Sequence alignment for CL0053

PF00489

M3X721_FELCA/44-225PTPGPLGGD----ATSNRLPLTSADKME------------------------ELIKYILGKISALKKE---MCDNYN---
IL6_BOVIN/27-208PTPGPLGEDFKNDTTPGRLLLTTPEKTE------------------------ALIKRMVDKISAMRKE---ICEKND---
IL6_HORSE/27-208PTPLPLGED---ETTSNGPLLTTADKTK------------------------QHIKYILGKISALKNE---MCNNFS---
G3UHF3_LOXAF/20-205PNPKPLEGDSKDDAASNRPSLTSPDKTE------------------------ELIRFILAEISVLRKK---MCDKYD---
L5KPK4_PTEAL/20-202PIPVPSGEDSKDDTNSNRPQLTSPNQTE------------------------NLIKSIFLEISEVRNK---MCGNDD---
F7HV62_CALJA/27-212PAPVPLGEDSKEVAAPNRQLLTSTERID------------------------KHIRYILDGISALRKE---ICNKSN---
IL6_MOUSE/26-210PTSQVRRGDFTEDTTPNRPVYTTS-QVG------------------------GLITHVLWEIVEMRKE---LCNGNS---

PF16647

CSF3_BOVIN/42-190------------------------------------------------------VRKIQADGAELQER---LCAAHK---
CSF3_HUMAN/51-202------------------------------------------------------VRKIQGDGAALQEKLVSECATYK---
CSF3_MOUSE/57-205------------------------------------------------------VRKIQASGSVLLEQ---LCATYK---

PF16649

IL23A_MOUSE/28-185------------------PDWAQCQQLS------------------------RNLCMLAWNAHAPAGH------------
F7HQI5_MACMU/28-184------------------PAWAQCQQLS------------------------QKLCTLAWSAHPLVGH------------
F1MSN4_BOVIN/35-192------------------PAWTRGQQLS------------------------QQLCMLAWSAHLPMGH------------
IL23A_CAVPO/28-184------------------PSWTQCQQLS------------------------QKLCTLAWSAHPSVGH------------
G3VET0_SARHA/31-186------------------VAWDLCQELS------------------------QNVTALAWGIHPEMGN------------

PF07400

F1R6T9_DANRE/26-187PANLPQ----------GKKHLSTLYQDM------------------------RMLLKLTSQQ--MNAN------------
A0A0P7XG98_9TELE/28-193PAHHR------------QIAEAEITNQT------------------------RHLLKLTQEL--LKDH------------
F1R1E3_DANRE/28-198PVHHRR----------NQIDFDKLSNQT------------------------KLLLTLTRNL--LKDR------------
H2T1R2_TAKRU/27-195PVPHRR-----------PSDMDRLSNQT------------------------KHLMKLTQEL--LREH------------
H2M884_ORYLA/28-196PVPPRR-----------SSDLDRLTNHT------------------------TNLKKLAQKL--LKKH------------
H3A6V0_LATCH/22-190PPPRRV-----------DHELDTMVNLA------------------------KNILHDTKIA--FRQF------------
G5BVZ4_HETGA/26-199PGPPRAAPD-------PRAELDSAVLLT------------------------RSLLVDTRQL--AAQL------------
F6WLV3_XENTR/22-187P---LK----------PKVEFDDLLNMA------------------------RHLLRDTKQS--YHNF------------
G3P408_GASAC/28-197PAHCSP----------LCGMFRPMVLQL------------------------NSLNNMSKKLHHLTDH------------
A0A091E199_FUKDA/60-227PGS-------------ARAEMDSTVLLT------------------------RSLLLDTQEL--FAQL------------
W5LKH5_ASTMX/28-199PAQSRRHPH-------SHADLDKLTNQT------------------------RHLQKLTHDL--INDH------------

PF06875

Q5BNQ4_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSADSLLPTY-LSFQGAPLSD
Q5BNQ2_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSADSLLPTY-LSFQGAPLSD

PF01110

CNTF_CHICK/1-194--------------------MAAADTPSATLRH----HDLCSRGI-------RLARKMRSDVTDLLDIY-VERQGL----
G3VWZ5_SARHA/1-195--------------------MAFPENTPLTPHH----RDLCTRSI-------WLARKIRSDLTSLLESY-VEYQGL----
E1BFH9_BOVIN/1-193--------------------MAFAEHSLLPPHR----RDLCSRSI-------WLARKIRSDLTALVDSY-MKHQGL----
G5AP46_HETGA/1-192--------------------MAFAELSPLTPHR----RDLCSRSI-------WLARKIRSDLTALMDSY-VKHQGL----
H0Z9U1_TAEGU/1-188--------------------MAASESPSAALRR----RDLCSRGI-------RLAGKMRADVVDLLDAY-VEQQGL----
CNTF_HUMAN/1-194--------------------MAFTEHSPLTPHR----RDLCSRSI-------WLARKIRSDLTALTESY-VKHQGL----

PF01291

LIF_MOUSE/44-203--------------------------------------NLMNQIK-------NQLAQLNGSANALFISY-YTAQGEPFPN
LIF_BOVIN/43-202--------------------------------------NLMNQIR-------NQLGQLNSSANSLFILY-YTAQGEPFPN
ONCM_HUMAN/37-209--------------------------------------VLLGQLQ-------KQTDLMQDTS-RLLDPY-IRIQGLDVP-
ONCM_MOUSE/34-194--------------------------------------QLLSQLQ-------NQANLTGNTE-SLLEPY-IRLQNLNTP-
ONCM_BOVIN/34-194--------------------------------------ELLLQLQ-------RQADLMQDPS-TLLDPY-IHLQGLHSP-

PF03039

I3MN91_ICTTR/3-204-LLLLASLVL---LEHLGSARNLPRSTPVPAV-SQECHNLSQTLL-------STVDSALQNAIEILEHYPCSAEEVNHED
IL12A_MOUSE/6-215YLLFLATLAL---LNHLSLARVIPVSGP------ARCLSQSRNLL-------KTTDDMVKTAREKLKHYSCTAEDIDHED
G3VQT1_SARHA/40-247--FLIAILIG---LSQVNWVKSIPVIQSEPSM--HQYLRGSKNLL-------GTVTETLQQARQKLELYSCSLEEIDHED
F6T5A8_MONDO/5-202HIFLIATLIG---LSQIHWATSLPVPQPEPSM--PQCLTASKNLV-------EATNEILQKSRKILELYPCSLEEIDHED
IL12A_PIG/6-222NLLLVATLVLLNHLDHLSLGRSLPATTAGPGM--FKCLNHSQNLL-------KAVSNTLQKAKQTLEFYSCTSEEIDHED
L8YEA2_TUPCH/1-213-LLLAATLVL---LHHGTLARNLPTAMPGPGK--FGCLSHSQNLL-------TAISNTLQKARKNLEFYSCTSEEIDHED
H0X861_OTOGA/6-217SLLLVAILVL---LDHLSLARNLPRPTPEPGR----CHQHSQKLL-------EAVSTTLQKARETLNSSSHTSEEIDHED
Q924V6_CAVPO/6-221KCLLLTSLVL---LVSCSLARNLPRASPAPVTEPVQCFNHSQTLL-------RAVNSELHKAIQMLAVYSCTPEEIDHED

PF02024

H3AP27_LATCH/26-169------------------------------------------------------IEKVKSDARNLTRII-----------
G3WWV6_SARHA/23-167-----------------------------------------------------PIRKVQDDTKTLTKTI-----------
F6PLK2_ORNAN/23-167-----------------------------------------------------SIEKIQADTKTLTKTI-----------
F7HGW1_CALJA/23-167-----------------------------------------------------PIQRVQDDTKTLIKTI-----------
G5BHA4_HETGA/23-167-----------------------------------------------------PIQKVQDDTKTLIKTI-----------
W5NER9_LEPOC/28-172--------------------------------------------------------RVKNDARLLAQTT-----------
A0A286XUJ2_CAVPO/23-165-----------------------------------------------------PMQKLQDDAKFLIKTI-----------
LEP_HUMAN/23-167-----------------------------------------------------PIQKVQDDTKTLIKTI-----------

PF15216

M3WGC3_FELCA/29-146------------------------------------------------------YNFTDCDFGKIRKKY-----------
F1RLI5_PIG/20-130------------------------------------------------------YNFTDCDFERIQDIF-----------
A0A2I2YQB0_GORGO/29-153------------------------------------------------------YDFTNCDFEKIKAAY-----------
F7I7D5_CALJA/29-153------------------------------------------------------YDFTNCDFTKIKKEY-----------
K7E5V9_MONDO/34-162------------------------------------------------------YNFSSCNHYQMASDY-----------
L8YGS5_TUPCH/5-129------------------------------------------------------YNFTNCDFTKIKEDY-----------
J9P5I8_CANLF/29-154------------------------------------------------------YNFIDCDFEKIRWKY-----------
TSLP_MOUSE/20-137------------------------------------------------------YNFSNCNFTSITKIY-----------

PF03487

F7DGH7_MACMU/16-144ALLLTMVIALTCLGGFASPSPVPP-ST--------------------------ALKELIEELVNITQNQ----KA-----
H0W834_CAVPO/2-134AFWVTVVLALACLGGLTAPGPVPV-SSTVA----------------------VSIKELLGELVNITQDQ----KT-----
I3MAR4_ICTTR/2-128ALWLTVVLTLACLGGLAAPGPVPPPSP--------------------------AFRELIEELVNITQDQ----KA-----
G1SCQ2_RABIT/16-144ALWWAVAIAVTCLGSLVSPGPVPP-PT--------------------------SLKELIEELVNITHNQ----KA-----
IL13_HUMAN/16-144ALLLTTVIALTCLGGFASPGPVPP-ST--------------------------ALRELIEELVNITQNQ----KA-----
IL13_RAT/2-130ALWVTAVLALACLGGLATPGPVRRSTSP-P----------------------VALRELIEELSNITQDQ----KT-----
L5M5Z7_MYODS/2-128ALWLTLVIVLTCFGGLASPGPVRP-LT--------------------------VVKELIEELDNITQ------KA-----
G5ASP9_HETGA/2-130ALWVTVVLALTCLSALTAPGPVPS-SA--------------------------ALRELIEELANVTQNH----KT-----
L8YAP6_TUPCH/2-128ALWLTVVIALTCLGGLASPASVPS-IR--------------------------ALKELIEELDNVTQNQ----KA-----
IL13_BOVIN/2-130ALLLTAVIVLICFGGLTSPSPVPS-AT--------------------------ALKELIEELVNITQNQ----KV-----
IL13_MOUSE/2-130ALWVTAVLALACLGGLAAPGPVPRSVSL-P----------------------LTLKELIEELSNITQDQ-----T-----
F6WQF3_ORNAN/2-128TVVLLAVFWIDCI----SAKPVTR-SKE-N----------------------ARLEELISYLSSLNLPN----KQ-----
G3T2N9_LOXAF/2-133ALWLTVVIALTCIGGLASPVPVY--NRH-I----------------------WVLRELIGELINITQNQ--LPQA-----
M3YGH3_MUSPF/2-126ALWLTVIIAFICLSGLASPGPVHN-LT--------------------------TTKELIEELANITQNQ-----A-----
B5FW67_OTOGA/2-129ALWLTMVIALTCLGGLASPGPVPR-LT--------------------------KLKELIEELDNITQNQ----RA-----
IL13_CANLF/2-129ALWLTVVIALTCLGGLASPSPVTP-SP--------------------------TLKELIEELVNITQNQ-----A-----

PF00727

IL4_FELCA/26-131-------------------------NF--N----------------------NTLKEIIKTLNILT--A----RN-----
H0XDE1_OTOGA/26-149-------------------------KR--G----------------------IVLKECIKALNILT--E----NK-----
IL4_MOUSE/27-140-----------------------------K----------------------NHLREIIGILNEVT--G----EG-----
G3T4B8_LOXAF/26-132-------------------------TC--G----------------------NILREIIKTLNFLT--E----KK-----
IL4_RABIT/28-143-----------------------------D----------------------IILPEVIKTLNILT--E----RK-----
G5ASQ0_HETGA/25-138--------------------------C--N----------------------DALQEIINDLNVLS--S----QK-----
F6U5N6_HORSE/26-135-------------------------KY--D----------------------ITLQEIIKTLNNLTDGK----GK-----
IL4_BOVIN/26-133-------------------------KC--D----------------------ITLAEIIKTLNILT--T----RK-----
G3QSC0_GORGO/26-149-------------------------KC--D----------------------IALQEIIKTLNSLT--E----QK-----
A3FBF0_MUSPF/26-130-------------------------NF--S----------------------IAIKEIIKTLNILT--A----RN-----
IL4_RAT/27-139-----------------------------D----------------------SPLREIINTLNQVT--E----KG-----
G3WEJ0_SARHA/28-149-------------------------NC--R----------------------STVREIILSASSLT--T----KK-----
IL4_PIG/26-131-------------------------KC--D----------------------ITLQEIIKTLNILT--A----RK-----

PF00143

H8XX39_CHICK/27-182---------------------LPL-QQR-R----------------------VIES-SLQLL-DKMG-------R-----
I3N7K4_ICTTR/69-238---------------------LEV-HLD-M----------------------STSE-NLMLL-TNLS-------N-----
H0W3G0_CAVPO/26-185---------------------LPQ-NSV-L----------------------LCKK-TFVLL-GQIR-------K-----
H0W510_CAVPO/26-185---------------------LPQ-THS-Q----------------------GNMR-ALILL-GQRR-------R-----
Q29098_PIG/26-180---------------------LSQ-NHV-H----------------------VGRK-NLVLL-HQMR-------R-----
G5E7E1_LOXAF/9-168---------------------LQK-KHT-L----------------------TSKK-TFVVL-DQMR-------R-----
IFNE_MOUSE/27-185---------------------IPF-QLW------------------------MNRE-SLQLL-KPLP-------S-----
G3I0H8_CRIGR/26-185---------------------LPQ-THN-I----------------------RNRK-PLTLL-AQMR-------R-----
H0VF99_CAVPO/28-187---------------------LQQ-QQQ-R----------------------SSLA-CLKLL-RQVK-------G-----
L5KKJ7_PTEAL/25-192-----------------------N-LLN-R----------------------VTWQ-NLKLL-SSMR-------N-----
G1U0Q8_RABIT/26-185---------------------LPH-NSV-P----------------------LSRK-TLVLL-GQMR-------R-----
F6YZB3_ORNAN/25-183-----------------------R-PLQ-T----------------------ADVEQSLNRL-DRMK-------G-----
V8NNB8_OPHHA/15-183---------------------LQR-KLL-K----------------------ANKD-NSNLLSSNIR-------P-----
C8CKA7_PIG/26-185---------------------PVQ-THS-L----------------------AHTR-ALRLL-AQMR-------R-----
G3GXU9_CRIGR/27-182---------------------LEL-KQR-K----------------------CNSE-CLEVL-RQLH-------G-----
H0XSG1_OTOGA/26-185---------------------LPQ-SHS-L----------------------GNRR-ALKVL-AQMR-------R-----
G1KX99_ANOCA/25-184---------------------LRS-RLR-Q----------------------ASQV-YLELLNSKMNST----IS-----
G3I0I6_CRIGR/27-185---------------------ILF-QSR------------------------MKRE-SLHLL-KTLP-------I-----
IFNT4_SHEEP/26-185---------------------LSQ-RLM-L----------------------DARE-NLKLL-DRMN-------R-----
L8Y4J0_TUPCH/27-186---------------------FLF-QQR-R----------------------VNRE-SFKLL-NTLR-------S-----
F7B527_HORSE/26-183---------------------PPL-RQR-------------------------NQE-TITLL-SQME-------R-----
G1Q950_MYOLU/27-184---------------------LRF-QQS-S----------------------SNSA-CQKLL-WQLI-------T-----
M3XCW7_FELCA/26-186---------------------LPG-SHA-Q----------------------VSRD-NLVLL-GQMR-------R-----
G5CB66_HETGA/27-185---------------------LQA-QQR-S----------------------SSLA-CGELL-KQLK-------G-----
L9L941_TUPCH/27-198---------------------LNV-HLR-R----------------------VTWQ-NLRLL-SSMS-------N-----
D2H9N6_AILME/27-184---------------------LRF-QLS-S----------------------SSVE-CQNLL-LQLN-------G-----
D3Z919_RAT/26-179---------------------LPR-TH------------------------------NLTVL-KQMS-------R-----
C8CKB9_PIG/24-176---------------------FSG-IHR-L----------------------ENRE-IFMLL-RQMK-------R-----
A8E6F6_XENTR/27-179---------------------LHP-KQE-Y----------------------LNTQ-ILKAF-NEMMP-----LK-----
L8Y906_TUPCH/26-185---------------------LPQ-SLD-S----------------------GKQE-TLTAL-AQMG-------T-----
L5KWM8_PTEAL/106-263---------------------LSQ-DHV-Q----------------------VSKE-NIAIL-HQMQ-------------
G3WZJ8_SARHA/27-182---------------------LTQ-GLQ-E---------------------------DFSFL-NQIS-------V-----
G3UCD2_LOXAF/26-187---------------------LPQ-SHR-L----------------------ANRR-TLILL-EQMR-------R-----
K7GQJ6_PIG/17-164---------------------CQQ-------------------------------K-NLALL-CQIR-------R-----
G3I0H3_CRIGR/26-178---------------------LSL-TPK-P----------------------GEKT-ALTLL-KEMM-------R-----
H0VYK7_CAVPO/28-181---------------------LQQ-QQR-S----------------------SNSA-CLKLL-RQVK-------G-----
L5K635_PTEAL/26-185---------------------LSQ-SLD-L----------------------GKQE-TSTAL-NQMQ-------R-----
W5JYQ9_ASTMX/23-179---------------------VKC-SLQ-R----------------------RLVQTCHHLL-DSMG-------G-----
H0Y0D2_OTOGA/28-187---------------------LPK-SPI-L----------------------NTAV-TLKIL-AQMR-------R-----
IFN_ANAPL/34-190---------------------LRL-HDS-A----------------------FAWD-SLQLL-RNMA-------P-----
G3UJX3_LOXAF/27-185---------------------LQF-QQR-S----------------------SNLA-CQKLL-WKLN-------G-----
G5C259_HETGA/26-185---------------------LPR-THS-Q----------------------GNRR-ALTLL-EQMR-------R-----
G3WZF5_SARHA/26-185---------------------LRF-YQR-R----------------------TNKS-SIYLL-KKMI-------G-----
IFNE_PIG/27-186---------------------VLS-QQR-R----------------------VNRE-SLKLL-NKLQ-------T-----
W5N6G4_LEPOC/27-185---------------------LEH-QLG-N----------------------INEK-SIQAL-KEMG-------G-----
H9KYA4_CALJA/26-185---------------------LPQ-AHS-L----------------------SNRR-ASILL-AQMR-------R-----
D2HTQ4_AILME/33-205---------------------LHF-HLR-K----------------------VTWQ-NLRLL-SSTS-------S-----
IFNB_HUMAN/27-185---------------------LGF-LQR-S----------------------SNFQ-CQKLL-WQLN-------G-----
G1NR05_MELGA/32-188---------------------LRH-QDA-N----------------------FSWK-SLQLL-QKAA-------P-----
F7BVP5_ORNAN/23-181---------------------LYS-HQW-L----------------------NNWQ-SLHLL-DEMG-------G-----
F7G875_MONDO/27-182---------------------LRF-HQR-R----------------------TNQR-SLMFL-NKMI-------G-----
C8CKC3_PIG/33-205---------------------LNA-HLR-R----------------------VSWQ-NLRLL-SRMS-------H-----
F7A317_HORSE/26-184---------------------LPH-THS-L----------------------GNTR-VLMLL-GQMR-------R-----
G1KU56_ANOCA/28-182---------------------LRK-HLL-D----------------------DNKE-NLAVLKSQLG-------S-----
L5KBH2_PTEAL/26-185---------------------LSQ-DHV-Q----------------------VSKE-NIALL-HQMQ-------R-----
L5K909_PTEAL/26-185---------------------LPQ-THS-L----------------------VNRR-ALMLL-GQMR-------R-----
I3N5Z0_ICTTR/23-179---------------------VLL-QQR------------------------IKEE-NLQLL-NNLQ-------T-----
F7GHL9_MONDO/26-181---------------------LTQ-GLQ-K---------------------------DFSLL-NQMS-------T-----
IFNE_HUMAN/27-186---------------------IIF-QQR-Q----------------------VNQE-SLKLL-NKLQ-------T-----
G3UK87_LOXAF/27-184---------------------LPQ-ILG-L----------------------GKQE-TFTPL-GQMR-------R-----
L9LC61_TUPCH/27-185---------------------LRF-QLS-G----------------------SSLA-CKKFL-QQLG-------G-----
IFNB_RAT/27-182---------------------LQF-RQS-T----------------------SIRT-CQKLL-RQLN-------G-----
H0XMZ9_OTOGA/27-186---------------------VLF-QQR-R----------------------VNRE-SIKLL-NELQ-------T-----
G3VDC6_SARHA/27-182---------------------LTQ-GLQ-E---------------------------DVSLL-YQMS-------T-----
I3JM36_ORENI/26-182---------------------MDD-KFK-Q----------------------HNEE-TLKLL-DTMA-------------
L5LKN9_MYODS/27-186---------------------VLF-QQR-R----------------------VNRE-SSELL-KKWQ-------P-----
G1TYS8_RABIT/29-195---------------------LNV-NLN-R----------------------VIRK-NMKLL-RNVS-------H-----
I3UJJ8_FELCA/27-185---------------------ALF-QQR------------------------VNRE-SLKLL-STLQ-------S-----
C8CKA9_PIG/26-183---------------------LPQ-SHD-------------------------NPE-IFTLL-RQMG-------R-----
IFNT2_BOVIN/3-162---------------------LSE-DHM-L----------------------GARE-NLRLL-ARMN-------R-----
M3Z729_MUSPF/26-183---------------------LPQ-DHG-L----------------------LHWR-ALMLL-RQMK-------R-----
IFNA1_MOUSE/26-185---------------------LPQ-THN-L----------------------RNKR-ALTLL-VQMR-------R-----
G3TTC1_LOXAF/26-185---------------------LPQ-NHT-V----------------------ASEK-TVDLL-DQMQ-------R-----
G1PDS6_MYOLU/29-199-----------------------I-HLR-R----------------------ITWQ-NVELL-TNMS-------K-----
F7ABU5_MONDO/27-182---------------------LTL-GLQ-E---------------------------DFSLL-NQMS-------T-----
G1TTX4_RABIT/27-180---------------------LQI-QLW-H----------------------GSLT-CAKLL-LQLN-------G-----
H0XRP5_OTOGA/26-185---------------------LPQ-SHS-L----------------------GNRR-ALIPL-VHMR-------R-----
H0WK94_OTOGA/33-202---------------------LNV-HLR-R----------------------VTLQ-NLRLL-SSMS-------N-----
G1KYL3_ANOCA/23-176---------------------LLT-RLR-E----------------------ANQA-NLDVLHRNMG-------P-----
G3WZQ8_SARHA/26-181---------------------LTQ-GLQ-E---------------------------DFSLL-NQMS-------T-----
H0YTY6_TAEGU/34-188---------------------LWT-HDD-S----------------------FPGD-ALRLL-QDMA-------P-----
I3MXH1_ICTTR/27-185---------------------LRL-QQF-N----------------------SSVE-CQKLL-EQLN-------G-----
M3WRV1_FELCA/26-184---------------------LPQ-THG-L----------------------LNRR-ALTLL-GQMR-------R-----
R4GKJ6_CHICK/35-191---------------------LRP-QDA-T----------------------FSHD-SLQLL-RDMA-------P-----
A3FBE8_MUSPF/27-184---------------------LRF-QLS-S----------------------SSVE-CQELL-LQLN-------G-----
G1KWE0_ANOCA/28-180---------------------LCS-WLR-Q----------------------ANQA-NLELLNSKMG-------S-----
G7PS89_MACFA/26-185---------------------LPQ-THS-L----------------------GYRR-PLVLL-AQMR-------R-----
G1Q880_MYOLU/26-185---------------------LPQ-DHI-L----------------------LSRE-NLELL-SQMS-------T-----
IFNB_MOUSE/27-180---------------------LQL-QER-T----------------------NIRK-CQELL-EQLN-------G-----
IFNB2_BOVIN/27-184---------------------LRF-QQR-R----------------------SLAL-CQKLL-RQLP-------S-----
G1SJC4_RABIT/26-185---------------------LPQ-THS-L----------------------SDRR-SSMLL-GQMR-------R-----
W5PG31_SHEEP/26-185---------------------LPH-THS-L----------------------ANRR-VLTLL-RQLR-------R-----
IFNA3_CANLF/26-183---------------------LPD-THS-L----------------------RNWR-VLTLL-GQMR-------R-----
G5BPX2_HETGA/27-199---------------------QNV-RLS-T----------------------VTKE-NVRLL-SSVS-------N-----
IFNW2_HORSE/26-185---------------------LPQ-NHI-L----------------------VSRK-NFVLL-GQMS-------R-----
G3N2A8_BOVIN/26-185---------------------LSQ-NHM-L----------------------VGRK-NLRLL-GQMR-------R-----
H0XKS8_OTOGA/27-185---------------------LQF-QQR-R----------------------STLG-CQKLL-RQLN-------G-----
A0A286X8P0_CAVPO/26-185---------------------LPL-TYM-Q----------------------GNTT-ALSLL-EQMR-------R-----
Q29412_PIG/27-184---------------------LRY-QQR-S----------------------SNLA-CQKLL-GQLP-------G-----
G7PS88_MACFA/26-185---------------------LPE-THS-L----------------------DNRR-TMMLL-KQMS-------R-----
M3WZS7_FELCA/26-181---------------------LRP-S---------------------------NPE-TFTLL-SQME-------R-----
H9GZR7_HORSE/26-185---------------------LPA-SLD-L----------------------RKQE-TLRVL-DQME-------T-----
F1LVL8_RAT/26-184---------------------ILF-QSR------------------------RNRE-SLQLL-KALP-------S-----
M3YX13_MUSPF/27-179---------------------ALF-QQR------------------------VNRE--LKLL-NKFP-------K-----
G1L8G2_AILME/26-185---------------------LPQ-NHG-L----------------------FAWR-ALTLL-SQME-------R-----
IFNB_HORSE/27-184---------------------LRS-QLR-S----------------------SNSA-CLMLL-RQLN-------G-----
H0W289_CAVPO/26-190---------------------LPQ-NFI-L----------------------LSRK-ILELL-DQMR-------R-----
A8E6E8_MONDO/27-182---------------------LTQ-GLQ-E---------------------------DFSLL-NQMS-------T-----
I3N788_ICTTR/27-185---------------------LRL-QQS-S----------------------SSLE-CQKLL-QQLN-------G-----
G1L8I1_AILME/26-183---------------------LPQ-NHG-L----------------------FAWR-ALTLL-GQMK-------R-----
IFNB_FELCA/27-184---------------------LGF-QLR-S----------------------SSLE-CQELL-VNLN-------R-----
G3TS29_LOXAF/26-179---------------------LPL-SHS-------------------------NQE-TFTLL-NQME-------R-----
W5PZ39_SHEEP/26-184---------------------LNV-HLR-R----------------------VTWQ-NLRLL-SRMS-------N-----
G3I0H6_CRIGR/26-178---------------------LSP-SPK-P----------------------GNKT-ALTLL-KEMR-------R-----
M3Z715_MUSPF/26-183---------------------LPR-DHS-L----------------------LHWR-ALMLL-RQMK-------R-----
M3VXI8_FELCA/33-205---------------------LHL-HLR-E----------------------VTWQ-NLRLL-NSMS-------N-----
G3R8Q7_GORGO/26-185---------------------LPQ-NHG-L----------------------LSRN-TLVLL-HQMR-------R-----
A8E6F5_XENTR/51-202---------------------LQP-KQE-Y----------------------LNRQ-TLKTF-EEMNP-----PE-----

PF02947

FLT3L_MOUSE/30-162------------------DCYFSH-SPI-S----------------------SNFKVKFRELTDHLL-------K-----
F6T7S9_ORNAN/28-157------------------ACAFRY-SPV-S----------------------SMFGLHIHNLAQYLL-------Q-----
H9GP84_ANOCA/29-165------------------GCIFGS-VPIDT----------------------SDFPSIVKNLKKLLL-------L-----
F6TPW7_MONDO/34-163------------------SCTFPD-SPI-S----------------------STFLQAIGRLSDYLL-------T-----
G5B8P0_HETGA/20-150------------------SCSFSH-NPI-S----------------------SDFKIKFSTLSDYLL-------K-----
G1M637_AILME/29-159------------------DCAFSH-SPI-S----------------------STFSVTIHKLSDYLL-------Q-----
L9JA37_TUPCH/769-910----------------------QG-SPI-A----------------------STFADRIDQLSDYLL-------L-----
G3VSA3_SARHA/79-209------------------PCSFPD-SPI-S----------------------SIYPGIISTLSDFML-------G-----
G1QZC3_NOMLE/30-160------------------DCSFQH-SPI-S----------------------SDFAVKIRELSDYLL-------Q-----

PF00714

I3MNV6_ICTTR/15-152------------------------------------------------------------IL------------G-----
IFNG_HORSE/15-152------------------------------------------------------------IL------------G-----
H0WPL1_OTOGA/15-151------------------------------------------------------------LL------------G-----
Q8CGS0_CAVPO/15-154------------------------------------------------------------IL------------S-----
B9VS86_CALJA/15-152------------------------------------------------------------VL------------G-----
G3SUC6_LOXAF/15-152------------------------------------------------------------IL------------G-----
G3GY20_CRIGR/2-135--------------------------------------------------------------------------------
L5LME8_MYODS/15-153------------------------------------------------------------IL------------G-----
G5BGB5_HETGA/15-152------------------------------------------------------------IL------------G-----
G3WQJ9_SARHA/15-153------------------------------------------------------------IL------------S-----
IFNG_SHEEP/15-152------------------------------------------------------------LL------------G-----
IFNG_RAT/14-151------------------------------------------------------------LM------------A-----
IFNG_RABIT/15-152------------------------------------------------------------IL------------G-----
L9KVU0_TUPCH/51-188------------------------------------------------------------IL------------G-----
IFNG_FELCA/15-153------------------------------------------------------------IL------------C-----

PF02372

IL15_PIG/33-160VFILGCISAGLPKT----EAT----WQ-------------------------HVISD-LKKI-----------ED-----
IL15_CAVPO/33-160VFVWGCISAGLPKT----EAS----WH-------------------------DVIYD-LKRI-----------EN-----
IL15_FELCA/33-160VFILSCINAGLPKT----EAN----WQ-------------------------DVISD-LKII-----------DK-----
IL15_SHEEP/33-160VFILGCISAGLPKT----EAN----WQ-------------------------SVIHD-LKTI-----------EH-----
F1NZN5_CHICK/55-183-FFL-C--AYVPKT----EANHCK-WS-------------------------DVLKD-LELI-----------K------
G1NDP6_MELGA/5-137VLIFSCISVALLMT----TAYGAS-LS-----------------PEKLEILPALIKD-LEIL-----------EE-----
O73883_CHICK/5-138VLIFGCISVAMLMT----TAYGAS-LS-----------------SAKRKPLQTLIKD-LEIL-----------EN-----
Q8JFF4_ANAPL/4-134VLIFSCLSVLMLMT----TAYGAP-LS-----------------EKD-NTLKTLIKD-LENL-----------GT-----

PF00715

I3MQX6_ICTTR/7-151---LSCLALTLALL----AHGAPT-SGS-A--------------EETRQQLEHLLLD-LQVLSRGVSNQ----EN-----
G5C793_HETGA/7-149---LSCIALTLALI----TSSAPT-SSS-T--------------RETQEQLEQLLLD-LQVILKGVT------RN-----
G1PJ32_MYOLU/7-147---LSCIALTLAFI----ADGAPT-SSS-S--------------QETQQQLEHLILD-MQRLLNGVSNY----KN-----
B1AB81_HORSE/7-146---LACIALTLAVL----ANSAPT-SSS-K--------------RETQQQLKQLQMD-LKLLLEGVNNN----KN-----
G3HTL8_CRIGR/7-150---ASCLALTLALL----VNSAPT-SSS-K--------------KETQQHLEQLLLD-LQVLLKGINNN----KN-----
IL2_MACMU/7-151---LSCIALSLALV----TNSAPT-SSS-T--------------KKTQLQLEHLLLD-LQMILNGINNY----KN-----
H0Y254_OTOGA/7-149---LTCIALTFALV----TNSAPI-SSS-T--------------KETRQQLEQLLLD-LQMVLNGVNNN----KN-----
IL2_MOUSE/7-165---ASCVTLTLVLL----VNSAPT-SSS-TSSSTAEAQQQQQQQQQQQQHLEQLLMD-LQELLSRMENY----RN-----
G3SU90_LOXAF/7-147---LSCIALTLALV----ANSAPT-SSS-T--------------KETQQQLEQLLLD-LQMLLIRVKNY----ET-----
IL2_PIG/7-151---LCCIALTLALM----ANGAPT-SSS-T--------------KNTKKQLEPLLLD-LQLLLKEVKNY----EN-----
IL2_FELCA/7-151---LSCIALTLILV----TNSAPA-SSS-T--------------KETQQQLEQLLLD-LRLLLNGVNNP----EN-----
L5K7D9_PTEAL/7-149---LSCIALTLALV----ADGAPT-SSS-R--------------KETQQQLEHLLKD-LQRLLETVNNY----KN-----
IL2_BOVIN/7-152---LSCIALTLALV----ANGAPT-SSS-T--------------GNTMKEVKSLLLD-LQLLLEKVKNP----EN-----
H0VBY4_CAVPO/7-149---LSCLALTLALL----TSSAPT-SSS-P--------------KQTQDRLELLLRD-LQTLLEGVT------SN-----

PF01415

M3WJR8_FELCA/15-127-----------SVA----SQRCST-LSG-I------------------QDVTYLINK-LQEHPPSKCDC----G------
H0X0U6_OTOGA/15-141-----------SVD----GQGCST-HMG-I------------------LDINFLINK-LQTDLSSKCSC----S------
G1QNL2_NOMLE/28-172-----------DIE----GKDGKQ-YES-V------------------LMVS--IDQLLDSMKEIGSNC----L------
IL7_BOVIN/28-171-----------DIS----GKDGGA-YQN-V------------------LMVN--IDD-LDNMINFDSNC----L------
F1PA23_CANLF/29-154-----------DIE----GKDGRE-YQH-V------------------LMIS--IND-LDIMIKNRTNC----S------
IL9_MOUSE/15-141-----------SVL----GQRCST-TWG-I------------------RDTNYLIEN-LKDDPPSKCSC----S------
U3KN10_RABIT/31-153-----------KI------KHGKE-YEN-V------------------LMIS--INE-LDKMIEIGSNC----L------
K7E262_MONDO/59-200-----------------------D-YIH-L------------------LHEG--IEI-LEKAINF-ANC----S------
E1BF10_BOVIN/18-141-----------S-------QGCFT-LTG-I------------------RNAVYLIDN-LQKDTSSKCSC----S------
F6PLW3_HORSE/15-136-----------SVA----GQGCST-MAG-I------------------MDVKYLIDN-LQVSFREG--------------
IL9_HUMAN/15-141-----------SVA----GQGCPT-LAG-I------------------LDINFLINK-MQEDPASKCHC----S------
IL7_MOUSE/28-151-----------HIK----DKEGKA-YES-V------------------LMIS--IDE-LDKMTGTDSNC----P------
G5BX09_HETGA/15-141-----------SVA----GQRCST-SSG-I------------------RYINYLISN-LQKDPLSTCSC----S------
L8Y4N8_TUPCH/15-141-----------SVA----SQECST-SEG-I------------------WNLNSLIQK-WQEEPSAKCNC----S------
D4A8I9_RAT/15-141-----------SVL----GQRCST-SWG-I------------------QHTSYLIEN-LKDDPSSKCSC----S------
G3TKQ6_LOXAF/16-136------------MA----GKTCFS-SWG-T------------------KDVNYLIQK-LQEHPPSKCEC----S------
M3YEX7_MUSPF/16-137-----------SVT----SKSCPT-FIG-I------------------RDVTHLIDK-LQEHPASKCNC----SR-----
G1NXN3_MYOLU/28-153-----------EIE----GKSGEE-YQH-V------------------IMVS--LND-LDRIRENDSNC----L------

PF00103

PLRP1_BOVIN/26-238---LLMSNLLLCQ-----GKSCPS-CGP-DVFVSLRKSFTDRFMNAASLSHDFYNLS-TIMFNEFDEKY----AQ-----
CSH2_BOVIN/26-238---LVVSNLLLCQ-----GISCPS-CGP-DMFVSLQKSLIDVFINAASLSHDFHNLS-TIMFNEFDEKY----AQ-----
PLRP3_BOVIN/1-213---MVMSNLLLCQ-----VNSCPS-CCP-DVFDIPLESLTHLFLNASRLSHDIVNHT-TIMFHEFDEKY----AQ-----
PR4A1_RAT/17-227---LLVSNLLLWEN----TASAMR-AKL-L-NVHNYTSYGDTWNQAIKISQDMNQYI-SDLSTHVKIFY----AQ-----
CSH1_BOVIN/26-236---LVVSNLLLCQGVEDYAPYCKN-QPG-N----CRIPLQSLFERATLVASNNYRLA-REMFNEFNKQF----GE-----
PLRP4_BOVIN/26-239---LVMSNLLLCQ-----GILCPS-LCP-DGDDVCRASLIDLFVHASVLSTGMYNTS-VKMFTDFDEQY----AQ-----
PR3D4_RAT/16-223---LLVSNLLLWEN----MASKPT-VLV-S--------TEDLYHRLVEQSHNTFIKA-ADVYREFDINF----AK-----
PR2C2_MOUSE/16-224---LLVNSSLLWKN----VASFPM-CAM-R-NGRCFMSFEDTFELAGSLSHNISIEV-SELFTEFEKHY----SN-----
SOM2_HUMAN/9-215---LLLAFGLLCLSWLQEGSAFPT-IP-----------LSRLFDNAMLRARRLYQLA-YDTYQEFEEAY----IL-----
PR8A5_RAT/17-238---LVVSNLLLWEK----AASIPA-CMV-E-DGGCWDPLREAFNSATQRAETLRNLS-DQLYVEFFQNQ----FS-----
PR6A1_RAT/20-234---LLMSNILLWEN----VASVPR-HAS-GAGRG-EMSLHGLLDHAIILAHNVTELI-AEMNSVFLEDV----LY-----
PR7D1_MOUSE/17-240---LLMSNLFLWEK----VSSAPI-NAS----EAVLSDLKDLFDNATVLSGEMSKLG-VIMRKEFFMNS----FS-----
CSH2_HUMAN/9-215---LLLAFALLCLP---WLQEAGA-VQ--------TVPLSRLFDHAMLQAHRAHQLA-IDTYQEFEETY----IP-----

PF01109

CSF2_RAT/18-139----------------------AP-TRS-P----------------------NPVTR-P--WKHVDA-I----KE-----
CSF2_MOUSE/18-136----------------------AP-TRS-P----------------------ITVTR-P--WKHVEA-I----KE-----
CSF2_BOVIN/18-138----------------------AP-TRP-P----------------------NTATR-P--WQHVDA-I----KE-----
CSF2_CAVPO/18-140----------------------AP-TDL-L----------------------SPVTQ-S--WKHVDATI----NE-----
CSF2_PIG/18-139----------------------AP-TRP-P----------------------SPVTR-P--WQHVDA-I----KE-----
CSF2_HUMAN/18-139----------------------AP-ARS-P----------------------SPSTQ-P--WEHVNA-I----QE-----
CSF2_CANLF/18-139----------------------AP-TRS-P----------------------TLVTR-P--SQHVDA-I----QE-----

PF02025

I3MDT8_ICTTR/22-133---------------------------L-E----------------------IPMST-L---------V----KE-----
G1RQD7_NOMLE/22-133---------------------------T-E----------------------IPTSA-L---------V----KE-----
IL5_CAVPO/23-134---------------------------Q-S----------------------ATLRA-L---------V----RE-----
J9NWP5_CANLF/22-132---------------------------V-E----------------------NPMNR-L---------V----AE-----
IL5_MOUSE/21-132---------------------------M-E----------------------IPMST-V---------V----KE-----
G3WAR7_SARHA/25-134----------------------------------------------------NPVTE-L---------I----SE-----
IL5_HORSE/22-133---------------------------V-E----------------------SPMNR-L---------V----AE-----
B5FW65_OTOGA/22-133---------------------------I-E----------------------ISMST-L---------V----KE-----
G3T4B0_LOXAF/23-133---------------------------I-E----------------------IPVHR-L---------V----AE-----
G1SL79_RABIT/22-133---------------------------T-E----------------------IRMST-V---------V----KE-----

PF02059

IL3_CANLF/19-132-----------------------P-QAQ-G----------------------RP-FS-TDLPKQYFTMI----NE-----
IL3_MOUSE/27-138----------------------AS-I-S-G----------------------RDTHR-LTRTLNCSSIV----KE-----
IL3_BOVIN/18-132----------------------AP-QAK-G----------------------LPVVT-SRTP--YSMLM----KE-----
G3UC30_LOXAF/22-133-------------------------KAQ-G----------------------MP-VT-A--PQHYSVMI----NE-----
G1MH15_AILME/18-131----------------------AP-MAQ-G----------------------RS-LS-TYQPKQYFEMI----SE-----
G1RQ11_NOMLE/20-137----------------------AP-MTQ-T----------------------TSLKT-S--WVNCSNMI----DE-----
IL3_CALJA/19-136----------------------AA-PTQ-T----------------------MPLKT-T--QVNCSNLR----EE-----
F1LS41_RAT/29-138----------------------GS-A-----------------------------HR-LLRTLDCRTIA----LE-----

PF00758

H0W023_CAVPO/30-191----------------------RL-ICD-S----------------------TVLER-Y--IVEAKDAE----NV-----
G3TYQ1_LOXAF/25-173----------------------PP-ACD-P----------------------RLLNK-L--LRDSHILH----SR-----
W5K758_ASTMX/26-175----------------------RP-ICD-L----------------------RVLDH-F--IKEAWDAE----AT-----
B1N8Y2_DANRE/15-168----------------------RP-ICD-L----------------------RVLDH-F--IKEAWDAE----AA-----
F7DTH0_CALJA/31-193----------------------HL-ICD-S----------------------GVLER-Y--VLEGKEAE----NV-----
M3XJ62_LATCH/27-177----------------------RP-VCD-T----------------------SVMDK-F--IEDAKDAE----SF-----
G3W289_SARHA/30-190-----------------------P-FCE-S----------------------HILER-Y--ILEAKEAQ----NA-----
F6WUU2_MONDO/31-191-----------------------P-FCD-S----------------------HILER-Y--ILEAKEAQ----NA-----
G3VW20_SARHA/26-175----------------------AP-VCD-P----------------------RLFNK-L--LRDSAALH----SR-----
G1PF99_MYOLU/45-207----------------------RL-ICD-S----------------------RVLER-Y--ILEAREAE----NV-----
TPO_CANLF/25-176----------------------PP-ACD-P----------------------RLLNK-M--LRDSHVLH----SR-----
F7G570_MONDO/26-177----------------------AP-VCD-P----------------------RLFNK-L--LRDSAALH----SR-----
H2LEX3_ORYLA/33-182----------------------RP-ICD-L----------------------RVLNH-F--IQEARDAE----VA-----

PF00726

IL10_BOVIN/5-174ALLCCLVFLAGVAASRDASTLSDS-SCI-H----------------------LPTSL-PHMLRELRAAF----GK-----
IL10H_EBVB9/7-167VTLQCLVLL---------YLAPEC-GGT-D----------------------QCDNF-PQMLRDLRDAF----SR-----
G3HB01_CRIGR/14-174---------AGVGPSRGQYTQQEN-NCT-H----------------------FPVSQ-THMLRELRTAF----SQ-----

PF14565

IL22_HUMAN/40-178--------------------------CR-L----------------------DKSNF-QQPYITNRT-F----ML-----
E1C1U2_CHICK/46-184--------------------------CR-L----------------------RKINF-QQPYIRNRT-Y----TL-----

PF15177

I3MK89_ICTTR/29-189----------------------AR-DCD-M----------------------AQFKT-LAP-QELQA-F----RK-----
H0VBN4_CAVPO/32-188----------------------TK-ECH-M----------------------AKFKS-LSP-QELQA-F----KT-----
IFNL3_CHICK/28-182----------------------KK-SCS-L----------------------SKYQF-PAP-LELKA-V----WR-----
F1M3K4_RAT/31-188----------------------AK-DCN-I----------------------AQFKS-LSP-QELQA-F----RK-----
F1PY54_CANLF/31-186----------------------RR-GCH-M----------------------DRFQS-LSP-RELEA-F----KK-----
H0XRJ1_OTOGA/35-191----------------------WR-GCH-I----------------------GTFKS-LSP-QEVET-F----KK-----
F6PNH9_HORSE/31-184----------------------QR-SCD-I----------------------GRFKS-LSP-SELEA-F----KK-----
D2DJP5_XENTR/23-178----------------------RR-HCH-M----------------------SRYRS-VSP-SDIRA-V----RR-----
G3TQK4_LOXAF/32-188----------------------AR-GCR-I----------------------DQFKS-LSP-RELQA-F----QR-----
F7DXI8_HORSE/34-187----------------------AR-GCH-I----------------------AQYKS-LSP-GERLA-F----KN-----
F6W920_MONDO/30-184----------------------EK-SCQ-I----------------------PQFKS-LSP-REMEA-F----TM-----
U3KED0_FICAL/27-186----------------------RK-GCR-L----------------------SKYQN-IAH-EEQKA-V----DK-----
IFNL4_HUMAN/25-174-----------------------R-RCL-L----------------------SHYRS-LEP-RTLAA-A----KA-----
IFNL2_MOUSE/32-189----------------------AK-DCH-I----------------------AQFKS-LSP-KELQA-F----KK-----
G3N0M3_BOVIN/37-192----------------------AR-GCH-M----------------------AQFKS-LSP-QELQA-F----KT-----
G1LPU9_AILME/37-191----------------------WK-GCD-I----------------------GRFKS-LSP-RELEA-F----RK-----
L5LZZ9_MYODS/163-319----------------------AR-GCH-M----------------------GQFKS-LSP-QEMKA-F----KR-----
IFNL3_HUMAN/34-192----------------------AR-GCH-I----------------------AQFKS-LSP-QELQA-F----KR-----
F6R8C9_XENTR/23-177----------------------RR-HCH-M----------------------SRYRS-VSP-SDIRA-V----RR-----
G3VJ97_SARHA/12-167----------------------ER-SCQ-I----------------------SQFKS-LSP-RELET-F----KV-----
H0XJU8_OTOGA/36-192----------------------AK-GCH-L----------------------AQFKS-FSP-KELQA-F----KR-----
G3HJD0_CRIGR/30-187----------------------AK-DCH-I----------------------ARFKS-LSP-QEREA-F----LK-----
G1LPW2_AILME/34-190----------------------AR-GCP-L----------------------AQFQS-LSP-QELQA-F----KK-----
L5L378_PTEAL/33-182----------------------GR-SCN-I----------------------GKFKS-LPP-TEWKA-F----KK-----
G1T4B0_RABIT/34-188----------------------GR-DCR-I----------------------DSFKS-LSP-RELEA-F----KT-----
U3IYH6_ANAPL/34-185----------------------KK-SCR-L----------------------SQYGS-PAY-SELAE-V----LK-----
L9LBW1_TUPCH/31-181----------------------GR-SCN-M----------------------SRFKS-LSP-RELEA-F----KK-----
D0FHA1_PIG/36-191----------------------AR-GCH-L----------------------AQFKS-LSP-QALQA-F----KR-----

PF05337

CSF1_HUMAN/41-180--------------------HMIG-SGH-L----------------------QSLQR-LID-SQMET-S----CQ-----
Q3TLQ6_MOUSE/41-180--------------------HMIG-NGH-L----------------------KVLQQ-LID-SQMET-S----CQ-----
O77709_BOVIN/41-180--------------------HMIG-NGH-L----------------------LFLQQ-LID-SQMET-S----CQ-----
O77710_BOVIN/41-180--------------------HMIG-NGH-L----------------------LFLQQ-LID-SQMET-S----CQ-----
Q64129_9MURI/41-180--------------------HMIG-NGH-L----------------------KVLQQ-LID-SQMET-S----CQ-----

PF15036

IL34_MOUSE/28-184------------------TLTQDK-ECD-L----------------------TGYLR-GKLQYKNRLQY----MK-----
R4GIU3_CHICK/19-177-------------------VAALG-ECE-L----------------------ARLLQ-DKLRYEMRLQY----MK-----
F7EA00_CALJA/29-185------------------PLTQSK-ECT-V----------------------TGFLR-DKLQYRNRLQY----MY-----
H0WFN4_OTOGA/28-184------------------SLTQSQ-ECT-V----------------------TSSLR-DKLQYRNRLRY----MK-----
M3ZVZ0_XIPMA/24-191------------------ASTPAS-MCT-P----------------------LKTLN-DSLSH--RRRY----MK-----
U3JY35_FICAL/18-179------------------EAAAPG-ECE-L----------------------TRLLQ-DKLQYEMRLQY----MK-----
L9KJY3_TUPCH/28-184------------------PVTQSK-ECA-V----------------------TGFLR-EKLQYRNRLQY----MK-----
G3T3A6_LOXAF/28-182------------------PLTQGE-ECT-F----------------------TGYLR-DKLQYKNRLQY----MK-----
F6W3U1_MONDO/15-167---------------------QNK-ECI-I----------------------TGILR-DKLQYRHRLRY----MK-----
I3JZ08_ORENI/24-192-------------------PTHSS-MCT-P----------------------LRTIN-DSLSH--RRQY----MK-----
L5MCR9_MYODS/28-182------------------PLTQSK-ECA-L----------------------TGILR-NKLQYRNRLLY----MK-----
B3DLJ8_DANRE/23-195------------------SSAAPD-LCG-P----------------------LKTVQ-DSLNATLRRRY----MK-----
IL34_BOVIN/28-183------------------PLTRSD-ECA-I----------------------TGFLR-DKLQYRNRLQY----MK-----

PF02404

R4GD07_ANOCA/1-283---------------MKTAQTWII-TCF-Y----------------------LQLLL-LHPLVKTQSPC----GNPVTDD
SCF_CHICK/1-287---------------MKKAQTWII-TCF-C----------------------LQLLL-LNPLVKAQSSC----GNPVTDD
SCF_RAT/1-273---------------MKKTQTWII-TCI-Y----------------------LQLLL-FNPLVKTQEIC----RNPVTDN
G1NWC8_MYOLU/1-272-----------------KTQTWII-TCI-Y----------------------LQLLL-FNHLVRTTGIC----TNRVTDD
F7EP53_MONDO/1-273---------------MKKTQTWII-TCI-Y----------------------LQLLL-FNPLVKTKGIC----GNPVTDD
F7C5I3_ORNAN/1-273---------------MKKTQTWII-TCI-Y----------------------LQLLL-FIPLIRAQKNC----GNPVTDD
F7G0W2_CALJA/1-273---------------MKKTQTWIL-TCI-Y----------------------LQLFL-FNPFVKTEGVC----RNRVTNN

PF00489

M3X721_FELCA/44-225KCE-------------------DSKEALAENNLNLPKLAEKDGCFQS--------------------GF--NQETCLTRI
IL6_BOVIN/27-208ECE-------------------SSKETLAENKLNLPKMEEKDGCFQS--------------------GF--NQAICLIRT
IL6_HORSE/27-208KCE-------------------NSKEVLAENNLNLPKMAEKDGCFQS--------------------GF--NQETCLMKI
G3UHF3_LOXAF/20-205KCE-------------------NSREALAGNNLKLPQMTEEDGCFHS--------------------GF--NKETCLMKI
L5KPK4_PTEAL/20-202SCK-------------------NSKEVLTENNLNLPKMAEKDGCFQS--------------------GF--NQETCLMKI
F7HV62_CALJA/27-212MCE-------------------SSKEALAENNLNLPKMAEKDGCFQS--------------------GF--NEETCLLKI
IL6_MOUSE/26-210DCM-------------------NNDDALAENNLKLPEIQRNDGCYQT--------------------GY--NQEICLLKI

PF16647

CSF3_BOVIN/42-190LCH-------------------PEELMLLRHSLGIPQ-APLSSCSSQ--------------------SL--QLTSCLNQL
CSF3_HUMAN/51-202LCH-------------------PEELVLLGHSLGIPW-APLSSCPSQ--------------------AL--QLAGCLSQL
CSF3_MOUSE/57-205LCH-------------------PEELVLLGHSLGIPK-ASLSGCSSQ--------------------AL--QQTQCLSQL

PF16649

IL23A_MOUSE/28-185MNL-------------------LREEEDEETKNNVPRIQCEDGCDPQ--------------------GLKDNSQFCLQRI
F7HQI5_MACMU/28-184MDL--------------------REEGDEETTNDVPHIQCGDGCDPQ--------------------GLRDNSQFCLQRI
F1MSN4_BOVIN/35-192VDL-------------------PREEGGDKTTDDVPRIQCEDGCDPQ--------------------GLRDNSQSCLQRI
IL23A_CAVPO/28-184VEP-------------------PREEADEETTDYVPHILCGDGCDPQ--------------------GLKDNSQFCLQRI
G3VET0_SARHA/31-186LEL-------------------PREEGTGEAVDDVPHIQCGDGCDHQ--------------------SLNDNSQLCLQQI

PF07400

F1R6T9_DANRE/26-187E----------------------LTDFE-HSLSSLPSLNYS-VKDLH--------------------SL--EVSSTLAQL
A0A0P7XG98_9TELE/28-193V---------------------IGTDIE-HRFKTLPAMANR-VADLS--------------------TL--EVKSTLAQL
F1R1E3_DANRE/28-198V---------------------FSTEINHHRFKSLPAISSR-ASDFA--------------------TL--EVKPTLSQL
H2T1R2_TAKRU/27-195S---------------------FDSDVEPHRFTSLPEMSNRSAHSLN--------------------NL--ELKPTLSQL
H2M884_ORYLA/28-196E---------------------FDSDVESHRFRSLPEMSNRLATDLH--------------------NL--ELKPTLSQL
H3A6V0_LATCH/22-190KLK-------------------FPSEGE-HRLETLPVLSGS-ASDLG--------------------AI--QVTNALSKI
G5BVZ4_HETGA/26-199RDK-------------------FPVDGD-HSLDSLPTLAMS-ASALG--------------------AL--QLPSVLTRL
F6WLV3_XENTR/22-187KAK-------------------YPSEGE-HKLDSLPVLSMN-AVEIS--------------------NV--QIHTGLLKL
G3P408_GASAC/28-197ELV-------------------IFEGVE-HRLDDLPHIQHT-AAHFS--------------------SL--KVNESLSQL
A0A091E199_FUKDA/60-227KNQ-------------------YPVAGG-FGLKSLPKLAMS-AGALG--------------------AL--QLSSMLTRL
W5LKH5_ASTMX/28-199E---------------------LDSVIDHHRFKSLPAINGR-ANDLS--------------------SL--ELKTTLSQL

PF06875

Q5BNQ4_9SALA/2-215PDY-------------------QLPHIKVVNLPTAAMD------------------------------YDTFIRQTDETR
Q5BNQ2_9SALA/2-215PDY-------------------QLPHIKVANLPTAAMD------------------------------YDTFMKQTDETR

PF01110

CNTF_CHICK/1-194-DA-------------------SISVAAVDGVPTAAV--------------------------------ERWAEQTGTQR
G3VWZ5_SARHA/1-195-NK-------------------DVDLDSMDGVPTAST--------------------------------DRWSELTEAER
E1BFH9_BOVIN/1-193-NG-------------------NMNLDTLEGVPTASS--------------------------------SRWSELTEAER
G5AP46_HETGA/1-192-SE-------------------NVSLDAVGGVPAASI--------------------------------AQWSELTEAER
H0Z9U1_TAEGU/1-188-DA-------------------SASVAAMEGVPLAAV--------------------------------ERWDEQTGTQR
CNTF_HUMAN/1-194-NK-------------------NINLDSADGMPVAST--------------------------------DQWSELTEAER

PF01291

LIF_MOUSE/44-203NVE-------------------KLCAPNMTDFPSFHG------------------------------------NGTEKTK
LIF_BOVIN/43-202NLD-------------------KLCSPNVTDFPPFHA------------------------------------NGTEKAR
ONCM_HUMAN/37-209KLR-------------------EHCRERPGAFP-SEE------------------------------------TLRGLGR
ONCM_MOUSE/34-194DLR-------------------AACTQHSVAFP-SED------------------------------------TLRQLSK
ONCM_BOVIN/34-194VLQ-------------------EHCRERPGDFP-SED------------------------------------ALWRLSR

PF03039

I3MN91_ICTTR/3-204ITK-------------------NRTNTVKACLPQELAQ-NENCLASR--------------------ETSFII-------
IL12A_MOUSE/6-215ITR-------------------DQTSTLKTCLPLELHK-NESCLATR--------------------ETSSTTRGSCLPP
G3VQT1_SARHA/40-247ITE---------------------SNTGRVCLPPELIKKNFISNPTG--------------------KIFIINNGSCLDS
F6T5A8_MONDO/5-202ITK-------------------GRSDTVRACLPPEFIK-----------------------------------NGSCLVS
IL12A_PIG/6-222ITK-------------------DKTSTVEACLPLELAT-NESCLAAR--------------------ETSLITNGNCLTS
L8YEA2_TUPCH/1-213ITK-------------------DKTSTVKACLPLELIT-NESCLASR--------------------ETSFKTNGSCLAP
H0X861_OTOGA/6-217ITK-------------------DKTSTVRACIPLELTK-NESCLASR--------------------ETSFIPNGKCLTS
Q924V6_CAVPO/6-221ITK-------------------DKTSTVKACVPLELVK-NESCLASG--------------------HISFTTNGSCLAS

PF02024

H3AP27_LATCH/26-169ITR-------------------IQQHPNQFLLPLNLK-----------------------------------VSGLEFIP
G3WWV6_SARHA/23-167ITR-------------------INDISHMYSISAKQR-----------------------------------VTGLDFIP
F6PLK2_ORNAN/23-167ITR-------------------IIQLSNRNGVSTDQR-----------------------------------VSGLDFIP
F7HGW1_CALJA/23-167IAR-------------------INDLSHTQSVSPRQR-----------------------------------VTGLEFIP
G5BHA4_HETGA/23-167VSR-------------------INDISHMQSVSSKHK-----------------------------------VTGLDFIP
W5NER9_LEPOC/28-172VIR-------------------IQKHTNESKMSPNLV-----------------------------------FSGLELIP
A0A286XUJ2_CAVPO/23-165INR-------------------IRNISHLQSVSSKHK-----------------------------------VTGFDFIP
LEP_HUMAN/23-167VTR-------------------INDISHTQSVSSKQK-----------------------------------VTGLDFIP

PF15216

M3WGC3_FELCA/29-146-QE-------------------VIYQA-LNKYMNGV------------------------------------------NP
F1RLI5_PIG/20-130-EE-------------------VIHHE-LKTYINGV--------------------------------------------
A0A2I2YQB0_GORGO/29-153-LS-------------------TISKD-LITYMSGT-------------------------------------KSTEFNN
F7I7D5_CALJA/29-153-CR-------------------TILED-LLTYMIGT-------------------------------------KSTEFNN
K7E5V9_MONDO/34-162-EN-------------------IIYNEKLESLYNSEM------------------------------------PSSEDSN
L8YGS5_TUPCH/5-129-EK-------------------LIVGD-FQTYINGT-------------------------------------KSTQSSN
J9P5I8_CANLF/29-154-QE-------------------VIYQA-LEKYMDGVN------------------------------------RSTEFSH
TSLP_MOUSE/20-137-CN-------------------IIFHD-L----TGDL------------------------------------KGAKFEQ

PF03487

F7DGH7_MACMU/16-144----------------------PLCNGSMVWSI-----NL----TAG--------------------V-YCAALESLINV
H0W834_CAVPO/2-134----------------------PLCNSSMVWSV-----NL----TAG--------------------LWYCAARESLINV
I3MAR4_ICTTR/2-128----------------------PLCNGSMVWSV-----NL----TAG--------------------E-YCAALDSLIKV
G1SCQ2_RABIT/16-144----------------------PLCNGTMVWSV-----NL----TGS--------------------V-YCAALESLVNV
IL13_HUMAN/16-144----------------------PLCNGSMVWSI-----NL----TAG--------------------M-YCAALESLINV
IL13_RAT/2-130----------------------SLCNSSMVWSV-----DL----TAG--------------------G-FCAALESLTNI
L5M5Z7_MYODS/2-128----------------------PLCNGSMVWSV-----NL----TAG--------------------S-YCAAFESLMNV
G5ASP9_HETGA/2-130----------------------PLCSGSMVWSV-----NL----TAG--------------------VWYCAARESLINV
L8YAP6_TUPCH/2-128----------------------QLCNGSMVWSV-----NL----TTD--------------------V-CCVALESLTNV
IL13_BOVIN/2-130----------------------PLCNGSMVWSL-----NL----TSS--------------------M-YCAALDSLISI
IL13_MOUSE/2-130----------------------PLCNGSMVWSV-----DL----AAG--------------------G-FCVALDSLTNI
F6WQF3_ORNAN/2-128----------------------SLCNGSMVWKV-----NF----DWE--------------------KAQKEAESQRNNI
G3T2N9_LOXAF/2-133----------------------SLCNGSMVWNV-----NL----TTN--------------------V-YCAAMEALSNV
M3YGH3_MUSPF/2-126----------------------SLCNGSMVWSV-----NR----TTS--------------------M-YCAALESLTSV
B5FW67_OTOGA/2-129----------------------PLCNGSMVWSV-----NL----TTD--------------------I-YCAALESLINV
IL13_CANLF/2-129----------------------SLCNGSMVWSV-----NL----TAG--------------------M-YCAALESLINV

PF00727

IL4_FELCA/26-131----------------------DSCMELTVMDVLAAPKNT----SDK--------------------EIFCRATTVLRQI
H0XDE1_OTOGA/26-149----------------------TPCDELTVADIFAASKNT----TEK--------------------EIFCRAATVLRQV
IL4_MOUSE/27-140----------------------TPCTEMDVPNVLTATKNT----TES--------------------ELVCRASKVLRIF
G3T4B8_LOXAF/26-132----------------------HACTELTVADAFAAPKNT----TEK--------------------ETFCRATTVLWQV
IL4_RABIT/28-143----------------------TPCTKLMIADALAVPKNT----TER--------------------EAVCRAATALRQF
G5ASQ0_HETGA/25-138----------------------TPCAELAAADVFAAPKDT----AEK----------------------LCQAVTVLHRT
F6U5N6_HORSE/26-135----------------------NSCMELTVADAFAGPKNT----DGK--------------------E-ICRAAKVLQQL
IL4_BOVIN/26-133----------------------NSCMELPVADVFAAPKNT----TEK--------------------ETFCRVGIELRRI
G3QSC0_GORGO/26-149----------------------TLCTELTVTDIFAASKNT----TEK--------------------ETFCRAATVLRQF
A3FBF0_MUSPF/26-130----------------------DSCMELTVTEVFSAPKNT----SEK--------------------EIFCRAATVLQQL
IL4_RAT/27-139----------------------TPCTEMFVPDVLTATRNT----TEN--------------------ELICRASRVLRKF
G3WEJ0_SARHA/28-149----------------------FLCSEMEVLDIFEDTKKN----SSTRKLLPEMSSCSQLAMTVNDFETLCRAVTVLQQA
IL4_PIG/26-131----------------------NSCMELPVTDVFAAPENT----TEK--------------------ETFCRASTVLRHI

PF00143

H8XX39_CHICK/27-182RFP-------------------QQCLREKMSFRF-PEQVL----KPR-----------------------QKET-VKVAI
I3N7K4_ICTTR/69-238SIP-------------------VQCFREIHNFEL-PEEIL----SST--------------------QP-EKTN-IKYVF
H0W3G0_CAVPO/26-185MPR-------------------SLCLKDRSNFLL-PQKMM----TSS--------------------KL-QKAQ-MVSVL
H0W510_CAVPO/26-185ISA-------------------FSCLKHRQDFGL-AGLEF----EGK--------------------QV-QKAQ-ALSVL
Q29098_PIG/26-180LSP-------------------SFCLKDRKDFGF-PQEMV----EGS--------------------QL-QKTQ-AISVL
G5E7E1_LOXAF/9-168LSP-------------------FSCLKERKDFRF-PQEMV----DGS--------------------QL-QKAQ-VISVL
IFNE_MOUSE/27-185SSV-------------------QQCLAHRKNFLL-PQQPV----SPH--------------------QY-QEGQ-VLAVV
G3I0H8_CRIGR/26-185LSP-------------------LSCLKDRKDFAF-PLENM----DAQ--------------------HI-QKAQ-AIPIL
H0VF99_CAVPO/28-187KPE--------------------NCHQDRIDFKF-PEEIL----QPQ--------------------QF-QKEK-AALVI
L5KKJ7_PTEAL/25-192SFP-------------------KDCLRENKAFEM-PQEIL----YST--------------------QL-LKRD-IKEAF
G1U0Q8_RABIT/26-185VSP-------------------VLCLKDRRDFQF-PREVV----NGS--------------------QF-QKNQ-AVSVL
F6YZB3_ORNAN/25-183KSL-------------------LSCLEHRKDFQF-PRAVV----EAG--------------------LL-QKGN-RAVVV
V8NNB8_OPHHA/15-183TTP-------------------LQCMRSFVELSL-EDIGKKIMIDMN--------------------DECQVDI-AKTAV
C8CKA7_PIG/26-185ISP-------------------FSCLDHRRDFGF-PQEAL----GGN--------------------QV-QKAQ-AMALV
G3GXU9_CRIGR/27-182PL----------------------CLNHRMDFKI-PMEVK----HPG--------------------QM-EKRN-VALII
H0XSG1_OTOGA/26-185ISP-------------------FSCLKDRSDFGI-PQEKL----NGN--------------------QL-QKAQ-AISVL
G1KX99_ANOCA/25-184TIP-------------------QQCFEDVFNFS--PKMYL----KNL--------------------DVSEEEN-AKVVI
G3I0I6_CRIGR/27-185SSV-------------------YQCLAHRKNFQL-PWQSV----SRH--------------------QY-QKGH-VLAVL
IFNT4_SHEEP/26-185LSP-------------------HSCLQDRKDFGL-PQEMV----EGD--------------------QL-QKDQ-AFPVL
L8Y4J0_TUPCH/27-186SSI-------------------QQCLPHRKNFLL-PHKSV----NPQ--------------------QF-QKRH-TLAIL
F7B527_HORSE/26-183IST-------------------LLCLKDRADFRF-PQILV----DGD--------------------QL-GKTQ-ATAVL
G1Q950_MYOLU/27-184SPQ--------------------HCLDDRMDFQI-PREVE----QPQ--------------------QV-RKEE-AMVVM
M3XCW7_FELCA/26-186LSP-------------------FLCLRARKDFRF-PREML----EGG--------------------QL-REAQAAAAVL
G5CB66_HETGA/27-185KPE--------------------YCLKDRMDFKF-PEEIK----QPQ--------------------HF-RKEN-AALVI
L9L941_TUPCH/27-198SFP-------------------VECLRENKAFEL-PQEIL----SST--------------------QP-VKRD-IKEVF
D2H9N6_AILME/27-184TTK--------------------DCIKDRMNFKF-PEEIE----KPQ--------------------QV-QKEA-LLLVT
D3Z919_RAT/26-179QSP-------------------VSCLKDIQYFEL-PLEKV----DAQ--------------------QI-QKSQ-AISVL
C8CKB9_PIG/24-176TSS-------------------QACLKDRTDFQF-PWRGG----KTT--------------------RT-QTSQ-GTCFH
A8E6F6_XENTR/27-179ETE-------------------EICEEHPTDLPN-TESTY----SVS--------------------QV-EA---GALAV
L8Y906_TUPCH/26-185ISF-------------------LSCLKDRTDFKF-PQEQL----DGR--------------------QL-QKTQ-ALRVL
L5KWM8_PTEAL/106-263-NS-------------------FSCWKDTKNFRF-PLEMV----DGS--------------------QV-QEAQ-AISVL
G3WZJ8_SARHA/27-182FSL-------------------LPCLKDRTNFTF-PKEAM----EGS--------------------QL-QREN-TTVMV
G3UCD2_LOXAF/26-187ISP-------------------SSCLKDRNDFGF-PQEEL----EGN--------------------KF-QKAQ-AISVH
K7GQJ6_PIG/17-164ISP-------------------SFCLKDRKDFGF-PQEMV----EGS--------------------QL-QKVQ-AISVF
G3I0H3_CRIGR/26-178LSP-------------------FSCLKDRKDFAS-PVEKV----DAQ--------------------HI-QKAQ-AMSVL
H0VYK7_CAVPO/28-181KPE--------------------HCQQDRMDFKF-PEEIK----QPR--------------------PF-QKEM-AALVI
L5K635_PTEAL/26-185ISS-------------------FLCQKDRKDFRF-PRKMV----DGS--------------------QV-QKAQ-AISVL
W5JYQ9_ASTMX/23-179AFP-------------------FRCLDDYVLVPF-PKAAF----ESN--------------------TRKQTVA-LEKSI
H0Y0D2_OTOGA/28-187IHP-------------------FLCLKDRRYLGF-PQEEF----KNK--------------------QP-EKNQ-AITVL
IFN_ANAPL/34-190SPT-------------------QPCPQQHAPCSF-PDTLL----DTN-----------------------DTQQ-AAHTA
G3UJX3_LOXAF/27-185APE--------------------SCLEDRMDFKI-PEEIK----QPG--------------------QL-QKED-AALVI
G5C259_HETGA/26-185IST-------------------FSCLKDREDFGL-PHQEF----DGK--------------------QI-QKAQ-AISVL
G3WZF5_SARHA/26-185ELH-------------------PECQKDRMDFQI-PKEIL----QPK--------------------QY-QKEN-ATMVI
IFNE_PIG/27-186SSI-------------------QQCLPHRKNFLL-PQKSM----NPH--------------------QY-QKQQ-ALAIL
W5N6G4_LEPOC/27-185GFP-------------------VECVSQIIT-TF-PVDAF----KTA--------------------ENAKNED-IVLTG
H9KYA4_CALJA/26-185ISP-------------------FSCLKDRQDFVF-PQEVF----FGD--------------------HF-QKAQ-AIFIL
D2HTQ4_AILME/33-205SFP-------------------VECLRETKAFEL-PQEIL----SHT--------------------QP-AKRY-IKEAF
IFNB_HUMAN/27-185RLE--------------------YCLKDRMNFDI-PEEIK----QLQ--------------------QF-QKED-AALTI
G1NR05_MELGA/32-188PPP-------------------QNCPQQDVTYPF-PETVL----ESK-----------------------DKKQ-AAIIT
F7BVP5_ORNAN/23-181QFP-------------------LHCLKERMKFKL-PAEMV----HPH--------------------QF-QQEN-ATEAI
F7G875_MONDO/27-182KLH-------------------PECLQERMDFQI-PREIV----QPR--------------------QC-QREN-ATMII
C8CKC3_PIG/33-205SFP-------------------IECLTESKAFEL-PQEIL----SHT--------------------QP-LKRD-IQEAF
F7A317_HORSE/26-184ISP-------------------FSCLKDRNDFGF-PQEVF----DGN--------------------QF-RKAQ-AISAV
G1KU56_ANOCA/28-182VFP-------------------LQCLNDVISFSSQPEEENI--QSIF--------------------EL-QKEN-AAVAL
L5KBH2_PTEAL/26-185ISS-------------------FRCRKDRKNFGF-LREMV----DGS--------------------HM-QKAQ-AISVL
L5K909_PTEAL/26-185ISP-------------------FSCLKDREDFGF-PQEAF----SGN--------------------QF-QEAQ-AITVI
I3N5Z0_ICTTR/23-179SSI-------------------QQCLPYRKNFRL-PQNSV----NFH--------------------QY-PKGH-VLAIL
F7GHL9_MONDO/26-181SSL-------------------VPCLKEWTNFSF-PKEAL----DGS--------------------QL-QKEN-ATVVV
IFNE_HUMAN/27-186LSI-------------------QQCLPHRKNFLL-PQKSL----SPQ--------------------QY-QKGH-TLAIL
G3UK87_LOXAF/27-184----------------------FFCLKERKDFRF-PR-MV----YGS--------------------HL-QKAQ-AVFIL
L9LC61_TUPCH/27-185VPE--------------------DCLKDRMSFEV-PEEIQ----RPQ--------------------QF-QKEN-ATLVI
IFNB_RAT/27-182RLN----------------------LSYRTDFKI-PMEVM----HPS--------------------QM-EKSY-TAFAI
H0XMZ9_OTOGA/27-186SSV-------------------QQCLPHRKNFLL-PEKPV----SPQ--------------------HY-QEGH-ALALL
G3VDC6_SARHA/27-182FSL-------------------LSCLKDRTDFKF-PEEAV----EGS--------------------QL-QREN-AIVIV
I3JM36_ORENI/26-182NNS-------------------TNITEVEVTVPF-PNHLY---RQVS--------------------KS-SDED-KLAFT
L5LKN9_MYODS/27-186SSI-------------------RQCLPHRKDFLL-PQEAG----NPH--------------------QD-QKGS-ALTIL
G1TYS8_RABIT/29-195SFP-------------------IECLREIKDFEL-PQEIL----SHS--------------------QM-EKRD-IKEAW
I3UJJ8_FELCA/27-185SSI-------------------QQCLPHRKNFLL-PQRSV----NPR--------------------QY-QKGQ-ALAIL
C8CKA9_PIG/26-183LSI-------------------LSCLKDRTDFRF-PRTLV----DGN--------------------QV-EKTQ-AVAVA
IFNT2_BOVIN/3-162LSP-------------------HPCLQDRKDFGL-PQEMV----EGN--------------------QL-QKDQ-AISVL
M3Z729_MUSPF/26-183VSA-------------------FSCLRDRNDFAF-PQEVF----DGK--------------------QL-QKAQ-AISVL
IFNA1_MOUSE/26-185LSP-------------------LSCLKDRKDFGF-PQEKV----DAQ--------------------QI-KKAQ-AIPVL
G3TTC1_LOXAF/26-185CPT-------------------FFCLDDRKDFRF-PQEMV----DGS--------------------QL-QKAQ-AIAFL
G1PDS6_MYOLU/29-199SLP-------------------LECLRENKAFEL-PREVL----AYS--------------------QPLLHRD-IKGTF
F7ABU5_MONDO/27-182SSL-------------------VPCLKDGINFNF-PKEAM----DRS--------------------QL-QKEN-ATVIV
G1TTX4_RABIT/27-180TTE--------------------DCLNERINFKV-PKEIK----EPQ--------------------QL-QKED-TTLVI
H0XRP5_OTOGA/26-185ISP-------------------FSCLKDRSDFRF-PREEM----RGK--------------------QL-QKAQ-AISVL
H0WK94_OTOGA/33-202SFP-------------------RECLKENKDFEL-PQEIL----SHT--------------------QT-VKRG-LREAF
G1KYL3_ANOCA/23-176SIS-------------------QQCIDDVFSFS--HREAL----GNI--------------------NVSEEGN-AKAAI
G3WZQ8_SARHA/26-181FFL-------------------LPCLKDRTNFNF-PKEAV----EVN--------------------QL-QREN-ATAIV
H0YTY6_TAEGU/34-188SHT-------------------QPCHLQEPPF-F-PDTLL----HPN--------------------L--HPHQ-AAATA
I3MXH1_ICTTR/27-185RPA--------------------DCLSDRMDFKI-PKEIK----HPQ--------------------QF-QKEH-AAFVI
M3WRV1_FELCA/26-184LPA-------------------SSCQKDRNDFAF-PQDVF----GGD--------------------QS-HKAQ-ALSVV
R4GKJ6_CHICK/35-191TLP-------------------QLCPQHNASCSF-NDTIL----DTS-----------------------NTQQ-ADKTT
A3FBE8_MUSPF/27-184TSK--------------------DCLKDRMNFKI-PEEIQ----KSQ--------------------KF-QKED-IVLVT
G1KWE0_ANOCA/28-180TIP-------------------QQCIEDVFSFS--PKEDL----RNL--------------------DVSEEEN-AKVAI
G7PS89_MACFA/26-185ISP-------------------FSCLKDRHDFEL-PQEEF----DDK--------------------NF-QKAQ-AISVL
G1Q880_MYOLU/26-185ISP-------------------FFCLKDRKDFRF-PRATV----DGS--------------------QV-QKAQ-AIAVL
IFNB_MOUSE/27-180KIN----------------------LTYRADFKI-PMEMT------E--------------------KM-QKSY-TAFAI
IFNB2_BOVIN/27-184TPQ--------------------HCLEARMDFQM-PEEMK----QAQ--------------------QF-QKED-AILVI
G1SJC4_RABIT/26-185VSP-------------------LSCLQDRHDFEC-PLEEL----GGH--------------------QA-QRTQ-AISVL
W5PG31_SHEEP/26-185VSP-------------------SSCLQDRKDFAF-PQEAL----GGS--------------------QL-QKAQ-AISVL
IFNA3_CANLF/26-183LSA-------------------SSCDHYTTDFAF-PKELF----DGQ--------------------RL-QEAQ-ALSVV
G5BPX2_HETGA/27-199PLP-------------------LRCLREIKAFGL-PQNIL----SYS--------------------QH-VERD-IKEVF
IFNW2_HORSE/26-185ISS-------------------AICLKDRKDFRF-PQDMA----DGR--------------------QF-PEAQ-AASVL
G3N2A8_BOVIN/26-185LSS-------------------RFCLQDRKDFTF-PQEMV----EGS--------------------QL-QEAQ-AISVL
H0XKS8_OTOGA/27-185KPE--------------------GCLKDRMNFEI-PKEIK----QPQ--------------------HL-QKED-AMLFI
A0A286X8P0_CAVPO/26-185TFT-------------------FSCLKHRQDFGL-ALLDF----DGK--------------------QV-QKTQ-ALSFL
Q29412_PIG/27-184TPQ--------------------YCLEDRMNFEV-PEEIM----QPP--------------------QF-QKED-AVLII
G7PS88_MACFA/26-185ISP-------------------SSCLMDRHDFGF-PQQEF----DGN--------------------QF-QKAP-AISVL
M3WZS7_FELCA/26-181VSI-------------------LSCLKDRTDFNF-PQILV----AGN--------------------QL-EKTQ-VTAVV
H9GZR7_HORSE/26-185ISP-------------------PSCLKHRTDFKF-PQEQL----DGR--------------------QF-PEAQ-ATSVL
F1LVL8_RAT/26-184SSV-------------------QLCLAHRKNFLL-PQQSV----SPH--------------------QH-QEGH-VLAVL
M3YX13_MUSPF/27-179SSV-------------------QPCLPHRTNFLL-SQQSV----NRR--------------------RS-QSGQ-ALAIL
G1L8G2_AILME/26-185ISI-------------------LSCLKDRTDFSF-PQMLV----DGS--------------------KF-EKTE-ATGVM
IFNB_HORSE/27-184APQ--------------------RCPEDTMNFQV-PEEIE----QAQ--------------------QF-QKED-AALVI
H0W289_CAVPO/26-190IST-------------------FLCLKDRRDFRF-PKEMM----TGN--------------------QV-QEAQ-AIWVL
A8E6E8_MONDO/27-182FSL-------------------VPCLKDRTSFNL-PKEAL----EDN--------------------KL-QRGD-ALIIF
I3N788_ICTTR/27-185RPE--------------------DCLSDRMDFKI-PKEIK----HPQ--------------------QL-QKEH-AAFVI
G1L8I1_AILME/26-183MTA-------------------FSCLKDRNDFAF-PKEVV----DGK--------------------QL-QKAQ-ALSVV
IFNB_FELCA/27-184TSK--------------------YCLKDRMNFEV-PEEIK----KSQ--------------------RF-QKEE-AILVI
G3TS29_LOXAF/26-179ISL-------------------LSCLKDRTDFRF-PQILM----DMN--------------------QL-EKTQ-AAVLL
W5PZ39_SHEEP/26-184SFP-------------------IECLQERKAFEL-PQEIL----SYT--------------------QP-LMRN-IKEAF
G3I0H6_CRIGR/26-178LSP-------------------FSCLKDRKVFAS-PVEKV----DAQ--------------------HI-QKAQ-AMSVL
M3Z715_MUSPF/26-183ISL-------------------IFCDKYINDFAF-PKKVF----HSK--------------------QL-QKAQ-ALSVV
M3VXI8_FELCA/33-205SFP-------------------VECLRESRAFEL-PQDIQ----SHT--------------------PP-GKRY-LKEAF
G3R8Q7_GORGO/26-185ISP-------------------FLCLKDRRDFRF-PQEMV----KGS--------------------QL-QKAQ-VMSVL
A8E6F5_XENTR/51-202DYD-------------------ESCQYDSIELPN-IDEIY----SIS--------------------QM-EE---MVLAV

PF02947

FLT3L_MOUSE/30-162DYP-------------------VTVAVNLQD---------------E--------------------KH-CKALWSLFLA
F6T7S9_ORNAN/28-157DYP-------------------VSVVTNLQT---------------D--------------------EL-CWELWHLSVA
H9GP84_ANOCA/29-165DYP-------------------VPVPVNLKQ---------------D--------------------EF-CKELWHVHLI
F6TPW7_MONDO/34-163DYP-------------------VEVPDNLQ----------------D--------------------ER-CRALWHLFLA
G5B8P0_HETGA/20-150DYP-------------------VTVAANLQD---------------E--------------------QF-CAKLWHLVLA
G1M637_AILME/29-159DYP-------------------VTVASNLQD---------------D--------------------EL-CGPFWHLVLA
L9JA37_TUPCH/769-910DYP-------------------VTMASNLQDPGTGPPRLQRAWSPQE--------------------EL-CGALWRLVLA
G3VSA3_SARHA/79-209DYP-------------------VDVPENLRV---------------D--------------------EQ-CWALWHLALA
G1QZC3_NOMLE/30-160DYP-------------------VTVASNLQD---------------E--------------------EL-CGALWRLVLA

PF00714

I3MNV6_ICTTR/15-152SSS-------------------YYSQDIV------NKEIE----ALK--------------------EYFNASNSNVSDG
IFNG_HORSE/15-152SST-------------------YYCQAAF------FKEIE----NLK--------------------EYFNASNPDVGDG
H0WPL1_OTOGA/15-151SSA-------------------FYCRVTS------SAEID----QLK--------------------EYFNTSSTDTAGG
Q8CGS0_CAVPO/15-154FSS-------------------YYCQSRF------TNEIR----ILK--------------------NYFNADNSDVGDN
B9VS86_CALJA/15-152SLG-------------------CYCQDPY------VKEAE----NLK--------------------KYFNAGDSDVADN
G3SUC6_LOXAF/15-152SSS-------------------CYCQATF------LKEIQ----NLK--------------------EYLNATDSDVADG
G3GY20_CRIGR/2-135-SG-------------------CYCQRTL------IEEIE----NLK--------------------KYFNSSSEDVGNG
L5LME8_MYODS/15-153FSS-------------------CYSQSTI------FNETQ----KLK--------------------RYFNATSSDVGNG
G5BGB5_HETGA/15-152FST-------------------YYCESRF------TKEIN----ILK--------------------DYFNASSSDVGDN
G3WQJ9_SARHA/15-153SSG-------------------CLSQVNL------REDMQ----TLH--------------------NYFNATKSDVSDG
IFNG_SHEEP/15-152FSG-------------------SYGQGPF------FKEIE----NLK--------------------EYFNASNPDVAKG
IFNG_RAT/14-151LSG-------------------CYCQGTL------IESLE----SLK--------------------NYFNSSSMDAMEG
IFNG_RABIT/15-152SYG-------------------CYCQDTL------TRETE----HLK--------------------AYLKANTSDVANG
L9KVU0_TUPCH/51-188SSS-------------------CYCQAPF------MKEVQ----NLK--------------------NYFNATDPGVGDT
IFNG_FELCA/15-153SSG-------------------YYCQAMF------FKEIE----ELK--------------------GYFNASNPDVADG

PF02372

IL15_PIG/33-160LIR-------------------SIHMDATLYT-ES-DAHP----NCK--------------------VTA---------M
IL15_CAVPO/33-160LIQ-------------------SIHIDATLYT-ES-DVHP----NCK--------------------ITA---------M
IL15_FELCA/33-160IIQ-------------------SLHIDATLYT-ES-DVHP----NCK--------------------VTA---------M
IL15_SHEEP/33-160LIQ-------------------SMHMDATLYT-ES-DAHP----NCK--------------------VTA---------L
F1NZN5_CHICK/55-183--T-------------------SEDIDVSLYTANT-YEDI----ECQ--------------------EPV---------M
G1NDP6_MELGA/5-137SKN-------------------KIHVV--LYT-PN-EIK-----ECS--------------------QQT---------L
O73883_CHICK/5-138IKN-------------------KIHLE--LYT-PT-ETQ-----ECT--------------------QQT---------L
Q8JFF4_ANAPL/4-134SMN-------------------GIDLE--LYT-PN-DTK-----ECS--------------------WQT---------L

PF00715

I3MQX6_ICTTR/7-151STL-------------------TRMLKFKFYM-PK-KAT-------D--------------------LEH---------L
G5C793_HETGA/7-149PKL-------------------SKMLKPKLYF-PN-KPS-------E--------------------LQH---------L
G1PJ32_MYOLU/7-147SKL-------------------PMMLTFKFYM-PR-NAT-------E--------------------LKH---------L
B1AB81_HORSE/7-146PKL-------------------SKMLTFKINM-PK-KAT-------E--------------------LKH---------L
G3HTL8_CRIGR/7-150PKL-------------------PMMLTFKFYM-PK-KAT-------E--------------------LKH---------L
IL2_MACMU/7-151PKL-------------------TRMLTFKFYM-PK-KAT-------E--------------------LKH---------L
H0Y254_OTOGA/7-149PKL-------------------SRMLTLKLYV-PK-KAT-------E--------------------LKH---------L
IL2_MOUSE/7-165LKL-------------------PRMLTFKFYL-PK-QAT-------E--------------------LKD---------L
G3SU90_LOXAF/7-147RRL-------------------SMIFTFKFNM-PK-EVT-------E--------------------LKH---------L
IL2_PIG/7-151ADL-------------------SRMLTFKFYM-PK-QAT-------E--------------------LKH---------L
IL2_FELCA/7-151PKL-------------------SRMLTFKFYV-PK-KAT-------E--------------------LTH---------L
L5K7D9_PTEAL/7-149HEL-------------------SSMLTFKFYM-P--NAT-------E--------------------LNH---------L
IL2_BOVIN/7-152LKL-------------------SRMHTFDFYV-PKVNAT-------E--------------------LKH---------L
H0VBY4_CAVPO/7-149PRL-------------------PKMLKLKLYP-PK-MVS-------E--------------------LQH---------L

PF01415

M3WJR8_FELCA/15-127TN--------------------------------------------D--------------------DCT---------T
H0X0U6_OTOGA/15-141SNV-------------------TSCL--CLPI-PS-----------D--------------------NCT---------R
G1QNL2_NOMLE/28-172NNE-------------------FNFF---KRH-IC-----------D--------------------ANK---------E
IL7_BOVIN/28-171NNE-------------------PNFF---KKH-SC-----------D--------------------DNK---------E
F1PA23_CANLF/29-154NNE-------------------PNIL---KKH-AC-----------D--------------------DNK---------E
IL9_MOUSE/15-141GNV-------------------TSCL--CLSV-PT-----------D--------------------DCT---------T
U3KN10_RABIT/31-153NNE-------------------SNFF---KKH-SC-----------D--------------------DNK---------E
K7E262_MONDO/59-200SKE-------------------YSSL---KNH-TC-----------D--------------------D-K---------E
E1BF10_BOVIN/18-141TNA-------------------TDCL--CLPI-SS-----------G--------------------DCS---------T
F6PLW3_HORSE/15-136AAV-------------------SECFLSILII-YQ-----------D--------------------DCT---------T
IL9_HUMAN/15-141ANV-------------------TSCL--CLGI-PS-----------D--------------------NCT---------R
IL7_MOUSE/28-151NNE-------------------PNFF---RKH-VC-----------D--------------------DTK---------E
G5BX09_HETGA/15-141ANV-------------------TSCL--CLPI-PS-----------D--------------------NCT---------M
L8Y4N8_TUPCH/15-141ANV-------------------TSCL--CLPI-PS-----------D--------------------NCT---------T
D4A8I9_RAT/15-141ANV-------------------TSCL--CLPI-PS-----------D--------------------DCT---------T
G3TKQ6_LOXAF/16-136GNV-------------------TDCL--CLPI-PS-----------D--------------------DCT---------T
M3YEX7_MUSPF/16-137ANV-------------------TDCL--CPTI-PS-----------D--------------------SCT---------T
G1NXN3_MYOLU/28-153NNE-------------------PNFF---KKH-SC-----------D--------------------DDK---------E

PF00103

PLRP1_BOVIN/26-238GKL------YYINVT-------KSCHTNSFHA-PEERDIV----QQT--------------------NIEDLSKWTLVLL
CSH2_BOVIN/26-238GKL------YYINAT-------KSCHTNSFHT-PEERDKA----QQM--------------------NNEDLSKWTLVLL
PLRP3_BOVIN/1-213NQP------YTINAT-------KSCHTNSLHT-PQEREKA----LRM--------------------NNEDLSKWILMLL
PR4A1_RAT/17-227GRG-------FERRT-------TRCHTSSLSS-PENKEQA----QQF--------------------QLEVLLGLSHSLL
CSH1_BOVIN/26-236GKN-------FTSKV------INSCHTEFMTT-PNNKEAA----ANT--------------------EDEALLRLVISLL
PLRP4_BOVIN/26-239GKE------YFINVS-------DKCHTNSLHL-PEDMQHN----PTD--------------------EQKGLIMWILMLL
PR3D4_RAT/16-223RSW------MKDRIL-------PLCHTASIHV-PENREEV----HEI--------------------KTEDLLRSIINIS
PR2C2_MOUSE/16-224VSG------LRDKSP-------MRCNTSFLPT-PENKEQA----RLT--------------------HYSALLKSGAMIL
SOM2_HUMAN/9-215KEQK----YSFLQNPQ-----TSLCFSESIPT-PSNRVKT----QQK--------------------SNLELLRISLLLI
PR8A5_RAT/17-238SRQFADLSSQLIRKDETVLKAGTYCHSNRAK--PKSR--G----VNI--------------------DIEEYLKMSINFC
PR6A1_RAT/20-234KPG-----RWFPERD------LTACHRSPFTI-AVSKEGT----QQR--------------------LGVFLVKEMIGML
PR7D1_MOUSE/17-240SETFNKIILDLHKSTENITKAFNSCHTVPINV-PETVEDV----RKT--------------------SFEEFLKMVLHML
CSH2_HUMAN/9-215KDQKY--SFLHDSQT-------SFCFSDSIPT-PSNMEET----QQK--------------------SNLELLRISLLLI

PF01109

CSF2_RAT/18-139ALS-------------------LLNDMRALENEKNE-DVD----IIS--------------------N------EFSIQR
CSF2_MOUSE/18-136ALN-------------------LLD---DMPVTLN-EEVE----VVS--------------------N------EFSFKK
CSF2_BOVIN/18-138ALS-------------------LLNHSSDTDAVMN--DTE----VVS--------------------E------KFDSQE
CSF2_CAVPO/18-140ALS-------------------LLNHTSDPAAVMNE-TVE----VVY--------------------D------QFEPQE
CSF2_PIG/18-139ALS-------------------LLNNSNDTAAVMNE-TVD----VVC--------------------E------MFDPQE
CSF2_HUMAN/18-139ARR-------------------LLNLSRDTAAEMNE-TVE----VIS--------------------E------MFDLQE
CSF2_CANLF/18-139ALS-------------------LLNNSNDVTAVMNK-AVK----VVS--------------------E------VFDPEG

PF02025

I3MDT8_ICTTR/22-133TLT-------------------LLSTHQTV--LIGN-ETL----RIP--------------------V------PAHKNH
G1RQD7_NOMLE/22-133TLA-------------------LLSTHRTL--LIAN-ETL----RIP--------------------V------PVHKNH
IL5_CAVPO/23-134TLT-------------------LLSTHRTL--LKGN-ETL----RIS--------------------V------PAHKNH
J9NWP5_CANLF/22-132TLT-------------------LLSTHRTW--LIGD-GVI----FFL--------------------I------PTVFKH
IL5_MOUSE/21-132TLT-------------------QLSAHRAL--LTSN-ETM----RLP--------------------V------PTHKNH
G3WAR7_SARHA/25-134TLS-------------------LITAHRTL--LIGN-GTL----RIS--------------------I------PDPKNH
IL5_HORSE/22-133TLT-------------------LLSTHRTL--LIGD-GNL----MIP--------------------T------PEHKNH
B5FW65_OTOGA/22-133TLA-------------------LLSTHQTL--LIHN-ETL----RIP--------------------V------PVHKNH
G3T4B0_LOXAF/23-133TLA-------------------LLSTHRTL--LIGD-GTP----RIL--------------------T------PVHENH
G1SL79_RABIT/22-133TLT-------------------LLSTYQSL--LIGN-ETL----MIP--------------------V------PVHKNH

PF02059

IL3_CANLF/19-132IME-------------------MLNKSPSPSE--EPLDSN----EKE--------------------T------LLEDTL
IL3_MOUSE/27-138IIG-------------------KLPEPELKTD-------D----EGP--------------------S------LRNKSF
IL3_BOVIN/18-132IMD-------------------DLKKITPSPE--GSLNSD----EKN--------------------F------LTKESL
G3UC30_LOXAF/22-133IKE-------------------ILQKSPPLNS--ATPSDT----EKT--------------------I------LRDRAS
G1MH15_AILME/18-131IMD-------------------ILNNSPSPSE--ETLDPN----ETS--------------------T------LLNTTL
G1RQ11_NOMLE/20-137IIT-------------------HLKQPPLPLLDFNNLNGE----DQD--------------------I------LMENNL
IL3_CALJA/19-136IVT-------------------LLNQPPLASSNFNNLNRE----DQR--------------------I------LMKPNL
F1LS41_RAT/29-138ILV-------------------KLPYPQVSGL----NNSD----DKA--------------------N------LRNSTL

PF00758

H0W023_CAVPO/30-191TMS-------------------CTEGCSLGENITVPDTKV----NFC--------------------A------WEKMGV
G3TYQ1_LOXAF/25-173LSQ-------------------CPDFNPLSTPVPLPTVDF----SLG--------------------E------WKTQTE
W5K758_ASTMX/26-175MRV-------------------CKEDCSIGVPLMVPLTRV----DIG--------------------V------WEKKNM
B1N8Y2_DANRE/15-168MRT-------------------CKDDCSIATNVTVPLTRV----DFE--------------------V------WEAMNI
F7DTH0_CALJA/31-193TMG-------------------CAESCSLNENITVPDTKV----NFY--------------------A------WKKMEF
M3XJ62_LATCH/27-177VNG-------------------CTEACELPVDMTLPATKV----NIK--------------------E------WNEMDN
G3W289_SARHA/30-190TVA-------------------CLEDCSLGENITVPDTRV----NFH--------------------T------WKKMEV
F6WUU2_MONDO/31-191TVR-------------------LHPRRNIVLAFSNTSCLI----NIY--------------------F------AINSNV
G3VW20_SARHA/26-175LSQ-------------------CSDLGPLPIPVLLPTVDF----SLR--------------------E------WRAKTE
G1PF99_MYOLU/45-207TMG-------------------CAEGCSFSENITVPDTKV----NFY--------------------A------WKRMEV
TPO_CANLF/25-176LSQ-------------------CPDIYPLSTPVLLPAVDF----SLG--------------------E------WKTQKE
F7G570_MONDO/26-177LSQ-------------------CSDLSPLPIPVLLPTVDF----SLR--------------------E------WRAKTE
H2LEX3_ORYLA/33-182MRS-------------------CREGCGLTQTVSVPQTTV----NFE--------------------D------WEKKNA

PF00726

IL10_BOVIN/5-174VKT-------------------FF------QMKDQLHSLL----LTQ--------------------S------L-LDDF
IL10H_EBVB9/7-167VKT-------------------FF------QTKDEVDNLL----LKE--------------------S------L-LEDF
G3HB01_CRIGR/14-174VKT-------------------FF------QKKDQLDNIL----LTD--------------------S------L-VQDF

PF14565

IL22_HUMAN/40-178AKE-------------------AS------LADNNTDVRL----IGE--------------------K------L-FHGV
E1C1U2_CHICK/46-184AEM-------------------AR------LSDQDTDNRL----IGQ--------------------Q------I-YVNI

PF15177

I3MK89_ICTTR/29-189ARD-------------------AF-EDSHLPKDHNCPSPL----FPR--------------------P------WDLRQL
H0VBN4_CAVPO/32-188AKD-------------------AF-EEQLLLKDSRCSLRL----FPR--------------------T------WDLGQL
IFNL3_CHICK/28-182MKE-------------------QF-EDIMLLTNRKCNTRL----FHR--------------------K------WDIAEL
F1M3K4_RAT/31-188AKD-------------------AI-EEGLLPKDVRRASRL----LPR--------------------D------GNLQQL
F1PY54_CANLF/31-186AKD-------------------AL-EESLSWKNWSCSSRL----FPR--------------------S------RDLRLL
H0XRJ1_OTOGA/35-191AKD-------------------AL-ENSLSQINWSCSSRF----FPR--------------------P------WDLRQL
F6PNH9_HORSE/31-184AKD-------------------AL-ENSL--ENWTCRSPV----FPT--------------------T------WDLRQL
D2DJP5_XENTR/23-178LHN-------------------EH-EKSPFSDGIKCYRKM----LRQ--------------------K------PSVCDL
G3TQK4_LOXAF/32-188AKD-------------------AF-EESLLLKDGSCSSLL----FPR--------------------T------WDLRQL
F7DXI8_HORSE/34-187ATD-------------------AF-EESFWLKNHTCRSRP----FPR--------------------T------WDLRQL
F6W920_MONDO/30-184AKD-------------------TY-EKSMLQKKRKCSSKF----FHR--------------------G------WDFRQL
U3KED0_FICAL/27-186MRL-------------------SL-GSCLQVNNHKCNTRL----FHR--------------------K------WNAVDL
IFNL4_HUMAN/25-174LRD-------------------RYEEEALSWGQRNCS-------FRP--------------------R------RDPPRP
IFNL2_MOUSE/32-189AKD-------------------AI-EKRLLEKDLRCSSHL----FPR--------------------A------WDLKQL
G3N0M3_BOVIN/37-192ARD-------------------AF-EDSFLPKDWDCSTHL----FPR--------------------T------RDLKHL
G1LPU9_AILME/37-191AKD-------------------AL-ENSL--KNWSCSSRL----FPR--------------------N------RDLRQL
L5LZZ9_MYODS/163-319VKD-------------------AL-EESLLLKNWSCGSRP----LPR--------------------T------RDLRQL
IFNL3_HUMAN/34-192AKD-------------------AL-EESLLLKDCKCRSRL----FPR--------------------T------WDLRQL
F6R8C9_XENTR/23-177LHN-------------------EN-PISVFLRDIVFYLSL----FGS--------------------L------LQICS-
G3VJ97_SARHA/12-167AKD-------------------AY-EKAMLQTERKCSSRF----FHR--------------------N------WDLRQL
H0XJU8_OTOGA/36-192IKD-------------------VF-EESLLPEDCRGSSHL----FPR--------------------P------WSLRQL
G3HJD0_CRIGR/30-187ATD-------------------AI-EKWLLNKDVRCSSRL----FPK--------------------A------WDLKLL
G1LPW2_AILME/34-190AKD-------------------IF-EESLSLKAWSCRPRL----FPR--------------------T------WDLQQL
L5L378_PTEAL/33-182AKD-------------------AL-ENSL--KNQSCSFSL----FPR--------------------N------WKLTEL
G1T4B0_RABIT/34-188ARD-------------------AL-EESLLLKSRRHPSSL----TSQ--------------------E------W-----
U3IYH6_ANAPL/34-185FKK-------------------YY-ENIT-SKDSKCSTRL----FNR--------------------K------WTPNEL
L9LBW1_TUPCH/31-181AKD-------------------AL-EKSLSLKKYSCKFRL----FPR--------------------D------WHPRHL
D0FHA1_PIG/36-191AKD-------------------AF-EESLL-EDWNCSSRI----FPR--------------------S------RDLKQL

PF05337

CSF1_HUMAN/41-180ITF-------------------EF-VDQEQLKDPVCYLK-----------------------------------------
Q3TLQ6_MOUSE/41-180IAF-------------------EF-VDQEQLDDPVCYLK-----------------------------------------
O77709_BOVIN/41-180ISF-------------------EF-VDQEQLDDPVCYLK-----------------------------------------
O77710_BOVIN/41-180ISF-------------------EF-VDQEQLDDPVCYLK-----------------------------------------
Q64129_9MURI/41-180IAF-------------------EF-VDQEQLDDPVCYLK-----------------------------------------

PF15036

IL34_MOUSE/28-184HYF-------------------PINYRIAVPYEGVLRVAN----ITR--------------------L------QKAHVS
R4GIU3_CHICK/19-177HNF-------------------PIDYTLRVQHEEVLRTAN----VTR--------------------L------RDGKVS
F7EA00_CALJA/29-185VSF-------------------KINYLLKLXQQAMFHHTQ----LDV--------------------L------QRARVS
H0WFN4_OTOGA/28-184HYF-------------------PINYMISVPYEGVFRIAN----ITK--------------------L------HRARVS
M3ZVZ0_XIPMA/24-191HNF-------------------PINYAIRVHHEEIFKLSN----ISK--------------------MKLKVEGLDELV-
U3JY35_FICAL/18-179HYF-------------------PIDYTVQVQYEEVLRPSN----ITR--------------------L------RNGTVS
L9KJY3_TUPCH/28-184HYF-------------------PINYRIGVPYEGVLRAAN----ITR--------------------L------RRARMS
G3T3A6_LOXAF/28-182YNF-------------------PINYRISVPYEAVLRVAN----ITR--------------------L------QRAQVS
F6W3U1_MONDO/15-167HYF-------------------PIDYRIRVPYEGVLRLAN----ITR--------------------L------QQAEVS
I3JZ08_ORENI/24-192HNF-------------------PIEYTIKVHNREIFRLSN----ISR--------------------MRLRTEGLNELV-
L5MCR9_MYODS/28-182QYF-------------------PIGYRVSMPYEGVLRAAN----VTR--------------------L------QRARVS
B3DLJ8_DANRE/23-195MHF-------------------PINYTVQVRYEEVFRLRN----ISR--------------------L-VNTSNEEEPVL
IL34_BOVIN/28-183HYF-------------------PINYRVSVPYEGVLRTAN----VTR--------------------L------QRAQVS

PF02404

R4GD07_ANOCA/1-283VND-------------------IAKLVGNLPNDYMIALKY----VRK--------------------M-------DTLPN
SCF_CHICK/1-287VND-------------------IAKLVGNLPNDYLITLKY----VPK--------------------M-------DSLPN
SCF_RAT/1-273VKD-------------------ITKLVANLPNDYMITLNY----VAG--------------------M-------DVLPS
G1NWC8_MYOLU/1-272VKD-------------------VTKLVANLPKDYKIGLKY----VPG--------------------M-------DVLPS
F7EP53_MONDO/1-273VKE-------------------ITTLVANLPNDYMIPLKY----VPD--------------------M-------ELLPN
F7C5I3_ORNAN/1-273VKD-------------------ITKLVGNLPNDYMIALKY----VPE--------------------M-------DGLPN
F7G0W2_CALJA/1-273VKD-------------------VTKLVANLPKDYMITLKY----VPG--------------------M-------DVLPS

PF00489

M3X721_FELCA/44-225TTGLQEFQIYL--KFLQDK-----YEGDKEN-------------------------------------------------
IL6_BOVIN/27-208TAGLLEYQIYL--DYLQNE-----YEGNQEN-------------------------------------------------
IL6_HORSE/27-208TTGLSEFQIYL--EYLQNE-----FKGEKEN-------------------------------------------------
G3UHF3_LOXAF/20-205ITGLSEFQIYL--DYLQNK-----FEGSKAN-------------------------------------------------
L5KPK4_PTEAL/20-202TTGLLEFQIYL--DYLQNK-----FE---EN-------------------------------------------------
F7HV62_CALJA/27-212TTGLLEFEVYL--EYLQNR-----FESSKEQ-------------------------------------------------
IL6_MOUSE/26-210SSGLLEYHSYL--EYMKNN-----LKDNKKDK------------------------------------------------

PF16647

CSF3_BOVIN/42-190HGGLFLYQGLL--QALAGI-----SPELAPT-------------------------------------------------
CSF3_HUMAN/51-202HSGLFLYQGLL--QALEGI-----SPELGPT-------------------------------------------------
CSF3_MOUSE/57-205HSGLCLYQGLL--QALSGI-----SPALAPT-------------------------------------------------

PF16649

IL23A_MOUSE/28-185RQGLAFYKHLLDSDIFKGE-----PALLPDSP------------------------------------------------
F7HQI5_MACMU/28-184RQGLIFYEKLLGSDIFTGE-----PSLLPDSP------------------------------------------------
F1MSN4_BOVIN/35-192HRGLVFYEKLLGSDIFTGE-----PSLLPNGP------------------------------------------------
IL23A_CAVPO/28-184YQGLVFYQNLLGSDIFTGE-----PPLFPDGP------------------------------------------------
G3VET0_SARHA/31-186HRGLIFYGHLLNSDIFKGE-----PSLLQDGP------------------------------------------------

PF07400

F1R6T9_DANRE/26-187YSGLKSFKFHL--DWVQRNSDELGNDYSKTKK------------------------------------------------
A0A0P7XG98_9TELE/28-193HSDIQLFDLHF--EWLNKALKN--RKHASFPK------------------------------------------------
F1R1E3_DANRE/28-198HANLKSFQHHF--EWLNNITHK--QQHSI-PK------------------------------------------------
H2T1R2_TAKRU/27-195HADLKLYEHHF--EWLNRVSKK--HHHPALPK------------------------------------------------
H2M884_ORYLA/28-196HADLKLYKDHF--DWLSNVSKK--HHHPAVPK------------------------------------------------
H3A6V0_LATCH/22-190DSDLRSYEEHF--EWLKKAEVI--SKAPLEQS------------------------------------------------
G5BVZ4_HETGA/26-199RTDLLSYLRHV--QWLRRVGGP--SLRTLEPE------------------------------------------------
F6WLV3_XENTR/22-187STDLFIYQKHF--DWLRKAAH---AIRPMDHE------------------------------------------------
G3P408_GASAC/28-197LRYTRSFRLHV--DWLKTAKEN--VSLSS-RS------------------------------------------------
A0A091E199_FUKDA/60-227RTDLLSYLRHM--QWLRRVGGP--SVKSLEPE------------------------------------------------
W5LKH5_ASTMX/28-199HTDLKSFEHHF--EWLNKVTKK--HQHSTAPK------------------------------------------------

PF06875

Q5BNQ4_9SALA/2-215LKNNLYFYSAI--VEFLKEAMTE-Q-EDLNPA--------------------------------------ELA-------
Q5BNQ2_9SALA/2-215LNNNLYFYSAI--VEFLKEAMTE-Q-EDLNPA--------------------------------------ELS-------

PF01110

CNTF_CHICK/1-194LLDNLAAYRAF--RTLLAQMLEE-QRELLGDT--------------------------------------DAE-------
G3VWZ5_SARHA/1-195LQANLHAYRTF--HVLLTEVLED-QRAQFTPT--------------------------------------ERD-------
E1BFH9_BOVIN/1-193LQENLQAYRAF--HGMLARLLED-QRAHFTPA--------------------------------------EED-------
G5AP46_HETGA/1-192LQENLHAYRTF--HVLLARLLED-QQVHFTPT--------------------------------------ESD-------
H0Z9U1_TAEGU/1-188LLENLAAYRAF--RTLLAQMLEE-QREQLGEA--------------------------------------DAG-------
CNTF_HUMAN/1-194LQENLQAYRTF--HVLLARLLED-QQVHFTPT--------------------------------------EGD-------

PF01291

LIF_MOUSE/44-203LVELYRMVAYL--SASLTNITRD-Q-KVLNPT--------------------------------------AVS-------
LIF_BOVIN/43-202LVELYRIIAYL--GASLGNITRD-Q-KVLNPY--------------------------------------AHG-------
ONCM_HUMAN/37-209RGFLQTLNATL--GCVLHRLADL-E-QRLPKA--------------------------------------QDLERSGLNI
ONCM_MOUSE/34-194PHFLSTVYTTL--DRVLYQLDAL-R-QKFLKT--------------------------------------PAFP------
ONCM_BOVIN/34-194QDFLQTLNTTL--GLILRMLSAL-Q-QDLPEA--------------------------------------AH--------

PF03039

I3MN91_ICTTR/3-204-------TLCF--SSIYEDLKMY-Q-LELKAI--------------------------------------NEK-------
IL12A_MOUSE/6-215QKTSLMMTLCL--GSIYEDLKMY-Q-TEFQAI--------------------------------------NAA-------
G3VQT1_SARHA/40-247KEKLSVKQLCL--KSIYKDLETY-K-TEFKVV--------------------------------------EET-------
F6T5A8_MONDO/5-202TETLFIKDLCL--RSIYEDLETY-K-AEFNVI--------------------------------------KKT-------
IL12A_PIG/6-222GKTSFMTTLCL--SSIYEDLKMY-H-VEFQAM--------------------------------------NAK-------
L8YEA2_TUPCH/1-213EKTSHMMTLCL--SSIYEDLKMY-Q-VEFKAI--------------------------------------NAQ-------
H0X861_OTOGA/6-217RKTSSMMTLCL--SSIYEDLKMY-Q-VEFKAM--------------------------------------NEV-------
Q924V6_CAVPO/6-221GKTSFMMALCL--NSIYEDLKLY-Q-LEFKNM--------------------------------------NAQ-------

PF02024

H3AP27_LATCH/26-169---AERPLESL--GSMDETLEIF-H-WILSSL--------------------------------------P---------
G3WWV6_SARHA/23-167---GLHPFQSL--SDMDQTLAIY-Q-QILSNL--------------------------------------S---------
F6PLK2_ORNAN/23-167---GNQQFQNL--ADMDQTLAVY-Q-QILSSL--------------------------------------P---------
F7HGW1_CALJA/23-167---GFHSDLSF--SKMDEILATY-Q-QIVISL--------------------------------------P---------
G5BHA4_HETGA/23-167----LYPDLSF--SKMDQTLAVY-Q-QIISNL--------------------------------------P---------
W5NER9_LEPOC/28-172DALNDKTLEGL--STVEDNLHTF-Q-EILSSL--------------------------------------P---------
A0A286XUJ2_CAVPO/23-165----LSPYLSL--PKMDQTLTLY-Q-KVITTL--------------------------------------S---------
LEP_HUMAN/23-167---GLHPILTL--SKMDQTLAVY-Q-QILTSM--------------------------------------P---------

PF15216

M3WGC3_FELCA/29-146VSGCS--PDCL--AKIDL--------ITFYPT--------------------------------------HGC-------
F1RLI5_PIG/20-130----SEQPDCL--TKIEL--------FTFKPV--------------------------------------HGC-------
A0A2I2YQB0_GORGO/29-153TVSCSNRPHCL--TEIQS--------LTFNPT--------------------------------------AGC-------
F7I7D5_CALJA/29-153TIFCNNRSHCL--TEIQR--------LTFDPT--------------------------------------PGC-------
K7E5V9_MONDO/34-162-LFCETKSDCL--TVIEQ--------LARNWS--------------------------------------NNC-------
L8YGS5_TUPCH/5-129YIFCSNQSDCL--AKIES--------LTFGTH--------------------------------------AGC-------
J9P5I8_CANLF/29-154PVYCAYPPDCL--ARIER--------LTLHRI--------------------------------------RGC-------
TSLP_MOUSE/20-137IEDCESKPACL--LKIEY--------YTLNPI--------------------------------------PGC-------

PF03487

F7DGH7_MACMU/16-144SG-------CS--A-----------IEKTQRM------------------------------------------------
H0W834_CAVPO/2-134SN-------CS--A-----------LQRTQKI------------------------------------------------
I3MAR4_ICTTR/2-128SN-------CS--A-----------IQKTQRM------------------------------------------------
G1SCQ2_RABIT/16-144SG-------CN--A-----------IQRTQRM------------------------------------------------
IL13_HUMAN/16-144SG-------CS--A-----------IEKTQRM------------------------------------------------
IL13_RAT/2-130SS-------CN--A-----------IHRTQRI------------------------------------------------
L5M5Z7_MYODS/2-128SD-------CP--A-----------IQRTQRM------------------------------------------------
G5ASP9_HETGA/2-130SS-------CS--A-----------LQRTQKI------------------------------------------------
L8YAP6_TUPCH/2-128SG-------CS--T-----------LQRTLRL------------------------------------------------
IL13_BOVIN/2-130SN-------CS--V-----------IQRTKRM------------------------------------------------
IL13_MOUSE/2-130SN-------CN--A-----------IYRTQRI------------------------------------------------
F6WQF3_ORNAN/2-128SD-------CE--T-----------IQDILRI------------------------------------------------
G3T2N9_LOXAF/2-133SD-------CR--A-----------IEKTKRN------------------------------------------------
M3YGH3_MUSPF/2-126SN-------CS--A-----------IHRTQRL------------------------------------------------
B5FW67_OTOGA/2-129SS-------CS--A-----------IQRTQRI------------------------------------------------
IL13_CANLF/2-129SD-------CS--A-----------IQRTQRM------------------------------------------------

PF00727

IL4_FELCA/26-131YTHHN----CS--T----------------KF------------------------------------------------
H0XDE1_OTOGA/26-149YSHHQKEP-CR--GAT-ERQQLY-RHQQVIRF------------------------------------------------
IL4_MOUSE/27-140YLKHGKTP-CL--K----------KNSSVLME------------------------------------------------
G3T4B8_LOXAF/26-132SKRHE----CF--T----------------KY------------------------------------------------
IL4_RABIT/28-143YLHHKVSW-CF--K-------EH-GELGDLRL------------------------------------------------
G5ASQ0_HETGA/25-138SYLGVGLS-CL--N-------RH-RESVFLVL------------------------------------------------
F6U5N6_HORSE/26-135YKRHDRS--LI--K----------------EC------------------------------------------------
IL4_BOVIN/26-133YRSHT----CL--N----------------KF------------------------------------------------
G3QSC0_GORGO/26-149YSHHEKDTRCL--GAT-A-QQFH-RHKQLIRF------------------------------------------------
A3FBF0_MUSPF/26-130STHN-----CS--N----------------RL------------------------------------------------
IL4_RAT/27-139YFPRDVPP-CL--K----------NKSGVLGE------------------------------------------------
G3WEJ0_SARHA/28-149SNS------CP--R----------------QE------------------------------------------------
IL4_PIG/26-131YRHHT----CM--K----------------SL------------------------------------------------

PF00143

H8XX39_CHICK/27-182EEILQHIFYIF--SKN-LTLAAW-DGAALEQF------------------------------------------------
I3N7K4_ICTTR/69-238YETYTQAINIF--SQN-TFNSSW-DEEQLVQL------------------------------------------------
H0W3G0_CAVPO/26-185QGTLQQILTLF--NTQ-LSSAAW-NATILHKL------------------------------------------------
H0W510_CAVPO/26-185HEMTRQTFILF--TSQ-YSCPPW-NQSLLDSF------------------------------------------------
Q29098_PIG/26-180HEMLQQTFLLL--HTE-RSSAAW-DSTLLDKL------------------------------------------------
G5E7E1_LOXAF/9-168HEMLQQIFNLF--HTK-DSSAAW-NTTLLDQL------------------------------------------------
IFNE_MOUSE/27-185HEILQQIFTLL--QTH-GTMGIW-EENHIEKV------------------------------------------------
G3I0H8_CRIGR/26-185QELIQQVLILF--SSK-DSSATW-ETTLLDTF------------------------------------------------
H0VF99_CAVPO/28-187QEMLQNVLGIF--RKN-ISTTVW-NETIVENL------------------------------------------------
L5KKJ7_PTEAL/25-192YEISLQAFNIF--SQY-TFQSTW-KKKYLKRI------------------------------------------------
G1U0Q8_RABIT/26-185HEMLQQIFNLL--HTA-RSSAAW-NNTLLEEL------------------------------------------------
F6YZB3_ORNAN/25-183HELLQQIFTVF--SQT-LSQTGW-DQAEVENF------------------------------------------------
V8NNB8_OPHHA/15-183KEILQQIDVIF--RQN-HTELVW-HEGSLRDF------------------------------------------------
C8CKA7_PIG/26-185HEMLQQTFQLF--STE-GSAAAW-DESLLHQF------------------------------------------------
G3GXU9_CRIGR/27-182EEMLQNIFIVF--NSN-YSSTGW-NKTIVESF------------------------------------------------
H0XSG1_OTOGA/26-185HDMTQQTFNLF--STK-DSSEAW-NKTLLDQF------------------------------------------------
G1KX99_ANOCA/25-184QEVLQQTGHIF--RQN-YTEMPW-DEDSLRVF------------------------------------------------
G3I0I6_CRIGR/27-185HELLQQIFSLF--QAH-VSRGIW-EENHIERV------------------------------------------------
IFNT4_SHEEP/26-185YEMLQQSFNLF--YTE-HSSAAW-DTTLLDQL------------------------------------------------
L8Y4J0_TUPCH/27-186HEMLQQIFNLF--SAN-VSPDDW-EEHYKEKF------------------------------------------------
F7B527_HORSE/26-183HEMLQHTFHLF--STT-GSRAAW-DETLLDKF------------------------------------------------
G1Q950_MYOLU/27-184HEMLQQIFSIF--RRG-FSNAGW-NETIVENL------------------------------------------------
M3XCW7_FELCA/26-186RELLQQTFNLL--HTE-RSSAAW-SPAPLHGL------------------------------------------------
G5CB66_HETGA/27-185QEMLQNILDIV--RKN-FSNTVW-NETIVENL------------------------------------------------
L9L941_TUPCH/27-198YEISMQAFNIF--SQD-TFKSTW-EQKHLKQI------------------------------------------------
D2H9N6_AILME/27-184LDMFQKTSDIF--RKN-LSSTGW-NEIIVNNL------------------------------------------------
D3Z919_RAT/26-179ETLTQQVLTLF--ESE-ESRAAW-NETLRLSF------------------------------------------------
C8CKB9_PIG/24-176PLMLQQIINLF--NTE-NSRAAW-NNALLDHL------------------------------------------------
A8E6F6_XENTR/27-179REVLNETMRFY--MKH-HESMGC-KQQAWERF------------------------------------------------
L8Y906_TUPCH/26-185HGMLQQIFNLF--SSE-GSSATW-EEALLDKL------------------------------------------------
L5KWM8_PTEAL/106-263HEMLQETFDVF--CTE-HSSAAW-NTTLQHGL------------------------------------------------
G3WZJ8_SARHA/27-182HETLQQIFTIF--SLN-TTPAAW-NQTQLRQL------------------------------------------------
G3UCD2_LOXAF/26-187HEMIQQIFNLF--SLQ-ASSAAW-DQTLLDKL------------------------------------------------
K7GQJ6_PIG/17-164HEMLQQTFLLF--HIE-RSSAAW-DSTLLDKL------------------------------------------------
G3I0H3_CRIGR/26-178QELTQQALILF--SSN-ESSAAW-ETTLLDTF------------------------------------------------
H0VYK7_CAVPO/28-181QEMLQNIFVII--RKE-FSTTVW-NKTIVDDL------------------------------------------------
L5K635_PTEAL/26-185HEMLQQTFDVF--GTK-QSSAAW-NTTLLHGL------------------------------------------------
W5JYQ9_ASTMX/23-179YITLEYINSML--NDH-ELPDQWTSQEKLDYF------------------------------------------------
H0Y0D2_OTOGA/28-187YVVVQHIFSLF--STT-ESSDAW-NKTLLDQL------------------------------------------------
IFN_ANAPL/34-190LHLLQHLFDTL--SSP-STPAHW-LHTARHDL------------------------------------------------
G3UJX3_LOXAF/27-185YEMLLQIFDIF--LGN-FSHTGW-DETVIENL------------------------------------------------
G5C259_HETGA/26-185HEMTSQTFNLF--STQ-DSSAAW-NNGLLDTF------------------------------------------------
G3WZF5_SARHA/26-185HEMLQQIFLLF--SSK-NASLGV-NNTIIETF------------------------------------------------
IFNE_PIG/27-186HEMLQQIFSLF--RAV-ISLDGW-EESHMEEF------------------------------------------------
W5N6G4_LEPOC/27-185LETMRCVHNIF--NKT-GHPATW-EISELERF------------------------------------------------
H9KYA4_CALJA/26-185HEMIQQTFNLF--STK-DSSVTW-DATLLDTF------------------------------------------------
D2HTQ4_AILME/33-205YEMSIQAFNIF--SQY-TFTSTW-EKDYLKQI------------------------------------------------
IFNB_HUMAN/27-185YEMLQNIFAIF--RQD-SSSTGW-NETIVENL------------------------------------------------
G1NR05_MELGA/32-188LHILQQLFNIL--SSP-HTPAHW-IDHAHHSL------------------------------------------------
F7BVP5_ORNAN/23-181HDLLQHIFNVF--SRN-HSQTGW-DEATVEKF------------------------------------------------
F7G875_MONDO/27-182HEMLQQTLILF--SSK-NACPDV-NDTIIEPF------------------------------------------------
C8CKC3_PIG/33-205YEMSIRAFNIF--TQD-TFKATW-EEKLLRQV------------------------------------------------
F7A317_HORSE/26-184HETIQQIFHLF--STD-GSSAAW-DESLLDKL------------------------------------------------
G1KU56_ANOCA/28-182HEILQQILCLY--IQN-HTKLPW-DENSIGIL------------------------------------------------
L5KBH2_PTEAL/26-185QEMLQEISNVF--GTQ-QSSGAW-NTTLLHGL------------------------------------------------
L5K909_PTEAL/26-185HEVTWQTFLLF--CTE-ASSTAW-DETLLGRF------------------------------------------------
I3N5Z0_ICTTR/23-179HEMLQQIFNLF--KKN-ISLGSR-EENHIPIF------------------------------------------------
F7GHL9_MONDO/26-181LEMVQQIFNLF--SQN-AMPATW-NQTQVIEL------------------------------------------------
IFNE_HUMAN/27-186HEMLQQIFSLF--RAN-ISLDGW-EENHTEKF------------------------------------------------
G3UK87_LOXAF/27-184HKMLQQIFNLF--RTK-EPSTAW-NTTLPDQL------------------------------------------------
L9LC61_TUPCH/27-185HEMLQNIFGVF--RRN-FSSTGW-NDTIVEHL------------------------------------------------
IFNB_RAT/27-182QVMLQNVFLVF--RSN-FSSTGW-NETIVESL------------------------------------------------
H0XMZ9_OTOGA/27-186HETLQQIFNLF--RAN-ISVDGW-EESHVEKF------------------------------------------------
G3VDC6_SARHA/27-182NETLQQIFNIF--SLN-TTPAEW-NQTQLIQL------------------------------------------------
I3JM36_ORENI/26-182VQVLEEVAALF--EED-HSSASW-EDSTVRNF------------------------------------------------
L5LKN9_MYODS/27-186HEMLQQIFSLF--QAN-TSLEGW-KESRMERF------------------------------------------------
G1TYS8_RABIT/29-195YEISTQAFCIF--MGH-AFQTTW-EETHLTQI------------------------------------------------
I3UJJ8_FELCA/27-185HEMLQQIFNLF--RAN-TSSDGW-EESHVEKF------------------------------------------------
C8CKA9_PIG/26-183HEMLQQIFRLF--STR-GSPSSW-DETLLIKF------------------------------------------------
IFNT2_BOVIN/3-162HEMLQQCFNLF--YTE-HSSAAW-NTTLLEQL------------------------------------------------
M3Z729_MUSPF/26-183HVTNQKTFHLF--CTE-ASPAPW-NTTLLEEL------------------------------------------------
IFNA1_MOUSE/26-185SELTQQILNIF--TSK-DSSAAW-NTTLLDSF------------------------------------------------
G3TTC1_LOXAF/26-185HEMLQQIFDLF--RTM-DSFAAW-NTTLLNQL------------------------------------------------
G1PDS6_MYOLU/29-199YEMYMLAFSIF--TQS-TFQSTG-EEKHLGQI------------------------------------------------
F7ABU5_MONDO/27-182LEMVQQIFTLF--SQN-TTPATW-NQTQVIQL------------------------------------------------
G1TTX4_RABIT/27-180FEMLNNIFDIF--RKN-FSSTGW-NETLVENL------------------------------------------------
H0XRP5_OTOGA/26-185HEMTQQTFNLF--STN-DSSEAW-NKTLLDQF------------------------------------------------
H0WK94_OTOGA/33-202YEVSIQAFHIF--SQY-TFEPTW-KLKHLNQI------------------------------------------------
G1KYL3_ANOCA/23-176QEVLQQTGHIF--KQN-YTEMPW-DEDSLRAF------------------------------------------------
G3WZQ8_SARHA/26-181YEMLQQIFTIF--SLN-TTPATW-SQTQLKQL------------------------------------------------
H0YTY6_TAEGU/34-188LRILQHLFHTL--SSN-STRQHW-PSHARNLL------------------------------------------------
I3MXH1_ICTTR/27-185YEMLKDIFHVF--KKG-YSNPDW-NNTIVTDL------------------------------------------------
M3WRV1_FELCA/26-184HVANQKIFHFF--CTEASSSAAW-NTTLLEEF------------------------------------------------
R4GKJ6_CHICK/35-191HDILQHLFKIL--SSP-STPAHW-NDSQRQSL------------------------------------------------
A3FBE8_MUSPF/27-184LEMFQKTSDIF--RRN-LSSTGW-NESIVENL------------------------------------------------
G1KWE0_ANOCA/28-180QEVLQQTGHIF--RQN-RTEMLW-DEDSLRAF------------------------------------------------
G7PS89_MACFA/26-185HEIIQQTFNLF--NTK-NSSAAF-NETLLDEF------------------------------------------------
G1Q880_MYOLU/26-185HEMLQQVSNLL--STE-NSSVTW-NTTLVDQL------------------------------------------------
IFNB_MOUSE/27-180QEMLQNVFLVF--RNN-FSSTGW-NETIVVRL------------------------------------------------
IFNB2_BOVIN/27-184YEMLQQIFNIL--TRD-FSSTGW-SETIIEDL------------------------------------------------
G1SJC4_RABIT/26-185HEMTQQLLNLF--STK-EASAAW-DKALLDRL------------------------------------------------
W5PG31_SHEEP/26-185HEVTQHTFQLF--STE-SSAAAW-DQSLLDKL------------------------------------------------
IFNA3_CANLF/26-183HVMTQKVFHLF--CTN-TSSAPW-NMTLLEEL------------------------------------------------
G5BPX2_HETGA/27-199YDIIIQAFNIF--SRH-TSDSTW-KEEYLTQI------------------------------------------------
IFNW2_HORSE/26-185HEMLQQIFSLF--HTE-RSSAAW-NTTLLDEL------------------------------------------------
G3N2A8_BOVIN/26-185HEMLQQTFNLF--HTE-RSSAAW-DTTLLEQL------------------------------------------------
H0XKS8_OTOGA/27-185YEMLQNIFRIL--RRD-FSSTGW-NETIVDAL------------------------------------------------
A0A286X8P0_CAVPO/26-185HEMTTQTLILF--SSQ-NSHAAW-NQSLRRTF------------------------------------------------
Q29412_PIG/27-184HEMLQQIFGIL--RRN-FSSTGW-NETVIKTI------------------------------------------------
G7PS88_MACFA/26-185HELIQQTFNLF--TTK-DSSAAW-DEDLLDKF------------------------------------------------
M3WZS7_FELCA/26-181HEMLQQIFNLF--SKS-DSFVAW-DEMLLDRF------------------------------------------------
H9GZR7_HORSE/26-185HEMLQQIVNLF--HTE-RSSAAW-NTTLLDRL------------------------------------------------
F1LVL8_RAT/26-184HEILQQIFVLF--QTH-SSRGVW-EENHIEEV------------------------------------------------
M3YX13_MUSPF/27-179HEMLLQTFSLF--RAG-ISLDGW-EEIRVE-F------------------------------------------------
G1L8G2_AILME/26-185HEMFRQIFNLF--SQS-GSFVAW-DETLLDKF------------------------------------------------
IFNB_HORSE/27-184YEMLQHTWRIF--RRN-FASTGW-NETIVKNL------------------------------------------------
H0W289_CAVPO/26-190HGMLQQILTLF--YTE-HASAAW-NGALLDQL------------------------------------------------
A8E6E8_MONDO/27-182HEMLQQKFTLF--SQN-AAPVAW-NQTQLMQL------------------------------------------------
I3N788_ICTTR/27-185YEMLQDIFVIF--TRN-FSNTGW-NETIVKDL------------------------------------------------
G1L8I1_AILME/26-183HVMDQKIFHVF--CTE-PSSAAW-NRTLLEEF------------------------------------------------
IFNB_FELCA/27-184NEMFQKIFNIF--SRS-TSSTGW-NETTVENL------------------------------------------------
G3TS29_LOXAF/26-179YEMLQQTFNLF--SRS-DSLEAW-DETFLDKF------------------------------------------------
W5PZ39_SHEEP/26-184YEMTRQAFHIF--TQD-TFQSTW-EGKQLRQI------------------------------------------------
G3I0H6_CRIGR/26-178QELTQQALILF--SSN-KSSAAW-EKTLLKPF------------------------------------------------
M3Z715_MUSPF/26-183HVTKQNIFHLF--CTE-ASPAPW-NTTLLEEL------------------------------------------------
M3VXI8_FELCA/33-205YEMSTQAFNIF--RES-TTKSTW-KKKNLKQI------------------------------------------------
G3R8Q7_GORGO/26-185HEMLQQIFSLF--HTE-RSSAAW-NMTLLDQL------------------------------------------------
A8E6F5_XENTR/51-202RGVLNETMRFY--MKH-HESMGC-KQQAWERF------------------------------------------------

PF02947

FLT3L_MOUSE/30-162QRWIEQLKTV--------------AGSKMQTL------------------------------------------------
F6T7S9_ORNAN/28-157EDRLKHLERM--------------SGPRLREL------------------------------------------------
H9GP84_ANOCA/29-165HRNLNRMINV--------------SGSELEKS------------------------------------------------
F6TPW7_MONDO/34-163KKTLDRLELV--------------AGKELKKL------------------------------------------------
G5B8P0_HETGA/20-150QRWMERLKTV--------------AGLKIREL------------------------------------------------
G1M637_AILME/29-159QRWMGQLKAV--------------AGSQMQIL------------------------------------------------
L9JA37_TUPCH/769-910QRWMERLKTV--------------AGPQIQDL------------------------------------------------
G3VSA3_SARHA/79-209KETLDRLKLV--------------AGSKLQEP------------------------------------------------
G1QZC3_NOMLE/30-160QRWMERLKTV--------------AGSKMQGL------------------------------------------------

PF00714

I3MNV6_ICTTR/15-152GSLFLDILDRW--EE--ESDKKV-IQSQIVSF------------------------------------------------
IFNG_HORSE/15-152GPLFLDILKNW--KE--DSDKKI-IQSQIVSF------------------------------------------------
H0WPL1_OTOGA/15-151GILFLDILKNW--EK--ESD-KI-IQSQIVSF------------------------------------------------
Q8CGS0_CAVPO/15-154GTLFVGILKNC--QE--ESERKI-FQSQIVSF------------------------------------------------
B9VS86_CALJA/15-152GTLFLDILRTW--RE--EGDRKI-MQSQIISF------------------------------------------------
G3SUC6_LOXAF/15-152GPLFIDILKNW--KE--DSDKKI-IQSQIVSF------------------------------------------------
G3GY20_CRIGR/2-135GDLVFNTLMNW--QK--DGDTKI-IQSQIVSF------------------------------------------------
L5LME8_MYODS/15-153GHLFLDILMNW--KG--ESDIKI-IQSQIISF------------------------------------------------
G5BGB5_HETGA/15-152GTLFVGILKNC--QE--ESDKKI-FQSQIVSF------------------------------------------------
G3WQJ9_SARHA/15-153SSLFMDMMKTW--KEG-NCDKKI-LMSHVVAV------------------------------------------------
IFNG_SHEEP/15-152GPLFSEILKNW--KE--ESDKKI-IQSQIVSF------------------------------------------------
IFNG_RAT/14-151KSLLLDIWRNW--QK--DGNTKI-LESQIISF------------------------------------------------
IFNG_RABIT/15-152GPLFLNILRNW--KE--ESDNKI-IQSQIVSF------------------------------------------------
L9KVU0_TUPCH/51-188GRLFVDILKNW--TE--ESDKKI-FQSQIVSF------------------------------------------------
IFNG_FELCA/15-153GSLFVDILKNW--KE--ESDKTI-IQSQIVSF------------------------------------------------

PF02372

IL15_PIG/33-160KCFLLELRVIL--QES---RNSD-ISDTVENL------------------------------------------------
IL15_CAVPO/33-160KCFLLELRVIL--HES---RNED-IHETITNL------------------------------------------------
IL15_FELCA/33-160KCFLLELHVIS--LES---KNET-IHQTVENI------------------------------------------------
IL15_SHEEP/33-160QCFLLELRVIL--HES---KNAA-IYEIIENL------------------------------------------------
F1NZN5_CHICK/55-183RCFFLEMNVIL--HEC-GIKKCS-RKHDVRNI------------------------------------------------
G1NDP6_MELGA/5-137QCYLEEM-VML--EKE-IEDEPE-IKNEFKNA------------------------------------------------
O73883_CHICK/5-138QCYLGEV-VTL--KKE-TEDDTE-IKEEFVTA------------------------------------------------
Q8JFF4_ANAPL/4-134QCYLKEI-VTL--EEE-IEDEDE-IEDEKVSS------------------------------------------------

PF00715

I3MQX6_ICTTR/7-151QCLEEELKPL----QE-VLNVPQ-SKNFHLKD------------------------------------------------
G5C793_HETGA/7-149QCLEEELKPL----EQ-VLNLAE-HKHFPLIN------------------------------------------------
G1PJ32_MYOLU/7-147QCLVDELKPL----EE-VLKLEK-S----LSN------------------------------------------------
B1AB81_HORSE/7-146QCLEEELKPL----EE-ML------KNFLSKD------------------------------------------------
G3HTL8_CRIGR/7-150QCLEEELGAL----QS-VLDLAQ-SKSFQLED------------------------------------------------
IL2_MACMU/7-151QCLEEELKPL----EE-VLNLAQ-SKNFHLRD------------------------------------------------
H0Y254_OTOGA/7-149QCLEEELGPL----EK-VLDLGQ-SKNFHLGD------------------------------------------------
IL2_MOUSE/7-165QCLEDELGPL----RH-VLDLTQ-SKSFQLED------------------------------------------------
G3SU90_LOXAF/7-147QCLVDELKPL----ED-VLNVAP-SK----QN------------------------------------------------
IL2_PIG/7-151QCLVEELKAL----EG-VLNLGQ-SKNSDSAN------------------------------------------------
IL2_FELCA/7-151QCLVEELKPL----EE-VLYLAQ-SKNFHLNH------------------------------------------------
L5K7D9_PTEAL/7-149QCLVDELKPL----EE-VLTIAQ-SKNSH-SD------------------------------------------------
IL2_BOVIN/7-152KCLLEELKLL----EE-VLNLAP-SKNLNPRE------------------------------------------------
H0VBY4_CAVPO/7-149QCLEEELRAV----EQ-VLNLAE-HKNFPLIH------------------------------------------------

PF01415

M3WJR8_FELCA/15-127PCF----QEGL--SQM-TNS-TV-QTSFPLIF------------------------------------------------
H0X0U6_OTOGA/15-141PCF----QEGL--SQM-TNS-TV-HTEHPQIF------------------------------------------------
G1QNL2_NOMLE/28-172GMFLFRAARKL--RQF-LKM-NS-TGDFDLHL------------------------------------------------
IL7_BOVIN/28-171ASFLNRASRKL--RQF-LKM-NI-SDDFKLHL------------------------------------------------
F1PA23_CANLF/29-154GMFLYRAAHKL--KQF-VKV-NN-SEDFNLHL------------------------------------------------
IL9_MOUSE/15-141PCY----REGL--LQL-TNA-TQ-KSRLLPVF------------------------------------------------
U3KN10_RABIT/31-153ADFLERAARKL--DQF-HDM-SI-NEDFQNHL------------------------------------------------
K7E262_MONDO/59-200VTFIVHVTCKL--KQL-VKANNI-PENLSHSL------------------------------------------------
E1BF10_BOVIN/18-141ACF----QEGL--SQM-SSS-TV-STRFHLIV------------------------------------------------
F6PLW3_HORSE/15-136ACF----QEGL--SQM-TNT-TV-KTRFALIF------------------------------------------------
IL9_HUMAN/15-141PCF----SERL--SQM-TNT-TM-QTRYPLIF------------------------------------------------
IL7_MOUSE/28-151AAFLNRAARKL--KQF-LKM-NI-SEEFNVHL------------------------------------------------
G5BX09_HETGA/15-141PCF----QEGL--SQM-TNI-TQ-KTKFSLTF------------------------------------------------
L8Y4N8_TUPCH/15-141PCF----QEGL--AQM-THV-MA-NTASSLIF------------------------------------------------
D4A8I9_RAT/15-141PCF----QEGM--SQV-TNA-TQ-QSKFSPFF------------------------------------------------
G3TKQ6_LOXAF/16-136PCF----QEGL--SQL-TDK-TV-QSEFTLSF------------------------------------------------
M3YEX7_MUSPF/16-137PCF----QEGL--SQM-TNS-TV-GTRYPLIF------------------------------------------------
G1NXN3_MYOLU/28-153ATFLKTAARKL--KQF-LKM-NI-HEEFKLHL------------------------------------------------

PF00103

PLRP1_BOVIN/26-238YSWNNPLHHLV--TEL-QHMKEL-SNAFLSSA------------------------------------------------
CSH2_BOVIN/26-238YSWNNPLYYLL--LEL-RNMKNL-SEAVISSA------------------------------------------------
PLRP3_BOVIN/1-213YSWHRPLYLLV--KDL-QSMKEV-SDTILSSA------------------------------------------------
PR4A1_RAT/17-227QAWLNPLHHLW--AEM-CDRLGS-TPPTLYKA------------------------------------------------
CSH1_BOVIN/26-236HSWDEPLHQAV--TEL-LHRNGA-SPDILARA------------------------------------------------
PLRP4_BOVIN/26-239YSWQRPLYQLV--TDL-RSMKEV-SNTILSSA------------------------------------------------
PR3D4_RAT/16-223VSWKEPLKHFV--SAV-TDLPGA-SASMRKKA------------------------------------------------
PR2C2_MOUSE/16-224DAWESPLDDLV--SEL-STIKNV-PDIIISKA------------------------------------------------
SOM2_HUMAN/9-215QSWLEPVQLLR-------SVFAN-SLVYGASD------------------------------------------------
PR8A5_RAT/17-238GFMDQPLFHLV--IEL-SAMEGV-PETILSKA------------------------------------------------
PR6A1_RAT/20-234ETWTFSLYHIA--NEM-SHMEEP-PDEIISRA------------------------------------------------
PR7D1_MOUSE/17-240LAWKEPLKHLV--TEL-SALPEC-PYRILSKA------------------------------------------------
CSH2_HUMAN/9-215ESWLEPVRFLR-------SMFAN-NLVYDTSD------------------------------------------------

PF01109

CSF2_RAT/18-139PTCVQTRLK------L-YKQGLR-GN-L----------------------------------------------------
CSF2_MOUSE/18-136LTCVQTRLK------I-FEQGLR-GN-F----------------------------------------------------
CSF2_BOVIN/18-138PTCLQTRLK------L-YKNGLQ-GS-L----------------------------------------------------
CSF2_CAVPO/18-140PTCLQTRLA------L-FMKGLR-GN-L----------------------------------------------------
CSF2_PIG/18-139PTCVQTRLN------L-YKQGLR-GS-L----------------------------------------------------
CSF2_HUMAN/18-139PTCLQTRLE------L-YKQGLR-GS-L----------------------------------------------------
CSF2_CANLF/18-139PTCLETRLQ------L-YKEGLQ-GS-L----------------------------------------------------

PF02025

I3MDT8_ICTTR/22-133QLCIEEIFQGI--DTL-KNQTTQ-GDAV----------------------------------------------------
G1RQD7_NOMLE/22-133QLCTEEIFQGI--GTL-ESQTVQ-GGTV----------------------------------------------------
IL5_CAVPO/23-134QLCIEEIFQGI--DTL-KNQTTQ-GEAL----------------------------------------------------
J9NWP5_CANLF/22-132QLCIKEVFQGI--DTL-KNQTAH-GEAV----------------------------------------------------
IL5_MOUSE/21-132QLCIGEIFQGL--DIL-KNQTVR-GGTV----------------------------------------------------
G3WAR7_SARHA/25-134PLCIEEIFQGI--ETL-KNQTAE-DNVV----------------------------------------------------
IL5_HORSE/22-133QLCIEEVFQGI--DTL-KNQTVQ-GDAV----------------------------------------------------
B5FW65_OTOGA/22-133QLCTEEIFHGL--DTL-RNQTAH-EDGV----------------------------------------------------
G3T4B0_LOXAF/23-133QLCTEEIFQGI--DTL-KNQTVQ-DDAV----------------------------------------------------
G1SL79_RABIT/22-133HLCIEETFRGV--DTL-KAQIVQ-GEAM----------------------------------------------------

PF02059

IL3_CANLF/19-132LRPNLDVFL------N-ASSKF--HKNG----------------------------------------------------
IL3_MOUSE/27-138RRVNLSKFV------E-SQGEVD-PEDR----------------------------------------------------
IL3_BOVIN/18-132LQANLKVFM------T-FATDT--FGSD----------------------------------------------------
G3UC30_LOXAF/22-133LKPNLDAFL------K-ATENFK-EKGG----------------------------------------------------
G1MH15_AILME/18-131LRPNLEAFL------N-ATKNF--YNSE----------------------------------------------------
G1RQ11_NOMLE/20-137RRPNLEAFN------K-AVKSL---QNA----------------------------------------------------
IL3_CALJA/19-136RKPNLEAFQ------K-AVKSL---QNA----------------------------------------------------
F1LS41_RAT/29-138RRVNLDEFL------K-SQEEFD-SQDT----------------------------------------------------

PF00758

H0W023_CAVPO/30-191GQQAAEVWQGL--VLL-SEAMLQ-GQALLANS-------------------------------------------SQQSE
G3TYQ1_LOXAF/25-173QNKAQDVLGAV--TLL-LEGVMA-ARRQVGPT-------------------------------------------CLSSL
W5K758_ASTMX/26-175EEQAQEVQTGL--WLL-NRAFIS-LHTSISNS-------------------------------------------A----
B1N8Y2_DANRE/15-168EEQAQEVQSGL--HML-NEAIGS-LQISNQTE-------------------------------------------V----
F7DTH0_CALJA/31-193GQQAVDIWQGL--TLL-SEAVLR-GQALLANS-------------------------------------------SQPRE
M3XJ62_LATCH/27-177KIKEREIWAGI--NLF-THTFKT-VRDFIRDS-------------------------------------------V----
G3W289_SARHA/30-190GQKAGEVWQGL--TLL-SEAVLK-GQALLANS-------------------------------------------SQTPV
F6WUU2_MONDO/31-191GQKAGEVWQGL--TLL-SEAVLK-GQALLANS-------------------------------------------SQTPA
G3VW20_SARHA/26-175RFKCTQLSPTR--NSL-TKG-----GGSPLPA-------------------------------------------WEAAL
G1PF99_MYOLU/45-207EQQALEVWQGL--ALL-SEAILR-GQALLANS-------------------------------------------SQTSE
TPO_CANLF/25-176QTKAQDVWGAV--ALL-LDGVLA-ARGQLGPS-------------------------------------------CLSSL
F7G570_MONDO/26-177QTKGQEVLGAV--TLL-LEGAIA-ARGQLNPS-------------------------------------------CLSSL
H2LEX3_ORYLA/33-182LEQAEEVQTGL--WLL-QQALGS-FGPSVTNT-------------------------------------------A----

PF00726

IL10_BOVIN/5-174KGYLGCQA--L--SEM-IQFYLE-EVM-PQAE------------------------------------------------
IL10H_EBVB9/7-167KGYLGCQA--L--SEM-IQFYLE-EVM-PQAE------------------------------------------------
G3HB01_CRIGR/14-174EGYLGCQT--L--SEM-IQFYLV-EVM-PQAE------------------------------------------------

PF14565

IL22_HUMAN/40-178SMSERCYL--M--KQV-LNFTLE-EVLFPQSD------------------------------------------------
E1C1U2_CHICK/46-184RENNRCYM--M--KRI-TEIIVK-DVLLTEAK------------------------------------------------

PF15177

I3MK89_ICTTR/29-189QVWERPVA--L--QAE-LALTLR-VLGTMANS------------------------------------------------
H0VBN4_CAVPO/32-188QVWERPLA--L--QAE-LALTLK-VLGTVTDP------------------------------------------------
IFNL3_CHICK/28-182SVPDRITL--V--EAE-LDLTIT-VLTNPTTQ------------------------------------------------
F1M3K4_RAT/31-188QVQERQKA--L--QAE-VALTLK-VLGNMTDP------------------------------------------------
F1PY54_CANLF/31-186QAWERPVA--L--EAE-LDLTLK-VLENMTDS------------------------------------------------
H0XRJ1_OTOGA/35-191QVWERPVA--L--EAE-LALTLK-VLEAVTNE------------------------------------------------
F6PNH9_HORSE/31-184QVWERPVA--L--EAE-LALTLK-ILAMVADS------------------------------------------------
D2DJP5_XENTR/23-178QASDRLIL--T--LER-VTLAVD-VLTNMTES------------------------------------------------
G3TQK4_LOXAF/32-188QVWERPMA--L--EAE-LALTVK-VLRTMSDS------------------------------------------------
F7DXI8_HORSE/34-187QVWERPVA--L--EAE-LNLTLR-VL---ANS------------------------------------------------
F6W920_MONDO/30-184QLADRPIV--L--EAE-LKLTLE-VLKGIQNP------------------------------------------------
U3KED0_FICAL/27-186PMSDRVLL--V--AAE-LNLTMA-MLELPAAP------------------------------------------------
IFNL4_HUMAN/25-174SSCARLRH--V--ARG-IADAQA-VLSGLHRS------------------------------------------------
IFNL2_MOUSE/32-189QVQERPKA--L--QAE-VALTLK-VWENMTDS------------------------------------------------
G3N0M3_BOVIN/37-192QVWERPVA--L--EAE-LALTLT-VLEAMANS------------------------------------------------
G1LPU9_AILME/37-191QVWERPVA--L--EAE-LILTLK-VLETMADR------------------------------------------------
L5LZZ9_MYODS/163-319QVWERPVA--L--EAE-LALTLK-VLGTLKNS------------------------------------------------
IFNL3_HUMAN/34-192QVRERPVA--L--EAE-LALTLK-VLEATADT----------------------------------------------DP
F6R8C9_XENTR/23-177KASDRIIL--T--LER-VTMAVD-VLTNITES------------------------------------------------
G3VJ97_SARHA/12-167PVSVRPVV--L--QAE-LKLTLE-VLKAVTKP------------------------------------------------
H0XJU8_OTOGA/36-192QVWERPVT--L--EAE-LALTLK-VLEAVTKE------------------------------------------------
G3HJD0_CRIGR/30-187QVQERLKA--L--QAE-LHLTLQ-VLENVTDS------------------------------------------------
G1LPW2_AILME/34-190QVWERPVA--L--EAE-LALTMK-VLETMADS------------------------------------------------
L5L378_PTEAL/33-182QVWERPMA--L--EAE-LALTLK-VLETKADS------------------------------------------------
G1T4B0_RABIT/34-188---ERPEA--L--EAE-LFMSLK-VLEAMEDS------------------------------------------------
U3IYH6_ANAPL/34-185SVPDRLLL--V--EAE-LDLTIA-VLAHPTVD------------------------------------------------
L9LBW1_TUPCH/31-181QMWERLMA--L--EAE-LALTLR-VLGSVADS------------------------------------------------
D0FHA1_PIG/36-191QVWERPVA--L--EAE-VALTLS-VLGSLANS------------------------------------------------

PF05337

CSF1_HUMAN/41-180---KAFLL--V--QDI-MEDTMR-FRDNTPNA------------------------------------------------
Q3TLQ6_MOUSE/41-180---KAFFL--V--QDI-IDETMR-FKDNTPNA------------------------------------------------
O77709_BOVIN/41-180---KAFLL--V--QDI-MEDTMR-FKDNTPNA------------------------------------------------
O77710_BOVIN/41-180---KAFLL--V--QDI-MEDTMR-FKDNTPNA------------------------------------------------
Q64129_9MURI/41-180---KAFFL--V--QDI-IDETMR-FKDNTPNR------------------------------------------------

PF15036

IL34_MOUSE/28-184ERELRYLW--V--LVS-LNATES-VMDVLLEG----------------------------------------------HP
R4GIU3_CHICK/19-177EASLRYLW--F--HAC-SQAVLH-ILEVLPEK----------------------------------------------HP
F7EA00_CALJA/29-185ERELRYLW--V--LVS-LSATES-VQDVLLEG----------------------------------------------HP
H0WFN4_OTOGA/28-184ERELRYLW--V--LVS-LSATES-VQDVLLEG----------------------------------------------HP
M3ZVZ0_XIPMA/24-191---LQRLW--F--QVN-QGVLKK-IIRVLPER----------------------------------------------HP
U3JY35_FICAL/18-179EAALRYLW--F--HVS-SQAVLR-IREVLPEK----------------------------------------------HP
L9KJY3_TUPCH/28-184ERELRYLW--V--LVS-LSAAES-VQDVLLEG----------------------------------------------HP
G3T3A6_LOXAF/28-182EQELRYLW--V--LVS-LSATES-VQDVLLKN----------------------------------------------HP
F6W3U1_MONDO/15-167QPNLRYLW--A--ALN-CNTMEI-IQNVLLED----------------------------------------------HP
I3JZ08_ORENI/24-192---LQRLW--F--QVY-QGVLKK-ILWVLPTR----------------------------------------------HP
L5MCR9_MYODS/28-182QQELRHLW--V--SVS-LGATEA-VQGVLLEG----------------------------------------------HP
B3DLJ8_DANRE/23-195PRDLQDLW--L--YVS-QQGIKK-VLRVLPER----------------------------------------------HP
IL34_BOVIN/28-183QQELRYLW--V--LVS-LSATEW-VQEVLLEG----------------------------------------------HP

PF02404

R4GD07_ANOCA/1-283HCWLHLMVPEL--SKS-LSNLLN-KFTEFSDMPDVLSNYSIINNLRRIINDLMECLSSTKYRNFRQHHDHLYEEGRFIPE
SCF_CHICK/1-287HCWLHLMVPEF--SRS-LHNLLQ-KFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPE
SCF_RAT/1-273HCWLRDMVTHL--SVS-LTTLLD-KFSNISEG---LSNYSIIDKLGKIVDDLVACMEENAPKN-VKESLKKPETRNFTPE
G1NWC8_MYOLU/1-272HCWISKMVEQL--SVS-LTDLLD-KFSNISEG---LSNYSIIDKLVKIVDDLVECMEEHALEN-VKKSSNSLELKMLTPE
F7EP53_MONDO/1-273HCWLHLMVPEL--ARS-LNNLLD-KFSKISSS---LSNYSIIDKLIKIIDDLMGCLEE-KNKNFRKQNIHIYKRDSFNPE
F7C5I3_ORNAN/1-273HCWLHLMVPEL--AKS-LNNLLQ-KFSEISES---LSNYSIINNLTRIIDDLMACLASDKNKHFVQRNIHLYKKGSFIPK
F7G0W2_CALJA/1-273HCWISEMVVQL--SSS-LTDLLD-KFSNISEG---LSNYSIIDKLVNIVDDLVECVKENSSKD-LKKPFKSPEPRLFTPE

PF00489

M3X721_FELCA/44-225--AKSVYTSTN-VLL---------QMLKRKGKNQDEVTIPV-PTVEVGLQAKLQSQEEW-----LRHTTIH-----LT--
IL6_BOVIN/27-208--VRDLRKNIR-TLI---------QILKQKIADL--ITT---PATNTDLLEKMQSSNEW-----VKNAKII-----LI--
IL6_HORSE/27-208--IKTMQISTK-VLV---------QILMQKMKNP-EVTTPD-PTAKSSLLAKLHSQNEW-----LKNTTTH-----LI--
G3UHF3_LOXAF/20-205--VIVVQNSTK-ALV---------QILKQKIKNPEDVTTPD-PTANASLLSKLQLQTEW-----LKNTTIN-----LI--
L5KPK4_PTEAL/20-202--AKAMQMRTK-ALV---------QVLKQKVKNPNEITTPD-PTTNSSLLAKLQSQSEW-----LQTTTIH-----LI--
F7HV62_CALJA/27-212--AGAVQMSTK-GLI---------QSLQKKAKNLSAIATPD-PATNASLLTKLQAQDQW-----LQGVTTH-----LI--
IL6_MOUSE/26-210--ARVLQRDTE-TLI---------HIFNQEVKDLHKIVLPT-PISNALLTDKLESQKEW-----LRTKTIQ-----FI--

PF16647

CSF3_BOVIN/42-190--LDTLQLDVT-DFA---------TNIWLQMEDLGAAPAVQ-PTQGAMPT----FTSAF-----QRRAGGV-----LV--
CSF3_HUMAN/51-202--LDTLQLDVA-DFA---------TTIWQQMEELGMAPALQ-PTQGAMPA----FASAF-----QRRAGGV-----LV--
CSF3_MOUSE/57-205--LDLLQLDVA-NFA---------TTIWQQMENLGVAPTVQ-PTQSAMPA----FTSAF-----QRRAGGV-----LA--

PF16649

IL23A_MOUSE/28-185--MEQLHTSLL-GLS---------QLLQPEDHPRETQQMPS-LS----------SSQQW-----QRPLLRS-----KI--
F7HQI5_MACMU/28-184--VGQLHASLL-GLS---------QLLQPEGHHWETQQIPS-PS----------PSQPW-----QRLLLRF-----KI--
F1MSN4_BOVIN/35-192--VDQLHASIL-GLR---------ELLQPKGHHWETEQTPS-PI----------PSQPW-----QRLLLRL-----KI--
IL23A_CAVPO/28-184--VSQLHASLL-GLS---------QLLQPEVHQWE-PQIPS-LS----------PNQPW-----QRLLLRI-----KI--
G3VET0_SARHA/31-186--VGQLHSSLL-GLS---------QLLQPKDHSWKKQQVPS-------------PSEPW-----QRLLLRP-----KI--

PF07400

F1R6T9_DANRE/26-187--IVHLIQAI----------------IQKVLQELGQTAPEI-VHPTLPPL-----ETFW-----QLYQTNA-----EI--
A0A0P7XG98_9TELE/28-193--LGELIQHLK-LLK---------FSLQRQMTKLQVLRPPT-PSPSLPST----DVNEW-----EVVQSSL-----EL--
F1R1E3_DANRE/28-198--LTDMVSHIG-GLV---------NSLQRQMNHIGAPRLTV-PSPSLPPI----PAFHW-----EMVQTSQ-----EL--
H2T1R2_TAKRU/27-195--LVEMIKEMK-SLI---------TLLHCQMLRVEAPRLTP-ATPSLPPH----LPYQF-----DVLQSSH-----EL--
H2M884_ORYLA/28-196--LEKMITEMK-SVI---------TMLHHQMQRVEAPVLTP-ATPSLPSH----LPYHF-----EVLQSTH-----EL--
H3A6V0_LATCH/22-190--ITKIHSKTQ-NLA---------NHIEHLMNRHNIPKSNF-SPPQLPPQ----HATHW-----SAVHAGH-----AI--
G5BVZ4_HETGA/26-199--LGTLQARLD-RLL---------RRLQLLMSVLALPQVPPEPPTPPLAP----PASAW-----GGIRAAH-----AV--
F6WLV3_XENTR/22-187--FNGIHNRIE-KLL---------KKIDLLMIKHHMPRVTEPVVPQF-PN----STTPW-----GVIQSGH-----AI--
G3P408_GASAC/28-197--TGGAGAHLL-RLS---------DLLTASLLQMGEEVPPS-LSPPLAPI-----STAF-----DVLRFSV-----EM--
A0A091E199_FUKDA/60-227--LGTLQTQLD-RLL---------RRLQLLMASLALPQVPPELPAPPLPS----SLKDW-----RSIQAAH-----AI--
W5LKH5_ASTMX/28-199--LGEMISHIK-SLI---------NSLQRQMSRVDAQRNPV-PSPSLPPH----PTSHW-----EMDQSSQ-----EL--

PF06875

Q5BNQ4_9SALA/2-215-LKAKFEEAMA-NSN----TLISKISDIMTQMGMSV------TITLPKP---LVVPFKG------SAYFSK-----KL--
Q5BNQ2_9SALA/2-215-LKAKFEEAMA-NSN----TLISKISDIMTQMGMSV------TITLPKP---LVVPFEG------SAYFRK-----KL--

PF01110

CNTF_CHICK/1-194-LGPALAAMLL-QVS----AFVYHLEELLELESRGA------PAEEGSE---PPA-PPR------LSLFEQ-----KL--
G3VWZ5_SARHA/1-195-FHQNIHRVLL-QVA----AFAYEMEELMALLGHQA------PSQETDS---GPVGGSH------RTFLEK-----KL--
E1BFH9_BOVIN/1-193-FHQAIHAVLL-QVA----AFAYQLEELMALLEHRV------PPREAGG---PPLLPGD------AGLFEK-----KL--
G5AP46_HETGA/1-192-FHQAIRSLGL-QVS----AFAYQLEELMVLLEHEI------PPNETSG---VPL--GE------GGLFEK-----KL--
H0Z9U1_TAEGU/1-188-LGRALAAVLL-QVS----AFAYHLEELLRLESRGI------PGEEGDG---PPP-PPR------LSLFEQ-----KL--
CNTF_HUMAN/1-194-FHQAIHTLLL-QVA----AFAYQIEELMILLEYKI------PRNEADG---MPINVGD------GGLFEK-----KL--

PF01291

LIF_MOUSE/44-203-LQVKLNATID-VMR----GLLSNVLCRLCNKYRVG----HVDVP-------PVPDHSD------KEAFQR-----KK--
LIF_BOVIN/43-202-LHSKLSTTAD-VLR----GLLSNVLCRLCSKYHVS----HVDVT-------YGPDTSG------KDVFQK-----KK--
ONCM_HUMAN/37-209EDLEKLQMARP-NIL----GLRNNIYCMAQLLDNSD---TAEPTKAGRGASQPPTPTPA------SDAFQR-----KL--
ONCM_MOUSE/34-194----KLDSARH-NIL----GIRNNVFCMARLLNHSL--EIPEPTQTDSG---ASRSTTT------PDVFNT-----KI--
ONCM_BOVIN/34-194------QQAEM-NVR----GFGNNIHCMAQLLRGSSDPKAAEPTQPGPGPT-PLPPTPP------SSTFQR-----KL--

PF03039

I3MN91_ICTTR/3-204-LLMDPKGQIY-EDK----ALLAAVDYLMQAVNVNN---ETVPQT-------PSPEAPS------PNLYRT-----KT--
IL12A_MOUSE/6-215-LQNHNHQQII-LDK----GMLVAIDELMQSLNHNG---ETLRQK-------PPVG--E------ADPYRV-----KM--
G3VQT1_SARHA/40-247-LAKDPTRQIS-LDQ----NMLAAIDEMMQALNFSS---ENMTVT-------PSPK--E------PDFYKA-----KV--
F6T5A8_MONDO/5-202-LTKDPAKQIS-VDL----NMLAAIEEMMQALNFNS---KNVPLI-------SSPK--E------SDFYKT-----KV--
IL12A_PIG/6-222-LLMDPKRQIF-LDQ----NMLTAITELMQALNFNS---ETVPQK-------PSLE--E------LDFYKT-----KI--
L8YEA2_TUPCH/1-213-LWMDPERQIL-LDQ----NMLTAIDELMQALNFNS---DTVPRS-------YSLE--E------PDFYKT-----KI--
H0X861_OTOGA/6-217-LSMYPINQTI-LDQ----NLLTVMEKLMQDLNSTS---ETVMHP-------SSHE--E------TNFYKT-----KV--
Q924V6_CAVPO/6-221-LLMDPQRQIF-LDQ----NMLSAIDELIQALNGSD---VTVPQK-------LSLE--E------PDFYKI-----KM--

PF02024

H3AP27_LATCH/26-169-V-DDVTQILW-DIE----NLRALLQTLATTMGCEL------HQTTELETLKDLAKEHS------TSPYTT-----EK--
G3WWV6_SARHA/23-167-S-RNMVQISN-DLE----NLRDLLHLLGSLKSCPF------DEADGLSALGNLEGVME------ASLYST-----EV--
F6PLK2_ORNAN/23-167-M-PDRTQISN-DLE----NLRSLFALLATLKNCPF------TRSDGLDTMEIWGGIVE------ESLYST-----EV--
F7HGW1_CALJA/23-167-S-GNMIQISN-DLE----NLRALLHLLAASKSCHL------PWASGLENLANLGGVLE------VSLYST-----EV--
G5BHA4_HETGA/23-167-SRRNMVQISN-DLD----NLQNLVHMLASSKGCPL------PQTRGPELLENLGGALK------ESIYST-----EV--
W5NER9_LEPOC/28-172-M-EEMDQILA-DIF----NLRMIIKSLATSVNCAP------LKSSNMSHLESFLKTNA------AFHVTI-----GN--
A0A286XUJ2_CAVPO/23-165-S-SHTAQISN-DLE----NLQSLVQMMASSKGCPL------PHTTEPE-LQDLESTLK------ESRYSI-----EV--
LEP_HUMAN/23-167-S-RNVIQISN-DLE----NLRDLLHVLAFSKSCHL------PWASGLETLDSLGGVLE------ASGYST-----EV--

PF15216

M3WGC3_FELCA/29-146---TTLAKEI----F----AIRTNATLTLQCPGYSG------------------TQINN------TQAKKK-----RK--
F1RLI5_PIG/20-130---TSLAKEE----F----AKRTKAAFALQCSGYSG------------------IQINN------TQAMR----------
A0A2I2YQB0_GORGO/29-153---ASLAKEM----F----AMKTKAALAIWCPGYSE------------------TQINA------TQAMKK-----RR--
F7I7D5_CALJA/29-153---AALAKEL----F----AVRTNATLALWCPGYSE------------------TQINA------TQEMKK-----RK--
K7E5V9_MONDO/34-162---SSEMGETL-EAF----VNRTRIALKSYCPVFQG------------------NQTNN------MQTTKN-----NM--
L8YGS5_TUPCH/5-129---GSLSKEM----F----ACRTKATFAHRCPDYPR------------------VKVNN------TQAMKK-----RK--
J9P5I8_CANLF/29-154---ASGAREA----F----AEGTVAALAAECPGYAA------------------APINN------TQAKKK-----RK--
TSLP_MOUSE/20-137---PSLPDKT----F----ARRTREALNDHCPGYPE------------------TERND-----GTQEMAQ-----EV--

PF03487

F7DGH7_MACMU/16-144--LNGFCPH-K-VSA-------------------------------------------------GQFSSLR-----VR--
H0W834_CAVPO/2-134--LSGLCQH-K-ASA--------------------------------------------------GVSSLR-----SP--
I3MAR4_ICTTR/2-128--LSGLCTH-K-NTA----------------------------------------------------STVP-----IP--
G1SCQ2_RABIT/16-144--LSGLCTD-K-AVA-------------------------------------------------KQVTSVQ-----AR--
IL13_HUMAN/16-144--LSGFCPH-K-VSA-------------------------------------------------GQFSSLH-----VR--
IL13_RAT/2-130--LNGLCNQ-K-ASD--------------------------------------------------VASSPP---------
L5M5Z7_MYODS/2-128--LSALCPR-Q-PSA-------------------------------------------------GPASSPP-----VR--
G5ASP9_HETGA/2-130--LSSLCQH-R-AVA--------------------------------------------------KVSSFH-----NR--
L8YAP6_TUPCH/2-128--LNGLCTS-K-SSA-------------------------------------------------EQVSSLP-----TR--
IL13_BOVIN/2-130--LNALCPH-K-PSA-------------------------------------------------KQVSSEY-----VR--
IL13_MOUSE/2-130--LHGLCNR-K-APT--------------------------------------------------TVSSLP---------
F6WQF3_ORNAN/2-128--MQR--PQPP-PLS-------------------------------------------------LQVHCEV-----NQ--
G3T2N9_LOXAF/2-133--LSGACEQYK-APA-------------------------------------------------SQVSSLQ-----VR--
M3YGH3_MUSPF/2-126--LKSLCHQ-D-TSA-------------------------------------------------GQISS--------K--
B5FW67_OTOGA/2-129--LGGLCKQ-K-DLP-------------------------------------------------G-VPSSH-----IR--
IL13_CANLF/2-129--LKALCSQ-K-PAA-------------------------------------------------GQISSER-----SR--

PF00727

IL4_FELCA/26-131--LKGLDRNLS-SMA-------------------------------------------------NR-TCSV-----NE--
H0XDE1_OTOGA/26-149--LKGLDRNLC-SLA-------------------------------------------------NSRYCPV-----ND--
IL4_MOUSE/27-140--LQRLFRAFR-CLD-------------------------------------------------SSISCTM-----NE--
G3T4B8_LOXAF/26-132--LRGLSRSLS-SMT-------------------------------------------------NLDYCPV-----NE--
IL4_RABIT/28-143--LRGLDRNLC-SMA-------------------------------------------------KLSNCPG-----KE--
G5ASQ0_HETGA/25-138--LKKVYRNLR-SMV-------------------------------------------------QP-NCSV-----SE--
F6U5N6_HORSE/26-135--LSGLDRNLK-GMA-------------------------------------------------NGTCCTV-----NE--
IL4_BOVIN/26-133--LGGLDRNLN-SLA-------------------------------------------------SK-TCSV-----NE--
G3QSC0_GORGO/26-149--LKRLDRNLW-GLA-------------------------------------------------GLNSCPV-----KE--
A3FBF0_MUSPF/26-130--LRGLHRNLR-NMA-------------------------------------------------NM-TCSV-----NE--
IL4_RAT/27-139--LRKLCRGVS-GLN-------------------------------------------------SLRSCTV-----NE--
G3WEJ0_SARHA/28-149--LKKMCRNLM-HLV-------------------------------------------------NQTKCPV-----NE--
IL4_PIG/26-131--LSGLDRNLS-SMA-------------------------------------------------NM-TCSV-----HE--

PF00143

H8XX39_CHICK/27-182--QNGLYQQIE-KLE----------ACIIKKQTQY----FWSKEV-----------NRL-----KLKKYFQ-----KI--
I3N7K4_ICTTR/69-238--QSNLYEQVE-YLK----------QCWGKENKEKED--VKADEKKHSEA-GVLPLGNL-----KLRRYFS-----RI--
H0W3G0_CAVPO/26-185--HTVLHQQLE-VMK----------TCLVQVLREEGC--VLAIQN-----------PIL-----ALRRYFL-----GI--
H0W510_CAVPO/26-185--CTGLYELLK-ALQ----------ACLTQEAGLQEP--LLMHED-----------SRL-----AVRKYFH-----RI--
Q29098_PIG/26-180--CSGLHQQLE-DLD----------PCLVQEMEEQTS--ALG----------------M-----AVKRYFE-----GI--
G5E7E1_LOXAF/9-168--HSGLYLQLE-DLE----------ACLVQAMEEEES--VLAIES-----------SAL-----AVKRYFQ-----GI--
IFNE_MOUSE/27-185--LAALHRQLE-YVE----------SLGGLNAAQKSG--GSSAQN-----------LRL-----QIKAYFR-----RI--
G3I0H8_CRIGR/26-185--CTGLHQQLS-DLQ----------ACLMQQVGEQEP--PLSQED-----------SLV-----AVRKYFH-----RI--
H0VF99_CAVPO/28-187--TDELHQQMD-HLK---------STILQERLEDKNM--TMRDTM-----------TTL-----RLKSYYW-----RI--
L5KKJ7_PTEAL/25-192--QIGLHRQLQ-YLE----------QCLEEEEKENEDMKEMEEDESKYPGAMVSQLTNL-----ELKRYFH-----RI--
G1U0Q8_RABIT/26-185--HTALHQQLQ-GLE----------TCLVQAMGEEDS--VLTADS-----------PTL-----MLKRYFQ-----RI--
F6YZB3_ORNAN/25-183--LHGLHRQLE-ELE----------VCLEEDTDPSQA--SVGSGI-----------LRL-----RLKSYFR-----GI--
V8NNB8_OPHHA/15-183--HIGLDQQIK-MLE----------TCGNAELEQVIT--SPRNRKL--------QLTRL-----RIKRYFQ-----RL--
C8CKA7_PIG/26-185--CTGLDQQLR-DLE----------ACVMQEVGLEGT--PLLEEG-----------SIL-----AVRKYFH-----RL--
G3GXU9_CRIGR/27-182--LDKLYKQID-FLK----------KILKEMPKNESL--TTRD-S-----------TIP-----RLKSYYE-----RM--
H0XSG1_OTOGA/26-185--RSGLYQQLN-ELE----------ACLMQEVGVGEA--ALMNQD-----------SML-----AIRSYFQ-----RI--
G1KX99_ANOCA/25-184--HAGLDQQSE-NLK----------SCLSESPRSQRI--------Q---------LTRL-----KVKKYFR-----SL--
G3I0I6_CRIGR/27-185--LGALHQQLE-YVE----------LLAGLKAESKSG--GLSAQS-----------LRL-----QIKSYFR-----RI--
IFNT4_SHEEP/26-185--CTGLQQQLD-HLD----------TCRDQVMGEKDS--ELGNMD-----------PIV-----TVKKYFQ-----GI--
L8Y4J0_TUPCH/27-186--LIELHEQLD-YLE----------GLMELEAEQKND--ALDSED-----------RRL-----HVKKYFR-----RI--
F7B527_HORSE/26-183--LLGLYQQLD-DLE----------TCLGKETKVEQS--ALGSEI-----------STL-----AVKRYFR-----RI--
G1Q950_MYOLU/27-184--LEELDGQMD-RLE----------TALEEITKEGKF--PWEN-R-----------TVL-----RLKTYYL-----GI--
M3XCW7_FELCA/26-186--RSGLHRQLE-ALD----------ACLLQATGEGER--APGMHG-----------PVL-----AIKRYFQ-----DI--
G5CB66_HETGA/27-185--LVELHQQMD-SLK----------TLLQEILEKKDI--TWEDTM-----------IIP-----RLKGYYW-----RI--
L9L941_TUPCH/27-198--QMGLHQQVE-YLE----------QCLEEEENEN-DWEKMEEDEMEHSGAAVPQLGNL-----ELKRYFN-----RI--
D2H9N6_AILME/27-184--LEKIHWQIE-HLE----------EILEKIKEEENF--TWDD-R-----------TLL-----PLKRYYL-----RI--
D3Z919_RAT/26-179--CNYLYQQLK-DLE----------ACQNQQVGVQEV--PLTQEP-----------SWL-----AVREYFG-----RI--
C8CKB9_PIG/24-176--LSRLDHGLD-RLE------------------------QMEGDN-----------LACAYLGSVVRKYFQ-----RI--
A8E6F6_XENTR/27-179--QQLLYYQIH-QLE----------ACVSQTEENDLLKE-------------------------SISEEFN-----LL--
L8Y906_TUPCH/26-185--LAGLHQQLE-DLE----------TCLVQGVGEEPS--ALETDS-----------TTL-----ALRGYFQ-----GL--
L5KWM8_PTEAL/106-263--LTGLHRQLE-DLG----------ICLVPEMKEVES--ALGMED-----------PTL-----AVKRYFQ-----GI--
G3WZJ8_SARHA/27-182--LIGLDQQLE-QLE----------QCVGQEAEQEEP--SLGSEN-----------PIL-----VLKSYFQ-----GI--
G3UCD2_LOXAF/26-187--FAALDQQLN-DLE----------VCLMQETGVEETPVPVINED-----------SML-----AVRKYFQ-----RI--
K7GQJ6_PIG/17-164--CSGLHQQLE-DLD----------PCLVQVMGEQAS--SLG----------------M-----AVKRYFE-----RI--
G3I0H3_CRIGR/26-178--CDELHQLLS-DQQ----------ACLKQQVVMQ---------D-----------SLM-----AVRKYFH-----RI--
H0VYK7_CAVPO/28-181--LDKLHQQMD-RLK---------STILQERPEDTNM-------------------TTL-----RLKSYYW-----RI--
L5K635_PTEAL/26-185--LSGLHRQLE-DLG----------TCLVPEMKEVES--VLGTED-----------PTL-----AMKRYFQ-----GI--
W5JYQ9_ASTMX/23-179--LHIVFRLIE-ENK----------CVMSKTQDSLDD--FLKREA-------------------SLRAYFQ-----NI--
H0Y0D2_OTOGA/28-187--RTNLGWQLQ-ELE----------SCLMSLGEEEGT--PLMNQG-----------PTL-----AVRSYFQ-----RL--
IFN_ANAPL/34-190--LNQLQHHIH-HLE----------RCFPADAARLHRRGPRN--------------LHL-----SINKYFG-----CI--
G3UJX3_LOXAF/27-185--LAELSQQRD-RLV----------TILEESMEEENP--TSRNIM-----------TIL-----HLKNYYL-----GI--
G5C259_HETGA/26-185--CTGLHQQLS-DLE----------ACLTQEVGQEEV--PISHED-----------SRL-----AVRKYFH-----RI--
G3WZF5_SARHA/26-185--LNIIFQQME-HLE----------MALKEEMNQVNS--TRLNEE-----------SIQ-----HLNNYYQ-----RI--
IFNE_PIG/27-186--LVELHQQLE-YLE----------ALMRLQAEQKSD--TLCSEN-----------LTL-----QVKMYFQ-----RI--
W5N6G4_LEPOC/27-185--QGLLYRQIR-QLT----------LCAGSEMKFSGEPNRLGVSV-------------------VLKTSFA-----KL--
H9KYA4_CALJA/26-185--YTELYKQLN-YLE----------ACVMQRIGVEGT--PLMNAD-----------SIL-----AVRKYFE-----RI--
D2HTQ4_AILME/33-205--QIGLDQQLQ-YLE----------QCLEEEEKEKEDSKELEEDGMNWSGALVPQLSNL-----ELRRYFN-----RI--
IFNB_HUMAN/27-185--LANVYHQIN-HLK----------TVLEEKLEKEDF--TRGKLM-----------SSL-----HLKRYYG-----RI--
G1NR05_MELGA/32-188--LNQMQHYIH-HLE----------QCFVDQGTRSQKQGPRN--------------SHL-----SINKYFR-----SI--
F7BVP5_ORNAN/23-181--LHGVHKEMM-RLE----------VFLEEEMGWENS--TLRRD------------ISL-----HIKSYFK-----RM--
F7G875_MONDO/27-182--LSGIYQQML-HLE--------------EEMDQANS--SWESLE-----------SIL-----RLKNYYQ-----GI--
C8CKC3_PIG/33-205--QMGLDQQLQ-VLE----------QCLQEEEEENEDIKEMDEVERKPSGATVPPSHSL-----ELRRYFN-----RI--
F7A317_HORSE/26-184--YTGLYQQLT-ELE----------ACLSQEVGVEET--PLMNED-----------SLL-----AVRRYFQ-----RI--
G1KU56_ANOCA/28-182--KVGLKQEIA-KLT----------PCLSEDKQEIRE---------------------------DVKKYFE-----RI--
L5KBH2_PTEAL/26-185--LSGLHWQLE-DLG----------TCLVPEMKEAES--ALGMED-----------PAL-----AVKKYFQ-----GI--
L5K909_PTEAL/26-185--CTGLYQQLN-HLE----------ACQTQEVGTEET--PLLDED-----------STV-----AVRKYFQ-----RI--
I3N5Z0_ICTTR/23-179--LTDLHQQLE-YLE----------TLLGLEAEQKSH--AQGSKN-----------LRL-----QVKAYFR-----RI--
F7GHL9_MONDO/26-181--RIGLDHQLG-QLE----------SCLGQDAEWEVP--SLGSEN-----------PMM-----ALKSYFQ-----GI--
IFNE_HUMAN/27-186--LIQLHQQLE-YLE----------ALMGLEAEKLSG--TLGSDN-----------LRL-----QVKMYFR-----RI--
G3UK87_LOXAF/27-184--HNGLYQQLE-DLE----------TCSMQAVGEGSV---LAIEG-----------PVL-----AVKRYFQ-----EI--
L9LC61_TUPCH/27-185--LAQLFWQMD-HLE----------TMLEEKLEEENV--TWGNSM-----------SVM-----HLKSYYL-----RI--
IFNB_RAT/27-182--LDELHQQTE-LLE----------IILKEK-QEERL--TWVTST-----------TTL-----GLKSYYW-----RV--
H0XMZ9_OTOGA/27-186--LIELHQQLE-YLE----------ALTGLEAEQRSG--TVGIEK-----------LRL-----QVKMYFR-----RI--
G3VDC6_SARHA/27-182--LMGLDQQLE-QLK----------SCVGQEVEWKEH---LKSEN-----------PRI----QALQTYFQ-----GI--
I3JM36_ORENI/26-182--LNIVNKQAE-ELH----------SCIGSHSHKKKN-------------------SQLY---FKTEMYFK-----RL--
L5LKN9_MYODS/27-186--LIELHQQLE-YLE----------TLRGLQTDQKSS--TVGREK-----------LRL-----QVKMYFR-----RI--
G1TYS8_RABIT/29-195--QNGLYEQVA-YLE----------QCLMEDIHETKE------EEMKYSGTGRFLLNNL-----ELRKYFY-----RM--
I3UJJ8_FELCA/27-185--LTELHQQLE-YLE----------ELTGPEAEQDSC--ILGSEN-----------VRL-----QIKMYFQ-----RI--
C8CKA9_PIG/26-183--LSGLYQQLD-DLE----------KCLREGKKVEQS--PPGGEN-----------SIL-----AVKTYFQ-----GI--
IFNT2_BOVIN/3-162--CTGLQQQLE-DLD----------ACLGQVMEEKDS--DMGRMG-----------PIL-----TVKKYFQ-----GI--
M3Z729_MUSPF/26-183--CSGLSEQMS-HLE----------ACPLQEAGVEEK--PLVNRD-----------SIL-------RNYFQ-----RI--
IFNA1_MOUSE/26-185--CNDLHQQLN-DLQ----------GCLMQQVGVQEF--PLTQED-----------ALL-----AVRKYFH-----RI--
G3TTC1_LOXAF/26-185--LNGLPEQQE-DLE----------TCFMQAMEEGKS--ALPIEG-----------PAL-----AVKEYFE-----GI--
G1PDS6_MYOLU/29-199--QTGLDRQLQ-YLE----------QCLKEE-KGNEDKEEMEEDERRHPGARTPQPSNL-----ELRRYFH-----RI--
F7ABU5_MONDO/27-182--LIRLDQQLE-QLE----------RCLGQNVKWEEF--SLRSEK-----------TRF-----ALKSYFQ-----GI--
G1TTX4_RABIT/27-180--LGETHLQIH-HLK----------SKINKKV-------TLESIR-----------MNL-----RLKSYYW-----RI--
H0XRP5_OTOGA/26-185--RTGLYQQLN-ELE----------ACLMPDEGVEDT--APMGED-----------PVL-----ALRSYFH-----RI--
H0WK94_OTOGA/33-202--QMGLDKQLE-YLE----------QCLQEEENENAD---VKEAAMKYSGAQGPQVHNL-----ELRRYFN-----KM--
G1KYL3_ANOCA/23-176--HAGLDQQSE-NLK----------SCLSASPR------------I--------QLTRL-----RVKKYFR-----SL--
G3WZQ8_SARHA/26-181--LIGLDQQLD-QLE----------QCLGQDVEREEP--SLGSEN-----------PSL-----VLKSYFQ-----GI--
H0YTY6_TAEGU/34-188--LNKLQHHIH-HLE----------QCLPDNALLFKG--PRN--------------PLL-----TINKYFR-----DI--
I3MXH1_ICTTR/27-185--LSELHQQMD-LLN----------TTVVEKLGEENK--RQAYSM-----------IIL-----RLKSYYV-----RI--
M3WRV1_FELCA/26-184--CTGLDRQLT-RLE----------ACVVQEVGEGEA--PLTNED-----------SLL-------RNYFQ-----RL--
R4GKJ6_CHICK/35-191--LNRIHRYTQ-HLE----------QCLDSSDTRSRTRWPRN--------------LHL-----TIKKHFS-----CL--
A3FBE8_MUSPF/27-184--LATLHWQKE-HLE----------EILEDIMQEENV--TWDH-R-----------TLL-----HLKRYYL-----RI--
G1KWE0_ANOCA/28-180--HAGLDQQSE-NLK----------SCLSASPRSQRI--------Q---------LTSL-----RVKRYFR-----SL--
G7PS89_MACFA/26-185--YIELDQQLN-DLE----------SCVMQEVGVTET--HLMYED-----------SIL-----AVKKYFR-----RI--
G1Q880_MYOLU/26-185--RSGLHRQLE-DLE----------ACLVEEMGEEGS--ALAMEG-----------PTL-----ALKRYFQ-----GI--
IFNB_MOUSE/27-180--LDELHQQTV-FLK----------TVLEEK-QEERL--TWEMSS-----------TAL-----HLKSYYW-----RV--
IFNB2_BOVIN/27-184--LEELYEQMN-HLE----------PIQKEIMQKQNS--TMGD-T-----------TVL-----HLRKYYF-----NL--
G1SJC4_RABIT/26-185--CTGLFEQQS-DLE----------VCMMQGAGAEEM--PLKHED-----------SAW-----AVRKYFQ-----GI--
W5PG31_SHEEP/26-185--CAALDQQLT-DLQ----------ACLRQEEGLRGA--PLLKED-----------SSL-----AVRKYFH-----RV--
IFNA3_CANLF/26-183--CSGLSEQLD-DLD----------ACPLQEAGLAET--PLMHED-----------STL-------RTYFQ-----RI--
G5BPX2_HETGA/27-199--KSELAEQRE-YLE----------QCLKEEKKENKGMQEMKTHELEHSGVQVVQQSKL-----ALRGYFQ-----RI--
IFNW2_HORSE/26-185--CTGLLRQLE-DLD----------TCLEQEMGEEES--ALGTVR-----------PTL-----AVKRYFR-----GI--
G3N2A8_BOVIN/26-185--HTGLHQQLD-DLD----------ACLGQVMGEEDS--ALGRMG-----------PTL-----AMKRYFQ-----GI--
H0XKS8_OTOGA/27-185--LANFHQQMD-SLE----------TTLDEKLEDKNF--IGGKVT-----------NIL-----HLKSYYF-----RI--
A0A286X8P0_CAVPO/26-185--CDALRDQMN-DLK----------ACLTKETGLEDP--SLWHED-----------SRN-----AVKKYFH-----GI--
Q29412_PIG/27-184--LVELDGQMD-DLE----------TILEEIMEEENF--PRGD-M-----------TIL-----HLKKYYL-----SI--
G7PS88_MACFA/26-185--CTELYQQLN-DLE----------ACVMQQERVGET--PLMNAD-----------STL-----AVKKYFR-----RI--
M3WZS7_FELCA/26-181--LVGLYQQLD-DLE----------TCLREEMNMEQL--PLGNEN-----------SRL-----AVKRYFQ-----GI--
H9GZR7_HORSE/26-185--LTGLHQQLE-DLN----------TCLDEQTGEEES--ALGTVG-----------PTL-----AVKRYFR-----RI--
F1LVL8_RAT/26-184--LAALHRQLG-YLE----------SLGGLKAERKSG--GLSVKD-----------LRL-----QIKAYFR-----RI--
M3YX13_MUSPF/27-179--LTELHQQLE-YLG----------ALRGLGAEQNSG--VLSGGN-----------SRM-----QVKKYFR-----RI--
G1L8G2_AILME/26-185--LAGLHQQLE-DLE----------TCLEEEKNVEQL--LLGSEN-----------SRL-----AVKRYFH-----GI--
IFNB_HORSE/27-184--LVEVHLQMD-RLE----------TNLEEIMEEESS--TWGN-T-----------TIL-----RLKKYYG-----RI--
H0W289_CAVPO/26-190--HSLLYQQLE-AMK----------ICMVQEAGGEES--ALATED-----------LTLNHSWRTLMKYFQ-----GI--
A8E6E8_MONDO/27-182--LIGLDQQIE-QLE----------RCLTQDVEQDEP--SLGREN-----------PLM-----ALKNYFQ-----GI--
I3N788_ICTTR/27-185--LVELHQQMD-LLE----------TILEKKLGEENK--SWGNSR-----------TIL-----HLKSYYW-----RI--
G1L8I1_AILME/26-183--CSGLSEQLS-VLE----------ACPMQAAGVGET--PVRNVD-----------SIL-------RNYFQ-----RI--
IFNB_FELCA/27-184--LATLHWQKE-HLE----------TILEEIMEEENF--TWDN-T-----------TLL-----NLKKYYL-----RI--
G3TS29_LOXAF/26-179--LLGLYQQLN-DLE----------ICFEKERKVEQI--PLGTEN-------------------SVKSYFQ-----GI--
W5PZ39_SHEEP/26-184--QIGLDHQLQ-YLE----------QCLEEEER------------PSGA--PVLQPSNL-----ELRRYFN-----RI--
G3I0H6_CRIGR/26-178--CNSLLQQFN-ALK----------ACLMHQVGMQ---------D-----------SQV-----AMKNYFD-----RI--
M3Z715_MUSPF/26-183--CSGIYQQVN-DLQ----------ACLMQEAGVEEM--ALVNGD-----------SIL-------RNYFQ-----RI--
M3VXI8_FELCA/33-205--QIRLDWQMH-HLE----------KCFEEEEKGKEDSKQREEDGMDFSGAMVSQVSSL-----ELRRYFY-----RM--
G3R8Q7_GORGO/26-185--HTGLHQQLQ-HLE----------TCLLQVMGEGES--AGTIRS-----------PAL-----TLRRYFQ-----GI--
A8E6F5_XENTR/51-202--QQLLYYQIN-QLE----------ACIPETAENPVFNQ-------------------------TISDQYQ-----AL--

PF02947

FLT3L_MOUSE/30-162--LEDVNTEIH-FVT----------SCTFQPLPECLRFVQTNISH-----------LLK-----DTCTQLL-----AL--
F6T7S9_ORNAN/28-157--VHKVQAEVD-FVN----------DCGFQRPQKCARFQQINISQ-----------FLG-----DVSQHLT-----SL--
H9GP84_ANOCA/29-165--IRKLMIHTT-FVE----------MCDIN--DSCVKFITTNISE-----------FLE-----PIPSYLS-----DL--
F6TPW7_MONDO/34-163--LDKVCTEIS-FVR----------KCFSEALPGCLHFRKANISH-----------LLL-----DISSHLE-----AL--
G5B8P0_HETGA/20-150--LETVDTEIH-FVT----------SCAFQPLPSCLRFVQTNISH-----------LLQ-----DTVAQLE-----AM--
G1M637_AILME/29-159--LEAVNTEIH-FVT----------LCALQPLPSCLRFVQTNISH-----------LLQ-----DTSKHLA-----AL--
L9JA37_TUPCH/769-910--LEKVNTEIH-FVT----------SCDFQPLPSCLRFVQTNISD-----------LLQ-----DTSAQLL-----AL--
G3VSA3_SARHA/79-209--LEAVYAEID-FVG----------QCVNQSFPSCLRFRKANISH-----------LLL-----EVSNHLG-----AL--
G1QZC3_NOMLE/30-160--LERVNTEIH-FVT----------KCAFQPPPSCLRFVQTNISR-----------LLQ-----ETSEQLV-----AL--

PF00714

I3MNV6_ICTTR/15-152--YFKLFEHLT-DNK----------IIQGSINTIRED---------------------------LSAKFFNSNCI-KR--
IFNG_HORSE/15-152--YFKLFENLK-DNQ----------VIQKSMDTIKED---------------------------LFVKFFNSSTS-KL--
H0WPL1_OTOGA/15-151--YFKLFEQHK-DNQ----------TIKKSIETIKEE---------------------------IIAKFFNSSYS-KA--
Q8CGS0_CAVPO/15-154--YFKLFEKHFTDNQ----------TVQNSMNTIKEQ---------------------------IITKFFKDNSSNKV--
B9VS86_CALJA/15-152--YFKLFKNFK-DNQ----------SIQKSMETIKED---------------------------MNVKFFNSNKR-KQ--
G3SUC6_LOXAF/15-152--YLKIFDNLK-DNQ----------VIQESVKTLEED---------------------------LFVKFFNSSSS-KR--
G3GY20_CRIGR/2-135--YFKLFEALK-DNQ----------AIQRSIDTIKAD---------------------------LFANFFNSSME-KL--
L5LME8_MYODS/15-153--YFKLFENIE-DNK----------TIQNSLDIIKEE---------------------------LRVKVFNSSNS-KM--
G5BGB5_HETGA/15-152--YFKLFEKSG-GNQ----------IVQKSMDTIKED---------------------------IIAKFFHSNSS-KL--
G3WQJ9_SARHA/15-153--YFKIFEIFK-NNS----------IVKRSMEHIRED---------------------------MIMKLFPNNTASSV--
IFNG_SHEEP/15-152--YFKLFENLK-DNQ----------VIQRSMDIIKQD---------------------------MFQKFLNGSSE-KL--
IFNG_RAT/14-151--YLRLFEVLK-DNQ----------AISNNISVIESH---------------------------LITNFFSNSKA-KK--
IFNG_RABIT/15-152--YFKLFDNLK-DHE----------VIKKSMESIKED---------------------------IFVKFFNSNLT-KM--
L9KVU0_TUPCH/51-188--YFKLFESFK-DNQ----------VIKKSVDIIKED---------------------------MIDKFFNSSPT-KL--
IFNG_FELCA/15-153--YLKMFENLKDDDQ----------RIQRSMDTIKED---------------------------MLDKLLNTSSS-KR--

PF02372

IL15_PIG/33-160--IILANSSLS-S------IE---YKTESGC-----------------------------------KECE------EL--
IL15_CAVPO/33-160--IILANSSLN-S------NG---NVTESGC-----------------------------------KECE------EL--
IL15_FELCA/33-160--IILANSGLS-S------NR---NITETGC-----------------------------------KECE------EL--
IL15_SHEEP/33-160--TMLADRNLS-S------IE---NKTELGC-----------------------------------KECE------EL--
F1NZN5_CHICK/55-183--LKNGNARFA-TYQ----LN---STTSKKC-----------------------------------KECE------EY--
G1NDP6_MELGA/5-137--LQNIKKNLH-RLK----DL---SPTGGEC-----------------------------------KICE------AN--
O73883_CHICK/5-138--IQNIEKNLK-SLT----GL---NHTGSEC-----------------------------------KICE------AN--
Q8JFF4_ANAPL/4-134--VRNIKMNLQ-KLM----DL---IPPGTGC-----------------------------------NICE------A---

PF00715

I3MQX6_ICTTR/7-151--TRNFISNIN-VTV----LK---LKGSATT-----------------------------------FTCEY-----AQ--
G5C793_HETGA/7-149--TKDFISNIN-VTV----WK---LKGSKTT-----------------------------------LKCDL-----ND--
G1PJ32_MYOLU/7-147--ITELMSNVN-VLV----QN---LKGPKTR-----------------------------------FECDY-----DD--
B1AB81_HORSE/7-146--IKELMSNIN-VTV----LG---LKGSETR-----------------------------------FTCEY-----DD--
G3HTL8_CRIGR/7-150--TENFISNIR-VTV----VK---LKGSENT-----------------------------------FTCEF-----DD--
IL2_MACMU/7-151--TKDLISNIN-VIV----LE---LKGSETT-----------------------------------LMCEY-----AD--
H0Y254_OTOGA/7-149--TREVIGNIN-VTV----LE---LKGSET------------------------------------FICE------DN--
IL2_MOUSE/7-165--AENFISNIR-VTV----VK---LKGSDNT-----------------------------------FECQF-----DD--
G3SU90_LOXAF/7-147--TRELISNIN-VTA----LE---LQGSETT-----------------------------------FMCEY-----DD--
IL2_PIG/7-151--IKESMNNIN-VTV----LE---LKGSETS-----------------------------------FKCEY-----DD--
IL2_FELCA/7-151--IKELMSNIN-VTV----LK---LKGSETR-----------------------------------FTCNY-----DD--
L5K7D9_PTEAL/7-149--IKESVSNIN-VTA----QK---LKGPETK-----------------------------------YTCVY-----ND--
IL2_BOVIN/7-152--IKDSMDNIK-RIV----LE---LQGSETR-----------------------------------FTCEY-----DD--
H0VBY4_CAVPO/7-149--TKDFISNIN-VTV----LS---LKGSETA-----------------------------------FVCDL-----ED--

PF01415

M3WJR8_FELCA/15-127--NRLKR-NVK-DLK----SS---KCQFFSC----------------------------------EQPCNQ-----TA--
H0X0U6_OTOGA/15-141--NRVKK-TVA-ALK----NN---KCPFFSC----------------------------------EQPCNQ-----TT--
G1QNL2_NOMLE/28-172--LKVSEGTTI-LL---------------NCTGQVKGRKPAALG------EAQPTKSLE-----ENKSLKE-----QK--
IL7_BOVIN/28-171--STVSQGTLT-LL---------------NCTSKGKGRKPPSLS------EAQPTKNLE-----ENKSSKE-----QK--
F1PA23_CANLF/29-154--SRVSQGTLQ-LL---------------NCTP------------------------KE-----DNKSLKE-----QR--
IL9_MOUSE/15-141--HRVKR-IVE-VLK----NI---TCPSFSC----------------------------------EKPCNQ-----TM--
U3KN10_RABIT/31-153--ERVSKGTLT-LV---------------NCTG------------------------KE-----EKKPLKD-----QK--
K7E262_MONDO/59-200--EVYSHHALG-ILK----GC---KCDEVNGTEKKAGGPCF--F------VENDPNKNP-----GEKSAKE-----QK--
E1BF10_BOVIN/18-141--NQLKK-IVV-TLK----SN---KCGSFAC----------------------------------EQPCNR-----TT--
F6PLW3_HORSE/15-136--NRVKK-TVA-ALK----NN---KCQLFSC----------------------------------EQPCNQ-----TT--
IL9_HUMAN/15-141--SRVKK-SVE-VLK----NN---KCPYFSC----------------------------------EQPCNQ-----TT--
IL7_MOUSE/28-151--LTVSQGTQT-LV---------------NCTS-------------------------K-----EEKNVKE-----QK--
G5BX09_HETGA/15-141--NQVKR-TVE-VLK----NN---KCPSFSC----------------------------------EQPCNQ-----TT--
L8Y4N8_TUPCH/15-141--YKVKR-TVQ-GLK----NN---KCPFFSC----------------------------------EQPCNQ-----TT--
D4A8I9_RAT/15-141--FRVKR-IVE-TLK----SN---KCQFFSC----------------------------------EKPCNQ-----TT--
G3TKQ6_LOXAF/16-136--NRVKK-TVE-DLQ----RK---NCRTFSC----------------------------------EQPCNQ-----TT--
M3YEX7_MUSPF/16-137--NRVKR-TVQ-DLK----KN---KCQFFSC----------------------------------EQPCNQ-----TT--
G1NXN3_MYOLU/28-153--SIVSQGTLK-LL---------------NCTR------------------------KE-----EKKSSKG-----QK--

PF00103

PLRP1_BOVIN/26-238--TRFENMSEK-LQA----FI---ERQFSKI---IVPVLNTMIQ------ARSSWTGLP-----SLMSSDE-----DR--
CSH2_BOVIN/26-238--MEIENMSEK-LQA----FI---ESQFRKI---IVPVLKMIHE------VSDTWSRFS-----SMTFSDE-----DR--
PLRP3_BOVIN/1-213--KENMRKIEE-LQA----FI---ERQFSQV---IYPVIRTIFK------ARIYWSGLA-----SLVSNDE-----DV--
PR4A1_RAT/17-227--LMLKESNIK-LLD----AI---KNIAKKG---NF--EINEKA------NYTAWSELG-----FLQSPNR-----DT--
CSH1_BOVIN/26-236--KEIEDKTKV-LLE----GV---EMIQKRV---H-PGEKKNEP------YPVWSEKSS------LTADDE-----DV--
PLRP4_BOVIN/26-239--RENVKKLKE-LQA----LI---ERPFSQV---IFTARRKMYI------ARIYWFGLR-----SLLSSNE-----DR--
PR3D4_RAT/16-223--VDMKDKNLI-ILE----GL---QKIFNRT---QTKVEENENF------DYPAWSGLK-----DLQSSDE-----DT--
PR2C2_MOUSE/16-224--TDIKKKINA-VRN----GV---NALMSTM---LQ--NGDEEK------KNPAWFLQS---------DNE-----DA--
SOM2_HUMAN/9-215--SNVYRHLKD-LEE----GI---QTLMWRL---EDGSPRTGQI------FNQSYSKFD-------TKSHN-----DD--
PR8A5_RAT/17-238--KDLEENNRQ-LLD----DL---RWILTKV---F--PTAEIKE------EFPSWDYLS-----FLKSSNK-----NH--
PR6A1_RAT/20-234--KNIEEKIKE-LMD----VL---KGILNKI---Q--PGSPQNE------RFPMWNELA-----YLRSPDE-----ER--
PR7D1_MOUSE/17-240--EAIEAKNKD-LLE----YI---IRIISKV---N--PAIKENE------DYPTWSDLD-----SLKSADK-----ET--
CSH2_HUMAN/9-215--SDDYHLLKD-LEE----GI---QTLMGRL---EDGSRRTGQI------LKQTYSKFD-------TNSHN-----HD--

PF01109

CSF2_RAT/18-139------TKLNG-ALT----MI---ASHYQTNCPPT-----------------------P-----ETDCEIE-----VT--
CSF2_MOUSE/18-136------TKLKG-ALN----MT---ASYYQTYCPPT-----------------------P-----ETDCETQ-----VT--
CSF2_BOVIN/18-138------TSLMG-SLT----MM---ATHYEKHCPPT-----------------------P-----ETSCGTQ-----FI--
CSF2_CAVPO/18-140------TRLEG-SLT----LM---ANFYKQHCPPT-----------------------P-----ETSCMTQ-----II--
CSF2_PIG/18-139------TRLKS-PLT----LL---AKHYEQHCPLT-----------------------E-----ETSCETQ-----SI--
CSF2_HUMAN/18-139------TKLKG-PLT----MM---ASHYKQHCPPT-----------------------P-----ETSCATQ-----II--
CSF2_CANLF/18-139------TSLKN-PLT----MM---ANHYKQHCPPT-----------------------P-----ESPCATQ-----NI--

PF02025

I3MDT8_ICTTR/22-133------ERLFQ-NLS----LM---KKYIDIQ---------------------------------KKKCGQE-----RR--
G1RQD7_NOMLE/22-133------ERLFK-NLS----LI---KKYIDGQ---------------------------------KKKCGEE-----RR--
IL5_CAVPO/23-134------ATLFQ-NLS----LI---KKHIDLQ---------------------------------KQKCGEE-----RR--
J9NWP5_CANLF/22-132------DKLFQ-NLS----LI---KEHIERQ---------------------------------KKRCAGE-----RW--
IL5_MOUSE/21-132------EMLFQ-NLS----LI---KKYIDRQ---------------------------------KEKCGEE-----RR--
G3WAR7_SARHA/25-134------ERIFQ-NFS----SL---KEHITTK---------------------------------EKQCGGE-----RR--
IL5_HORSE/22-133------AKLFQ-NLS----LI---KGYIDLQ---------------------------------KKKCGGE-----RW--
B5FW65_OTOGA/22-133------EQLFQ-NLS----LI---KKYIDRQ---------------------------------KKRCGEE-----RR--
G3T4B0_LOXAF/23-133------GKLFK-NLS----LL---KEYIDLQ---------------------------------KKKCGGE-----RR--
G1SL79_RABIT/22-133------DNLFQ-NLY----LI---KKYIDLQ---------------------------------KKKCGEE-----RR--

PF02059

IL3_CANLF/19-132------LLIWN-NLK----EF---LPLLPTPT--P-----------------------R-----GEPISIM-----EN--
IL3_MOUSE/27-138------YVIKS-NLQ----KL---NCCLPTSA--N-----------------------D-----SALPGVF-----IR--
IL3_BOVIN/18-132------SKIMK-NLK----EF---QPVLPTAT--P-----------------------T-----EDPIFIE-----NK--
G3UC30_LOXAF/22-133------SSISK-NLR----KF---HPCLPKAK--P-----------------------Q-----TASIVI------QN--
G1MH15_AILME/18-131------SLIWK-NLK----EF---LPLLPTPT--P-----------------------R-----GQPISI------EN--
G1RQ11_NOMLE/20-137------SAIES-ILK----NL---PPCLPMATAAP-----------------------T-----RHPIRIK-----DG--
IL3_CALJA/19-136------AAIES-NLK----DL---PVCLPTATNAA-----------------------T-----QHPIRIK-----DG--
F1LS41_RAT/29-138------MDIKS-KLQ----KL---KCCIPAAA--S-----------------------D-----SVLPGVY-----NK--

PF00758

H0W023_CAVPO/30-191TLQLHLDKAVS-GLR----SL---TSLLHLLGAQKAPILPPDA-AS----PAPLRTFPV-----DTLCKLF-----QV--
G3TYQ1_LOXAF/25-173LEQL--SGQVR-LL------L---GALQGLLGTQL----PPQG-----------RTTAH-----KDPNAIF-----PE--
W5K758_ASTMX/26-175-LHSHIDASVR-NIA----SI---GQVLRSLSIQD---YVPTV-SG----IDLQETWQV-----SSAPELF-----QV--
B1N8Y2_DANRE/15-168-LQSHIDASIR-NIA----SI---RQVLRSLSIPE---YVPPT-SS----GEDKETQKI-----SSISELF-----QV--
F7DTH0_CALJA/31-193PLQLHMDRAVS-GLR----SL---TTLLRALGAQKEATSPPDAAPS----AVPLQTITA-----DTFSKLF-----QV--
M3XJ62_LATCH/27-177-TVYHITKSYS-NTR----ST---AQILKRLHTQE--IPVPDS--------PPQKTVVV-----RTLGELF-----HI--
G3W289_SARHA/30-190ALKLFVDKAVS-SLR----SL---RFLLRGLGTQEEAIFVPNA-PT----AVPLRTFTV-----GTMDKLF-----RI--
F6WUU2_MONDO/31-191ALKLFVDKAVS-SLR----SL---RFLLRGLRTQEETVSLPDA-PT----AAPFRTFTV-----GTMDKLF-----RI--
G3VW20_SARHA/26-175VLSLCRSGWAG-DM------I---SGLGPVLCPQS----LPKG-----------QTAAH-----REPTAIF-----LS--
G1PF99_MYOLU/45-207TLQLHVDKAIS-GLR----SL---TSLLRALGSQKEAISLPDATAS----AIPLRTFTV-----DTLCKFF-----RI--
TPO_CANLF/25-176LGQL--SGQVR-LL------L---GALQGLLGTQL----PPQG-----------RTTTH-----KDPNAIF-----LS--
F7G570_MONDO/26-177LGQL--SAQTH-SL------L---GALQGLLGTPS----LPKG-----------QTIAH-----REPTAIF-----LS--
H2LEX3_ORYLA/33-182-LNNHIDNTAR-NLV----SI---NAVLRSLNFQE---YTPPA-NA----SSLDGTWTV-----SSATELL-----QV--

PF00726

IL10_BOVIN/5-174NHGPDIKEHVN-SLGEKLKTL---RLRLRRCHRFL--------PCE----NKSKAVEKV-----KRVFSEL-----QER-
IL10H_EBVB9/7-167NQDPEAKDHVN-SLGENLKTL---RLRLRRCHRFL--------PCE----NKSKAVEQI-----KNAFNKL-----QEK-
G3HB01_CRIGR/14-174NHGPEIKEHLN-SLGEKLKTL---RRQLQRCHRFL--------PCE----NKSKAVEKV-----KSDFNKL-----QEK-

PF14565

IL22_HUMAN/40-178RFQPYMQEVVP-FLA----RL---SNRLSTCHIEG--------DDL----HIQRNVQKL-----KDTVKKL-----GES-
E1C1U2_CHICK/46-184ERYPYAEDVAQ-FLA----SL---TSELSRCKYSG--------NRE----HIEKNLEEM-----KSKMKEL-----GEN-

PF15177

I3MK89_ICTTR/29-189TLGDVLDQPLH-TLG----HI---QSQLQACAPAQPTAGPR--PQGRHRHRLSHWLQRL-----QQAPEKE-----SP--
H0VBN4_CAVPO/32-188ALGDVLEQPLH-MLR----HI---HAQLQACVPTLRTAAPR--PVS---RRLSHWLQRL-----NQASKKA-----SP--
IFNL3_CHICK/28-182RLAETCQQPLA-FLT----QV---QEDLRDCLALE---APSHQPSG----KLRHWLQKL-----KTAKKKE-----TA--
F1M3K4_RAT/31-188ALVTILGQPLH-TLS----HI---HSQLQTCTEPQPTAEPT--PQS---RLLSRWLHRL-----QEAQNKE-----TP--
F1PY54_CANLF/31-186SLGVTLDQPLR-TLH----HI---HSELQACVPAQPTADPR--PHG----RLHHWLHRL-----QKAP-KE-----SQ--
H0XRJ1_OTOGA/35-191ALRDVLDQPLH-TLR----HI---QSQLQACGSAQPTAGPM--PRG----RLRNWLHRL-----QKAPKKE-----SP--
F6PNH9_HORSE/31-184SLADILDRPLH-TLR----HI---HSELQACVPARPTAGPG--PRG----RLHQWLRQL-----HEVQKK------SW--
D2DJP5_XENTR/23-178PLAKLLSLPLT-MLL----SL---EDDLKICRKSPLYSDP---PSE----QLMPWLHHL-----KHFREKV-----SS--
G3TQK4_LOXAF/32-188ALGAVLDQPLH-TLH----HI---HSKLRACVSAQPTSGPR--PQS----RLHRWLHRL-----QKATKKE-----SQ--
F7DXI8_HORSE/34-187SLGDVLDQPLG-TLS----HI---HSELQACVAAQPTEGPR--PRG----RLHQWLHRL-----HKAPKKE-----PW--
F6W920_MONDO/30-184ELQDVLIQPLQ-TLS----HI---YREIQSCVTPLPSRGHR--LPG----RPNNWLHRL-----TEA-GKE-----SQ--
U3KED0_FICAL/27-186SFAEVRRRPLE-FFA----QA---REDVRGCVSACPSVDPAHQPSG----RLRHWLHKL-----QAAMRTE-----SPES
IFNL4_HUMAN/25-174ELLPGAGPILE-LLA----AA---GRDVAACLELARPGSSRKVPGA----QKRR----------HKPRRAD-----SP--
IFNL2_MOUSE/32-189ALATILGQPLH-TLS----HI---HSQLQTCTQLQATAEPR--SPS---RRLSRWLHRL-----QEAQSKE-----TP--
G3N0M3_BOVIN/37-192SLGHSLEQPLL-TLQ----NI---HSKLQACVPAQPTASSR--PRG----RLHHWLHRL-----QEA-RKE-----SQ--
G1LPU9_AILME/37-191SQGGILDQPLH-TLR----HI---HSELQACVEAQPTAGPQ--PRG----RLHHWLHRL-----SEASKKE-----SQ--
L5LZZ9_MYODS/163-319TLGDILDQPLH-TLH----HI---HSKLQACAPAQATAGPR--PRG----LLRQWLHRL-----WEAGKKE-----SQ--
IFNL3_HUMAN/34-192ALGDVLDQPLH-TLH----HI---LSQLRACIQPQPTAGPR--TRG----RLHHWLHRL-----QEAPKKE-----SP--
F6R8C9_XENTR/23-177PLSEFVSQPLE-FFR----SL---EDDLKHCRKSPLYSDP---PSQ----QLMPWLNHL-----KHFRERV-----SS--
G3VJ97_SARHA/12-167ELDSVLAQPLQ-TLS----HI---HQEIQSCVTSQTSKEHK--LPG----RLKNWLNKL-----SEA-RKE-----PQ--
H0XJU8_OTOGA/36-192ALRDILDQPLH-TLR----HI---QSQLQACGRVQPTAGPR--LRG----RLRNWLHQL-----QEAPKKE-----SP--
G3HJD0_CRIGR/30-187ALYPILEQPLH-TLS----NI---HSQLQACIQPEPAAEPR--PPS---HRLSRWLHRL-----REAQEKE-----TP--
G1LPW2_AILME/34-190SLGDILDQPLH-TLG----HI---HSELQACVEAQPPAGPR--PRG----RLQHWLHRL-----HEAPKKE-----SL--
L5L378_PTEAL/33-182SLGDILDQPLH-TLR----HI---HSELQACVSPQPTASPR--PHG----RLHHWLHRL-----QKAPKKV-----SQ--
G1T4B0_RABIT/34-188ARGHVLEQPLR-TLR----HI---HTQLRG-LSPQQTASAHHPPVP----KRRGRLHPLATPGSQEAPKKE-----AP--
U3IYH6_ANAPL/34-185KLAEKSQQPLA-FFT----QA---REDLRGCVAAE---APSHQPSG----KLRHWLQKL-----ETAKKTE-----TA--
L9LBW1_TUPCH/31-181ALGDVLDQPLH-VLR----HI---HSLLQACVPAQ--------PQG----HLPSWLLQL-----QEVEKKK-----SP--
D0FHA1_PIG/36-191SLHSSLDQPLH-TLR----HI---HAQLQACVPAQPMAGPR--PRG----RLHHWLHRL-----QEAQKKE-----PQ--

PF05337

CSF1_HUMAN/41-180-------IAIV-QLQ----EL---SLRLKSCFTKDYEEHDKACVRT----FYETPLQLL-----EKVKNVF-----NE--
Q3TLQ6_MOUSE/41-180-------NATE-RLQ----EL---SNNLNSCFTKDYEEQNKACVRT----FHETPLQLL-----EKIKNFF-----NE--
O77709_BOVIN/41-180-------KVIV-QLQ----EL---SLRLKSCFTMDYDEQDKACVRT----FHETPLQLL-----EKIKNVF-----NE--
O77710_BOVIN/41-180-------KVIV-QLQ----EL---SLRLKSCFTMDYDEQDKACVRT----FHETPLQLL-----EKIKNVF-----NE--
Q64129_9MURI/41-180-------NATE-RLQ----EL---SNNLNSCFTKDYEEQNKACVRT----FHETPLQLL-----EKIKNFF-----NE--

PF15036

IL34_MOUSE/28-184S-WKYLQEVQT-LLE----NV---QRSLMD---------VEIGP------HVEAVLSLL-----STPGLS----------
R4GIU3_CHICK/19-177S-RGYTQELSQ-LLD----ALGVEYSGYRQ---------SDVDA------VVADLVKQL-----HSGDSR----------
F7EA00_CALJA/29-185S-WKYLQEVQT-LLL----DV---QRGLTD---------VEVSP------KVESVLSLL-----NAPGPN----------
H0WFN4_OTOGA/28-184S-WSYLQEVQR-LLL----DV---HQGFKD---------MEVSP------KVEAVLSLL-----NAPGLS----------
M3ZVZ0_XIPMA/24-191S-RPYTAELER-RFR----DA---EGVFVQ-SHPAEVFQQELPE------TIQDIWDQL-----TEEPDRV-----PESS
U3JY35_FICAL/18-179S-WKYTQELCQ-LFD----ALGEEYSKYRQ---------TDVET------VVADVVKLI-----HSAGAE--------SR
L9KJY3_TUPCH/28-184S-WQYLQDVQT-LLQ----NV---QEGLTD---------VEVSP------KVEAVLSHL-----NTPGLI----------
G3T3A6_LOXAF/28-182S-WKYLDEVQT-LLV----TI---QQGLMD---------VEASP------EVEAVLSLL-----SAPG------------
F6W3U1_MONDO/15-167S-RNYIKEIHE-LLI----YV---QEIAKD---------LQVHP------QVEKILTLA-----NS-GRD----------
I3JZ08_ORENI/24-192S-RPYTAELER-RFK----DA---QAVFMQ-SHPAQVFQEDLPE------KIHDIWDSL-----TEKPENM-----PESS
L5MCR9_MYODS/28-182S-WKYLKDIHS-LLV----DV---QQALGD---------VKLSP------PVDAVLSLP-----SDRRLS----------
B3DLJ8_DANRE/23-195TRRKYLSDLEN-LFK----KF---ETVFKEGNHEDQENVRERPE------SLQTIWDHL-----TEQDYK---------G
IL34_BOVIN/28-183S-WKYLEEVHT-LLL----DV---KQGLGG---------VEVSP------QVEAVLNLL-----SAPG-S----------

PF02404

R4GD07_ANOCA/1-283EFFKHFSNTVE-SYK----IL-AKTPVQSDCVLPSTTETPPNDSRL----SVTKSFLSY-----PFAASHL-----KNDS
SCF_CHICK/1-287NFFRLFNSTIE-VYK----EF-ADSLDKNDCIMPSTVETPENDSRV----AVTKTISFP-----PVAASSL-----RNDS
SCF_RAT/1-273EFFSIFNRSID-AFK----DF-MVASDTSDCVLS-STLGPEKDSRV----SVTKPFMLP-----PVAASSL-----RNDS
G1NWC8_MYOLU/1-272EFFRIFNRSIN-AFK----DLEMVSSKTSECVFS-STLSPGNDSRV----SVTKPFMLP-----PVAANSL-----RNDS
F7EP53_MONDO/1-273DFFRFFNKSID-AFK----EY-EETSEHSNCVLP-STIGPERDSRV----NVTKPFLLP-----PVAASSL-----RNDS
F7C5I3_ORNAN/1-273EFFGYFNRSIE-AFR----DF---QAEHSDCIFPTTTLMPEKDSRV----SVTKPFLLP-----PVAASSL-----KNDS
F7G0W2_CALJA/1-273EFFRIFNRSID-AFK----DF-VVASETSDCMAS-STLSPEKDSRV----SVTKPFMLP-----SVAANSL-----RNDS

PF00489

M3X721_FELCA/44-225--------------------------------------LRRLEDFLQFSLRAV------RIM------------------
IL6_BOVIN/27-208--------------------------------------LRNLENFLQFSLRAI------RMK------------------
IL6_HORSE/27-208--------------------------------------LRSLEDFLQFSLRAV------RIM------------------
G3UHF3_LOXAF/20-205--------------------------------------LRSLDDFMQFSLRAV------RIM------------------
L5KPK4_PTEAL/20-202--------------------------------------LRSLEDFLQFTQRAV------RIM------------------
F7HV62_CALJA/27-212--------------------------------------LRSFKDFLQNSLRAL------RQM------------------
IL6_MOUSE/26-210--------------------------------------LKSLEEFLKVTLRST------RQ-------------------

PF16647

CSF3_BOVIN/42-190--------------------------------------ASQLHRFLELAYRGL------R--------------------
CSF3_HUMAN/51-202--------------------------------------ASHLQSFLEVSYRVL------R--------------------
CSF3_MOUSE/57-205--------------------------------------ISYLQGFLETARLAL------H--------------------

PF16649

IL23A_MOUSE/28-185--------------------------------------LRSLQAFLAIAARVF------AHGA-----------------
F7HQI5_MACMU/28-184--------------------------------------LRSLQAFVAVAARVF------AHGA-----------------
F1MSN4_BOVIN/35-192--------------------------------------LRSLQAFVAVAARVF------AHGA-----------------
IL23A_CAVPO/28-184--------------------------------------LRSFQAFVAVAARVF------GHGA-----------------
G3VET0_SARHA/31-186--------------------------------------LQRLRAFAAIAARVF------THGA-----------------

PF07400

F1R6T9_DANRE/26-187--------------------------------------HKKLLIFCDYYTRAL---GSLKRKH-----------------
A0A0P7XG98_9TELE/28-193--------------------------------------FQKFRLFCDWALRVF---LSLKLRH-----------------
F1R1E3_DANRE/28-198--------------------------------------LEQFSLFCDWAARVLGRTRSLLTSR-----------------
H2T1R2_TAKRU/27-195--------------------------------------LQHFKLFCDWAYRAF---LSLKPKV-----------------
H2M884_ORYLA/28-196--------------------------------------LQHFNLFCDWAIRAF---IGLKPKA-----------------
H3A6V0_LATCH/22-190--------------------------------------FHHFKLFMDWTVRAL---VVLQNKH-----------------
G5BVZ4_HETGA/26-199--------------------------------------LGGLHLTLDWAVRGL---LLLKTRL-----------------
F6WLV3_XENTR/22-187--------------------------------------FHHFHLFLDYATRVL---VLMKNKW-----------------
G3P408_GASAC/28-197--------------------------------------SERLMVFCNWSKRVL---LRLQRLC-----------------
A0A091E199_FUKDA/60-227--------------------------------------IGGLHLTLDWAVRGL---MLQKAQL-----------------
W5LKH5_ASTMX/28-199--------------------------------------LQRFRLYCDWATRAF---LSLKSKT-----------------

PF06875

Q5BNQ4_9SALA/2-215------------------------R-------------GGVVCKEYKERVFLTKRDFMLLAEKYQGPL------------
Q5BNQ2_9SALA/2-215------------------------R-------------GGVVCKEYKERVLLTKRDFEFLAKKYQGHL------------

PF01110

CNTF_CHICK/1-194------------------------R-------------GLRVLRELAQWAVRSVRDLRQLSKHGPGSGAALGLPES----
G3VWZ5_SARHA/1-195------------------------W-------------GLKVLQELMQWTVRSIHDLRLISSPGQNRVPARGGQQL----
E1BFH9_BOVIN/1-193------------------------W-------------GLKVLQELSRWTVRSVHDLRTISR--QSGVPACGSRCA----
G5AP46_HETGA/1-192------------------------W-------------GLKVLQELSQWTVRSIRDLRLISSQ-PAGIPADESRYF----
H0Z9U1_TAEGU/1-188------------------------R-------------GLGVLRELAQWAVRSVRDLRQLGKPSSAAGTA----------
CNTF_HUMAN/1-194------------------------W-------------GLKVLQELSQWTVRSIHDLRFISSH-QTGIPARGSHYI----

PF01291

LIF_MOUSE/44-203------------------------L-------------GCQLLGTYKQVISVVVQAF-----------------------
LIF_BOVIN/43-202------------------------L-------------GCQLLGKYKQVIAVLAQAF-----------------------
ONCM_HUMAN/37-209------------------------E-------------GCRFLHGYHRFMHSVGRVF-----------------------
ONCM_MOUSE/34-194------------------------G-------------SCGFLWGYHRFMGSVGRVF-----------------------
ONCM_BOVIN/34-194------------------------R-------------NCGFLRGYHRFMRTAGQVL-----------------------

PF03039

I3MN91_ICTTR/3-204------------------------K-------------LCILLHALRIRAVTIDRVMSYLNSS-----------------
IL12A_MOUSE/6-215------------------------K-------------LCILLHAFSTRVVTINRVMGYLSSA-----------------
G3VQT1_SARHA/40-247------------------------K-------------LCLLLHAFRIRVVTIDRMRNYL--------------------
F6T5A8_MONDO/5-202------------------------K-------------LCVLLHAFQTRTVTIDRMMNYL--A-----------------
IL12A_PIG/6-222------------------------K-------------LCILLHAFRIRAVTIDRMMSYLNSS-----------------
L8YEA2_TUPCH/1-213------------------------K-------------LCILLHAFRVRAVTIDRVMSYLNTS-----------------
H0X861_OTOGA/6-217------------------------K-------------LFVLLHAFRIRAVTIDRVMSYLNSS-----------------
Q924V6_CAVPO/6-221------------------------K-------------LCILLHAFRIRAVTIDRVMSYLTSS-----------------

PF02024

H3AP27_LATCH/26-169----------------------------------------VALDRLQKCLLTMVKELEQIKDC-----------------
G3WWV6_SARHA/23-167----------------------------------------VTLSRLQKSLYGMLQQLDLIHGC-----------------
F6PLK2_ORNAN/23-167----------------------------------------VTLDRLRKSLKNIEKQLDHIQGC-----------------
F7HGW1_CALJA/23-167----------------------------------------VALSRLRGTLKDILQQLDLGPAC-----------------
G5BHA4_HETGA/23-167----------------------------------------VALSRLQRFLQEMLLQLDHNTMC-----------------
W5NER9_LEPOC/28-172----------------------------------------VALERLQKYLLKLIRNLDQLKNC-----------------
A0A286XUJ2_CAVPO/23-165----------------------------------------VVLRRMKRFLLEMLRQLELGIVC-----------------
LEP_HUMAN/23-167----------------------------------------VALSRLQGSLQDMLWQLDLSPGC-----------------

PF15216

M3WGC3_FELCA/29-146------------------------K-------------RQVTTNKCREQVSHLMELWRRFSR------------------
F1RLI5_PIG/20-130------------------------K-------------REVKANKCLEQVSYLLELWRRFSR------------------
A0A2I2YQB0_GORGO/29-153------------------------K-------------RKVTTNKCLEQVSQLQGLWRRFNR------------------
F7I7D5_CALJA/29-153------------------------K-------------RKVTTNKCLEQVSQLSGLWRRFIR------------------
K7E5V9_MONDO/34-162------------------------E-------------EGIKKMTCPEIARNLLDIWREYWK------------------
L8YGS5_TUPCH/5-129------------------------K-------------REDTAKECLKHVLRLQGLWRRFTR------------------
J9P5I8_CANLF/29-154------------------------K-------------RGVTTNKCREQVAHLIGLWRRFSR------------------
TSLP_MOUSE/20-137------------------------Q------------------NICLNQTSQILRLWYSFMQ------------------

PF03487

F7DGH7_MACMU/16-144--------------------------------------DT--KIEVAQFVKDLLVHLKKLFREGQ---------------
H0W834_CAVPO/2-134--------------------------------------DT--KIEVAEFVKKLRIHVQCLYRHGK---------------
I3MAR4_ICTTR/2-128--------------------------------------DT--KIEVGQFVKKLLSHLRCLLRHGK---------------
G1SCQ2_RABIT/16-144--------------------------------------DT--KIELLQFLKELRRHLQMLYRLGK---------------
IL13_HUMAN/16-144--------------------------------------DT--KIEVAQFVKDLLLHLKKLFREGR---------------
IL13_RAT/2-130--------------------------------------DT--KIEVAQFISKLLNYSKQLFRYG----------------
L5M5Z7_MYODS/2-128--------------------------------------DT--KVEVTRLAKDLLQQLRKGVRQGK---------------
G5ASP9_HETGA/2-130--------------------------------------DT--KIEVAQFVQTLLRYLQSLYRHGN---------------
L8YAP6_TUPCH/2-128--------------------------------------DT--KIEVAQFVKDLLRHLKRLYRH-----------------
IL13_BOVIN/2-130--------------------------------------DT--KIEVAQFLKDLLRHSRIVFRNER---------------
IL13_MOUSE/2-130--------------------------------------DT--KIEVAHFITKLLSYTKQLFRHGP---------------
F6WQF3_ORNAN/2-128--------------------------------------ET--QVELLMFLKKMLPFYQKIFRDT----------------
G3T2N9_LOXAF/2-133--------------------------------------DT--KIELITFMKNLLDHLRRIYRY-----------------
M3YGH3_MUSPF/2-126--------------------------------------DT--KIEVIQLVKNLLTYARSVFRHGN---------------
B5FW67_OTOGA/2-129--------------------------------------DT--KIEVAQFIKDLLRHLKKRFRDAN---------------
IL13_CANLF/2-129--------------------------------------DT--KIEVIQLVKNLLTYVRGVYRHGN---------------

PF00727

IL4_FELCA/26-131--------------------------------------VK--KCTLKDFLERLKAIMQKKYS------------------
H0XDE1_OTOGA/26-149--------------------------------------AM--QSTLKDFLERLKTTMKEKYS------------------
IL4_MOUSE/27-140--------------------------------------SK--STSLKDFLESLKSIMQMDYS------------------
G3T4B8_LOXAF/26-132--------------------------------------DRNLFKTAR-VIEKLKTIYYTKF-------------------
IL4_RABIT/28-143--------------------------------------AR--QTTLEDFLDRLKTAMQEKYS------------------
G5ASQ0_HETGA/25-138--------------------------------------LK--QTTLKDFLENLKTILKKKYS------------------
F6U5N6_HORSE/26-135--------------------------------------AK--KSTLKDFLERLKTIMKEKYS------------------
IL4_BOVIN/26-133--------------------------------------AKTSTSTLKDLLERLKTIMKEKYS------------------
G3QSC0_GORGO/26-149--------------------------------------AN--QSTLEDFLERLKTIMREKYS------------------
A3FBF0_MUSPF/26-130--------------------------------------VK--KSTLKDFLERLKVIMQQKYY------------------
IL4_RAT/27-139--------------------------------------ST--LTTLKDFLESLKSILRGKY-------------------
G3WEJ0_SARHA/28-149--------------------------------------TK--ITKLQDFLSKLKTINQK---------------------
IL4_PIG/26-131--------------------------------------AK--KSTLKDFLERLKTIMKEKYS------------------

PF00143

H8XX39_CHICK/27-182------------------------D-SFLKE-------KQHNLCSWEISRAEMRRCLQLIDKV------IRKL-------
I3N7K4_ICTTR/69-238------------------------Y-NFLKD-------KTYSRCAWEIVRVEITRYFLYLKKF------ITLH-------
H0W3G0_CAVPO/26-185------------------------R-LYLED-------KKYSDCAWEIVRVEIMRAFSLSAKL------QEKI-------
H0W510_CAVPO/26-185------------------------T-VYLKE-------KSYSPCAWEVVRAEIRRSFSFSATL------KTPK-------
Q29098_PIG/26-180------------------------H-LYLKE-------KIYSDCAWETVRVEITRPLSLSTYL------QERL-------
G5E7E1_LOXAF/9-168------------------------H-SYLKE-------KEYSDCAWEIVRVEIKRSFSSSTNL------QERL-------
IFNE_MOUSE/27-185------------------------H-DYLEN-------QRYSSCAWIIVQTEIHRCMFFVFRF------TTWL-------
G3I0H8_CRIGR/26-185------------------------T-AYLRE-------KNHSPCAWEVVRAEVWRALSSSANL------LARL-------
H0VF99_CAVPO/28-187------------------------S-KYLRA-------KKNSICAWTVVQAELIRNFSIINRL------TNYF-------
L5KKJ7_PTEAL/25-192------------------------S-SFLKD-------KKYSHCAWEIVRVEIRRCFCYF---------TALL-------
G1U0Q8_RABIT/26-185------------------------R-LYLDE-------KKHSGCAWELVRMEIRRAFSSTADL------QESL-------
F6YZB3_ORNAN/25-183------------------------S-LYLRD-------KEYSSCAWEIVRAEIRRSFEYSVVL------SPGL-------
V8NNB8_OPHHA/15-183------------------------S-DFLKN-------KKYSLCAWEIVQIQIEACFQLINHY------IQRI-------
C8CKA7_PIG/26-185------------------------T-LYLQE-------KSYSPCAWEIIRAEVMRAFSSSTNL------QDRL-------
G3GXU9_CRIGR/27-182------------------------Q-RYLED-------NGHSSCAWMVTQAEVLRNFMFIKRL------TRIF-------
H0XSG1_OTOGA/26-185------------------------T-LYLKE-------KKYSSCAWEVVRAEIMRAFSSSTRL------QERL-------
G1KX99_ANOCA/25-184------------------------S-DLLKE-------KGYSRCAWEIVHIQVKYHLSASSVL------GWKL-------
G3I0I6_CRIGR/27-185------------------------H-DYLEN-------QRYSSCAWIVVQVEINRCMFFVFRL------TAWL-------
IFNT4_SHEEP/26-185------------------------H-DYLQE-------KGYSDCAWEIVRVEMMRALTVSTTL------QKRL-------
L8Y4J0_TUPCH/27-186------------------------R-NYLEN-------HKYSSCAWTIVQVEIKRCLFLVLRL------IGKL-------
F7B527_HORSE/26-183------------------------S-LYLKE-------KDYSGCAWEVVRVEIRRCLLFMNKL------TGKL-------
G1Q950_MYOLU/27-184------------------------F-QYLKG-------KSYSRCAWTVVQAEILRNFSFLNRL------IGAL-------
M3XCW7_FELCA/26-186------------------------R-VYLED-------EGYSDCAWEIVRLEIMRALSSSATL------QDSL-------
G5CB66_HETGA/27-185------------------------R-RHMKA-------KDNSICAWTVVQVELSRNFSFINRL------TDYF-------
L9L941_TUPCH/27-198------------------------K-NFLKD-------KKYSRCAWEIIRMEIRRCFHYFQKF------TELL-------
D2H9N6_AILME/27-184------------------------V-RYLKA-------KVYSICAWKIVRAEMLRSFFFLDKF------TNYL-------
D3Z919_RAT/26-179------------------------T-MYLKQ-------KKHSPCAWEVVRVEVGRALIYSDMF------LAKL-------
C8CKB9_PIG/24-176------------------------H-RYLKK-------KEYSSCAWEVVRVETEVCLSLMQQL------STKS-------
A8E6F6_XENTR/27-179------------------------E-TMVLE-------KDNSACVWDFIHLETRRNLQQVLQL------SSRL-------
L8Y906_TUPCH/26-185------------------------H-LYLEK-------KNFSDCAWEVVRVEIRKCFLFINKL------IRKL-------
L5KWM8_PTEAL/106-263------------------------R-LYLKE-------KRYSDCAWEVVRVEIKEILLFINKL------TKKV-------
G3WZJ8_SARHA/27-182------------------------R-AYLQG-------KEYSRCAWEIVRVEIRRIFLFMSKL------TKKL-------
G3UCD2_LOXAF/26-187------------------------T-VYLTE-------KKYSPCAWEIVRAEIMRSFSASTNW------QERL-------
K7GQJ6_PIG/17-164------------------------H-LFLKE-------KKYSDCVWEIVRVEIMKPLSSLNSF------ARKV-------
G3I0H3_CRIGR/26-178------------------------T-VYLRE-------KNHSPCAWEVVRAEVWRALSSSVNL------LARL-------
H0VYK7_CAVPO/28-181------------------------S-RYLTA-------RENSICAWTVVQAELISKFPIINSL------TDYF-------
L5K635_PTEAL/26-185------------------------H-LYLEE-------KQYSDCAWEVVRVEIRRYLFVVNKF------TRKE-------
W5JYQ9_ASTMX/23-179------------------------T-AVLIE-------KDYQYCAWEFARFEILHALQFI---------LINL-------
H0Y0D2_OTOGA/28-187------------------------I-LYLQE-------KKYSLCAWEIVRTEIMRSYSYSKHL------QNTL-------
IFN_ANAPL/34-190------------------------Q-HFLQN-------HTYSPCAWDHVRLEAHACFQRIHRL------TRTM-------
G3UJX3_LOXAF/27-185------------------------G-QYLEA-------KDYSSCAWTVVQVEILRNFSFISGL------TDYL-------
G5C259_HETGA/26-185------------------------T-LYLKE-------KRYSPCAWEVVRAEIMRSFSSSEKL------ARKV-------
G3WZF5_SARHA/26-185------------------------M-NYLEN-------KKYSSCSWKIVQVETRLNFIFLYKL------TERL-------
IFNE_PIG/27-186------------------------R-DYLEN-------QDYSSCAWTIVRVEINRCLFFVFQL------TGKL-------
W5N6G4_LEPOC/27-185------------------------E-KVLRD-------KDYSYCAWESVRRDLRRALEQFQEF------LESN-------
H9KYA4_CALJA/26-185------------------------T-LYLTE-------KKHSPCAWEVVRAEIMRSFSLLTSL------QERL-------
D2HTQ4_AILME/33-205------------------------D-NFLKE-------KKYSHCAWEIIRVEIRRCFYYFQKF------AALL-------
IFNB_HUMAN/27-185------------------------L-HYLKA-------KEYSHCAWTIVRVEILRNFYFINRL------TGYL-------
G1NR05_MELGA/32-188------------------------H-NFLQR-------NNYSACSWDHVRLHARTCFQNVDTL------IQQM-------
F7BVP5_ORNAN/23-181------------------------M-DYLKG-------RNYSSCAWEVIRMKTKRCFLVIYRL------TRKL-------
F7G875_MONDO/27-182------------------------T-NYLKN-------KEYSSCACKIVQVETRRNFSFLYKL------TEYL-------
C8CKC3_PIG/33-205------------------------D-KFLKD-------KEHSHCAWEIVRVEIRRCFYFFQKF------TALL-------
F7A317_HORSE/26-184------------------------A-LYLQE-------KKYSPCAWEIVRAEIMRCFSSSTNL------QQS--------
G1KU56_ANOCA/28-182------------------------H-TFLKD-------GEYNECAWEVAQIEVSRFFMVMEQL------IRTL-------
L5KBH2_PTEAL/26-185------------------------R-LYLKE-------KEYSVCAWEVVRVEIRKAFSLSTNL------LDRL-------
L5K909_PTEAL/26-185------------------------T-LYLQE-------KKHSPCAWEIVRAEIMRSYSLSTHL------KEKS-------
I3N5Z0_ICTTR/23-179------------------------H-NYLES-------QRHSSCAWTIVHAEINRCLVFVFRL------IR---------
F7GHL9_MONDO/26-181------------------------S-RYLQG-------KGYSRCAWEFTRIEIRRCILFMSNL------TRKF-------
IFNE_HUMAN/27-186------------------------H-DYLEN-------QDYSTCAWAIVQVEISRCLFFVFSL------TEKL-------
G3UK87_LOXAF/27-184--------------------------LYLKE-------KEHSDCVWEVIRVEISKLIYVSTNLG--SSGQKRL-------
L9LC61_TUPCH/27-185------------------------T-QYLKA-------KEYSSCAWTIVRVEILRNFLFINRL------IDYL-------
IFNB_RAT/27-182------------------------Q-RYLKD-------KKYNSYAWMVVRAEVFRNFSIILRL------NRNF-------
H0XMZ9_OTOGA/27-186------------------------R-EYLEN-------QEYSSCARTIVQVEINRCLLFVFRL------TEKL-------
G3VDC6_SARHA/27-182------------------------N-QYLQD-------KEYSRCAWEMVRIEIRRIFLFMDKP------IRKL-------
I3JM36_ORENI/26-182------------------------SDDVLKK-------KGHSAEAWEVIRKETKAHLMRAEQL------ASSL-------
L5LKN9_MYODS/27-186------------------------R-DYLEN-------QKYSGCAWTVVQVEVNRCLFFVLPL------TGKL-------
G1TYS8_RABIT/29-195------------------------N-NFLED-------KKYSYCAREIVRVEITRCFSYFYRF------TAFL-------
I3UJJ8_FELCA/27-185------------------------H-DYLES-------QEYSSCAWTIVRVEINRCLFFALQL------IRKI-------
C8CKA9_PIG/26-183------------------------S-LYLKE-------KEYSHCAWEVVRVETRKCLLFINNL------VGKL-------
IFNT2_BOVIN/3-162------------------------H-VYLKE-------KEYSDCAWEIIRMEMMRALSSSTTL------QKRL-------
M3Z729_MUSPF/26-183------------------------S-LYLQE-------KQYSPCAWEMVRAEIMKPLYASTAL------HKRL-------
IFNA1_MOUSE/26-185------------------------T-VYLRE-------KKHSPCAWEVVRAEVWRALSSSANV------LGRL-------
G3TTC1_LOXAF/26-185------------------------R-FYLKE-------KEYSDCAWEFVRVEIRRSFSSSTAL------QERL-------
G1PDS6_MYOLU/29-199------------------------S-SFLQD-------KQYSHCAWKIVQVEIRRCFYYFQTL------IELL-------
F7ABU5_MONDO/27-182------------------------S-QYLQG-------KEYSPCAWEIVRVEIRRLFLFMSKL------ARKL-------
G1TTX4_RABIT/27-180------------------------M-DYLET-------KQYSNCAWKIVQLEIFRNFSFIIML------IDYL-------
H0XRP5_OTOGA/26-185------------------------T-LYLKE-------KKYTPCAWEVVKAEILRSFSSTTSL------QERL-------
H0WK94_OTOGA/33-202------------------------H-NFLKE-------KKYSHCAWDIVQVEIRRCIYYFYQF------TALL-------
G1KYL3_ANOCA/23-176------------------------S-NLLKE-------KEYSRCAWEIIQIQVKQCFLWIEKI------IQEI-------
G3WZQ8_SARHA/26-181------------------------N-QYLQD-------KEYSRCAWEIVRIEIRKMFLFMNKF------TRNL-------
H0YTY6_TAEGU/34-188------------------------H-LFLHA-------HNHSACAWDHVRLEARASLRHLHNL------TRAR-------
I3MXH1_ICTTR/27-185------------------------R-MYLEA-------KLYSSCAWTVVRDELYWNFSFINRL------TDKF-------
M3WRV1_FELCA/26-184------------------------S-LYLQE-------KKYSPCAWEIVRAEIMRSLYSSTAL------QKRL-------
R4GKJ6_CHICK/35-191------------------------H-TFLQD-------NDYSACAWEHVRLQARAWFLHIHNL------TGNT-------
A3FBE8_MUSPF/27-184------------------------V-RYLKA-------KEFSVCAWTIVQAEILRSFFFLDKL------TDSL-------
G1KWE0_ANOCA/28-180------------------------N-DFLKE-------KEYSRCAWEIVQIQVKQCFLWIEKL-----------------
G7PS89_MACFA/26-185------------------------T-LYLTE-------KKYSPCAWEVVRAEIMRSFSLSINL------QKRL-------
G1Q880_MYOLU/26-185------------------------R-LYLKE-------KKYSDCAWEVVRVEIMRSFSSTRAL------QERL-------
IFNB_MOUSE/27-180------------------------Q-RYLKL-------MKYNSYAWMVVRAEIFRNFLIIRRL------TRNF-------
IFNB2_BOVIN/27-184------------------------V-QYLKS-------KEYNRCAWTVVRVQILRNFSFLTRL------TGYL-------
G1SJC4_RABIT/26-185------------------------A-VYLAE-------KQYSPCAWEVVRAEARRAVSLSRIL------QERI-------
W5PG31_SHEEP/26-185------------------------T-LYLQE-------KGHSPCAWEVVRAEVMRAFSSSTNL------QERF-------
IFNA3_CANLF/26-183------------------------S-LYLQD-------RNHSPCAWEMVRAEIGRSFFSLTIL------QERV-------
G5BPX2_HETGA/27-199------------------------E-NYLKD-------KKYSYCAWKIVQVEIKRCFFYFLKF------IKLP-------
IFNW2_HORSE/26-185------------------------H-LYLKE-------KKYSDCAWEIVRMEIMRSFSSSANL------QGRL-------
G3N2A8_BOVIN/26-185------------------------H-VYLKE-------KEYSDCAWEIVRLEIMRALSSSTSL------QERL-------
H0XKS8_OTOGA/27-185------------------------T-WYLKA-------KRYSSCAWTVVREEILRNLFFINRL------TGYL-------
A0A286X8P0_CAVPO/26-185------------------------T-DYLKE-------KSYSPCAWEVVRAEFFRSFSSSEEL------LRKM-------
Q29412_PIG/27-184------------------------L-QYLKS-------KEYRSCAWTVVQVEILRNFSFLNRL------TDYL-------
G7PS88_MACFA/26-185------------------------T-LYLTE-------KKYSPCAWEVVRAEIMRSFSLSTNL------QERL-------
M3WZS7_FELCA/26-181------------------------S-LYLKE-------KEYSHCAWEVVRVEIRRCLLVINKL------TGTF-------
H9GZR7_HORSE/26-185------------------------R-LYLTE-------KKYSDCAWEIVRVDIMRSFSSSANL------QGRL-------
F1LVL8_RAT/26-184------------------------H-DYLEN-------HRYSTCAWIIVQIEVNRCMFFVSRL------ARRL-------
M3YX13_MUSPF/27-179------------------------H-NYLEN-------QEYNSCAWR----EINRCLFFAFQL------VRKL-------
G1L8G2_AILME/26-185------------------------G-LYLEK-------KKYSRCAWEVVRVEIRRCLFFVNEL------AGKL-------
IFNB_HORSE/27-184------------------------S-QYLKA-------KKYSHCAWTVVQAEMLRNLAFLNGL------TDYL-------
H0W289_CAVPO/26-190------------------------S-LYLEE-------KKYSDCAWEIVRVEIRRVVSFSLRL------QQRL-------
A8E6E8_MONDO/27-182------------------------S-QYLQG-------KGYSHCAWEVTRVEIRRCFLFLSKL------SRKF-------
I3N788_ICTTR/27-185------------------------L-RYLKA-------KQYSSCAWTVIRMELFQNFSFINRL------MDHF-------
G1L8I1_AILME/26-183------------------------S-LYLQE-------KQYSPCAWETVRAEITKPLFSSTIL------QEGL-------
IFNB_FELCA/27-184------------------------V-RYLKA-------KEYSVCAWTVVHAEILRNFFFLERL------TDYL-------
G3TS29_LOXAF/26-179------------------------G-LYLKE-------KEHSLC-WEVVRVEIRKCFLFINML------TVQI-------
W5PZ39_SHEEP/26-184------------------------D-RFLKD-------KKHSHCAWEIVRVEIRRCFYFFQKL------TALL-------
G3I0H6_CRIGR/26-178------------------------T-AYLGE-------KNHSPCAWEVVRAEVWRAMSASANL------LATL-------
M3Z715_MUSPF/26-183------------------------S-LYLQE-------KQYSPCAWEIVRAEIMKPLYASMIL------QERL-------
M3VXI8_FELCA/33-205------------------------Y-NFLKD-------KKYSPCAWEIIRVELRRCFYYFYKL------TLLL-------
G3R8Q7_GORGO/26-185------------------------R-VYLKE-------KKYSDCAWEVVRMEIMKSLFLSTNM------QERL-------
A8E6F5_XENTR/51-202------------------------E-QILQE-------KN-TACTRDIIQSEIRGNLQLVGQL------ASRA-------

PF02947

FLT3L_MOUSE/30-162------------------------K-PCIGK-----ACQNFSRCL-------EVQCQ-----------------------
F6T7S9_ORNAN/28-157------------------------R-PKITS-------LNFSSCL-------ELRC------------------------
H9GP84_ANOCA/29-165------------------------R-KKMEEFEAHDVPANFSNCT-------VIHCQ-----------------------
F6TPW7_MONDO/34-163------------------------Q-PLISS-------QDFGPCR-------RLRCQ-----------------------
G5B8P0_HETGA/20-150------------------------K-PWITH-------RNFSQCL-------ELRCQ-----------------------
G1M637_AILME/29-159------------------------K-PRITR-------RNFSGCL-------ELRCQ-----------------------
L9JA37_TUPCH/769-910------------------------K-PRITR-------RNFSRCL-------ELRCQ-----------------------
G3VSA3_SARHA/79-209------------------------R-PLITQ-------QNFQPCQ-------QYRCQ-----------------------
G1QZC3_NOMLE/30-160------------------------K-PWITR-------QNFSRCL-------ELQCQ-----------------------

PF00714

I3MNV6_ICTTR/15-152------------------------E-DFLKV-------SQFQVNDLKIQRKAVRELKKVMNDLL-PHSTLRKR-------
IFNG_HORSE/15-152------------------------E-DFQKL-------IQIPVNDLKVQRKAISELIKVMNDLS-PKANLRKR-------
H0WPL1_OTOGA/15-151------------------------E-AFQNL-------LRISVHDLQVQRKAISELYEVIVSLV-PGTPLRKR-------
Q8CGS0_CAVPO/15-154------------------------Q-AFKNL-------IQISVNDEHVQRQAIIELKKVIDDLS-PNQRKRRR-------
B9VS86_CALJA/15-152------------------------D-DFERL-------TNYSVNDLNVQRKAIHELIQVMAELS-PAPKIGKR-------
G3SUC6_LOXAF/15-152------------------------D-DFLKV-------MQTPVNDRNIQRKAISELAKVMNDLS-HRSTGSKR-------
G3GY20_CRIGR/2-135------------------------N-DFVRI-------TKIPVNDVQVQRKAVNELISVMPLLS-PKLSLRKR-------
L5LME8_MYODS/15-153------------------------E-DFKKL-------IQTPVNDQRVQRKAISELYNVITELSKSNSKMRKR-------
G5BGB5_HETGA/15-152------------------------D-VFQSL-------TRISVDNVDFQRRAIIELKKVMDDLS-PNQRKRRR-------
G3WQJ9_SARHA/15-153------------------------D-DFEAL-------INTQVNDLKVQRKAMFELVYVFRNLS-PKPHLTG--------
IFNG_SHEEP/15-152------------------------E-DFKRL-------IQIPVDDLQIQRKAINELIKVMNDLS-PKSNLRKR-------
IFNG_RAT/14-151------------------------D-AFMSI-------AKFEVNNPQIQHKAVNELIRVIHQLS-PESSLRKR-------
IFNG_RABIT/15-152------------------------D-DFQNL-------TRISVDDRLVQRKAVSELSNVLNFLS-PKSNLKKR-------
L9KVU0_TUPCH/51-188------------------------D-VFLNL-------TRISVNDVQVQRKAIYELLNVMIDLT-PKSNQKKR-------
IFNG_FELCA/15-153------------------------D-DFLKL-------IQIPVNDLQVQRKAINELFKVMNDLS-PRSNLRKR-------

PF02372

IL15_PIG/33-160------------------------E-------------EKNINEFLKSFIHIVQMFIN----------------------
IL15_CAVPO/33-160------------------------E-------------EKSIAEFLQSFVHIVQMFIN----------------------
IL15_FELCA/33-160------------------------E-------------EKNIKEFLQSFVHIVQMFIN----------------------
IL15_SHEEP/33-160------------------------E-------------KKSIKEFLKSFVHIVQMFIN----------------------
F1NZN5_CHICK/55-183------------------------E-------------EKNFTEFIQSFVKVIQRECK----------------------
G1NDP6_MELGA/5-137------------------------D-------------KKNFPDFLQQLTNL----------------------------
O73883_CHICK/5-138------------------------N-------------KKKFPDFLHELTNFV---------------------------
Q8JFF4_ANAPL/4-134------------------------N-------------ANNFPEFRQELTN----F------------------------

PF00715

I3MQX6_ICTTR/7-151------------------------E-------------TANIVEFLNTWITFCQSIIS----------------------
G5C793_HETGA/7-149------------------------E-------------EANIVQFLKGWIAFCQKIIS----------------------
G1PJ32_MYOLU/7-147------------------------E-------------TVTIVEFLNKWITFCQRIFS----------------------
B1AB81_HORSE/7-146------------------------E-------------TGTIVEFLNKWITFCQSIFS----------------------
G3HTL8_CRIGR/7-150------------------------E-------------TVTVVEFLSRWITFCQSII-----------------------
IL2_MACMU/7-151------------------------E-------------TATIVEFLNRWITFCQSIIS----------------------
H0Y254_OTOGA/7-149------------------------E-------------TATIVEFLNRWITFCQSIIS----------------------
IL2_MOUSE/7-165------------------------E-------------SATVVDFLRRWIAFCQSIIS----------------------
G3SU90_LOXAF/7-147------------------------H-------------AATIEEFLNKWIVFCQSIIS----------------------
IL2_PIG/7-151------------------------E-------------TVTAVEFLNKWITFCQSIYS----------------------
IL2_FELCA/7-151------------------------E-------------TATIVEFLNKWITFCQSIFS----------------------
L5K7D9_PTEAL/7-149------------------------E-------------SANVKEFLNKWITFCQSILS----------------------
IL2_BOVIN/7-152------------------------A-------------TVNAVEFLNKWITFCQSIYS----------------------
H0VBY4_CAVPO/7-149------------------------E-------------SVNIVEFLKRWIAFCQKIMS----------------------

PF01415

M3WJR8_FELCA/15-127------------------------T-------------GNV-LTFLKSLQEILQKERVK---------------------
H0X0U6_OTOGA/15-141------------------------A-------------GNT-LTFLQSLLEIFQKENMRQMM------------------
G1QNL2_NOMLE/28-172------------------------K-------------LND-LCFLKRLLQEIKTCWNKILM------------------
IL7_BOVIN/28-171------------------------K-------------QND-LCFLKILLQKIKTCWNKILR------------------
F1PA23_CANLF/29-154------------------------K-------------QKS-LCSLGILLQKIKTCWNKILR------------------
IL9_MOUSE/15-141------------------------A-------------GNT-LSFLKSLLGTFQKTEMQRQK------------------
U3KN10_RABIT/31-153------------------------K--------------NG-RCFLKKLLQKIKTCWNKILR------------------
K7E262_MONDO/59-200------------------------K-------------ERKCKCLIKKMVSDVKNCWRKFLM------------------
E1BF10_BOVIN/18-141------------------------T-------------GNT-LTFLKALLESFQNDRMRGKR------------------
F6PLW3_HORSE/15-136------------------------R-------------GNT-VTFLKSLLEIFQKKRIR---------------------
IL9_HUMAN/15-141------------------------A-------------GNA-LTFLKSLLEIFQKEKMRGMR------------------
IL7_MOUSE/28-151------------------------K--------------ND-ACFLKRLLREIKTCWNKILK------------------
G5BX09_HETGA/15-141------------------------A-------------GNT-VTFLRNLLELFQRETMKGMR------------------
L8Y4N8_TUPCH/15-141------------------------A-------------GNM-LTFLKSLLEVFQKENVRKMR------------------
D4A8I9_RAT/15-141------------------------A-------------GNT-VSFLKSLLKTFQKTEVQVQR------------------
G3TKQ6_LOXAF/16-136------------------------T-------------GNT-LTFLKRLLDTFQKEY-----------------------
M3YEX7_MUSPF/16-137------------------------T-------------GNT-LTFLRSLQETLQKQ------------------------
G1NXN3_MYOLU/28-153------------------------K-------------QDE-MCFLMILLEKIKTCWNKILS------------------

PF00103

PLRP1_BOVIN/26-238------------------------R-------------HSEFYNLFYCLRRDSRKVDMYIKILTCRTHKT---C------
CSH2_BOVIN/26-238------------------------S-------------ISEYYNLFYCLRRDSRKVDMYIKILTCRTRKT---C------
PLRP3_BOVIN/1-213------------------------R-------------HSAFYKLFMCLYRDSRKLDMYTEILACRITNT---C------
PR4A1_RAT/17-227------------------------R-------------YFAFYNLFHCLKKDSNNVEMYLKLLKCRLIRS--KC------
CSH1_BOVIN/26-236------------------------R-------------QTAFYRMFHCLHRDSSKISTYINLLKCR-FTP---C------
PLRP4_BOVIN/26-239------------------------R-------------HSAFYSLFFCLRRDTRKLDIYTKFVACRLIYK--KC------
PR3D4_RAT/16-223------------------------H-------------LFAIYNLCRCFKSDIHKIDTYLKVLRCRVVFKN-EC------
PR2C2_MOUSE/16-224------------------------R-------------IHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDN-C------
SOM2_HUMAN/9-215------------------------A-------------LLKNYGLLYCFRKDMDKVETFLRIVQCR-SVEG-SC------
PR8A5_RAT/17-238------------------------K-------------FLAIFNLSSCLDYDTQVHYTLSQILNCLITGKD--C------
PR6A1_RAT/20-234------------------------R-------------HFAFTNLFQCLLQDSRKFDSKVRLLKCRLIYNR-DC------
PR7D1_MOUSE/17-240------------------------Q-------------FFALYMFSFCLRIDLETVDFLVNFLKCLLLYDD-VC------
CSH2_HUMAN/9-215------------------------A-------------LLKNYGLLYCFRKDMDKVETFLRMVQCR-SVEG-SC------

PF01109

CSF2_RAT/18-139------------------------T-------------FEDFIKNLKGFLFDI-PFDCW---------------------
CSF2_MOUSE/18-136------------------------T-------------YADFIDSLKTFLTDI-PFECK---------------------
CSF2_BOVIN/18-138------------------------S-------------FKNFKEDLKEFLFII-PFDCW---------------------
CSF2_CAVPO/18-140------------------------T-------------FKSFKENLKRFLFAI-PFDCW---------------------
CSF2_PIG/18-139------------------------T-------------FKSFKDSLNKFLFTI-PFDCW---------------------
CSF2_HUMAN/18-139------------------------T-------------FESFKENLKDFLLVI-PFDCW---------------------
CSF2_CANLF/18-139------------------------N-------------FKSFKENLKDFLFNI-PFDCW---------------------

PF02025

I3MDT8_ICTTR/22-133------------------------R-------------VKQFLEYLQEFLGVI-NTE-WMME------------------
G1RQD7_NOMLE/22-133------------------------R-------------VNQFLDYLQEFLGVM-NTE-WIIE------------------
IL5_CAVPO/23-134------------------------R-------------VKQFLDYLQEFLAVI-NTE-WTIE------------------
J9NWP5_CANLF/22-132------------------------R-------------VTKFLDYLQVFLGVI-NTE-WTP-------------------
IL5_MOUSE/21-132------------------------R-------------TRQFLDYLQEFLGVM-STE-WAME------------------
G3WAR7_SARHA/25-134------------------------K-------------VEQFLDYLEEFLQTV-NTE-WTVE------------------
IL5_HORSE/22-133------------------------R-------------VKQFLDYLQEFLGVI-NTE-WTIE------------------
B5FW65_OTOGA/22-133------------------------K-------------VKQFLDYLQEFLGII-NTE-WTME------------------
G3T4B0_LOXAF/23-133------------------------K-------------VKQFLDYLEEFLGVI-STD-WMI-------------------
G1SL79_RABIT/22-133------------------------G-------------VKHFLDYLQEFLGVI-NTE-WTME------------------

PF02059

IL3_CANLF/19-132------------------------N-------------WGDFQRKLKKYLEA----------------------------
IL3_MOUSE/27-138------------------------D-------------LDDFRKKLRFYMVHL---------------------------
IL3_BOVIN/18-132------------------------N-------------LGDFRMKLEEYLVII---------------------------
G3UC30_LOXAF/22-133------------------------D-------------WEDFRGKLYPYLETL---------------------------
G1MH15_AILME/18-131------------------------N-------------LGDFQKKLKKYLEA----------------------------
G1RQ11_NOMLE/20-137------------------------D-------------WNEFRRKLKFYLKTL---------------------------
IL3_CALJA/19-136------------------------D-------------WNDFQMKLKFYLKTL---------------------------
F1LS41_RAT/29-138------------------------D-------------LDDFKKKLRFYVIHL---------------------------

PF00758

H0W023_CAVPO/30-191------------------------Y-------------SNFLRGKLKLYTGMA----CRRGD------------------
G3TYQ1_LOXAF/25-173------------------------F-------------PT---AALSFLLLVVGLTLCARRA------------------
W5K758_ASTMX/26-175------------------------H-------------INFLRGKVRLLLANA----P----------------------
B1N8Y2_DANRE/15-168------------------------H-------------VNFLRGKARLLLANA----PVCRQ------------------
F7DTH0_CALJA/31-193------------------------Y-------------SNFIRGKLKLYAGEA----CRTED------------------
M3XJ62_LATCH/27-177------------------------H-------------VNFLRGKVKLFISDA----CSMQ-------------------
G3W289_SARHA/30-190------------------------Y-------------SNFLRGKLKLFWREA----CQSQE------------------
F6WUU2_MONDO/31-191------------------------Y-------------SNFLRGKLKLFLREA----CQSEE------------------
G3VW20_SARHA/26-175------------------------F-------------QQLLRGKVRFLLHALRPILCARQD------------------
G1PF99_MYOLU/45-207------------------------Y-------------SNFLRGKLKLYTGEA----CRRGD------------------
TPO_CANLF/25-176------------------------F-------------QQLLRGKVRFLLLVAGPTLCAKQS------------------
F7G570_MONDO/26-177------------------------F-------------QQLLRGKVRFLLHAVRPLLCARQD------------------
H2LEX3_ORYLA/33-182------------------------H-------------VNFLRGKVRLLLMDA----P----------------------

PF00726

IL10_BOVIN/5-174------------------------G-------------VYKAMSEFDIFINYIETYMTT---------------------
IL10H_EBVB9/7-167------------------------G-------------IYKAMSEFDIFINYIEAYMTI---------------------
G3HB01_CRIGR/14-174------------------------G-------------VYKAMNEFDIFINCIETYMTI---------------------

PF14565

IL22_HUMAN/40-178------------------------G-------------EIKAIGELDLLFMSLRNAC-----------------------
E1C1U2_CHICK/46-184------------------------G-------------KNKAIGELDLLFDYIENAC-----------------------

PF15177

I3MK89_ICTTR/29-189------------------------A-------------CLQASVTFNLLRLLVRDLKCVASG------------------
H0VBN4_CAVPO/32-188------------------------G-------------CLQESVTFNLLRLLTRDLRCVAR-------------------
IFNL3_CHICK/28-182------------------------G-------------CLEASAILHIFQVL-NDLRCAAQR------------------
F1M3K4_RAT/31-188------------------------G-------------CLKAYVTLNLFRLLTRDLKCVASG------------------
F1PY54_CANLF/31-186------------------------G-------------CLEASITFNLFRLLTRDLKCVASR------------------
H0XRJ1_OTOGA/35-191------------------------G-------------CLEASVTFNLFRLLTRDLKCVASG------------------
F6PNH9_HORSE/31-184------------------------G-------------CLEASVTFNLFRLLTRDLNCVASG------------------
D2DJP5_XENTR/23-178------------------------E-------------CVQDAVLLSLTQLLIEDIMCWANN------------------
G3TQK4_LOXAF/32-188------------------------S-------------CLEASVMFNLFRLLTRDLKCVASG------------------
F7DXI8_HORSE/34-187------------------------G-------------CLEASVMFNLFRLLTKDLTCVASG------------------
F6W920_MONDO/30-184------------------------S-------------CLEASVMLTLPRLPDTDLRCVAY-------------------
U3KED0_FICAL/27-186-----------------------TA-------------CLRATTILHVLQVL-GNLRCAAL-------------------
IFNL4_HUMAN/25-174------------------------R-------------CRKASVVFNLLRLLTWELRLAAH-------------------
IFNL2_MOUSE/32-189------------------------G-------------CLEASVTSNLFRLLTRDLKCVANG------------------
G3N0M3_BOVIN/37-192------------------------D-------------CLEASVMFNLLRLLTRDLKCVASG------------------
G1LPU9_AILME/37-191------------------------G-------------CLEASVLFNLFRLLKKDLECVASG------------------
L5LZZ9_MYODS/163-319------------------------G-------------CLEASVTLNLFRLLTRDLRCVAAG------------------
IFNL3_HUMAN/34-192------------------------G-------------CLEASVTFNLFRLLTRDLNCVASG------------------
F6R8C9_XENTR/23-177------------------------Q-------------CVQDAMLLSLTQLLIEDVMCWANK------------------
G3VJ97_SARHA/12-167------------------------N-------------CLEASIMLNLFRLLTQDLRCVAYG------------------
H0XJU8_OTOGA/36-192------------------------G-------------CLEASVIFNLFRLLTWDLKCVASG------------------
G3HJD0_CRIGR/30-187------------------------G-------------CLEISVTSNLFRMLLRDLPCVARG------------------
G1LPW2_AILME/34-190------------------------G-------------CLEASVMFNLFRLLTRDLKCVASG------------------
L5L378_PTEAL/33-182------------------------D-------------CLESTVTFNLFRLLTRDLK-----------------------
G1T4B0_RABIT/34-188------------------------A-------------CLEASVIFILFRLLTRDLKCVASG------------------
U3IYH6_ANAPL/34-185------------------------S-------------CLEYSTIVHLFQVL-HDLGCVA--------------------
L9LBW1_TUPCH/31-181------------------------G-------------CLKAAATFNLFRLLNQNLKCVASE------------------
D0FHA1_PIG/36-191------------------------S-------------CLEASVMFNLFRLLTRDLKCVASG------------------

PF05337

CSF1_HUMAN/41-180------------------------T-------------KNLLDKDWNIFSKNCNNSFAECSS------------------
Q3TLQ6_MOUSE/41-180------------------------T-------------KNLLEKDWNIFTKNCNNSFAKCSS------------------
O77709_BOVIN/41-180------------------------T-------------KNLLKKDWNIFSKNCNNSFAKCSS------------------
O77710_BOVIN/41-180------------------------T-------------KNLLKKDWNIFSKNCNNSFAKCSS------------------
Q64129_9MURI/41-180------------------------T-------------KNLLEKDWNIFTKNCNNSFAKCSS------------------

PF15036

IL34_MOUSE/28-184-----------------------LK-------------LVRPKALLDNCFRVMELLYCSCCKQSP---------------
R4GIU3_CHICK/19-177-----------------------QK-------------AVRPKALLDNCLKVLRMLFGAHCRWDS---------------
F7EA00_CALJA/29-185-----------------------LK-------------LVRPKALLDNCFRVMELLYCSCCKQSS---------------
H0WFN4_OTOGA/28-184-----------------------RK-------------LVRPKALLDNCFRVMELLYCSCCKQSS---------------
M3ZVZ0_XIPMA/24-191-----------------------WR-------------FASPKSLVDNLCHTMCCLFWECFS--S---------------
U3JY35_FICAL/18-179-----------------------SK-------------AVRPKALLDNCLKVMRMLYGVPCRWES---------------
L9KJY3_TUPCH/28-184-----------------------LK-------------LVRPKALLDNCFRVMELLYCPCCKHNS---------------
G3T3A6_LOXAF/28-182-----------------------LK-------------LVRPKALLDNCFRVMDLLYCSCCKQSS---------------
F6W3U1_MONDO/15-167-----------------------QK-------------LVRPKALLDNCYKVMDLLYCLCCKESN---------------
I3JZ08_ORENI/24-192-----------------------WR-------------FATPKSLLDNLCRTMYCLFSECFSNAD---------------
L5MCR9_MYODS/28-182-----------------------LK-------------LVRPKALLDNCFRVMELLHCSCCKE-----------------
B3DLJ8_DANRE/23-195-----------------------WK-------------SVTPKSILDNCYRTMLCLFKECFTKED---------------
IL34_BOVIN/28-183-----------------------LK-------------LVRPKALLDNCFRVMQLLYCPCCKESS---------------

PF02404

R4GD07_ANOCA/1-283SG----NHNNEAALGFLGSPGMQGL-------------SIALTSLVTLFIGFILGAVCWKKTARKHILESNPTTQANICQ
SCF_CHICK/1-287IGSNTSSNSNKEALGFISSSSLQGI-------------SIALTSLLSLLIGFILGAIYWKKTHPKSRPESNETIQCHGCQ
SCF_RAT/1-273------SSSNRKAAKSPEDPGLQWT-------------AMALPALISLVIGFAFGALYWKKKQSSLTRAV-ENIQIN--E
G1NWC8_MYOLU/1-272------SSSNRKALNSIGDSKLQWA-------------AMTLPAFFSLLVGFGFGALYWKKKQPNLTRAV-ENIQIN--E
F7EP53_MONDO/1-273------SSSNRKAAGSTKDPSVQWV-------------AIVLPSLFSLVLGFVLGALYWKKKQMNLKMEV-ENIETS--E
F7C5I3_ORNAN/1-273------TSSNREAFGYISSSSLQWI-------------SIAVPSIFSLVIGFILGAIYWKKKHPKHSVEV-ENIQGN--E
F7G0W2_CALJA/1-273------SSSNRKAKNPPGDSGLHWA-------------AMALPALFSLIIGFAFGALYWKKRQPSLTRTV-ENIQIN--E

PF00489

M3X721_FELCA/44-225------------------
IL6_BOVIN/27-208------------------
IL6_HORSE/27-208------------------
G3UHF3_LOXAF/20-205------------------
L5KPK4_PTEAL/20-202------------------
F7HV62_CALJA/27-212------------------
IL6_MOUSE/26-210------------------

PF16647

CSF3_BOVIN/42-190------------------
CSF3_HUMAN/51-202------------------
CSF3_MOUSE/57-205------------------

PF16649

IL23A_MOUSE/28-185------------------
F7HQI5_MACMU/28-184------------------
F1MSN4_BOVIN/35-192------------------
IL23A_CAVPO/28-184------------------
G3VET0_SARHA/31-186------------------

PF07400

F1R6T9_DANRE/26-187------------------
A0A0P7XG98_9TELE/28-193------------------
F1R1E3_DANRE/28-198------------------
H2T1R2_TAKRU/27-195------------------
H2M884_ORYLA/28-196------------------
H3A6V0_LATCH/22-190------------------
G5BVZ4_HETGA/26-199------------------
F6WLV3_XENTR/22-187------------------
G3P408_GASAC/28-197------------------
A0A091E199_FUKDA/60-227------------------
W5LKH5_ASTMX/28-199------------------

PF06875

Q5BNQ4_9SALA/2-215------------------
Q5BNQ2_9SALA/2-215------------------

PF01110

CNTF_CHICK/1-194------------------
G3VWZ5_SARHA/1-195------------------
E1BFH9_BOVIN/1-193------------------
G5AP46_HETGA/1-192------------------
H0Z9U1_TAEGU/1-188------------------
CNTF_HUMAN/1-194------------------

PF01291

LIF_MOUSE/44-203------------------
LIF_BOVIN/43-202------------------
ONCM_HUMAN/37-209------------------
ONCM_MOUSE/34-194------------------
ONCM_BOVIN/34-194------------------

PF03039

I3MN91_ICTTR/3-204------------------
IL12A_MOUSE/6-215------------------
G3VQT1_SARHA/40-247------------------
F6T5A8_MONDO/5-202------------------
IL12A_PIG/6-222------------------
L8YEA2_TUPCH/1-213------------------
H0X861_OTOGA/6-217------------------
Q924V6_CAVPO/6-221------------------

PF02024

H3AP27_LATCH/26-169------------------
G3WWV6_SARHA/23-167------------------
F6PLK2_ORNAN/23-167------------------
F7HGW1_CALJA/23-167------------------
G5BHA4_HETGA/23-167------------------
W5NER9_LEPOC/28-172------------------
A0A286XUJ2_CAVPO/23-165------------------
LEP_HUMAN/23-167------------------

PF15216

M3WGC3_FELCA/29-146------------------
F1RLI5_PIG/20-130------------------
A0A2I2YQB0_GORGO/29-153------------------
F7I7D5_CALJA/29-153------------------
K7E5V9_MONDO/34-162------------------
L8YGS5_TUPCH/5-129------------------
J9P5I8_CANLF/29-154------------------
TSLP_MOUSE/20-137------------------

PF03487

F7DGH7_MACMU/16-144------------------
H0W834_CAVPO/2-134------------------
I3MAR4_ICTTR/2-128------------------
G1SCQ2_RABIT/16-144------------------
IL13_HUMAN/16-144------------------
IL13_RAT/2-130------------------
L5M5Z7_MYODS/2-128------------------
G5ASP9_HETGA/2-130------------------
L8YAP6_TUPCH/2-128------------------
IL13_BOVIN/2-130------------------
IL13_MOUSE/2-130------------------
F6WQF3_ORNAN/2-128------------------
G3T2N9_LOXAF/2-133------------------
M3YGH3_MUSPF/2-126------------------
B5FW67_OTOGA/2-129------------------
IL13_CANLF/2-129------------------

PF00727

IL4_FELCA/26-131------------------
H0XDE1_OTOGA/26-149------------------
IL4_MOUSE/27-140------------------
G3T4B8_LOXAF/26-132------------------
IL4_RABIT/28-143------------------
G5ASQ0_HETGA/25-138------------------
F6U5N6_HORSE/26-135------------------
IL4_BOVIN/26-133------------------
G3QSC0_GORGO/26-149------------------
A3FBF0_MUSPF/26-130------------------
IL4_RAT/27-139------------------
G3WEJ0_SARHA/28-149------------------
IL4_PIG/26-131------------------

PF00143

H8XX39_CHICK/27-182------------------
I3N7K4_ICTTR/69-238------------------
H0W3G0_CAVPO/26-185------------------
H0W510_CAVPO/26-185------------------
Q29098_PIG/26-180------------------
G5E7E1_LOXAF/9-168------------------
IFNE_MOUSE/27-185------------------
G3I0H8_CRIGR/26-185------------------
H0VF99_CAVPO/28-187------------------
L5KKJ7_PTEAL/25-192------------------
G1U0Q8_RABIT/26-185------------------
F6YZB3_ORNAN/25-183------------------
V8NNB8_OPHHA/15-183------------------
C8CKA7_PIG/26-185------------------
G3GXU9_CRIGR/27-182------------------
H0XSG1_OTOGA/26-185------------------
G1KX99_ANOCA/25-184------------------
G3I0I6_CRIGR/27-185------------------
IFNT4_SHEEP/26-185------------------
L8Y4J0_TUPCH/27-186------------------
F7B527_HORSE/26-183------------------
G1Q950_MYOLU/27-184------------------
M3XCW7_FELCA/26-186------------------
G5CB66_HETGA/27-185------------------
L9L941_TUPCH/27-198------------------
D2H9N6_AILME/27-184------------------
D3Z919_RAT/26-179------------------
C8CKB9_PIG/24-176------------------
A8E6F6_XENTR/27-179------------------
L8Y906_TUPCH/26-185------------------
L5KWM8_PTEAL/106-263------------------
G3WZJ8_SARHA/27-182------------------
G3UCD2_LOXAF/26-187------------------
K7GQJ6_PIG/17-164------------------
G3I0H3_CRIGR/26-178------------------
H0VYK7_CAVPO/28-181------------------
L5K635_PTEAL/26-185------------------
W5JYQ9_ASTMX/23-179------------------
H0Y0D2_OTOGA/28-187------------------
IFN_ANAPL/34-190------------------
G3UJX3_LOXAF/27-185------------------
G5C259_HETGA/26-185------------------
G3WZF5_SARHA/26-185------------------
IFNE_PIG/27-186------------------
W5N6G4_LEPOC/27-185------------------
H9KYA4_CALJA/26-185------------------
D2HTQ4_AILME/33-205------------------
IFNB_HUMAN/27-185------------------
G1NR05_MELGA/32-188------------------
F7BVP5_ORNAN/23-181------------------
F7G875_MONDO/27-182------------------
C8CKC3_PIG/33-205------------------
F7A317_HORSE/26-184------------------
G1KU56_ANOCA/28-182------------------
L5KBH2_PTEAL/26-185------------------
L5K909_PTEAL/26-185------------------
I3N5Z0_ICTTR/23-179------------------
F7GHL9_MONDO/26-181------------------
IFNE_HUMAN/27-186------------------
G3UK87_LOXAF/27-184------------------
L9LC61_TUPCH/27-185------------------
IFNB_RAT/27-182------------------
H0XMZ9_OTOGA/27-186------------------
G3VDC6_SARHA/27-182------------------
I3JM36_ORENI/26-182------------------
L5LKN9_MYODS/27-186------------------
G1TYS8_RABIT/29-195------------------
I3UJJ8_FELCA/27-185------------------
C8CKA9_PIG/26-183------------------
IFNT2_BOVIN/3-162------------------
M3Z729_MUSPF/26-183------------------
IFNA1_MOUSE/26-185------------------
G3TTC1_LOXAF/26-185------------------
G1PDS6_MYOLU/29-199------------------
F7ABU5_MONDO/27-182------------------
G1TTX4_RABIT/27-180------------------
H0XRP5_OTOGA/26-185------------------
H0WK94_OTOGA/33-202------------------
G1KYL3_ANOCA/23-176------------------
G3WZQ8_SARHA/26-181------------------
H0YTY6_TAEGU/34-188------------------
I3MXH1_ICTTR/27-185------------------
M3WRV1_FELCA/26-184------------------
R4GKJ6_CHICK/35-191------------------
A3FBE8_MUSPF/27-184------------------
G1KWE0_ANOCA/28-180------------------
G7PS89_MACFA/26-185------------------
G1Q880_MYOLU/26-185------------------
IFNB_MOUSE/27-180------------------
IFNB2_BOVIN/27-184------------------
G1SJC4_RABIT/26-185------------------
W5PG31_SHEEP/26-185------------------
IFNA3_CANLF/26-183------------------
G5BPX2_HETGA/27-199------------------
IFNW2_HORSE/26-185------------------
G3N2A8_BOVIN/26-185------------------
H0XKS8_OTOGA/27-185------------------
A0A286X8P0_CAVPO/26-185------------------
Q29412_PIG/27-184------------------
G7PS88_MACFA/26-185------------------
M3WZS7_FELCA/26-181------------------
H9GZR7_HORSE/26-185------------------
F1LVL8_RAT/26-184------------------
M3YX13_MUSPF/27-179------------------
G1L8G2_AILME/26-185------------------
IFNB_HORSE/27-184------------------
H0W289_CAVPO/26-190------------------
A8E6E8_MONDO/27-182------------------
I3N788_ICTTR/27-185------------------
G1L8I1_AILME/26-183------------------
IFNB_FELCA/27-184------------------
G3TS29_LOXAF/26-179------------------
W5PZ39_SHEEP/26-184------------------
G3I0H6_CRIGR/26-178------------------
M3Z715_MUSPF/26-183------------------
M3VXI8_FELCA/33-205------------------
G3R8Q7_GORGO/26-185------------------
A8E6F5_XENTR/51-202------------------

PF02947

FLT3L_MOUSE/30-162------------------
F6T7S9_ORNAN/28-157------------------
H9GP84_ANOCA/29-165------------------
F6TPW7_MONDO/34-163------------------
G5B8P0_HETGA/20-150------------------
G1M637_AILME/29-159------------------
L9JA37_TUPCH/769-910------------------
G3VSA3_SARHA/79-209------------------
G1QZC3_NOMLE/30-160------------------

PF00714

I3MNV6_ICTTR/15-152------------------
IFNG_HORSE/15-152------------------
H0WPL1_OTOGA/15-151------------------
Q8CGS0_CAVPO/15-154------------------
B9VS86_CALJA/15-152------------------
G3SUC6_LOXAF/15-152------------------
G3GY20_CRIGR/2-135------------------
L5LME8_MYODS/15-153------------------
G5BGB5_HETGA/15-152------------------
G3WQJ9_SARHA/15-153------------------
IFNG_SHEEP/15-152------------------
IFNG_RAT/14-151------------------
IFNG_RABIT/15-152------------------
L9KVU0_TUPCH/51-188------------------
IFNG_FELCA/15-153------------------

PF02372

IL15_PIG/33-160------------------
IL15_CAVPO/33-160------------------
IL15_FELCA/33-160------------------
IL15_SHEEP/33-160------------------
F1NZN5_CHICK/55-183------------------
G1NDP6_MELGA/5-137------------------
O73883_CHICK/5-138------------------
Q8JFF4_ANAPL/4-134------------------

PF00715

I3MQX6_ICTTR/7-151------------------
G5C793_HETGA/7-149------------------
G1PJ32_MYOLU/7-147------------------
B1AB81_HORSE/7-146------------------
G3HTL8_CRIGR/7-150------------------
IL2_MACMU/7-151------------------
H0Y254_OTOGA/7-149------------------
IL2_MOUSE/7-165------------------
G3SU90_LOXAF/7-147------------------
IL2_PIG/7-151------------------
IL2_FELCA/7-151------------------
L5K7D9_PTEAL/7-149------------------
IL2_BOVIN/7-152------------------
H0VBY4_CAVPO/7-149------------------

PF01415

M3WJR8_FELCA/15-127------------------
H0X0U6_OTOGA/15-141------------------
G1QNL2_NOMLE/28-172------------------
IL7_BOVIN/28-171------------------
F1PA23_CANLF/29-154------------------
IL9_MOUSE/15-141------------------
U3KN10_RABIT/31-153------------------
K7E262_MONDO/59-200------------------
E1BF10_BOVIN/18-141------------------
F6PLW3_HORSE/15-136------------------
IL9_HUMAN/15-141------------------
IL7_MOUSE/28-151------------------
G5BX09_HETGA/15-141------------------
L8Y4N8_TUPCH/15-141------------------
D4A8I9_RAT/15-141------------------
G3TKQ6_LOXAF/16-136------------------
M3YEX7_MUSPF/16-137------------------
G1NXN3_MYOLU/28-153------------------

PF00103

PLRP1_BOVIN/26-238------------------
CSH2_BOVIN/26-238------------------
PLRP3_BOVIN/1-213------------------
PR4A1_RAT/17-227------------------
CSH1_BOVIN/26-236------------------
PLRP4_BOVIN/26-239------------------
PR3D4_RAT/16-223------------------
PR2C2_MOUSE/16-224------------------
SOM2_HUMAN/9-215------------------
PR8A5_RAT/17-238------------------
PR6A1_RAT/20-234------------------
PR7D1_MOUSE/17-240------------------
CSH2_HUMAN/9-215------------------

PF01109

CSF2_RAT/18-139------------------
CSF2_MOUSE/18-136------------------
CSF2_BOVIN/18-138------------------
CSF2_CAVPO/18-140------------------
CSF2_PIG/18-139------------------
CSF2_HUMAN/18-139------------------
CSF2_CANLF/18-139------------------

PF02025

I3MDT8_ICTTR/22-133------------------
G1RQD7_NOMLE/22-133------------------
IL5_CAVPO/23-134------------------
J9NWP5_CANLF/22-132------------------
IL5_MOUSE/21-132------------------
G3WAR7_SARHA/25-134------------------
IL5_HORSE/22-133------------------
B5FW65_OTOGA/22-133------------------
G3T4B0_LOXAF/23-133------------------
G1SL79_RABIT/22-133------------------

PF02059

IL3_CANLF/19-132------------------
IL3_MOUSE/27-138------------------
IL3_BOVIN/18-132------------------
G3UC30_LOXAF/22-133------------------
G1MH15_AILME/18-131------------------
G1RQ11_NOMLE/20-137------------------
IL3_CALJA/19-136------------------
F1LS41_RAT/29-138------------------

PF00758

H0W023_CAVPO/30-191------------------
G3TYQ1_LOXAF/25-173------------------
W5K758_ASTMX/26-175------------------
B1N8Y2_DANRE/15-168------------------
F7DTH0_CALJA/31-193------------------
M3XJ62_LATCH/27-177------------------
G3W289_SARHA/30-190------------------
F6WUU2_MONDO/31-191------------------
G3VW20_SARHA/26-175------------------
G1PF99_MYOLU/45-207------------------
TPO_CANLF/25-176------------------
F7G570_MONDO/26-177------------------
H2LEX3_ORYLA/33-182------------------

PF00726

IL10_BOVIN/5-174------------------
IL10H_EBVB9/7-167------------------
G3HB01_CRIGR/14-174------------------

PF14565

IL22_HUMAN/40-178------------------
E1C1U2_CHICK/46-184------------------

PF15177

I3MK89_ICTTR/29-189------------------
H0VBN4_CAVPO/32-188------------------
IFNL3_CHICK/28-182------------------
F1M3K4_RAT/31-188------------------
F1PY54_CANLF/31-186------------------
H0XRJ1_OTOGA/35-191------------------
F6PNH9_HORSE/31-184------------------
D2DJP5_XENTR/23-178------------------
G3TQK4_LOXAF/32-188------------------
F7DXI8_HORSE/34-187------------------
F6W920_MONDO/30-184------------------
U3KED0_FICAL/27-186------------------
IFNL4_HUMAN/25-174------------------
IFNL2_MOUSE/32-189------------------
G3N0M3_BOVIN/37-192------------------
G1LPU9_AILME/37-191------------------
L5LZZ9_MYODS/163-319------------------
IFNL3_HUMAN/34-192------------------
F6R8C9_XENTR/23-177------------------
G3VJ97_SARHA/12-167------------------
H0XJU8_OTOGA/36-192------------------
G3HJD0_CRIGR/30-187------------------
G1LPW2_AILME/34-190------------------
L5L378_PTEAL/33-182------------------
G1T4B0_RABIT/34-188------------------
U3IYH6_ANAPL/34-185------------------
L9LBW1_TUPCH/31-181------------------
D0FHA1_PIG/36-191------------------

PF05337

CSF1_HUMAN/41-180------------------
Q3TLQ6_MOUSE/41-180------------------
O77709_BOVIN/41-180------------------
O77710_BOVIN/41-180------------------
Q64129_9MURI/41-180------------------

PF15036

IL34_MOUSE/28-184------------------
R4GIU3_CHICK/19-177------------------
F7EA00_CALJA/29-185------------------
H0WFN4_OTOGA/28-184------------------
M3ZVZ0_XIPMA/24-191------------------
U3JY35_FICAL/18-179------------------
L9KJY3_TUPCH/28-184------------------
G3T3A6_LOXAF/28-182------------------
F6W3U1_MONDO/15-167------------------
I3JZ08_ORENI/24-192------------------
L5MCR9_MYODS/28-182------------------
B3DLJ8_DANRE/23-195------------------
IL34_BOVIN/28-183------------------

PF02404

R4GD07_ANOCA/1-283EDNEISMLQQKDKSLLQV
SCF_CHICK/1-287EENEISMLQQKEKEHLQV
SCF_RAT/1-273EDNEISMLQQKEREFQEV
G1NWC8_MYOLU/1-272EDNEISMLQEKEREFQEV
F7EP53_MONDO/1-273EDNEISMLQENDGEFQEV
F7C5I3_ORNAN/1-273EDNEISMLQERERELQEV
F7G0W2_CALJA/1-273EDNEISMLQEKEREFQEV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window