Sequence alignment for CL0053

PF01109

CSF2_RAT/18-139--------------------------------------APTRSPNPVTRP--WKHVDA.IKEA--------------LSL
CSF2_MOUSE/18-136--------------------------------------APTRSPITVTRP--WKHVEA.IKEA--------------LNL
CSF2_BOVIN/18-138--------------------------------------APTRPPNTATRP--WQHVDA.IKEA--------------LSL
CSF2_CAVPO/18-140--------------------------------------APTDLLSPVTQS--WKHVDATINEA--------------LSL
CSF2_PIG/18-139--------------------------------------APTRPPSPVTRP--WQHVDA.IKEA--------------LSL
CSF2_HUMAN/18-139--------------------------------------APARSPSPSTQP--WEHVNA.IQEA--------------RRL
CSF2_CANFA/18-139--------------------------------------APTRSPTLVTRP--SQHVDA.IQEA--------------LSL

PF02025

G1RQD7_NOMLE/22-133------------------------------------------TEIPTSAL---------VKET--------------LAL
IL5_CAVPO/23-134------------------------------------------QSATLRAL---------VRET--------------LTL
J9NWP5_CANFA/22-132------------------------------------------VENPMNRL---------VAET--------------LTL
IL5_MOUSE/21-132------------------------------------------MEIPMSTV---------VKET--------------LTQ
G3WAR7_SARHA/25-134------------------------------------------..NPVTEL---------ISET--------------LSL
IL5_HORSE/22-133------------------------------------------VESPMNRL---------VAET--------------LTL
B5FW65_OTOGA/22-133------------------------------------------IEISMSTL---------VKET--------------LAL
I3MDT8_SPETR/23-134------------------------------------------LEIPMSTL---------VKET--------------LTL
G3T4B0_LOXAF/23-133------------------------------------------IEIPVHRL---------VAET--------------LAL
G1SL79_RABIT/22-133------------------------------------------TEIRMSTV---------VKET--------------LTL

PF02059

IL3_CANFA/19-132--------------------------------------.PQAQGRP.FSTDLPKQYFTMINEI--------------MEM
IL3_MOUSE/27-138--------------------------------------ASI.SGRDTHRLTRTLNCSSIVKEI--------------IGK
IL3_BOVIN/18-132--------------------------------------APQAKGLPVVTSRTP..YSMLMKEI--------------MDD
G3UC30_LOXAF/22-133--------------------------------------..KAQGMP.VTA..PQHYSVMINEI--------------KEI
G1MH15_AILME/18-131--------------------------------------APMAQGRS.LSTYQPKQYFEMISEI--------------MDI
F1RJV6_PIG/18-131--------------------------------------APQAQGMP.TTTLQPKNYLAMIQEI--------------TRS
G1RQ11_NOMLE/20-137--------------------------------------APMTQTTSLKTS..WVNCSNMIDEI--------------ITH
IL3_CALJA/19-136--------------------------------------AAPTQTMPLKTT..QVNCSNLREEI--------------VTL
F1LS41_RAT/29-138--------------------------------------GSA......HRLLRTLDCRTIALEI--------------LVK

PF07400

IL11_HUMAN/1-199-----------------MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLT--------------RSL

PF00758

G3TYQ1_LOXAF/25-173----------------------------------PPACDPRLLNKLLRDSHILHSRLSQCPDF--------------NPL
W5K758_ASTMX/26-175----------------------------------RPICDLRVLDHFIKEAWDAEATMRVCKED--------------CSI
B1N8Y2_DANRE/15-168----------------------------------RPICDLRVLDHFIKEAWDAEAAMRTCKDD--------------CSI
F7DTH0_CALJA/31-193----------------------------------HLICDSGVLERYVLEGKEAENVTMGCAES--------------CSL
M3XJ62_LATCH/27-177----------------------------------RPVCDTSVMDKFIEDAKDAESFVNGCTEA--------------CEL
G3W289_SARHA/30-190----------------------------------.PFCESHILERYILEAKEAQNATVACLED--------------CSL
F6WUU2_MONDO/31-191----------------------------------.PFCDSHILERYILEAKEAQNATVRLHPR--------------RNI
G3VW20_SARHA/26-175----------------------------------APVCDPRLFNKLLRDSAALHSRLSQCSDL--------------GPL
G1PF99_MYOLU/45-207----------------------------------RLICDSRVLERYILEAREAENVTMGCAEG--------------CSF
TPO_CANFA/25-176----------------------------------PPACDPRLLNKMLRDSHVLHSRLSQCPDI--------------YPL
F7G570_MONDO/26-177----------------------------------APVCDPRLFNKLLRDSAALHSRLSQCSDL--------------SPL
H0W023_CAVPO/30-191----------------------------------RLICDSTVLERYIVEAKDAENVTMSCTEG--------------CSL
H2LEX3_ORYLA/33-182----------------------------------RPICDLRVLNHFIQEARDAEVAMRSCREG--------------CGL

PF06875

Q5BNQ4_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVLFSEVQKFAEDIQSSADSLLPTY-LSFQGAPLSD
Q5BNQ2_9SALA/2-215RSTSLLTFLV----------VSLSTATSLAMAEINDVADLSSDTIVRFSEVQKFAEDIQSSADSLLPTY-LSFQGAPLSD

PF01110

CNTF_CHICK/1-194--------------------MAAADTPSATLRH----HDLCSRGI-------RLARKMRSDVTDLLDIY-VERQGL----
G3VWZ5_SARHA/1-195--------------------MAFPENTPLTPHH----RDLCTRSI-------WLARKIRSDLTSLLESY-VEYQGL----
E1BFH9_BOVIN/1-193--------------------MAFAEHSLLPPHR----RDLCSRSI-------WLARKIRSDLTALVDSY-MKHQGL----
G5AP46_HETGA/1-192--------------------MAFAELSPLTPHR----RDLCSRSI-------WLARKIRSDLTALMDSY-VKHQGL----
H0Z9U1_TAEGU/1-188--------------------MAASESPSAALRR----RDLCSRGI-------RLAGKMRADVVDLLDAY-VEQQGL----
CNTF_HUMAN/1-194--------------------MAFTEHSPLTPHR----RDLCSRSI-------WLARKIRSDLTALTESY-VKHQGL----

PF01291

LIF_MOUSE/44-203--------------------------------------NLMNQIK-------NQLAQLNGSANALFISY-YTAQGEPFPN
LIF_BOVIN/43-202--------------------------------------NLMNQIR-------NQLGQLNSSANSLFILY-YTAQGEPFPN
ONCM_HUMAN/37-209--------------------------------------VLLGQLQ-------KQTDLMQDTS.RLLDPY-IRIQGLDVP.
ONCM_MOUSE/34-194--------------------------------------QLLSQLQ-------NQANLTGNTE.SLLEPY-IRLQNLNTP.
ONCM_BOVIN/34-194--------------------------------------ELLLQLQ-------RQADLMQDPS.TLLDPY-IHLQGLHSP.

PF03039

IL12A_MOUSE/6-215YLLFLATLAL...LNHLSLARVIPVSGP......ARCLSQSRNLL-------KTTDDMVKTAREKLKHYSCTAEDIDHED
G3VQT1_SARHA/40-247..FLIAILIG...LSQVNWVKSIPVIQSEPSM..HQYLRGSKNLL-------GTVTETLQQARQKLELYSCSLEEIDHED
F6T5A8_MONDO/5-202HIFLIATLIG...LSQIHWATSLPVPQPEPSM..PQCLTASKNLV-------EATNEILQKSRKILELYPCSLEEIDHED
IL12A_PIG/6-222NLLLVATLVLLNHLDHLSLGRSLPATTAGPGM..FKCLNHSQNLL-------KAVSNTLQKAKQTLEFYSCTSEEIDHED
L8YEA2_TUPCH/1-213.LLLAATLVL...LHHGTLARNLPTAMPGPGK..FGCLSHSQNLL-------TAISNTLQKARKNLEFYSCTSEEIDHED
H0X861_OTOGA/6-217SLLLVAILVL...LDHLSLARNLPRPTPEPGR....CHQHSQKLL-------EAVSTTLQKARETLNSSSHTSEEIDHED
G1QWH2_NOMLE/40-254SLLLVATLVL...LDHLSLARNLPVATPGPGM..FPCLHHSQNLL-------RAVSNMLQKARQTLEFYPCTSEEIDHED
I3MN91_SPETR/4-220GLLLLASLVL...LEHLGSARNLPRSTPVPAVS.QECHNLSQTLL-------STVDSALQNAIEILEHYPCSAEEVNHED
Q924V6_CAVPO/6-221KCLLLTSLVL...LVSCSLARNLPRASPAPVTEPVQCFNHSQTLL-------RAVNSELHKAIQMLAVYSCTPEEIDHED

PF02024

H3AP27_LATCH/26-169-----------------------------------------------------.IEKVKSDARNLTRII-----------
G3WWV6_SARHA/23-167-----------------------------------------------------PIRKVQDDTKTLTKTI-----------
F6PLK2_ORNAN/23-167-----------------------------------------------------SIEKIQADTKTLTKTI-----------
F7HGW1_CALJA/23-167-----------------------------------------------------PIQRVQDDTKTLIKTI-----------
G5BHA4_HETGA/23-167-----------------------------------------------------PIQKVQDDTKTLIKTI-----------
W5NER9_LEPOC/28-172-----------------------------------------------------...RVKNDARLLAQTT-----------
H0V7C6_CAVPO/23-165-----------------------------------------------------PMQKLQDDAKFLIKTI-----------
LEP_HUMAN/23-167-----------------------------------------------------PIQKVQDDTKTLIKTI-----------

PF00143

I3MVD7_SPETR/41-186--------------------------------....EEGAL-TLL.EKMR...RIPTFSCLNY--------------RKD
M3WTR1_FELCA/30-186--------------------------------HAQVSRDNL-VLL.GQMR...RLSPFLCLRA--------------RKD
G3UK87_LOXAF/31-177--------------------------------LGLGKQETF-TPL.GQMR...R...FFCLKE--------------RKD
H0W7G8_CAVPO/30-185--------------------------------HSQRNARAL-LLL.EQMK...RISTFSCLKH--------------RQD
IFNB_HORSE/31-184--------------------------------LRSSNSACL-MLL.RQLN...GAPQ.RCPED--------------TMN
G5BPX2_HETGA/32-192--------------------------------.STVTKENV-RLL.SSVS...NPLPLRCLRE--------------IKA
I3JM36_ORENI/31-182--------------------------------.KQHNEETL-KLL.DTMA....NNSTNITEV--------------EVT
L8Y906_TUPCH/30-185--------------------------------LDSGKQETL-TAL.AQMG...TISFLSCLKD--------------RTD
F7BVP5_ORNAN/27-181--------------------------------QWLNNWQSL-HLL.DEMG...GQFPLHCLKE--------------RMK
H2R6R8_PANTR/30-185--------------------------------HNLGNRRAL-ILL.AQMG...RISPFSCLKD--------------RHD
F6YZB3_ORNAN/30-179--------------------------------..ADVEQSL-NRL.DRMK...GKSLLSCLEH--------------RKD
F7ABU5_MONDO/29-182--------------------------------..LGLQEDF-SLL.NQMS...TSSLVPCLKD--------------GIN
IFNB_RAT/31-182--------------------------------QSTSIRTCQ-KLL.RQLN...GRLN...LSY--------------RTD
I3N788_SPETR/31-185--------------------------------QSSSSLECQ-KLL.QQLN...GRPE.DCLSD--------------RMD
G5C259_HETGA/30-185--------------------------------HSQGNRRAL-TLL.EQMR...RISTFSCLKD--------------RED
H0XKS8_OTOGA/31-185--------------------------------QRRSTLGCQ-KLL.RQLN...GKPE.GCLKD--------------RMN
G5E7E1_LOXAF/13-168--------------------------------HTLTSKKTF-VVL.DQMR...RLSPFSCLKE--------------RKD
G3GXU9_CRIGR/31-180--------------------------------QRKCNSECL-EVL.RQLH...GPL...CLNH--------------RMD
H0XRP5_OTOGA/30-185--------------------------------HSLGNRRAL-IPL.VHMR...RISPFSCLKD--------------RSD
G1L8G2_AILME/30-185--------------------------------HGLFAWRAL-TLL.SQME...RISILSCLKD--------------RTD
H0W510_CAVPO/30-182--------------------------------HSQGNMRAL-ILL.GQRR...RISAFSCLKH--------------RQD
G1Q880_MYOLU/30-185--------------------------------HILLSRENL-ELL.SQMS...TISPFFCLKD--------------RKD
D2HTQ4_AILME/37-205--------------------------------LRKVTWQNL-RLL.SSTS...SSFPVECLRE--------------TKA
IFNE_PIG/31-186--------------------------------QRRVNRESL-KLL.NKLQ...TSSIQQCLPH--------------RKN
H0XSG1_OTOGA/30-185--------------------------------HSLGNRRAL-KVL.AQMR...RISPFSCLKD--------------RSD
A8E6E8_MONDO/30-182--------------------------------...GLQEDF-SLL.NQMS...TFSLVPCLKD--------------RTS
C8CKA7_PIG/30-185--------------------------------HSLAHTRAL-RLL.AQMR...RISPFSCLDH--------------RRD
G1NR05_MELGA/36-188--------------------------------DANFSWKSL-QLL.QKAA...PPPPQNCPQQ--------------DVT
G3I0H3_CRIGR/33-178--------------------------------...GEKTAL-TLL.KEMM...RLSPFSCLKD--------------RKD
I3LBU7_PIG/30-179--------------------------------HVHVSRKNL-VLL.CQMR...RISPSFCLKG--------------RKD
C8CKC3_PIG/37-205--------------------------------LRRVSWQNL-RLL.SRMS...HSFPIECLTE--------------SKA
IFNE_MOUSE/33-185--------------------------------...MNRESL-QLL.KPLP...SSSVQQCLAH--------------RKN
G3N2A8_BOVIN/30-185--------------------------------HMLVGRKNL-RLL.GQMR...RLSSRFCLQD--------------RKD
G3WZJ8_SARHA/30-182--------------------------------...GLQEDF-SFL.NQIS...VFSLLPCLKD--------------RTN
G1KU56_ANOCA/35-182--------------------------------...DNKENL-AVLKSQLG...SVFPLQCLND--------------VIS
G1KX99_ANOCA/29-180--------------------------------LRQASQVYL-ELLNSKMNSTISTIPQQCFED--------------VFN
L5K909_PTEAL/30-184--------------------------------HSLVNRRAL-MLL.GQMR...RISPFSCLKD--------------RED
H0VUV7_CAVPO/30-185--------------------------------YMQGNTTAL-SLL.EQMR...RTFTFSCLKH--------------RQD
L5K635_PTEAL/30-183--------------------------------LDLGKQETS-TAL.NQMQ...RISSFLCQKD--------------RKD
G5CB66_HETGA/31-185--------------------------------QRSSSLACG-ELL.KQLK...GKPE.YCLKD--------------RMD
L5LKN9_MYODS/31-186--------------------------------QRRVNRESS-ELL.KKWQ...PSSIRQCLPH--------------RKD
H0XMZ9_OTOGA/31-186--------------------------------QRRVNRESI-KLL.NELQ...TSSVQQCLPH--------------RKN
H9KYA4_CALJA/30-185--------------------------------HSLSNRRAS-ILL.AQMR...RISPFSCLKD--------------RQD
H0YTY6_TAEGU/41-187--------------------------------...FPGDAL-RLL.QDMA...PSHTQPCHLQ--------------EPP
A8E6F5_XENTR/55-202--------------------------------QEYLNRQTL-KTF.EEMNPP.EDYDESCQYD--------------SIE
G7PS89_MACFA/30-185--------------------------------HSLGYRRPL-VLL.AQMR...RISPFSCLKD--------------RHD
I3MY95_SPETR/37-186--------------------------------SEKNEEGAL-NLL.KEMR...RIPTSSCLND--------------RKD
G3WZF5_SARHA/30-185--------------------------------QRRTNKSSI-YLL.KKMI...GELHPECQKD--------------RMD
H0VF99_CAVPO/32-187--------------------------------QQRSSLACL-KLL.RQVK...GKPE.NCHQD--------------RID
L8Y8F8_TUPCH/30-184--------------------------------PGQLSRKTL-VLL.GQMR...RISLILCLKD--------------RRD
F1LVL8_RAT/29-184--------------------------------QSRRNRESL-QLL.KALP...SSSVQLCLAH--------------RKN
G1Q950_MYOLU/31-184--------------------------------QSSSNSACQ-KLL.WQLI...TSPQ.HCLDD--------------RMD
I3N5Z0_SPETR/27-178--------------------------------.QRIKEENL-QLL.NNLQ...TSSIQQCLPY--------------RKN
A3FBE8_MUSPF/31-184--------------------------------LSSSSVECQ-ELL.LQLN...GTSK.DCLKD--------------RMN
G3UCD2_LOXAF/30-187--------------------------------HRLANRRTL-ILL.EQMR...RISPSSCLKD--------------RND
L9LC61_TUPCH/31-185--------------------------------LSGSSLACK-KFL.QQLG...GVPE.DCLKD--------------RMS
H0Y0D2_OTOGA/32-187--------------------------------PILNTAVTL-KIL.AQMR...RIHPFLCLKD--------------RRY
L5KKJ7_PTEAL/32-192--------------------------------.....WQNL-KLL.SSMR...NSFPKDCLRE--------------NKA
L5KWM8_PTEAL/110-263--------------------------------HVQVSKENI-AIL.HQMQ.....NSFSCWKD--------------TKN
F7GHL9_MONDO/29-181--------------------------------...GLQKDF-SLL.NQMS...TSSLVPCLKE--------------WTN
G3TS29_LOXAF/30-179--------------------------------..HSNQETF-TLL.NQME...RISLLSCLKD--------------RTD
W5PZ39_SHEEP/33-184--------------------------------...VTWQNL-RLL.SRMS...NSFPIECLQE--------------RKA
D2H9N6_AILME/31-184--------------------------------LSSSSVECQ-NLL.LQLN...GTTK.DCIKD--------------RMN
IFNT4_SHEEP/30-185--------------------------------LMLDARENL-KLL.DRMN...RLSPHSCLQD--------------RKD
F7A317_HORSE/30-183--------------------------------HSLGNTRVL-MLL.GQMR...RISPFSCLKD--------------RND
G3TTC1_LOXAF/30-185--------------------------------HTVASEKTV-DLL.DQMQ...RCPTFFCLDD--------------RKD
Q29412_PIG/31-184--------------------------------QRSSNLACQ-KLL.GQLP...GTPQ.YCLED--------------RMN
IFNB_MOUSE/31-180--------------------------------ERTNIRKCQ-ELL.EQLN...GKIN...LTY--------------RAD
IFNA3_CANFA/30-183--------------------------------HSLRNWRVL-TLL.GQMR...RLSASSCDHY--------------TTD
IFNB_HUMAN/31-185--------------------------------QRSSNFQCQ-KLL.WQLN...GRLE.YCLKD--------------RMN
I3UJJ8_FELCA/30-185--------------------------------QQRVNRESL-KLL.STLQ...SSSIQQCLPH--------------RKN
M3Z729_MUSPF/30-183--------------------------------HGLLHWRAL-MLL.RQMK...RVSAFSCLRD--------------RND
H0W289_CAVPO/30-190--------------------------------FILLSRKIL-ELL.DQMR...RISTFLCLKD--------------RRD
G3WZQ8_SARHA/29-181--------------------------------...GLQEDF-SLL.NQMS...TFFLLPCLKD--------------RTN
G1KYL3_ANOCA/28-176--------------------------------.REANQANL-DVLHRNMG...PSISQQCIDD--------------VFS
G1U0Q8_RABIT/30-185--------------------------------SVPLSRKTL-VLL.GQMR...RVSPVLCLKD--------------RRD
G1TYS8_RABIT/33-195--------------------------------LNRVIRKNM-KLL.RNVS...HSFPIECLRE--------------IKD
G1SJC4_RABIT/30-185--------------------------------HSLSDRRSS-MLL.GQMR...RVSPLSCLQD--------------RHD
IFN_ANAPL/38-190--------------------------------DSAFAWDSL-QLL.RNMA...PSPTQPCPQQ--------------HAP
A8E6F6_XENTR/31-179--------------------------------QEYLNTQIL-KAF.NEMMPL.KETEEICEEH--------------PTD
M3WRV1_FELCA/30-184--------------------------------HGLLNRRAL-TLL.GQMR...RLPASSCQKD--------------RND
L8Y4J0_TUPCH/31-186--------------------------------QRRVNRESF-KLL.NTLR...SSSIQQCLPH--------------RKN
F7G875_MONDO/31-182--------------------------------QRRTNQRSL-MFL.NKMI...GKLHPECLQE--------------RMD
I3N7K4_SPETR/37-197--------------------------------LDMSTSENL-MLL.TNLS...NSIPVQCFRE--------------IHN
IFNT2_BOVIN/7-162--------------------------------HMLGARENL-RLL.ARMN...RLSPHPCLQD--------------RKD
G1L8I1_AILME/30-183--------------------------------HGLFAWRAL-TLL.GQMK...RMTAFSCLKD--------------RND
V8NNB8_OPHHA/22-183--------------------------------...ANKDNS-NLLSSNIR...PTTPLQCMRS--------------FVE
G3SI98_GORGO/35-185--------------------------------....TWQNL-RHL.SSMS...NSFPVECLRE--------------NIA
H9GZR7_HORSE/30-185--------------------------------LDLRKQETL-RVL.DQME...TISPPSCLKH--------------RTD
G3I0I6_CRIGR/31-185--------------------------------.SRMKRESL-HLL.KTLP...ISSVYQCLAH--------------RKN
W5JYQ9_ASTMX/29-179--------------------------------.RRLVQTCH-HLL.DSMG...GAFPFRCLDD--------------YVL
G3I0H8_CRIGR/30-185--------------------------------HNIRNRKPL-TLL.AQMR...RLSPLSCLKD--------------RKD
K7GQJ6_PIG/18-164--------------------------------....QQKNL-ALL.CQIR...RISPSFCLKD--------------RKD
I3L756_PIG/30-180--------------------------------HVHVSRKNL-VLL.HQMR...RLSPSFCLKD--------------RKD
IFNE_HUMAN/31-186--------------------------------QRQVNQESL-KLL.NKLQ...TLSIQQCLPH--------------RKN
IFNW2_HORSE/30-185--------------------------------HILVSRKNF-VLL.GQMS...RISSAICLKD--------------RKD
G1KWE0_ANOCA/33-180--------------------------------.RQANQANL-ELLNSKMG...STIPQQCIED--------------VFS
IFNA1_MOUSE/30-185--------------------------------HNLRNKRAL-TLL.VQMR...RLSPLSCLKD--------------RKD
IFNB2_BOVIN/31-184--------------------------------QRRSLALCQ-KLL.RQLP...STPQ.HCLEA--------------RMD
G3UJX3_LOXAF/31-185--------------------------------QRSSNLACQ-KLL.WKLN...GAPE.SCLED--------------RMD
L9L941_TUPCH/34-198--------------------------------...VTWQNL-RLL.SSMS...NSFPVECLRE--------------NKA
W5N6G4_LEPOC/31-180--------------------------------LGNINEKSI-QAL.KEMG...GGFPVECVSQ--------------IIT
D3Z919_RAT/29-179--------------------------------.....THNL-TVL.KQMS...RQSPVSCLKD--------------IQY
IFNB_FELCA/31-184--------------------------------LRSSSLECQ-ELL.VNLN...RTSK.YCLKD--------------RMN
M3YX13_MUSPF/32-179--------------------------------..RVNRE.L-KLL.NKFP...KSSVQPCLPH--------------RTN
M3VXI8_FELCA/39-205--------------------------------..EVTWQNL-RLL.NSMS...NSFPVECLRE--------------SRA
W5PG31_SHEEP/30-185--------------------------------HSLANRRVL-TLL.RQLR...RVSPSSCLQD--------------RKD
F7B527_HORSE/29-183--------------------------------.RQRNQETI-TLL.SQME...RISTLLCLKD--------------RAD
M3WZS7_FELCA/29-181--------------------------------...SNPETF-TLL.SQME...RVSILSCLKD--------------RTD
G3VDC6_SARHA/30-182--------------------------------...GLQEDV-SLL.YQMS...TFSLLSCLKD--------------RTD
H9L1C3_CHICK/32-182--------------------------------QRRVIESSL-QLL.DKMG...RRFPQQCLRE--------------KMS
C8CKB9_PIG/28-175--------------------------------HRLENREIF-MLL.RQMK...RTSSQACLKD--------------RTD
H0VYK7_CAVPO/32-181--------------------------------QRSSNSACL-KLL.RQVK...GKPE.HCQQD--------------RMD
L5KBH2_PTEAL/30-185--------------------------------HVQVSKENI-ALL.HQMQ...RISSFRCRKD--------------RKN
G3R8Q7_GORGO/30-185--------------------------------HGLLSRNTL-VLL.HQMR...RISPFLCLKD--------------RRD
R4GKJ6_CHICK/39-191--------------------------------DATFSHDSL-QLL.RDMA...PTLPQLCPQH--------------NAS
G7PS88_MACFA/30-185--------------------------------HSLDNRRTM-MLL.KQMS...RISPSSCLMD--------------RHD
M3Z715_MUSPF/30-183--------------------------------HSLLHWRAL-MLL.RQMK...RISLIFCDKY--------------IND
H0VXI5_CAVPO/30-181--------------------------------HSQGNTRAL-ILL.GQMR...RISTFSCLKD--------------RQG
G3I0H6_CRIGR/31-178--------------------------------.KPGNKTAL-TLL.KEMR...RLSPFSCLKD--------------RKV
C8CKA9_PIG/29-183--------------------------------.SHDNPEIF-TLL.RQMG...RLSILSCLKD--------------RTD
H0W3G0_CAVPO/30-185--------------------------------SVLLCKKTF-VLL.GQIR...KMPRSLCLKD--------------RSN
G1PDS6_MYOLU/36-199--------------------------------.....WQNV-ELL.TNMS...KSLPLECLRE--------------NKA
H0W4H8_CAVPO/27-181--------------------------------QQRMNRLSL-QLL.NNLR...TSLVQQCLLH--------------KKS
G1TTX4_RABIT/34-180--------------------------------...GSLTCA-KLL.LQLN...GTTE.DCLNE--------------RIN
I3MXH1_SPETR/31-185--------------------------------QFNSSVECQ-KLL.EQLN...GRPA.DCLSD--------------RMD
H0WK94_OTOGA/40-202--------------------------------...VTLQNL-RLL.SSMS...NSFPRECLKE--------------NKD

PF02947

FLT3L_MOUSE/30-162--------------------------------DCYFSHSPI.SSN--------FKVKFRELTD--------------HLL
F6T7S9_ORNAN/28-157--------------------------------ACAFRYSPV.SSM--------FGLHIHNLAQ--------------YLL
H9GP84_ANOCA/29-165--------------------------------GCIFGSVPIDTSD--------FPSIVKNLKK--------------LLL
F6TPW7_MONDO/34-163--------------------------------SCTFPDSPI.SST--------FLQAIGRLSD--------------YLL
G5B8P0_HETGA/20-150--------------------------------SCSFSHNPI.SSD--------FKIKFSTLSD--------------YLL
G1M637_AILME/29-159--------------------------------DCAFSHSPI.SST--------FSVTIHKLSD--------------YLL
L9JA37_TUPCH/769-910--------------------------------....QGSPI.AST--------FADRIDQLSD--------------YLL
G3VSA3_SARHA/79-209--------------------------------PCSFPDSPI.SSI--------YPGIISTLSD--------------FML
G1QZC3_NOMLE/30-160--------------------------------DCSFQHSPI.SSD--------FAVKIRELSD--------------YLL

PF00714

IFNG_HORSE/15-152-------------------------------------------IL--------GSSTYYCQA------------------
H0WPL1_OTOGA/15-151-------------------------------------------LL--------GSSAFYCRV------------------
Q8CGS0_CAVPO/15-154-------------------------------------------IL--------SFSSYYCQS------------------
B9VS86_CALJA/15-152-------------------------------------------VL--------GSLGCYCQD------------------
G3SUC6_LOXAF/15-152-------------------------------------------IL--------GSSSCYCQA------------------
G3GY20_CRIGR/2-135-------------------------------------------..--------..SGCYCQR------------------
I3MNV6_SPETR/15-152-------------------------------------------IL--------GSSSYYSQD------------------
L5LME8_MYODS/15-153-------------------------------------------IL--------GFSSCYSQS------------------
G5BGB5_HETGA/15-152-------------------------------------------IL--------GFSTYYCES------------------
G3WQJ9_SARHA/15-153-------------------------------------------IL--------SSSGCLSQV------------------
IFNG_SHEEP/15-152-------------------------------------------LL--------GFSGSYGQG------------------
IFNG_RAT/14-151-------------------------------------------LM--------ALSGCYCQG------------------
IFNG_RABIT/15-152-------------------------------------------IL--------GSYGCYCQD------------------
L9KVU0_TUPCH/51-188-------------------------------------------IL--------GSSSCYCQA------------------
IFNG_FELCA/15-153-------------------------------------------IL--------CSSGYYCQA------------------

PF05337

CSF1_HUMAN/1-254----------------------------MTAPGAAGRCPPTTWL..GS---LLLLVCLLASRSITEE-VSEYCS......
CSF1_HUMAN/272-554----------------------------STIGGSPQPRPSVGAFNPGM---EDILDSAMGTNWVPEE-ASGEASEIPVPQ
Q6GMN4_RAT/265-566----------------------------QPNHEDPQPHPSAGAPIPGV---EDIIESSMGTNWVLEE-ASGEASEGFLTQ
O77709_BOVIN/1-254----------------------------MTARGAAGRCPPTTWL..GP---LLLLACLLVSNGATEE-VSENCS......
Q64129_9MURI/1-257----------------------------MTARGRAGPCPSSTWL..GS---RLLLVCLLMSRSIAKE-VSEHCS......
CSF1_MOUSE/273-552----------------------------LT..EDSQPHPSAGGPVPGV---EDILESSLGTNWVLEE-ASGEASEGFLTQ
O77709_BOVIN/274-554----------------------------TG..DSPQPGPSVGAFVTGM---EDVLDSLLGANIALEE-GSGEASEGPIPQ
Q3TLQ6_MOUSE/1-254----------------------------MTARGAAGRCPSSTWL..GS---RLLLVCLLMSRSIAKE-VSEHCS......
O77710_BOVIN/1-257----------------------------MTARGAAGRCPPTTWL..GP---LLLLACLLVSNGATEE-VSENCS......

PF02404

R4GD07_ANOCA/1-283----------------------------MK--------TAQTWIITCFYLQLLLLHPLVKTQSPCGNPVTDDVNDIAKLV
SCF_CHICK/1-287----------------------------MK--------KAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLV
SCF_RAT/1-273----------------------------MK--------KTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLV
G1NWC8_MYOLU/1-272----------------------------..--------KTQTWIITCIYLQLLLFNHLVRTTGICTNRVTDDVKDVTKLV
F7EP53_MONDO/1-273----------------------------MK--------KTQTWIITCIYLQLLLFNPLVKTKGICGNPVTDDVKEITTLV
F7C5I3_ORNAN/1-273----------------------------MK--------KTQTWIITCIYLQLLLFIPLIRAQKNCGNPVTDDVKDITKLV
F7G0W2_CALJA/1-273----------------------------MK--------KTQTWILTCIYLQLFLFNPFVKTEGVCRNRVTNNVKDVTKLV

PF00489

IL6_BOVIN/27-208-----------------------------------PTPGPLGEDFKNDT----TPGRLLLTTP--------------EKT
M3X721_FELCA/27-208-----------------------------------PTPGPLGGD....A----TSNRLPLTSA--------------DKM
IL6_HORSE/27-208-----------------------------------PTPLPLGED...ET----TSNGPLLTTA--------------DKT
G3UHF3_LOXAF/20-205-----------------------------------PNPKPLEGDSKDDA----ASNRPSLTSP--------------DKT
L5KPK4_PTEAL/20-202-----------------------------------PIPVPSGEDSKDDT----NSNRPQLTSP--------------NQT
F7HV62_CALJA/27-212-----------------------------------PAPVPLGEDSKEVA----APNRQLLTST--------------ERI
IL6_MOUSE/26-210-----------------------------------PTSQVRRGDFTEDT----TPNRPVYTTS--------------.QV

PF16647

CSF3_BOVIN/42-190--------------------------------------------------------------------------------
CSF3_HUMAN/51-202--------------------------------------------------------------------------------
CSF3_MOUSE/57-205--------------------------------------------------------------------------------

PF02372

IL15_PIG/33-160-----------------------------------VFILGCISAGLPKT----EAT...WQ----------------...
IL15_CAVPO/33-160-----------------------------------VFVWGCISAGLPKT----EAS...WH----------------...
IL15_FELCA/33-160-----------------------------------VFILSCINAGLPKT----EAN...WQ----------------...
IL15_SHEEP/33-160-----------------------------------VFILGCISAGLPKT----EAN...WQ----------------...
F1NZN5_CHICK/55-183-----------------------------------.FFL.C..AYVPKT----EANHCKWS----------------...
G1NDP6_MELGA/5-137-----------------------------------VLIFSCISVALLMT----TAYGASLS----------------PEK
O73883_CHICK/5-138-----------------------------------VLIFGCISVAMLMT----TAYGASLS----------------SAK
Q8JFF4_ANAPL/4-134-----------------------------------VLIFSCLSVLMLMT----TAYGAPLS----------------EKD

PF00715

I3MQX6_SPETR/7-151--------------------------------------LSCLALTLALL----AHGAPTSGSA..............EET
G5C793_HETGA/7-149--------------------------------------LSCIALTLALI----TSSAPTSSST..............RET
G1PJ32_MYOLU/7-147--------------------------------------LSCIALTLAFI----ADGAPTSSSS..............QET
B1AB81_HORSE/7-146--------------------------------------LACIALTLAVL----ANSAPTSSSK..............RET
G3HTL8_CRIGR/7-150--------------------------------------ASCLALTLALL----VNSAPTSSSK..............KET
IL2_MACMU/7-151--------------------------------------LSCIALSLALV----TNSAPTSSST..............KKT
H0Y254_OTOGA/7-149--------------------------------------LTCIALTFALV----TNSAPISSST..............KET
IL2_MOUSE/7-165--------------------------------------ASCVTLTLVLL----VNSAPTSSSTSSSTAEAQQQQQQQQQQ
G3SU90_LOXAF/7-147--------------------------------------LSCIALTLALV----ANSAPTSSST..............KET
IL2_PIG/7-151--------------------------------------LCCIALTLALM----ANGAPTSSST..............KNT
IL2_FELCA/7-151--------------------------------------LSCIALTLILV----TNSAPASSST..............KET
L5K7D9_PTEAL/7-149--------------------------------------LSCIALTLALV----ADGAPTSSSR..............KET
IL2_BOVIN/7-152--------------------------------------LSCIALTLALV----ANGAPTSSST..............GNT
H0VBY4_CAVPO/7-149--------------------------------------LSCLALTLALL----TSSAPTSSSP..............KQT

PF00103

PLRP1_BOVIN/26-238--------------------------------------LLMSNLLLCQ.....GKSCPSCGPDVFVSLRKSFTDRFMNAA
CSH2_BOVIN/26-238--------------------------------------LVVSNLLLCQ.....GISCPSCGPDMFVSLQKSLIDVFINAA
PLRP3_BOVIN/1-213--------------------------------------MVMSNLLLCQ.....VNSCPSCCPDVFDIPLESLTHLFLNAS
PR4A1_RAT/17-227--------------------------------------LLVSNLLLWEN....TASAMRAKLL.NVHNYTSYGDTWNQAI
CSH1_BOVIN/26-236--------------------------------------LVVSNLLLCQGVEDYAPYCKNQPGN....CRIPLQSLFERAT
PLRP4_BOVIN/26-239--------------------------------------LVMSNLLLCQ.....GILCPSLCPDGDDVCRASLIDLFVHAS
PR3D4_RAT/16-223--------------------------------------LLVSNLLLWEN....MASKPTVLVS........TEDLYHRLV
PR2C2_MOUSE/16-224--------------------------------------LLVNSSLLWKN....VASFPMCAMR.NGRCFMSFEDTFELAG
SOM2_HUMAN/9-215--------------------------------------LLLAFGLLCLSWLQEGSAFPTIP..........LSRLFDNAM
PR8A5_RAT/17-238--------------------------------------LVVSNLLLWEK....AASIPACMVE.DGGCWDPLREAFNSAT
PR6A1_RAT/20-234--------------------------------------LLMSNILLWEN....VASVPRHASGAGRG.EMSLHGLLDHAI
PR7D1_MOUSE/17-240--------------------------------------LLMSNLFLWEK....VSSAPINAS...EAVLSDLKDLFDNAT
CSH2_HUMAN/9-215--------------------------------------LLLAFALLCLP...WLQEAGAVQ.......TVPLSRLFDHAM

PF03487

G1SCQ2_RABIT/16-144-----------------------------------ALWWAVAIAVTCLG----SLVSPGPVPP-------------.PT.
IL13_HUMAN/16-144-----------------------------------ALLLTTVIALTCLG----GFASPGPVPP-------------.ST.
IL13_RAT/2-130-----------------------------------ALWVTAVLALACLG----GLATPGPVRR-------------STSP
F7DGH7_MACMU/16-151-----------------------------------ALLLTMVIALTCLG----GFASPSPVPP-------------.ST.
L5M5Z7_MYODS/2-128-----------------------------------ALWLTLVIVLTCFG----GLASPGPVRP-------------.LT.
G5ASP9_HETGA/2-130-----------------------------------ALWVTVVLALTCLS----ALTAPGPVPS-------------.SA.
B3GDZ5_PIG/2-130-----------------------------------ALWLTLVIALTCFG----GLASPGPVPP-------------HST.
L8YAP6_TUPCH/2-128-----------------------------------ALWLTVVIALTCLG----GLASPASVPS-------------.IR.
IL13_BOVIN/2-130-----------------------------------ALLLTAVIVLICFG----GLTSPSPVPS-------------.AT.
IL13_MOUSE/2-130-----------------------------------ALWVTAVLALACLG----GLAAPGPVPR-------------SVSL
H0W834_CAVPO/16-149-----------------------------------AFWVTVVLALACLG----GLTAPGPVPV-------------SSTV
F6WQF3_ORNAN/2-128-----------------------------------TVVLLAVFWIDCI.----...SAKPVTR-------------.SKE
G3T2N9_LOXAF/2-133-----------------------------------ALWLTVVIALTCIG----GLASPVPVY.-------------.NRH
M3YGH3_MUSPF/2-126-----------------------------------ALWLTVIIAFICLS----GLASPGPVHN-------------.LT.
B5FW67_OTOGA/2-129-----------------------------------ALWLTMVIALTCLG----GLASPGPVPR-------------.LT.
I3MAR4_SPETR/2-131-----------------------------------ALWLTVVLTLACLG----GLAAPGPVPP-------------PSP.
IL13_CANFA/2-129-----------------------------------ALWLTVVIALTCLG----GLASPSPVTP-------------.SP.

PF00727

IL4_FELCA/26-131-----------------------------------NFNNTLKEIIKTLN----ILT..ARNDS-----------------
H0XDE1_OTOGA/26-149-----------------------------------KRGIVLKECIKALN----ILT..ENKTP-----------------
IL4_MOUSE/27-140-----------------------------------..KNHLREIIGILN----EVT..GEGTP-----------------
G3T4B8_LOXAF/26-132-----------------------------------TCGNILREIIKTLN----FLT..EKKHA-----------------
IL4_RABIT/28-143-----------------------------------..DIILPEVIKTLN----ILT..ERKTP-----------------
G5ASQ0_HETGA/25-138-----------------------------------.CNDALQEIINDLN----VLS..SQKTP-----------------
F6U5N6_HORSE/26-135-----------------------------------KYDITLQEIIKTLN----NLTDGKGKNS-----------------
IL4_BOVIN/26-133-----------------------------------KCDITLAEIIKTLN----ILT..TRKNS-----------------
G3QSC0_GORGO/26-149-----------------------------------KCDIALQEIIKTLN----SLT..EQKTL-----------------
A3FBF0_MUSPF/26-130-----------------------------------NFSIAIKEIIKTLN----ILT..ARNDS-----------------
IL4_RAT/27-139-----------------------------------..DSPLREIINTLN----QVT..EKGTP-----------------
G3WEJ0_SARHA/28-149-----------------------------------NCRSTVREIILSAS----SLT..TKKFL-----------------
I3MAS4_SPETR/24-141-----------------------------------GCDVTLEEIIKTLN----TLS..GKKTT-----------------
IL4_PIG/26-131-----------------------------------KCDITLQEIIKTLN----ILT..ARKNS-----------------

PF00726

IL10_BOVIN/5-174---------ALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLREL----RAAFGKVKTF--------------FQM
IL10H_EBVB9/7-167---------VTLQCLVLL.........YLAPECGGTDQCDNFPQMLRDL----RDAFSRVKTF--------------FQT
G3HB01_CRIGR/14-174---------.........AGVGPSRGQYTQQENNCTHFPVSQTHMLREL----RTAFSQVKTF--------------FQK

PF14565

IL22_HUMAN/40-178----------------------------------CRLDKSNFQQPYITN----RT-FMLAKEA--------------SLA
E1C1U2_CHICK/46-184----------------------------------CRLRKINFQQPYIRN----RT-YTLAEMA--------------RLS

PF15036

IL34_MOUSE/28-184---------------------------TLTQDKECDLTGYLRGKLQYKN----RLQYM--KHY--------------FPI
R4GIU3_CHICK/19-177---------------------------.VAALGECELARLLQDKLRYEM----RLQYM--KHN--------------FPI
F7EA00_CALJA/29-185---------------------------PLTQSKECTVTGFLRDKLQYRN----RLQYM--YVS--------------FKI
H0WFN4_OTOGA/28-184---------------------------SLTQSQECTVTSSLRDKLQYRN----RLRYM--KHY--------------FPI
M3ZVZ0_XIPMA/24-191---------------------------ASTPASMCTPLKTLNDSLSH..----RRRYM--KHN--------------FPI
U3JY35_FICAL/18-179---------------------------EAAAPGECELTRLLQDKLQYEM----RLQYM--KHY--------------FPI
L9KJY3_TUPCH/28-184---------------------------PVTQSKECAVTGFLREKLQYRN----RLQYM--KHY--------------FPI
G3T3A6_LOXAF/28-182---------------------------PLTQGEECTFTGYLRDKLQYKN----RLQYM--KYN--------------FPI
F6W3U1_MONDO/15-167---------------------------...QNKECIITGILRDKLQYRH----RLRYM--KHY--------------FPI
I3JZ08_ORENI/24-192---------------------------.PTHSSMCTPLRTINDSLSH..----RRQYM--KHN--------------FPI
L5MCR9_MYODS/28-182---------------------------PLTQSKECALTGILRNKLQYRN----RLLYM--KQY--------------FPI
B3DLJ8_DANRE/23-195---------------------------SSAAPDLCGPLKTVQDSLNATL----RRRYM--KMH--------------FPI
IL34_BOVIN/28-183---------------------------PLTRSDECAITGFLRDKLQYRN----RLQYM--KHY--------------FPI

PF01109

CSF2_RAT/18-139LNDMRALEN-----EK-----------------------------------------------------NE.DVDIISNE
CSF2_MOUSE/18-136LD...DMPV-----TL-----------------------------------------------------N.EEVEVVSNE
CSF2_BOVIN/18-138LNHSSDTDA-----VM-----------------------------------------------------N..DTEVVSEK
CSF2_CAVPO/18-140LNHTSDPAA-----VM-----------------------------------------------------NE.TVEVVYDQ
CSF2_PIG/18-139LNNSNDTAA-----VM-----------------------------------------------------NE.TVDVVCEM
CSF2_HUMAN/18-139LNLSRDTAA-----EM-----------------------------------------------------NE.TVEVISEM
CSF2_CANFA/18-139LNNSNDVTA-----VM-----------------------------------------------------NK.AVKVVSEV

PF02025

G1RQD7_NOMLE/22-133LSTHRTL-------LI-----------------------------------------------------AN-ETLRIPVP
IL5_CAVPO/23-134LSTHRTL-------LK-----------------------------------------------------GN-ETLRISVP
J9NWP5_CANFA/22-132LSTHRTW-------LI-----------------------------------------------------GD-GVIFFLIP
IL5_MOUSE/21-132LSAHRAL-------LT-----------------------------------------------------SN-ETMRLPVP
G3WAR7_SARHA/25-134ITAHRTL-------LI-----------------------------------------------------GN-GTLRISIP
IL5_HORSE/22-133LSTHRTL-------LI-----------------------------------------------------GD-GNLMIPTP
B5FW65_OTOGA/22-133LSTHQTL-------LI-----------------------------------------------------HN-ETLRIPVP
I3MDT8_SPETR/23-134LSTHQTV-------LI-----------------------------------------------------GN-ETLRIPVP
G3T4B0_LOXAF/23-133LSTHRTL-------LI-----------------------------------------------------GD-GTPRILTP
G1SL79_RABIT/22-133LSTYQSL-------LI-----------------------------------------------------GN-ETLMIPVP

PF02059

IL3_CANFA/19-132LNKSPSPSE-----..-----------------------------------------------------EPLDSNEKETL
IL3_MOUSE/27-138LPEPELKTD-----..-----------------------------------------------------.....DEGPSL
IL3_BOVIN/18-132LKKITPSPE-----..-----------------------------------------------------GSLNSDEKNFL
G3UC30_LOXAF/22-133LQKSPPLNS-----..-----------------------------------------------------ATPSDTEKTIL
G1MH15_AILME/18-131LNNSPSPSE-----..-----------------------------------------------------ETLDPNETSTL
F1RJV6_PIG/18-131LENLTVTSN-----..-----------------------------------------------------KSLTLNE..LE
G1RQ11_NOMLE/20-137LKQPPLPLL-----DF-----------------------------------------------------NNLNGEDQDIL
IL3_CALJA/19-136LNQPPLASS-----NF-----------------------------------------------------NNLNREDQRIL
F1LS41_RAT/29-138LPYPQVSGL-----..-----------------------------------------------------..NNSDDKANL

PF07400

IL11_HUMAN/1-199LADTRQLAA-----QLRDKF---------------PA-------------------------------DGDHNLDSLPTL

PF00758

G3TYQ1_LOXAF/25-173STPVPLPTV-----DFSLGE---------------WK-------------------------------TQTEQNKAQDVL
W5K758_ASTMX/26-175GVPLMVPLT-----RVDIGV---------------WE-------------------------------KKNMEEQAQEVQ
B1N8Y2_DANRE/15-168ATNVTVPLT-----RVDFEV---------------WE-------------------------------AMNIEEQAQEVQ
F7DTH0_CALJA/31-193NENITVPDT-----KVNFYA---------------WK-------------------------------KMEFGQQAVDIW
M3XJ62_LATCH/27-177PVDMTLPAT-----KVNIKE---------------WN-------------------------------EMDNKIKEREIW
G3W289_SARHA/30-190GENITVPDT-----RVNFHT---------------WK-------------------------------KMEVGQKAGEVW
F6WUU2_MONDO/31-191VLAFSNTSC-----LINIYF---------------AI-------------------------------NSNVGQKAGEVW
G3VW20_SARHA/26-175PIPVLLPTV-----DFSLRE---------------WR-------------------------------AKTERFKCTQLS
G1PF99_MYOLU/45-207SENITVPDT-----KVNFYA---------------WK-------------------------------RMEVEQQALEVW
TPO_CANFA/25-176STPVLLPAV-----DFSLGE---------------WK-------------------------------TQKEQTKAQDVW
F7G570_MONDO/26-177PIPVLLPTV-----DFSLRE---------------WR-------------------------------AKTEQTKGQEVL
H0W023_CAVPO/30-191GENITVPDT-----KVNFCA---------------WE-------------------------------KMGVGQQAAEVW
H2LEX3_ORYLA/33-182TQTVSVPQT-----TVNFED---------------WE-------------------------------KKNALEQAEEVQ

PF06875

Q5BNQ4_9SALA/2-215PDYQLPHIK-----VVNLPT---------------AAMD-----------------------------YDTFIRQTDETR
Q5BNQ2_9SALA/2-215PDYQLPHIK-----VANLPT---------------AAMD-----------------------------YDTFMKQTDETR

PF01110

CNTF_CHICK/1-194-DASISVAA-----VDGVPT---------------AAV-------------------------------ERWAEQTGTQR
G3VWZ5_SARHA/1-195-NKDVDLDS-----MDGVPT---------------AST-------------------------------DRWSELTEAER
E1BFH9_BOVIN/1-193-NGNMNLDT-----LEGVPT---------------ASS-------------------------------SRWSELTEAER
G5AP46_HETGA/1-192-SENVSLDA-----VGGVPA---------------ASI-------------------------------AQWSELTEAER
H0Z9U1_TAEGU/1-188-DASASVAA-----MEGVPL---------------AAV-------------------------------ERWDEQTGTQR
CNTF_HUMAN/1-194-NKNINLDS-----ADGMPV---------------AST-------------------------------DQWSELTEAER

PF01291

LIF_MOUSE/44-203NVEKLCAPN-----MTDFPS---------------FHG-----------------------------------NGTEKTK
LIF_BOVIN/43-202NLDKLCSPN-----VTDFPP---------------FHA-----------------------------------NGTEKAR
ONCM_HUMAN/37-209KLREHCRER-----PGAFP.---------------SEE-----------------------------------TLRGLGR
ONCM_MOUSE/34-194DLRAACTQH-----SVAFP.---------------SED-----------------------------------TLRQLSK
ONCM_BOVIN/34-194VLQEHCRER-----PGDFP.---------------SED-----------------------------------ALWRLSR

PF03039

IL12A_MOUSE/6-215ITRDQTSTL-----KTCLPL---------------ELHK.NESCLATRE-------------------TSSTTRGSCLPP
G3VQT1_SARHA/40-247ITE..SNTG-----RVCLPP---------------ELIKKNFISNPTGK-------------------IFIINNGSCLDS
F6T5A8_MONDO/5-202ITKGRSDTV-----RACLPP---------------EFIK..........-------------------.....NGSCLVS
IL12A_PIG/6-222ITKDKTSTV-----EACLPL---------------ELAT.NESCLAARE-------------------TSLITNGNCLTS
L8YEA2_TUPCH/1-213ITKDKTSTV-----KACLPL---------------ELIT.NESCLASRE-------------------TSFKTNGSCLAP
H0X861_OTOGA/6-217ITKDKTSTV-----RACIPL---------------ELTK.NESCLASRE-------------------TSFIPNGKCLTS
G1QWH2_NOMLE/40-254ITKDKTSTV-----EACLPL---------------ELTK.NESCLNSRE-------------------TSFITCQRMLSS
I3MN91_SPETR/4-220ITKNRTNTV-----KACLPQ---------------ELAQ.NENCLASRE-------------------TSFIIKGSSLTS
Q924V6_CAVPO/6-221ITKDKTSTV-----KACVPL---------------ELVK.NESCLASGH-------------------ISFTTNGSCLAS

PF02024

H3AP27_LATCH/26-169ITRIQQHPN-----QFLLPL---------------NLK----------------------------------VSGLEFIP
G3WWV6_SARHA/23-167ITRINDISH-----MYSISA---------------KQR----------------------------------VTGLDFIP
F6PLK2_ORNAN/23-167ITRIIQLSN-----RNGVST---------------DQR----------------------------------VSGLDFIP
F7HGW1_CALJA/23-167IARINDLSH-----TQSVSP---------------RQR----------------------------------VTGLEFIP
G5BHA4_HETGA/23-167VSRINDISH-----MQSVSS---------------KHK----------------------------------VTGLDFIP
W5NER9_LEPOC/28-172VIRIQKHTN-----ESKMSP---------------NLV----------------------------------FSGLELIP
H0V7C6_CAVPO/23-165INRIRNISH-----LQSVSS---------------KHK----------------------------------VTGFDFIP
LEP_HUMAN/23-167VTRINDISH-----TQSVSS---------------KQK----------------------------------VTGLDFIP

PF00143

I3MVD7_SPETR/41-186FAFPQEQLE.....GEQV.Q---------------KA-------------------------------Q.AVAVLHQMTQ
M3WTR1_FELCA/30-186FRFPREMLE.....GGQL.R---------------EA-------------------------------QAAAAVLRELLQ
G3UK87_LOXAF/31-177FRFPR.MVY.....GSHL.Q---------------KA-------------------------------Q.AVFILHKMLQ
H0W7G8_CAVPO/30-185FGLAQLNFD.....GKQV.Q---------------EA-------------------------------Q.AFSVLHEMAR
IFNB_HORSE/31-184FQVPEEIEQ.....AQQF.Q---------------KE-------------------------------D.AALVIYEMLQ
G5BPX2_HETGA/32-192FGLPQNILS.....YSQH.V---------------ER-------------------------------D.IKEVFYDIII
I3JM36_ORENI/31-182VPFPNHLYR.....QVSKSS---------------DE-------------------------------D.KLAFTVQVLE
L8Y906_TUPCH/30-185FKFPQEQLD.....GRQL.Q---------------KT-------------------------------Q.ALRVLHGMLQ
F7BVP5_ORNAN/27-181FKLPAEMVH.....PHQF.Q---------------QE-------------------------------N.ATEAIHDLLQ
H2R6R8_PANTR/30-185FGFPQEEFD.....GNQF.Q---------------KT-------------------------------Q.AISVLHEMIQ
F6YZB3_ORNAN/30-179FQFPRAVVE.....AGLL.Q---------------KG-------------------------------N.RAVVVHELLQ
F7ABU5_MONDO/29-182FNFPKEAMD.....RSQL.Q---------------KE-------------------------------N.ATVIVLEMVQ
IFNB_RAT/31-182FKIPMEVMH.....PSQM.E---------------KS-------------------------------Y.TAFAIQVMLQ
I3N788_SPETR/31-185FKIPKEIKH.....PQQL.Q---------------KE-------------------------------H.AAFVIYEMLQ
G5C259_HETGA/30-185FGLPHQEFD.....GKQI.Q---------------KA-------------------------------Q.AISVLHEMTS
H0XKS8_OTOGA/31-185FEIPKEIKQ.....PQHL.Q---------------KE-------------------------------D.AMLFIYEMLQ
G5E7E1_LOXAF/13-168FRFPQEMVD.....GSQL.Q---------------KA-------------------------------Q.VISVLHEMLQ
G3GXU9_CRIGR/31-180FKIPMEVKH.....PGQM.E---------------KR-------------------------------N.VALIIEEMLQ
H0XRP5_OTOGA/30-185FRFPREEMR.....GKQL.Q---------------KA-------------------------------Q.AISVLHEMTQ
G1L8G2_AILME/30-185FSFPQMLVD.....GSKF.E---------------KT-------------------------------E.ATGVMHEMFR
H0W510_CAVPO/30-182FGLAGLEFE.....GKQV.Q---------------KA-------------------------------Q.ALSVLHEMTR
G1Q880_MYOLU/30-185FRFPRATVD.....GSQV.Q---------------KA-------------------------------Q.AIAVLHEMLQ
D2HTQ4_AILME/37-205FELPQEILS.....HTQP.A---------------KR-------------------------------Y.IKEAFYEMSI
IFNE_PIG/31-186FLLPQKSMN.....PHQY.Q---------------KQ-------------------------------Q.ALAILHEMLQ
H0XSG1_OTOGA/30-185FGIPQEKLN.....GNQL.Q---------------KA-------------------------------Q.AISVLHDMTQ
A8E6E8_MONDO/30-182FNLPKEALE.....DNKL.Q---------------RG-------------------------------D.ALIIFHEMLQ
C8CKA7_PIG/30-185FGFPQEALG.....GNQV.Q---------------KA-------------------------------Q.AMALVHEMLQ
G1NR05_MELGA/36-188YPFPETVLE.....SK...D---------------KK-------------------------------Q.AAIITLHILQ
G3I0H3_CRIGR/33-178FASPVEKVD.....AQHI.Q---------------KA-------------------------------Q.AMSVLQELTQ
I3LBU7_PIG/30-179FGFPQEMVE.....RSHL.Q---------------KA-------------------------------Q.AIFVLHKMLQ
C8CKC3_PIG/37-205FELPQEILS.....HTQP.L---------------KR-------------------------------D.IQEAFYEMSI
IFNE_MOUSE/33-185FLLPQQPVS.....PHQY.Q---------------EG-------------------------------Q.VLAVVHEILQ
G3N2A8_BOVIN/30-185FTFPQEMVE.....GSQL.Q---------------EA-------------------------------Q.AISVLHEMLQ
G3WZJ8_SARHA/30-182FTFPKEAME.....GSQL.Q---------------RE-------------------------------N.TTVMVHETLQ
G1KU56_ANOCA/35-182FSSQPEEEN..IQSIFEL.Q---------------KE-------------------------------N.AAVALHEILQ
G1KX99_ANOCA/29-180FS.PKMYLK.....NLDVSE---------------EE-------------------------------N.AKVVIQEVLQ
L5K909_PTEAL/30-184FGFPQEAFS.....GNQF.Q---------------EA-------------------------------Q.AITVIHEVTW
H0VUV7_CAVPO/30-185FGLALLDFD.....GKQV.Q---------------KT-------------------------------Q.ALSFLHEMTT
L5K635_PTEAL/30-183FRFPRKMVD.....GSQV.Q---------------KA-------------------------------Q.AISVLHEMLQ
G5CB66_HETGA/31-185FKFPEEIKQ.....PQHF.R---------------KE-------------------------------N.AALVIQEMLQ
L5LKN9_MYODS/31-186FLLPQEAGN.....PHQD.Q---------------KG-------------------------------S.ALTILHEMLQ
H0XMZ9_OTOGA/31-186FLLPEKPVS.....PQHY.Q---------------EG-------------------------------H.ALALLHETLQ
H9KYA4_CALJA/30-185FVFPQEVFF.....GDHF.Q---------------KA-------------------------------Q.AIFILHEMIQ
H0YTY6_TAEGU/41-187F.FPDTLLH.....PNL..H---------------PH-------------------------------Q.AAATALRILQ
A8E6F5_XENTR/55-202LPNIDEIYS.....ISQM.E---------------E.-------------------------------..MVLAVRGVLN
G7PS89_MACFA/30-185FELPQEEFD.....DKNF.Q---------------KA-------------------------------Q.AISVLHEIIQ
I3MY95_SPETR/37-186FAFPQKLLE.....GEKV.P---------------RA-------------------------------Q.AVAALQEMTR
G3WZF5_SARHA/30-185FQIPKEILQ.....PKQY.Q---------------KE-------------------------------N.ATMVIHEMLQ
H0VF99_CAVPO/32-187FKFPEEILQ.....PQQF.Q---------------KE-------------------------------K.AALVIQEMLQ
L8Y8F8_TUPCH/30-184FGFPRHVVE.....DRQL.Q---------------EA-------------------------------Q.AVSVLHEMLQ
F1LVL8_RAT/29-184FLLPQQSVS.....PHQH.Q---------------EG-------------------------------H.VLAVLHEILQ
G1Q950_MYOLU/31-184FQIPREVEQ.....PQQV.R---------------KE-------------------------------E.AMVVMHEMLQ
I3N5Z0_SPETR/27-178FRLPQNSVN.....FHQY.P---------------KG-------------------------------H.VLAILHEMLQ
A3FBE8_MUSPF/31-184FKIPEEIQK.....SQKF.Q---------------KE-------------------------------D.IVLVTLEMFQ
G3UCD2_LOXAF/30-187FGFPQEELE.....GNKF.Q---------------KA-------------------------------Q.AISVHHEMIQ
L9LC61_TUPCH/31-185FEVPEEIQR.....PQQF.Q---------------KE-------------------------------N.ATLVIHEMLQ
H0Y0D2_OTOGA/32-187LGFPQEEFK.....NKQP.E---------------KN-------------------------------Q.AITVLYVVVQ
L5KKJ7_PTEAL/32-192FEMPQEILY.....STQL.L---------------KR-------------------------------D.IKEAFYEISL
L5KWM8_PTEAL/110-263FRFPLEMVD.....GSQV.Q---------------EA-------------------------------Q.AISVLHEMLQ
F7GHL9_MONDO/29-181FSFPKEALD.....GSQL.Q---------------KE-------------------------------N.ATVVVLEMVQ
G3TS29_LOXAF/30-179FRFPQILMD.....MNQL.E---------------KT-------------------------------Q.AAVLLYEMLQ
W5PZ39_SHEEP/33-184FELPQEILS.....YTQP.L---------------MR-------------------------------N.IKEAFYEMTR
D2H9N6_AILME/31-184FKFPEEIEK.....PQQV.Q---------------KE-------------------------------A.LLLVTLDMFQ
IFNT4_SHEEP/30-185FGLPQEMVE.....GDQL.Q---------------KD-------------------------------Q.AFPVLYEMLQ
F7A317_HORSE/30-183FGFPQEVFD.....GNQF.R---------------KA-------------------------------Q.AISAVHETIQ
G3TTC1_LOXAF/30-185FRFPQEMVD.....GSQL.Q---------------KA-------------------------------Q.AIAFLHEMLQ
Q29412_PIG/31-184FEVPEEIMQ.....PPQF.Q---------------KE-------------------------------D.AVLIIHEMLQ
IFNB_MOUSE/31-180FKIPMEMTE.......KM.Q---------------KS-------------------------------Y.TAFAIQEMLQ
IFNA3_CANFA/30-183FAFPKELFD.....GQRL.Q---------------EA-------------------------------Q.ALSVVHVMTQ
IFNB_HUMAN/31-185FDIPEEIKQ.....LQQF.Q---------------KE-------------------------------D.AALTIYEMLQ
I3UJJ8_FELCA/30-185FLLPQRSVN.....PRQY.Q---------------KG-------------------------------Q.ALAILHEMLQ
M3Z729_MUSPF/30-183FAFPQEVFD.....GKQL.Q---------------KA-------------------------------Q.AISVLHVTNQ
H0W289_CAVPO/30-190FRFPKEMMT.....GNQV.Q---------------EA-------------------------------Q.AIWVLHGMLQ
G3WZQ8_SARHA/29-181FNFPKEAVE.....VNQL.Q---------------RE-------------------------------N.ATAIVYEMLQ
G1KYL3_ANOCA/28-176FS.HREALG.....NINVSE---------------EG-------------------------------N.AKAAIQEVLQ
G1U0Q8_RABIT/30-185FQFPREVVN.....GSQF.Q---------------KN-------------------------------Q.AVSVLHEMLQ
G1TYS8_RABIT/33-195FELPQEILS.....HSQM.E---------------KR-------------------------------D.IKEAWYEIST
G1SJC4_RABIT/30-185FECPLEELG.....GHQA.Q---------------RT-------------------------------Q.AISVLHEMTQ
IFN_ANAPL/38-190CSFPDTLLD.....TN...D---------------TQ-------------------------------Q.AAHTALHLLQ
A8E6F6_XENTR/31-179LPNTESTYS.....VSQV.E---------------A.-------------------------------..GALAVREVLN
M3WRV1_FELCA/30-184FAFPQDVFG.....GDQS.H---------------KA-------------------------------Q.ALSVVHVANQ
L8Y4J0_TUPCH/31-186FLLPHKSVN.....PQQF.Q---------------KR-------------------------------H.TLAILHEMLQ
F7G875_MONDO/31-182FQIPREIVQ.....PRQC.Q---------------RE-------------------------------N.ATMIIHEMLQ
I3N7K4_SPETR/37-197FELPEEILS.....STQP.E---------------KT-------------------------------N.IKYVFYETYT
IFNT2_BOVIN/7-162FGLPQEMVE.....GNQL.Q---------------KD-------------------------------Q.AISVLHEMLQ
G1L8I1_AILME/30-183FAFPKEVVD.....GKQL.Q---------------KA-------------------------------Q.ALSVVHVMDQ
V8NNB8_OPHHA/22-183LSLEDIGKKIMIDMNDEC.Q---------------VD-------------------------------I.AKTAVKEILQ
G3SI98_GORGO/35-185FELPQEFLQ.....DTQP.M---------------KR-------------------------------D.IKKAFYEMSL
H9GZR7_HORSE/30-185FKFPQEQLD.....GRQF.P---------------EA-------------------------------Q.ATSVLHEMLQ
G3I0I6_CRIGR/31-185FQLPWQSVS.....RHQY.Q---------------KG-------------------------------H.VLAVLHELLQ
W5JYQ9_ASTMX/29-179VPFPKAAFE.....SNTRKQ---------------TV-------------------------------A.LEKSIYITLE
G3I0H8_CRIGR/30-185FAFPLENMD.....AQHI.Q---------------KA-------------------------------Q.AIPILQELIQ
K7GQJ6_PIG/18-164FGFPQEMVE.....GSQL.Q---------------KV-------------------------------Q.AISVFHEMLQ
I3L756_PIG/30-180FGFPQEMVE.....GSQL.Q---------------KT-------------------------------Q.AISVLHEMLQ
IFNE_HUMAN/31-186FLLPQKSLS.....PQQY.Q---------------KG-------------------------------H.TLAILHEMLQ
IFNW2_HORSE/30-185FRFPQDMAD.....GRQF.P---------------EA-------------------------------Q.AASVLHEMLQ
G1KWE0_ANOCA/33-180FS.PKEDLR.....NLDVSE---------------EE-------------------------------N.AKVAIQEVLQ
IFNA1_MOUSE/30-185FGFPQEKVD.....AQQI.K---------------KA-------------------------------Q.AIPVLSELTQ
IFNB2_BOVIN/31-184FQMPEEMKQ.....AQQF.Q---------------KE-------------------------------D.AILVIYEMLQ
G3UJX3_LOXAF/31-185FKIPEEIKQ.....PGQL.Q---------------KE-------------------------------D.AALVIYEMLL
L9L941_TUPCH/34-198FELPQEILS.....STQP.V---------------KR-------------------------------D.IKEVFYEISM
W5N6G4_LEPOC/31-180.TFPVDAFK.....TAENAK---------------NE-------------------------------D.IVLTGLETMR
D3Z919_RAT/29-179FELPLEKVD.....AQQI.Q---------------KS-------------------------------Q.AISVLETLTQ
IFNB_FELCA/31-184FEVPEEIKK.....SQRF.Q---------------KE-------------------------------E.AILVINEMFQ
M3YX13_MUSPF/32-179FLLSQQSVN.....RRRS.Q---------------SG-------------------------------Q.ALAILHEMLL
M3VXI8_FELCA/39-205FELPQDIQS.....HTPP.G---------------KR-------------------------------Y.LKEAFYEMST
W5PG31_SHEEP/30-185FAFPQEALG.....GSQL.Q---------------KA-------------------------------Q.AISVLHEVTQ
F7B527_HORSE/29-183FRFPQILVD.....GDQL.G---------------KT-------------------------------Q.ATAVLHEMLQ
M3WZS7_FELCA/29-181FNFPQILVA.....GNQL.E---------------KT-------------------------------Q.VTAVVHEMLQ
G3VDC6_SARHA/30-182FKFPEEAVE.....GSQL.Q---------------RE-------------------------------N.AIVIVNETLQ
H9L1C3_CHICK/32-182FRFPEQVLK.....PR...Q---------------KE-------------------------------T.VKVAIEEILQ
C8CKB9_PIG/28-175FQFPWRGGK.....TTRT.Q---------------TS-------------------------------Q.GTCFHPLMLQ
H0VYK7_CAVPO/32-181FKFPEEIKQ.....PRPF.Q---------------KE-------------------------------M.AALVIQEMLQ
L5KBH2_PTEAL/30-185FGFLREMVD.....GSHM.Q---------------KA-------------------------------Q.AISVLQEMLQ
G3R8Q7_GORGO/30-185FRFPQEMVK.....GSQL.Q---------------KA-------------------------------Q.VMSVLHEMLQ
R4GKJ6_CHICK/39-191CSFNDTILD.....TS...N---------------TQ-------------------------------Q.ADKTTHDILQ
G7PS88_MACFA/30-185FGFPQQEFD.....GNQF.Q---------------KA-------------------------------P.AISVLHELIQ
M3Z715_MUSPF/30-183FAFPKKVFH.....SKQL.Q---------------KA-------------------------------Q.ALSVVHVTKQ
H0VXI5_CAVPO/30-181FDL....FD.....GKQV.Q---------------KA-------------------------------Q.ALSVLHEMTR
G3I0H6_CRIGR/31-178FASPVEKVD.....AQHI.Q---------------KA-------------------------------Q.AMSVLQELTQ
C8CKA9_PIG/29-183FRFPRTLVD.....GNQV.E---------------KT-------------------------------Q.AVAVAHEMLQ
H0W3G0_CAVPO/30-185FLLPQKMMT.....SSKL.Q---------------KA-------------------------------Q.MVSVLQGTLQ
G1PDS6_MYOLU/36-199FELPREVLA.....YSQPLL---------------HR-------------------------------D.IKGTFYEMYM
H0W4H8_CAVPO/27-181FLIPQKSVG.....SKPC.Q---------------KD-------------------------------H.ALVSEHLHLE
G1TTX4_RABIT/34-180FKVPKEIKE.....PQQL.Q---------------KE-------------------------------D.TTLVIFEMLN
I3MXH1_SPETR/31-185FKIPKEIKH.....PQQF.Q---------------KE-------------------------------H.AAFVIYEMLK
H0WK94_OTOGA/40-202FELPQEILS.....HTQT.V---------------KR-------------------------------G.LREAFYEVSI

PF02947

FLT3L_MOUSE/30-162KDYPVTV-------AVNLQD...............EK-------------------------------HCKALWSLFLAQ
F6T7S9_ORNAN/28-157QDYPVSV-------VTNLQT...............DE-------------------------------LCWELWHLSVAE
H9GP84_ANOCA/29-165LDYPVPV-------PVNLKQ...............DE-------------------------------FCKELWHVHLIH
F6TPW7_MONDO/34-163TDYPVEV-------PDNLQ................DE-------------------------------RCRALWHLFLAK
G5B8P0_HETGA/20-150KDYPVTV-------AANLQD...............EQ-------------------------------FCAKLWHLVLAQ
G1M637_AILME/29-159QDYPVTV-------ASNLQD...............DE-------------------------------LCGPFWHLVLAQ
L9JA37_TUPCH/769-910LDYPVTM-------ASNLQDPGTGPPRLQRAWSPQEE-------------------------------LCGALWRLVLAQ
G3VSA3_SARHA/79-209GDYPVDV-------PENLRV...............DE-------------------------------QCWALWHLALAK
G1QZC3_NOMLE/30-160QDYPVTV-------ASNLQD...............EE-------------------------------LCGALWRLVLAQ

PF00714

IFNG_HORSE/15-152-AFFKEIEN-----LKEYFN---------------AS-------------------------------NPDVGDGGPLFL
H0WPL1_OTOGA/15-151-TSSAEIDQ-----LKEYFN---------------TS-------------------------------STDTAGGGILFL
Q8CGS0_CAVPO/15-154-RFTNEIRI-----LKNYFN---------------AD-------------------------------NSDVGDNGTLFV
B9VS86_CALJA/15-152-PYVKEAEN-----LKKYFN---------------AG-------------------------------DSDVADNGTLFL
G3SUC6_LOXAF/15-152-TFLKEIQN-----LKEYLN---------------AT-------------------------------DSDVADGGPLFI
G3GY20_CRIGR/2-135-TLIEEIEN-----LKKYFN---------------SS-------------------------------SEDVGNGGDLVF
I3MNV6_SPETR/15-152-IVNKEIEA-----LKEYFN---------------AS-------------------------------NSNVSDGGSLFL
L5LME8_MYODS/15-153-TIFNETQK-----LKRYFN---------------AT-------------------------------SSDVGNGGHLFL
G5BGB5_HETGA/15-152-RFTKEINI-----LKDYFN---------------AS-------------------------------SSDVGDNGTLFV
G3WQJ9_SARHA/15-153-NLREDMQT-----LHNYFN---------------AT-------------------------------KSDVSDGSSLFM
IFNG_SHEEP/15-152-PFFKEIEN-----LKEYFN---------------AS-------------------------------NPDVAKGGPLFS
IFNG_RAT/14-151-TLIESLES-----LKNYFN---------------SS-------------------------------SMDAMEGKSLLL
IFNG_RABIT/15-152-TLTRETEH-----LKAYLK---------------AN-------------------------------TSDVANGGPLFL
L9KVU0_TUPCH/51-188-PFMKEVQN-----LKNYFN---------------AT-------------------------------DPGVGDTGRLFV
IFNG_FELCA/15-153-MFFKEIEE-----LKGYFN---------------AS-------------------------------NPDVADGGSLFV

PF05337

CSF1_HUMAN/1-254......HMI-----GSGHLQ---------------SLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIME
CSF1_HUMAN/272-554GTELSPSRP-----GGGSMQ---------------TEPARPSNFLSASSPLPASAKGQQPAD.....VTGTALPRVGPVR
Q6GMN4_RAT/265-566ERKFSPSNP-----VGGSIQ---------------AETDRPWA.RSASSPFPKLTEDQQPTN.....ITDTPLTEVNPMR
O77709_BOVIN/1-254......HMI-----GNGHLL---------------FLQQLIDSQMETSCQISFEFVDQEQLDDPVCYLKKAFLLVQDIME
Q64129_9MURI/1-257......HMI-----GNGHLK---------------VLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIID
CSF1_MOUSE/273-552EAKFSPSTP-----VGGSIQ---------------AETDRPRA.LSAS.PFPKSTEDQKPVD.....ITDRPLTEVNPMR
O77709_BOVIN/274-554GGELSFYSL-----GGRSVQ---------------AEPASPSHTPPASSALSGSGKGLRLVD.....ATSAHLPTLGPMR
Q3TLQ6_MOUSE/1-254......HMI-----GNGHLK---------------VLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIID
O77710_BOVIN/1-257......HMI-----GNGHLL---------------FLQQLIDSQMETSCQISFEFVDQEQLDDPVCYLKKAFLLVQDIME

PF02404

R4GD07_ANOCA/1-283GNLPNDYMI-----ALKYVR---------------KMDTLPNH-----CWLHLMVPE----------LSKSLSNLLNKFT
SCF_CHICK/1-287GNLPNDYLI-----TLKYVP---------------KMDSLPNH-----CWLHLMVPE----------FSRSLHNLLQKFS
SCF_RAT/1-273ANLPNDYMI-----TLNYVA---------------GMDVLPSH-----CWLRDMVTH----------LSVSLTTLLDKFS
G1NWC8_MYOLU/1-272ANLPKDYKI-----GLKYVP---------------GMDVLPSH-----CWISKMVEQ----------LSVSLTDLLDKFS
F7EP53_MONDO/1-273ANLPNDYMI-----PLKYVP---------------DMELLPNH-----CWLHLMVPE----------LARSLNNLLDKFS
F7C5I3_ORNAN/1-273GNLPNDYMI-----ALKYVP---------------EMDGLPNH-----CWLHLMVPE----------LAKSLNNLLQKFS
F7G0W2_CALJA/1-273ANLPKDYMI-----TLKYVP---------------GMDVLPSH-----CWISEMVVQ----------LSSSLTDLLDKFS

PF00489

IL6_BOVIN/27-208EALIKRMVD-----KISAMR---------------KE---ICEKN-----------------------DECESSKETLAE
M3X721_FELCA/27-208EELIKYILG-----KISALK---------------KE---MCDNY-----------------------NKCEDSKEALAE
IL6_HORSE/27-208KQHIKYILG-----KISALK---------------NE---MCNNF-----------------------SKCENSKEVLAE
G3UHF3_LOXAF/20-205EELIRFILA-----EISVLR---------------KK---MCDKY-----------------------DKCENSREALAG
L5KPK4_PTEAL/20-202ENLIKSIFL-----EISEVR---------------NK---MCGND-----------------------DSCKNSKEVLTE
F7HV62_CALJA/27-212DKHIRYILD-----GISALR---------------KE---ICNKS-----------------------NMCESSKEALAE
IL6_MOUSE/26-210GGLITHVLW-----EIVEMR---------------KE---LCNGN-----------------------SDCMNNDDALAE

PF16647

CSF3_BOVIN/42-190---VRKIQA-----DGAELQ---------------ER...LCAAH-----------------------KLCHPEELMLLR
CSF3_HUMAN/51-202---VRKIQG-----DGAALQ---------------EKLVSECATY-----------------------KLCHPEELVLLG
CSF3_MOUSE/57-205---VRKIQA-----SGSVLL---------------EQ...LCATY-----------------------KLCHPEELVLLG

PF02372

IL15_PIG/33-160.....HVIS-----DLKKI-------------------------EDLIR-------------------SIHMDATLYT.E
IL15_CAVPO/33-160.....DVIY-----DLKRI-------------------------ENLIQ-------------------SIHIDATLYT.E
IL15_FELCA/33-160.....DVIS-----DLKII-------------------------DKIIQ-------------------SLHIDATLYT.E
IL15_SHEEP/33-160.....SVIH-----DLKTI-------------------------EHLIQ-------------------SMHMDATLYT.E
F1NZN5_CHICK/55-183.....DVLK-----DLELI-------------------------K...T-------------------SEDIDVSLYTAN
G1NDP6_MELGA/5-137LEILPALIK-----DLEIL-------------------------EESKN-------------------KIHVV..LYT.P
O73883_CHICK/5-138RKPLQTLIK-----DLEIL-------------------------ENIKN-------------------KIHLE..LYT.P
Q8JFF4_ANAPL/4-134.NTLKTLIK-----DLENL-------------------------GTSMN-------------------GIDLE..LYT.P

PF00715

I3MQX6_SPETR/7-151RQQLEHLLL-----DLQVLS---------------RG---VSNQENSTL-------------------TRMLKFKFYM-P
G5C793_HETGA/7-149QEQLEQLLL-----DLQVIL---------------KG---VT..RNPKL-------------------SKMLKPKLYF-P
G1PJ32_MYOLU/7-147QQQLEHLIL-----DMQRLL---------------NG---VSNYKNSKL-------------------PMMLTFKFYM-P
B1AB81_HORSE/7-146QQQLKQLQM-----DLKLLL---------------EG---VNNNKNPKL-------------------SKMLTFKINM-P
G3HTL8_CRIGR/7-150QQHLEQLLL-----DLQVLL---------------KG---INNNKNPKL-------------------PMMLTFKFYM-P
IL2_MACMU/7-151QLQLEHLLL-----DLQMIL---------------NG---INNYKNPKL-------------------TRMLTFKFYM-P
H0Y254_OTOGA/7-149RQQLEQLLL-----DLQMVL---------------NG---VNNNKNPKL-------------------SRMLTLKLYV-P
IL2_MOUSE/7-165QQHLEQLLM-----DLQELL---------------SR---MENYRNLKL-------------------PRMLTFKFYL-P
G3SU90_LOXAF/7-147QQQLEQLLL-----DLQMLL---------------IR---VKNYETRRL-------------------SMIFTFKFNM-P
IL2_PIG/7-151KKQLEPLLL-----DLQLLL---------------KE---VKNYENADL-------------------SRMLTFKFYM-P
IL2_FELCA/7-151QQQLEQLLL-----DLRLLL---------------NG---VNNPENPKL-------------------SRMLTFKFYV-P
L5K7D9_PTEAL/7-149QQQLEHLLK-----DLQRLL---------------ET---VNNYKNHEL-------------------SSMLTFKFYM-P
IL2_BOVIN/7-152MKEVKSLLL-----DLQLLL---------------EK---VKNPENLKL-------------------SRMHTFDFYV-P
H0VBY4_CAVPO/7-149QDRLELLLR-----DLQTLL---------------EG---VT..SNPRL-------------------PKMLKLKLYP-P

PF00103

PLRP1_BOVIN/26-238SLSHDFYNL-----STIMFN---------------EF---DEKYAQGKL......YYINVT.......KSCHTNSFHA-P
CSH2_BOVIN/26-238SLSHDFHNL-----STIMFN---------------EF---DEKYAQGKL......YYINAT.......KSCHTNSFHT-P
PLRP3_BOVIN/1-213RLSHDIVNH-----TTIMFH---------------EF---DEKYAQNQP......YTINAT.......KSCHTNSLHT-P
PR4A1_RAT/17-227KISQDMNQY-----ISDLST---------------HV---KIFYAQGRG.......FERRT.......TRCHTSSLSS-P
CSH1_BOVIN/26-236LVASNNYRL-----AREMFN---------------EF---NKQFGEGKN.......FTSKV......INSCHTEFMTT-P
PLRP4_BOVIN/26-239VLSTGMYNT-----SVKMFT---------------DF---DEQYAQGKE......YFINVS.......DKCHTNSLHL-P
PR3D4_RAT/16-223EQSHNTFIK-----AADVYR---------------EF---DINFAKRSW......MKDRIL.......PLCHTASIHV-P
PR2C2_MOUSE/16-224SLSHNISIE-----VSELFT---------------EF---EKHYSNVSG......LRDKSP.......MRCNTSFLPT-P
SOM2_HUMAN/9-215LRARRLYQL-----AYDTYQ---------------EF---EEAYILKEQK....YSFLQNPQ.....TSLCFSESIPT-P
PR8A5_RAT/17-238QRAETLRNL-----SDQLYV---------------EF---FQNQFSSRQFADLSSQLIRKDETVLKAGTYCHSNRAK.-P
PR6A1_RAT/20-234ILAHNVTEL-----IAEMNS---------------VF---LEDVLYKPG.....RWFPERD......LTACHRSPFTI-A
PR7D1_MOUSE/17-240VLSGEMSKL-----GVIMRK---------------EF---FMNSFSSETFNKIILDLHKSTENITKAFNSCHTVPINV-P
CSH2_HUMAN/9-215LQAHRAHQL-----AIDTYQ---------------EF---EETYIPKDQKY..SFLHDSQT.......SFCFSDSIPT-P

PF03487

G1SCQ2_RABIT/16-144..SLKELIE-----ELVNIT---------------HN---Q..K------------------------------------
IL13_HUMAN/16-144..ALRELIE-----ELVNIT---------------QN---Q..K------------------------------------
IL13_RAT/2-130PVALRELIE-----ELSNIT---------------QD---Q..K------------------------------------
F7DGH7_MACMU/16-151..ALKELIE-----ELVNIT---------------QN---Q..K------------------------------------
L5M5Z7_MYODS/2-128..VVKELIE-----ELDNIT---------------Q.---...K------------------------------------
G5ASP9_HETGA/2-130..ALRELIE-----ELANVT---------------QN---H..K------------------------------------
B3GDZ5_PIG/2-130..ALKELIE-----ELVNIT---------------QN---Q..K------------------------------------
L8YAP6_TUPCH/2-128..ALKELIE-----ELDNVT---------------QN---Q..K------------------------------------
IL13_BOVIN/2-130..ALKELIE-----ELVNIT---------------QN---Q..K------------------------------------
IL13_MOUSE/2-130PLTLKELIE-----ELSNIT---------------QD---Q...------------------------------------
H0W834_CAVPO/16-149AVSIKELLG-----ELVNIT---------------QD---Q..K------------------------------------
F6WQF3_ORNAN/2-128NARLEELIS-----YLSSLN---------------LP---N..K------------------------------------
G3T2N9_LOXAF/2-133IWVLRELIG-----ELINIT---------------QN---QLPQ------------------------------------
M3YGH3_MUSPF/2-126..TTKELIE-----ELANIT---------------QN---Q...------------------------------------
B5FW67_OTOGA/2-129..KLKELIE-----ELDNIT---------------QN---Q..R------------------------------------
I3MAR4_SPETR/2-131..AFRELIE-----ELVNIT---------------QD---Q..K------------------------------------
IL13_CANFA/2-129..TLKELIE-----ELVNIT---------------QN---Q...------------------------------------

PF00727

IL4_FELCA/26-131--CMELTVM-----DVLAAP---------------KN---TSDK.....-------------------..........-.
H0XDE1_OTOGA/26-149--CDELTVA-----DIFAAS---------------KN---TTEK.....-------------------..........-.
IL4_MOUSE/27-140--CTEMDVP-----NVLTAT---------------KN---TTES.....-------------------..........-.
G3T4B8_LOXAF/26-132--CTELTVA-----DAFAAP---------------KN---TTEK.....-------------------..........-.
IL4_RABIT/28-143--CTKLMIA-----DALAVP---------------KN---TTER.....-------------------..........-.
G5ASQ0_HETGA/25-138--CAELAAA-----DVFAAP---------------KD---TAEK.....-------------------..........-.
F6U5N6_HORSE/26-135--CMELTVA-----DAFAGP---------------KN---TDGK.....-------------------..........-.
IL4_BOVIN/26-133--CMELPVA-----DVFAAP---------------KN---TTEK.....-------------------..........-.
G3QSC0_GORGO/26-149--CTELTVT-----DIFAAS---------------KN---TTEK.....-------------------..........-.
A3FBF0_MUSPF/26-130--CMELTVT-----EVFSAP---------------KN---TSEK.....-------------------..........-.
IL4_RAT/27-139--CTEMFVP-----DVLTAT---------------RN---TTEN.....-------------------..........-.
G3WEJ0_SARHA/28-149--CSEMEVL-----DIFEDT---------------KK---NSSTRKLLP-------------------EMSSCSQLAM-T
I3MAS4_SPETR/24-141--CMELMVA-----DVFAVP---------------KN---TTEK.....-------------------..........-.
IL4_PIG/26-131--CMELPVT-----DVFAAP---------------EN---TTEK.....-------------------..........-.

PF00726

IL10_BOVIN/5-174KDQLHSLLL-----TQSLLD---------------DF---KGY-------------------------LGCQALSEMI-Q
IL10H_EBVB9/7-167KDEVDNLLL-----KESLLE---------------DF---KGY-------------------------LGCQALSEMI-Q
G3HB01_CRIGR/14-174KDQLDNILL-----TDSLVQ---------------DF---EGY-------------------------LGCQTLSEMI-Q

PF14565

IL22_HUMAN/40-178DNNTDVRLI-----GEKLFH---------------GV---SMS-------------------------ERCYLMKQVL-N
E1C1U2_CHICK/46-184DQDTDNRLI-----GQQIYV---------------NI---REN-------------------------NRCYMMKRIT-E

PF15036

IL34_MOUSE/28-184NYRIAVPYE-----GVLRVA---------------NI---TRL......-------------------QKAHVSEREL-R
R4GIU3_CHICK/19-177DYTLRVQHE-----EVLRTA---------------NV---TRL......-------------------RDGKVSEASL-R
F7EA00_CALJA/29-185NYLLKLXQQ-----AMFHHT---------------QL---DVL......-------------------QRARVSEREL-R
H0WFN4_OTOGA/28-184NYMISVPYE-----GVFRIA---------------NI---TKL......-------------------HRARVSEREL-R
M3ZVZ0_XIPMA/24-191NYAIRVHHE-----EIFKLS---------------NI---SKMKLKVEG-------------------LDELV....L-Q
U3JY35_FICAL/18-179DYTVQVQYE-----EVLRPS---------------NI---TRL......-------------------RNGTVSEAAL-R
L9KJY3_TUPCH/28-184NYRIGVPYE-----GVLRAA---------------NI---TRL......-------------------RRARMSEREL-R
G3T3A6_LOXAF/28-182NYRISVPYE-----AVLRVA---------------NI---TRL......-------------------QRAQVSEQEL-R
F6W3U1_MONDO/15-167DYRIRVPYE-----GVLRLA---------------NI---TRL......-------------------QQAEVSQPNL-R
I3JZ08_ORENI/24-192EYTIKVHNR-----EIFRLS---------------NI---SRMRLRTEG-------------------LNELV....L-Q
L5MCR9_MYODS/28-182GYRVSMPYE-----GVLRAA---------------NV---TRL......-------------------QRARVSQQEL-R
B3DLJ8_DANRE/23-195NYTVQVRYE-----EVFRLR---------------NI---SRL.VNTSN-------------------EEEPVLPRDL-Q
IL34_BOVIN/28-183NYRVSVPYE-----GVLRTA---------------NV---TRL......-------------------QRAQVSQQEL-R

PF01109

CSF2_RAT/18-139FSI-------------QRPTCVQTRLK----L--------YKQGLRGN-LTKLNGALT----------------------
CSF2_MOUSE/18-136FSF-------------KKLTCVQTRLK----I--------FEQGLRGN-FTKLKGALN----------------------
CSF2_BOVIN/18-138FDS-------------QEPTCLQTRLK----L--------YKNGLQGS-LTSLMGSLT----------------------
CSF2_CAVPO/18-140FEP-------------QEPTCLQTRLA----L--------FMKGLRGN-LTRLEGSLT----------------------
CSF2_PIG/18-139FDP-------------QEPTCVQTRLN----L--------YKQGLRGS-LTRLKSPLT----------------------
CSF2_HUMAN/18-139FDL-------------QEPTCLQTRLE----L--------YKQGLRGS-LTKLKGPLT----------------------
CSF2_CANFA/18-139FDP-------------EGPTCLETRLQ----L--------YKEGLQGS-LTSLKNPLT----------------------

PF02025

G1RQD7_NOMLE/22-133VHK-------------NHQLCTEEIFQGIGTL--------ESQTVQGGTVERLFKNLS----------------------
IL5_CAVPO/23-134AHK-------------NHQLCIEEIFQGIDTL--------KNQTTQGEALATLFQNLS----------------------
J9NWP5_CANFA/22-132TVF-------------KHQLCIKEVFQGIDTL--------KNQTAHGEAVDKLFQNLS----------------------
IL5_MOUSE/21-132THK-------------NHQLCIGEIFQGLDIL--------KNQTVRGGTVEMLFQNLS----------------------
G3WAR7_SARHA/25-134DPK-------------NHPLCIEEIFQGIETL--------KNQTAEDNVVERIFQNFS----------------------
IL5_HORSE/22-133EHK-------------NHQLCIEEVFQGIDTL--------KNQTVQGDAVAKLFQNLS----------------------
B5FW65_OTOGA/22-133VHK-------------NHQLCTEEIFHGLDTL--------RNQTAHEDGVEQLFQNLS----------------------
I3MDT8_SPETR/23-134AHK-------------NHQLCIEEIFQGIDTL--------KNQTTQGDAVERLFQNLS----------------------
G3T4B0_LOXAF/23-133VHE-------------NHQLCTEEIFQGIDTL--------KNQTVQDDAVGKLFKNLS----------------------
G1SL79_RABIT/22-133VHK-------------NHHLCIEETFRGVDTL--------KAQIVQGEAMDNLFQNLY----------------------

PF02059

IL3_CANFA/19-132LED-------------TLLRPNLDVFL----N--------ASSKF.HKNGLLIWNNLK----------------------
IL3_MOUSE/27-138RNK-------------SFRRVNLSKFV----E--------SQGEVDPEDRYVIKSNLQ----------------------
IL3_BOVIN/18-132TKE-------------SLLQANLKVFM----T--------FATDT.FGSDSKIMKNLK----------------------
G3UC30_LOXAF/22-133RDR-------------ASLKPNLDAFL----K--------ATENFKEKGGSSISKNLR----------------------
G1MH15_AILME/18-131LNT-------------TLLRPNLEAFL----N--------ATKNF.YNSESLIWKNLK----------------------
F1RJV6_PIG/18-131TNN-------------TLLRPNLEAFV----T--------FAENH.LKNISGIKKNLE----------------------
G1RQ11_NOMLE/20-137MEN-------------NLRRPNLEAFN----K--------AVKSL..QNASAIESILK----------------------
IL3_CALJA/19-136MKP-------------NLRKPNLEAFQ----K--------AVKSL..QNAAAIESNLK----------------------
F1LS41_RAT/29-138RNS-------------TLRRVNLDEFL----K--------SQEEFDSQDTMDIKSKLQ----------------------

PF07400

IL11_HUMAN/1-199AMSAGALGALQLPGVLTRLRADLLSYL-RHVQ--------WLRRAGGSSLKTLEPELG----------------------

PF00758

G3TYQ1_LOXAF/25-173GAVTLLLEGVMAARRQVGPTCLSSLLE----Q--------L..SGQVRLL..LGALQG----------------------
W5K758_ASTMX/26-175TGLWLLNRAFISLHTSISNSA.....L----H--------SHIDASVRNIASIGQVLR----------------------
B1N8Y2_DANRE/15-168SGLHMLNEAIGSLQISNQTEV.....L----Q--------SHIDASIRNIASIRQVLR----------------------
F7DTH0_CALJA/31-193QGLTLLSEAVLRGQALLANSSQPREPL----Q--------LHMDRAVSGLRSLTTLLR----------------------
M3XJ62_LATCH/27-177AGINLFTHTFKTVRDFIRDSV.....T----V--------YHITKSYSNTRSTAQILK----------------------
G3W289_SARHA/30-190QGLTLLSEAVLKGQALLANSSQTPVAL----K--------LFVDKAVSSLRSLRFLLR----------------------
F6WUU2_MONDO/31-191QGLTLLSEAVLKGQALLANSSQTPAAL----K--------LFVDKAVSSLRSLRFLLR----------------------
G3VW20_SARHA/26-175PTRNSLTKG....GGSPLPAWEAALVL----S--------LCRSGWAGDM..ISGLGP----------------------
G1PF99_MYOLU/45-207QGLALLSEAILRGQALLANSSQTSETL----Q--------LHVDKAISGLRSLTSLLR----------------------
TPO_CANFA/25-176GAVALLLDGVLAARGQLGPSCLSSLLG----Q--------L..SGQVRLL..LGALQG----------------------
F7G570_MONDO/26-177GAVTLLLEGAIAARGQLNPSCLSSLLG----Q--------L..SAQTHSL..LGALQG----------------------
H0W023_CAVPO/30-191QGLVLLSEAMLQGQALLANSSQQSETL----Q--------LHLDKAVSGLRSLTSLLH----------------------
H2LEX3_ORYLA/33-182TGLWLLQQALGSFGPSVTNTA.....L----N--------NHIDNTARNLVSINAVLR----------------------

PF06875

Q5BNQ4_9SALA/2-215LKNNLYFYSAIVEFLKEAMTEQ-EDLNPAELA--------LKAKFE-EAMANSNTLIS----------------------
Q5BNQ2_9SALA/2-215LNNNLYFYSAIVEFLKEAMTEQ-EDLNPAELS--------LKAKFE-EAMANSNTLIS----------------------

PF01110

CNTF_CHICK/1-194LLDNLAAYRAFRTLLAQMLEEQRELLGDTDAE--------LGPALA-AMLLQVSAFVY----------------------
G3VWZ5_SARHA/1-195LQANLHAYRTFHVLLTEVLEDQRAQFTPTERD--------FHQNIH-RVLLQVAAFAY----------------------
E1BFH9_BOVIN/1-193LQENLQAYRAFHGMLARLLEDQRAHFTPAEED--------FHQAIH-AVLLQVAAFAY----------------------
G5AP46_HETGA/1-192LQENLHAYRTFHVLLARLLEDQQVHFTPTESD--------FHQAIR-SLGLQVSAFAY----------------------
H0Z9U1_TAEGU/1-188LLENLAAYRAFRTLLAQMLEEQREQLGEADAG--------LGRALA-AVLLQVSAFAY----------------------
CNTF_HUMAN/1-194LQENLQAYRTFHVLLARLLEDQQVHFTPTEGD--------FHQAIH-TLLLQVAAFAY----------------------

PF01291

LIF_MOUSE/44-203LVELYRMVAYLSASLTNITRDQ-KVLNPTAVS........LQVKLN-ATIDVMRGLLS----------------------
LIF_BOVIN/43-202LVELYRIIAYLGASLGNITRDQ-KVLNPYAHG........LHSKLS-TTADVLRGLLS----------------------
ONCM_HUMAN/37-209RGFLQTLNATLGCVLHRLADLE-QRLPKAQDLERSGLNIEDLEKLQ-MARPNILGLRN----------------------
ONCM_MOUSE/34-194PHFLSTVYTTLDRVLYQLDALR-QKFLKTPAFP..........KLD-SARHNILGIRN----------------------
ONCM_BOVIN/34-194QDFLQTLNTTLGLILRMLSALQ-QDLPEAAH..............Q-QAEMNVRGFGN----------------------

PF03039

IL12A_MOUSE/6-215QKTSLMMTLCLGSI.YEDLKMYQTEFQAINAA--------LQNHNH-QQIILDKGMLV----------------------
G3VQT1_SARHA/40-247KEKLSVKQLCLKSI.YKDLETYKTEFKVVEET--------LAKDPT-RQISLDQNMLA----------------------
F6T5A8_MONDO/5-202TETLFIKDLCLRSI.YEDLETYKAEFNVIKKT--------LTKDPA-KQISVDLNMLA----------------------
IL12A_PIG/6-222GKTSFMTTLCLSSI.YEDLKMYHVEFQAMNAK--------LLMDPK-RQIFLDQNMLT----------------------
L8YEA2_TUPCH/1-213EKTSHMMTLCLSSI.YEDLKMYQVEFKAINAQ--------LWMDPE-RQILLDQNMLT----------------------
H0X861_OTOGA/6-217RKTSSMMTLCLSSI.YEDLKMYQVEFKAMNEV--------LSMYPI-NQTILDQNLLT----------------------
G1QWH2_NOMLE/40-254RQLYHLTPLCLSFLQYESIYSSRVQIKQASHR--------RCMCLE-NEYFFSQVLRT----------------------
I3MN91_SPETR/4-220GRTSWNTTLCFSSI.YEDLKMYQLELKAINEK--------LLMDPK-GQIYEDKALLA----------------------
Q924V6_CAVPO/6-221GKTSFMMALCLNSI.YEDLKLYQLEFKNMNAQ--------LLMDPQ-RQIFLDQNMLS----------------------

PF02024

H3AP27_LATCH/26-169...AERPLESLGSM-DETLEIFHWILSSLP----------V.DDVT-QILWDIENLRA----------------------
G3WWV6_SARHA/23-167...GLHPFQSLSDM-DQTLAIYQQILSNLS----------S.RNMV-QISNDLENLRD----------------------
F6PLK2_ORNAN/23-167...GNQQFQNLADM-DQTLAVYQQILSSLP----------M.PDRT-QISNDLENLRS----------------------
F7HGW1_CALJA/23-167...GFHSDLSFSKM-DEILATYQQIVISLP----------S.GNMI-QISNDLENLRA----------------------
G5BHA4_HETGA/23-167....LYPDLSFSKM-DQTLAVYQQIISNLP----------SRRNMV-QISNDLDNLQN----------------------
W5NER9_LEPOC/28-172DALNDKTLEGLSTV-EDNLHTFQEILSSLP----------M.EEMD-QILADIFNLRM----------------------
H0V7C6_CAVPO/23-165....LSPYLSLPKM-DQTLTLYQKVITTLS----------S.SHTA-QISNDLENLQS----------------------
LEP_HUMAN/23-167...GLHPILTLSKM-DQTLAVYQQILTSMP----------S.RNVI-QISNDLENLRD----------------------

PF00143

I3MVD7_SPETR/41-186QVFNLFSTQ.EAFAAW.NQTLLNTFLTGLHQQ--------LD-DLK.ACGTQQVGVEEA.--------------------
M3WTR1_FELCA/30-186QTFNLLHTE.RSSAAW.SPAPLHGLRSGLHRQ--------LE-ALD.ACLLQATGEGER.--------------------
G3UK87_LOXAF/31-177QIFNLFRTK.EPSTAW.NTTLPDQLHNGLYQQ--------LE-DLE.TCSMQAVGEGSV.--------------------
H0W7G8_CAVPO/30-185QTFNIFTSE.DSSAAW.NQSLLDTFCTGLHQQ--------LN-DLQ.ACLTQDTGLEEP.--------------------
IFNB_HORSE/31-184HTWRIFRRN.FASTGW.NETIVKNLLVEVHLQ--------MD-RLE.TNLEEIMEEESS.--------------------
G5BPX2_HETGA/32-192QAFNIFSRH.TSDSTW.KEEYLTQIKSELAEQ--------RE-YLE.QCLKEEKKENKGM--------------------
I3JM36_ORENI/31-182EVAALFEED.HSSASW.EDSTVRNFLNIVNKQ--------AE-ELH.SCIGSHSHKKKN.--------------------
L8Y906_TUPCH/30-185QIFNLFSSE.GSSATW.EEALLDKLLAGLHQQ--------LE-DLE.TCLVQGVGEEPS.--------------------
F7BVP5_ORNAN/27-181HIFNVFSRN.HSQTGW.DEATVEKFLHGVHKE--------MM-RLE.VFLEEEMGWENS.--------------------
H2R6R8_PANTR/30-185QTFNLFSTE.DSSAAW.EQSLLEKFSTELYQQ--------LN-DLE.ACVIQEVGVEET.--------------------
F6YZB3_ORNAN/30-179QIFTVFSQT.LSQTGW.DQAEVENFLHGLHRQ--------LE-ELE.VCLEEDTDPSQA.--------------------
F7ABU5_MONDO/29-182QIFTLFSQN.TTPATW.NQTQVIQLLIRLDQQ--------LE-QLE.RCLGQNVKWEEF.--------------------
IFNB_RAT/31-182NVFLVFRSN.FSSTGW.NETIVESLLDELHQQ--------TE-LLE.IILKEK.QEERL.--------------------
I3N788_SPETR/31-185DIFVIFTRN.FSNTGW.NETIVKDLLVELHQQ--------MD-LLE.TILEKKLGEENK.--------------------
G5C259_HETGA/30-185QTFNLFSTQ.DSSAAW.NNGLLDTFCTGLHQQ--------LS-DLE.ACLTQEVGQEEV.--------------------
H0XKS8_OTOGA/31-185NIFRILRRD.FSSTGW.NETIVDALLANFHQQ--------MD-SLE.TTLDEKLEDKNF.--------------------
G5E7E1_LOXAF/13-168QIFNLFHTK.DSSAAW.NTTLLDQLHSGLYLQ--------LE-DLE.ACLVQAMEEEES.--------------------
G3GXU9_CRIGR/31-180NIFIVFNSN.YSSTGW.NKTIVESFLDKLYKQ--------ID-FLK.KILKEMPKNESL.--------------------
H0XRP5_OTOGA/30-185QTFNLFSTN.DSSEAW.NKTLLDQFRTGLYQQ--------LN-ELE.ACLMPDEGVEDT.--------------------
G1L8G2_AILME/30-185QIFNLFSQS.GSFVAW.DETLLDKFLAGLHQQ--------LE-DLE.TCLEEEKNVEQL.--------------------
H0W510_CAVPO/30-182QTFILFTSQ.YSCPPW.NQSLLDSFCTGLYEL--------LK-ALQ.ACLTQEAGLQEP.--------------------
G1Q880_MYOLU/30-185QVSNLLSTE.NSSVTW.NTTLVDQLRSGLHRQ--------LE-DLE.ACLVEEMGEEGS.--------------------
D2HTQ4_AILME/37-205QAFNIFSQY.TFTSTW.EKDYLKQIQIGLDQQ--------LQ-YLE.QCLEEEEKEKEDS--------------------
IFNE_PIG/31-186QIFSLFRAV.ISLDGW.EESHMEEFLVELHQQ--------LE-YLE.ALMRLQAEQKSD.--------------------
H0XSG1_OTOGA/30-185QTFNLFSTK.DSSEAW.NKTLLDQFRSGLYQQ--------LN-ELE.ACLMQEVGVGEA.--------------------
A8E6E8_MONDO/30-182QKFTLFSQN.AAPVAW.NQTQLMQLLIGLDQQ--------IE-QLE.RCLTQDVEQDEP.--------------------
C8CKA7_PIG/30-185QTFQLFSTE.GSAAAW.DESLLHQFCTGLDQQ--------LR-DLE.ACVMQEVGLEGT.--------------------
G1NR05_MELGA/36-188QLFNILSSP.HTPAHW.IDHAHHSLLNQMQHY--------IH-HLE.QCFVDQGTRSQKQ--------------------
G3I0H3_CRIGR/33-178QALILFSSN.ESSAAW.ETTLLDTFCDELHQL--------LS-DQQ.ACLKQQVVMQ...--------------------
I3LBU7_PIG/30-179QTFLLFHTE.HSSAA..DSTRLDKLCSGLHQQ--------ME-DLD.SCLVQVRGEQVS.--------------------
C8CKC3_PIG/37-205RAFNIFTQD.TFKATW.EEKLLRQVQMGLDQQ--------LQ-VLE.QCLQEEEEENEDI--------------------
IFNE_MOUSE/33-185QIFTLLQTH.GTMGIW.EENHIEKVLAALHRQ--------LE-YVE.SLGGLNAAQKSG.--------------------
G3N2A8_BOVIN/30-185QTFNLFHTE.RSSAAW.DTTLLEQLHTGLHQQ--------LD-DLD.ACLGQVMGEEDS.--------------------
G3WZJ8_SARHA/30-182QIFTIFSLN.TTPAAW.NQTQLRQLLIGLDQQ--------LE-QLE.QCVGQEAEQEEP.--------------------
G1KU56_ANOCA/35-182QILCLYIQN.HTKLPW.DENSIGILKVGLKQE--------IA-KLT.PCLSEDKQEIRE.--------------------
G1KX99_ANOCA/29-180QTGHIFRQN.YTEMPW.DEDSLRVFHAGLDQQ--------SE-NLK.SCLSESPRSQRI.--------------------
L5K909_PTEAL/30-184QTFLLFCTE.ASSTAW.DETLLGRFCTGLYQQ--------LN-HLE.ACQTQEVGTEET.--------------------
H0VUV7_CAVPO/30-185QTLILFSSQ.NSHAAW.NQSLRRTFCDALRDQ--------MN-DLK.ACLTKETGLEDP.--------------------
L5K635_PTEAL/30-183QTFDVFGTK.QSSAAW.NTTLLHGLLSGLHRQ--------LE-DLG.TCLVPEMKEVES.--------------------
G5CB66_HETGA/31-185NILDIVRKN.FSNTVW.NETIVENLLVELHQQ--------MD-SLK.TLLQEILEKKDI.--------------------
L5LKN9_MYODS/31-186QIFSLFQAN.TSLEGW.KESRMERFLIELHQQ--------LE-YLE.TLRGLQTDQKSS.--------------------
H0XMZ9_OTOGA/31-186QIFNLFRAN.ISVDGW.EESHVEKFLIELHQQ--------LE-YLE.ALTGLEAEQRSG.--------------------
H9KYA4_CALJA/30-185QTFNLFSTK.DSSVTW.DATLLDTFYTELYKQ--------LN-YLE.ACVMQRIGVEGT.--------------------
H0YTY6_TAEGU/41-187HLFHTLSSN.STRQHW.PSHARNLLLNKLQHH--------IH-HLE.QCLPDNALLFKG.--------------------
A8E6F5_XENTR/55-202ETMRFYMKH.HESMGC.KQQAWERFQQLLYYQ--------IN-QLE.ACIPETAENPVFN--------------------
G7PS89_MACFA/30-185QTFNLFNTK.NSSAAF.NETLLDEFYIELDQQ--------LN-DLE.SCVMQEVGVTET.--------------------
I3MY95_SPETR/37-186KILDLFGTQ.EAFAAW.NKILLDIFLSGLNQQ--------YQ-DLK.ACVTHQVWRQKP.--------------------
G3WZF5_SARHA/30-185QIFLLFSSK.NASLGV.NNTIIETFLNIIFQQ--------ME-HLE.MALKEEMNQVNS.--------------------
H0VF99_CAVPO/32-187NVLGIFRKN.ISTTVW.NETIVENLTDELHQQ--------MD-HLKSTILQERLEDKNM.--------------------
L8Y8F8_TUPCH/30-184QTFNLFVSE.ASSAAW.NTTLLDQLHSGLHRQ--------LE-DLE.ACLVQGVVEEPS.--------------------
F1LVL8_RAT/29-184QIFVLFQTH.SSRGVW.EENHIEEVLAALHRQ--------LG-YLE.SLGGLKAERKSG.--------------------
G1Q950_MYOLU/31-184QIFSIFRRG.FSNAGW.NETIVENLLEELDGQ--------MD-RLE.TALEEITKEGKF.--------------------
I3N5Z0_SPETR/27-178QIFNLFKKN.ISLGSR.EENHIPIFLTDLHQQ--------LE-YLE.TLLGLEAEQKSH.--------------------
A3FBE8_MUSPF/31-184KTSDIFRRN.LSSTGW.NESIVENLLATLHWQ--------KE-HLE.EILEDIMQEENV.--------------------
G3UCD2_LOXAF/30-187QIFNLFSLQ.ASSAAW.DQTLLDKLFAALDQQ--------LN-DLE.VCLMQETGVEETP--------------------
L9LC61_TUPCH/31-185NIFGVFRRN.FSSTGW.NDTIVEHLLAQLFWQ--------MD-HLE.TMLEEKLEEENV.--------------------
H0Y0D2_OTOGA/32-187HIFSLFSTT.ESSDAW.NKTLLDQLRTNLGWQ--------LQ-ELE.SCLMSLGEEEGT.--------------------
L5KKJ7_PTEAL/32-192QAFNIFSQY.TFQSTW.KKKYLKRIQIGLHRQ--------LQ-YLE.QCLEEEEKENEDM--------------------
L5KWM8_PTEAL/110-263ETFDVFCTE.HSSAAW.NTTLQHGLLTGLHRQ--------LE-DLG.ICLVPEMKEVES.--------------------
F7GHL9_MONDO/29-181QIFNLFSQN.AMPATW.NQTQVIELRIGLDHQ--------LG-QLE.SCLGQDAEWEVP.--------------------
G3TS29_LOXAF/30-179QTFNLFSRS.DSLEAW.DETFLDKFLLGLYQQ--------LN-DLE.ICFEKERKVEQI.--------------------
W5PZ39_SHEEP/33-184QAFHIFTQD.TFQSTW.EGKQLRQIQIGLDHQ--------LQ-YLE.QCLEEEER.....--------------------
D2H9N6_AILME/31-184KTSDIFRKN.LSSTGW.NEIIVNNLLEKIHWQ--------IE-HLE.EILEKIKEEENF.--------------------
IFNT4_SHEEP/30-185QSFNLFYTE.HSSAAW.DTTLLDQLCTGLQQQ--------LD-HLD.TCRDQVMGEKDS.--------------------
F7A317_HORSE/30-183QIFHLFSTD.GSSAAW.DESLLDKLYTGLYQQ--------LT-ELE.ACLSQEVGVEET.--------------------
G3TTC1_LOXAF/30-185QIFDLFRTM.DSFAAW.NTTLLNQLLNGLPEQ--------QE-DLE.TCFMQAMEEGKS.--------------------
Q29412_PIG/31-184QIFGILRRN.FSSTGW.NETVIKTILVELDGQ--------MD-DLE.TILEEIMEEENF.--------------------
IFNB_MOUSE/31-180NVFLVFRNN.FSSTGW.NETIVVRLLDELHQQ--------TV-FLK.TVLEEK.QEERL.--------------------
IFNA3_CANFA/30-183KVFHLFCTN.TSSAPW.NMTLLEELCSGLSEQ--------LD-DLD.ACPLQEAGLAET.--------------------
IFNB_HUMAN/31-185NIFAIFRQD.SSSTGW.NETIVENLLANVYHQ--------IN-HLK.TVLEEKLEKEDF.--------------------
I3UJJ8_FELCA/30-185QIFNLFRAN.TSSDGW.EESHVEKFLTELHQQ--------LE-YLE.ELTGPEAEQDSC.--------------------
M3Z729_MUSPF/30-183KTFHLFCTE.ASPAPW.NTTLLEELCSGLSEQ--------MS-HLE.ACPLQEAGVEEK.--------------------
H0W289_CAVPO/30-190QILTLFYTE.HASAAW.NGALLDQLHSLLYQQ--------LE-AMK.ICMVQEAGGEES.--------------------
G3WZQ8_SARHA/29-181QIFTIFSLN.TTPATW.SQTQLKQLLIGLDQQ--------LD-QLE.QCLGQDVEREEP.--------------------
G1KYL3_ANOCA/28-176QTGHIFKQN.YTEMPW.DEDSLRAFHAGLDQQ--------SE-NLK.SCLSASPR.....--------------------
G1U0Q8_RABIT/30-185QIFNLLHTA.RSSAAW.NNTLLEELHTALHQQ--------LQ-GLE.TCLVQAMGEEDS.--------------------
G1TYS8_RABIT/33-195QAFCIFMGH.AFQTTW.EETHLTQIQNGLYEQ--------VA-YLE.QCLMEDIHETKE.--------------------
G1SJC4_RABIT/30-185QLLNLFSTK.EASAAW.DKALLDRLCTGLFEQ--------QS-DLE.VCMMQGAGAEEM.--------------------
IFN_ANAPL/38-190HLFDTLSSP.STPAHW.LHTARHDLLNQLQHH--------IH-HLE.RCFPADAARLHRR--------------------
A8E6F6_XENTR/31-179ETMRFYMKH.HESMGC.KQQAWERFQQLLYYQ--------IH-QLE.ACVSQTEENDLLK--------------------
M3WRV1_FELCA/30-184KIFHFFCTEASSSAAW.NTTLLEEFCTGLDRQ--------LT-RLE.ACVVQEVGEGEA.--------------------
L8Y4J0_TUPCH/31-186QIFNLFSAN.VSPDDW.EEHYKEKFLIELHEQ--------LD-YLE.GLMELEAEQKND.--------------------
F7G875_MONDO/31-182QTLILFSSK.NACPDV.NDTIIEPFLSGIYQQ--------ML-HLE.....EEMDQANS.--------------------
I3N7K4_SPETR/37-197QAINIFSQN.TFNSSW.DEEQLVQLQSNLYEQ--------VE-YLK.QCWGKENKEKED.--------------------
IFNT2_BOVIN/7-162QCFNLFYTE.HSSAAW.NTTLLEQLCTGLQQQ--------LE-DLD.ACLGQVMEEKDS.--------------------
G1L8I1_AILME/30-183KIFHVFCTE.PSSAAW.NRTLLEEFCSGLSEQ--------LS-VLE.ACPMQAAGVGET.--------------------
V8NNB8_OPHHA/22-183QIDVIFRQN.HTELVW.HEGSLRDFHIGLDQQ--------IK-MLE.TCGNAELEQVIT.--------------------
G3SI98_GORGO/35-185QAFNIFSQH.TFK.YW.KERHFKQIQIGLDQQ--------AE-YLN.QCLEEDENENEDM--------------------
H9GZR7_HORSE/30-185QIVNLFHTE.RSSAAW.NTTLLDRLLTGLHQQ--------LE-DLN.TCLDEQTGEEES.--------------------
G3I0I6_CRIGR/31-185QIFSLFQAH.VSRGIW.EENHIERVLGALHQQ--------LE-YVE.LLAGLKAESKSG.--------------------
W5JYQ9_ASTMX/29-179YINSMLNDH.ELPDQWTSQEKLDYFLHIVFRL--------IE-ENK.CVMSKTQDSLDD.--------------------
G3I0H8_CRIGR/30-185QVLILFSSK.DSSATW.ETTLLDTFCTGLHQQ--------LS-DLQ.ACLMQQVGEQEP.--------------------
K7GQJ6_PIG/18-164QTFLLFHIE.RSSAAW.DSTLLDKLCSGLHQQ--------LE-DLD.PCLVQVMGEQAS.--------------------
I3L756_PIG/30-180QTFLLFHTE.RSSAAW.DSTLLDKLCSGLHQQ--------LE-DLD.PCLVQEMEEQTF.--------------------
IFNE_HUMAN/31-186QIFSLFRAN.ISLDGW.EENHTEKFLIQLHQQ--------LE-YLE.ALMGLEAEKLSG.--------------------
IFNW2_HORSE/30-185QIFSLFHTE.RSSAAW.NTTLLDELCTGLLRQ--------LE-DLD.TCLEQEMGEEES.--------------------
G1KWE0_ANOCA/33-180QTGHIFRQN.RTEMLW.DEDSLRAFHAGLDQQ--------SE-NLK.SCLSASPRSQRI.--------------------
IFNA1_MOUSE/30-185QILNIFTSK.DSSAAW.NTTLLDSFCNDLHQQ--------LN-DLQ.GCLMQQVGVQEF.--------------------
IFNB2_BOVIN/31-184QIFNILTRD.FSSTGW.SETIIEDLLEELYEQ--------MN-HLE.PIQKEIMQKQNS.--------------------
G3UJX3_LOXAF/31-185QIFDIFLGN.FSHTGW.DETVIENLLAELSQQ--------RD-RLV.TILEESMEEENP.--------------------
L9L941_TUPCH/34-198QAFNIFSQD.TFKSTW.EQKHLKQIQMGLHQQ--------VE-YLE.QCLEEEENEN.DW--------------------
W5N6G4_LEPOC/31-180CVHNIFNKT.GHPATW.EISELERFQGLLYRQ--------IR-QLT.LCAGSEMKFSGEP--------------------
D3Z919_RAT/29-179QVLTLFESE.ESRAAW.NETLRLSFCNYLYQQ--------LK-DLE.ACQNQQVGVQEV.--------------------
IFNB_FELCA/31-184KIFNIFSRS.TSSTGW.NETTVENLLATLHWQ--------KE-HLE.TILEEIMEEENF.--------------------
M3YX13_MUSPF/32-179QTFSLFRAG.ISLDGW.EEIRVE.FLTELHQQ--------LE-YLG.ALRGLGAEQNSG.--------------------
M3VXI8_FELCA/39-205QAFNIFRES.TTKSTW.KKKNLKQIQIRLDWQ--------MH-HLE.KCFEEEEKGKEDS--------------------
W5PG31_SHEEP/30-185HTFQLFSTE.SSAAAW.DQSLLDKLCAALDQQ--------LT-DLQ.ACLRQEEGLRGA.--------------------
F7B527_HORSE/29-183HTFHLFSTT.GSRAAW.DETLLDKFLLGLYQQ--------LD-DLE.TCLGKETKVEQS.--------------------
M3WZS7_FELCA/29-181QIFNLFSKS.DSFVAW.DEMLLDRFLVGLYQQ--------LD-DLE.TCLREEMNMEQL.--------------------
G3VDC6_SARHA/30-182QIFNIFSLN.TTPAEW.NQTQLIQLLMGLDQQ--------LE-QLK.SCVGQEVEWKE..--------------------
H9L1C3_CHICK/32-182HIFYIFSKN.LTLAAW.DGAALEQFQNGLYQQ--------IE-KLE.ACIIKKQTQYFWS--------------------
C8CKB9_PIG/28-175QIINLFNTE.NSRAAW.NNALLDHLLSRLDHG--------LD-RLE..............--------------------
H0VYK7_CAVPO/32-181NIFVIIRKE.FSTTVW.NKTIVDDLLDKLHQQ--------MD-RLKSTILQERPEDTNM.--------------------
L5KBH2_PTEAL/30-185EISNVFGTQ.QSSGAW.NTTLLHGLLSGLHWQ--------LE-DLG.TCLVPEMKEAES.--------------------
G3R8Q7_GORGO/30-185QIFSLFHTE.RSSAAW.NMTLLDQLHTGLHQQ--------LQ-HLE.TCLLQVMGEGES.--------------------
R4GKJ6_CHICK/39-191HLFKILSSP.STPAHW.NDSQRQSLLNRIHRY--------TQ-HLE.QCLDSSDTRSRTR--------------------
G7PS88_MACFA/30-185QTFNLFTTK.DSSAAW.DEDLLDKFCTELYQQ--------LN-DLE.ACVMQQERVGET.--------------------
M3Z715_MUSPF/30-183NIFHLFCTE.ASPAPW.NTTLLEELCSGIYQQ--------VN-DLQ.ACLMQEAGVEEM.--------------------
H0VXI5_CAVPO/30-181QTFNLFTSE.DSSAAW.DKSLLSYFCTGLHQH--------LK-HLH.ACLTQEVGLQEP.--------------------
G3I0H6_CRIGR/31-178QALILFSSN.KSSAAW.EKTLLKPFCNSLLQQ--------FN-ALK.ACLMHQVGMQ...--------------------
C8CKA9_PIG/29-183QIFRLFSTR.GSPSSW.DETLLIKFLSGLYQQ--------LD-DLE.KCLREGKKVEQS.--------------------
H0W3G0_CAVPO/30-185QILTLFNTQ.LSSAAW.NATILHKLHTVLHQQ--------LE-VMK.TCLVQVLREEGC.--------------------
G1PDS6_MYOLU/36-199LAFSIFTQS.TFQSTG.EEKHLGQIQTGLDRQ--------LQ-YLE.QCLKEE.KGNEDK--------------------
H0W4H8_CAVPO/27-181QTFNLFISE.DSSAAW.NKSLLHSFCTGLHQQ--------LN-DLE.ACLTQETGLEEP.--------------------
G1TTX4_RABIT/34-180NIFDIFRKN.FSSTGW.NETLVENLLGETHLQ--------IH-HLK.SKINKKV......--------------------
I3MXH1_SPETR/31-185DIFHVFKKG.YSNPDW.NNTIVTDLLSELHQQ--------MD-LLN.TTVVEKLGEENK.--------------------
H0WK94_OTOGA/40-202QAFHIFSQY.TFEPTW.KLKHLNQIQMGLDKQ--------LE-YLE.QCLQEEENENAD.--------------------

PF02947

FLT3L_MOUSE/30-162RWIEQLKTV--------AGSKMQTLLEDVNTE--------IH-FVT-SCTFQPLPECLRF--------------------
F6T7S9_ORNAN/28-157DRLKHLERM--------SGPRLRELVHKVQAE--------VD-FVN-DCGFQRPQKCARF--------------------
H9GP84_ANOCA/29-165RNLNRMINV--------SGSELEKSIRKLMIH--------TT-FVE-MCDIN..DSCVKF--------------------
F6TPW7_MONDO/34-163KTLDRLELV--------AGKELKKLLDKVCTE--------IS-FVR-KCFSEALPGCLHF--------------------
G5B8P0_HETGA/20-150RWMERLKTV--------AGLKIRELLETVDTE--------IH-FVT-SCAFQPLPSCLRF--------------------
G1M637_AILME/29-159RWMGQLKAV--------AGSQMQILLEAVNTE--------IH-FVT-LCALQPLPSCLRF--------------------
L9JA37_TUPCH/769-910RWMERLKTV--------AGPQIQDLLEKVNTE--------IH-FVT-SCDFQPLPSCLRF--------------------
G3VSA3_SARHA/79-209ETLDRLKLV--------AGSKLQEPLEAVYAE--------ID-FVG-QCVNQSFPSCLRF--------------------
G1QZC3_NOMLE/30-160RWMERLKTV--------AGSKMQGLLERVNTE--------IH-FVT-KCAFQPPPSCLRF--------------------

PF00714

IFNG_HORSE/15-152DILKNWKE.-DSDKKI-IQSQIVSFYFKLFEN--------LK.DNQ-VIQKSMDTIKED---------------------
H0WPL1_OTOGA/15-151DILKNWEK.-ESD.KI-IQSQIVSFYFKLFEQ--------HK.DNQ-TIKKSIETIKEE---------------------
Q8CGS0_CAVPO/15-154GILKNCQE.-ESERKI-FQSQIVSFYFKLFEK--------HFTDNQ-TVQNSMNTIKEQ---------------------
B9VS86_CALJA/15-152DILRTWRE.-EGDRKI-MQSQIISFYFKLFKN--------FK.DNQ-SIQKSMETIKED---------------------
G3SUC6_LOXAF/15-152DILKNWKE.-DSDKKI-IQSQIVSFYLKIFDN--------LK.DNQ-VIQESVKTLEED---------------------
G3GY20_CRIGR/2-135NTLMNWQK.-DGDTKI-IQSQIVSFYFKLFEA--------LK.DNQ-AIQRSIDTIKAD---------------------
I3MNV6_SPETR/15-152DILDRWEE.-ESDKKV-IQSQIVSFYFKLFEH--------LT.DNK-IIQGSINTIRED---------------------
L5LME8_MYODS/15-153DILMNWKG.-ESDIKI-IQSQIISFYFKLFEN--------IE.DNK-TIQNSLDIIKEE---------------------
G5BGB5_HETGA/15-152GILKNCQE.-ESDKKI-FQSQIVSFYFKLFEK--------SG.GNQ-IVQKSMDTIKED---------------------
G3WQJ9_SARHA/15-153DMMKTWKEG-NCDKKI-LMSHVVAVYFKIFEI--------FK.NNS-IVKRSMEHIRED---------------------
IFNG_SHEEP/15-152EILKNWKE.-ESDKKI-IQSQIVSFYFKLFEN--------LK.DNQ-VIQRSMDIIKQD---------------------
IFNG_RAT/14-151DIWRNWQK.-DGNTKI-LESQIISFYLRLFEV--------LK.DNQ-AISNNISVIESH---------------------
IFNG_RABIT/15-152NILRNWKE.-ESDNKI-IQSQIVSFYFKLFDN--------LK.DHE-VIKKSMESIKED---------------------
L9KVU0_TUPCH/51-188DILKNWTE.-ESDKKI-FQSQIVSFYFKLFES--------FK.DNQ-VIKKSVDIIKED---------------------
IFNG_FELCA/15-153DILKNWKE.-ESDKTI-IQSQIVSFYLKMFEN--------LKDDDQ-RIQRSMDTIKED---------------------

PF05337

CSF1_HUMAN/1-254DTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD--------YEEHDK-ACVRTFYET......................-.
CSF1_HUMAN/272-554PTGQDWNHTPQKT..........DHPSALLRD--------PPEPGS-PRISSLRPQGLSNPSTLSAQPQLSRSHSSGS-V
Q6GMN4_RAT/265-566PTGQTLNNTPEKT..........DGSSTLRED--------QQEPRS-PHFATLNPQRVGNSATPYAKLLPPKSHSWGI-V
O77709_BOVIN/1-254DTMRFKDNTPNAKVIVQLQELSLRLKSCFTMD--------YDEQDK-ACVRTFHET......................-.
Q64129_9MURI/1-257ETMRFKDNTPNRNATERLQELSNNLNSCFTKD--------YEEQNK-ACVRTFHET......................-.
CSF1_MOUSE/273-552PIGQTQNNTPEKT..........DGTSTLRED--------HQEPGS-PHIATPNPQRVSNSATPVAQLLLPKSHSWGI-V
O77709_BOVIN/274-554PT.EAWSHTPEKT..........ERPSASPRD--------PQEPDM-AKTPALHPQGLSNPSALSSQPKLPRSHSWGH-V
Q3TLQ6_MOUSE/1-254ETMRFKDNTPNANATERLQELSNNLNSCFTKD--------YEEQNK-ACVRTFHET......................-.
O77710_BOVIN/1-257DTMRFKDNTPNAKVIVQLQELSLRLKSCFTMD--------YDEQDK-ACVRTFHET......................-.

PF02404

R4GD07_ANOCA/1-283EFSDMPDVLSNYSIINNLRRIINDLMECLSST--------KYRNFR-QHHDHLYEEGRFIPEEFFKHFSNTVESYKIL.A
SCF_CHICK/1-287DISDMSDVLSNYSIINNLTRIINDLMACLAFD--------KNKDFI-KENGHLYEEDRFIPENFFRLFNSTIEVYKEF.A
SCF_RAT/1-273NISEG...LSNYSIIDKLGKIVDDLVACMEEN--------APKN.V-KESLKKPETRNFTPEEFFSIFNRSIDAFKDF.M
G1NWC8_MYOLU/1-272NISEG...LSNYSIIDKLVKIVDDLVECMEEH--------ALEN.V-KKSSNSLELKMLTPEEFFRIFNRSINAFKDLEM
F7EP53_MONDO/1-273KISSS...LSNYSIIDKLIKIIDDLMGCLEE.--------KNKNFR-KQNIHIYKRDSFNPEDFFRFFNKSIDAFKEY.E
F7C5I3_ORNAN/1-273EISES...LSNYSIINNLTRIIDDLMACLASD--------KNKHFV-QRNIHLYKKGSFIPKEFFGYFNRSIEAFRDF..
F7G0W2_CALJA/1-273NISEG...LSNYSIIDKLVNIVDDLVECVKEN--------SSKD.L-KKPFKSPEPRLFTPEEFFRIFNRSIDAFKDF.V

PF00489

IL6_BOVIN/27-208N-KLNLPKMEEKDGCFQSGFNQAICLIRTTAG--------LLEYQI-YLDYLQNEYEGNQEN------------------
M3X721_FELCA/27-208N-NLNLPKLAEKDGCFQSGFNQETCLTRITTG--------LQEFQI-YLKFLQDKYEGDKEN------------------
IL6_HORSE/27-208N-NLNLPKMAEKDGCFQSGFNQETCLMKITTG--------LSEFQI-YLEYLQNEFKGEKEN------------------
G3UHF3_LOXAF/20-205N-NLKLPQMTEEDGCFHSGFNKETCLMKIITG--------LSEFQI-YLDYLQNKFEGSKAN------------------
L5KPK4_PTEAL/20-202N-NLNLPKMAEKDGCFQSGFNQETCLMKITTG--------LLEFQI-YLDYLQNKFE...EN------------------
F7HV62_CALJA/27-212N-NLNLPKMAEKDGCFQSGFNEETCLLKITTG--------LLEFEV-YLEYLQNRFESSKEQ------------------
IL6_MOUSE/26-210N-NLKLPEIQRNDGCYQTGYNQEICLLKISSG--------LLEYHS-YLEYMKNNLKDNKKD------------------

PF16647

CSF3_BOVIN/42-190H-SLGIPQ-APLSSCSSQSLQLTSCLNQLHGG--------LFLYQG-LLQALAGISPELAPT------------------
CSF3_HUMAN/51-202H-SLGIPW-APLSSCPSQALQLAGCLSQLHSG--------LFLYQG-LLQALEGISPELGPT------------------
CSF3_MOUSE/57-205H-SLGIPK-ASLSGCSSQALQQTQCLSQLHSG--------LCLYQG-LLQALSGISPALAPT------------------

PF02372

IL15_PIG/33-160S-DAHPNCKVTAMKCFLLELRVI-----------------LQES..-RNSDISDTVEN----------------------
IL15_CAVPO/33-160S-DVHPNCKITAMKCFLLELRVI-----------------LHES..-RNEDIHETITN----------------------
IL15_FELCA/33-160S-DVHPNCKVTAMKCFLLELHVI-----------------SLES..-KNETIHQTVEN----------------------
IL15_SHEEP/33-160S-DAHPNCKVTALQCFLLELRVI-----------------LHES..-KNAAIYEIIEN----------------------
F1NZN5_CHICK/55-183T-YEDIECQEPVMRCFFLEMNVI-----------------LHECGI-KKCSRKHDVRN----------------------
G1NDP6_MELGA/5-137N-EIK.ECSQQTLQCYLEEM.VM-----------------LEKEIE-DEPEIKNEFKN----------------------
O73883_CHICK/5-138T-ETQ.ECTQQTLQCYLGEV.VT-----------------LKKETE-DDTEIKEEFVT----------------------
Q8JFF4_ANAPL/4-134N-DTK.ECSWQTLQCYLKEI.VT-----------------LEEEIE-DEDEIEDEKVS----------------------

PF00715

I3MQX6_SPETR/7-151K.KAT---DLEHLQCLEEELKPL-------------------QEVL-NVPQSKNFHLK----------------------
G5C793_HETGA/7-149N.KPS---ELQHLQCLEEELKPL-------------------EQVL-NLAEHKHFPLI----------------------
G1PJ32_MYOLU/7-147R.NAT---ELKHLQCLVDELKPL-------------------EEVL-KLEKS....LS----------------------
B1AB81_HORSE/7-146K.KAT---ELKHLQCLEEELKPL-------------------EEML-.....KNFLSK----------------------
G3HTL8_CRIGR/7-150K.KAT---ELKHLQCLEEELGAL-------------------QSVL-DLAQSKSFQLE----------------------
IL2_MACMU/7-151K.KAT---ELKHLQCLEEELKPL-------------------EEVL-NLAQSKNFHLR----------------------
H0Y254_OTOGA/7-149K.KAT---ELKHLQCLEEELGPL-------------------EKVL-DLGQSKNFHLG----------------------
IL2_MOUSE/7-165K.QAT---ELKDLQCLEDELGPL-------------------RHVL-DLTQSKSFQLE----------------------
G3SU90_LOXAF/7-147K.EVT---ELKHLQCLVDELKPL-------------------EDVL-NVAPSK....Q----------------------
IL2_PIG/7-151K.QAT---ELKHLQCLVEELKAL-------------------EGVL-NLGQSKNSDSA----------------------
IL2_FELCA/7-151K.KAT---ELTHLQCLVEELKPL-------------------EEVL-YLAQSKNFHLN----------------------
L5K7D9_PTEAL/7-149..NAT---ELNHLQCLVDELKPL-------------------EEVL-TIAQSKNSH.S----------------------
IL2_BOVIN/7-152KVNAT---ELKHLKCLLEELKLL-------------------EEVL-NLAPSKNLNPR----------------------
H0VBY4_CAVPO/7-149K.MVS---ELQHLQCLEEELRAV-------------------EQVL-NLAEHKNFPLI----------------------

PF00103

PLRP1_BOVIN/26-238E-ERDIVQQTNIEDLSKWTLVLLYSWNNPLHH--------LVTELQ-HMKELSNAFLS----------------------
CSH2_BOVIN/26-238E-ERDKAQQMNNEDLSKWTLVLLYSWNNPLYY--------LLLELR-NMKNLSEAVIS----------------------
PLRP3_BOVIN/1-213Q-EREKALRMNNEDLSKWILMLLYSWHRPLYL--------LVKDLQ-SMKEVSDTILS----------------------
PR4A1_RAT/17-227E-NKEQAQQFQLEVLLGLSHSLLQAWLNPLHH--------LWAEMC-DRLGSTPPTLY----------------------
CSH1_BOVIN/26-236N-NKEAAANTEDEALLRLVISLLHSWDEPLHQ--------AVTELL-HRNGASPDILA----------------------
PLRP4_BOVIN/26-239E-DMQHNPTDEQKGLIMWILMLLYSWQRPLYQ--------LVTDLR-SMKEVSNTILS----------------------
PR3D4_RAT/16-223E-NREEVHEIKTEDLLRSIINISVSWKEPLKH--------FVSAVT-DLPGASASMRK----------------------
PR2C2_MOUSE/16-224E-NKEQARLTHYSALLKSGAMILDAWESPLDD--------LVSELS-TIKNVPDIIIS----------------------
SOM2_HUMAN/9-215S-NRVKTQQKSNLELLRISLLLIQSWLEPVQL--------LR....-SVFANSLVYGA----------------------
PR8A5_RAT/17-238K-SR..GVNIDIEEYLKMSINFCGFMDQPLFH--------LVIELS-AMEGVPETILS----------------------
PR6A1_RAT/20-234V-SKEGTQQRLGVFLVKEMIGMLETWTFSLYH--------IANEMS-HMEEPPDEIIS----------------------
PR7D1_MOUSE/17-240E-TVEDVRKTSFEEFLKMVLHMLLAWKEPLKH--------LVTELS-ALPECPYRILS----------------------
CSH2_HUMAN/9-215S-NMEETQQKSNLELLRISLLLIESWLEPVRF--------LR....-SMFANNLVYDT----------------------

PF03487

G1SCQ2_RABIT/16-144-----APLCNGTMV-WSVNLTGSV.Y-CAALE--------SLVNVS-GCNAIQRTQR........---------------
IL13_HUMAN/16-144-----APLCNGSMV-WSINLTAGM.Y-CAALE--------SLINVS-GCSAIEKTQR........---------------
IL13_RAT/2-130-----TSLCNSSMV-WSVDLTAGG.F-CAALE--------SLTNIS-SCNAIHRTQR........---------------
F7DGH7_MACMU/16-151-----APLCNGSMV-WSINLTAGV..-.....--------..VRTF-SLGTSVRTERDSPWKAPG---------------
L5M5Z7_MYODS/2-128-----APLCNGSMV-WSVNLTAGS.Y-CAAFE--------SLMNVS-DCPAIQRTQR........---------------
G5ASP9_HETGA/2-130-----TPLCSGSMV-WSVNLTAGVWY-CAARE--------SLINVS-SCSALQRTQK........---------------
B3GDZ5_PIG/2-130-----TPLCNGSMV-WSVNLTTSM.Y-CAALE--------SLINIS-DCSAIQKTQR........---------------
L8YAP6_TUPCH/2-128-----AQLCNGSMV-WSVNLTTDV.C-CVALE--------SLTNVS-GCSTLQRTLR........---------------
IL13_BOVIN/2-130-----VPLCNGSMV-WSLNLTSSM.Y-CAALD--------SLISIS-NCSVIQRTKR........---------------
IL13_MOUSE/2-130-----TPLCNGSMV-WSVDLAAGG.F-CVALD--------SLTNIS-NCNAIYRTQR........---------------
H0W834_CAVPO/16-149-----TPLCNSSMV-WSVNLTAGLWY-CAARE--------SLINVS-NCSALQRTQK........---------------
F6WQF3_ORNAN/2-128-----QSLCNGSMV-WKVNFDWEKAQ-KEAES--------QRNNIS-DCETIQDILR........---------------
G3T2N9_LOXAF/2-133-----ASLCNGSMV-WNVNLTTNV.Y-CAAME--------ALSNVS-DCRAIEKTKR........---------------
M3YGH3_MUSPF/2-126-----ASLCNGSMV-WSVNRTTSM.Y-CAALE--------SLTSVS-NCSAIHRTQR........---------------
B5FW67_OTOGA/2-129-----APLCNGSMV-WSVNLTTDI.Y-CAALE--------SLINVS-SCSAIQRTQR........---------------
I3MAR4_SPETR/2-131-----APLCNGSMV-WSVNLTAGE.Y-CAALD--------SLIKVS-NCSAIQKTQR........---------------
IL13_CANFA/2-129-----ASLCNGSMV-WSVNLTAGM.Y-CAALE--------SLINVS-DCSAIQRTQR........---------------

PF00727

IL4_FELCA/26-131.-...EIFCRATTVLRQIYTHHN....CST..--------......-......K--------------------------
H0XDE1_OTOGA/26-149.-...EIFCRAATVLRQVYSHHQKEP.CRGAT--------ERQQLY-RHQQVIR--------------------------
IL4_MOUSE/27-140.-...ELVCRASKVLRIFYLKHGKTP.CLK..--------......-KNSSVLM--------------------------
G3T4B8_LOXAF/26-132.-...ETFCRATTVLWQVSKRHE....CFT..--------......-......K--------------------------
IL4_RABIT/28-143.-...EAVCRAATALRQFYLHHKVSW.CFK..--------....EH-GELGDLR--------------------------
G5ASQ0_HETGA/25-138.-.....LCQAVTVLHRTSYLGVGLS.CLN..--------....RH-RESVFLV--------------------------
F6U5N6_HORSE/26-135.-...E.ICRAAKVLQQLYKRHDRS..LIK..--------......-......E--------------------------
IL4_BOVIN/26-133.-...ETFCRVGIELRRIYRSHT....CLN..--------......-......K--------------------------
G3QSC0_GORGO/26-149.-...ETFCRAATVLRQFYSHHEKDTRCLGAT--------A.QQFH-RHKQLIR--------------------------
A3FBF0_MUSPF/26-130.-...EIFCRAATVLQQLSTHN.....CSN..--------......-......R--------------------------
IL4_RAT/27-139.-...ELICRASRVLRKFYFPRDVPP.CLK..--------......-NKSGVLG--------------------------
G3WEJ0_SARHA/28-149V-NDFETLCRAVTVLQQASNS......CPR..--------......-......Q--------------------------
I3MAS4_SPETR/24-141.-...EILCRATTVLRQTYQDHPVSR.CLN..--------....KN-GKLDILK--------------------------
IL4_PIG/26-131.-...ETFCRASTVLRHIYRHHT....CMK..--------......-......S--------------------------

PF00726

IL10_BOVIN/5-174F-YLEEVM-PQAENHGPDIKEHVNSLGEKLKT--------LRLRLR-RC---HRFLPC----------------------
IL10H_EBVB9/7-167F-YLEEVM-PQAENQDPEAKDHVNSLGENLKT--------LRLRLR-RC---HRFLPC----------------------
G3HB01_CRIGR/14-174F-YLVEVM-PQAENHGPEIKEHLNSLGEKLKT--------LRRQLQ-RC---HRFLPC----------------------

PF14565

IL22_HUMAN/40-178F-TLEEVLFPQSDRFQPYMQEVVPFLA----R--------LSNRLS-TC---HIEGDD----------------------
E1C1U2_CHICK/46-184I-IVKDVLLTEAKERYPYAEDVAQFLA----S--------LTSELS-RC---KYSGNR----------------------

PF15036

IL34_MOUSE/28-184Y-LWVLVSLNATESVMDVLLEGHPS.WKYLQE--------VQTLLE-NV...QRSLMD.......---------------
R4GIU3_CHICK/19-177Y-LWFHACSQAVLHILEVLPEKHPS.RGYTQE--------LSQLLD-ALGVEYSGYRQ.......---------------
F7EA00_CALJA/29-185Y-LWVLVSLSATESVQDVLLEGHPS.WKYLQE--------VQTLLL-DV...QRGLTD.......---------------
H0WFN4_OTOGA/28-184Y-LWVLVSLSATESVQDVLLEGHPS.WSYLQE--------VQRLLL-DV...HQGFKD.......---------------
M3ZVZ0_XIPMA/24-191R-LWFQVNQGVLKKIIRVLPERHPS.RPYTAE--------LERRFR-DA...EGVFVQ.SHPAEV---------------
U3JY35_FICAL/18-179Y-LWFHVSSQAVLRIREVLPEKHPS.WKYTQE--------LCQLFD-ALGEEYSKYRQ.......---------------
L9KJY3_TUPCH/28-184Y-LWVLVSLSAAESVQDVLLEGHPS.WQYLQD--------VQTLLQ-NV...QEGLTD.......---------------
G3T3A6_LOXAF/28-182Y-LWVLVSLSATESVQDVLLKNHPS.WKYLDE--------VQTLLV-TI...QQGLMD.......---------------
F6W3U1_MONDO/15-167Y-LWAALNCNTMEIIQNVLLEDHPS.RNYIKE--------IHELLI-YV...QEIAKD.......---------------
I3JZ08_ORENI/24-192R-LWFQVYQGVLKKILWVLPTRHPS.RPYTAE--------LERRFK-DA...QAVFMQ.SHPAQV---------------
L5MCR9_MYODS/28-182H-LWVSVSLGATEAVQGVLLEGHPS.WKYLKD--------IHSLLV-DV...QQALGD.......---------------
B3DLJ8_DANRE/23-195D-LWLYVSQQGIKKVLRVLPERHPTRRKYLSD--------LENLFK-KF...ETVFKEGNHEDQE---------------
IL34_BOVIN/28-183Y-LWVLVSLSATEWVQEVLLEGHPS.WKYLEE--------VHTLLL-DV...KQGLGG.......---------------

PF01109

CSF2_RAT/18-139--------------------------------------------------------------MIAS--------------
CSF2_MOUSE/18-136--------------------------------------------------------------MTAS--------------
CSF2_BOVIN/18-138--------------------------------------------------------------MMAT--------------
CSF2_CAVPO/18-140--------------------------------------------------------------LMAN--------------
CSF2_PIG/18-139--------------------------------------------------------------LLAK--------------
CSF2_HUMAN/18-139--------------------------------------------------------------MMAS--------------
CSF2_CANFA/18-139--------------------------------------------------------------MMAN--------------

PF02025

G1RQD7_NOMLE/22-133--------------------------------------------------------------LIKK--------------
IL5_CAVPO/23-134--------------------------------------------------------------LIKK--------------
J9NWP5_CANFA/22-132--------------------------------------------------------------LIKE--------------
IL5_MOUSE/21-132--------------------------------------------------------------LIKK--------------
G3WAR7_SARHA/25-134--------------------------------------------------------------SLKE--------------
IL5_HORSE/22-133--------------------------------------------------------------LIKG--------------
B5FW65_OTOGA/22-133--------------------------------------------------------------LIKK--------------
I3MDT8_SPETR/23-134--------------------------------------------------------------LMKK--------------
G3T4B0_LOXAF/23-133--------------------------------------------------------------LLKE--------------
G1SL79_RABIT/22-133--------------------------------------------------------------LIKK--------------

PF02059

IL3_CANFA/19-132--------------------------------------------------------------EFLP--------------
IL3_MOUSE/27-138--------------------------------------------------------------KLNC--------------
IL3_BOVIN/18-132--------------------------------------------------------------EFQP--------------
G3UC30_LOXAF/22-133--------------------------------------------------------------KFHP--------------
G1MH15_AILME/18-131--------------------------------------------------------------EFLP--------------
F1RJV6_PIG/18-131--------------------------------------------------------------KFRP--------------
G1RQ11_NOMLE/20-137--------------------------------------------------------------NLPP--------------
IL3_CALJA/19-136--------------------------------------------------------------DLPV--------------
F1LS41_RAT/29-138--------------------------------------------------------------KLKC--------------

PF07400

IL11_HUMAN/1-199--------------------------------------------------------------TLQARLDRLLRRLQLLMS

PF00758

G3TYQ1_LOXAF/25-173--------------------------------------------------------------LLGTQL...---------
W5K758_ASTMX/26-175--------------------------------------------------------------SLSIQD...---------
B1N8Y2_DANRE/15-168--------------------------------------------------------------SLSIPE...---------
F7DTH0_CALJA/31-193--------------------------------------------------------------ALGAQKEAT---------
M3XJ62_LATCH/27-177--------------------------------------------------------------RLHTQE..I---------
G3W289_SARHA/30-190--------------------------------------------------------------GLGTQEEAI---------
F6WUU2_MONDO/31-191--------------------------------------------------------------GLRTQEETV---------
G3VW20_SARHA/26-175--------------------------------------------------------------VLCPQS...---------
G1PF99_MYOLU/45-207--------------------------------------------------------------ALGSQKEAI---------
TPO_CANFA/25-176--------------------------------------------------------------LLGTQL...---------
F7G570_MONDO/26-177--------------------------------------------------------------LLGTPS...---------
H0W023_CAVPO/30-191--------------------------------------------------------------LLGAQKAPI---------
H2LEX3_ORYLA/33-182--------------------------------------------------------------SLNFQE...---------

PF06875

Q5BNQ4_9SALA/2-215--------------------------------------------------------------KISDIM-------T----
Q5BNQ2_9SALA/2-215--------------------------------------------------------------KISDIM-------T----

PF01110

CNTF_CHICK/1-194--------------------------------------------------------------HLEELL-------E----
G3VWZ5_SARHA/1-195--------------------------------------------------------------EMEELM-------A----
E1BFH9_BOVIN/1-193--------------------------------------------------------------QLEELM-------A----
G5AP46_HETGA/1-192--------------------------------------------------------------QLEELM-------V----
H0Z9U1_TAEGU/1-188--------------------------------------------------------------HLEELL-------R----
CNTF_HUMAN/1-194--------------------------------------------------------------QIEELM-------I----

PF01291

LIF_MOUSE/44-203--------------------------------------------------------------NVLCRL-------C----
LIF_BOVIN/43-202--------------------------------------------------------------NVLCRL-------C----
ONCM_HUMAN/37-209--------------------------------------------------------------NIYCMA-------Q----
ONCM_MOUSE/34-194--------------------------------------------------------------NVFCMA-------R----
ONCM_BOVIN/34-194--------------------------------------------------------------NIHCMA-------Q----

PF03039

IL12A_MOUSE/6-215--------------------------------------------------------------AIDELM-------Q----
G3VQT1_SARHA/40-247--------------------------------------------------------------AIDEMM-------Q----
F6T5A8_MONDO/5-202--------------------------------------------------------------AIEEMM-------Q----
IL12A_PIG/6-222--------------------------------------------------------------AITELM-------Q----
L8YEA2_TUPCH/1-213--------------------------------------------------------------AIDELM-------Q----
H0X861_OTOGA/6-217--------------------------------------------------------------VMEKLM-------Q----
G1QWH2_NOMLE/40-254--------------------------------------------------------------ELQALR-------H----
I3MN91_SPETR/4-220--------------------------------------------------------------AVDYLM-------Q----
Q924V6_CAVPO/6-221--------------------------------------------------------------AIDELI-------Q----

PF02024

H3AP27_LATCH/26-169--------------------------------------------------------------LLQTLA-------T----
G3WWV6_SARHA/23-167--------------------------------------------------------------LLHLLG-------S----
F6PLK2_ORNAN/23-167--------------------------------------------------------------LFALLA-------T----
F7HGW1_CALJA/23-167--------------------------------------------------------------LLHLLA-------A----
G5BHA4_HETGA/23-167--------------------------------------------------------------LVHMLA-------S----
W5NER9_LEPOC/28-172--------------------------------------------------------------IIKSLA-------T----
H0V7C6_CAVPO/23-165--------------------------------------------------------------LVQMMA-------S----
LEP_HUMAN/23-167--------------------------------------------------------------LLHVLA-------F----

PF00143

I3MVD7_SPETR/41-186------------------------------------.PLR......................AVRKYF-------H----
M3WTR1_FELCA/30-186------------------------------------.APGMHG...........PVL.....AIKRYF-------Q----
G3UK87_LOXAF/31-177------------------------------------..LAIEG...........PVL.....AVKRYF-------Q----
H0W7G8_CAVPO/30-185------------------------------------.SLLHED...........SRL.....AVRKYF-------H----
IFNB_HORSE/31-184------------------------------------.TWGN.T...........TIL.....RLKKYY-------G----
G5BPX2_HETGA/32-192------------------------------------QEMKTHELEHSGVQVVQQSKL.....ALRGYF-------Q----
I3JM36_ORENI/31-182------------------------------------..................SQLYF...KTEMYF-------K----
L8Y906_TUPCH/30-185------------------------------------.ALETDS...........TTL.....ALRGYF-------Q----
F7BVP5_ORNAN/27-181------------------------------------.TLRRD............ISL.....HIKSYF-------K----
H2R6R8_PANTR/30-185------------------------------------.PLMNED...........SIL.....AVRKYF-------Q----
F6YZB3_ORNAN/30-179------------------------------------.SVGSGI...........LRL.....RLKSYF-------R----
F7ABU5_MONDO/29-182------------------------------------.SLRSEK...........TRF.....ALKSYF-------Q----
IFNB_RAT/31-182------------------------------------.TWVTST...........TTL.....GLKSYY-------W----
I3N788_SPETR/31-185------------------------------------.SWGNSR...........TIL.....HLKSYY-------W----
G5C259_HETGA/30-185------------------------------------.PISHED...........SRL.....AVRKYF-------H----
H0XKS8_OTOGA/31-185------------------------------------.IGGKVT...........NIL.....HLKSYY-------F----
G5E7E1_LOXAF/13-168------------------------------------.VLAIES...........SAL.....AVKRYF-------Q----
G3GXU9_CRIGR/31-180------------------------------------.TTRD.S...........TIP.....RLKSYY-------E----
H0XRP5_OTOGA/30-185------------------------------------.APMGED...........PVL.....ALRSYF-------H----
G1L8G2_AILME/30-185------------------------------------.LLGSEN...........SRL.....AVKRYF-------H----
H0W510_CAVPO/30-182------------------------------------.LLMHED...........SRL.....AVRKYF-------H----
G1Q880_MYOLU/30-185------------------------------------.ALAMEG...........PTL.....ALKRYF-------Q----
D2HTQ4_AILME/37-205------------------------------------KELEEDGMNWSGALVPQLSNL.....ELRRYF-------N----
IFNE_PIG/31-186------------------------------------.TLCSEN...........LTL.....QVKMYF-------Q----
H0XSG1_OTOGA/30-185------------------------------------.ALMNQD...........SML.....AIRSYF-------Q----
A8E6E8_MONDO/30-182------------------------------------.SLGREN...........PLM.....ALKNYF-------Q----
C8CKA7_PIG/30-185------------------------------------.PLLEEG...........SIL.....AVRKYF-------H----
G1NR05_MELGA/36-188------------------------------------GPRN..............SHL.....SINKYF-------R----
G3I0H3_CRIGR/33-178------------------------------------......D...........SLM.....AVRKYF-------H----
I3LBU7_PIG/30-179------------------------------------.ALG................I.....VVWKYF-------Q----
C8CKC3_PIG/37-205------------------------------------KEMDEVERKPSGATVPPSHSL.....ELRRYF-------N----
IFNE_MOUSE/33-185------------------------------------.GSSAQN...........LRL.....QIKAYF-------R----
G3N2A8_BOVIN/30-185------------------------------------.ALGRMG...........PTL.....AMKRYF-------Q----
G3WZJ8_SARHA/30-182------------------------------------.SLGSEN...........PIL.....VLKSYF-------Q----
G1KU56_ANOCA/35-182------------------------------------..........................DVKKYF-------E----
G1KX99_ANOCA/29-180------------------------------------................QLTRL.....KVKKYF-------R----
L5K909_PTEAL/30-184------------------------------------.PLLDED...........STV.....AVRKYF-------Q----
H0VUV7_CAVPO/30-185------------------------------------.SLWHED...........SRN.....AVKKYF-------H----
L5K635_PTEAL/30-183------------------------------------.VLGTED...........PTL.....AMKRYF-------Q----
G5CB66_HETGA/31-185------------------------------------.TWEDTM...........IIP.....RLKGYY-------W----
L5LKN9_MYODS/31-186------------------------------------.TVGREK...........LRL.....QVKMYF-------R----
H0XMZ9_OTOGA/31-186------------------------------------.TVGIEK...........LRL.....QVKMYF-------R----
H9KYA4_CALJA/30-185------------------------------------.PLMNAD...........SIL.....AVRKYF-------E----
H0YTY6_TAEGU/41-187------------------------------------.PRN..............PLL.....TINKYF-------R----
A8E6F5_XENTR/55-202------------------------------------Q.........................TISDQY-------Q----
G7PS89_MACFA/30-185------------------------------------.HLMYED...........SIL.....AVKKYF-------R----
I3MY95_SPETR/37-186------------------------------------..................LGI.....TVKKCF-------Q----
G3WZF5_SARHA/30-185------------------------------------.TRLNEE...........SIQ.....HLNNYY-------Q----
H0VF99_CAVPO/32-187------------------------------------.TMRDTM...........TTL.....RLKSYY-------W----
L8Y8F8_TUPCH/30-184------------------------------------.ALAPES...........SLL.....ALKGYF-------Q----
F1LVL8_RAT/29-184------------------------------------.GLSVKD...........LRL.....QIKAYF-------R----
G1Q950_MYOLU/31-184------------------------------------.PWEN.R...........TVL.....RLKTYY-------L----
I3N5Z0_SPETR/27-178------------------------------------.AQGSKN...........LRL.....QVKAYF-------R----
A3FBE8_MUSPF/31-184------------------------------------.TWDH.R...........TLL.....HLKRYY-------L----
G3UCD2_LOXAF/30-187------------------------------------VPVINED...........SML.....AVRKYF-------Q----
L9LC61_TUPCH/31-185------------------------------------.TWGNSM...........SVM.....HLKSYY-------L----
H0Y0D2_OTOGA/32-187------------------------------------.PLMNQG...........PTL.....AVRSYF-------Q----
L5KKJ7_PTEAL/32-192------------------------------------KEMEEDESKYPGAMVSQLTNL.....ELKRYF-------H----
L5KWM8_PTEAL/110-263------------------------------------.ALGMED...........PTL.....AVKRYF-------Q----
F7GHL9_MONDO/29-181------------------------------------.SLGSEN...........PMM.....ALKSYF-------Q----
G3TS29_LOXAF/30-179------------------------------------.PLGTEN...................SVKSYF-------Q----
W5PZ39_SHEEP/33-184------------------------------------.........PSGAPVLQPSNL.....ELRRYF-------N----
D2H9N6_AILME/31-184------------------------------------.TWDD.R...........TLL.....PLKRYY-------L----
IFNT4_SHEEP/30-185------------------------------------.ELGNMD...........PIV.....TVKKYF-------Q----
F7A317_HORSE/30-183------------------------------------.PLMNED...........SLL.....AVRRYF-------Q----
G3TTC1_LOXAF/30-185------------------------------------.ALPIEG...........PAL.....AVKEYF-------E----
Q29412_PIG/31-184------------------------------------.PRGDM............TIL.....HLKKYY-------L----
IFNB_MOUSE/31-180------------------------------------.TWEMSS...........TAL.....HLKSYY-------W----
IFNA3_CANFA/30-183------------------------------------.PLMHED...........STL.......RTYF-------Q----
IFNB_HUMAN/31-185------------------------------------.TRGKLM...........SSL.....HLKRYY-------G----
I3UJJ8_FELCA/30-185------------------------------------.ILGSEN...........VRL.....QIKMYF-------Q----
M3Z729_MUSPF/30-183------------------------------------.PLVNRD...........SIL.......RNYF-------Q----
H0W289_CAVPO/30-190------------------------------------.ALATED...........LTLNHSWRTLMKYF-------Q----
G3WZQ8_SARHA/29-181------------------------------------.SLGSEN...........PSL.....VLKSYF-------Q----
G1KYL3_ANOCA/28-176------------------------------------...............IQLTRL.....RVKKYF-------R----
G1U0Q8_RABIT/30-185------------------------------------.VLTADS...........PTL.....MLKRYF-------Q----
G1TYS8_RABIT/33-195------------------------------------.....EEMKYSGTGRFLLNNL.....ELRKYF-------Y----
G1SJC4_RABIT/30-185------------------------------------.PLKHED...........SAW.....AVRKYF-------Q----
IFN_ANAPL/38-190------------------------------------GPRN..............LHL.....SINKYF-------G----
A8E6F6_XENTR/31-179------------------------------------E.........................SISEEF-------N----
M3WRV1_FELCA/30-184------------------------------------.PLTNED...........SLL.......RNYF-------Q----
L8Y4J0_TUPCH/31-186------------------------------------.ALDSED...........RRL.....HVKKYF-------R----
F7G875_MONDO/31-182------------------------------------.SWESLE...........SIL.....RLKNYY-------Q----
I3N7K4_SPETR/37-197------------------------------------..VKADEKKHSEAGVLPLGNL.....KLRRYF-------S----
IFNT2_BOVIN/7-162------------------------------------.DMGRMG...........PIL.....TVKKYF-------Q----
G1L8I1_AILME/30-183------------------------------------.PVRNVD...........SIL.......RNYF-------Q----
V8NNB8_OPHHA/22-183------------------------------------.SPRNRK........LQLTRL.....RIKRYF-------Q----
G3SI98_GORGO/35-185------------------------------------KEMK.............LSSL.....ELRRYF-------H----
H9GZR7_HORSE/30-185------------------------------------.ALGTVG...........PTL.....AVKRYF-------R----
G3I0I6_CRIGR/31-185------------------------------------.GLSAQS...........LRL.....QIKSYF-------R----
W5JYQ9_ASTMX/29-179------------------------------------.FLKREA...................SLRAYF-------Q----
G3I0H8_CRIGR/30-185------------------------------------.PLSQED...........SLV.....AVRKYF-------H----
K7GQJ6_PIG/18-164------------------------------------.SLG................M.....AVKRYF-------E----
I3L756_PIG/30-180------------------------------------.ALG................M.....AVKRYF-------E----
IFNE_HUMAN/31-186------------------------------------.TLGSDN...........LRL.....QVKMYF-------R----
IFNW2_HORSE/30-185------------------------------------.ALGTVR...........PTL.....AVKRYF-------R----
G1KWE0_ANOCA/33-180------------------------------------................QLTSL.....RVKRYF-------R----
IFNA1_MOUSE/30-185------------------------------------.PLTQED...........ALL.....AVRKYF-------H----
IFNB2_BOVIN/31-184------------------------------------.TMGDT............TVL.....HLRKYY-------F----
G3UJX3_LOXAF/31-185------------------------------------.TSRNIM...........TIL.....HLKNYY-------L----
L9L941_TUPCH/34-198------------------------------------EKMEEDEMEHSGAAVPQLGNL.....ELKRYF-------N----
W5N6G4_LEPOC/31-180------------------------------------NRLGVSV...................VLKTSF-------A----
D3Z919_RAT/29-179------------------------------------.PLTQEP...........SWL.....AVREYF-------G----
IFNB_FELCA/31-184------------------------------------.TWDN.T...........TLL.....NLKKYY-------L----
M3YX13_MUSPF/32-179------------------------------------.VLSGGN...........SRM.....QVKKYF-------R----
M3VXI8_FELCA/39-205------------------------------------KQREEDGMDFSGAMVSQVSSL.....ELRRYF-------Y----
W5PG31_SHEEP/30-185------------------------------------.PLLKED...........SSL.....AVRKYF-------H----
F7B527_HORSE/29-183------------------------------------.ALGSEI...........STL.....AVKRYF-------R----
M3WZS7_FELCA/29-181------------------------------------.PLGNEN...........SRL.....AVKRYF-------Q----
G3VDC6_SARHA/30-182------------------------------------.HLKSEN...........PRIQ....ALQTYF-------Q----
H9L1C3_CHICK/32-182------------------------------------KEV...............NRL.....KLKKYF-------Q----
C8CKB9_PIG/28-175------------------------------------.QMEGDN...........LACAYLGSVVRKYF-------Q----
H0VYK7_CAVPO/32-181------------------------------------..................TTL.....RLKSYY-------W----
L5KBH2_PTEAL/30-185------------------------------------.ALGMED...........PAL.....AVKKYF-------Q----
G3R8Q7_GORGO/30-185------------------------------------.AGTIRS...........PAL.....TLRRYF-------Q----
R4GKJ6_CHICK/39-191------------------------------------WPRN..............LHL.....TIKKHF-------S----
G7PS88_MACFA/30-185------------------------------------.PLMNAD...........STL.....AVKKYF-------R----
M3Z715_MUSPF/30-183------------------------------------.ALVNGD...........SIL.......RNYF-------Q----
H0VXI5_CAVPO/30-181------------------------------------.PLMHED...........SRQ.....AVRKYF-------H----
G3I0H6_CRIGR/31-178------------------------------------......D...........SQV.....AMKNYF-------D----
C8CKA9_PIG/29-183------------------------------------.PPGGEN...........SIL.....AVKTYF-------Q----
H0W3G0_CAVPO/30-185------------------------------------.VLAIQN...........PIL.....ALRRYF-------L----
G1PDS6_MYOLU/36-199------------------------------------EEMEEDERRHPGARTPQPSNL.....ELRRYF-------H----
H0W4H8_CAVPO/27-181------------------------------------.PLMHED...........SRL.....VVRKYF-------H----
G1TTX4_RABIT/34-180------------------------------------.TLESIR...........MNL.....RLKSYY-------W----
I3MXH1_SPETR/31-185------------------------------------.RQAYSM...........IIL.....RLKSYY-------V----
H0WK94_OTOGA/40-202------------------------------------..VKEAAMKYSGAQGPQVHNL.....ELRRYF-------N----

PF02947

FLT3L_MOUSE/30-162------------------------------------VQTNISH-----------LLK-----DTCTQL-------L----
F6T7S9_ORNAN/28-157------------------------------------QQINISQ-----------FLG-----DVSQHL-------T----
H9GP84_ANOCA/29-165------------------------------------ITTNISE-----------FLE-----PIPSYL-------S----
F6TPW7_MONDO/34-163------------------------------------RKANISH-----------LLL-----DISSHL-------E----
G5B8P0_HETGA/20-150------------------------------------VQTNISH-----------LLQ-----DTVAQL-------E----
G1M637_AILME/29-159------------------------------------VQTNISH-----------LLQ-----DTSKHL-------A----
L9JA37_TUPCH/769-910------------------------------------VQTNISD-----------LLQ-----DTSAQL-------L----
G3VSA3_SARHA/79-209------------------------------------RKANISH-----------LLL-----EVSNHL-------G----
G1QZC3_NOMLE/30-160------------------------------------VQTNISR-----------LLQ-----ETSEQL-------V----

PF00714

IFNG_HORSE/15-152--------------------------------------------------------------LFVKFF-------NSSTS
H0WPL1_OTOGA/15-151--------------------------------------------------------------IIAKFF-------NSSYS
Q8CGS0_CAVPO/15-154--------------------------------------------------------------IITKFF-------KDNSS
B9VS86_CALJA/15-152--------------------------------------------------------------MNVKFF-------NSNKR
G3SUC6_LOXAF/15-152--------------------------------------------------------------LFVKFF-------NSSSS
G3GY20_CRIGR/2-135--------------------------------------------------------------LFANFF-------NSSME
I3MNV6_SPETR/15-152--------------------------------------------------------------LSAKFF-------NSNCI
L5LME8_MYODS/15-153--------------------------------------------------------------LRVKVF-------NSSNS
G5BGB5_HETGA/15-152--------------------------------------------------------------IIAKFF-------HSNSS
G3WQJ9_SARHA/15-153--------------------------------------------------------------MIMKLF-------PNNTA
IFNG_SHEEP/15-152--------------------------------------------------------------MFQKFL-------NGSSE
IFNG_RAT/14-151--------------------------------------------------------------LITNFF-------SNSKA
IFNG_RABIT/15-152--------------------------------------------------------------IFVKFF-------NSNLT
L9KVU0_TUPCH/51-188--------------------------------------------------------------MIDKFF-------NSSPT
IFNG_FELCA/15-153--------------------------------------------------------------MLDKLL-------NTSSS

PF05337

CSF1_HUMAN/1-254.PLQLLEKVKN.........................VFNETKN-------------------LLDKDW-------N----
CSF1_HUMAN/272-554LPLGELEGRR..........................STRDRRS-------------------PAEPEG-------G----
Q6GMN4_RAT/265-566LPLGELEGKKSTRDRRSPAELKGGPASEGAARPVAQSTRDRRS-------------------PAELKG-------G----
O77709_BOVIN/1-254.PLQLLEKIKN.........................VFNETKN-------------------LLKKDW-------N----
Q64129_9MURI/1-257.PLQLLEKIKN.........................FFNETKN-------------------LLEKDW-------N----
CSF1_MOUSE/273-552LPLGELEGKR..........................STRDRRS-------------------PAELEG-------G----
O77709_BOVIN/274-554LSLGELEGRR..........................STRDRRS-------------------LAELKG-------G----
Q3TLQ6_MOUSE/1-254.PLQLLEKIKN.........................FFNETKN-------------------LLEKDW-------N----
O77710_BOVIN/1-257.PLQLLEKIKN.........................VFNETKN-------------------LLKKDW-------N----

PF02404

R4GD07_ANOCA/1-283KTPVQSDCV---------------------------LPSTTET-------------------PPNDSR-------L----
SCF_CHICK/1-287DSLDKNDCI---------------------------MPSTVET-------------------PENDSR-------V----
SCF_RAT/1-273VASDTSDCV---------------------------LS.STLG-------------------PEKDSR-------V----
G1NWC8_MYOLU/1-272VSSKTSECV---------------------------FS.STLS-------------------PGNDSR-------V----
F7EP53_MONDO/1-273ETSEHSNCV---------------------------LP.STIG-------------------PERDSR-------V----
F7C5I3_ORNAN/1-273.QAEHSDCI---------------------------FPTTTLM-------------------PEKDSR-------V----
F7G0W2_CALJA/1-273VASETSDCM---------------------------AS.STLS-------------------PEKDSR-------V----

PF00489

IL6_BOVIN/27-208------------------------------------.VRDLRK-------------------NIRTLI-------Q----
M3X721_FELCA/27-208------------------------------------.AKSVYT-------------------STNVLL-------Q----
IL6_HORSE/27-208------------------------------------.IKTMQI-------------------STKVLV-------Q----
G3UHF3_LOXAF/20-205------------------------------------.VIVVQN-------------------STKALV-------Q----
L5KPK4_PTEAL/20-202------------------------------------.AKAMQM-------------------RTKALV-------Q----
F7HV62_CALJA/27-212------------------------------------.AGAVQM-------------------STKGLI-------Q----
IL6_MOUSE/26-210------------------------------------KARVLQR-------------------DTETLI-------H----

PF16647

CSF3_BOVIN/42-190-------------------------------------LDTLQL-------------------DVTDFA-------T----
CSF3_HUMAN/51-202-------------------------------------LDTLQL-------------------DVADFA-------T----
CSF3_MOUSE/57-205-------------------------------------LDLLQL-------------------DVANFA-------T----

PF02372

IL15_PIG/33-160------------------------------------LIILANS-------------------SLSS..-------I----
IL15_CAVPO/33-160------------------------------------LIILANS-------------------SLNS..-------N----
IL15_FELCA/33-160------------------------------------IIILANS-------------------GLSS..-------N----
IL15_SHEEP/33-160------------------------------------LTMLADR-------------------NLSS..-------I----
F1NZN5_CHICK/55-183------------------------------------ILKNGNA-------------------RFATYQ-------L----
G1NDP6_MELGA/5-137------------------------------------ALQNIKK-------------------NLHRLK-------D----
O73883_CHICK/5-138------------------------------------AIQNIEK-------------------NLKSLT-------G----
Q8JFF4_ANAPL/4-134------------------------------------SVRNIKM-------------------NLQKLM-------D----

PF00715

I3MQX6_SPETR/7-151------------------------------------DTRNFIS-------------------NINVTV-------L----
G5C793_HETGA/7-149------------------------------------NTKDFIS-------------------NINVTV-------W----
G1PJ32_MYOLU/7-147------------------------------------NITELMS-------------------NVNVLV-------Q----
B1AB81_HORSE/7-146------------------------------------DIKELMS-------------------NINVTV-------L----
G3HTL8_CRIGR/7-150------------------------------------DTENFIS-------------------NIRVTV-------V----
IL2_MACMU/7-151------------------------------------DTKDLIS-------------------NINVIV-------L----
H0Y254_OTOGA/7-149------------------------------------DTREVIG-------------------NINVTV-------L----
IL2_MOUSE/7-165------------------------------------DAENFIS-------------------NIRVTV-------V----
G3SU90_LOXAF/7-147------------------------------------NTRELIS-------------------NINVTA-------L----
IL2_PIG/7-151------------------------------------NIKESMN-------------------NINVTV-------L----
IL2_FELCA/7-151------------------------------------HIKELMS-------------------NINVTV-------L----
L5K7D9_PTEAL/7-149------------------------------------DIKESVS-------------------NINVTA-------Q----
IL2_BOVIN/7-152------------------------------------EIKDSMD-------------------NIKRIV-------L----
H0VBY4_CAVPO/7-149------------------------------------HTKDFIS-------------------NINVTV-------L----

PF00103

PLRP1_BOVIN/26-238------------------------------------SATRFEN-------------------MSEKLQ-------A----
CSH2_BOVIN/26-238------------------------------------SAMEIEN-------------------MSEKLQ-------A----
PLRP3_BOVIN/1-213------------------------------------SAKENMR-------------------KIEELQ-------A----
PR4A1_RAT/17-227------------------------------------KALMLKE-------------------SNIKLL-------D----
CSH1_BOVIN/26-236------------------------------------RAKEIED-------------------KTKVLL-------E----
PLRP4_BOVIN/26-239------------------------------------SARENVK-------------------KLKELQ-------A----
PR3D4_RAT/16-223------------------------------------KAVDMKD-------------------KNLIIL-------E----
PR2C2_MOUSE/16-224------------------------------------KATDIKK-------------------KINAVR-------N----
SOM2_HUMAN/9-215------------------------------------SDSNVYR-------------------HLKDLE-------E----
PR8A5_RAT/17-238------------------------------------KAKDLEE-------------------NNRQLL-------D----
PR6A1_RAT/20-234------------------------------------RAKNIEE-------------------KIKELM-------D----
PR7D1_MOUSE/17-240------------------------------------KAEAIEA-------------------KNKDLL-------E----
CSH2_HUMAN/9-215------------------------------------SDSDDYH-------------------LLKDLE-------E----

PF03487

G1SCQ2_RABIT/16-144------------------------------------MLSGLCT-------------------D.KAVA.......K----
IL13_HUMAN/16-144------------------------------------MLSGFCP-------------------H.KVSA.......G----
IL13_RAT/2-130------------------------------------ILNGLCN-------------------Q.KASD........----
F7DGH7_MACMU/16-151------------------------------------LCGPFCP-------------------L.ASHSRAGLFVLQ----
L5M5Z7_MYODS/2-128------------------------------------MLSALCP-------------------R.QPSA.......G----
G5ASP9_HETGA/2-130------------------------------------ILSSLCQ-------------------H.RAVA........----
B3GDZ5_PIG/2-130------------------------------------MLSALCS-------------------H.KPPS.......E----
L8YAP6_TUPCH/2-128------------------------------------LLNGLCT-------------------S.KSSA.......E----
IL13_BOVIN/2-130------------------------------------MLNALCP-------------------H.KPSA.......K----
IL13_MOUSE/2-130------------------------------------ILHGLCN-------------------R.KAPT........----
H0W834_CAVPO/16-149------------------------------------ILSGLCQ-------------------H.KASA.......G----
F6WQF3_ORNAN/2-128------------------------------------IMQR..P-------------------QPPPLS.......L----
G3T2N9_LOXAF/2-133------------------------------------NLSGACE-------------------QYKAPA.......S----
M3YGH3_MUSPF/2-126------------------------------------LLKSLCH-------------------Q.DTSA.......G----
B5FW67_OTOGA/2-129------------------------------------ILGGLCK-------------------Q.KDLP.......G----
I3MAR4_SPETR/2-131------------------------------------MLSGLCT-------------------H.KNTA.......K----
IL13_CANFA/2-129------------------------------------MLKALCS-------------------Q.KPAA.......G----

PF00727

IL4_FELCA/26-131------------------------------------FLKGLDR-------------------NLSSMA-------N----
H0XDE1_OTOGA/26-149------------------------------------FLKGLDR-------------------NLCSLA-------N----
IL4_MOUSE/27-140------------------------------------ELQRLFR-------------------AFRCLD-------S----
G3T4B8_LOXAF/26-132------------------------------------YLRGLSR-------------------SLSSMT-------N----
IL4_RABIT/28-143------------------------------------LLRGLDR-------------------NLCSMA-------K----
G5ASQ0_HETGA/25-138------------------------------------LLKKVYR-------------------NLRSMV-------Q----
F6U5N6_HORSE/26-135------------------------------------CLSGLDR-------------------NLKGMA-------N----
IL4_BOVIN/26-133------------------------------------FLGGLDR-------------------NLNSLA-------S----
G3QSC0_GORGO/26-149------------------------------------FLKRLDR-------------------NLWGLA-------G----
A3FBF0_MUSPF/26-130------------------------------------LLRGLHR-------------------NLRNMA-------N----
IL4_RAT/27-139------------------------------------ELRKLCR-------------------GVSGLN-------S----
G3WEJ0_SARHA/28-149------------------------------------ELKKMCR-------------------NLMHLV-------N----
I3MAS4_SPETR/24-141------------------------------------LLRGLYR-------------------NLRSMA-------Q----
IL4_PIG/26-131------------------------------------LLSGLDR-------------------NLSSMA-------N----

PF00726

IL10_BOVIN/5-174--------------------------------------ENKSK-------------------AVEKVK-------R----
IL10H_EBVB9/7-167--------------------------------------ENKSK-------------------AVEQIK-------N----
G3HB01_CRIGR/14-174--------------------------------------ENKSK-------------------AVEKVK-------S----

PF14565

IL22_HUMAN/40-178--------------------------------------LHIQR-------------------NVQKLK-------D----
E1C1U2_CHICK/46-184--------------------------------------EHIEK-------------------NLEEMK-------S----

PF15036

IL34_MOUSE/28-184------------------------------------..VEIGP-------------------HVEAVL-------S----
R4GIU3_CHICK/19-177------------------------------------..SDVDA-------------------VVADLV-------K----
F7EA00_CALJA/29-185------------------------------------..VEVSP-------------------KVESVL-------S----
H0WFN4_OTOGA/28-184------------------------------------..MEVSP-------------------KVEAVL-------S----
M3ZVZ0_XIPMA/24-191------------------------------------FQQELPE-------------------TIQDIW-------D----
U3JY35_FICAL/18-179------------------------------------..TDVET-------------------VVADVV-------K----
L9KJY3_TUPCH/28-184------------------------------------..VEVSP-------------------KVEAVL-------S----
G3T3A6_LOXAF/28-182------------------------------------..VEASP-------------------EVEAVL-------S----
F6W3U1_MONDO/15-167------------------------------------..LQVHP-------------------QVEKIL-------T----
I3JZ08_ORENI/24-192------------------------------------FQEDLPE-------------------KIHDIW-------D----
L5MCR9_MYODS/28-182------------------------------------..VKLSP-------------------PVDAVL-------S----
B3DLJ8_DANRE/23-195------------------------------------NVRERPE-------------------SLQTIW-------D----
IL34_BOVIN/28-183------------------------------------..VEVSP-------------------QVEAVL-------N----

PF01109

CSF2_RAT/18-139--HYQTN-------CPPTPETDCEIE------------VTTFEDFIKNLKGF---------------LFDIPFDCW----
CSF2_MOUSE/18-136--YYQTY-------CPPTPETDCETQ------------VTTYADFIDSLKTF---------------LTDIPFECK----
CSF2_BOVIN/18-138--HYEKH-------CPPTPETSCGTQ------------FISFKNFKEDLKEF---------------LFIIPFDCW----
CSF2_CAVPO/18-140--FYKQH-------CPPTPETSCMTQ------------IITFKSFKENLKRF---------------LFAIPFDCW----
CSF2_PIG/18-139--HYEQH-------CPLTEETSCETQ------------SITFKSFKDSLNKF---------------LFTIPFDCW----
CSF2_HUMAN/18-139--HYKQH-------CPPTPETSCATQ------------IITFESFKENLKDF---------------LLVIPFDCW----
CSF2_CANFA/18-139--HYKQH-------CPPTPESPCATQ------------NINFKSFKENLKDF---------------LFNIPFDCW----

PF02025

G1RQD7_NOMLE/22-133--YIDGQ------------KKKCGEE------------RRRVNQFLDYLQEF---------------LGVMNTE-WIIE-
IL5_CAVPO/23-134--HIDLQ------------KQKCGEE------------RRRVKQFLDYLQEF---------------LAVINTE-WTIE-
J9NWP5_CANFA/22-132--HIERQ------------KKRCAGE------------RWRVTKFLDYLQVF---------------LGVINTE-WTP.-
IL5_MOUSE/21-132--YIDRQ------------KEKCGEE------------RRRTRQFLDYLQEF---------------LGVMSTE-WAME-
G3WAR7_SARHA/25-134--HITTK------------EKQCGGE------------RRKVEQFLDYLEEF---------------LQTVNTE-WTVE-
IL5_HORSE/22-133--YIDLQ------------KKKCGGE------------RWRVKQFLDYLQEF---------------LGVINTE-WTIE-
B5FW65_OTOGA/22-133--YIDRQ------------KKRCGEE------------RRKVKQFLDYLQEF---------------LGIINTE-WTME-
I3MDT8_SPETR/23-134--YIDIQ------------KKKCGQE------------RRRVKQFLEYLQEF---------------LGVINTE-WMME-
G3T4B0_LOXAF/23-133--YIDLQ------------KKKCGGE------------RRKVKQFLDYLEEF---------------LGVISTD-WMI.-
G1SL79_RABIT/22-133--YIDLQ------------KKKCGEE------------RRGVKHFLDYLQEF---------------LGVINTE-WTME-

PF02059

IL3_CANFA/19-132--LLPTP-------T..PRGEPISIM------------ENNWGDFQRKLKKY---------------LEA.---------
IL3_MOUSE/27-138--CLPTS-------A..NDSALPGVF------------IRDLDDFRKKLRFY---------------MVHL---------
IL3_BOVIN/18-132--VLPTA-------T..PTEDPIFIE------------NKNLGDFRMKLEEY---------------LVII---------
G3UC30_LOXAF/22-133--CLPKA-------K..PQTASIVI.------------QNDWEDFRGKLYPY---------------LETL---------
G1MH15_AILME/18-131--LLPTP-------T..PRGQPISI.------------ENNLGDFQKKLKKY---------------LEA.---------
F1RJV6_PIG/18-131--ILPTS-------M..STEEPISIE------------EGDLGDFRAKLMEY---------------LVVL---------
G1RQ11_NOMLE/20-137--CLPMA-------TAAPTRHPIRIK------------DGDWNEFRRKLKFY---------------LKTL---------
IL3_CALJA/19-136--CLPTA-------TNAATQHPIRIK------------DGDWNDFQMKLKFY---------------LKTL---------
F1LS41_RAT/29-138--CIPAA-------A..SDSVLPGVY------------NKDLDDFKKKLRFY---------------VIHL---------

PF07400

IL11_HUMAN/1-199RLALPQP-------PPDPPAPPLAPP------------SSAWGGIRAAHAIL---------------GGLHLTLDWAVRG

PF00758

G3TYQ1_LOXAF/25-173--.PPQG.......RTTAHKDPNAIF------------PEFPT...AALSFL---------------LLVVGLTLCARRA
W5K758_ASTMX/26-175--YVPTV.SGIDLQETWQVSSAPELF------------QVHINFLRGKVRLL---------------LANA....P....
B1N8Y2_DANRE/15-168--YVPPT.SSGEDKETQKISSISELF------------QVHVNFLRGKARLL---------------LANA....PVCRQ
F7DTH0_CALJA/31-193--SPPDAAPSAVPLQTITADTFSKLF------------QVYSNFIRGKLKLY---------------AGEA....CRTED
M3XJ62_LATCH/27-177--PVPDS....PPQKTVVVRTLGELF------------HIHVNFLRGKVKLF---------------ISDA....CSMQ.
G3W289_SARHA/30-190--FVPNA.PTAVPLRTFTVGTMDKLF------------RIYSNFLRGKLKLF---------------WREA....CQSQE
F6WUU2_MONDO/31-191--SLPDA.PTAAPFRTFTVGTMDKLF------------RIYSNFLRGKLKLF---------------LREA....CQSEE
G3VW20_SARHA/26-175--.LPKG.......QTAAHREPTAIF------------LSFQQLLRGKVRFL---------------LHALRPILCARQD
G1PF99_MYOLU/45-207--SLPDATASAIPLRTFTVDTLCKFF------------RIYSNFLRGKLKLY---------------TGEA....CRRGD
TPO_CANFA/25-176--.PPQG.......RTTTHKDPNAIF------------LSFQQLLRGKVRFL---------------LLVAGPTLCAKQS
F7G570_MONDO/26-177--.LPKG.......QTIAHREPTAIF------------LSFQQLLRGKVRFL---------------LHAVRPLLCARQD
H0W023_CAVPO/30-191--LPPDA.ASPAPLRTFPVDTLCKLF------------QVYSNFLRGKLKLY---------------TGMA....CRRGD
H2LEX3_ORYLA/33-182--YTPPA.NASSLDGTWTVSSATELL------------QVHVNFLRGKVRLL---------------LMDA....P....

PF06875

Q5BNQ4_9SALA/2-215-QMGMSV------TITLPKP---LVVPFKGSAYFSK--KLRGGVVCKEYKER---------------VFLTKRDFMLLAE
Q5BNQ2_9SALA/2-215-QMGMSV------TITLPKP---LVVPFEGSAYFRK--KLRGGVVCKEYKER---------------VLLTKRDFEFLAK

PF01110

CNTF_CHICK/1-194-LESRGA------PAEEGSE---PPA.PPRLSLFEQ--KLRGLRVLRELAQW---------------AVRSVRDLRQLSK
G3VWZ5_SARHA/1-195-LLGHQA------PSQETDS---GPVGGSHRTFLEK--KLWGLKVLQELMQW---------------TVRSIHDLRLISS
E1BFH9_BOVIN/1-193-LLEHRV------PPREAGG---PPLLPGDAGLFEK--KLWGLKVLQELSRW---------------TVRSVHDLRTISR
G5AP46_HETGA/1-192-LLEHEI------PPNETSG---VPL..GEGGLFEK--KLWGLKVLQELSQW---------------TVRSIRDLRLISS
H0Z9U1_TAEGU/1-188-LESRGI------PGEEGDG---PPP.PPRLSLFEQ--KLRGLGVLRELAQW---------------AVRSVRDLRQLGK
CNTF_HUMAN/1-194-LLEYKI------PRNEADG---MPINVGDGGLFEK--KLWGLKVLQELSQW---------------TVRSIHDLRFISS

PF01291

LIF_MOUSE/44-203-NKYRVG....HVDVP.......PVPDHSDKEAFQR--KKLGCQLLGTYKQV---------------ISVVVQAF-----
LIF_BOVIN/43-202-SKYHVS....HVDVT.......YGPDTSGKDVFQK--KKLGCQLLGKYKQV---------------IAVLAQAF-----
ONCM_HUMAN/37-209-LLDNSD...TAEPTKAGRGASQPPTPTPASDAFQR--KLEGCRFLHGYHRF---------------MHSVGRVF-----
ONCM_MOUSE/34-194-LLNHSL..EIPEPTQTDSG...ASRSTTTPDVFNT--KIGSCGFLWGYHRF---------------MGSVGRVF-----
ONCM_BOVIN/34-194-LLRGSSDPKAAEPTQPGPGPT.PLPPTPPSSTFQR--KLRNCGFLRGYHRF---------------MRTAGQVL-----

PF03039

IL12A_MOUSE/6-215-SLNHNG---ETLRQK-------PPVG..EADPYRV--KMKLCILLHAFSTR---------------VVTINRVMGYLSS
G3VQT1_SARHA/40-247-ALNFSS---ENMTVT-------PSPK..EPDFYKA--KVKLCLLLHAFRIR---------------VVTIDRMRNYL..
F6T5A8_MONDO/5-202-ALNFNS---KNVPLI-------SSPK..ESDFYKT--KVKLCVLLHAFQTR---------------TVTIDRMMNYL..
IL12A_PIG/6-222-ALNFNS---ETVPQK-------PSLE..ELDFYKT--KIKLCILLHAFRIR---------------AVTIDRMMSYLNS
L8YEA2_TUPCH/1-213-ALNFNS---DTVPRS-------YSLE..EPDFYKT--KIKLCILLHAFRVR---------------AVTIDRVMSYLNT
H0X861_OTOGA/6-217-DLNSTS---ETVMHP-------SSHE..ETNFYKT--KVKLFVLLHAFRIR---------------AVTIDRVMSYLNS
G1QWH2_NOMLE/40-254-ALNFNS---ETVPQK-------SSLE..EPDFYKT--KIKLCILLHAFRIR---------------AVTIDRVMSYLNA
I3MN91_SPETR/4-220-AVNVNN---ETVPQT-------PSPEAPSPNLYRT--KTKLCILLHALRIR---------------AVTIDRVMSYLNS
Q924V6_CAVPO/6-221-ALNGSD---VTVPQK-------LSLE..EPDFYKI--KMKLCILLHAFRIR---------------AVTIDRVMSYLTS

PF02024

H3AP27_LATCH/26-169-TMGCEL------HQTTELETLKDLAKEHSTSPYTT--EK---VALDRLQKC---------------LLTMVKELEQIKD
G3WWV6_SARHA/23-167-LKSCPF------DEADGLSALGNLEGVMEASLYST--EV---VTLSRLQKS---------------LYGMLQQLDLIHG
F6PLK2_ORNAN/23-167-LKNCPF------TRSDGLDTMEIWGGIVEESLYST--EV---VTLDRLRKS---------------LKNIEKQLDHIQG
F7HGW1_CALJA/23-167-SKSCHL------PWASGLENLANLGGVLEVSLYST--EV---VALSRLRGT---------------LKDILQQLDLGPA
G5BHA4_HETGA/23-167-SKGCPL------PQTRGPELLENLGGALKESIYST--EV---VALSRLQRF---------------LQEMLLQLDHNTM
W5NER9_LEPOC/28-172-SVNCAP------LKSSNMSHLESFLKTNAAFHVTI--GN---VALERLQKY---------------LLKLIRNLDQLKN
H0V7C6_CAVPO/23-165-SKGCPL------PHTTEPE.LQDLESTLKESRYSI--EV---VVLRRMKRF---------------LLEMLRQLELGIV
LEP_HUMAN/23-167-SKSCHL------PWASGLETLDSLGGVLEASGYST--EV---VALSRLQGS---------------LQDMLWQLDLSPG

PF00143

I3MVD7_SPETR/41-186-RIT.VYLKE-------KKYLPCAW-------------EVVRAEIMKSFSSS---------------ANLY------ARL
M3WTR1_FELCA/30-186-DIR.VYLED-------EGYSDCAW-------------EIVRLEIMRALSSS---------------ATLQ------DSL
G3UK87_LOXAF/31-177-EI..LYLKE-------KEHSDCVW-------------EVIRVEISKLIYVS---------------TNLG------...
H0W7G8_CAVPO/30-185-RIA.VYLKE-------KSYSPCAW-------------EVVRAEIVRCFSSS---------------EELL------RKM
IFNB_HORSE/31-184-RIS.QYLKA-------KKYSHCAW-------------TVVQAEMLRNLAFL---------------NGLT------DYL
G5BPX2_HETGA/32-192-RIE.NYLKD-------KKYSYCAW-------------KIVQVEIKRCFFYF---------------....------...
I3JM36_ORENI/31-182-RLSDDVLKK-------KGHSAEAW-------------EVIRKETKAHLMRA---------------EQLA------SSL
L8Y906_TUPCH/30-185-GLH.LYLEK-------KNFSDCAW-------------EVVRVEIRKCFLFI---------------NKLI------RKL
F7BVP5_ORNAN/27-181-RMM.DYLKG-------RNYSSCAW-------------EVIRMKTKRCFLVI---------------YRLT------RKL
H2R6R8_PANTR/30-185-RIT.LYLTE-------KKYSPCAW-------------EVVRAEIMRSLSFS---------------TNLQ------KRL
F6YZB3_ORNAN/30-179-GIS.LYLRD-------KEYSSCAW-------------EIVRAEIRRSFEYS---------------VVL.------...
F7ABU5_MONDO/29-182-GIS.QYLQG-------KEYSPCAW-------------EIVRVEIRRLFLFM---------------SKLA------RKL
IFNB_RAT/31-182-RVQ.RYLKD-------KKYNSYAW-------------MVVRAEVFRNFSII---------------LRLN------RNF
I3N788_SPETR/31-185-RIL.RYLKA-------KQYSSCAW-------------TVIRMELFQNFSFI---------------NRLM------DHF
G5C259_HETGA/30-185-RIT.LYLKE-------KRYSPCAW-------------EVVRAEIMRSFSSS---------------EKLA------RKV
H0XKS8_OTOGA/31-185-RIT.WYLKA-------KRYSSCAW-------------TVVREEILRNLFFI---------------NRLT------GYL
G5E7E1_LOXAF/13-168-GIH.SYLKE-------KEYSDCAW-------------EIVRVEIKRSFSSS---------------TNLQ------ERL
G3GXU9_CRIGR/31-180-RMQ.RYLED-------NGHSSCAW-------------MVTQAEVLRNFMFI---------------KRLT------R..
H0XRP5_OTOGA/30-185-RIT.LYLKE-------KKYTPCAW-------------EVVKAEILRSFSST---------------TSLQ------ERL
G1L8G2_AILME/30-185-GIG.LYLEK-------KKYSRCAW-------------EVVRVEIRRCLFFV---------------NELA------GKL
H0W510_CAVPO/30-182-RIT.VYLKE-------KSYSPCAW-------------EVVRAEIRRSFSFS---------------ATLK------...
G1Q880_MYOLU/30-185-GIR.LYLKE-------KKYSDCAW-------------EVVRVEIMRSFSST---------------RALQ------ERL
D2HTQ4_AILME/37-205-RID.NFLKE-------KKYSHCAW-------------EIIRVEIRRCFYYF---------------QKFA------ALL
IFNE_PIG/31-186-RIR.DYLEN-------QDYSSCAW-------------TIVRVEINRCLFFV---------------FQLT------GKL
H0XSG1_OTOGA/30-185-RIT.LYLKE-------KKYSSCAW-------------EVVRAEIMRAFSSS---------------TRLQ------ERL
A8E6E8_MONDO/30-182-GIS.QYLQG-------KGYSHCAW-------------EVTRVEIRRCFLFL---------------SKLS------RKF
C8CKA7_PIG/30-185-RLT.LYLQE-------KSYSPCAW-------------EIIRAEVMRAFSSS---------------TNLQ------DRL
G1NR05_MELGA/36-188-SIH.NFLQR-------NNYSACSW-------------DHVRLHARTCFQNV---------------DTLI------QQM
G3I0H3_CRIGR/33-178-RIT.VYLRE-------KNHSPCAW-------------EVVRAEVWRALSSS---------------VNLL------ARL
I3LBU7_PIG/30-179-RIH.RYLKE-------KSYSPCAW-------------EIVRAEVMRAFSSS---------------TNLQ------DRL
C8CKC3_PIG/37-205-RID.KFLKD-------KEHSHCAW-------------EIVRVEIRRCFYFF---------------QKFT------ALL
IFNE_MOUSE/33-185-RIH.DYLEN-------QRYSSCAW-------------IIVQTEIHRCMFFV---------------FRFT------TWL
G3N2A8_BOVIN/30-185-GIH.VYLKE-------KEYSDCAW-------------EIVRLEIMRALSSS---------------TSLQ------ERL
G3WZJ8_SARHA/30-182-GIR.AYLQG-------KEYSRCAW-------------EIVRVEIRRIFLFM---------------SKLT------KKL
G1KU56_ANOCA/35-182-RIH.TFLKD-------GEYNECAW-------------EVAQIEVSRFFMVM---------------EQLI------RTL
G1KX99_ANOCA/29-180-SLS.DLLKE-------KGYSRCAW-------------EIVHIQVKYHLSAS---------------SVL.------...
L5K909_PTEAL/30-184-RIT.LYLQE-------KKHSPCAW-------------EIVRAEIMRSYSLS---------------THLK------EK.
H0VUV7_CAVPO/30-185-GIT.DYLKE-------KSYSPCAW-------------EVVRAEFFRSFSSS---------------EELL------RKM
L5K635_PTEAL/30-183-GIH.LYLEE-------KQYSDCAW-------------EVVRVEIRRYLFVV---------------NKFT------R..
G5CB66_HETGA/31-185-RIR.RHMKA-------KDNSICAW-------------TVVQVELSRNFSFI---------------NRLT------DYF
L5LKN9_MYODS/31-186-RIR.DYLEN-------QKYSGCAW-------------TVVQVEVNRCLFFV---------------LPLT------GKL
H0XMZ9_OTOGA/31-186-RIR.EYLEN-------QEYSSCAR-------------TIVQVEINRCLLFV---------------FRLT------EKL
H9KYA4_CALJA/30-185-RIT.LYLTE-------KKHSPCAW-------------EVVRAEIMRSFSLL---------------TSLQ------ERL
H0YTY6_TAEGU/41-187-DIH.LFLHA-------HNHSACAW-------------DHVRLEARASLRHL---------------HNLT------RA.
A8E6F5_XENTR/55-202-ALE.QILQE-------KN.TACTR-------------DIIQSEIRGNLQLV---------------GQLA------SRA
G7PS89_MACFA/30-185-RIT.LYLTE-------KKYSPCAW-------------EVVRAEIMRSFSLS---------------INLQ------KRL
I3MY95_SPETR/37-186-RIT.DYLKE-------KEYRPCAW-------------EVVRTEVVKFVSSS---------------PKLY------ERL
G3WZF5_SARHA/30-185-RIM.NYLEN-------KKYSSCSW-------------KIVQVETRLNFIFL---------------YKLT------ERL
H0VF99_CAVPO/32-187-RIS.KYLRA-------KKNSICAW-------------TVVQAELIRNFSII---------------NRLT------NYF
L8Y8F8_TUPCH/30-184-GLQ.LYLKE-------KNYSDCAW-------------EIVRSEILRSLSAS---------------SKLY------ER.
F1LVL8_RAT/29-184-RIH.DYLEN-------HRYSTCAW-------------IIVQIEVNRCMFFV---------------SRLA------RRL
G1Q950_MYOLU/31-184-GIF.QYLKG-------KSYSRCAW-------------TVVQAEILRNFSFL---------------NRLI------GAL
I3N5Z0_SPETR/27-178-RIH.NYLES-------QRHSSCAW-------------TIVHAEINRCLVFV---------------FRLI------...
A3FBE8_MUSPF/31-184-RIV.RYLKA-------KEFSVCAW-------------TIVQAEILRSFFFL---------------DKLT------DSL
G3UCD2_LOXAF/30-187-RIT.VYLTE-------KKYSPCAW-------------EIVRAEIMRSFSAS---------------TNWQ------ERL
L9LC61_TUPCH/31-185-RIT.QYLKA-------KEYSSCAW-------------TIVRVEILRNFLFI---------------NRLI------DYL
H0Y0D2_OTOGA/32-187-RLI.LYLQE-------KKYSLCAW-------------EIVRTEIMRSYSYS---------------KHLQ------NTL
L5KKJ7_PTEAL/32-192-RIS.SFLKD-------KKYSHCAW-------------EIVRVEIRRCFCYF---------------...T------ALL
L5KWM8_PTEAL/110-263-GIR.LYLKE-------KRYSDCAW-------------EVVRVEIKEILLFI---------------NKLT------KKV
F7GHL9_MONDO/29-181-GIS.RYLQG-------KGYSRCAW-------------EFTRIEIRRCILFM---------------SNLT------RKF
G3TS29_LOXAF/30-179-GIG.LYLKE-------KEHSLC.W-------------EVVRVEIRKCFLFI---------------NMLT------VQI
W5PZ39_SHEEP/33-184-RID.RFLKD-------KKHSHCAW-------------EIVRVEIRRCFYFF---------------QKLT------ALL
D2H9N6_AILME/31-184-RIV.RYLKA-------KVYSICAW-------------KIVRAEMLRSFFFL---------------DKFT------NYL
IFNT4_SHEEP/30-185-GIH.DYLQE-------KGYSDCAW-------------EIVRVEMMRALTVS---------------TTLQ------KRL
F7A317_HORSE/30-183-RIA.LYLQE-------KKYSPCAW-------------EIVRAEIMRCFSSS---------------TNLQ------Q..
G3TTC1_LOXAF/30-185-GIR.FYLKE-------KEYSDCAW-------------EFVRVEIRRSFSSS---------------TALQ------ERL
Q29412_PIG/31-184-SIL.QYLKS-------KEYRSCAW-------------TVVQVEILRNFSFL---------------NRLT------DYL
IFNB_MOUSE/31-180-RVQ.RYLKL-------MKYNSYAW-------------MVVRAEIFRNFLII---------------RRLT------RNF
IFNA3_CANFA/30-183-RIS.LYLQD-------RNHSPCAW-------------EMVRAEIGRSFFSL---------------TILQ------ERV
IFNB_HUMAN/31-185-RIL.HYLKA-------KEYSHCAW-------------TIVRVEILRNFYFI---------------NRLT------GYL
I3UJJ8_FELCA/30-185-RIH.DYLES-------QEYSSCAW-------------TIVRVEINRCLFFA---------------LQLI------RKI
M3Z729_MUSPF/30-183-RIS.LYLQE-------KQYSPCAW-------------EMVRAEIMKPLYAS---------------TALH------KRL
H0W289_CAVPO/30-190-GIS.LYLEE-------KKYSDCAW-------------EIVRVEIRRVVSFS---------------LRLQ------QRL
G3WZQ8_SARHA/29-181-GIN.QYLQD-------KEYSRCAW-------------EIVRIEIRKMFLFM---------------NKFT------RNL
G1KYL3_ANOCA/28-176-SLS.NLLKE-------KEYSRCAW-------------EIIQIQVKQCFLWI---------------EKII------QEI
G1U0Q8_RABIT/30-185-RIR.LYLDE-------KKHSGCAW-------------ELVRMEIRRAFSST---------------ADLQ------ESL
G1TYS8_RABIT/33-195-RMN.NFLED-------KKYSYCAR-------------EIVRVEITRCFSYF---------------YRFT------AFL
G1SJC4_RABIT/30-185-GIA.VYLAE-------KQYSPCAW-------------EVVRAEARRAVSLS---------------RILQ------ERI
IFN_ANAPL/38-190-CIQ.HFLQN-------HTYSPCAW-------------DHVRLEAHACFQRI---------------HRLT------RTM
A8E6F6_XENTR/31-179-LLE.TMVLE-------KDNSACVW-------------DFIHLETRRNLQQV---------------LQLS------SRL
M3WRV1_FELCA/30-184-RLS.LYLQE-------KKYSPCAW-------------EIVRAEIMRSLYSS---------------TALQ------KRL
L8Y4J0_TUPCH/31-186-RIR.NYLEN-------HKYSSCAW-------------TIVQVEIKRCLFLV---------------LRLI------GKL
F7G875_MONDO/31-182-GIT.NYLKN-------KEYSSCAC-------------KIVQVETRRNFSFL---------------YKLT------EYL
I3N7K4_SPETR/37-197-RIY.NFLKD-------KTYSRCAW-------------EIVRVEITRYFLYL---------------KK..------...
IFNT2_BOVIN/7-162-GIH.VYLKE-------KEYSDCAW-------------EIIRMEMMRALSSS---------------TTLQ------KRL
G1L8I1_AILME/30-183-RIS.LYLQE-------KQYSPCAW-------------ETVRAEITKPLFSS---------------TILQ------EGL
V8NNB8_OPHHA/22-183-RLS.DFLKN-------KKYSLCAW-------------EIVQIQIEACFQLI---------------NHYI------QRI
G3SI98_GORGO/35-185-RID.NFLKE-------KKYSDCAW-------------EIVRVEIRRCLYYF---------------YKFT------ALF
H9GZR7_HORSE/30-185-RIR.LYLTE-------KKYSDCAW-------------EIVRVDIMRSFSSS---------------ANLQ------GRL
G3I0I6_CRIGR/31-185-RIH.DYLEN-------QRYSSCAW-------------IVVQVEINRCMFFV---------------FRLT------AWL
W5JYQ9_ASTMX/29-179-NIT.AVLIE-------KDYQYCAW-------------EFARFEILHALQFI---------------LINL------...
G3I0H8_CRIGR/30-185-RIT.AYLRE-------KNHSPCAW-------------EVVRAEVWRALSSS---------------ANLL------ARL
K7GQJ6_PIG/18-164-RIH.LFLKE-------KKYSDCVW-------------EIVRVEIMKPLSSL---------------NSFA------RKV
I3L756_PIG/30-180-GIH.LYLKE-------KKYSDCAW-------------ETVRVEIVRALSST---------------TNLQ------ERL
IFNE_HUMAN/31-186-RIH.DYLEN-------QDYSTCAW-------------AIVQVEISRCLFFV---------------FSLT------EKL
IFNW2_HORSE/30-185-GIH.LYLKE-------KKYSDCAW-------------EIVRMEIMRSFSSS---------------ANLQ------GRL
G1KWE0_ANOCA/33-180-SLN.DFLKE-------KEYSRCAW-------------EIVQIQVKQCFLWI---------------EKL.------...
IFNA1_MOUSE/30-185-RIT.VYLRE-------KKHSPCAW-------------EVVRAEVWRALSSS---------------ANVL------GRL
IFNB2_BOVIN/31-184-NLV.QYLKS-------KEYNRCAW-------------TVVRVQILRNFSFL---------------TRLT------GYL
G3UJX3_LOXAF/31-185-GIG.QYLEA-------KDYSSCAW-------------TVVQVEILRNFSFI---------------SGLT------DYL
L9L941_TUPCH/34-198-RIK.NFLKD-------KKYSRCAW-------------EIIRMEIRRCFHYF---------------QKFT------ELL
W5N6G4_LEPOC/31-180-KLE.KVLRD-------KDYSYCAW-------------ESVRRDLRRALEQF---------------QE..------...
D3Z919_RAT/29-179-RIT.MYLKQ-------KKHSPCAW-------------EVVRVEVGRALIYS---------------DMFL------AKL
IFNB_FELCA/31-184-RIV.RYLKA-------KEYSVCAW-------------TVVHAEILRNFFFL---------------ERLT------DYL
M3YX13_MUSPF/32-179-RIH.NYLEN-------QEYNSCAW-------------R....EINRCLFFA---------------FQLV------RKL
M3VXI8_FELCA/39-205-RMY.NFLKD-------KKYSPCAW-------------EIIRVELRRCFYYF---------------YKLT------LLL
W5PG31_SHEEP/30-185-RVT.LYLQE-------KGHSPCAW-------------EVVRAEVMRAFSSS---------------TNLQ------ERF
F7B527_HORSE/29-183-RIS.LYLKE-------KDYSGCAW-------------EVVRVEIRRCLLFM---------------NKLT------GKL
M3WZS7_FELCA/29-181-GIS.LYLKE-------KEYSHCAW-------------EVVRVEIRRCLLVI---------------NKLT------GTF
G3VDC6_SARHA/30-182-GIN.QYLQD-------KEYSRCAW-------------EMVRIEIRRIFLFM---------------DKPI------RKL
H9L1C3_CHICK/32-182-KID.SFLKE-------KQHNLCSW-------------EISRAEMRRCLQLI---------------DKVI------RK.
C8CKB9_PIG/28-175-RIH.RYLKK-------KEYSSCAW-------------EVVRVETEVCLSLM---------------QQLS------TK.
H0VYK7_CAVPO/32-181-RIS.RYLTA-------RENSICAW-------------TVVQAELISKFPII---------------NSLT------DYF
L5KBH2_PTEAL/30-185-GIR.LYLKE-------KEYSVCAW-------------EVVRVEIRKAFSLS---------------TNLL------DRL
G3R8Q7_GORGO/30-185-GIR.VYLKE-------KKYSDCAW-------------EVVRMEIMKSLFLS---------------TNMQ------ERL
R4GKJ6_CHICK/39-191-CLH.TFLQD-------NDYSACAW-------------EHVRLQARAWFLHI---------------HNLT------GNT
G7PS88_MACFA/30-185-RIT.LYLTE-------KKYSPCAW-------------EVVRAEIMRSFSLS---------------TNLQ------ERL
M3Z715_MUSPF/30-183-RIS.LYLQE-------KQYSPCAW-------------EIVRAEIMKPLYAS---------------MILQ------ERL
H0VXI5_CAVPO/30-181-RIA.VYLKE-------KSYSPCAW-------------EVVRAEIVRCFSSS---------------ETMQ------KNI
G3I0H6_CRIGR/31-178-RIT.AYLGE-------KNHSPCAW-------------EVVRAEVWRAMSAS---------------ANLL------ATL
C8CKA9_PIG/29-183-GIS.LYLKE-------KEYSHCAW-------------EVVRVETRKCLLFI---------------NNLV------GKL
H0W3G0_CAVPO/30-185-GIR.LYLED-------KKYSDCAW-------------EIVRVEIMRAFSLS---------------AKLQ------EKI
G1PDS6_MYOLU/36-199-RIS.SFLQD-------KQYSHCAW-------------KIVQVEIRRCFYYF---------------QTLI------ELL
H0W4H8_CAVPO/27-181-RIA.VYLKE-------KSYSPCAW-------------EVVRAQIVRSLSAS---------------EKLA------RK.
G1TTX4_RABIT/34-180-RIM.DYLET-------KQYSNCAW-------------KIVQLEIFRNFSFI---------------IMLI------DYL
I3MXH1_SPETR/31-185-RIR.MYLEA-------KLYSSCAW-------------TVVRDELYWNFSFI---------------NRLT------DKF
H0WK94_OTOGA/40-202-KMH.NFLKE-------KKYSHCAW-------------DIVQVEIRRCIYYF---------------YQFT------ALL

PF02947

FLT3L_MOUSE/30-162-ALK-PCIGK.....ACQNFSRCL--------------------EVQCQ-------------------------------
F6T7S9_ORNAN/28-157-SLR-PKITS.......LNFSSCL--------------------ELRC.-------------------------------
H9GP84_ANOCA/29-165-DLR-KKMEEFEAHDVPANFSNCT--------------------VIHCQ-------------------------------
F6TPW7_MONDO/34-163-ALQ-PLISS.......QDFGPCR--------------------RLRCQ-------------------------------
G5B8P0_HETGA/20-150-AMK-PWITH.......RNFSQCL--------------------ELRCQ-------------------------------
G1M637_AILME/29-159-ALK-PRITR.......RNFSGCL--------------------ELRCQ-------------------------------
L9JA37_TUPCH/769-910-ALK-PRITR.......RNFSRCL--------------------ELRCQ-------------------------------
G3VSA3_SARHA/79-209-ALR-PLITQ.......QNFQPCQ--------------------QYRCQ-------------------------------
G1QZC3_NOMLE/30-160-ALK-PWITR.......QNFSRCL--------------------ELQCQ-------------------------------

PF00714

IFNG_HORSE/15-152.KLE-DFQKL-------IQIPVNDL-------------KVQRKAISELIKVM---------------NDLS.PKANLRKR
H0WPL1_OTOGA/15-151.KAE-AFQNL-------LRISVHDL-------------QVQRKAISELYEVI---------------VSLV.PGTPLRKR
Q8CGS0_CAVPO/15-154NKVQ-AFKNL-------IQISVNDE-------------HVQRQAIIELKKVI---------------DDLS.PNQRKRRR
B9VS86_CALJA/15-152.KQD-DFERL-------TNYSVNDL-------------NVQRKAIHELIQVM---------------AELS.PAPKIGKR
G3SUC6_LOXAF/15-152.KRD-DFLKV-------MQTPVNDR-------------NIQRKAISELAKVM---------------NDLS.HRSTGSKR
G3GY20_CRIGR/2-135.KLN-DFVRI-------TKIPVNDV-------------QVQRKAVNELISVM---------------PLLS.PKLSLRKR
I3MNV6_SPETR/15-152.KRE-DFLKV-------SQFQVNDL-------------KIQRKAVRELKKVM---------------NDLL.PHSTLRKR
L5LME8_MYODS/15-153.KME-DFKKL-------IQTPVNDQ-------------RVQRKAISELYNVI---------------TELSKSNSKMRKR
G5BGB5_HETGA/15-152.KLD-VFQSL-------TRISVDNV-------------DFQRRAIIELKKVM---------------DDLS.PNQRKRRR
G3WQJ9_SARHA/15-153SSVD-DFEAL-------INTQVNDL-------------KVQRKAMFELVYVF---------------RNLS.PKPHLTG.
IFNG_SHEEP/15-152.KLE-DFKRL-------IQIPVDDL-------------QIQRKAINELIKVM---------------NDLS.PKSNLRKR
IFNG_RAT/14-151.KKD-AFMSI-------AKFEVNNP-------------QIQHKAVNELIRVI---------------HQLS.PESSLRKR
IFNG_RABIT/15-152.KMD-DFQNL-------TRISVDDR-------------LVQRKAVSELSNVL---------------NFLS.PKSNLKKR
L9KVU0_TUPCH/51-188.KLD-VFLNL-------TRISVNDV-------------QVQRKAIYELLNVM---------------IDLT.PKSNQKKR
IFNG_FELCA/15-153.KRD-DFLKL-------IQIPVNDL-------------QVQRKAINELFKVM---------------NDLS.PRSNLRKR

PF05337

CSF1_HUMAN/1-254-IFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP......LAPS....MAPVAGLTW........EDS
CSF1_HUMAN/272-554-PASEGAARPLPRFNSVP.........LTDTGHERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEP
Q6GMN4_RAT/265-566-PASEGAARPVARFNSIP.........LTDTGSSIQ.....DPQTSAFVFWVL..GIILVLLAVGGLLFYSWKRRSHRDP
O77709_BOVIN/1-254-IFSKNCNNSFAKCSSHDVVTKPDCNCLYPKATPSSDLASVSPQQS......PTPS....TAPMAGLTW........ADS
Q64129_9MURI/1-257-IFTKNCNNSFAKCSSR..............GHVEQHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDP
CSF1_MOUSE/273-552-SASEGAARPVARFNSIP.........LTDTGHVEQHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDP
O77709_BOVIN/274-554-QASEGAARPPARFNSVP.........LTDTGHERQHKEASDPQLPGFVFRLLVPSIILVLLAVGGLLFYRRRRRSHQEP
Q3TLQ6_MOUSE/1-254-IFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQP......PAPS....MAPLAGLAW........DDS
O77710_BOVIN/1-257-IFSKNCNNSFAKCSSH..............GHERQHKEASDPQLPGFVFRLLVPSIILVLLAVGGLLFYRRRRRSHQEP

PF02404

R4GD07_ANOCA/1-283-SVTKSFLSYPFAASHLK--NDSSG....NHNNEAALGFLGSPGMQGLSIALTSLVTLFIGFILGAVCWKKTARKHILES
SCF_CHICK/1-287-AVTKTISFPPVAASSLR--NDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIGFILGAIYWKKTHPKSRPES
SCF_RAT/1-273-SVTKPFMLPPVAASSLR--NDS......SSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAV
G1NWC8_MYOLU/1-272-SVTKPFMLPPVAANSLR--NDS......SSSNRKALNSIGDSKLQWAAMTLPAFFSLLVGFGFGALYWKKKQPNLTRAV
F7EP53_MONDO/1-273-NVTKPFLLPPVAASSLR--NDS......SSSNRKAAGSTKDPSVQWVAIVLPSLFSLVLGFVLGALYWKKKQMNLKMEV
F7C5I3_ORNAN/1-273-SVTKPFLLPPVAASSLK--NDS......TSSNREAFGYISSSSLQWISIAVPSIFSLVIGFILGAIYWKKKHPKHSVEV
F7G0W2_CALJA/1-273-SVTKPFMLPSVAANSLR--NDS......SSSNRKAKNPPGDSGLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRTV

PF00489

IL6_BOVIN/27-208-ILKQKIADL..ITT..PATNTDLLEKMQSSNEWVK--NAKIILILRNLENF---------------LQFSLRAIRMK--
M3X721_FELCA/27-208-MLKRKGKNQDEVTIPVPTVEVGLQAKLQSQEEWLR--HTTIHLTLRRLEDF---------------LQFSLRAVRIM--
IL6_HORSE/27-208-ILMQKMKNP.EVTTPDPTAKSSLLAKLHSQNEWLK--NTTTHLILRSLEDF---------------LQFSLRAVRIM--
G3UHF3_LOXAF/20-205-ILKQKIKNPEDVTTPDPTANASLLSKLQLQTEWLK--NTTINLILRSLDDF---------------MQFSLRAVRIM--
L5KPK4_PTEAL/20-202-VLKQKVKNPNEITTPDPTTNSSLLAKLQSQSEWLQ--TTTIHLILRSLEDF---------------LQFTQRAVRIM--
F7HV62_CALJA/27-212-SLQKKAKNLSAIATPDPATNASLLTKLQAQDQWLQ--GVTTHLILRSFKDF---------------LQNSLRALRQM--
IL6_MOUSE/26-210-IFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLR--TKTIQFILKSLEEF---------------LKVTLRSTRQ.--

PF16647

CSF3_BOVIN/42-190-NIWLQMEDLGAAPAVQPTQGAMPT----FTSAFQR--RAGGVLVASQLHRF---------------LELAYRGLR----
CSF3_HUMAN/51-202-TIWQQMEELGMAPALQPTQGAMPA----FASAFQR--RAGGVLVASHLQSF---------------LEVSYRVLR----
CSF3_MOUSE/57-205-TIWQQMENLGVAPTVQPTQSAMPA----FTSAFQR--RAGGVLAISYLQGF---------------LETARLALH----

PF02372

IL15_PIG/33-160-EYKTESGCKE-------------------CE-ELE--EKNINEFLKSFIHI---------------VQMFIN-------
IL15_CAVPO/33-160-GNVTESGCKE-------------------CE-ELE--EKSIAEFLQSFVHI---------------VQMFIN-------
IL15_FELCA/33-160-RNITETGCKE-------------------CE-ELE--EKNIKEFLQSFVHI---------------VQMFIN-------
IL15_SHEEP/33-160-ENKTELGCKE-------------------CE-ELE--KKSIKEFLKSFVHI---------------VQMFIN-------
F1NZN5_CHICK/55-183-NSTTSKKCKE-------------------CE-EYE--EKNFTEFIQSFVKV---------------IQRECK-------
G1NDP6_MELGA/5-137-LSPTGGECKI-------------------CE-AND--KKNFPDFLQQLTNL---------------......-------
O73883_CHICK/5-138-LNHTGSECKI-------------------CE-ANN--KKKFPDFLHELTNF---------------V.....-------
Q8JFF4_ANAPL/4-134-LIPPGTGCNI-------------------CE-A.N--ANNFPEFRQELTN.---------------...F..-------

PF00715

I3MQX6_SPETR/7-151-KLKGSATTFT-------------------CEYAQE--TANIVEFLNTWITF---------------CQSIIS-------
G5C793_HETGA/7-149-KLKGSKTTLK-------------------CDLNDE--EANIVQFLKGWIAF---------------CQKIIS-------
G1PJ32_MYOLU/7-147-NLKGPKTRFE-------------------CDYDDE--TVTIVEFLNKWITF---------------CQRIFS-------
B1AB81_HORSE/7-146-GLKGSETRFT-------------------CEYDDE--TGTIVEFLNKWITF---------------CQSIFS-------
G3HTL8_CRIGR/7-150-KLKGSENTFT-------------------CEFDDE--TVTVVEFLSRWITF---------------CQSII.-------
IL2_MACMU/7-151-ELKGSETTLM-------------------CEYADE--TATIVEFLNRWITF---------------CQSIIS-------
H0Y254_OTOGA/7-149-ELKGSET.FI-------------------CE.DNE--TATIVEFLNRWITF---------------CQSIIS-------
IL2_MOUSE/7-165-KLKGSDNTFE-------------------CQFDDE--SATVVDFLRRWIAF---------------CQSIIS-------
G3SU90_LOXAF/7-147-ELQGSETTFM-------------------CEYDDH--AATIEEFLNKWIVF---------------CQSIIS-------
IL2_PIG/7-151-ELKGSETSFK-------------------CEYDDE--TVTAVEFLNKWITF---------------CQSIYS-------
IL2_FELCA/7-151-KLKGSETRFT-------------------CNYDDE--TATIVEFLNKWITF---------------CQSIFS-------
L5K7D9_PTEAL/7-149-KLKGPETKYT-------------------CVYNDE--SANVKEFLNKWITF---------------CQSILS-------
IL2_BOVIN/7-152-ELQGSETRFT-------------------CEYDDA--TVNAVEFLNKWITF---------------CQSIYS-------
H0VBY4_CAVPO/7-149-SLKGSETAFV-------------------CDLEDE--SVNIVEFLKRWIAF---------------CQKIMS-------

PF00103

PLRP1_BOVIN/26-238-FIERQFSKIIVPVLNTMIQARSSWTGLPSLMSSDE--DRRHSEFYNLFYCLRRDSRKVDMYIKILTCRTHKT...C---
CSH2_BOVIN/26-238-FIESQFRKIIVPVLKMIHEVSDTWSRFSSMTFSDE--DRSISEYYNLFYCLRRDSRKVDMYIKILTCRTRKT...C---
PLRP3_BOVIN/1-213-FIERQFSQVIYPVIRTIFKARIYWSGLASLVSNDE--DVRHSAFYKLFMCLYRDSRKLDMYTEILACRITNT...C---
PR4A1_RAT/17-227-AIKNIAKKGNF..EINEKANYTAWSELGFLQSPNR--DTRYFAFYNLFHCLKKDSNNVEMYLKLLKCRLIRS..KC---
CSH1_BOVIN/26-236-GVEMIQKRVH.PGEKKNEPYPVWSEKSS.LTADDE--DVRQTAFYRMFHCLHRDSSKISTYINLLKCR.FTP...C---
PLRP4_BOVIN/26-239-LIERPFSQVIFTARRKMYIARIYWFGLRSLLSSNE--DRRHSAFYSLFFCLRRDTRKLDIYTKFVACRLIYK..KC---
PR3D4_RAT/16-223-GLQKIFNRTQTKVEENENFDYPAWSGLKDLQSSDE--DTHLFAIYNLCRCFKSDIHKIDTYLKVLRCRVVFKN.EC---
PR2C2_MOUSE/16-224-GVNALMSTMLQ..NGDEEKKNPAWFLQS....DNE--DARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDN.C---
SOM2_HUMAN/9-215-GIQTLMWRLEDGSPRTGQIFNQSYSKFD..TKSHN--DDALLKNYGLLYCFRKDMDKVETFLRIVQCR.SVEG.SC---
PR8A5_RAT/17-238-DLRWILTKVF..PTAEIKEEFPSWDYLSFLKSSNK--NHKFLAIFNLSSCLDYDTQVHYTLSQILNCLITGKD..C---
PR6A1_RAT/20-234-VLKGILNKIQ..PGSPQNERFPMWNELAYLRSPDE--ERRHFAFTNLFQCLLQDSRKFDSKVRLLKCRLIYNR.DC---
PR7D1_MOUSE/17-240-YIIRIISKVN..PAIKENEDYPTWSDLDSLKSADK--ETQFFALYMFSFCLRIDLETVDFLVNFLKCLLLYDD.VC---
CSH2_HUMAN/9-215-GIQTLMGRLEDGSRRTGQILKQTYSKFD..TNSHN--HDALLKNYGLLYCFRKDMDKVETFLRMVQCR.SVEG.SC---

PF03487

G1SCQ2_RABIT/16-144-QVTSVQAR-------------------------DT--KIELLQFLKELRRH---------------LQMLYRLGK----
IL13_HUMAN/16-144-QFSSLHVR-------------------------DT--KIEVAQFVKDLLLH---------------LKKLFREGR----
IL13_RAT/2-130-VASSPP..-------------------------DT--KIEVAQFISKLLNY---------------SKQLFRYG.----
F7DGH7_MACMU/16-151-QFSSLRVR-------------------------DT--KIEVAQFVKDLLVH---------------LKKLFREGQ----
L5M5Z7_MYODS/2-128-PASSPPVR-------------------------DT--KVEVTRLAKDLLQQ---------------LRKGVRQGK----
G5ASP9_HETGA/2-130-KVSSFHNR-------------------------DT--KIEVAQFVQTLLRY---------------LQSLYRHGN----
B3GDZ5_PIG/2-130-QVPGKHIR-------------------------DT--KIEVAQFVKDLLKH---------------LRMIFRHG.----
L8YAP6_TUPCH/2-128-QVSSLPTR-------------------------DT--KIEVAQFVKDLLRH---------------LKRLYRH..----
IL13_BOVIN/2-130-QVSSEYVR-------------------------DT--KIEVAQFLKDLLRH---------------SRIVFRNER----
IL13_MOUSE/2-130-TVSSLP..-------------------------DT--KIEVAHFITKLLSY---------------TKQLFRHGP----
H0W834_CAVPO/16-149-QVSSLRSP-------------------------DT--KIEVAEFVKKLRIH---------------VQCLYRHGK----
F6WQF3_ORNAN/2-128-QVHCEVNQ-------------------------ET--QVELLMFLKKMLPF---------------YQKIFRDT.----
G3T2N9_LOXAF/2-133-QVSSLQVR-------------------------DT--KIELITFMKNLLDH---------------LRRIYRY..----
M3YGH3_MUSPF/2-126-QISS...K-------------------------DT--KIEVIQLVKNLLTY---------------ARSVFRHGN----
B5FW67_OTOGA/2-129-.VPSSHIR-------------------------DT--KIEVAQFIKDLLRH---------------LKKRFRDAN----
I3MAR4_SPETR/2-131-QASTVPIP-------------------------DT--KIEVGQFVKKLLSH---------------LRCLLRHGK----
IL13_CANFA/2-129-QISSERSR-------------------------DT--KIEVIQLVKNLLTY---------------VRGVYRHGN----

PF00727

IL4_FELCA/26-131-R.TCSVNE-------------------------VK..KCTLKDFLERLKAI---------------MQKKYS-------
H0XDE1_OTOGA/26-149-SRYCPVND-------------------------AM..QSTLKDFLERLKTT---------------MKEKYS-------
IL4_MOUSE/27-140-SISCTMNE-------------------------SK..STSLKDFLESLKSI---------------MQMDYS-------
G3T4B8_LOXAF/26-132-LDYCPVNE-------------------------DRNLFKTAR.VIEKLKTI---------------YYTKF.-------
IL4_RABIT/28-143-LSNCPGKE-------------------------AR..QTTLEDFLDRLKTA---------------MQEKYS-------
G5ASQ0_HETGA/25-138-P.NCSVSE-------------------------LK..QTTLKDFLENLKTI---------------LKKKYS-------
F6U5N6_HORSE/26-135-GTCCTVNE-------------------------AK..KSTLKDFLERLKTI---------------MKEKYS-------
IL4_BOVIN/26-133-K.TCSVNE-------------------------AKTSTSTLKDLLERLKTI---------------MKEKYS-------
G3QSC0_GORGO/26-149-LNSCPVKE-------------------------AN..QSTLEDFLERLKTI---------------MREKYS-------
A3FBF0_MUSPF/26-130-M.TCSVNE-------------------------VK..KSTLKDFLERLKVI---------------MQQKYY-------
IL4_RAT/27-139-LRSCTVNE-------------------------ST..LTTLKDFLESLKSI---------------LRGKY.-------
G3WEJ0_SARHA/28-149-QTKCPVNE-------------------------TK..ITKLQDFLSKLKTI---------------NQK...-------
I3MAS4_SPETR/24-141-LHNSPASE-------------------------SK..QRTLKDFLESLKTT---------------MQKKYS-------
IL4_PIG/26-131-M.TCSVHE-------------------------AK..KSTLKDFLERLKTI---------------MKEKYS-------

PF00726

IL10_BOVIN/5-174-VFSELQER-----------------------GVYK--AMSEFDIFINYIET---------------YMTT---------
IL10H_EBVB9/7-167-AFNKLQEK-----------------------GIYK--AMSEFDIFINYIEA---------------YMTI---------
G3HB01_CRIGR/14-174-DFNKLQEK-----------------------GVYK--AMNEFDIFINCIET---------------YMTI---------

PF14565

IL22_HUMAN/40-178-TVKKLGES-----------------------GEIK--AIGELDLLFMSLRN---------------AC-----------
E1C1U2_CHICK/46-184-KMKELGEN-----------------------GKNK--AIGELDLLFDYIEN---------------AC-----------

PF15036

IL34_MOUSE/28-184-LLSTPGLS..--------------------...LK--LVRPKALLDNCFRV---------------MELLYCSCCKQSP
R4GIU3_CHICK/19-177-QLHSGDSR..--------------------...QK--AVRPKALLDNCLKV---------------LRMLFGAHCRWDS
F7EA00_CALJA/29-185-LLNAPGPN..--------------------...LK--LVRPKALLDNCFRV---------------MELLYCSCCKQSS
H0WFN4_OTOGA/28-184-LLNAPGLS..--------------------...RK--LVRPKALLDNCFRV---------------MELLYCSCCKQSS
M3ZVZ0_XIPMA/24-191-QLTEEPDRVP--------------------ESSWR--FASPKSLVDNLCHT---------------MCCLFWECFS..S
U3JY35_FICAL/18-179-LIHSAGAE..--------------------.SRSK--AVRPKALLDNCLKV---------------MRMLYGVPCRWES
L9KJY3_TUPCH/28-184-HLNTPGLI..--------------------...LK--LVRPKALLDNCFRV---------------MELLYCPCCKHNS
G3T3A6_LOXAF/28-182-LLSAPG....--------------------...LK--LVRPKALLDNCFRV---------------MDLLYCSCCKQSS
F6W3U1_MONDO/15-167-LANS.GRD..--------------------...QK--LVRPKALLDNCYKV---------------MDLLYCLCCKESN
I3JZ08_ORENI/24-192-SLTEKPENMP--------------------ESSWR--FATPKSLLDNLCRT---------------MYCLFSECFSNAD
L5MCR9_MYODS/28-182-LPSDRRLS..--------------------...LK--LVRPKALLDNCFRV---------------MELLHCSCCKE..
B3DLJ8_DANRE/23-195-HLTEQDYK..--------------------..GWK--SVTPKSILDNCYRT---------------MLCLFKECFTKED
IL34_BOVIN/28-183-LLSAPG.S..--------------------...LK--LVRPKALLDNCFRV---------------MQLLYCPCCKESS

PF01109

CSF2_RAT/18-139-----------------------------
CSF2_MOUSE/18-136-----------------------------
CSF2_BOVIN/18-138-----------------------------
CSF2_CAVPO/18-140-----------------------------
CSF2_PIG/18-139-----------------------------
CSF2_HUMAN/18-139-----------------------------
CSF2_CANFA/18-139-----------------------------

PF02025

G1RQD7_NOMLE/22-133-----------------------------
IL5_CAVPO/23-134-----------------------------
J9NWP5_CANFA/22-132-----------------------------
IL5_MOUSE/21-132-----------------------------
G3WAR7_SARHA/25-134-----------------------------
IL5_HORSE/22-133-----------------------------
B5FW65_OTOGA/22-133-----------------------------
I3MDT8_SPETR/23-134-----------------------------
G3T4B0_LOXAF/23-133-----------------------------
G1SL79_RABIT/22-133-----------------------------

PF02059

IL3_CANFA/19-132-----------------------------
IL3_MOUSE/27-138-----------------------------
IL3_BOVIN/18-132-----------------------------
G3UC30_LOXAF/22-133-----------------------------
G1MH15_AILME/18-131-----------------------------
F1RJV6_PIG/18-131-----------------------------
G1RQ11_NOMLE/20-137-----------------------------
IL3_CALJA/19-136-----------------------------
F1LS41_RAT/29-138-----------------------------

PF07400

IL11_HUMAN/1-199LLLLKTRL---------------------

PF00758

G3TYQ1_LOXAF/25-173-----------------------------
W5K758_ASTMX/26-175-----------------------------
B1N8Y2_DANRE/15-168-----------------------------
F7DTH0_CALJA/31-193-----------------------------
M3XJ62_LATCH/27-177-----------------------------
G3W289_SARHA/30-190-----------------------------
F6WUU2_MONDO/31-191-----------------------------
G3VW20_SARHA/26-175-----------------------------
G1PF99_MYOLU/45-207-----------------------------
TPO_CANFA/25-176-----------------------------
F7G570_MONDO/26-177-----------------------------
H0W023_CAVPO/30-191-----------------------------
H2LEX3_ORYLA/33-182-----------------------------

PF06875

Q5BNQ4_9SALA/2-215KYQGPL-----------------------
Q5BNQ2_9SALA/2-215KYQGHL-----------------------

PF01110

CNTF_CHICK/1-194HGPGSGAALGLPES---------------
G3VWZ5_SARHA/1-195PGQNRVPARGGQQL---------------
E1BFH9_BOVIN/1-193..QSGVPACGSRCA---------------
G5AP46_HETGA/1-192Q.PAGIPADESRYF---------------
H0Z9U1_TAEGU/1-188PSSAAGTA......---------------
CNTF_HUMAN/1-194H.QTGIPARGSHYI---------------

PF01291

LIF_MOUSE/44-203-----------------------------
LIF_BOVIN/43-202-----------------------------
ONCM_HUMAN/37-209-----------------------------
ONCM_MOUSE/34-194-----------------------------
ONCM_BOVIN/34-194-----------------------------

PF03039

IL12A_MOUSE/6-215A----------------------------
G3VQT1_SARHA/40-247.----------------------------
F6T5A8_MONDO/5-202A----------------------------
IL12A_PIG/6-222S----------------------------
L8YEA2_TUPCH/1-213S----------------------------
H0X861_OTOGA/6-217S----------------------------
G1QWH2_NOMLE/40-254S----------------------------
I3MN91_SPETR/4-220S----------------------------
Q924V6_CAVPO/6-221S----------------------------

PF02024

H3AP27_LATCH/26-169C----------------------------
G3WWV6_SARHA/23-167C----------------------------
F6PLK2_ORNAN/23-167C----------------------------
F7HGW1_CALJA/23-167C----------------------------
G5BHA4_HETGA/23-167C----------------------------
W5NER9_LEPOC/28-172C----------------------------
H0V7C6_CAVPO/23-165C----------------------------
LEP_HUMAN/23-167C----------------------------

PF00143

I3MVD7_SPETR/41-186-----------------------------
M3WTR1_FELCA/30-186-----------------------------
G3UK87_LOXAF/31-177-----------------------------
H0W7G8_CAVPO/30-185-----------------------------
IFNB_HORSE/31-184-----------------------------
G5BPX2_HETGA/32-192-----------------------------
I3JM36_ORENI/31-182-----------------------------
L8Y906_TUPCH/30-185-----------------------------
F7BVP5_ORNAN/27-181-----------------------------
H2R6R8_PANTR/30-185-----------------------------
F6YZB3_ORNAN/30-179-----------------------------
F7ABU5_MONDO/29-182-----------------------------
IFNB_RAT/31-182-----------------------------
I3N788_SPETR/31-185-----------------------------
G5C259_HETGA/30-185-----------------------------
H0XKS8_OTOGA/31-185-----------------------------
G5E7E1_LOXAF/13-168-----------------------------
G3GXU9_CRIGR/31-180-----------------------------
H0XRP5_OTOGA/30-185-----------------------------
G1L8G2_AILME/30-185-----------------------------
H0W510_CAVPO/30-182-----------------------------
G1Q880_MYOLU/30-185-----------------------------
D2HTQ4_AILME/37-205-----------------------------
IFNE_PIG/31-186-----------------------------
H0XSG1_OTOGA/30-185-----------------------------
A8E6E8_MONDO/30-182-----------------------------
C8CKA7_PIG/30-185-----------------------------
G1NR05_MELGA/36-188-----------------------------
G3I0H3_CRIGR/33-178-----------------------------
I3LBU7_PIG/30-179-----------------------------
C8CKC3_PIG/37-205-----------------------------
IFNE_MOUSE/33-185-----------------------------
G3N2A8_BOVIN/30-185-----------------------------
G3WZJ8_SARHA/30-182-----------------------------
G1KU56_ANOCA/35-182-----------------------------
G1KX99_ANOCA/29-180-----------------------------
L5K909_PTEAL/30-184-----------------------------
H0VUV7_CAVPO/30-185-----------------------------
L5K635_PTEAL/30-183-----------------------------
G5CB66_HETGA/31-185-----------------------------
L5LKN9_MYODS/31-186-----------------------------
H0XMZ9_OTOGA/31-186-----------------------------
H9KYA4_CALJA/30-185-----------------------------
H0YTY6_TAEGU/41-187-----------------------------
A8E6F5_XENTR/55-202-----------------------------
G7PS89_MACFA/30-185-----------------------------
I3MY95_SPETR/37-186-----------------------------
G3WZF5_SARHA/30-185-----------------------------
H0VF99_CAVPO/32-187-----------------------------
L8Y8F8_TUPCH/30-184-----------------------------
F1LVL8_RAT/29-184-----------------------------
G1Q950_MYOLU/31-184-----------------------------
I3N5Z0_SPETR/27-178-----------------------------
A3FBE8_MUSPF/31-184-----------------------------
G3UCD2_LOXAF/30-187-----------------------------
L9LC61_TUPCH/31-185-----------------------------
H0Y0D2_OTOGA/32-187-----------------------------
L5KKJ7_PTEAL/32-192-----------------------------
L5KWM8_PTEAL/110-263-----------------------------
F7GHL9_MONDO/29-181-----------------------------
G3TS29_LOXAF/30-179-----------------------------
W5PZ39_SHEEP/33-184-----------------------------
D2H9N6_AILME/31-184-----------------------------
IFNT4_SHEEP/30-185-----------------------------
F7A317_HORSE/30-183-----------------------------
G3TTC1_LOXAF/30-185-----------------------------
Q29412_PIG/31-184-----------------------------
IFNB_MOUSE/31-180-----------------------------
IFNA3_CANFA/30-183-----------------------------
IFNB_HUMAN/31-185-----------------------------
I3UJJ8_FELCA/30-185-----------------------------
M3Z729_MUSPF/30-183-----------------------------
H0W289_CAVPO/30-190-----------------------------
G3WZQ8_SARHA/29-181-----------------------------
G1KYL3_ANOCA/28-176-----------------------------
G1U0Q8_RABIT/30-185-----------------------------
G1TYS8_RABIT/33-195-----------------------------
G1SJC4_RABIT/30-185-----------------------------
IFN_ANAPL/38-190-----------------------------
A8E6F6_XENTR/31-179-----------------------------
M3WRV1_FELCA/30-184-----------------------------
L8Y4J0_TUPCH/31-186-----------------------------
F7G875_MONDO/31-182-----------------------------
I3N7K4_SPETR/37-197-----------------------------
IFNT2_BOVIN/7-162-----------------------------
G1L8I1_AILME/30-183-----------------------------
V8NNB8_OPHHA/22-183-----------------------------
G3SI98_GORGO/35-185-----------------------------
H9GZR7_HORSE/30-185-----------------------------
G3I0I6_CRIGR/31-185-----------------------------
W5JYQ9_ASTMX/29-179-----------------------------
G3I0H8_CRIGR/30-185-----------------------------
K7GQJ6_PIG/18-164-----------------------------
I3L756_PIG/30-180-----------------------------
IFNE_HUMAN/31-186-----------------------------
IFNW2_HORSE/30-185-----------------------------
G1KWE0_ANOCA/33-180-----------------------------
IFNA1_MOUSE/30-185-----------------------------
IFNB2_BOVIN/31-184-----------------------------
G3UJX3_LOXAF/31-185-----------------------------
L9L941_TUPCH/34-198-----------------------------
W5N6G4_LEPOC/31-180-----------------------------
D3Z919_RAT/29-179-----------------------------
IFNB_FELCA/31-184-----------------------------
M3YX13_MUSPF/32-179-----------------------------
M3VXI8_FELCA/39-205-----------------------------
W5PG31_SHEEP/30-185-----------------------------
F7B527_HORSE/29-183-----------------------------
M3WZS7_FELCA/29-181-----------------------------
G3VDC6_SARHA/30-182-----------------------------
H9L1C3_CHICK/32-182-----------------------------
C8CKB9_PIG/28-175-----------------------------
H0VYK7_CAVPO/32-181-----------------------------
L5KBH2_PTEAL/30-185-----------------------------
G3R8Q7_GORGO/30-185-----------------------------
R4GKJ6_CHICK/39-191-----------------------------
G7PS88_MACFA/30-185-----------------------------
M3Z715_MUSPF/30-183-----------------------------
H0VXI5_CAVPO/30-181-----------------------------
G3I0H6_CRIGR/31-178-----------------------------
C8CKA9_PIG/29-183-----------------------------
H0W3G0_CAVPO/30-185-----------------------------
G1PDS6_MYOLU/36-199-----------------------------
H0W4H8_CAVPO/27-181-----------------------------
G1TTX4_RABIT/34-180-----------------------------
I3MXH1_SPETR/31-185-----------------------------
H0WK94_OTOGA/40-202-----------------------------

PF02947

FLT3L_MOUSE/30-162-----------------------------
F6T7S9_ORNAN/28-157-----------------------------
H9GP84_ANOCA/29-165-----------------------------
F6TPW7_MONDO/34-163-----------------------------
G5B8P0_HETGA/20-150-----------------------------
G1M637_AILME/29-159-----------------------------
L9JA37_TUPCH/769-910-----------------------------
G3VSA3_SARHA/79-209-----------------------------
G1QZC3_NOMLE/30-160-----------------------------

PF00714

IFNG_HORSE/15-152-----------------------------
H0WPL1_OTOGA/15-151-----------------------------
Q8CGS0_CAVPO/15-154-----------------------------
B9VS86_CALJA/15-152-----------------------------
G3SUC6_LOXAF/15-152-----------------------------
G3GY20_CRIGR/2-135-----------------------------
I3MNV6_SPETR/15-152-----------------------------
L5LME8_MYODS/15-153-----------------------------
G5BGB5_HETGA/15-152-----------------------------
G3WQJ9_SARHA/15-153-----------------------------
IFNG_SHEEP/15-152-----------------------------
IFNG_RAT/14-151-----------------------------
IFNG_RABIT/15-152-----------------------------
L9KVU0_TUPCH/51-188-----------------------------
IFNG_FELCA/15-153-----------------------------

PF05337

CSF1_HUMAN/1-254-EGTEGSSLLPGEQPLHTVDPGSAKQRPP
CSF1_HUMAN/272-554-QRADSPLEQPEGSPL.TQD.DRQVELPV
Q6GMN4_RAT/265-566-RTLDSSVGRPEGSSL.AQDEDRQVELPV
O77709_BOVIN/1-254-EATDGSSLLPREQALRTVDPGSAKQRPP
Q64129_9MURI/1-257-QTLDSSVGRPEDSSL.TQDEDRQVELPV
CSF1_MOUSE/273-552-QTLDSSVGRPEDSSL.TQDEDRQVELPV
O77709_BOVIN/274-554-QMVDSPMEQPEGSLL.TQEEDRQEELPV
Q3TLQ6_MOUSE/1-254-QRTEGSSLLPSELPLRIEDPGSAKQRPP
O77710_BOVIN/1-257-QMVDSPMEQPEGSLL.TQEEDRQEELPV

PF02404

R4GD07_ANOCA/1-283NPTTQANICQEDNEISMLQQKDKSLL-QV
SCF_CHICK/1-287NETIQCHGCQEENEISMLQQKEKEHL-QV
SCF_RAT/1-273.ENIQIN..EEDNEISMLQQKEREFQ-EV
G1NWC8_MYOLU/1-272.ENIQIN..EEDNEISMLQEKEREFQ-EV
F7EP53_MONDO/1-273.ENIETS..EEDNEISMLQENDGEFQ-EV
F7C5I3_ORNAN/1-273.ENIQGN..EEDNEISMLQERERELQ-EV
F7G0W2_CALJA/1-273.ENIQIN..EEDNEISMLQEKEREFQ-EV

PF00489

IL6_BOVIN/27-208-----------------------------
M3X721_FELCA/27-208-----------------------------
IL6_HORSE/27-208-----------------------------
G3UHF3_LOXAF/20-205-----------------------------
L5KPK4_PTEAL/20-202-----------------------------
F7HV62_CALJA/27-212-----------------------------
IL6_MOUSE/26-210-----------------------------

PF16647

CSF3_BOVIN/42-190-----------------------------
CSF3_HUMAN/51-202-----------------------------
CSF3_MOUSE/57-205-----------------------------

PF02372

IL15_PIG/33-160-----------------------------
IL15_CAVPO/33-160-----------------------------
IL15_FELCA/33-160-----------------------------
IL15_SHEEP/33-160-----------------------------
F1NZN5_CHICK/55-183-----------------------------
G1NDP6_MELGA/5-137-----------------------------
O73883_CHICK/5-138-----------------------------
Q8JFF4_ANAPL/4-134-----------------------------

PF00715

I3MQX6_SPETR/7-151-----------------------------
G5C793_HETGA/7-149-----------------------------
G1PJ32_MYOLU/7-147-----------------------------
B1AB81_HORSE/7-146-----------------------------
G3HTL8_CRIGR/7-150-----------------------------
IL2_MACMU/7-151-----------------------------
H0Y254_OTOGA/7-149-----------------------------
IL2_MOUSE/7-165-----------------------------
G3SU90_LOXAF/7-147-----------------------------
IL2_PIG/7-151-----------------------------
IL2_FELCA/7-151-----------------------------
L5K7D9_PTEAL/7-149-----------------------------
IL2_BOVIN/7-152-----------------------------
H0VBY4_CAVPO/7-149-----------------------------

PF00103

PLRP1_BOVIN/26-238-----------------------------
CSH2_BOVIN/26-238-----------------------------
PLRP3_BOVIN/1-213-----------------------------
PR4A1_RAT/17-227-----------------------------
CSH1_BOVIN/26-236-----------------------------
PLRP4_BOVIN/26-239-----------------------------
PR3D4_RAT/16-223-----------------------------
PR2C2_MOUSE/16-224-----------------------------
SOM2_HUMAN/9-215-----------------------------
PR8A5_RAT/17-238-----------------------------
PR6A1_RAT/20-234-----------------------------
PR7D1_MOUSE/17-240-----------------------------
CSH2_HUMAN/9-215-----------------------------

PF03487

G1SCQ2_RABIT/16-144-----------------------------
IL13_HUMAN/16-144-----------------------------
IL13_RAT/2-130-----------------------------
F7DGH7_MACMU/16-151-----------------------------
L5M5Z7_MYODS/2-128-----------------------------
G5ASP9_HETGA/2-130-----------------------------
B3GDZ5_PIG/2-130-----------------------------
L8YAP6_TUPCH/2-128-----------------------------
IL13_BOVIN/2-130-----------------------------
IL13_MOUSE/2-130-----------------------------
H0W834_CAVPO/16-149-----------------------------
F6WQF3_ORNAN/2-128-----------------------------
G3T2N9_LOXAF/2-133-----------------------------
M3YGH3_MUSPF/2-126-----------------------------
B5FW67_OTOGA/2-129-----------------------------
I3MAR4_SPETR/2-131-----------------------------
IL13_CANFA/2-129-----------------------------

PF00727

IL4_FELCA/26-131-----------------------------
H0XDE1_OTOGA/26-149-----------------------------
IL4_MOUSE/27-140-----------------------------
G3T4B8_LOXAF/26-132-----------------------------
IL4_RABIT/28-143-----------------------------
G5ASQ0_HETGA/25-138-----------------------------
F6U5N6_HORSE/26-135-----------------------------
IL4_BOVIN/26-133-----------------------------
G3QSC0_GORGO/26-149-----------------------------
A3FBF0_MUSPF/26-130-----------------------------
IL4_RAT/27-139-----------------------------
G3WEJ0_SARHA/28-149-----------------------------
I3MAS4_SPETR/24-141-----------------------------
IL4_PIG/26-131-----------------------------

PF00726

IL10_BOVIN/5-174-----------------------------
IL10H_EBVB9/7-167-----------------------------
G3HB01_CRIGR/14-174-----------------------------

PF14565

IL22_HUMAN/40-178-----------------------------
E1C1U2_CHICK/46-184-----------------------------

PF15036

IL34_MOUSE/28-184-----------------------------
R4GIU3_CHICK/19-177-----------------------------
F7EA00_CALJA/29-185-----------------------------
H0WFN4_OTOGA/28-184-----------------------------
M3ZVZ0_XIPMA/24-191-----------------------------
U3JY35_FICAL/18-179-----------------------------
L9KJY3_TUPCH/28-184-----------------------------
G3T3A6_LOXAF/28-182-----------------------------
F6W3U1_MONDO/15-167-----------------------------
I3JZ08_ORENI/24-192-----------------------------
L5MCR9_MYODS/28-182-----------------------------
B3DLJ8_DANRE/23-195-----------------------------
IL34_BOVIN/28-183-----------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window