-202PP.EDYD-------------------ESCQYDSIEL----PN.ID----------------EIY....SIS---------

PF02947

FLT3L_MOUSE/30-162---KDYP-------------------VTVAVNLQD.----.....----------------.........E---------
F6T7S9_ORNAN/28-157---QDYP-------------------VSVVTNLQT.----.....----------------.........D---------
H9GP84_ANOCA/29-165---LDYP-------------------VPVPVNLKQ.----.....----------------.........D---------
F6TPW7_MONDO/34-163---TDYP-------------------VEVPDNLQ..----.....----------------.........D---------
G5B8P0_HETGA/20-150---KDYP-------------------VTVAANLQD.----.....----------------.........E---------
G1M637_AILME/29-159---QDYP-------------------VTVASNLQD.----.....----------------.........D---------
L9JA37_TUPCH/769-910---LDYP-------------------VTMASNLQDP----GTGPP----------------RLQRAWSPQE---------
G3VSA3_SARHA/79-209---GDYP-------------------VDVPENLRV.----.....----------------.........D---------
G1QZC3_NOMLE/30-160---QDYP-------------------VTVASNLQD.----.....----------------.........E---------

PF00489

IL6_BOVIN/27-208---ESSK-------------------ETLAENKLNL----PKMEE----------------KDG----CFQ---------
M3X721_FELCA/27-208---EDSK-------------------EALAENNLNL----PKLAE----------------KDG----CFQ---------
IL6_HORSE/27-208---ENSK-------------------EVLAENNLNL----PKMAE----------------KDG----CFQ---------
G3UHF3_LOXAF/20-205---ENSR-------------------EALAGNNLKL----PQMTE----------------EDG----CFH---------
L5KPK4_PTEAL/20-202---KNSK-------------------EVLTENNLNL----PKMAE----------------KDG----CFQ---------
F7HV62_CALJA/27-212---ESSK-------------------EALAENNLNL----PKMAE----------------KDG----CFQ---------
IL6_MOUSE/26-210---MNND-------------------DALAENNLKL----PEIQR----------------NDG----CYQ---------

PF16647

CSF3_BOVIN/42-190---HPEE-------------------LMLLRHSLGI----PQ-AP----------------LSS----CSS---------
CSF3_HUMAN/51-202---HPEE-------------------LVLLGHSLGI----PW-AP----------------LSS----CPS---------
CSF3_MOUSE/57-205---HPEE-------------------LVLLGHSLGI----PK-AS----------------LSG----CSS---------

PF06875

Q5BNQ4_9SALA/2-215---DPDY-------------------QLPHIKVVNL----PTAAMD----------YDTFIRQT----DET---------
Q5BNQ2_9SALA/2-215---DPDY-------------------QLPHIKVANL----PTAAMD----------YDTFMKQT----DET---------

PF01110

CNTF_CHICK/1-194-----DA-------------------SISVAAVDGV----PTAAV------------ERWAEQT----GTQ---------
G3VWZ5_SARHA/1-195-----NK-------------------DVDLDSMDGV----PTAST------------DRWSELT----EAE---------
E1BFH9_BOVIN/1-193-----NG-------------------NMNLDTLEGV----PTASS------------SRWSELT----EAE---------
G5AP46_HETGA/1-192-----SE-------------------NVSLDAVGGV----PAASI------------AQWSELT----EAE---------
H0Z9U1_TAEGU/1-188-----DA-------------------SASVAAMEGV----PLAAV------------ERWDEQT----GTQ---------
CNTF_HUMAN/1-194-----NK-------------------NINLDSADGM----PVAST------------DQWSELT----EAE---------

PF01291

LIF_MOUSE/44-203---NNVE-------------------KLCAPNMTDF----PSFHG----------------NGT----EKT---------
LIF_BOVIN/43-202---NNLD-------------------KLCSPNVTDF----PPFHA----------------NGT----EKA---------
ONCM_HUMAN/37-209---.KLR-------------------EHCRERPGAF----P.SEE----------------TLR----GLG---------
ONCM_MOUSE/34-194---.DLR-------------------AACTQHSVAF----P.SED----------------TLR----QLS---------
ONCM_BOVIN/34-194---.VLQ-------------------EHCRERPGDF----P.SED----------------ALW----RLS---------

PF03039

IL12A_MOUSE/6-215---DITR-------------------DQTSTLKTCL----PLELHK.NESCLATRETSSTTRGS----CLP---------
G3VQT1_SARHA/40-247---DITE-------------------..SNTGRVCL----PPELIKKNFISNPTGKIFIINNGS----CLD---------
F6T5A8_MONDO/5-202---DITK-------------------GRSDTVRACL----PPEFIK...............NGS----CLV---------
IL12A_PIG/6-222---DITK-------------------DKTSTVEACL----PLELAT.NESCLAARETSLITNGN----CLT---------
L8YEA2_TUPCH/1-213---DITK-------------------DKTSTVKACL----PLELIT.NESCLASRETSFKTNGS----CLA---------
H0X861_OTOGA/6-217---DITK-------------------DKTSTVRACI----PLELTK.NESCLASRETSFIPNGK----CLT---------
G1QWH2_NOMLE/40-254---DITK-------------------DKTSTVEACL----PLELTK.NESCLNSRETSFITCQR----MLS---------
I3MN91_SPETR/4-220---DITK-------------------NRTNTVKACL----PQELAQ.NENCLASRETSFIIKGS----SLT---------
Q924V6_CAVPO/6-221---DITK-------------------DKTSTVKACV----PLELVK.NESCLASGHISFTTNGS----CLA---------

PF02024

H3AP27_LATCH/26-169----ITR-------------------IQQHPNQFLL----PLNLK---------------VSGL----EFI---------
G3WWV6_SARHA/23-167----ITR-------------------INDISHMYSI----SAKQR---------------VTGL----DFI---------
F6PLK2_ORNAN/23-167----ITR-------------------IIQLSNRNGV----STDQR---------------VSGL----DFI---------
F7HGW1_CALJA/23-167----IAR-------------------INDLSHTQSV----SPRQR---------------VTGL----EFI---------
G5BHA4_HETGA/23-167----VSR-------------------INDISHMQSV----SSKHK---------------VTGL----DFI---------
W5NER9_LEPOC/28-172----VIR-------------------IQKHTNESKM----SPNLV---------------FSGL----ELI---------
H0V7C6_CAVPO/23-165----INR-------------------IRNISHLQSV----SSKHK---------------VTGF----DFI---------
LEP_HUMAN/23-167----VTR-------------------INDISHTQSV----SSKQK---------------VTGL----DFI---------

PF02372

IL15_PIG/33-160-----------KCFLLELRVI---------LQES..RNSDISDT----------VENLIILANS--------S-LSS..I
IL15_CAVPO/33-160-----------KCFLLELRVI---------LHES..RNEDIHET----------ITNLIILANS--------S-LNS..N
IL15_FELCA/33-160-----------KCFLLELHVI---------SLES..KNETIHQT----------VENIIILANS--------G-LSS..N
IL15_SHEEP/33-160-----------QCFLLELRVI---------LHES..KNAAIYEI----------IENLTMLADR--------N-LSS..I
F1NZN5_CHICK/55-183-----------RCFFLEMNVI---------LHECGIKKCSRKHD----------VRNILKNGNA--------R-FATYQL
G1NDP6_MELGA/5-137-----------QCYLEEM.VM---------LEKEIEDEPEIKNE----------FKNALQNIKK--------N-LHRLKD
O73883_CHICK/5-138-----------QCYLGEV.VT---------LKKETEDDTEIKEE----------FVTAIQNIEK--------N-LKSLTG
Q8JFF4_ANAPL/4-134-----------QCYLKEI.VT---------LEEEIEDEDEIEDE----------KVSSVRNIKM--------N-LQKLMD

PF00715

I3MQX6_SPETR/7-151-----------QCLEEELKPL-----------QEVLNVPQSKNF----------HLKDTRNFIS--------N-INVTVL
G5C793_HETGA/7-149-----------QCLEEELKPL-----------EQVLNLAEHKHF----------PLINTKDFIS--------N-INVTVW
G1PJ32_MYOLU/7-147-----------QCLVDELKPL-----------EEVLKLEKS...----------.LSNITELMS--------N-VNVLVQ
B1AB81_HORSE/7-146-----------QCLEEELKPL-----------EEML.....KNF----------LSKDIKELMS--------N-INVTVL
G3HTL8_CRIGR/7-150-----------QCLEEELGAL-----------QSVLDLAQSKSF----------QLEDTENFIS--------N-IRVTVV
IL2_MACMU/7-151-----------QCLEEELKPL-----------EEVLNLAQSKNF----------HLRDTKDLIS--------N-INVIVL
H0Y254_OTOGA/7-149-----------QCLEEELGPL-----------EKVLDLGQSKNF----------HLGDTREVIG--------N-INVTVL
IL2_MOUSE/7-165-----------QCLEDELGPL-----------RHVLDLTQSKSF----------QLEDAENFIS--------N-IRVTVV
G3SU90_LOXAF/7-147-----------QCLVDELKPL-----------EDVLNVAPSK..----------..QNTRELIS--------N-INVTAL
IL2_PIG/7-151-----------QCLVEELKAL-----------EGVLNLGQSKNS----------DSANIKESMN--------N-INVTVL
IL2_FELCA/7-151-----------QCLVEELKPL-----------EEVLYLAQSKNF----------HLNHIKELMS--------N-INVTVL
L5K7D9_PTEAL/7-149-----------QCLVDELKPL-----------EEVLTIAQSKNS----------H.SDIKESVS--------N-INVTAQ
IL2_BOVIN/7-152-----------KCLLEELKLL-----------EEVLNLAPSKNL----------NPREIKDSMD--------N-IKRIVL
H0VBY4_CAVPO/7-149-----------QCLEEELRAV-----------EQVLNLAEHKNF----------PLIHTKDFIS--------N-INVTVL

PF00103

PLRP1_BOVIN/26-238-----------DLSKWTLVLLYSWNNPLHHLVTELQHMKELSNA----------FLSSATRFEN--------M-SEKLQA
CSH2_BOVIN/26-238-----------DLSKWTLVLLYSWNNPLYYLLLELRNMKNLSEA----------VISSAMEIEN--------M-SEKLQA
PLRP3_BOVIN/1-213-----------DLSKWILMLLYSWHRPLYLLVKDLQSMKEVSDT----------ILSSAKENMR--------K-IEELQA
PR4A1_RAT/17-227-----------VLLGLSHSLLQAWLNPLHHLWAEMCDRLGSTPP----------TLYKALMLKE--------S-NIKLLD
CSH1_BOVIN/26-236-----------ALLRLVISLLHSWDEPLHQAVTELLHRNGASPD----------ILARAKEIED--------K-TKVLLE
PLRP4_BOVIN/26-239-----------GLIMWILMLLYSWQRPLYQLVTDLRSMKEVSNT----------ILSSARENVK--------K-LKELQA
PR3D4_RAT/16-223-----------DLLRSIINISVSWKEPLKHFVSAVTDLPGASAS----------MRKKAVDMKD--------K-NLIILE
PR2C2_MOUSE/16-224-----------ALLKSGAMILDAWESPLDDLVSELSTIKNVPDI----------IISKATDIKK--------K-INAVRN
SOM2_HUMAN/9-215-----------ELLRISLLLIQSWLEPVQLLR....SVFANSLV----------YGASDSNVYR--------H-LKDLEE
PR8A5_RAT/17-238-----------EYLKMSINFCGFMDQPLFHLVIELSAMEGVPET----------ILSKAKDLEE--------N-NRQLLD
PR6A1_RAT/20-234-----------FLVKEMIGMLETWTFSLYHIANEMSHMEEPPDE----------IISRAKNIEE--------K-IKELMD
PR7D1_MOUSE/17-240-----------EFLKMVLHMLLAWKEPLKHLVTELSALPECPYR----------ILSKAEAIEA--------K-NKDLLE
CSH2_HUMAN/9-215-----------ELLRISLLLIESWLEPVRFLR....SMFANNLV----------YDTSDSDDYH--------L-LKDLEE

PF00726

IL10_BOVIN/5-174-----------DDFKGY------LGCQALSEMIQFYLEEVM-PQAENHGPDIKEHVNSLGEK------------LKTLRL
IL10H_EBVB9/7-167-----------EDFKGY------LGCQALSEMIQFYLEEVM-PQAENQDPEAKDHVNSLGEN------------LKTLRL
G3HB01_CRIGR/14-174-----------QDFEGY------LGCQTLSEMIQFYLVEVM-PQAENHGPEIKEHLNSLGEK------------LKTLRR

PF14565

IL22_HUMAN/40-178-----------HGVSMS------ERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLA----------------RLSN
E1C1U2_CHICK/46-184-----------VNIREN------NRCYMMKRITEIIVKDVLLTEAKERYPYAEDVAQFLA----------------SLTS

PF05337

CSF1_HUMAN/41-180-------------------------CYLKKAF--LLVQDIM-EDTMRFRDNTPNAIAIVQ--------------LQELSL
Q3TLQ6_MOUSE/41-180-------------------------CYLKKAF--FLVQDII-DETMRFKDNTPNANATER--------------LQELSN
O77709_BOVIN/41-180-------------------------CYLKKAF--LLVQDIM-EDTMRFKDNTPNAKVIVQ--------------LQELSL
O77710_BOVIN/41-180-------------------------CYLKKAF--LLVQDIM-EDTMRFKDNTPNAKVIVQ--------------LQELSL
Q64129_9MURI/41-180-------------------------CYLKKAF--FLVQDII-DETMRFKDNTPNRNATER--------------LQELSN

PF15036

IL34_MOUSE/28-184-----------ANITRL......QKAHVSERELRYLWVLVSLNATESVMDVLLEGHPS.WKY------------LQEVQT
R4GIU3_CHICK/19-177-----------ANVTRL......RDGKVSEASLRYLWFHACSQAVLHILEVLPEKHPS.RGY------------TQELSQ
F7EA00_CALJA/29-185-----------TQLDVL......QRARVSERELRYLWVLVSLSATESVQDVLLEGHPS.WKY------------LQEVQT
H0WFN4_OTOGA/28-184-----------ANITKL......HRARVSERELRYLWVLVSLSATESVQDVLLEGHPS.WSY------------LQEVQR
M3ZVZ0_XIPMA/24-191-----------SNISKMKLKVEGLDELV....LQRLWFQVNQGVLKKIIRVLPERHPS.RPY------------TAELER
U3JY35_FICAL/18-179-----------SNITRL......RNGTVSEAALRYLWFHVSSQAVLRIREVLPEKHPS.WKY------------TQELCQ
L9KJY3_TUPCH/28-184-----------ANITRL......RRARMSERELRYLWVLVSLSAAESVQDVLLEGHPS.WQY------------LQDVQT
G3T3A6_LOXAF/28-182-----------ANITRL......QRAQVSEQELRYLWVLVSLSATESVQDVLLKNHPS.WKY------------LDEVQT
F6W3U1_MONDO/15-167-----------ANITRL......QQAEVSQPNLRYLWAALNCNTMEIIQNVLLEDHPS.RNY------------IKEIHE
I3JZ08_ORENI/24-192-----------SNISRMRLRTEGLNELV....LQRLWFQVYQGVLKKILWVLPTRHPS.RPY------------TAELER
L5MCR9_MYODS/28-182-----------ANVTRL......QRARVSQQELRHLWVSVSLGATEAVQGVLLEGHPS.WKY------------LKDIHS
B3DLJ8_DANRE/23-195-----------RNISRL.VNTSNEEEPVLPRDLQDLWLYVSQQGIKKVLRVLPERHPTRRKY------------LSDLEN
IL34_BOVIN/28-183-----------ANVTRL......QRAQVSQQELRYLWVLVSLSATEWVQEVLLEGHPS.WKY------------LEEVHT

PF00714

IFNG_HORSE/15-152-----------LDILKNWKE.DSDKKIIQSQIVSFYF---------KLFENLK.DNQVIQKS------------MDTIKE
H0WPL1_OTOGA/15-151-----------LDILKNWEK.ESD.KIIQSQIVSFYF---------KLFEQHK.DNQTIKKS------------IETIKE
Q8CGS0_CAVPO/15-154-----------VGILKNCQE.ESERKIFQSQIVSFYF---------KLFEKHFTDNQTVQNS------------MNTIKE
B9VS86_CALJA/15-152-----------LDILRTWRE.EGDRKIMQSQIISFYF---------KLFKNFK.DNQSIQKS------------METIKE
G3SUC6_LOXAF/15-152-----------IDILKNWKE.DSDKKIIQSQIVSFYL---------KIFDNLK.DNQVIQES------------VKTLEE
G3GY20_CRIGR/2-135-----------FNTLMNWQK.DGDTKIIQSQIVSFYF---------KLFEALK.DNQAIQRS------------IDTIKA
I3MNV6_SPETR/15-152-----------LDILDRWEE.ESDKKVIQSQIVSFYF---------KLFEHLT.DNKIIQGS------------INTIRE
L5LME8_MYODS/15-153-----------LDILMNWKG.ESDIKIIQSQIISFYF---------KLFENIE.DNKTIQNS------------LDIIKE
G5BGB5_HETGA/15-152-----------VGILKNCQE.ESDKKIFQSQIVSFYF---------KLFEKSG.GNQIVQKS------------MDTIKE
G3WQJ9_SARHA/15-153-----------MDMMKTWKEGNCDKKILMSHVVAVYF---------KIFEIFK.NNSIVKRS------------MEHIRE
IFNG_SHEEP/15-152-----------SEILKNWKE.ESDKKIIQSQIVSFYF---------KLFENLK.DNQVIQRS------------MDIIKQ
IFNG_RAT/14-151-----------LDIWRNWQK.DGNTKILESQIISFYL---------RLFEVLK.DNQAISNN------------ISVIES
IFNG_RABIT/15-152-----------LNILRNWKE.ESDNKIIQSQIVSFYF---------KLFDNLK.DHEVIKKS------------MESIKE
L9KVU0_TUPCH/51-188-----------VDILKNWTE.ESDKKIFQSQIVSFYF---------KLFESFK.DNQVIKKS------------VDIIKE
IFNG_FELCA/15-153-----------VDILKNWKE.ESDKTIIQSQIVSFYL---------KMFENLKDDDQRIQRS------------MDTIKE

PF02404

R4GD07_ANOCA/1-283-----------VGNLPNDYMIALKYVRKMDTLPNHCWLHLMVPELSKSLSNLLNKFTEFSDMPDVLSNYSIINNLRRIIN
SCF_CHICK/1-287-----------VGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIIN
SCF_RAT/1-273-----------VANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEG...LSNYSIIDKLGKIVD
G1NWC8_MYOLU/1-272-----------VANLPKDYKIGLKYVPGMDVLPSHCWISKMVEQLSVSLTDLLDKFSNISEG...LSNYSIIDKLVKIVD
F7EP53_MONDO/1-273-----------VANLPNDYMIPLKYVPDMELLPNHCWLHLMVPELARSLNNLLDKFSKISSS...LSNYSIIDKLIKIID
F7C5I3_ORNAN/1-273-----------VGNLPNDYMIALKYVPEMDGLPNHCWLHLMVPELAKSLNNLLQKFSEISES...LSNYSIINNLTRIID
F7G0W2_CALJA/1-273-----------VANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSSSLTDLLDKFSNISEG...LSNYSIIDKLVNIVD

PF03487

G1SCQ2_RABIT/16-144-----------APLCNGTMV-WSVNLTGSV.Y-CAALESLVNVS----------GCNAIQRTQR........M-LSGLCT
IL13_HUMAN/16-144-----------APLCNGSMV-WSINLTAGM.Y-CAALESLINVS----------GCSAIEKTQR........M-LSGFCP
IL13_RAT/2-130-----------TSLCNSSMV-WSVDLTAGG.F-CAALESLTNIS----------SCNAIHRTQR........I-LNGLCN
F7DGH7_MACMU/16-151-----------APLCNGSMV-WSINLTAGV..-.......VRTF----------SLGTSVRTERDSPWKAPGL-CGPFCP
L5M5Z7_MYODS/2-128-----------APLCNGSMV-WSVNLTAGS.Y-CAAFESLMNVS----------DCPAIQRTQR........M-LSALCP
G5ASP9_HETGA/2-130-----------TPLCSGSMV-WSVNLTAGVWY-CAARESLINVS----------SCSALQRTQK........I-LSSLCQ
B3GDZ5_PIG/2-130-----------TPLCNGSMV-WSVNLTTSM.Y-CAALESLINIS----------DCSAIQKTQR........M-LSALCS
L8YAP6_TUPCH/2-128-----------AQLCNGSMV-WSVNLTTDV.C-CVALESLTNVS----------GCSTLQRTLR........L-LNGLCT
IL13_BOVIN/2-130-----------VPLCNGSMV-WSLNLTSSM.Y-CAALDSLISIS----------NCSVIQRTKR........M-LNALCP
IL13_MOUSE/2-130-----------TPLCNGSMV-WSVDLAAGG.F-CVALDSLTNIS----------NCNAIYRTQR........I-LHGLCN
H0W834_CAVPO/16-149-----------TPLCNSSMV-WSVNLTAGLWY-CAARESLINVS----------NCSALQRTQK........I-LSGLCQ
F6WQF3_ORNAN/2-128-----------QSLCNGSMV-WKVNFDWEKAQ-KEAESQRNNIS----------DCETIQDILR........I-MQR..P
G3T2N9_LOXAF/2-133-----------ASLCNGSMV-WNVNLTTNV.Y-CAAMEALSNVS----------DCRAIEKTKR........N-LSGACE
M3YGH3_MUSPF/2-126-----------ASLCNGSMV-WSVNRTTSM.Y-CAALESLTSVS----------NCSAIHRTQR........L-LKSLCH
B5FW67_OTOGA/2-129-----------APLCNGSMV-WSVNLTTDI.Y-CAALESLINVS----------SCSAIQRTQR........I-LGGLCK
I3MAR4_SPETR/2-131-----------APLCNGSMV-WSVNLTAGE.Y-CAALDSLIKVS----------NCSAIQKTQR........M-LSGLCT
IL13_CANFA/2-129-----------ASLCNGSMV-WSVNLTAGM.Y-CAALESLINVS----------DCSAIQRTQR........M-LKALCS

PF00727

IL4_FELCA/26-131...........EIFCRATTVLRQIYTHHN....CST........----------......K-----------F-LKGLDR
H0XDE1_OTOGA/26-149...........EIFCRAATVLRQVYSHHQKEP.CRGATERQQLY----------RHQQVIR-----------F-LKGLDR
IL4_MOUSE/27-140...........ELVCRASKVLRIFYLKHGKTP.CLK........----------KNSSVLM-----------E-LQRLFR
G3T4B8_LOXAF/26-132...........ETFCRATTVLWQVSKRHE....CFT........----------......K-----------Y-LRGLSR
IL4_RABIT/28-143...........EAVCRAATALRQFYLHHKVSW.CFK......EH----------GELGDLR-----------L-LRGLDR
G5ASQ0_HETGA/25-138.............LCQAVTVLHRTSYLGVGLS.CLN......RH----------RESVFLV-----------L-LKKVYR
F6U5N6_HORSE/26-135...........E.ICRAAKVLQQLYKRHDRS..LIK........----------......E-----------C-LSGLDR
IL4_BOVIN/26-133...........ETFCRVGIELRRIYRSHT....CLN........----------......K-----------F-LGGLDR
G3QSC0_GORGO/26-149...........ETFCRAATVLRQFYSHHEKDTRCLGATA.QQFH----------RHKQLIR-----------F-LKRLDR
A3FBF0_MUSPF/26-130...........EIFCRAATVLQQLSTHN.....CSN........----------......R-----------L-LRGLHR
IL4_RAT/27-139...........ELICRASRVLRKFYFPRDVPP.CLK........----------NKSGVLG-----------E-LRKLCR
G3WEJ0_SARHA/28-149CSQLAMTVNDFETLCRAVTVLQQASNS......CPR........----------......Q-----------E-LKKMCR
I3MAS4_SPETR/24-141...........EILCRATTVLRQTYQDHPVSR.CLN......KN----------GKLDILK-----------L-LRGLYR
IL4_PIG/26-131...........ETFCRASTVLRHIYRHHT....CMK........----------......S-----------L-LSGLDR

PF01109

CSF2_RAT/18-139-----------SNEFSI-------------QR-PTCVQTRLK--------------LYKQGLRG--------N-LTKLNG
CSF2_MOUSE/18-136-----------SNEFSF-------------KK-LTCVQTRLK--------------IFEQGLRG--------N-FTKLKG
CSF2_BOVIN/18-138-----------SEKFDS-------------QE-PTCLQTRLK--------------LYKNGLQG--------S-LTSLMG
CSF2_CAVPO/18-140-----------YDQFEP-------------QE-PTCLQTRLA--------------LFMKGLRG--------N-LTRLEG
CSF2_PIG/18-139-----------CEMFDP-------------QE-PTCVQTRLN--------------LYKQGLRG--------S-LTRLKS
CSF2_HUMAN/18-139-----------SEMFDL-------------QE-PTCLQTRLE--------------LYKQGLRG--------S-LTKLKG
CSF2_CANFA/18-139-----------SEVFDP-------------EG-PTCLETRLQ--------------LYKEGLQG--------S-LTSLKN

PF02025

G1RQD7_NOMLE/22-133-----------PVPVHK-------------NH-QLCTEEIFQGI----------GTLESQTVQG--------GTVERLFK
IL5_CAVPO/23-134-----------SVPAHK-------------NH-QLCIEEIFQGI----------DTLKNQTTQG--------EALATLFQ
J9NWP5_CANFA/22-132-----------LIPTVF-------------KH-QLCIKEVFQGI----------DTLKNQTAHG--------EAVDKLFQ
IL5_MOUSE/21-132-----------PVPTHK-------------NH-QLCIGEIFQGL----------DILKNQTVRG--------GTVEMLFQ
G3WAR7_SARHA/25-134-----------SIPDPK-------------NH-PLCIEEIFQGI----------ETLKNQTAED--------NVVERIFQ
IL5_HORSE/22-133-----------PTPEHK-------------NH-QLCIEEVFQGI----------DTLKNQTVQG--------DAVAKLFQ
B5FW65_OTOGA/22-133-----------PVPVHK-------------NH-QLCTEEIFHGL----------DTLRNQTAHE--------DGVEQLFQ
I3MDT8_SPETR/23-134-----------PVPAHK-------------NH-QLCIEEIFQGI----------DTLKNQTTQG--------DAVERLFQ
G3T4B0_LOXAF/23-133-----------LTPVHE-------------NH-QLCTEEIFQGI----------DTLKNQTVQD--------DAVGKLFK
G1SL79_RABIT/22-133-----------PVPVHK-------------NH-HLCIEETFRGV----------DTLKAQIVQG--------EAMDNLFQ

PF02059

IL3_CANFA/19-132-----------ETLLED-------------TL-LRPNLDVFL--------------NASSKF.H--------KNGLLIWN
IL3_MOUSE/27-138-----------PSLRNK-------------SF-RRVNLSKFV--------------ESQGEVDP--------EDRYVIKS
IL3_BOVIN/18-132-----------NFLTKE-------------SL-LQANLKVFM--------------TFATDT.F--------GSDSKIMK
G3UC30_LOXAF/22-133-----------TILRDR-------------AS-LKPNLDAFL--------------KATENFKE--------KGGSSISK
G1MH15_AILME/18-131-----------STLLNT-------------TL-LRPNLEAFL--------------NATKNF.Y--------NSESLIWK
F1RJV6_PIG/18-131-----------.LETNN-------------TL-LRPNLEAFV--------------TFAENH.L--------KNISGIKK
G1RQ11_NOMLE/20-137-----------DILMEN-------------NL-RRPNLEAFN--------------KAVKSL..--------QNASAIES
IL3_CALJA/19-136-----------RILMKP-------------NL-RKPNLEAFQ--------------KAVKSL..--------QNAAAIES
F1LS41_RAT/29-138-----------ANLRNS-------------TL-RRVNLDEFL--------------KSQEEFDS--------QDTMDIKS

PF07400

IL11_HUMAN/22-199-----------PTLAMSAGALGALQLPGVLTR-LRADLLSYL-R----------HVQWLRRAGG--------SSLKTLEP

PF00758

G3TYQ1_LOXAF/25-173-----------NKAQDVLGAVTLLLEGVMAAR-RQVGPTCLSSL----------LEQL..SGQV--------RLL..LGA
W5K758_ASTMX/26-175-----------EQAQEVQTGLWLLNRAFISLH-TSISNSA....----------.LHSHIDASV--------RNIASIGQ
B1N8Y2_DANRE/15-168-----------EQAQEVQSGLHMLNEAIGSLQ-ISNQTEV....----------.LQSHIDASI--------RNIASIRQ
F7DTH0_CALJA/31-193-----------QQAVDIWQGLTLLSEAVLRGQ-ALLANSSQPRE----------PLQLHMDRAV--------SGLRSLTT
M3XJ62_LATCH/27-177-----------IKEREIWAGINLFTHTFKTVR-DFIRDSV....----------.TVYHITKSY--------SNTRSTAQ
G3W289_SARHA/30-190-----------QKAGEVWQGLTLLSEAVLKGQ-ALLANSSQTPV----------ALKLFVDKAV--------SSLRSLRF
F6WUU2_MONDO/31-191-----------QKAGEVWQGLTLLSEAVLKGQ-ALLANSSQTPA----------ALKLFVDKAV--------SSLRSLRF
G3VW20_SARHA/26-175-----------FKCTQLSPTRNSLTKG....G-GSPLPAWEAAL----------VLSLCRSGWA--------GDM..ISG
G1PF99_MYOLU/45-207-----------QQALEVWQGLALLSEAILRGQ-ALLANSSQTSE----------TLQLHVDKAI--------SGLRSLTS
TPO_CANFA/25-176-----------TKAQDVWGAVALLLDGVLAAR-GQLGPSCLSSL----------LGQL..SGQV--------RLL..LGA
F7G570_MONDO/26-177-----------TKGQEVLGAVTLLLEGAIAAR-GQLNPSCLSSL----------LGQL..SAQT--------HSL..LGA
H0W023_CAVPO/30-191-----------QQAAEVWQGLVLLSEAMLQGQ-ALLANSSQQSE----------TLQLHLDKAV--------SGLRSLTS
H2LEX3_ORYLA/33-182-----------EQAEEVQTGLWLLQQALGSFG-PSVTNTA....----------.LNNHIDNTA--------RNLVSINA

PF00143

G5E7E1_LOXAF/9-168-----------QL.QKAQ.VISVLHEMLQQIF-NLFHTK.DSSA----------AW.NTTLLDQ--------L-HSGLYL
IFNE_MOUSE/27-185-----------QY.QEGQ.VLAVVHEILQQIF-TLLQTH.GTMG----------IW.EENHIEK--------V-LAALHR
G3I0H8_CRIGR/26-185-----------HI.QKAQ.AIPILQELIQQVL-ILFSSK.DSSA----------TW.ETTLLDT--------F-CTGLHQ
H0VF99_CAVPO/28-187-----------QF.QKEK.AALVIQEMLQNVL-GIFRKN.ISTT----------VW.NETIVEN--------L-TDELHQ
L5KKJ7_PTEAL/25-192-----------QL.LKRD.IKEAFYEISLQAF-NIFSQY.TFQS----------TW.KKKYLKR--------I-QIGLHR
G1U0Q8_RABIT/26-185-----------QF.QKNQ.AVSVLHEMLQQIF-NLLHTA.RSSA----------AW.NNTLLEE--------L-HTALHQ
F6YZB3_ORNAN/25-183-----------LL.QKGN.RAVVVHELLQQIF-TVFSQT.LSQT----------GW.DQAEVEN--------F-LHGLHR
I3MY95_SPETR/32-186-----------KV.PRAQ.AVAALQEMTRKIL-DLFGTQ.EAFA----------AW.NKILLDI--------F-LSGLNQ
V8NNB8_OPHHA/15-183-----------DECQVDI.AKTAVKEILQQID-VIFRQN.HTEL----------VW.HEGSLRD--------F-HIGLDQ
C8CKA7_PIG/26-185-----------QV.QKAQ.AMALVHEMLQQTF-QLFSTE.GSAA----------AW.DESLLHQ--------F-CTGLDQ
H0W7G8_CAVPO/26-185-----------QV.QEAQ.AFSVLHEMARQTF-NIFTSE.DSSA----------AW.NQSLLDT--------F-CTGLHQ
G3GXU9_CRIGR/27-182-----------QM.EKRN.VALIIEEMLQNIF-IVFNSN.YSST----------GW.NKTIVES--------F-LDKLYK
H0XSG1_OTOGA/26-185-----------QL.QKAQ.AISVLHDMTQQTF-NLFSTK.DSSE----------AW.NKTLLDQ--------F-RSGLYQ
G1KX99_ANOCA/25-184-----------DVSEEEN.AKVVIQEVLQQTG-HIFRQN.YTEM----------PW.DEDSLRV--------F-HAGLDQ
G3I0I6_CRIGR/27-185-----------QY.QKGH.VLAVLHELLQQIF-SLFQAH.VSRG----------IW.EENHIER--------V-LGALHQ
IFNT4_SHEEP/26-185-----------QL.QKDQ.AFPVLYEMLQQSF-NLFYTE.HSSA----------AW.DTTLLDQ--------L-CTGLQQ
L8Y4J0_TUPCH/27-186-----------QF.QKRH.TLAILHEMLQQIF-NLFSAN.VSPD----------DW.EEHYKEK--------F-LIELHE
F7B527_HORSE/26-183-----------QL.GKTQ.ATAVLHEMLQHTF-HLFSTT.GSRA----------AW.DETLLDK--------F-LLGLYQ
G1Q950_MYOLU/27-184-----------QV.RKEE.AMVVMHEMLQQIF-SIFRRG.FSNA----------GW.NETIVEN--------L-LEELDG
M3WTR1_FELCA/26-186-----------QL.REAQAAAAVLRELLQQTF-NLLHTE.RSSA----------AW.SPAPLHG--------L-RSGLHR
G5CB66_HETGA/27-185-----------HF.RKEN.AALVIQEMLQNIL-DIVRKN.FSNT----------VW.NETIVEN--------L-LVELHQ
L9L941_TUPCH/27-198-----------QP.VKRD.IKEVFYEISMQAF-NIFSQD.TFKS----------TW.EQKHLKQ--------I-QMGLHQ
D2H9N6_AILME/27-184-----------QV.QKEA.LLLVTLDMFQKTS-DIFRKN.LSST----------GW.NEIIVNN--------L-LEKIHW
D3Z919_RAT/26-179-----------QI.QKSQ.AISVLETLTQQVL-TLFESE.ESRA----------AW.NETLRLS--------F-CNYLYQ
C8CKB9_PIG/24-176-----------RT.QTSQ.GTCFHPLMLQQII-NLFNTE.NSRA----------AW.NNALLDH--------L-LSRLDH
A8E6F6_XENTR/27-179-----------QV.EA...GALAVREVLNETM-RFYMKH.HESM----------GC.KQQAWER--------F-QQLLYY
L8Y906_TUPCH/26-185-----------QL.QKTQ.ALRVLHGMLQQIF-NLFSSE.GSSA----------TW.EEALLDK--------L-LAGLHQ
H9L1C3_CHICK/28-183-----------...QKET.VKVAIEEILQHIF-YIFSKN.LTLA----------AW.DGAALEQ--------F-QNGLYQ
L5KWM8_PTEAL/106-263-----------QV.QEAQ.AISVLHEMLQETF-DVFCTE.HSSA----------AW.NTTLQHG--------L-LTGLHR
G3WZJ8_SARHA/27-182-----------QL.QREN.TTVMVHETLQQIF-TIFSLN.TTPA----------AW.NQTQLRQ--------L-LIGLDQ
G3UCD2_LOXAF/26-187-----------KF.QKAQ.AISVHHEMIQQIF-NLFSLQ.ASSA----------AW.DQTLLDK--------L-FAALDQ
K7GQJ6_PIG/17-164-----------QL.QKVQ.AISVFHEMLQQTF-LLFHIE.RSSA----------AW.DSTLLDK--------L-CSGLHQ
G3I0H3_CRIGR/26-178-----------HI.QKAQ.AMSVLQELTQQAL-ILFSSN.ESSA----------AW.ETTLLDT--------F-CDELHQ
H0VYK7_CAVPO/28-181-----------PF.QKEM.AALVIQEMLQNIF-VIIRKE.FSTT----------VW.NKTIVDD--------L-LDKLHQ
I3N7K4_SPETR/33-202-----------QP.EKTN.IKYVFYETYTQAI-NIFSQN.TFNS----------SW.DEEQLVQ--------L-QSNLYE
L5K635_PTEAL/26-185-----------QV.QKAQ.AISVLHEMLQQTF-DVFGTK.QSSA----------AW.NTTLLHG--------L-LSGLHR
H0W3G0_CAVPO/26-185-----------KL.QKAQ.MVSVLQGTLQQIL-TLFNTQ.LSSA----------AW.NATILHK--------L-HTVLHQ
W5JYQ9_ASTMX/23-179-----------TRKQTVA.LEKSIYITLEYIN-SMLNDH.ELPD----------QWTSQEKLDY--------F-LHIVFR
G3SI98_GORGO/28-185-----------QP.MKRD.IKKAFYEMSLQAF-NIFSQH.TFK.----------YW.KERHFKQ--------I-QIGLDQ
H0Y0D2_OTOGA/28-187-----------QP.EKNQ.AITVLYVVVQHIF-SLFSTT.ESSD----------AW.NKTLLDQ--------L-RTNLGW
IFN_ANAPL/34-190-----------...DTQQ.AAHTALHLLQHLF-DTLSSP.STPA----------HW.LHTARHD--------L-LNQLQH
G3UJX3_LOXAF/27-185-----------QL.QKED.AALVIYEMLLQIF-DIFLGN.FSHT----------GW.DETVIEN--------L-LAELSQ
G5C259_HETGA/26-185-----------QI.QKAQ.AISVLHEMTSQTF-NLFSTQ.DSSA----------AW.NNGLLDT--------F-CTGLHQ
G3WZF5_SARHA/26-185-----------QY.QKEN.ATMVIHEMLQQIF-LLFSSK.NASL----------GV.NNTIIET--------F-LNIIFQ
IFNE_PIG/27-186-----------QY.QKQQ.ALAILHEMLQQIF-SLFRAV.ISLD----------GW.EESHMEE--------F-LVELHQ
W5N6G4_LEPOC/27-185-----------ENAKNED.IVLTGLETMRCVH-NIFNKT.GHPA----------TW.EISELER--------F-QGLLYR
H9KYA4_CALJA/26-185-----------HF.QKAQ.AIFILHEMIQQTF-NLFSTK.DSSV----------TW.DATLLDT--------F-YTELYK
D2HTQ4_AILME/33-205-----------QP.AKRY.IKEAFYEMSIQAF-NIFSQY.TFTS----------TW.EKDYLKQ--------I-QIGLDQ
IFNB_HUMAN/27-185-----------QF.QKED.AALTIYEMLQNIF-AIFRQD.SSST----------GW.NETIVEN--------L-LANVYH
G1NR05_MELGA/32-188-----------...DKKQ.AAIITLHILQQLF-NILSSP.HTPA----------HW.IDHAHHS--------L-LNQMQH
F7BVP5_ORNAN/23-181-----------QF.QQEN.ATEAIHDLLQHIF-NVFSRN.HSQT----------GW.DEATVEK--------F-LHGVHK
F7G875_MONDO/27-182-----------QC.QREN.ATMIIHEMLQQTL-ILFSSK.NACP----------DV.NDTIIEP--------F-LSGIYQ
C8CKC3_PIG/33-205-----------QP.LKRD.IQEAFYEMSIRAF-NIFTQD.TFKA----------TW.EEKLLRQ--------V-QMGLDQ
I3MVD7_SPETR/34-186-----------QV.QKAQ.AVAVLHQMTQQVF-NLFSTQ.EAFA----------AW.NQTLLNT--------F-LTGLHQ
F7A317_HORSE/26-184-----------QF.RKAQ.AISAVHETIQQIF-HLFSTD.GSSA----------AW.DESLLDK--------L-YTGLYQ
G1KU56_ANOCA/28-182-----------EL.QKEN.AAVALHEILQQIL-CLYIQN.HTKL----------PW.DENSIGI--------L-KVGLKQ
L5KBH2_PTEAL/26-185-----------HM.QKAQ.AISVLQEMLQEIS-NVFGTQ.QSSG----------AW.NTTLLHG--------L-LSGLHW
L5K909_PTEAL/26-185-----------QF.QEAQ.AITVIHEVTWQTF-LLFCTE.ASST----------AW.DETLLGR--------F-CTGLYQ
I3N5Z0_SPETR/23-179-----------QY.PKGH.VLAILHEMLQQIF-NLFKKN.ISLG----------SR.EENHIPI--------F-LTDLHQ
F7GHL9_MONDO/26-181-----------QL.QKEN.ATVVVLEMVQQIF-NLFSQN.AMPA----------TW.NQTQVIE--------L-RIGLDH
IFNE_HUMAN/27-186-----------QY.QKGH.TLAILHEMLQQIF-SLFRAN.ISLD----------GW.EENHTEK--------F-LIQLHQ
I3LBU7_PIG/26-179-----------HL.QKAQ.AIFVLHKMLQQTF-LLFHTE.HSSA----------A..DSTRLDK--------L-CSGLHQ
G3UK87_LOXAF/27-184-----------HL.QKAQ.AVFILHKMLQQIF-NLFRTK.EPST----------AW.NTTLPDQ--------L-HNGLYQ
L9LC61_TUPCH/27-185-----------QF.QKEN.ATLVIHEMLQNIF-GVFRRN.FSST----------GW.NDTIVEH--------L-LAQLFW
IFNB_RAT/27-182-----------QM.EKSY.TAFAIQVMLQNVF-LVFRSN.FSST----------GW.NETIVES--------L-LDELHQ
H0XMZ9_OTOGA/27-186-----------HY.QEGH.ALALLHETLQQIF-NLFRAN.ISVD----------GW.EESHVEK--------F-LIELHQ
G3VDC6_SARHA/27-182-----------QL.QREN.AIVIVNETLQQIF-NIFSLN.TTPA----------EW.NQTQLIQ--------L-LMGLDQ
I3JM36_ORENI/26-182-----------KS.SDED.KLAFTVQVLEEVA-ALFEED.HSSA----------SW.EDSTVRN--------F-LNIVNK
L5LKN9_MYODS/27-186-----------QD.QKGS.ALTILHEMLQQIF-SLFQAN.TSLE----------GW.KESRMER--------F-LIELHQ
G1TYS8_RABIT/29-195-----------QM.EKRD.IKEAWYEISTQAF-CIFMGH.AFQT----------TW.EETHLTQ--------I-QNGLYE
I3UJJ8_FELCA/27-185-----------QY.QKGQ.ALAILHEMLQQIF-NLFRAN.TSSD----------GW.EESHVEK--------F-LTELHQ
C8CKA9_PIG/26-183-----------QV.EKTQ.AVAVAHEMLQQIF-RLFSTR.GSPS----------SW.DETLLIK--------F-LSGLYQ
IFNT2_BOVIN/3-162-----------QL.QKDQ.AISVLHEMLQQCF-NLFYTE.HSSA----------AW.NTTLLEQ--------L-CTGLQQ
H0W510_CAVPO/26-186-----------QV.QKAQ.ALSVLHEMTRQTF-ILFTSQ.YSCP----------PW.NQSLLDS--------F-CTGLYE
M3Z729_MUSPF/26-183-----------QL.QKAQ.AISVLHVTNQKTF-HLFCTE.ASPA----------PW.NTTLLEE--------L-CSGLSE
IFNA1_MOUSE/26-185-----------QI.KKAQ.AIPVLSELTQQIL-NIFTSK.DSSA----------AW.NTTLLDS--------F-CNDLHQ
G3TTC1_LOXAF/26-185-----------QL.QKAQ.AIAFLHEMLQQIF-DLFRTM.DSFA----------AW.NTTLLNQ--------L-LNGLPE
G1PDS6_MYOLU/29-199-----------QPLLHRD.IKGTFYEMYMLAF-SIFTQS.TFQS----------TG.EEKHLGQ--------I-QTGLDR
F7ABU5_MONDO/27-182-----------QL.QKEN.ATVIVLEMVQQIF-TLFSQN.TTPA----------TW.NQTQVIQ--------L-LIRLDQ
G1TTX4_RABIT/27-180-----------QL.QKED.TTLVIFEMLNNIF-DIFRKN.FSST----------GW.NETLVEN--------L-LGETHL
H0XRP5_OTOGA/26-185-----------QL.QKAQ.AISVLHEMTQQTF-NLFSTN.DSSE----------AW.NKTLLDQ--------F-RTGLYQ
H0WK94_OTOGA/33-202-----------QT.VKRG.LREAFYEVSIQAF-HIFSQY.TFEP----------TW.KLKHLNQ--------I-QMGLDK
G1KYL3_ANOCA/23-176-----------NVSEEGN.AKAAIQEVLQQTG-HIFKQN.YTEM----------PW.DEDSLRA--------F-HAGLDQ
G3WZQ8_SARHA/26-181-----------QL.QREN.ATAIVYEMLQQIF-TIFSLN.TTPA----------TW.SQTQLKQ--------L-LIGLDQ
H2R6R8_PANTR/26-185-----------QF.QKTQ.AISVLHEMIQQTF-NLFSTE.DSSA----------AW.EQSLLEK--------F-STELYQ
H0YTY6_TAEGU/34-188-----------L..HPHQ.AAATALRILQHLF-HTLSSN.STRQ----------HW.PSHARNL--------L-LNKLQH
I3MXH1_SPETR/27-185-----------QF.QKEH.AAFVIYEMLKDIF-HVFKKG.YSNP----------DW.NNTIVTD--------L-LSELHQ
M3WRV1_FELCA/26-184-----------QS.HKAQ.ALSVVHVANQKIF-HFFCTEASSSA----------AW.NTTLLEE--------F-CTGLDR
H0W4H8_CAVPO/23-182-----------PC.QKDH.ALVSEHLHLEQTF-NLFISE.DSSA----------AW.NKSLLHS--------F-CTGLHQ
R4GKJ6_CHICK/35-191-----------...NTQQ.ADKTTHDILQHLF-KILSSP.STPA----------HW.NDSQRQS--------L-LNRIHR
A3FBE8_MUSPF/27-184-----------KF.QKED.IVLVTLEMFQKTS-DIFRRN.LSST----------GW.NESIVEN--------L-LATLHW
G1KWE0_ANOCA/28-180-----------DVSEEEN.AKVAIQEVLQQTG-HIFRQN.RTEM----------LW.DEDSLRA--------F-HAGLDQ
G7PS89_MACFA/26-185-----------NF.QKAQ.AISVLHEIIQQTF-NLFNTK.NSSA----------AF.NETLLDE--------F-YIELDQ
G1Q880_MYOLU/26-185-----------QV.QKAQ.AIAVLHEMLQQVS-NLLSTE.NSSV----------TW.NTTLVDQ--------L-RSGLHR
IFNB_MOUSE/27-180-----------KM.QKSY.TAFAIQEMLQNVF-LVFRNN.FSST----------GW.NETIVVR--------L-LDELHQ
IFNB2_BOVIN/27-184-----------QF.QKED.AILVIYEMLQQIF-NILTRD.FSST----------GW.SETIIED--------L-LEELYE
G1SJC4_RABIT/26-185-----------QA.QRTQ.AISVLHEMTQQLL-NLFSTK.EASA----------AW.DKALLDR--------L-CTGLFE
W5PG31_SHEEP/26-185-----------QL.QKAQ.AISVLHEVTQHTF-QLFSTE.SSAA----------AW.DQSLLDK--------L-CAALDQ
IFNA3_CANFA/26-183-----------RL.QEAQ.ALSVVHVMTQKVF-HLFCTN.TSSA----------PW.NMTLLEE--------L-CSGLSE
G5BPX2_HETGA/27-199-----------QH.VERD.IKEVFYDIIIQAF-NIFSRH.TSDS----------TW.KEEYLTQ--------I-KSELAE
IFNW2_HORSE/26-185-----------QF.PEAQ.AASVLHEMLQQIF-SLFHTE.RSSA----------AW.NTTLLDE--------L-CTGLLR
G3N2A8_BOVIN/26-185-----------QL.QEAQ.AISVLHEMLQQTF-NLFHTE.RSSA----------AW.DTTLLEQ--------L-HTGLHQ
H0XKS8_OTOGA/27-185-----------HL.QKED.AMLFIYEMLQNIF-RILRRD.FSST----------GW.NETIVDA--------L-LANFHQ
H0VUV7_CAVPO/26-185-----------QV.QKTQ.ALSFLHEMTTQTL-ILFSSQ.NSHA----------AW.NQSLRRT--------F-CDALRD
Q29412_PIG/27-184-----------QF.QKED.AVLIIHEMLQQIF-GILRRN.FSST----------GW.NETVIKT--------I-LVELDG
G7PS88_MACFA/26-185-----------QF.QKAP.AISVLHELIQQTF-NLFTTK.DSSA----------AW.DEDLLDK--------F-CTELYQ
M3WZS7_FELCA/26-181-----------QL.EKTQ.VTAVVHEMLQQIF-NLFSKS.DSFV----------AW.DEMLLDR--------F-LVGLYQ
H9GZR7_HORSE/26-185-----------QF.PEAQ.ATSVLHEMLQQIV-NLFHTE.RSSA----------AW.NTTLLDR--------L-LTGLHQ
F1LVL8_RAT/26-184-----------QH.QEGH.VLAVLHEILQQIF-VLFQTH.SSRG----------VW.EENHIEE--------V-LAALHR
M3YX13_MUSPF/27-179-----------RS.QSGQ.ALAILHEMLLQTF-SLFRAG.ISLD----------GW.EEIRVE.--------F-LTELHQ
G1L8G2_AILME/26-185-----------KF.EKTE.ATGVMHEMFRQIF-NLFSQS.GSFV----------AW.DETLLDK--------F-LAGLHQ
IFNB_HORSE/27-184-----------QF.QKED.AALVIYEMLQHTW-RIFRRN.FAST----------GW.NETIVKN--------L-LVEVHL
H0W289_CAVPO/26-190-----------QV.QEAQ.AIWVLHGMLQQIL-TLFYTE.HASA----------AW.NGALLDQ--------L-HSLLYQ
A8E6E8_MONDO/27-182-----------KL.QRGD.ALIIFHEMLQQKF-TLFSQN.AAPV----------AW.NQTQLMQ--------L-LIGLDQ
I3N788_SPETR/27-185-----------QL.QKEH.AAFVIYEMLQDIF-VIFTRN.FSNT----------GW.NETIVKD--------L-LVELHQ
G1L8I1_AILME/26-183-----------QL.QKAQ.ALSVVHVMDQKIF-HVFCTE.PSSA----------AW.NRTLLEE--------F-CSGLSE
IFNB_FELCA/27-184-----------RF.QKEE.AILVINEMFQKIF-NIFSRS.TSST----------GW.NETTVEN--------L-LATLHW
H0VXI5_CAVPO/26-181-----------QV.QKAQ.ALSVLHEMTRQTF-NLFTSE.DSSA----------AW.DKSLLSY--------F-CTGLHQ
G3TS29_LOXAF/26-179-----------QL.EKTQ.AAVLLYEMLQQTF-NLFSRS.DSLE----------AW.DETFLDK--------F-LLGLYQ
W5PZ39_SHEEP/26-184-----------QP.LMRN.IKEAFYEMTRQAF-HIFTQD.TFQS----------TW.EGKQLRQ--------I-QIGLDH
G3I0H6_CRIGR/26-178-----------HI.QKAQ.AMSVLQELTQQAL-ILFSSN.KSSA----------AW.EKTLLKP--------F-CNSLLQ
I3L756_PIG/26-180-----------QL.QKTQ.AISVLHEMLQQTF-LLFHTE.RSSA----------AW.DSTLLDK--------L-CSGLHQ
M3Z715_MUSPF/26-183-----------QL.QKAQ.ALSVVHVTKQNIF-HLFCTE.ASPA----------PW.NTTLLEE--------L-CSGIYQ
M3VXI8_FELCA/33-205-----------PP.GKRY.LKEAFYEMSTQAF-NIFRES.TTKS----------TW.KKKNLKQ--------I-QIRLDW
G3R8Q7_GORGO/26-185-----------QL.QKAQ.VMSVLHEMLQQIF-SLFHTE.RSSA----------AW.NMTLLDQ--------L-HTGLHQ
A8E6F5_XENTR/51-202-----------QM.EE...MVLAVRGVLNETM-RFYMKH.HESM----------GC.KQQAWER--------F-QQLLYY

PF02947

FLT3L_MOUSE/30-162-----------KH-CKALWSLFLAQRWIEQLK-TV----------------------AGSKMQT--------L-LEDVNT
F6T7S9_ORNAN/28-157-----------EL-CWELWHLSVAEDRLKHLE-RM----------------------SGPRLRE--------L-VHKVQA
H9GP84_ANOCA/29-165-----------EF-CKELWHVHLIHRNLNRMI-NV----------------------SGSELEK--------S-IRKLMI
F6TPW7_MONDO/34-163-----------ER-CRALWHLFLAKKTLDRLE-LV----------------------AGKELKK--------L-LDKVCT
G5B8P0_HETGA/20-150-----------QF-CAKLWHLVLAQRWMERLK-TV----------------------AGLKIRE--------L-LETVDT
G1M637_AILME/29-159-----------EL-CGPFWHLVLAQRWMGQLK-AV----------------------AGSQMQI--------L-LEAVNT
L9JA37_TUPCH/769-910-----------EL-CGALWRLVLAQRWMERLK-TV----------------------AGPQIQD--------L-LEKVNT
G3VSA3_SARHA/79-209-----------EQ-CWALWHLALAKETLDRLK-LV----------------------AGSKLQE--------P-LEAVYA
G1QZC3_NOMLE/30-160-----------EL-CGALWRLVLAQRWMERLK-TV----------------------AGSKMQG--------L-LERVNT

PF00489

IL6_BOVIN/27-208-----------S----GFNQAICLIRT-TAGL-LEYQIYLDY------------LQNEYEGNQE--------N.VRDLRK
M3X721_FELCA/27-208-----------S----GFNQETCLTRI-TTGL-QEFQIYLKF------------LQDKYEGDKE--------N.AKSVYT
IL6_HORSE/27-208-----------S----GFNQETCLMKI-TTGL-SEFQIYLEY------------LQNEFKGEKE--------N.IKTMQI
G3UHF3_LOXAF/20-205-----------S----GFNKETCLMKI-ITGL-SEFQIYLDY------------LQNKFEGSKA--------N.VIVVQN
L5KPK4_PTEAL/20-202-----------S----GFNQETCLMKI-TTGL-LEFQIYLDY------------LQNKFE...E--------N.AKAMQM
F7HV62_CALJA/27-212-----------S----GFNEETCLLKI-TTGL-LEFEVYLEY------------LQNRFESSKE--------Q.AGAVQM
IL6_MOUSE/26-210-----------T----GYNQEICLLKI-SSGL-LEYHSYLEY------------MKNNLKDNKK--------DKARVLQR

PF16647

CSF3_BOVIN/42-190-----------Q----SLQLTSCLNQL-HGGL-FLYQGLLQA------------LAGISPELAP--------T-LDTLQL
CSF3_HUMAN/51-202-----------Q----ALQLAGCLSQL-HSGL-FLYQGLLQA------------LEGISPELGP--------T-LDTLQL
CSF3_MOUSE/57-205-----------Q----ALQQTQCLSQL-HSGL-CLYQGLLQA------------LSGISPALAP--------T-LDLLQL

PF06875

Q5BNQ4_9SALA/2-215-----------RL-KNNLYFYSAIVEFLKEAM-TEQ-EDLNPAELA--------LKAKFEEAMA--------N-SNTLIS
Q5BNQ2_9SALA/2-215-----------RL-NNNLYFYSAIVEFLKEAM-TEQ-EDLNPAELS--------LKAKFEEAMA--------N-SNTLIS

PF01110

CNTF_CHICK/1-194-----------RL-LDNLAAYRAFRTLLAQML-EEQRELLGDTDAE--------LGPALAAMLL--------Q-VSAFVY
G3VWZ5_SARHA/1-195-----------RL-QANLHAYRTFHVLLTEVL-EDQRAQFTPTERD--------FHQNIHRVLL--------Q-VAAFAY
E1BFH9_BOVIN/1-193-----------RL-QENLQAYRAFHGMLARLL-EDQRAHFTPAEED--------FHQAIHAVLL--------Q-VAAFAY
G5AP46_HETGA/1-192-----------RL-QENLHAYRTFHVLLARLL-EDQQVHFTPTESD--------FHQAIRSLGL--------Q-VSAFAY
H0Z9U1_TAEGU/1-188-----------RL-LENLAAYRAFRTLLAQML-EEQREQLGEADAG--------LGRALAAVLL--------Q-VSAFAY
CNTF_HUMAN/1-194-----------RL-QENLQAYRTFHVLLARLL-EDQQVHFTPTEGD--------FHQAIHTLLL--------Q-VAAFAY

PF01291

LIF_MOUSE/44-203-----------KL-VELYRMVAYLSASLTNIT-RDQ-KVLNPTAVS........LQVKLNATID--------V-MRGLLS
LIF_BOVIN/43-202-----------RL-VELYRIIAYLGASLGNIT-RDQ-KVLNPYAHG........LHSKLSTTAD--------V-LRGLLS
ONCM_HUMAN/37-209-----------RR-GFLQTLNATLGCVLHRLA-DLE-QRLPKAQDLERSGLNIEDLEKLQMARP--------N-ILGLRN
ONCM_MOUSE/34-194-----------KP-HFLSTVYTTLDRVLYQLD-ALR-QKFLKTPAFP..........KLDSARH--------N-ILGIRN
ONCM_BOVIN/34-194-----------RQ-DFLQTLNTTLGLILRMLS-ALQ-QDLPEAAH..............QQAEM--------N-VRGFGN

PF03039

IL12A_MOUSE/6-215-----------PQ-KTSLMMTLCLGSI.YEDL-KMYQTEFQAINAA--------LQNHNHQQII--------L-DKGMLV
G3VQT1_SARHA/40-247-----------SK-EKLSVKQLCLKSI.YKDL-ETYKTEFKVVEET--------LAKDPTRQIS--------L-DQNMLA
F6T5A8_MONDO/5-202-----------ST-ETLFIKDLCLRSI.YEDL-ETYKAEFNVIKKT--------LTKDPAKQIS--------V-DLNMLA
IL12A_PIG/6-222-----------SG-KTSFMTTLCLSSI.YEDL-KMYHVEFQAMNAK--------LLMDPKRQIF--------L-DQNMLT
L8YEA2_TUPCH/1-213-----------PE-KTSHMMTLCLSSI.YEDL-KMYQVEFKAINAQ--------LWMDPERQIL--------L-DQNMLT
H0X861_OTOGA/6-217-----------SR-KTSSMMTLCLSSI.YEDL-KMYQVEFKAMNEV--------LSMYPINQTI--------L-DQNLLT
G1QWH2_NOMLE/40-254-----------SR-QLYHLTPLCLSFLQYESI-YSSRVQIKQASHR--------RCMCLENEYF--------F-SQVLRT
I3MN91_SPETR/4-220-----------SG-RTSWNTTLCFSSI.YEDL-KMYQLELKAINEK--------LLMDPKGQIY--------E-DKALLA
Q924V6_CAVPO/6-221-----------SG-KTSFMMALCLNSI.YEDL-KLYQLEFKNMNAQ--------LLMDPQRQIF--------L-DQNMLS

PF02024

H3AP27_LATCH/26-169-----------P.-..AERPLESLGSM-DETL-EIFHWILSSLP----------V.DDVTQILW--------D-IENLRA
G3WWV6_SARHA/23-167-----------P.-..GLHPFQSLSDM-DQTL-AIYQQILSNLS----------S.RNMVQISN--------D-LENLRD
F6PLK2_ORNAN/23-167-----------P.-..GNQQFQNLADM-DQTL-AVYQQILSSLP----------M.PDRTQISN--------D-LENLRS
F7HGW1_CALJA/23-167-----------P.-..GFHSDLSFSKM-DEIL-ATYQQIVISLP----------S.GNMIQISN--------D-LENLRA
G5BHA4_HETGA/23-167-----------P.-...LYPDLSFSKM-DQTL-AVYQQIISNLP----------SRRNMVQISN--------D-LDNLQN
W5NER9_LEPOC/28-172-----------PD-ALNDKTLEGLSTV-EDNL-HTFQEILSSLP----------M.EEMDQILA--------D-IFNLRM
H0V7C6_CAVPO/23-165-----------P.-...LSPYLSLPKM-DQTL-TLYQKVITTLS----------S.SHTAQISN--------D-LENLQS
LEP_HUMAN/23-167-----------P.-..GLHPILTLSKM-DQTL-AVYQQILTSMP----------S.RNVIQISN--------D-LENLRD

PF02372

IL15_PIG/33-160EYKTES--------G----------------CKE-------------------CE-EL-------------------EEK
IL15_CAVPO/33-160GNVTES--------G----------------CKE-------------------CE-EL-------------------EEK
IL15_FELCA/33-160RNITET--------G----------------CKE-------------------CE-EL-------------------EEK
IL15_SHEEP/33-160ENKTEL--------G----------------CKE-------------------CE-EL-------------------EKK
F1NZN5_CHICK/55-183NSTTSK--------K----------------CKE-------------------CE-EY-------------------EEK
G1NDP6_MELGA/5-137LSPTGG--------E----------------CKI-------------------CE-AN-------------------DKK
O73883_CHICK/5-138LNHTGS--------E----------------CKI-------------------CE-AN-------------------NKK
Q8JFF4_ANAPL/4-134LIPPGT--------G----------------CNI-------------------CE-A.-------------------NAN

PF00715

I3MQX6_SPETR/7-151KLKGSA--------T----------------TFT-------------------CEYAQ-------------------ETA
G5C793_HETGA/7-149KLKGSK--------T----------------TLK-------------------CDLND-------------------EEA
G1PJ32_MYOLU/7-147NLKGPK--------T----------------RFE-------------------CDYDD-------------------ETV
B1AB81_HORSE/7-146GLKGSE--------T----------------RFT-------------------CEYDD-------------------ETG
G3HTL8_CRIGR/7-150KLKGSE--------N----------------TFT-------------------CEFDD-------------------ETV
IL2_MACMU/7-151ELKGSE--------T----------------TLM-------------------CEYAD-------------------ETA
H0Y254_OTOGA/7-149ELKGSE--------T----------------.FI-------------------CE.DN-------------------ETA
IL2_MOUSE/7-165KLKGSD--------N----------------TFE-------------------CQFDD-------------------ESA
G3SU90_LOXAF/7-147ELQGSE--------T----------------TFM-------------------CEYDD-------------------HAA
IL2_PIG/7-151ELKGSE--------T----------------SFK-------------------CEYDD-------------------ETV
IL2_FELCA/7-151KLKGSE--------T----------------RFT-------------------CNYDD-------------------ETA
L5K7D9_PTEAL/7-149KLKGPE--------T----------------KYT-------------------CVYND-------------------ESA
IL2_BOVIN/7-152ELQGSE--------T----------------RFT-------------------CEYDD-------------------ATV
H0VBY4_CAVPO/7-149SLKGSE--------T----------------AFV-------------------CDLED-------------------ESV

PF00103

PLRP1_BOVIN/26-238FIERQF--------S----------------KIIVPVLNTMIQARSSWTGLPSLMSSD-------------------EDR
CSH2_BOVIN/26-238FIESQF--------R----------------KIIVPVLKMIHEVSDTWSRFSSMTFSD-------------------EDR
PLRP3_BOVIN/1-213FIERQF--------S----------------QVIYPVIRTIFKARIYWSGLASLVSND-------------------EDV
PR4A1_RAT/17-227AIKNIA--------K----------------KGNF..EINEKANYTAWSELGFLQSPN-------------------RDT
CSH1_BOVIN/26-236GVEMIQ--------K----------------RVH.PGEKKNEPYPVWSEKSS.LTADD-------------------EDV
PLRP4_BOVIN/26-239LIERPF--------S----------------QVIFTARRKMYIARIYWFGLRSLLSSN-------------------EDR
PR3D4_RAT/16-223GLQKIF--------N----------------RTQTKVEENENFDYPAWSGLKDLQSSD-------------------EDT
PR2C2_MOUSE/16-224GVNALM--------S----------------TMLQ..NGDEEKKNPAWFLQS....DN-------------------EDA
SOM2_HUMAN/9-215GIQTLM--------W----------------RLEDGSPRTGQIFNQSYSKFD..TKSH-------------------NDD
PR8A5_RAT/17-238DLRWIL--------T----------------KVF..PTAEIKEEFPSWDYLSFLKSSN-------------------KNH
PR6A1_RAT/20-234VLKGIL--------N----------------KIQ..PGSPQNERFPMWNELAYLRSPD-------------------EER
PR7D1_MOUSE/17-240YIIRII--------S----------------KVN..PAIKENEDYPTWSDLDSLKSAD-------------------KET
CSH2_HUMAN/9-215GIQTLM--------G----------------RLEDGSRRTGQILKQTYSKFD..TNSH-------------------NHD

PF00726

IL10_BOVIN/5-174RLRRC--------------------------HRF--LPCENKSKAVE-------KVKR-------------------VFS
IL10H_EBVB9/7-167RLRRC--------------------------HRF--LPCENKSKAVE-------QIKN-------------------AFN
G3HB01_CRIGR/14-174QLQRC--------------------------HRF--LPCENKSKAVE-------KVKS-------------------DFN

PF14565

IL22_HUMAN/40-178RLSTC--------------------------HIE--GDDLHIQRNVQ-------KLKD-------------------TVK
E1C1U2_CHICK/46-184ELSRC--------------------------KYS--GNREHIEKNLE-------EMKS-------------------KMK

PF05337

CSF1_HUMAN/41-180RLKSC--------------------------FTK--DYEEHDKACVRTFYETPLQLLE-------------------KVK
Q3TLQ6_MOUSE/41-180NLNSC--------------------------FTK--DYEEQNKACVRTFHETPLQLLE-------------------KIK
O77709_BOVIN/41-180RLKSC--------------------------FTM--DYDEQDKACVRTFHETPLQLLE-------------------KIK
O77710_BOVIN/41-180RLKSC--------------------------FTM--DYDEQDKACVRTFHETPLQLLE-------------------KIK
Q64129_9MURI/41-180NLNSC--------------------------FTK--DYEEQNKACVRTFHETPLQLLE-------------------KIK

PF15036

IL34_MOUSE/28-184LLENV.--------.----------------.QR--SLMD.........VEIGPHVEA-------------------VLS
R4GIU3_CHICK/19-177LLDALG--------V----------------EYS--GYRQ.........SDVDAVVAD-------------------LVK
F7EA00_CALJA/29-185LLLDV.--------.----------------.QR--GLTD.........VEVSPKVES-------------------VLS
H0WFN4_OTOGA/28-184LLLDV.--------.----------------.HQ--GFKD.........MEVSPKVEA-------------------VLS
M3ZVZ0_XIPMA/24-191RFRDA.--------.----------------.EG--VFVQ.SHPAEVFQQELPETIQD-------------------IWD
U3JY35_FICAL/18-179LFDALG--------E----------------EYS--KYRQ.........TDVETVVAD-------------------VVK
L9KJY3_TUPCH/28-184LLQNV.--------.----------------.QE--GLTD.........VEVSPKVEA-------------------VLS
G3T3A6_LOXAF/28-182LLVTI.--------.----------------.QQ--GLMD.........VEASPEVEA-------------------VLS
F6W3U1_MONDO/15-167LLIYV.--------.----------------.QE--IAKD.........LQVHPQVEK-------------------ILT
I3JZ08_ORENI/24-192RFKDA.--------.----------------.QA--VFMQ.SHPAQVFQEDLPEKIHD-------------------IWD
L5MCR9_MYODS/28-182LLVDV.--------.----------------.QQ--ALGD.........VKLSPPVDA-------------------VLS
B3DLJ8_DANRE/23-195LFKKF.--------.----------------.ET--VFKEGNHEDQENVRERPESLQT-------------------IWD
IL34_BOVIN/28-183LLLDV.--------.----------------.KQ--GLGG.........VEVSPQVEA-------------------VLN

PF00714

IFNG_HORSE/15-152DLFVK--------------------------FFN--SSTS--------------.KLE-------------------DFQ
H0WPL1_OTOGA/15-151EIIAK--------------------------FFN--SSYS--------------.KAE-------------------AFQ
Q8CGS0_CAVPO/15-154QIITK--------------------------FFK--DNSS--------------NKVQ-------------------AFK
B9VS86_CALJA/15-152DMNVK--------------------------FFN--SNKR--------------.KQD-------------------DFE
G3SUC6_LOXAF/15-152DLFVK--------------------------FFN--SSSS--------------.KRD-------------------DFL
G3GY20_CRIGR/2-135DLFAN--------------------------FFN--SSME--------------.KLN-------------------DFV
I3MNV6_SPETR/15-152DLSAK--------------------------FFN--SNCI--------------.KRE-------------------DFL
L5LME8_MYODS/15-153ELRVK--------------------------VFN--SSNS--------------.KME-------------------DFK
G5BGB5_HETGA/15-152DIIAK--------------------------FFH--SNSS--------------.KLD-------------------VFQ
G3WQJ9_SARHA/15-153DMIMK--------------------------LFP--NNTA--------------SSVD-------------------DFE
IFNG_SHEEP/15-152DMFQK--------------------------FLN--GSSE--------------.KLE-------------------DFK
IFNG_RAT/14-151HLITN--------------------------FFS--NSKA--------------.KKD-------------------AFM
IFNG_RABIT/15-152DIFVK--------------------------FFN--SNLT--------------.KMD-------------------DFQ
L9KVU0_TUPCH/51-188DMIDK--------------------------FFN--SSPT--------------.KLD-------------------VFL
IFNG_FELCA/15-153DMLDK--------------------------LLN--TSSS--------------.KRD-------------------DFL

PF02404

R4GD07_ANOCA/1-283DLMEC--------------------------LSS--TKYRNFRQHHDHLYEEGRFIPE-------------------EFF
SCF_CHICK/1-287DLMAC--------------------------LAF--DKNKDFIKENGHLYEEDRFIPE-------------------NFF
SCF_RAT/1-273DLVAC--------------------------MEE--NAPKN.VKESLKKPETRNFTPE-------------------EFF
G1NWC8_MYOLU/1-272DLVEC--------------------------MEE--HALEN.VKKSSNSLELKMLTPE-------------------EFF
F7EP53_MONDO/1-273DLMGC--------------------------LEE--.KNKNFRKQNIHIYKRDSFNPE-------------------DFF
F7C5I3_ORNAN/1-273DLMAC--------------------------LAS--DKNKHFVQRNIHLYKKGSFIPK-------------------EFF
F7G0W2_CALJA/1-273DLVEC--------------------------VKE--NSSKD.LKKPFKSPEPRLFTPE-------------------EFF

PF03487

G1SCQ2_RABIT/16-144D.KAVA.......KQ------------------------------VTSVQARDT--KI-------------------ELL
IL13_HUMAN/16-144H.KVSA.......GQ------------------------------FSSLHVRDT--KI-------------------EVA
IL13_RAT/2-130Q.KASD........V------------------------------ASSPP..DT--KI-------------------EVA
F7DGH7_MACMU/16-151L.ASHSRAGLFVLQQ------------------------------FSSLRVRDT--KI-------------------EVA
L5M5Z7_MYODS/2-128R.QPSA.......GP------------------------------ASSPPVRDT--KV-------------------EVT
G5ASP9_HETGA/2-130H.RAVA........K------------------------------VSSFHNRDT--KI-------------------EVA
B3GDZ5_PIG/2-130H.KPPS.......EQ------------------------------VPGKHIRDT--KI-------------------EVA
L8YAP6_TUPCH/2-128S.KSSA.......EQ------------------------------VSSLPTRDT--KI-------------------EVA
IL13_BOVIN/2-130H.KPSA.......KQ------------------------------VSSEYVRDT--KI-------------------EVA
IL13_MOUSE/2-130R.KAPT........T------------------------------VSSLP..DT--KI-------------------EVA
H0W834_CAVPO/16-149H.KASA.......GQ------------------------------VSSLRSPDT--KI-------------------EVA
F6WQF3_ORNAN/2-128QPPPLS.......LQ------------------------------VHCEVNQET--QV-------------------ELL
G3T2N9_LOXAF/2-133QYKAPA.......SQ------------------------------VSSLQVRDT--KI-------------------ELI
M3YGH3_MUSPF/2-126Q.DTSA.......GQ------------------------------ISS...KDT--KI-------------------EVI
B5FW67_OTOGA/2-129Q.KDLP.......G.------------------------------VPSSHIRDT--KI-------------------EVA
I3MAR4_SPETR/2-131H.KNTA.......KQ------------------------------ASTVPIPDT--KI-------------------EVG
IL13_CANFA/2-129Q.KPAA.......GQ------------------------------ISSERSRDT--KI-------------------EVI

PF00727

IL4_FELCA/26-131NLSSMA-------NR------------------------------.TCSVNEVK..KC-------------------TLK
H0XDE1_OTOGA/26-149NLCSLA-------NS------------------------------RYCPVNDAM..QS-------------------TLK
IL4_MOUSE/27-140AFRCLD-------SS------------------------------ISCTMNESK..ST-------------------SLK
G3T4B8_LOXAF/26-132SLSSMT-------NL------------------------------DYCPVNEDRNLFK-------------------TAR
IL4_RABIT/28-143NLCSMA-------KL------------------------------SNCPGKEAR..QT-------------------TLE
G5ASQ0_HETGA/25-138NLRSMV-------QP------------------------------.NCSVSELK..QT-------------------TLK
F6U5N6_HORSE/26-135NLKGMA-------NG------------------------------TCCTVNEAK..KS-------------------TLK
IL4_BOVIN/26-133NLNSLA-------SK------------------------------.TCSVNEAKTSTS-------------------TLK
G3QSC0_GORGO/26-149NLWGLA-------GL------------------------------NSCPVKEAN..QS-------------------TLE
A3FBF0_MUSPF/26-130NLRNMA-------NM------------------------------.TCSVNEVK..KS-------------------TLK
IL4_RAT/27-139GVSGLN-------SL------------------------------RSCTVNEST..LT-------------------TLK
G3WEJ0_SARHA/28-149NLMHLV-------NQ------------------------------TKCPVNETK..IT-------------------KLQ
I3MAS4_SPETR/24-141NLRSMA-------QL------------------------------HNSPASESK..QR-------------------TLK
IL4_PIG/26-131NLSSMA-------NM------------------------------.TCSVHEAK..KS-------------------TLK

PF01109

CSF2_RAT/18-139ALTMIA--------S----------------HYQ--TN-------CPPTPETDCEIEVT------------------TFE
CSF2_MOUSE/18-136ALNMTA--------S----------------YYQ--TY-------CPPTPETDCETQVT------------------TYA
CSF2_BOVIN/18-138SLTMMA--------T----------------HYE--KH-------CPPTPETSCGTQFI------------------SFK
CSF2_CAVPO/18-140SLTLMA--------N----------------FYK--QH-------CPPTPETSCMTQII------------------TFK
CSF2_PIG/18-139PLTLLA--------K----------------HYE--QH-------CPLTEETSCETQSI------------------TFK
CSF2_HUMAN/18-139PLTMMA--------S----------------HYK--QH-------CPPTPETSCATQII------------------TFE
CSF2_CANFA/18-139PLTMMA--------N----------------HYK--QH-------CPPTPESPCATQNI------------------NFK

PF02025

G1RQD7_NOMLE/22-133NLSLIK--------K----------------YID--GQ------------KKKCGEERR------------------RVN
IL5_CAVPO/23-134NLSLIK--------K----------------HID--LQ------------KQKCGEERR------------------RVK
J9NWP5_CANFA/22-132NLSLIK--------E----------------HIE--RQ------------KKRCAGERW------------------RVT
IL5_MOUSE/21-132NLSLIK--------K----------------YID--RQ------------KEKCGEERR------------------RTR
G3WAR7_SARHA/25-134NFSSLK--------E----------------HIT--TK------------EKQCGGERR------------------KVE
IL5_HORSE/22-133NLSLIK--------G----------------YID--LQ------------KKKCGGERW------------------RVK
B5FW65_OTOGA/22-133NLSLIK--------K----------------YID--RQ------------KKRCGEERR------------------KVK
I3MDT8_SPETR/23-134NLSLMK--------K----------------YID--IQ------------KKKCGQERR------------------RVK
G3T4B0_LOXAF/23-133NLSLLK--------E----------------YID--LQ------------KKKCGGERR------------------KVK
G1SL79_RABIT/22-133NLYLIK--------K----------------YID--LQ------------KKKCGEERR------------------GVK

PF02059

IL3_CANFA/19-132NLKEFL--------P----------------LLP--TP-------T..PRGEPISIMEN------------------NWG
IL3_MOUSE/27-138NLQKLN--------C----------------CLP--TS-------A..NDSALPGVFIR------------------DLD
IL3_BOVIN/18-132NLKEFQ--------P----------------VLP--TA-------T..PTEDPIFIENK------------------NLG
G3UC30_LOXAF/22-133NLRKFH--------P----------------CLP--KA-------K..PQTASIVI.QN------------------DWE
G1MH15_AILME/18-131NLKEFL--------P----------------LLP--TP-------T..PRGQPISI.EN------------------NLG
F1RJV6_PIG/18-131NLEKFR--------P----------------ILP--TS-------M..STEEPISIEEG------------------DLG
G1RQ11_NOMLE/20-137ILKNLP--------P----------------CLP--MA-------TAAPTRHPIRIKDG------------------DWN
IL3_CALJA/19-136NLKDLP--------V----------------CLP--TA-------TNAATQHPIRIKDG------------------DWN
F1LS41_RAT/29-138KLQKLK--------C----------------CIP--AA-------A..SDSVLPGVYNK------------------DLD

PF07400

IL11_HUMAN/22-199ELGTLQ--------ARLDRLLRRLQLLMSRLALP--QP-------PPDPPAPPLAPPSS------------------AWG

PF00758

G3TYQ1_LOXAF/25-173LQGLLG--------TQL...-----------.PP--QG.......RTTAHKDPNAIFPE------------------FPT
W5K758_ASTMX/26-175VLRSLS--------IQD...-----------YVP--TV.SGIDLQETWQVSSAPELFQV------------------HIN
B1N8Y2_DANRE/15-168VLRSLS--------IPE...-----------YVP--PT.SSGEDKETQKISSISELFQV------------------HVN
F7DTH0_CALJA/31-193LLRALG--------AQKEAT-----------SPP--DAAPSAVPLQTITADTFSKLFQV------------------YSN
M3XJ62_LATCH/27-177ILKRLH--------TQE..I-----------PVP--DS....PPQKTVVVRTLGELFHI------------------HVN
G3W289_SARHA/30-190LLRGLG--------TQEEAI-----------FVP--NA.PTAVPLRTFTVGTMDKLFRI------------------YSN
F6WUU2_MONDO/31-191LLRGLR--------TQEETV-----------SLP--DA.PTAAPFRTFTVGTMDKLFRI------------------YSN
G3VW20_SARHA/26-175LGPVLC--------PQS...-----------.LP--KG.......QTAAHREPTAIFLS------------------FQQ
G1PF99_MYOLU/45-207LLRALG--------SQKEAI-----------SLP--DATASAIPLRTFTVDTLCKFFRI------------------YSN
TPO_CANFA/25-176LQGLLG--------TQL...-----------.PP--QG.......RTTTHKDPNAIFLS------------------FQQ
F7G570_MONDO/26-177LQGLLG--------TPS...-----------.LP--KG.......QTIAHREPTAIFLS------------------FQQ
H0W023_CAVPO/30-191LLHLLG--------AQKAPI-----------LPP--DA.ASPAPLRTFPVDTLCKLFQV------------------YSN
H2LEX3_ORYLA/33-182VLRSLN--------FQE...-----------YTP--PA.NASSLDGTWTVSSATELLQV------------------HVN

PF00143

G5E7E1_LOXAF/9-168QLEDLE-------.A----------------CLV--QAM------EEEES..VLAIES...........SAL.....AVK
IFNE_MOUSE/27-185QLEYVE-------.S----------------LGG--LNA------AQKSG..GSSAQN...........LRL.....QIK
G3I0H8_CRIGR/26-185QLSDLQ-------.A----------------CLM--QQV------GEQEP..PLSQED...........SLV.....AVR
H0VF99_CAVPO/28-187QMDHLK-------ST----------------ILQ--ERL------EDKNM..TMRDTM...........TTL.....RLK
L5KKJ7_PTEAL/25-192QLQYLE-------.Q----------------CLE--EEE------KENEDMKEMEEDESKYPGAMVSQLTNL.....ELK
G1U0Q8_RABIT/26-185QLQGLE-------.T----------------CLV--QAM------GEEDS..VLTADS...........PTL.....MLK
F6YZB3_ORNAN/25-183QLEELE-------.V----------------CLE--EDT------DPSQA..SVGSGI...........LRL.....RLK
I3MY95_SPETR/32-186QYQDLK-------.A----------------CVT--HQV------WRQKP...................LGI.....TVK
V8NNB8_OPHHA/15-183QIKMLE-------.T----------------CGN--AEL------EQVIT..SPRNRK........LQLTRL.....RIK
C8CKA7_PIG/26-185QLRDLE-------.A----------------CVM--QEV------GLEGT..PLLEEG...........SIL.....AVR
H0W7G8_CAVPO/26-185QLNDLQ-------.A----------------CLT--QDT------GLEEP..SLLHED...........SRL.....AVR
G3GXU9_CRIGR/27-182QIDFLK-------.K----------------ILK--EMP------KNESL..TTRD.S...........TIP.....RLK
H0XSG1_OTOGA/26-185QLNELE-------.A----------------CLM--QEV------GVGEA..ALMNQD...........SML.....AIR
G1KX99_ANOCA/25-184QSENLK-------.S----------------CLS--ESP------RSQRI.................QLTRL.....KVK
G3I0I6_CRIGR/27-185QLEYVE-------.L----------------LAG--LKA------ESKSG..GLSAQS...........LRL.....QIK
IFNT4_SHEEP/26-185QLDHLD-------.T----------------CRD--QVM------GEKDS..ELGNMD...........PIV.....TVK
L8Y4J0_TUPCH/27-186QLDYLE-------.G----------------LME--LEA------EQKND..ALDSED...........RRL.....HVK
F7B527_HORSE/26-183QLDDLE-------.T----------------CLG--KET------KVEQS..ALGSEI...........STL.....AVK
G1Q950_MYOLU/27-184QMDRLE-------.T----------------ALE--EIT------KEGKF..PWEN.R...........TVL.....RLK
M3WTR1_FELCA/26-186QLEALD-------.A----------------CLL--QAT------GEGER..APGMHG...........PVL.....AIK
G5CB66_HETGA/27-185QMDSLK-------.T----------------LLQ--EIL------EKKDI..TWEDTM...........IIP.....RLK
L9L941_TUPCH/27-198QVEYLE-------.Q----------------CLE--EEE------NEN.DWEKMEEDEMEHSGAAVPQLGNL.....ELK
D2H9N6_AILME/27-184QIEHLE-------.E----------------ILE--KIK------EEENF..TWDD.R...........TLL.....PLK
D3Z919_RAT/26-179QLKDLE-------.A----------------CQN--QQV------GVQEV..PLTQEP...........SWL.....AVR
C8CKB9_PIG/24-176GLDRLE-------..----------------...--...------.......QMEGDN...........LACAYLGSVVR
A8E6F6_XENTR/27-179QIHQLE-------.A----------------CVS--QTE------ENDLLKE.........................SIS
L8Y906_TUPCH/26-185QLEDLE-------.T----------------CLV--QGV------GEEPS..ALETDS...........TTL.....ALR
H9L1C3_CHICK/28-183QIEKLE-------.A----------------CII--KKQ------TQY....FWSKEV...........NRL.....KLK
L5KWM8_PTEAL/106-263QLEDLG-------.I----------------CLV--PEM------KEVES..ALGMED...........PTL.....AVK
G3WZJ8_SARHA/27-182QLEQLE-------.Q----------------CVG--QEA------EQEEP..SLGSEN...........PIL.....VLK
G3UCD2_LOXAF/26-187QLNDLE-------.V----------------CLM--QET------GVEETPVPVINED...........SML.....AVR
K7GQJ6_PIG/17-164QLEDLD-------.P----------------CLV--QVM------GEQAS..SLG................M.....AVK
G3I0H3_CRIGR/26-178LLSDQQ-------.A----------------CLK--QQV------VMQ.........D...........SLM.....AVR
H0VYK7_CAVPO/28-181QMDRLK-------ST----------------ILQ--ERP------EDTNM...................TTL.....RLK
I3N7K4_SPETR/33-202QVEYLK-------.Q----------------CWG--KEN------KEKED...VKADEKKHSEAGVLPLGNL.....KLR
L5K635_PTEAL/26-185QLEDLG-------.T----------------CLV--PEM------KEVES..VLGTED...........PTL.....AMK
H0W3G0_CAVPO/26-185QLEVMK-------.T----------------CLV--QVL------REEGC..VLAIQN...........PIL.....ALR
W5JYQ9_ASTMX/23-179LIEENK-------.C----------------VMS--KTQ------DSLDD..FLKREA...................SLR
G3SI98_GORGO/28-185QAEYLN-------.Q----------------CLE--EDE------NENEDMKEMK.............LSSL.....ELR
H0Y0D2_OTOGA/28-187QLQELE-------.S----------------CLM--SLG------EEEGT..PLMNQG...........PTL.....AVR
IFN_ANAPL/34-190HIHHLE-------.R----------------CFP--ADA------ARLHRRGPRN..............LHL.....SIN
G3UJX3_LOXAF/27-185QRDRLV-------.T----------------ILE--ESM------EEENP..TSRNIM...........TIL.....HLK
G5C259_HETGA/26-185QLSDLE-------.A----------------CLT--QEV------GQEEV..PISHED...........SRL.....AVR
G3WZF5_SARHA/26-185QMEHLE-------.M----------------ALK--EEM------NQVNS..TRLNEE...........SIQ.....HLN
IFNE_PIG/27-186QLEYLE-------.A----------------LMR--LQA------EQKSD..TLCSEN...........LTL.....QVK
W5N6G4_LEPOC/27-185QIRQLT-------.L----------------CAG--SEM------KFSGEPNRLGVSV...................VLK
H9KYA4_CALJA/26-185QLNYLE-------.A----------------CVM--QRI------GVEGT..PLMNAD...........SIL.....AVR
D2HTQ4_AILME/33-205QLQYLE-------.Q----------------CLE--EEE------KEKEDSKELEEDGMNWSGALVPQLSNL.....ELR
IFNB_HUMAN/27-185QINHLK-------.T----------------VLE--EKL------EKEDF..TRGKLM...........SSL.....HLK
G1NR05_MELGA/32-188YIHHLE-------.Q----------------CFV--DQG------TRSQKQGPRN..............SHL.....SIN
F7BVP5_ORNAN/23-181EMMRLE-------.V----------------FLE--EEM------GWENS..TLRRD............ISL.....HIK
F7G875_MONDO/27-182QMLHLE-------..----------------...--EEM------DQANS..SWESLE...........SIL.....RLK
C8CKC3_PIG/33-205QLQVLE-------.Q----------------CLQ--EEE------EENEDIKEMDEVERKPSGATVPPSHSL.....ELR
I3MVD7_SPETR/34-186QLDDLK-------.A----------------CGT--QQV------GVEEA..PLR......................AVR
F7A317_HORSE/26-184QLTELE-------.A----------------CLS--QEV------GVEET..PLMNED...........SLL.....AVR
G1KU56_ANOCA/28-182EIAKLT-------.P----------------CLS--EDK------QEIRE...........................DVK
L5KBH2_PTEAL/26-185QLEDLG-------.T----------------CLV--PEM------KEAES..ALGMED...........PAL.....AVK
L5K909_PTEAL/26-185QLNHLE-------.A----------------CQT--QEV------GTEET..PLLDED...........STV.....AVR
I3N5Z0_SPETR/23-179QLEYLE-------.T----------------LLG--LEA------EQKSH..AQGSKN...........LRL.....QVK
F7GHL9_MONDO/26-181QLGQLE-------.S----------------CLG--QDA------EWEVP..SLGSEN...........PMM.....ALK
IFNE_HUMAN/27-186QLEYLE-------.A----------------LMG--LEA------EKLSG..TLGSDN...........LRL.....QVK
I3LBU7_PIG/26-179QMEDLD-------.S----------------CLV--QVR------GEQVS..ALG................I.....VVW
G3UK87_LOXAF/27-184QLEDLE-------.T----------------CSM--QAV------GEGSV...LAIEG...........PVL.....AVK
L9LC61_TUPCH/27-185QMDHLE-------.T----------------MLE--EKL------EEENV..TWGNSM...........SVM.....HLK
IFNB_RAT/27-182QTELLE-------.I----------------ILK--EK.------QEERL..TWVTST...........TTL.....GLK
H0XMZ9_OTOGA/27-186QLEYLE-------.A----------------LTG--LEA------EQRSG..TVGIEK...........LRL.....QVK
G3VDC6_SARHA/27-182QLEQLK-------.S----------------CVG--QEV------EWKEH...LKSEN...........PRIQ....ALQ
I3JM36_ORENI/26-182QAEELH-------.S----------------CIG--SHS------HKKKN...................SQLYF...KTE
L5LKN9_MYODS/27-186QLEYLE-------.T----------------LRG--LQT------DQKSS..TVGREK...........LRL.....QVK
G1TYS8_RABIT/29-195QVAYLE-------.Q----------------CLM--EDI------HETKE......EEMKYSGTGRFLLNNL.....ELR
I3UJJ8_FELCA/27-185QLEYLE-------.E----------------LTG--PEA------EQDSC..ILGSEN...........VRL.....QIK
C8CKA9_PIG/26-183QLDDLE-------.K----------------CLR--EGK------KVEQS..PPGGEN...........SIL.....AVK
IFNT2_BOVIN/3-162QLEDLD-------.A----------------CLG--QVM------EEKDS..DMGRMG...........PIL.....TVK
H0W510_CAVPO/26-186LLKALQ-------.A----------------CLT--QEA------GLQEP..LLMHED...........SRL.....AVR
M3Z729_MUSPF/26-183QMSHLE-------.A----------------CPL--QEA------GVEEK..PLVNRD...........SIL.......R
IFNA1_MOUSE/26-185QLNDLQ-------.G----------------CLM--QQV------GVQEF..PLTQED...........ALL.....AVR
G3TTC1_LOXAF/26-185QQEDLE-------.T----------------CFM--QAM------EEGKS..ALPIEG...........PAL.....AVK
G1PDS6_MYOLU/29-199QLQYLE-------.Q----------------CLK--EE.------KGNEDKEEMEEDERRHPGARTPQPSNL.....ELR
F7ABU5_MONDO/27-182QLEQLE-------.R----------------CLG--QNV------KWEEF..SLRSEK...........TRF.....ALK
G1TTX4_RABIT/27-180QIHHLK-------.S----------------KIN--KKV------.......TLESIR...........MNL.....RLK
H0XRP5_OTOGA/26-185QLNELE-------.A----------------CLM--PDE------GVEDT..APMGED...........PVL.....ALR
H0WK94_OTOGA/33-202QLEYLE-------.Q----------------CLQ--EEE------NENAD...VKEAAMKYSGAQGPQVHNL.....ELR
G1KYL3_ANOCA/23-176QSENLK-------.S----------------CLS--ASP------R....................IQLTRL.....RVK
G3WZQ8_SARHA/26-181QLDQLE-------.Q----------------CLG--QDV------EREEP..SLGSEN...........PSL.....VLK
H2R6R8_PANTR/26-185QLNDLE-------.A----------------CVI--QEV------GVEET..PLMNED...........SIL.....AVR
H0YTY6_TAEGU/34-188HIHHLE-------.Q----------------CLP--DNA------LLFKG..PRN..............PLL.....TIN
I3MXH1_SPETR/27-185QMDLLN-------.T----------------TVV--EKL------GEENK..RQAYSM...........IIL.....RLK
M3WRV1_FELCA/26-184QLTRLE-------.A----------------CVV--QEV------GEGEA..PLTNED...........SLL.......R
H0W4H8_CAVPO/23-182QLNDLE-------.A----------------CLT--QET------GLEEP..PLMHED...........SRL.....VVR
R4GKJ6_CHICK/35-191YTQHLE-------.Q----------------CLD--SSD------TRSRTRWPRN..............LHL.....TIK
A3FBE8_MUSPF/27-184QKEHLE-------.E----------------ILE--DIM------QEENV..TWDH.R...........TLL.....HLK
G1KWE0_ANOCA/28-180QSENLK-------.S----------------CLS--ASP------RSQRI.................QLTSL.....RVK
G7PS89_MACFA/26-185QLNDLE-------.S----------------CVM--QEV------GVTET..HLMYED...........SIL.....AVK
G1Q880_MYOLU/26-185QLEDLE-------.A----------------CLV--EEM------GEEGS..ALAMEG...........PTL.....ALK
IFNB_MOUSE/27-180QTVFLK-------.T----------------VLE--EK.------QEERL..TWEMSS...........TAL.....HLK
IFNB2_BOVIN/27-184QMNHLE-------.P----------------IQK--EIM------QKQNS..TMGD.T...........TVL.....HLR
G1SJC4_RABIT/26-185QQSDLE-------.V----------------CMM--QGA------GAEEM..PLKHED...........SAW.....AVR
W5PG31_SHEEP/26-185QLTDLQ-------.A----------------CLR--QEE------GLRGA..PLLKED...........SSL.....AVR
IFNA3_CANFA/26-183QLDDLD-------.A----------------CPL--QEA------GLAET..PLMHED...........STL.......R
G5BPX2_HETGA/27-199QREYLE-------.Q----------------CLK--EEK------KENKGMQEMKTHELEHSGVQVVQQSKL.....ALR
IFNW2_HORSE/26-185QLEDLD-------.T----------------CLE--QEM------GEEES..ALGTVR...........PTL.....AVK
G3N2A8_BOVIN/26-185QLDDLD-------.A----------------CLG--QVM------GEEDS..ALGRMG...........PTL.....AMK
H0XKS8_OTOGA/27-185QMDSLE-------.T----------------TLD--EKL------EDKNF..IGGKVT...........NIL.....HLK
H0VUV7_CAVPO/26-185QMNDLK-------.A----------------CLT--KET------GLEDP..SLWHED...........SRN.....AVK
Q29412_PIG/27-184QMDDLE-------.T----------------ILE--EIM------EEENF..PRGD.M...........TIL.....HLK
G7PS88_MACFA/26-185QLNDLE-------.A----------------CVM--QQE------RVGET..PLMNAD...........STL.....AVK
M3WZS7_FELCA/26-181QLDDLE-------.T----------------CLR--EEM------NMEQL..PLGNEN...........SRL.....AVK
H9GZR7_HORSE/26-185QLEDLN-------.T----------------CLD--EQT------GEEES..ALGTVG...........PTL.....AVK
F1LVL8_RAT/26-184QLGYLE-------.S----------------LGG--LKA------ERKSG..GLSVKD...........LRL.....QIK
M3YX13_MUSPF/27-179QLEYLG-------.A----------------LRG--LGA------EQNSG..VLSGGN...........SRM.....QVK
G1L8G2_AILME/26-185QLEDLE-------.T----------------CLE--EEK------NVEQL..LLGSEN...........SRL.....AVK
IFNB_HORSE/27-184QMDRLE-------.T----------------NLE--EIM------EEESS..TWGN.T...........TIL.....RLK
H0W289_CAVPO/26-190QLEAMK-------.I----------------CMV--QEA------GGEES..ALATED...........LTLNHSWRTLM
A8E6E8_MONDO/27-182QIEQLE-------.R----------------CLT--QDV------EQDEP..SLGREN...........PLM.....ALK
I3N788_SPETR/27-185QMDLLE-------.T----------------ILE--KKL------GEENK..SWGNSR...........TIL.....HLK
G1L8I1_AILME/26-183QLSVLE-------.A----------------CPM--QAA------GVGET..PVRNVD...........SIL.......R
IFNB_FELCA/27-184QKEHLE-------.T----------------ILE--EIM------EEENF..TWDN.T...........TLL.....NLK
H0VXI5_CAVPO/26-181HLKHLH-------.A----------------CLT--QEV------GLQEP..PLMHED...........SRQ.....AVR
G3TS29_LOXAF/26-179QLNDLE-------.I----------------CFE--KER------KVEQI..PLGTEN...................SVK
W5PZ39_SHEEP/26-184QLQYLE-------.Q----------------CLE--EEE------R..............PSGAPVLQPSNL.....ELR
G3I0H6_CRIGR/26-178QFNALK-------.A----------------CLM--HQV------GMQ.........D...........SQV.....AMK
I3L756_PIG/26-180QLEDLD-------.P----------------CLV--QEM------EEQTF..ALG................M.....AVK
M3Z715_MUSPF/26-183QVNDLQ-------.A----------------CLM--QEA------GVEEM..ALVNGD...........SIL.......R
M3VXI8_FELCA/33-205QMHHLE-------.K----------------CFE--EEE------KGKEDSKQREEDGMDFSGAMVSQVSSL.....ELR
G3R8Q7_GORGO/26-185QLQHLE-------.T----------------CLL--QVM------GEGES..AGTIRS...........PAL.....TLR
A8E6F5_XENTR/51-202QINQLE-------.A----------------CIP--ETA------ENPVFNQ.........................TIS

PF02947

FLT3L_MOUSE/30-162EIHFVT--------S----------------CTF--QPL------PECLRFVQTNISH-----------LLK-----DTC
F6T7S9_ORNAN/28-157EVDFVN--------D----------------CGF--QRP------QKCARFQQINISQ-----------FLG-----DVS
H9GP84_ANOCA/29-165HTTFVE--------M----------------CDI--N..------DSCVKFITTNISE-----------FLE-----PIP
F6TPW7_MONDO/34-163EISFVR--------K----------------CFS--EAL------PGCLHFRKANISH-----------LLL-----DIS
G5B8P0_HETGA/20-150EIHFVT--------S----------------CAF--QPL------PSCLRFVQTNISH-----------LLQ-----DTV
G1M637_AILME/29-159EIHFVT--------L----------------CAL--QPL------PSCLRFVQTNISH-----------LLQ-----DTS
L9JA37_TUPCH/769-910EIHFVT--------S----------------CDF--QPL------PSCLRFVQTNISD-----------LLQ-----DTS
G3VSA3_SARHA/79-209EIDFVG--------Q----------------CVN--QSF------PSCLRFRKANISH-----------LLL-----EVS
G1QZC3_NOMLE/30-160EIHFVT--------K----------------CAF--QPP------PSCLRFVQTNISR-----------LLQ-----ETS

PF00489

IL6_BOVIN/27-208NIRTLI--------Q----------------ILK--QKIADL..ITT..PATNTDLLE-----------KMQ-----SSN
M3X721_FELCA/27-208STNVLL--------Q----------------MLK--RKGKNQDEVTIPVPTVEVGLQA-----------KLQ-----SQE
IL6_HORSE/27-208STKVLV--------Q----------------ILM--QKMKNP.EVTTPDPTAKSSLLA-----------KLH-----SQN
G3UHF3_LOXAF/20-205STKALV--------Q----------------ILK--QKIKNPEDVTTPDPTANASLLS-----------KLQ-----LQT
L5KPK4_PTEAL/20-202RTKALV--------Q----------------VLK--QKVKNPNEITTPDPTTNSSLLA-----------KLQ-----SQS
F7HV62_CALJA/27-212STKGLI--------Q----------------SLQ--KKAKNLSAIATPDPATNASLLT-----------KLQ-----AQD
IL6_MOUSE/26-210DTETLI--------H----------------IFN--QEVKDLHKIVLPTPISNALLTD-----------KLE-----SQK

PF16647

CSF3_BOVIN/42-190DVTDFA--------T----------------NIW--LQMEDLGAAPAVQPTQGAMPT--------------------FTS
CSF3_HUMAN/51-202DVADFA--------T----------------TIW--QQMEELGMAPALQPTQGAMPA--------------------FAS
CSF3_MOUSE/57-205DVANFA--------T----------------TIW--QQMENLGVAPTVQPTQSAMPA--------------------FTS

PF06875

Q5BNQ4_9SALA/2-215KISDIM--------T----------------QMG--MSV------TITLPKP---LVV-----------PFK-----GSA
Q5BNQ2_9SALA/2-215KISDIM--------T----------------QMG--MSV------TITLPKP---LVV-----------PFE-----GSA

PF01110

CNTF_CHICK/1-194HLEELL--------E----------------LES--RGA------PAEEGSE---PPA-----------.PP-----RLS
G3VWZ5_SARHA/1-195EMEELM--------A----------------LLG--HQA------PSQETDS---GPV-----------GGS-----HRT
E1BFH9_BOVIN/1-193QLEELM--------A----------------LLE--HRV------PPREAGG---PPL-----------LPG-----DAG
G5AP46_HETGA/1-192QLEELM--------V----------------LLE--HEI------PPNETSG---VPL-----------..G-----EGG
H0Z9U1_TAEGU/1-188HLEELL--------R----------------LES--RGI------PGEEGDG---PPP-----------.PP-----RLS
CNTF_HUMAN/1-194QIEELM--------I----------------LLE--YKI------PRNEADG---MPI-----------NVG-----DGG

PF01291

LIF_MOUSE/44-203NVLCRL--------C----------------NKY--RVG....HVDVP.......PVP-----------DHS-----DKE
LIF_BOVIN/43-202NVLCRL--------C----------------SKY--HVS....HVDVT.......YGP-----------DTS-----GKD
ONCM_HUMAN/37-209NIYCMA--------Q----------------LLD--NSD...TAEPTKAGRGASQPPT-----------PTP-----ASD
ONCM_MOUSE/34-194NVFCMA--------R----------------LLN--HSL..EIPEPTQTDSG...ASR-----------STT-----TPD
ONCM_BOVIN/34-194NIHCMA--------Q----------------LLR--GSSDPKAAEPTQPGPGPT.PLP-----------PTP-----PSS

PF03039

IL12A_MOUSE/6-215AIDELM--------Q----------------SLN--HNG---ETLRQK-------PPV-----------G..-----EAD
G3VQT1_SARHA/40-247AIDEMM--------Q----------------ALN--FSS---ENMTVT-------PSP-----------K..-----EPD
F6T5A8_MONDO/5-202AIEEMM--------Q----------------ALN--FNS---KNVPLI-------SSP-----------K..-----ESD
IL12A_PIG/6-222AITELM--------Q----------------ALN--FNS---ETVPQK-------PSL-----------E..-----ELD
L8YEA2_TUPCH/1-213AIDELM--------Q----------------ALN--FNS---DTVPRS-------YSL-----------E..-----EPD
H0X861_OTOGA/6-217VMEKLM--------Q----------------DLN--STS---ETVMHP-------SSH-----------E..-----ETN
G1QWH2_NOMLE/40-254ELQALR--------H----------------ALN--FNS---ETVPQK-------SSL-----------E..-----EPD
I3MN91_SPETR/4-220AVDYLM--------Q----------------AVN--VNN---ETVPQT-------PSP-----------EAP-----SPN
Q924V6_CAVPO/6-221AIDELI--------Q----------------ALN--GSD---VTVPQK-------LSL-----------E..-----EPD

PF02024

H3AP27_LATCH/26-169LLQTLA--------T----------------TMG--CEL------HQTTELETLKDLA-----------KEH-----STS
G3WWV6_SARHA/23-167LLHLLG--------S----------------LKS--CPF------DEADGLSALGNLE-----------GVM-----EAS
F6PLK2_ORNAN/23-167LFALLA--------T----------------LKN--CPF------TRSDGLDTMEIWG-----------GIV-----EES
F7HGW1_CALJA/23-167LLHLLA--------A----------------SKS--CHL------PWASGLENLANLG-----------GVL-----EVS
G5BHA4_HETGA/23-167LVHMLA--------S----------------SKG--CPL------PQTRGPELLENLG-----------GAL-----KES
W5NER9_LEPOC/28-172IIKSLA--------T----------------SVN--CAP------LKSSNMSHLESFL-----------KTN-----AAF
H0V7C6_CAVPO/23-165LVQMMA--------S----------------SKG--CPL------PHTTEPE.LQDLE-----------STL-----KES
LEP_HUMAN/23-167LLHVLA--------F----------------SKS--CHL------PWASGLETLDSLG-----------GVL-----EAS

PF02372

IL15_PIG/33-160NINEFLK------------------------------------------------------------------------S
IL15_CAVPO/33-160SIAEFLQ------------------------------------------------------------------------S
IL15_FELCA/33-160NIKEFLQ------------------------------------------------------------------------S
IL15_SHEEP/33-160SIKEFLK------------------------------------------------------------------------S
F1NZN5_CHICK/55-183NFTEFIQ------------------------------------------------------------------------S
G1NDP6_MELGA/5-137NFPDFLQ------------------------------------------------------------------------Q
O73883_CHICK/5-138KFPDFLH------------------------------------------------------------------------E
Q8JFF4_ANAPL/4-134NFPEFRQ------------------------------------------------------------------------E

PF00715

I3MQX6_SPETR/7-151NIVEFLN------------------------------------------------------------------------T
G5C793_HETGA/7-149NIVQFLK------------------------------------------------------------------------G
G1PJ32_MYOLU/7-147TIVEFLN------------------------------------------------------------------------K
B1AB81_HORSE/7-146TIVEFLN------------------------------------------------------------------------K
G3HTL8_CRIGR/7-150TVVEFLS------------------------------------------------------------------------R
IL2_MACMU/7-151TIVEFLN------------------------------------------------------------------------R
H0Y254_OTOGA/7-149TIVEFLN------------------------------------------------------------------------R
IL2_MOUSE/7-165TVVDFLR------------------------------------------------------------------------R
G3SU90_LOXAF/7-147TIEEFLN------------------------------------------------------------------------K
IL2_PIG/7-151TAVEFLN------------------------------------------------------------------------K
IL2_FELCA/7-151TIVEFLN------------------------------------------------------------------------K
L5K7D9_PTEAL/7-149NVKEFLN------------------------------------------------------------------------K
IL2_BOVIN/7-152NAVEFLN------------------------------------------------------------------------K
H0VBY4_CAVPO/7-149NIVEFLK------------------------------------------------------------------------R

PF00103

PLRP1_BOVIN/26-238RHSEFYN------------------------------------------------------------------------L
CSH2_BOVIN/26-238SISEYYN------------------------------------------------------------------------L
PLRP3_BOVIN/1-213RHSAFYK------------------------------------------------------------------------L
PR4A1_RAT/17-227RYFAFYN------------------------------------------------------------------------L
CSH1_BOVIN/26-236RQTAFYR------------------------------------------------------------------------M
PLRP4_BOVIN/26-239RHSAFYS------------------------------------------------------------------------L
PR3D4_RAT/16-223HLFAIYN------------------------------------------------------------------------L
PR2C2_MOUSE/16-224RIHSLYG------------------------------------------------------------------------M
SOM2_HUMAN/9-215ALLKNYG------------------------------------------------------------------------L
PR8A5_RAT/17-238KFLAIFN------------------------------------------------------------------------L
PR6A1_RAT/20-234RHFAFTN------------------------------------------------------------------------L
PR7D1_MOUSE/17-240QFFALYM------------------------------------------------------------------------F
CSH2_HUMAN/9-215ALLKNYG------------------------------------------------------------------------L

PF00726

IL10_BOVIN/5-174ELQERGVY------------------------------------------------------------------------
IL10H_EBVB9/7-167KLQEKGIY------------------------------------------------------------------------
G3HB01_CRIGR/14-174KLQEKGVY------------------------------------------------------------------------

PF14565

IL22_HUMAN/40-178KLGESGEI------------------------------------------------------------------------
E1C1U2_CHICK/46-184ELGENGKN------------------------------------------------------------------------

PF05337

CSF1_HUMAN/41-180NVFNETKN------------------------------------------------------------------------
Q3TLQ6_MOUSE/41-180NFFNETKN------------------------------------------------------------------------
O77709_BOVIN/41-180NVFNETKN------------------------------------------------------------------------
O77710_BOVIN/41-180NVFNETKN------------------------------------------------------------------------
Q64129_9MURI/41-180NFFNETKN------------------------------------------------------------------------

PF15036

IL34_MOUSE/28-184LLSTPGLS.....----------------------------------------------------------------LKL
R4GIU3_CHICK/19-177QLHSGDSR.....----------------------------------------------------------------QKA
F7EA00_CALJA/29-185LLNAPGPN.....----------------------------------------------------------------LKL
H0WFN4_OTOGA/28-184LLNAPGLS.....----------------------------------------------------------------RKL
M3ZVZ0_XIPMA/24-191QLTEEPDRVPESS----------------------------------------------------------------WRF
U3JY35_FICAL/18-179LIHSAGAE...SR----------------------------------------------------------------SKA
L9KJY3_TUPCH/28-184HLNTPGLI.....----------------------------------------------------------------LKL
G3T3A6_LOXAF/28-182LLSAPG.......----------------------------------------------------------------LKL
F6W3U1_MONDO/15-167LANS.GRD.....----------------------------------------------------------------QKL
I3JZ08_ORENI/24-192SLTEKPENMPESS----------------------------------------------------------------WRF
L5MCR9_MYODS/28-182LPSDRRLS.....----------------------------------------------------------------LKL
B3DLJ8_DANRE/23-195HLTEQDYK....G----------------------------------------------------------------WKS
IL34_BOVIN/28-183LLSAPG.S.....----------------------------------------------------------------LKL

PF00714

IFNG_HORSE/15-152KLIQIPVN----------------------------------------------------------------------DL
H0WPL1_OTOGA/15-151NLLRISVH----------------------------------------------------------------------DL
Q8CGS0_CAVPO/15-154NLIQISVN----------------------------------------------------------------------DE
B9VS86_CALJA/15-152RLTNYSVN----------------------------------------------------------------------DL
G3SUC6_LOXAF/15-152KVMQTPVN----------------------------------------------------------------------DR
G3GY20_CRIGR/2-135RITKIPVN----------------------------------------------------------------------DV
I3MNV6_SPETR/15-152KVSQFQVN----------------------------------------------------------------------DL
L5LME8_MYODS/15-153KLIQTPVN----------------------------------------------------------------------DQ
G5BGB5_HETGA/15-152SLTRISVD----------------------------------------------------------------------NV
G3WQJ9_SARHA/15-153ALINTQVN----------------------------------------------------------------------DL
IFNG_SHEEP/15-152RLIQIPVD----------------------------------------------------------------------DL
IFNG_RAT/14-151SIAKFEVN----------------------------------------------------------------------NP
IFNG_RABIT/15-152NLTRISVD----------------------------------------------------------------------DR
L9KVU0_TUPCH/51-188NLTRISVN----------------------------------------------------------------------DV
IFNG_FELCA/15-153KLIQIPVN----------------------------------------------------------------------DL

PF02404

R4GD07_ANOCA/1-283KHFSNTVESYKIL.AKTPVQSDCVLPSTTETPPNDSRLSVTKSFLSYPFAASHLKNDSSG....NHNNEAALGFLGSPGM
SCF_CHICK/1-287RLFNSTIEVYKEF.ADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSL
SCF_RAT/1-273SIFNRSIDAFKDF.MVASDTSDCVLS.STLGPEKDSRVSVTKPFMLPPVAASSLRNDS......SSSNRKAAKSPEDPGL
G1NWC8_MYOLU/1-272RIFNRSINAFKDLEMVSSKTSECVFS.STLSPGNDSRVSVTKPFMLPPVAANSLRNDS......SSSNRKALNSIGDSKL
F7EP53_MONDO/1-273RFFNKSIDAFKEY.EETSEHSNCVLP.STIGPERDSRVNVTKPFLLPPVAASSLRNDS......SSSNRKAAGSTKDPSV
F7C5I3_ORNAN/1-273GYFNRSIEAFRDF...QAEHSDCIFPTTTLMPEKDSRVSVTKPFLLPPVAASSLKNDS......TSSNREAFGYISSSSL
F7G0W2_CALJA/1-273RIFNRSIDAFKDF.VVASETSDCMAS.STLSPEKDSRVSVTKPFMLPSVAANSLRNDS......SSSNRKAKNPPGDSGL

PF03487

G1SCQ2_RABIT/16-144QFLKELR------------------------------------------------------------------------R
IL13_HUMAN/16-144QFVKDLL------------------------------------------------------------------------L
IL13_RAT/2-130QFISKLL------------------------------------------------------------------------N
F7DGH7_MACMU/16-151QFVKDLL------------------------------------------------------------------------V
L5M5Z7_MYODS/2-128RLAKDLL------------------------------------------------------------------------Q
G5ASP9_HETGA/2-130QFVQTLL------------------------------------------------------------------------R
B3GDZ5_PIG/2-130QFVKDLL------------------------------------------------------------------------K
L8YAP6_TUPCH/2-128QFVKDLL------------------------------------------------------------------------R
IL13_BOVIN/2-130QFLKDLL------------------------------------------------------------------------R
IL13_MOUSE/2-130HFITKLL------------------------------------------------------------------------S
H0W834_CAVPO/16-149EFVKKLR------------------------------------------------------------------------I
F6WQF3_ORNAN/2-128MFLKKML------------------------------------------------------------------------P
G3T2N9_LOXAF/2-133TFMKNLL------------------------------------------------------------------------D
M3YGH3_MUSPF/2-126QLVKNLL------------------------------------------------------------------------T
B5FW67_OTOGA/2-129QFIKDLL------------------------------------------------------------------------R
I3MAR4_SPETR/2-131QFVKKLL------------------------------------------------------------------------S
IL13_CANFA/2-129QLVKNLL------------------------------------------------------------------------T

PF00727

IL4_FELCA/26-131DFLERLK------------------------------------------------------------------------A
H0XDE1_OTOGA/26-149DFLERLK------------------------------------------------------------------------T
IL4_MOUSE/27-140DFLESLK------------------------------------------------------------------------S
G3T4B8_LOXAF/26-132.VIEKLK------------------------------------------------------------------------T
IL4_RABIT/28-143DFLDRLK------------------------------------------------------------------------T
G5ASQ0_HETGA/25-138DFLENLK------------------------------------------------------------------------T
F6U5N6_HORSE/26-135DFLERLK------------------------------------------------------------------------T
IL4_BOVIN/26-133DLLERLK------------------------------------------------------------------------T
G3QSC0_GORGO/26-149DFLERLK------------------------------------------------------------------------T
A3FBF0_MUSPF/26-130DFLERLK------------------------------------------------------------------------V
IL4_RAT/27-139DFLESLK------------------------------------------------------------------------S
G3WEJ0_SARHA/28-149DFLSKLK------------------------------------------------------------------------T
I3MAS4_SPETR/24-141DFLESLK------------------------------------------------------------------------T
IL4_PIG/26-131DFLERLK------------------------------------------------------------------------T

PF01109

CSF2_RAT/18-139DFIKNLK------------------------------------------------------------------------G
CSF2_MOUSE/18-136DFIDSLK------------------------------------------------------------------------T
CSF2_BOVIN/18-138NFKEDLK------------------------------------------------------------------------E
CSF2_CAVPO/18-140SFKENLK------------------------------------------------------------------------R
CSF2_PIG/18-139SFKDSLN------------------------------------------------------------------------K
CSF2_HUMAN/18-139SFKENLK------------------------------------------------------------------------D
CSF2_CANFA/18-139SFKENLK------------------------------------------------------------------------D

PF02025

G1RQD7_NOMLE/22-133QFLDYLQ------------------------------------------------------------------------E
IL5_CAVPO/23-134QFLDYLQ------------------------------------------------------------------------E
J9NWP5_CANFA/22-132KFLDYLQ------------------------------------------------------------------------V
IL5_MOUSE/21-132QFLDYLQ------------------------------------------------------------------------E
G3WAR7_SARHA/25-134QFLDYLE------------------------------------------------------------------------E
IL5_HORSE/22-133QFLDYLQ------------------------------------------------------------------------E
B5FW65_OTOGA/22-133QFLDYLQ------------------------------------------------------------------------E
I3MDT8_SPETR/23-134QFLEYLQ------------------------------------------------------------------------E
G3T4B0_LOXAF/23-133QFLDYLE------------------------------------------------------------------------E
G1SL79_RABIT/22-133HFLDYLQ------------------------------------------------------------------------E

PF02059

IL3_CANFA/19-132DFQRKLK------------------------------------------------------------------------K
IL3_MOUSE/27-138DFRKKLR------------------------------------------------------------------------F
IL3_BOVIN/18-132DFRMKLE------------------------------------------------------------------------E
G3UC30_LOXAF/22-133DFRGKLY------------------------------------------------------------------------P
G1MH15_AILME/18-131DFQKKLK------------------------------------------------------------------------K
F1RJV6_PIG/18-131DFRAKLM------------------------------------------------------------------------E
G1RQ11_NOMLE/20-137EFRRKLK------------------------------------------------------------------------F
IL3_CALJA/19-136DFQMKLK------------------------------------------------------------------------F
F1LS41_RAT/29-138DFKKKLR------------------------------------------------------------------------F

PF07400

IL11_HUMAN/22-199GIRAAHA------------------------------------------------------------------------I

PF00758

G3TYQ1_LOXAF/25-173...AALS------------------------------------------------------------------------F
W5K758_ASTMX/26-175FLRGKVR------------------------------------------------------------------------L
B1N8Y2_DANRE/15-168FLRGKAR------------------------------------------------------------------------L
F7DTH0_CALJA/31-193FIRGKLK------------------------------------------------------------------------L
M3XJ62_LATCH/27-177FLRGKVK------------------------------------------------------------------------L
G3W289_SARHA/30-190FLRGKLK------------------------------------------------------------------------L
F6WUU2_MONDO/31-191FLRGKLK------------------------------------------------------------------------L
G3VW20_SARHA/26-175LLRGKVR------------------------------------------------------------------------F
G1PF99_MYOLU/45-207FLRGKLK------------------------------------------------------------------------L
TPO_CANFA/25-176LLRGKVR------------------------------------------------------------------------F
F7G570_MONDO/26-177LLRGKVR------------------------------------------------------------------------F
H0W023_CAVPO/30-191FLRGKLK------------------------------------------------------------------------L
H2LEX3_ORYLA/33-182FLRGKVR------------------------------------------------------------------------L

PF00143

G5E7E1_LOXAF/9-168RYFQGIH.-----------------------------------------------------------------------S
IFNE_MOUSE/27-185AYFRRIH.-----------------------------------------------------------------------D
G3I0H8_CRIGR/26-185KYFHRIT.-----------------------------------------------------------------------A
H0VF99_CAVPO/28-187SYYWRIS.-----------------------------------------------------------------------K
L5KKJ7_PTEAL/25-192RYFHRIS.-----------------------------------------------------------------------S
G1U0Q8_RABIT/26-185RYFQRIR.-----------------------------------------------------------------------L
F6YZB3_ORNAN/25-183SYFRGIS.-----------------------------------------------------------------------L
I3MY95_SPETR/32-186KCFQRIT.-----------------------------------------------------------------------D
V8NNB8_OPHHA/15-183RYFQRLS.-----------------------------------------------------------------------D
C8CKA7_PIG/26-185KYFHRLT.-----------------------------------------------------------------------L
H0W7G8_CAVPO/26-185KYFHRIA.-----------------------------------------------------------------------V
G3GXU9_CRIGR/27-182SYYERMQ.-----------------------------------------------------------------------R
H0XSG1_OTOGA/26-185SYFQRIT.-----------------------------------------------------------------------L
G1KX99_ANOCA/25-184KYFRSLS.-----------------------------------------------------------------------D
G3I0I6_CRIGR/27-185SYFRRIH.-----------------------------------------------------------------------D
IFNT4_SHEEP/26-185KYFQGIH.-----------------------------------------------------------------------D
L8Y4J0_TUPCH/27-186KYFRRIR.-----------------------------------------------------------------------N
F7B527_HORSE/26-183RYFRRIS.-----------------------------------------------------------------------L
G1Q950_MYOLU/27-184TYYLGIF.-----------------------------------------------------------------------Q
M3WTR1_FELCA/26-186RYFQDIR.-----------------------------------------------------------------------V
G5CB66_HETGA/27-185GYYWRIR.-----------------------------------------------------------------------R
L9L941_TUPCH/27-198RYFNRIK.-----------------------------------------------------------------------N
D2H9N6_AILME/27-184RYYLRIV.-----------------------------------------------------------------------R
D3Z919_RAT/26-179EYFGRIT.-----------------------------------------------------------------------M
C8CKB9_PIG/24-176KYFQRIH.-----------------------------------------------------------------------R
A8E6F6_XENTR/27-179EEFNLLE.-----------------------------------------------------------------------T
L8Y906_TUPCH/26-185GYFQGLH.-----------------------------------------------------------------------L
H9L1C3_CHICK/28-183KYFQKID.-----------------------------------------------------------------------S
L5KWM8_PTEAL/106-263RYFQGIR.-----------------------------------------------------------------------L
G3WZJ8_SARHA/27-182SYFQGIR.-----------------------------------------------------------------------A
G3UCD2_LOXAF/26-187KYFQRIT.-----------------------------------------------------------------------V
K7GQJ6_PIG/17-164RYFERIH.-----------------------------------------------------------------------L
G3I0H3_CRIGR/26-178KYFHRIT.-----------------------------------------------------------------------V
H0VYK7_CAVPO/28-181SYYWRIS.-----------------------------------------------------------------------R
I3N7K4_SPETR/33-202RYFSRIY.-----------------------------------------------------------------------N
L5K635_PTEAL/26-185RYFQGIH.-----------------------------------------------------------------------L
H0W3G0_CAVPO/26-185RYFLGIR.-----------------------------------------------------------------------L
W5JYQ9_ASTMX/23-179AYFQNIT.-----------------------------------------------------------------------A
G3SI98_GORGO/28-185RYFHRID.-----------------------------------------------------------------------N
H0Y0D2_OTOGA/28-187SYFQRLI.-----------------------------------------------------------------------L
IFN_ANAPL/34-190KYFGCIQ.-----------------------------------------------------------------------H
G3UJX3_LOXAF/27-185NYYLGIG.-----------------------------------------------------------------------Q
G5C259_HETGA/26-185KYFHRIT.-----------------------------------------------------------------------L
G3WZF5_SARHA/26-185NYYQRIM.-----------------------------------------------------------------------N
IFNE_PIG/27-186MYFQRIR.-----------------------------------------------------------------------D
W5N6G4_LEPOC/27-185TSFAKLE.-----------------------------------------------------------------------K
H9KYA4_CALJA/26-185KYFERIT.-----------------------------------------------------------------------L
D2HTQ4_AILME/33-205RYFNRID.-----------------------------------------------------------------------N
IFNB_HUMAN/27-185RYYGRIL.-----------------------------------------------------------------------H
G1NR05_MELGA/32-188KYFRSIH.-----------------------------------------------------------------------N
F7BVP5_ORNAN/23-181SYFKRMM.-----------------------------------------------------------------------D
F7G875_MONDO/27-182NYYQGIT.-----------------------------------------------------------------------N
C8CKC3_PIG/33-205RYFNRID.-----------------------------------------------------------------------K
I3MVD7_SPETR/34-186KYFHRIT.-----------------------------------------------------------------------V
F7A317_HORSE/26-184RYFQRIA.-----------------------------------------------------------------------L
G1KU56_ANOCA/28-182KYFERIH.-----------------------------------------------------------------------T
L5KBH2_PTEAL/26-185KYFQGIR.-----------------------------------------------------------------------L
L5K909_PTEAL/26-185KYFQRIT.-----------------------------------------------------------------------L
I3N5Z0_SPETR/23-179AYFRRIH.-----------------------------------------------------------------------N
F7GHL9_MONDO/26-181SYFQGIS.-----------------------------------------------------------------------R
IFNE_HUMAN/27-186MYFRRIH.-----------------------------------------------------------------------D
I3LBU7_PIG/26-179KYFQRIH.-----------------------------------------------------------------------R
G3UK87_LOXAF/27-184RYFQEI..-----------------------------------------------------------------------L
L9LC61_TUPCH/27-185SYYLRIT.-----------------------------------------------------------------------Q
IFNB_RAT/27-182SYYWRVQ.-----------------------------------------------------------------------R
H0XMZ9_OTOGA/27-186MYFRRIR.-----------------------------------------------------------------------E
G3VDC6_SARHA/27-182TYFQGIN.-----------------------------------------------------------------------Q
I3JM36_ORENI/26-182MYFKRLSD-----------------------------------------------------------------------D
L5LKN9_MYODS/27-186MYFRRIR.-----------------------------------------------------------------------D
G1TYS8_RABIT/29-195KYFYRMN.-----------------------------------------------------------------------N
I3UJJ8_FELCA/27-185MYFQRIH.-----------------------------------------------------------------------D
C8CKA9_PIG/26-183TYFQGIS.-----------------------------------------------------------------------L
IFNT2_BOVIN/3-162KYFQGIH.-----------------------------------------------------------------------V
H0W510_CAVPO/26-186KYFHRIT.-----------------------------------------------------------------------V
M3Z729_MUSPF/26-183NYFQRIS.-----------------------------------------------------------------------L
IFNA1_MOUSE/26-185KYFHRIT.-----------------------------------------------------------------------V
G3TTC1_LOXAF/26-185EYFEGIR.-----------------------------------------------------------------------F
G1PDS6_MYOLU/29-199RYFHRIS.-----------------------------------------------------------------------S
F7ABU5_MONDO/27-182SYFQGIS.-----------------------------------------------------------------------Q
G1TTX4_RABIT/27-180SYYWRIM.-----------------------------------------------------------------------D
H0XRP5_OTOGA/26-185SYFHRIT.-----------------------------------------------------------------------L
H0WK94_OTOGA/33-202RYFNKMH.-----------------------------------------------------------------------N
G1KYL3_ANOCA/23-176KYFRSLS.-----------------------------------------------------------------------N
G3WZQ8_SARHA/26-181SYFQGIN.-----------------------------------------------------------------------Q
H2R6R8_PANTR/26-185KYFQRIT.-----------------------------------------------------------------------L
H0YTY6_TAEGU/34-188KYFRDIH.-----------------------------------------------------------------------L
I3MXH1_SPETR/27-185SYYVRIR.-----------------------------------------------------------------------M
M3WRV1_FELCA/26-184NYFQRLS.-----------------------------------------------------------------------L
H0W4H8_CAVPO/23-182KYFHRIA.-----------------------------------------------------------------------V
R4GKJ6_CHICK/35-191KHFSCLH.-----------------------------------------------------------------------T
A3FBE8_MUSPF/27-184RYYLRIV.-----------------------------------------------------------------------R
G1KWE0_ANOCA/28-180RYFRSLN.-----------------------------------------------------------------------D
G7PS89_MACFA/26-185KYFRRIT.-----------------------------------------------------------------------L
G1Q880_MYOLU/26-185RYFQGIR.-----------------------------------------------------------------------L
IFNB_MOUSE/27-180SYYWRVQ.-----------------------------------------------------------------------R
IFNB2_BOVIN/27-184KYYFNLV.-----------------------------------------------------------------------Q
G1SJC4_RABIT/26-185KYFQGIA.-----------------------------------------------------------------------V
W5PG31_SHEEP/26-185KYFHRVT.-----------------------------------------------------------------------L
IFNA3_CANFA/26-183TYFQRIS.-----------------------------------------------------------------------L
G5BPX2_HETGA/27-199GYFQRIE.-----------------------------------------------------------------------N
IFNW2_HORSE/26-185RYFRGIH.-----------------------------------------------------------------------L
G3N2A8_BOVIN/26-185RYFQGIH.-----------------------------------------------------------------------V
H0XKS8_OTOGA/27-185SYYFRIT.-----------------------------------------------------------------------W
H0VUV7_CAVPO/26-185KYFHGIT.-----------------------------------------------------------------------D
Q29412_PIG/27-184KYYLSIL.-----------------------------------------------------------------------Q
G7PS88_MACFA/26-185KYFRRIT.-----------------------------------------------------------------------L
M3WZS7_FELCA/26-181RYFQGIS.-----------------------------------------------------------------------L
H9GZR7_HORSE/26-185RYFRRIR.-----------------------------------------------------------------------L
F1LVL8_RAT/26-184AYFRRIH.-----------------------------------------------------------------------D
M3YX13_MUSPF/27-179KYFRRIH.-----------------------------------------------------------------------N
G1L8G2_AILME/26-185RYFHGIG.-----------------------------------------------------------------------L
IFNB_HORSE/27-184KYYGRIS.-----------------------------------------------------------------------Q
H0W289_CAVPO/26-190KYFQGIS.-----------------------------------------------------------------------L
A8E6E8_MONDO/27-182NYFQGIS.-----------------------------------------------------------------------Q
I3N788_SPETR/27-185SYYWRIL.-----------------------------------------------------------------------R
G1L8I1_AILME/26-183NYFQRIS.-----------------------------------------------------------------------L
IFNB_FELCA/27-184KYYLRIV.-----------------------------------------------------------------------R
H0VXI5_CAVPO/26-181KYFHRIA.-----------------------------------------------------------------------V
G3TS29_LOXAF/26-179SYFQGIG.-----------------------------------------------------------------------L
W5PZ39_SHEEP/26-184RYFNRID.-----------------------------------------------------------------------R
G3I0H6_CRIGR/26-178NYFDRIT.-----------------------------------------------------------------------A
I3L756_PIG/26-180RYFEGIH.-----------------------------------------------------------------------L
M3Z715_MUSPF/26-183NYFQRIS.-----------------------------------------------------------------------L
M3VXI8_FELCA/33-205RYFYRMY.-----------------------------------------------------------------------N
G3R8Q7_GORGO/26-185RYFQGIR.-----------------------------------------------------------------------V
A8E6F5_XENTR/51-202DQYQALE.-----------------------------------------------------------------------Q

PF02947

FLT3L_MOUSE/30-162TQLLALK------------------------------------------------------------------------P
F6T7S9_ORNAN/28-157QHLTSLR------------------------------------------------------------------------P
H9GP84_ANOCA/29-165SYLSDLR------------------------------------------------------------------------K
F6TPW7_MONDO/34-163SHLEALQ------------------------------------------------------------------------P
G5B8P0_HETGA/20-150AQLEAMK------------------------------------------------------------------------P
G1M637_AILME/29-159KHLAALK------------------------------------------------------------------------P
L9JA37_TUPCH/769-910AQLLALK------------------------------------------------------------------------P
G3VSA3_SARHA/79-209NHLGALR------------------------------------------------------------------------P
G1QZC3_NOMLE/30-160EQLVALK------------------------------------------------------------------------P

PF00489

IL6_BOVIN/27-208EWVKNAK------------------------------------------------------------------------I
M3X721_FELCA/27-208EWLRHTT------------------------------------------------------------------------I
IL6_HORSE/27-208EWLKNTT------------------------------------------------------------------------T
G3UHF3_LOXAF/20-205EWLKNTT------------------------------------------------------------------------I
L5KPK4_PTEAL/20-202EWLQTTT------------------------------------------------------------------------I
F7HV62_CALJA/27-212QWLQGVT------------------------------------------------------------------------T
IL6_MOUSE/26-210EWLRTKT------------------------------------------------------------------------I

PF16647

CSF3_BOVIN/42-190AFQRRAG------------------------------------------------------------------------G
CSF3_HUMAN/51-202AFQRRAG------------------------------------------------------------------------G
CSF3_MOUSE/57-205AFQRRAG------------------------------------------------------------------------G

PF06875

Q5BNQ4_9SALA/2-215YFSKKLR------------------------------------------------------------------------G
Q5BNQ2_9SALA/2-215YFRKKLR------------------------------------------------------------------------G

PF01110

CNTF_CHICK/1-194LFEQKLR------------------------------------------------------------------------G
G3VWZ5_SARHA/1-195FLEKKLW------------------------------------------------------------------------G
E1BFH9_BOVIN/1-193LFEKKLW------------------------------------------------------------------------G
G5AP46_HETGA/1-192LFEKKLW------------------------------------------------------------------------G
H0Z9U1_TAEGU/1-188LFEQKLR------------------------------------------------------------------------G
CNTF_HUMAN/1-194LFEKKLW------------------------------------------------------------------------G

PF01291

LIF_MOUSE/44-203AFQRKKL------------------------------------------------------------------------G
LIF_BOVIN/43-202VFQKKKL------------------------------------------------------------------------G
ONCM_HUMAN/37-209AFQRKLE------------------------------------------------------------------------G
ONCM_MOUSE/34-194VFNTKIG------------------------------------------------------------------------S
ONCM_BOVIN/34-194TFQRKLR------------------------------------------------------------------------N

PF03039

IL12A_MOUSE/6-215PYRVKMK------------------------------------------------------------------------L
G3VQT1_SARHA/40-247FYKAKVK------------------------------------------------------------------------L
F6T5A8_MONDO/5-202FYKTKVK------------------------------------------------------------------------L
IL12A_PIG/6-222FYKTKIK------------------------------------------------------------------------L
L8YEA2_TUPCH/1-213FYKTKIK------------------------------------------------------------------------L
H0X861_OTOGA/6-217FYKTKVK------------------------------------------------------------------------L
G1QWH2_NOMLE/40-254FYKTKIK------------------------------------------------------------------------L
I3MN91_SPETR/4-220LYRTKTK------------------------------------------------------------------------L
Q924V6_CAVPO/6-221FYKIKMK------------------------------------------------------------------------L

PF02024

H3AP27_LATCH/26-169PYTTEK--------------------------------------------------------------------------
G3WWV6_SARHA/23-167LYSTEV--------------------------------------------------------------------------
F6PLK2_ORNAN/23-167LYSTEV--------------------------------------------------------------------------
F7HGW1_CALJA/23-167LYSTEV--------------------------------------------------------------------------
G5BHA4_HETGA/23-167IYSTEV--------------------------------------------------------------------------
W5NER9_LEPOC/28-172HVTIGN--------------------------------------------------------------------------
H0V7C6_CAVPO/23-165RYSIEV--------------------------------------------------------------------------
LEP_HUMAN/23-167GYSTEV--------------------------------------------------------------------------

PF02372

IL15_PIG/33-160FIHI----------------------VQMFIN--------------------------------------
IL15_CAVPO/33-160FVHI----------------------VQMFIN--------------------------------------
IL15_FELCA/33-160FVHI----------------------VQMFIN--------------------------------------
IL15_SHEEP/33-160FVHI----------------------VQMFIN--------------------------------------
F1NZN5_CHICK/55-183FVKV----------------------IQRECK--------------------------------------
G1NDP6_MELGA/5-137LTNL----------------------......--------------------------------------
O73883_CHICK/5-138LTNF----------------------V.....--------------------------------------
Q8JFF4_ANAPL/4-134LTN.----------------------...F..--------------------------------------

PF00715

I3MQX6_SPETR/7-151WITF----------------------CQSIIS--------------------------------------
G5C793_HETGA/7-149WIAF----------------------CQKIIS--------------------------------------
G1PJ32_MYOLU/7-147WITF----------------------CQRIFS--------------------------------------
B1AB81_HORSE/7-146WITF----------------------CQSIFS--------------------------------------
G3HTL8_CRIGR/7-150WITF----------------------CQSII.--------------------------------------
IL2_MACMU/7-151WITF----------------------CQSIIS--------------------------------------
H0Y254_OTOGA/7-149WITF----------------------CQSIIS--------------------------------------
IL2_MOUSE/7-165WIAF----------------------CQSIIS--------------------------------------
G3SU90_LOXAF/7-147WIVF----------------------CQSIIS--------------------------------------
IL2_PIG/7-151WITF----------------------CQSIYS--------------------------------------
IL2_FELCA/7-151WITF----------------------CQSIFS--------------------------------------
L5K7D9_PTEAL/7-149WITF----------------------CQSILS--------------------------------------
IL2_BOVIN/7-152WITF----------------------CQSIYS--------------------------------------
H0VBY4_CAVPO/7-149WIAF----------------------CQKIMS--------------------------------------

PF00103

PLRP1_BOVIN/26-238FYCL-------RRDSRKVDMYIKILTCRTHKT...C----------------------------------
CSH2_BOVIN/26-238FYCL-------RRDSRKVDMYIKILTCRTRKT...C----------------------------------
PLRP3_BOVIN/1-213FMCL-------YRDSRKLDMYTEILACRITNT...C----------------------------------
PR4A1_RAT/17-227FHCL-------KKDSNNVEMYLKLLKCRLIRS..KC----------------------------------
CSH1_BOVIN/26-236FHCL-------HRDSSKISTYINLLKCR.FTP...C----------------------------------
PLRP4_BOVIN/26-239FFCL-------RRDTRKLDIYTKFVACRLIYK..KC----------------------------------
PR3D4_RAT/16-223CRCF-------KSDIHKIDTYLKVLRCRVVFKN.EC----------------------------------
PR2C2_MOUSE/16-224ISCL-------DNDFKKVDIYLNVLKCYMLKIDN.C----------------------------------
SOM2_HUMAN/9-215LYCF-------RKDMDKVETFLRIVQCR.SVEG.SC----------------------------------
PR8A5_RAT/17-238SSCL-------DYDTQVHYTLSQILNCLITGKD..C----------------------------------
PR6A1_RAT/20-234FQCL-------LQDSRKFDSKVRLLKCRLIYNR.DC----------------------------------
PR7D1_MOUSE/17-240SFCL-------RIDLETVDFLVNFLKCLLLYDD.VC----------------------------------
CSH2_HUMAN/9-215LYCF-------RKDMDKVETFLRMVQCR.SVEG.SC----------------------------------

PF00726

IL10_BOVIN/5-174-KAM-------SEFDIFINYIETY----MTT---------------------------------------
IL10H_EBVB9/7-167-KAM-------SEFDIFINYIEAY----MTI---------------------------------------
G3HB01_CRIGR/14-174-KAM-------NEFDIFINCIETY----MTI---------------------------------------

PF14565

IL22_HUMAN/40-178-KAI-------GELDLLFMSLRNA----C-----------------------------------------
E1C1U2_CHICK/46-184-KAI-------GELDLLFDYIENA----C-----------------------------------------

PF05337

CSF1_HUMAN/41-180-LLD-------KDWNIFSKNCNNSF-AECSS---------------------------------------
Q3TLQ6_MOUSE/41-180-LLE-------KDWNIFTKNCNNSF-AKCSS---------------------------------------
O77709_BOVIN/41-180-LLK-------KDWNIFSKNCNNSF-AKCSS---------------------------------------
O77710_BOVIN/41-180-LLK-------KDWNIFSKNCNNSF-AKCSS---------------------------------------
Q64129_9MURI/41-180-LLE-------KDWNIFTKNCNNSF-AKCSS---------------------------------------

PF15036

IL34_MOUSE/28-184VRPK-------ALLDNCFRVMELLY-CSCCKQSP------------------------------------
R4GIU3_CHICK/19-177VRPK-------ALLDNCLKVLRMLF-GAHCRWDS------------------------------------
F7EA00_CALJA/29-185VRPK-------ALLDNCFRVMELLY-CSCCKQSS------------------------------------
H0WFN4_OTOGA/28-184VRPK-------ALLDNCFRVMELLY-CSCCKQSS------------------------------------
M3ZVZ0_XIPMA/24-191ASPK-------SLVDNLCHTMCCLF-WECFS..S------------------------------------
U3JY35_FICAL/18-179VRPK-------ALLDNCLKVMRMLY-GVPCRWES------------------------------------
L9KJY3_TUPCH/28-184VRPK-------ALLDNCFRVMELLY-CPCCKHNS------------------------------------
G3T3A6_LOXAF/28-182VRPK-------ALLDNCFRVMDLLY-CSCCKQSS------------------------------------
F6W3U1_MONDO/15-167VRPK-------ALLDNCYKVMDLLY-CLCCKESN------------------------------------
I3JZ08_ORENI/24-192ATPK-------SLLDNLCRTMYCLF-SECFSNAD------------------------------------
L5MCR9_MYODS/28-182VRPK-------ALLDNCFRVMELLH-CSCCKE..------------------------------------
B3DLJ8_DANRE/23-195VTPK-------SILDNCYRTMLCLF-KECFTKED------------------------------------
IL34_BOVIN/28-183VRPK-------ALLDNCFRVMQLLY-CPCCKESS------------------------------------

PF00714

IFNG_HORSE/15-152KVQR-------KAISELIKVMNDLS.PKANLRKR------------------------------------
H0WPL1_OTOGA/15-151QVQR-------KAISELYEVIVSLV.PGTPLRKR------------------------------------
Q8CGS0_CAVPO/15-154HVQR-------QAIIELKKVIDDLS.PNQRKRRR------------------------------------
B9VS86_CALJA/15-152NVQR-------KAIHELIQVMAELS.PAPKIGKR------------------------------------
G3SUC6_LOXAF/15-152NIQR-------KAISELAKVMNDLS.HRSTGSKR------------------------------------
G3GY20_CRIGR/2-135QVQR-------KAVNELISVMPLLS.PKLSLRKR------------------------------------
I3MNV6_SPETR/15-152KIQR-------KAVRELKKVMNDLL.PHSTLRKR------------------------------------
L5LME8_MYODS/15-153RVQR-------KAISELYNVITELSKSNSKMRKR------------------------------------
G5BGB5_HETGA/15-152DFQR-------RAIIELKKVMDDLS.PNQRKRRR------------------------------------
G3WQJ9_SARHA/15-153KVQR-------KAMFELVYVFRNLS.PKPHLTG.------------------------------------
IFNG_SHEEP/15-152QIQR-------KAINELIKVMNDLS.PKSNLRKR------------------------------------
IFNG_RAT/14-151QIQH-------KAVNELIRVIHQLS.PESSLRKR------------------------------------
IFNG_RABIT/15-152LVQR-------KAVSELSNVLNFLS.PKSNLKKR------------------------------------
L9KVU0_TUPCH/51-188QVQR-------KAIYELLNVMIDLT.PKSNQKKR------------------------------------
IFNG_FELCA/15-153QVQR-------KAINELFKVMNDLS.PRSNLRKR------------------------------------

PF02404

R4GD07_ANOCA/1-283QGLS-------IALTSLVTLFIGFILGAVCWKKTARKHILESNPTTQANICQEDNEISMLQQKDKSLLQV
SCF_CHICK/1-287QGIS-------IALTSLLSLLIGFILGAIYWKKTHPKSRPESNETIQCHGCQEENEISMLQQKEKEHLQV
SCF_RAT/1-273QWTA-------MALPALISLVIGFAFGALYWKKKQSSLTRAV.ENIQIN..EEDNEISMLQQKEREFQEV
G1NWC8_MYOLU/1-272QWAA-------MTLPAFFSLLVGFGFGALYWKKKQPNLTRAV.ENIQIN..EEDNEISMLQEKEREFQEV
F7EP53_MONDO/1-273QWVA-------IVLPSLFSLVLGFVLGALYWKKKQMNLKMEV.ENIETS..EEDNEISMLQENDGEFQEV
F7C5I3_ORNAN/1-273QWIS-------IAVPSIFSLVIGFILGAIYWKKKHPKHSVEV.ENIQGN..EEDNEISMLQERERELQEV
F7G0W2_CALJA/1-273HWAA-------MALPALFSLIIGFAFGALYWKKRQPSLTRTV.ENIQIN..EEDNEISMLQEKEREFQEV

PF03487

G1SCQ2_RABIT/16-144HLQ--------MLYRLGK----------------------------------------------------
IL13_HUMAN/16-144HLK--------KLFREGR----------------------------------------------------
IL13_RAT/2-130YSK--------QLFRYG.----------------------------------------------------
F7DGH7_MACMU/16-151HLK--------KLFREGQ----------------------------------------------------
L5M5Z7_MYODS/2-128QLR--------KGVRQGK----------------------------------------------------
G5ASP9_HETGA/2-130YLQ--------SLYRHGN----------------------------------------------------
B3GDZ5_PIG/2-130HLR--------MIFRHG.----------------------------------------------------
L8YAP6_TUPCH/2-128HLK--------RLYRH..----------------------------------------------------
IL13_BOVIN/2-130HSR--------IVFRNER----------------------------------------------------
IL13_MOUSE/2-130YTK--------QLFRHGP----------------------------------------------------
H0W834_CAVPO/16-149HVQ--------CLYRHGK----------------------------------------------------
F6WQF3_ORNAN/2-128FYQ--------KIFRDT.----------------------------------------------------
G3T2N9_LOXAF/2-133HLR--------RIYRY..----------------------------------------------------
M3YGH3_MUSPF/2-126YAR--------SVFRHGN----------------------------------------------------
B5FW67_OTOGA/2-129HLK--------KRFRDAN----------------------------------------------------
I3MAR4_SPETR/2-131HLR--------CLLRHGK----------------------------------------------------
IL13_CANFA/2-129YVR--------GVYRHGN----------------------------------------------------

PF00727

IL4_FELCA/26-131IMQ--------KKYS-------------------------------------------------------
H0XDE1_OTOGA/26-149TMK--------EKYS-------------------------------------------------------
IL4_MOUSE/27-140IMQ--------MDYS-------------------------------------------------------
G3T4B8_LOXAF/26-132IYY--------TKF.-------------------------------------------------------
IL4_RABIT/28-143AMQ--------EKYS-------------------------------------------------------
G5ASQ0_HETGA/25-138ILK--------KKYS-------------------------------------------------------
F6U5N6_HORSE/26-135IMK--------EKYS-------------------------------------------------------
IL4_BOVIN/26-133IMK--------EKYS-------------------------------------------------------
G3QSC0_GORGO/26-149IMR--------EKYS-------------------------------------------------------
A3FBF0_MUSPF/26-130IMQ--------QKYY-------------------------------------------------------
IL4_RAT/27-139ILR--------GKY.-------------------------------------------------------
G3WEJ0_SARHA/28-149INQ--------K...-------------------------------------------------------
I3MAS4_SPETR/24-141TMQ--------KKYS-------------------------------------------------------
IL4_PIG/26-131IMK--------EKYS-------------------------------------------------------

PF01109

CSF2_RAT/18-139FLFD-------IPFDCW-----------------------------------------------------
CSF2_MOUSE/18-136FLTD-------IPFECK-----------------------------------------------------
CSF2_BOVIN/18-138FLFI-------IPFDCW-----------------------------------------------------
CSF2_CAVPO/18-140FLFA-------IPFDCW-----------------------------------------------------
CSF2_PIG/18-139FLFT-------IPFDCW-----------------------------------------------------
CSF2_HUMAN/18-139FLLV-------IPFDCW-----------------------------------------------------
CSF2_CANFA/18-139FLFN-------IPFDCW-----------------------------------------------------

PF02025

G1RQD7_NOMLE/22-133FLGV-------MNTE-WIIE--------------------------------------------------
IL5_CAVPO/23-134FLAV-------INTE-WTIE--------------------------------------------------
J9NWP5_CANFA/22-132FLGV-------INTE-WTP.--------------------------------------------------
IL5_MOUSE/21-132FLGV-------MSTE-WAME--------------------------------------------------
G3WAR7_SARHA/25-134FLQT-------VNTE-WTVE--------------------------------------------------
IL5_HORSE/22-133FLGV-------INTE-WTIE--------------------------------------------------
B5FW65_OTOGA/22-133FLGI-------INTE-WTME--------------------------------------------------
I3MDT8_SPETR/23-134FLGV-------INTE-WMME--------------------------------------------------
G3T4B0_LOXAF/23-133FLGV-------ISTD-WMI.--------------------------------------------------
G1SL79_RABIT/22-133FLGV-------INTE-WTME--------------------------------------------------

PF02059

IL3_CANFA/19-132YLEA-------.----------------------------------------------------------
IL3_MOUSE/27-138YMVH-------L----------------------------------------------------------
IL3_BOVIN/18-132YLVI-------I----------------------------------------------------------
G3UC30_LOXAF/22-133YLET-------L----------------------------------------------------------
G1MH15_AILME/18-131YLEA-------.----------------------------------------------------------
F1RJV6_PIG/18-131YLVV-------L----------------------------------------------------------
G1RQ11_NOMLE/20-137YLKT-------L----------------------------------------------------------
IL3_CALJA/19-136YLKT-------L----------------------------------------------------------
F1LS41_RAT/29-138YVIH-------L----------------------------------------------------------

PF07400

IL11_HUMAN/22-199LGGL-------HLTLDWAVRGLLLLKTRL-----------------------------------------

PF00758

G3TYQ1_LOXAF/25-173LLLV-------VGLTLCARRA-------------------------------------------------
W5K758_ASTMX/26-175LLAN-------A....P....-------------------------------------------------
B1N8Y2_DANRE/15-168LLAN-------A....PVCRQ-------------------------------------------------
F7DTH0_CALJA/31-193YAGE-------A....CRTED-------------------------------------------------
M3XJ62_LATCH/27-177FISD-------A....CSMQ.-------------------------------------------------
G3W289_SARHA/30-190FWRE-------A....CQSQE-------------------------------------------------
F6WUU2_MONDO/31-191FLRE-------A....CQSEE-------------------------------------------------
G3VW20_SARHA/26-175LLHA-------LRPILCARQD-------------------------------------------------
G1PF99_MYOLU/45-207YTGE-------A....CRRGD-------------------------------------------------
TPO_CANFA/25-176LLLV-------AGPTLCAKQS-------------------------------------------------
F7G570_MONDO/26-177LLHA-------VRPLLCARQD-------------------------------------------------
H0W023_CAVPO/30-191YTGM-------A....CRRGD-------------------------------------------------
H2LEX3_ORYLA/33-182LLMD-------A....P....-------------------------------------------------

PF00143

G5E7E1_LOXAF/9-168YLKE-------KEYSDCAWEIVRVEIKRSFSSSTNL....QE.RL-------------------------
IFNE_MOUSE/27-185YLEN-------QRYSSCAWIIVQTEIHRCMFFVFRF....TT.WL-------------------------
G3I0H8_CRIGR/26-185YLRE-------KNHSPCAWEVVRAEVWRALSSSANL....LA.RL-------------------------
H0VF99_CAVPO/28-187YLRA-------KKNSICAWTVVQAELIRNFSIINRL....TN.YF-------------------------
L5KKJ7_PTEAL/25-192FLKD-------KKYSHCAWEIVRVEIRRCFCYF.......TA.LL-------------------------
G1U0Q8_RABIT/26-185YLDE-------KKHSGCAWELVRMEIRRAFSSTADL....QE.SL-------------------------
F6YZB3_ORNAN/25-183YLRD-------KEYSSCAWEIVRAEIRRSFEYSVVL....SP.GL-------------------------
I3MY95_SPETR/32-186YLKE-------KEYRPCAWEVVRTEVVKFVSSSPKL....YE.RL-------------------------
V8NNB8_OPHHA/15-183FLKN-------KKYSLCAWEIVQIQIEACFQLINHY....IQ.RI-------------------------
C8CKA7_PIG/26-185YLQE-------KSYSPCAWEIIRAEVMRAFSSSTNL....QD.RL-------------------------
H0W7G8_CAVPO/26-185YLKE-------KSYSPCAWEVVRAEIVRCFSSSEEL....LR.KM-------------------------
G3GXU9_CRIGR/27-182YLED-------NGHSSCAWMVTQAEVLRNFMFIKRL....TR.IF-------------------------
H0XSG1_OTOGA/26-185YLKE-------KKYSSCAWEVVRAEIMRAFSSSTRL....QE.RL-------------------------
G1KX99_ANOCA/25-184LLKE-------KGYSRCAWEIVHIQVKYHLSASSVL....GW.KL-------------------------
G3I0I6_CRIGR/27-185YLEN-------QRYSSCAWIVVQVEINRCMFFVFRL....TA.WL-------------------------
IFNT4_SHEEP/26-185YLQE-------KGYSDCAWEIVRVEMMRALTVSTTL....QK.RL-------------------------
L8Y4J0_TUPCH/27-186YLEN-------HKYSSCAWTIVQVEIKRCLFLVLRL....IG.KL-------------------------
F7B527_HORSE/26-183YLKE-------KDYSGCAWEVVRVEIRRCLLFMNKL....TG.KL-------------------------
G1Q950_MYOLU/27-184YLKG-------KSYSRCAWTVVQAEILRNFSFLNRL....IG.AL-------------------------
M3WTR1_FELCA/26-186YLED-------EGYSDCAWEIVRLEIMRALSSSATL....QD.SL-------------------------
G5CB66_HETGA/27-185HMKA-------KDNSICAWTVVQVELSRNFSFINRL....TD.YF-------------------------
L9L941_TUPCH/27-198FLKD-------KKYSRCAWEIIRMEIRRCFHYFQKF....TE.LL-------------------------
D2H9N6_AILME/27-184YLKA-------KVYSICAWKIVRAEMLRSFFFLDKF....TN.YL-------------------------
D3Z919_RAT/26-179YLKQ-------KKHSPCAWEVVRVEVGRALIYSDMF....LA.KL-------------------------
C8CKB9_PIG/24-176YLKK-------KEYSSCAWEVVRVETEVCLSLMQQL....ST.KS-------------------------
A8E6F6_XENTR/27-179MVLE-------KDNSACVWDFIHLETRRNLQQVLQL....SS.RL-------------------------
L8Y906_TUPCH/26-185YLEK-------KNFSDCAWEVVRVEIRKCFLFINKL....IR.KL-------------------------
H9L1C3_CHICK/28-183FLKE-------KQHNLCSWEISRAEMRRCLQLIDKV....IR.KL-------------------------
L5KWM8_PTEAL/106-263YLKE-------KRYSDCAWEVVRVEIKEILLFINKL....TK.KV-------------------------
G3WZJ8_SARHA/27-182YLQG-------KEYSRCAWEIVRVEIRRIFLFMSKL....TK.KL-------------------------
G3UCD2_LOXAF/26-187YLTE-------KKYSPCAWEIVRAEIMRSFSASTNW....QE.RL-------------------------
K7GQJ6_PIG/17-164FLKE-------KKYSDCVWEIVRVEIMKPLSSLNSF....AR.KV-------------------------
G3I0H3_CRIGR/26-178YLRE-------KNHSPCAWEVVRAEVWRALSSSVNL....LA.RL-------------------------
H0VYK7_CAVPO/28-181YLTA-------RENSICAWTVVQAELISKFPIINSL....TD.YF-------------------------
I3N7K4_SPETR/33-202FLKD-------KTYSRCAWEIVRVEITRYFLYLKKF....IT.LH-------------------------
L5K635_PTEAL/26-185YLEE-------KQYSDCAWEVVRVEIRRYLFVVNKF....TR.KE-------------------------
H0W3G0_CAVPO/26-185YLED-------KKYSDCAWEIVRVEIMRAFSLSAKL....QE.KI-------------------------
W5JYQ9_ASTMX/23-179VLIE-------KDYQYCAWEFARFEILHALQFI.......LI.NL-------------------------
G3SI98_GORGO/28-185FLKE-------KKYSDCAWEIVRVEIRRCLYYFYKF....TA.LF-------------------------
H0Y0D2_OTOGA/28-187YLQE-------KKYSLCAWEIVRTEIMRSYSYSKHL....QN.TL-------------------------
IFN_ANAPL/34-190FLQN-------HTYSPCAWDHVRLEAHACFQRIHRL....TR.TM-------------------------
G3UJX3_LOXAF/27-185YLEA-------KDYSSCAWTVVQVEILRNFSFISGL....TD.YL-------------------------
G5C259_HETGA/26-185YLKE-------KRYSPCAWEVVRAEIMRSFSSSEKL....AR.KV-------------------------
G3WZF5_SARHA/26-185YLEN-------KKYSSCSWKIVQVETRLNFIFLYKL....TE.RL-------------------------
IFNE_PIG/27-186YLEN-------QDYSSCAWTIVRVEINRCLFFVFQL....TG.KL-------------------------
W5N6G4_LEPOC/27-185VLRD-------KDYSYCAWESVRRDLRRALEQFQEF....LE.SN-------------------------
H9KYA4_CALJA/26-185YLTE-------KKHSPCAWEVVRAEIMRSFSLLTSL....QE.RL-------------------------
D2HTQ4_AILME/33-205FLKE-------KKYSHCAWEIIRVEIRRCFYYFQKF....AA.LL-------------------------
IFNB_HUMAN/27-185YLKA-------KEYSHCAWTIVRVEILRNFYFINRL....TG.YL-------------------------
G1NR05_MELGA/32-188FLQR-------NNYSACSWDHVRLHARTCFQNVDTL....IQ.QM-------------------------
F7BVP5_ORNAN/23-181YLKG-------RNYSSCAWEVIRMKTKRCFLVIYRL....TR.KL-------------------------
F7G875_MONDO/27-182YLKN-------KEYSSCACKIVQVETRRNFSFLYKL....TE.YL-------------------------
C8CKC3_PIG/33-205FLKD-------KEHSHCAWEIVRVEIRRCFYFFQKF....TA.LL-------------------------
I3MVD7_SPETR/34-186YLKE-------KKYLPCAWEVVRAEIMKSFSSSANL....YA.RL-------------------------
F7A317_HORSE/26-184YLQE-------KKYSPCAWEIVRAEIMRCFSSSTNL....QQ.S.-------------------------
G1KU56_ANOCA/28-182FLKD-------GEYNECAWEVAQIEVSRFFMVMEQL....IR.TL-------------------------
L5KBH2_PTEAL/26-185YLKE-------KEYSVCAWEVVRVEIRKAFSLSTNL....LD.RL-------------------------
L5K909_PTEAL/26-185YLQE-------KKHSPCAWEIVRAEIMRSYSLSTHL....KE.KS-------------------------
I3N5Z0_SPETR/23-179YLES-------QRHSSCAWTIVHAEINRCLVFVFRL....IR...-------------------------
F7GHL9_MONDO/26-181YLQG-------KGYSRCAWEFTRIEIRRCILFMSNL....TR.KF-------------------------
IFNE_HUMAN/27-186YLEN-------QDYSTCAWAIVQVEISRCLFFVFSL....TE.KL-------------------------
I3LBU7_PIG/26-179YLKE-------KSYSPCAWEIVRAEVMRAFSSSTNL....QD.RL-------------------------
G3UK87_LOXAF/27-184YLKE-------KEHSDCVWEVIRVEISKLIYVSTNLGSSGQK.RL-------------------------
L9LC61_TUPCH/27-185YLKA-------KEYSSCAWTIVRVEILRNFLFINRL....ID.YL-------------------------
IFNB_RAT/27-182YLKD-------KKYNSYAWMVVRAEVFRNFSIILRL....NR.NF-------------------------
H0XMZ9_OTOGA/27-186YLEN-------QEYSSCARTIVQVEINRCLLFVFRL....TE.KL-------------------------
G3VDC6_SARHA/27-182YLQD-------KEYSRCAWEMVRIEIRRIFLFMDKP....IR.KL-------------------------
I3JM36_ORENI/26-182VLKK-------KGHSAEAWEVIRKETKAHLMRAEQL....AS.SL-------------------------
L5LKN9_MYODS/27-186YLEN-------QKYSGCAWTVVQVEVNRCLFFVLPL....TG.KL-------------------------
G1TYS8_RABIT/29-195FLED-------KKYSYCAREIVRVEITRCFSYFYRF....TA.FL-------------------------
I3UJJ8_FELCA/27-185YLES-------QEYSSCAWTIVRVEINRCLFFALQL....IR.KI-------------------------
C8CKA9_PIG/26-183YLKE-------KEYSHCAWEVVRVETRKCLLFINNL....VG.KL-------------------------
IFNT2_BOVIN/3-162YLKE-------KEYSDCAWEIIRMEMMRALSSSTTL....QK.RL-------------------------
H0W510_CAVPO/26-186YLKE-------KSYSPCAWEVVRAEIRRSFSFSATL....KTPKI-------------------------
M3Z729_MUSPF/26-183YLQE-------KQYSPCAWEMVRAEIMKPLYASTAL....HK.RL-------------------------
IFNA1_MOUSE/26-185YLRE-------KKHSPCAWEVVRAEVWRALSSSANV....LG.RL-------------------------
G3TTC1_LOXAF/26-185YLKE-------KEYSDCAWEFVRVEIRRSFSSSTAL....QE.RL-------------------------
G1PDS6_MYOLU/29-199FLQD-------KQYSHCAWKIVQVEIRRCFYYFQTL....IE.LL-------------------------
F7ABU5_MONDO/27-182YLQG-------KEYSPCAWEIVRVEIRRLFLFMSKL....AR.KL-------------------------
G1TTX4_RABIT/27-180YLET-------KQYSNCAWKIVQLEIFRNFSFIIML....ID.YL-------------------------
H0XRP5_OTOGA/26-185YLKE-------KKYTPCAWEVVKAEILRSFSSTTSL....QE.RL-------------------------
H0WK94_OTOGA/33-202FLKE-------KKYSHCAWDIVQVEIRRCIYYFYQF....TA.LL-------------------------
G1KYL3_ANOCA/23-176LLKE-------KEYSRCAWEIIQIQVKQCFLWIEKI....IQ.EI-------------------------
G3WZQ8_SARHA/26-181YLQD-------KEYSRCAWEIVRIEIRKMFLFMNKF....TR.NL-------------------------
H2R6R8_PANTR/26-185YLTE-------KKYSPCAWEVVRAEIMRSLSFSTNL....QK.RL-------------------------
H0YTY6_TAEGU/34-188FLHA-------HNHSACAWDHVRLEARASLRHLHNL....TR.AR-------------------------
I3MXH1_SPETR/27-185YLEA-------KLYSSCAWTVVRDELYWNFSFINRL....TD.KF-------------------------
M3WRV1_FELCA/26-184YLQE-------KKYSPCAWEIVRAEIMRSLYSSTAL....QK.RL-------------------------
H0W4H8_CAVPO/23-182YLKE-------KSYSPCAWEVVRAQIVRSLSASEKL....AR.KM-------------------------
R4GKJ6_CHICK/35-191FLQD-------NDYSACAWEHVRLQARAWFLHIHNL....TG.NT-------------------------
A3FBE8_MUSPF/27-184YLKA-------KEFSVCAWTIVQAEILRSFFFLDKL....TD.SL-------------------------
G1KWE0_ANOCA/28-180FLKE-------KEYSRCAWEIVQIQVKQCFLWIEKL.........-------------------------
G7PS89_MACFA/26-185YLTE-------KKYSPCAWEVVRAEIMRSFSLSINL....QK.RL-------------------------
G1Q880_MYOLU/26-185YLKE-------KKYSDCAWEVVRVEIMRSFSSTRAL....QE.RL-------------------------
IFNB_MOUSE/27-180YLKL-------MKYNSYAWMVVRAEIFRNFLIIRRL....TR.NF-------------------------
IFNB2_BOVIN/27-184YLKS-------KEYNRCAWTVVRVQILRNFSFLTRL....TG.YL-------------------------
G1SJC4_RABIT/26-185YLAE-------KQYSPCAWEVVRAEARRAVSLSRIL....QE.RI-------------------------
W5PG31_SHEEP/26-185YLQE-------KGHSPCAWEVVRAEVMRAFSSSTNL....QE.RF-------------------------
IFNA3_CANFA/26-183YLQD-------RNHSPCAWEMVRAEIGRSFFSLTIL....QE.RV-------------------------
G5BPX2_HETGA/27-199YLKD-------KKYSYCAWKIVQVEIKRCFFYFLKF....IK.LP-------------------------
IFNW2_HORSE/26-185YLKE-------KKYSDCAWEIVRMEIMRSFSSSANL....QG.RL-------------------------
G3N2A8_BOVIN/26-185YLKE-------KEYSDCAWEIVRLEIMRALSSSTSL....QE.RL-------------------------
H0XKS8_OTOGA/27-185YLKA-------KRYSSCAWTVVREEILRNLFFINRL....TG.YL-------------------------
H0VUV7_CAVPO/26-185YLKE-------KSYSPCAWEVVRAEFFRSFSSSEEL....LR.KM-------------------------
Q29412_PIG/27-184YLKS-------KEYRSCAWTVVQVEILRNFSFLNRL....TD.YL-------------------------
G7PS88_MACFA/26-185YLTE-------KKYSPCAWEVVRAEIMRSFSLSTNL....QE.RL-------------------------
M3WZS7_FELCA/26-181YLKE-------KEYSHCAWEVVRVEIRRCLLVINKL....TG.TF-------------------------
H9GZR7_HORSE/26-185YLTE-------KKYSDCAWEIVRVDIMRSFSSSANL....QG.RL-------------------------
F1LVL8_RAT/26-184YLEN-------HRYSTCAWIIVQIEVNRCMFFVSRL....AR.RL-------------------------
M3YX13_MUSPF/27-179YLEN-------QEYNSCAWR....EINRCLFFAFQL....VR.KL-------------------------
G1L8G2_AILME/26-185YLEK-------KKYSRCAWEVVRVEIRRCLFFVNEL....AG.KL-------------------------
IFNB_HORSE/27-184YLKA-------KKYSHCAWTVVQAEMLRNLAFLNGL....TD.YL-------------------------
H0W289_CAVPO/26-190YLEE-------KKYSDCAWEIVRVEIRRVVSFSLRL....QQ.RL-------------------------
A8E6E8_MONDO/27-182YLQG-------KGYSHCAWEVTRVEIRRCFLFLSKL....SR.KF-------------------------
I3N788_SPETR/27-185YLKA-------KQYSSCAWTVIRMELFQNFSFINRL....MD.HF-------------------------
G1L8I1_AILME/26-183YLQE-------KQYSPCAWETVRAEITKPLFSSTIL....QE.GL-------------------------
IFNB_FELCA/27-184YLKA-------KEYSVCAWTVVHAEILRNFFFLERL....TD.YL-------------------------
H0VXI5_CAVPO/26-181YLKE-------KSYSPCAWEVVRAEIVRCFSSSETM....QK.NI-------------------------
G3TS29_LOXAF/26-179YLKE-------KEHSLC.WEVVRVEIRKCFLFINML....TV.QI-------------------------
W5PZ39_SHEEP/26-184FLKD-------KKHSHCAWEIVRVEIRRCFYFFQKL....TA.LL-------------------------
G3I0H6_CRIGR/26-178YLGE-------KNHSPCAWEVVRAEVWRAMSASANL....LA.TL-------------------------
I3L756_PIG/26-180YLKE-------KKYSDCAWETVRVEIVRALSSTTNL....QE.RL-------------------------
M3Z715_MUSPF/26-183YLQE-------KQYSPCAWEIVRAEIMKPLYASMIL....QE.RL-------------------------
M3VXI8_FELCA/33-205FLKD-------KKYSPCAWEIIRVELRRCFYYFYKL....TL.LL-------------------------
G3R8Q7_GORGO/26-185YLKE-------KKYSDCAWEVVRMEIMKSLFLSTNM....QE.RL-------------------------
A8E6F5_XENTR/51-202ILQE-------KN.TACTRDIIQSEIRGNLQLVGQL....AS.RA-------------------------

PF02947

FLT3L_MOUSE/30-162CIGK.....ACQNFSRC------LEVQ-------------CQ----------------------------
F6T7S9_ORNAN/28-157KITS.......LNFSSC------LELR-------------C.----------------------------
H9GP84_ANOCA/29-165KMEEFEAHDVPANFSNC------TVIH-------------CQ----------------------------
F6TPW7_MONDO/34-163LISS.......QDFGPC------RRLR-------------CQ----------------------------
G5B8P0_HETGA/20-150WITH.......RNFSQC------LELR-------------CQ----------------------------
G1M637_AILME/29-159RITR.......RNFSGC------LELR-------------CQ----------------------------
L9JA37_TUPCH/769-910RITR.......RNFSRC------LELR-------------CQ----------------------------
G3VSA3_SARHA/79-209LITQ.......QNFQPC------QQYR-------------CQ----------------------------
G1QZC3_NOMLE/30-160WITR.......QNFSRC------LELQ-------------CQ----------------------------

PF00489

IL6_BOVIN/27-208ILIL-------RNLENFLQFSLRAIRMK------------------------------------------
M3X721_FELCA/27-208HLTL-------RRLEDFLQFSLRAVRIM------------------------------------------
IL6_HORSE/27-208HLIL-------RSLEDFLQFSLRAVRIM------------------------------------------
G3UHF3_LOXAF/20-205NLIL-------RSLDDFMQFSLRAVRIM------------------------------------------
L5KPK4_PTEAL/20-202HLIL-------RSLEDFLQFTQRAVRIM------------------------------------------
F7HV62_CALJA/27-212HLIL-------RSFKDFLQNSLRALRQM------------------------------------------
IL6_MOUSE/26-210QFIL-------KSLEEFLKVTLRSTRQ.------------------------------------------

PF16647

CSF3_BOVIN/42-190VLVA-------SQLHRFLELAYRGLR--------------------------------------------
CSF3_HUMAN/51-202VLVA-------SHLQSFLEVSYRVLR--------------------------------------------
CSF3_MOUSE/57-205VLAI-------SYLQGFLETARLALH--------------------------------------------

PF06875

Q5BNQ4_9SALA/2-215GVVC-------KEYKERVFLTKRDFMLLAEKYQGPL----------------------------------
Q5BNQ2_9SALA/2-215GVVC-------KEYKERVLLTKRDFEFLAKKYQGHL----------------------------------

PF01110

CNTF_CHICK/1-194LRVL-------RELAQWAVRSVRDLRQLSKHGPGSGAALGLP-ES-------------------------
G3VWZ5_SARHA/1-195LKVL-------QELMQWTVRSIHDLRLISSPGQNRVPARGGQ-QL-------------------------
E1BFH9_BOVIN/1-193LKVL-------QELSRWTVRSVHDLRTISR..QSGVPACGSR-CA-------------------------
G5AP46_HETGA/1-192LKVL-------QELSQWTVRSIRDLRLISSQ.PAGIPADESR-YF-------------------------
H0Z9U1_TAEGU/1-188LGVL-------RELAQWAVRSVRDLRQLGKPSSAAGTA....-..-------------------------
CNTF_HUMAN/1-194LKVL-------QELSQWTVRSIHDLRFISSH.QTGIPARGSH-YI-------------------------

PF01291

LIF_MOUSE/44-203CQLL-------GTYKQVISVVVQAF---------------------------------------------
LIF_BOVIN/43-202CQLL-------GKYKQVIAVLAQAF---------------------------------------------
ONCM_HUMAN/37-209CRFL-------HGYHRFMHSVGRVF---------------------------------------------
ONCM_MOUSE/34-194CGFL-------WGYHRFMGSVGRVF---------------------------------------------
ONCM_BOVIN/34-194CGFL-------RGYHRFMRTAGQVL---------------------------------------------

PF03039

IL12A_MOUSE/6-215CILL-------HAFSTRVVTINRVMGYLSSA---------------------------------------
G3VQT1_SARHA/40-247CLLL-------HAFRIRVVTIDRMRNYL...---------------------------------------
F6T5A8_MONDO/5-202CVLL-------HAFQTRTVTIDRMMNYL..A---------------------------------------
IL12A_PIG/6-222CILL-------HAFRIRAVTIDRMMSYLNSS---------------------------------------
L8YEA2_TUPCH/1-213CILL-------HAFRVRAVTIDRVMSYLNTS---------------------------------------
H0X861_OTOGA/6-217FVLL-------HAFRIRAVTIDRVMSYLNSS---------------------------------------
G1QWH2_NOMLE/40-254CILL-------HAFRIRAVTIDRVMSYLNAS---------------------------------------
I3MN91_SPETR/4-220CILL-------HALRIRAVTIDRVMSYLNSS---------------------------------------
Q924V6_CAVPO/6-221CILL-------HAFRIRAVTIDRVMSYLTSS---------------------------------------

PF02024

H3AP27_LATCH/26-169-VAL-------DRLQKCLLTMVKELEQIKDC---------------------------------------
G3WWV6_SARHA/23-167-VTL-------SRLQKSLYGMLQQLDLIHGC---------------------------------------
F6PLK2_ORNAN/23-167-VTL-------DRLRKSLKNIEKQLDHIQGC---------------------------------------
F7HGW1_CALJA/23-167-VAL-------SRLRGTLKDILQQLDLGPAC---------------------------------------
G5BHA4_HETGA/23-167-VAL-------SRLQRFLQEMLLQLDHNTMC---------------------------------------
W5NER9_LEPOC/28-172-VAL-------ERLQKYLLKLIRNLDQLKNC---------------------------------------
H0V7C6_CAVPO/23-165-VVL-------RRMKRFLLEMLRQLELGIVC---------------------------------------
LEP_HUMAN/23-167-VAL-------SRLQGSLQDMLWQLDLSPGC---------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window