Sequence alignment for CL0055

PF02443

Q5Y4T0_PCV2/5-226-------------------------------------------------------RR-----------------------
Q27W03_PCV1/5-227-------------------------------------------------------RR-----------------------
A3FEQ4_9CIRC/3-256-------------------------------------------------------RS-----------------------
Q3HUU1_GOCV/5-247-------------------------------------------------------RA-----------------------
Q1L2D2_9CIRC/1-237-------------------------------------------------------ML-----------------------
CAPSD_CACV/7-243-------------------------------------------------------QV-----------------------
Q0H9S8_9CIRC/4-236-------------------------------------------------------QV-----------------------
Q06J73_9CIRC/8-245-------------------------------------------------------HF-----------------------
Q9DXG3_BFDV/11-242-------------------------------------------------------TF-----------------------
Q69EZ5_BFDV/7-239-------------------------------------------------------IF-----------------------
Q9DXG0_BFDV/11-242-------------------------------------------------------IF-----------------------
Q9DXF4_BFDV/3-235-------------------------------------------------------HF-----------------------

PF02956

A7VLZ2_9VIRU/1-506------------------------------------------MPF.WWARR....KR..WWRGRR...............
Q9WT88_9VIRU/1-603------------------------------------------MA..YWFRR.........WGWRPRR..RWRRWRRRR..
Q91CY9_9VIRU/1-581------------------------------------------MAFRWWWWR....RR.PQRRWTRRR...WRRL.RTR..
A7VLY0_9VIRU/1-515------------------------------------------MPF.WWARR....KK..PWYSN................
Q9JGT1_9VIRU/1-585------------------------------------------MAYRWWRRR....SR..RWRRRRWR..RWRRRRRP...
Q80QT8_9VIRU/1-595------------------------------------------MA..WWGRW....RR...WRWRPRR...WRRRRRRR..
CAPSD_TTVB1/1-533------------------------------------------MPPFYYRRR.........WYSNPWR.............
A7VM00_9VIRU/1-509------------------------------------------MAF.WWYRR....NK..PWFGR................
Q9JG61_9VIRU/1-534------------------------------------------MPPFNYYRR....R....YFYRPRR.............
Q91PS3_9VIRU/1-581------------------------------------------MWWNWW..K....RR..RWR.PRRR.WRT.RR.RRRLP
CAPSD_TTVV4/1-560------------------------------------------M...WWWRR....RF...WR.PKRR.WRWRRR.RRRPL
Q91C93_9VIRU/1-546------------------------------------------MPW..........RN...YYYRRRR.............
Q2F827_9VIRU/1-589------------------------------------------MAWSWWWRR....RK..RWWPRRRR..RWRRF.RTR..
Q91CY5_9VIRU/1-584------------------------------------------MAWRWWWQR....RR..RWWPRRRR..RWRRL.RRR..
Q8V7G9_9VIRU/1-572------------------------------------------MAW..YRYR....RR..PWRRRRRPRWGLRRR......
Q99A78_9VIRU/1-584------------------------------------------MAYGWWARR....RR..RWRRWKRR..PWRRRWRT...
Q6H9C2_9VIRU/1-573------------------------------------------MAWGFWGRR....RRWRRWRARRRR...WRPR.RR...
CAPSD_TTVT1/1-433------------------------------------------MRF....RY....RK...WR..................
Q9JG80_9VIRU/1-589------------------------------------------MAWGWWRRW....RR...WPARRWRRRRRRRPVRRR..
A7VLZ6_9VIRU/1-506------------------------------------------MPF.WWRRR....RR..FWTNRR...............
Q6H9D2_9VIRU/1-557------------------------------------------M...WWWRR....RR...WRAPWRR.RRW..R.RRRPR
Q6H999_9VIRU/1-471------------------------------------------M.....................................
Q77JT5_9VIRU/1-606------------------------------------------MAWRRWRWR....PW...WRRRRRR..RWRRR.RRRP.
Q91PS7_9VIRU/1-585------------------------------------------MWWNRW..K....RY..RWR.PLRR.WRT.YR.RRRPL
CAPSD_TTVV9/1-555------------------------------------------MPWWPWRRW....RR...WR...RRRGNWRRRVAPR..
Q9JG47_9VIRU/1-553------------------------------------------MPF.....Y....KRWRRWRWRR...............
A7VLW0_9VIRU/1-507------------------------------------------MAF.WWRRR....RK..PWFG.................
Q0ZLH9_9VIRU/1-573------------------------------------------MAWRWWWRR....RR..PW.....R.WRW.RR.RRRPA
Q5ENW7_9VIRU/1-501------------------------------------------MAP.....T....RR...WRR.................
A7VLX2_9VIRU/1-509------------------------------------------MPF.WWARR....RK..PWYGRF...............
Q80AR5_9VIRU/1-594------------------------------------------MAWGWWLKR.WRRRKKPAWKKWRTR..RWRRF.RRR..
Q91CZ2_9VIRU/1-601------------------------------------------MAYSYWWRR....RR...WPW..RG..RWRRW.RRR..
CAPSD_TTVG1/1-514------------------------------------------MPF.WWGRR....NK..FWYG.................
Q98Y63_9VIRU/1-581------------------------------------------MAWRWWWAR....RR.PNRRWTRRR...WRRL.RTR..
Q9QU36_9VIRU/1-529------------------------------------------MPYFY........RR...WFPRRR..............
A7VM12_9VIRU/1-509------------------------------------------MPF.WWRRR....RK..PWYG.................
A7VLV6_9VIRU/1-508------------------------------------------MPF.WWARR....RR..PWFGRY...............
Q9JG50_9VIRU/1-535------------------------------------------MPPYNYYRW....NNWRRPTYRRRR.............
A7VLW4_9VIRU/1-507------------------------------------------MPF.WWNRR....RK..NWWG.................
A7VM04_9VIRU/1-513------------------------------------------MPF.YWRRR....RK..FWWGKA...............
A7VLY4_9VIRU/1-498------------------------------------------MPF.WWNRR....KR..WWRGAR...............
CAPSD_TTVD1/1-324------------------------------------------MAY....FR....RN..FYGGRRHY.............
Q91CZ6_9VIRU/1-596------------------------------------------MA..YWWRR....RR...WPW..RR..RWRRR.GRR..
A7VM08_9VIRU/1-506------------------------------------------MPF.WWTRR....RK..PWFGT................
CAPSD_TTVV3/1-573------------------------------------------MAWYWWRRR....RRRGWWKPRRRR...WRRR.RA...
Q91D00_9VIRU/1-593------------------------------------------MAWRWWWRRRWKPRRRPAWTKYRRR..RWRRL.RPR..
Q99AR5_9VIRU/1-604------------------------------------------MA..WWGRW....RR...WPRRRWR..RWRRRRRRR..
Q9DTD2_9VIRU/1-559------------------------------------------MAFWWWRRR....RR.ARWRRRAAA.RRWRRR.RP...
Q91D04_9VIRU/1-591------------------------------------------MAWTWWWQR....RR.RRWPWRRRR...WRRL.RTR..
CAPSD_TTVV8/1-571------------------------------------------MAWP.WRRR....RW..RWRRRRPRWRRWRRR.RT...
Q5ENX0_9VIRU/1-603------------------------------------------MAWWGW.......RRRWGWRPRWRRRRRWTRR.RRR..
O90364_9VIRU/1-590------------------------------------------MAYGWWRRR....RR..RWRRWRPR..PWRPRWRT...
Q9IFV0_9VIRU/1-583------------------------------------------MAWRWWWRR....RR..RWP.RRRR.TTW.RR.RPRP.
Q9QUE7_9VIRU/1-586------------------------------------------MAYGWWRRR....RR..RWKRWRRR.PRWRRPWRT...
A8DMR2_9VIRU/1-531------------------------------------------MPY..............YWRGWRRR.............
Q9DUH8_9VIRU/1-609------------------------------------------MPWGWW.......RR...WRRRPRRWRRWRRWGRR...
A7VLW8_9VIRU/1-511------------------------------------------MPF.WWGRR....RK..YWWGRR...............
Q99AQ3_9VIRU/1-582------------------------------------------MS..WWGWR....RR...WWWKPRR..RWRRR.RARRP

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618-------------------------------NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLAT
POL2_CPMVS/460-832-------------------------------MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYD
POL2_BPMV/447-819-------------------------------METNLFKLSLDDVETPKGSMLDLKISQSKIALPKNTVGGTILRSDLLAN
Q9Z006_9SECO/476-846-------------------------------Q........TNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLN.
O12663_9SECO/321-691-------------------------------Q........TNNFAIESATETMRLLFSGHASIPLNVIPGTKITVAYLN.
Q9YWK0_9SECO/363-735-------------------------------NELDLAQLSLDDTSSLRGSVLQTKLATSRVILSKTMVGNTILRENLLAT
POL2_CPSMV/437-806-------------------------------D...LFKRNLDDVSTISDTMLGAMIGQTKVVIPKTLVAGTVLKSGPLSD
POL2_RCMV/407-778-------------------------------TDTDLFKLSLDDTSSPKGSLLDTRFAQKKVLIPKAMAGGADLLSSNLYD
Q9YWJ9_9SECO/452-824-------------------------------NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLAT
Q66170_CPMVS/343-715-------------------------------MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYD

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754ASANQAGKRLEPRKRTRSIRSRQDLDTMHRVVVSVDVDSLTTLMGNIMTLAGSGGRGSLLTAGDVEKNPGPQMTRENKAP
CAPSD_NCBVS/1-608MDANV.........QIRPAR..............................................NNP...........
CAPSD_HASV/2-647GDAGVASQRPHNRRGTRNVR............................................................

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226------RYRRRRHRPRSHLGQILRR----------------RPWLVHPR..HRYRWRRK..-.......NGIFNTRLSRT
Q27W03_PCV1/5-227------RYRRRRTRPRSHLGNILRR----------------RPYLAHPAFGNRYRWRRK..-.......TGIFNSRLSTE
A3FEQ4_9CIRC/3-256------TYRRAYRA.......RRRR----------------RGLRR......RLRRRRLRI-GRPRRRFS.VVTFKVTRH
Q3HUU1_GOCV/5-247------RPRSLYYR.......RRRA----------------ANRRR......RYRRRRLHI-GRIRSKYT.IFNVKQTQN
Q1L2D2_9CIRC/1-237------LSRRRWRRGLRP...RYRR----------------RHYRR......RRRTRRLPR-NRRGHRANRVYYFRLRHS
CAPSD_CACV/7-243------ARRRRPLAPRRR...RWRR----------------RYWXR......R...RRIPA-NRRGHRTNRVYRFRFVRE
Q0H9S8_9CIRC/4-236------ARRRRQTQAIRR...RWRR----------------RHWRR..........RRL.T-NRRGHRTNRVYRFKFVRM
Q06J73_9CIRC/8-245------LIQRRMRHWRRRRHLRMRR----------------RHWRR......R...RRIPA-NRRGHRTNRIYRIKLVRQ
Q9DXG3_BFDV/11-242------QIRRRYARP......Y.RG----------------RHIR.......RYRRRRRHF-RRRRFSTNRIYTLRLTRQ
Q69EZ5_BFDV/7-239------QIRRRYARP......YVRR----------------RHIR.......RYRRRRRHF-RRRRFTTNRIYTLRFKRQ
Q9DXG0_BFDV/11-242------QIRR.IARP......RYRR----------------RHIR.......RYRPRRTYF-RRRRFSTNRIYTLRLKRQ
Q9DXF4_BFDV/3-235------QIRRRYARP......Y.RR----------------RHIRR.....YRYRQRRRHF-CRRRFTTNRLYTIRLKRE

PF02956

A7VLZ2_9VIRU/1-506......RPFYRRRYHYKKRRP..RR......RLYKRKHR..RTYRRRRKSFRKVRRKRRTL.PLKQWQPETIRKCKVKGI
Q9WT88_9VIRU/1-603RRLPRRRTRRAVRGLGRRRKPRVRR..RRRTRRRTY.....RRGWRRRRYIR.RGRRKKKL.ILTQWNPAIVKRCNIKGG
Q91CY9_9VIRU/1-581......RPRRTVRRRRRRPRV...R..RRRWGRRRGRRRLYRRTYRKR......RKRRKKM.TLKMWNPSTIRACNIRGF
A7VLY0_9VIRU/1-515......WNRYRRRYKRRRWPR..RR..RRRIPYGRRR........RRRRRKRKVRRKRQRI.IVKQWQPESIVKCEIKGL
Q9JGT1_9VIRU/1-585......RRRRPARRCRRRRTV..RR..RRR.GR.WTRTY..RRWRRKG.....RRRSKKKL.IIRQWQPNYRRRCNIVGY
Q80QT8_9VIRU/1-595..VPRRRAQRPVRRRRRRVR.......RRRWGRRRW.....RRGYRRRLRLRRRRRRRKKI.ILTQWNPAKVRKCTIRGV
CAPSD_TTVB1/1-533......RKRLRFRRRRLRRPI..RKRFRR............RRWVRRRRFFR.FKRKLRKI.RIDQWQPETIRKCHVKGN
A7VM00_9VIRU/1-509......YKRRRTRRYKRTWRT..RR..RRP..IRRRRNR..RTNRRRRRRRYKVRRKQKKI.TLKQWQPESIKKCKIKGT
Q9JG61_9VIRU/1-534......YRRRWFTTWRPRQTL..RRRFRR............RRWVRKRRFFKYKKRKLKKI.RLSQWQPDSIRKCTIKGQ
Q91PS3_9VIRU/1-581V.....WRRRRTTRYARRRRV..RRLRRRR.RRGWAR....RRYLRARR....RVKRRKKI.KLTQWNPTVVKKCVVKGY
CAPSD_TTVV4/1-560A.....RRRRRPARLARRPRV...R..RRRFQWGRPR....RYRPRRRR....RRRKRQKI.KLKQWNPAVTKFCRIIGY
Q91C93_9VIRU/1-546......RPRRFWRRRFRTPIY..RRFWRR............RYRVRKRH....FKRKLSKL.TIQEWQPPSIRKLTIKGY
Q2F827_9VIRU/1-589......RARRAVPRRRRRRRV...R..RRRWGRRRRRRRV.FYKRRRRKTGRLYRKPKKKL.VLTQWHPTTVRNCSIRGL
Q91CY5_9VIRU/1-584......RPRRPVRRRRRRATV...R..RRRWRGRRGRRTYTRRAVRRR......RRPKKKL.VLTQWSPQTVRNCTIRGI
Q8V7G9_9VIRU/1-572......RFRRSFRGRGRRRYV..SRWSRRRYRRRRR.....RGRRRRGR....RRRKRQTL.IPRQWQPDVTKKCFITGW
Q99A78_9VIRU/1-584......RRRRPRRRYRRRRHV..RR..RRR.GR.WRRRY..RKWRRKG.....RRRGKKKI.IIRQWQPNYRRRCNIIGY
Q6H9C2_9VIRU/1-573......RRRRPTRRFRARRRV..RR..RG..GR.WRRRY..RKWRRGRR....RRTHRKKI.VIKQWQPNFIRRCYIIGY
CAPSD_TTVT1/1-433......RPRRLFRSRRRRGYA..RRRWRRRAWGRRRRVR..RYRRRR......GGTKRQYISSIMQWNPQHRHLCYIKGI
Q9JG80_9VIRU/1-589......RAGRPARRYRRRRTV...RTRRRRWGRRRYRRGWRRRTYVRKGR...HRKKKKRL.ILRQWQPATRRRCTITGY
A7VLZ6_9VIRU/1-506......FTYKRRKRYPRRYN...RR.......YGRRRNYR.RPARRRRRKLRKVRRKKKQI.AVKQWQPESITKCKILGH
Q6H9D2_9VIRU/1-557T.....RRFRRAARRPRRPRV...R..RPRRRRGWAR....RYRLRRRR....RRRRRRKL.ILTQWQPAKIRKCLVIGY
Q6H999_9VIRU/1-471.................................................................KG.............
Q77JT5_9VIRU/1-606......RRRRPYRR.RRPRRV..RR..RR..GR.WRRAY..RRWGRRRR....RRRHKKKL.VLTQWQPAVVKRCLIVGF
Q91PS7_9VIRU/1-585R.....WRRRGAARRPRRRRV..RRW.RRR.RRAWGR....RRYIRRRR....LRRRRKKI.PITQWNPSVVRKCVVTGY
CAPSD_TTVV9/1-555......RYRRTARRARRRRKAV.RR..RRRRRVRRRGYY..RRYRRR......RRYKRRLL.ILKQWQPTTNLRLTVKGL
Q9JG47_9VIRU/1-553......RPRRLWRRRFRRPLY..RRFWRR............KYRVR........KRKLKYL.PLRQWQPHYINKLKVQGW
A7VLW0_9VIRU/1-507..........RWRRYRRRTNYKPRR..KRRRIYRRRRNY..RTTKGRRRRRYKVRRKQQKI.LVKQWQPECIRKCKIKGL
Q0ZLH9_9VIRU/1-573RR....RRRRRPARRARRPRV..RRW.RRR..RVWAP....RPYIRRRR....RSFRRKKI.KITQWNPAVTKKCTVTGY
Q5ENW7_9VIRU/1-501......RFGRRRRRYRKRRYGWRRRYYRYRPRDYRR.....RWLVRRRRRSVYRRGGRRAR.PYRLFNPKVMRRVVIRGW
A7VLX2_9VIRU/1-509......RRRYRYRPYKKR.....RR..RRR.RFTRRRNF..KASRRRRRRRYEVRRKRQKI.VLKQWQPESIKKCKVKGF
Q80AR5_9VIRU/1-594......RPKRTYGRRRRRRTV......RRRRVRRLR.....RRGWTRRRYIR.RRRRKKKL.VLTQWNPQDVRRCTIRGI
Q91CZ2_9VIRU/1-601RRIPRRRPRRPVRRYRRR.PV..RR..KRRWGRRGRRRRYTRRYRRRLT....VRRKRNKL.RLSVWQPQNIRYCAIKGL
CAPSD_TTVG1/1-514............RNYRRKKRRFPKR..RKRRFYRRTKYR..RPARRRRRRRRKVRRKKKTL.IVRQWQPDSIVLCKIKGY
Q98Y63_9VIRU/1-581......RPRRPVRRRRRRPRV...R..RRRWGRRRGRRRFYRRRFKKR......RRRRRKL.TLKMWNPSTIRACNIKGA
Q9QU36_9VIRU/1-529......RFRRSWRRRIRGPFR..RKYWR.............RHWVRRYS....RKRKLSKL.NIKEWQPITIRKTKVKGL
A7VM12_9VIRU/1-509......RFRYRRRFQTKRRRN..RR......RFTRRRNRRVTRRRRRRTRHQKVRRKKNKI.PVLQWQPDSIRKCHIKGQ
A7VLV6_9VIRU/1-508.......KRYKTRRYRRRFRP..KR..HRY.PFRRRR.......RRRRRRRYKVRRKKKKI.VIQQWQPESIKKCKIKGF
Q9JG50_9VIRU/1-535......WRRRQYRRRRPRPFIR.RRFWR.............RHTVRRRR....IKKKLKKI.KIYEWQPTVIKKCHIKGT
A7VLW4_9VIRU/1-507.......YKYKTRKYRRRRWP..RR..RRQTLYRRRRPT..RTNRRRRRRHRKVKRKRKTL.TVKQWQPESIRKCKIIGL
A7VM04_9VIRU/1-513......RPRWRFQRYRRKTT...RR..RRRRPARKRAH...RYAGRRRRRRYKVRRKRQKI.PLFQWQPDKIVKCKIKGV
A7VLY4_9VIRU/1-498......RPWYKRKRYTRRYR...RR......IYKNRRRR..PTRRRRRRRHTKVRRKRQTI.PVRQWQPERIVRCKIKGI
CAPSD_TTVD1/1-324......YRRRNAYTRRRYRRV..RR................RHRGRRFPYFKQGKRRRTRL..LHVTDPRYKAHCTITGW
Q91CZ6_9VIRU/1-596RRVPRRRYRRPVRRYRKRYTV..RR..RRRRGRRGRPRR..RLYRRRYT....LRRKRKRL.IIKQWQPNNIRKCRITGM
A7VM08_9VIRU/1-506......WRQRRYRRRRRRTTY..KR..RKP.RYNRRRPR..RLTRRRRRRKYKVRRKQKKI.HLTQWQPDRIRKCKIKGR
CAPSD_TTVV3/1-573......RRRGPARRHRARRRV..RR..RR..GR.WRRRY..RRWRRRGG....RRRHRKKL.IIKQWQPNFIRHCYIIGY
Q91D00_9VIRU/1-593......RPRRLARGRRRRRTV......RRRRVRRLRR....RRGWTRRRYL..RRRKRRKL.ILTQWNPNIVRRCSIKGI
Q99AR5_9VIRU/1-604..LPTRRTRRAVRGLGRRPRKTVRR..RRRRPRRTY.....RRGWRRRRYIRRRRGRRKKL.TLTMWNPNIVRRCNIEGG
Q9DTD2_9VIRU/1-559......RRRRAARRAGRRRRV..RR..RR..GR.WRRAH..RRWRRRRG....RRRHKRKL.IIRQWQPPYTRRCYIVGY
Q91D04_9VIRU/1-591......RPRRLVRRRRKRYRV..RR..RRRWGRRRGRRTYLRRRLKK.......RKRRKKL.RLTQWNPSTIRGCTIKGM
CAPSD_TTVV8/1-571......WRRRP.RRAVRRRRV..RR..R...GRGWRRLY..RRYRRRRG....RRTYKKKP.VLTQWQPTVRRRCFIIGY
Q5ENX0_9VIRU/1-603..VPARRPRRPVRRHRKRYRV...R..RRRWGR........RYTRRGRLRLRRRRRRRKKI.VLTQWNPQTVRRCYIRGL
O90364_9VIRU/1-590......RRRRPARRRGHRRNV..RR..RRRGGR.WRRRY..RRWKRKG.....RRRKKAKI.IIRQWQPNYRRRCNIVGY
Q9IFV0_9VIRU/1-583......RRRRRTARTRRRGRV..RRW.RRR.GRGWRR....RTYIRRRR....R..RKKKI.NIQQWNPATVKKCVVTGY
Q9QUE7_9VIRU/1-586......RRRRPARRRGRRGTV..RR..RRR.GR.WRRRY..RRWRRKG.....RRRRKKKL.IIRQWQPNYTRKCNIVGY
A8DMR2_9VIRU/1-531......RRRRFWRRRAGAPFRR.RRYWRY............RYRVRR......LRRKPKKL.PIKQWQPTKMRRLTVTGK
Q9DUH8_9VIRU/1-609......RTRWGLRTRRARAAV...R..RRRRGRVRRRARGGRRYHYRRRFRRRRARRRKKI.VLTQWNPQTVRKCLIRGM
A7VLW8_9VIRU/1-511......FTRPKYRRYQ.......RR..RKR.PIRRRKPR..RTYRRRYRRRKKVRRKRKTL.LVRQWNPDSILTCKIKGF
Q99AQ3_9VIRU/1-582RRLPRRRYRRPTRRYRGR.RV..RR..RRAGGWRGR.RRYSRRYSRRLT....VRRKKKKL.TLKIWQPQNIRRCKIRGL

PF00729

CAPSD_PNLV/47-266-----------------------------------GRVVTAPVSSAALI.RYKAPSL------N....GNSMDSVRLASK
CAPSD_MCMVK/23-222-----------------------------------RAIRANPPVPRPNPQRNRPPPA------G..........TTCSMS
CAPSD_PMVK/39-236-----------------------------------YVTTLGP..........SRPRM------G.....QGQGWQKLSHE
CAPSD_RCNMV/24-213-----------------------------------VKTVAIPFAKTQII.KTVNP..------......PPKPARGILHT
CAPSD_CARMS/51-245-----------------------------------TPAILAFTPRRPRM.TNSPPRT------SRNSPGQAGKSMTMSKT
CAPSD_SBMVA/46-262-----------------------------------AGVSMAPIAQGTMV.RLREPSL------R.....TAGGVTVLTHS
CAPSD_TBSVC/76-269-----------------------------------GGAIMAPVAVTRQL.VGSKPKF------T....GRTSGSVTVTHR
CAPSD_POLVP/66-257-----------------------------------.GAIAAPVANTRII.RASKPKF------T.....RSKGSVTIAHR
CAPSD_OCSVU/111-308-----------------------------------.GTTAAPVSISRNINRRSKPSI------K.....MMGDAVVISHS
CAPSD_TNVA/61-272-----------------------------------GGYIVAPTSGGVVT.RPIVPKF------S.....NRGDSTIVRNT

PF11729

CAPSD_SJNNV/1-340-------------------------------MVRKGDKKLAKPPTTKAA-NSQPRRR------ATQRRRSGRADAPLAKA

PF00894

CAPSD_PLRV1/70-207------------------------------------------------------------------------ETFVFTKD
CAPSD_PEMVW/53-187------------------------------------------------------------------------D.FSMVHG
CAPSD_BYDVP/62-199------------------------------------------------------------------------EVFVFSVD

PF03014

CAPSD_HEVCH/41-659---------------------FWGDRADSQPFAIPYIHPTNPFAPDVTAAAGAGPRV------RQPARPLGSAWRDQAQR

PF03115

CAPSD_HASV1/1-416---------------------MASKSNKQVTVEVSNNGRSRSKSRARSQSRGRDKSVKITVNSRNRARRQPGRDKRQSSQ

PF00983

COAT_TYMV/8-177----------------------------------------APQDRTVTV-ATVLPAV-------------PGPSPLTIKQ

PF00073

Q9WMA0_9PICO/49-215-----------------------------DQSSVHTAEVGSHQI.......EPLKTSVDKPGSKK-TQGEKFFLIHSADW
POLG_AEVCA/45-212-----------------------------DQSSVSTATMGSLQDVQYRT.......AVDIPGSRV-TQGERFFLIDQREW
POLG_CXA9/93-300-----------------------------TTQECANVVVGYGRWPTYLR..DDEATAEDQPTQPD-VATCRFYTLDSIKW
POLG_CXB3N/93-302-----------------------------TTQECANVVVGYGVWPDYLK..DSEATAEDQPTQPD-VATCRFYTLDSVQW
POLG_CXB4J/93-300-----------------------------TTQECANVVVGYGVWPDYLS..DEEATAEDQPTQPD-VATCRFYTLNSVKW
POLG_CXA21/93-308-----------------------------TTQEAANAIVAYGEWPTYIN..DSEANPVDAPTEPD-VSSNRFYTLESVSW
POLG_POL1M/93-308-----------------------------TTQEAANSVVAYGRWPEYLR..DSEANPVDQPTEPD-VAACRFYTLDTVSW
POLG_POL3L/93-307-----------------------------TTQEAANSVVAYGRWPEFIR..DDEANPVDQPTEPD-VATCRFYTLDTVMW
POLG_HE701/93-288-----------------------------VTQEAANICCAYGEWPTYLP..DNEAVAIDKPTQPE-TSTDRFYTLKSKKW
POLG_BOVEV/93-285-----------------------------TTQEAANICVAYGCWPAKLS..DTDATSVDKPTEPG-VSADAFYTLRSKPW
POLG_HRV14/93-299-----------------------------TTQEAANAVVCYAEWPEYLP..DVDASDVNKTSKPD-TSVCRFYTLDSKTW
POLG_HRV2/93-302-----------------------------TSQDVANAIVAYGVWPHYLS..SKDASAIDKPSQPD-TSSNRFYTLRSVTW
POLG_HRV8A/93-302-----------------------------TSQDTANAVVAYGVWPSYLT..PDDATAIDKPTQPD-TSSNRFYTLDSRSW
POLG_HRV1B/93-301-----------------------------TSQDVANAVVGYGVWPHYLT..PQDATAIDKPTQPD-TSSNRFYTLESKHW
POLG_FMDV1/311-475-----------------------------TTQSSVGVTYGYSTEEDHVA..GPNTSGLETRV...-VQAERFFKKFLFDW
POLG_FMDVT/311-475-----------------------------TTQSSVGVTFGYATAEDSTS..GPNTSGLETRV...-HQAERFFKMALFDW
POLG_FMDVO/311-475-----------------------------TTQSSVGVTYGYATAEDFVS..GPNTSGLETRV...-VQAERFFKTHLFDW
POLG_EMCV/161-359-----------------------------........TPSQQWAVLSVM..VPFMMESIRHHVLT-LLQKRFWRWKGTTP
POLG_TMEVB/172-382-----------------------------NTQSTVGRLCGYGKSHHG....EHPASCADTATDKV-LAAERYYTIDLASW
POLG_ENMGO/162-361-----------------------------NTQSTVGRLVGYGTVHDG....EHPASCADTASEKI-LAVERYYTFKVNDW
POLG_FMDVO/533-691-----------------------------VFNPPRNQLPGRFTNLLDVAEACPTFLRFEGGV...-.....PYVTTKTDS
POLG_FMDV1/533-692-----------------------------VYNPPKTNYPGRFTNLLDVAEACPTFLRFDDG.KP.-......YVVTRADD
POLG_EMCV/420-582-----------------------------TPVAPSNYMVGEYKDFLEIAQ.IPTFIGNKIPN...-....AVPYIEASNT
POLG_TMEVB/443-606-----------------------------TISTPSDYMCGEFSDLLELCK.LPTFLG.....NPN-TNNKRYPYFSATNS
POLG_HE701/347-515-----------------------------FSPTPEMHIPGQVHSMLEIV..QIESMMEINNVN.D-ASGVERLRVQISAQ
POLG_HRV2/358-522-----------------------------YHPTKEISIPGEVKNLVEIC..QVDSLVPINNTDTY-INSENMYSVVLQSS
POLG_HRV8A/364-529-----------------------------FHPTKEIFIPGQVRNLIEMC..QVDTLIPVNNTQEN-VRSVNMYTVDLRTQ
POLG_HRV1B/360-525-----------------------------YHPTKEISIPGEVKNLIEMC..QVDTLIPVNNVGTN-VGNISMYTVQLGNQ
POLG_BOVEV/345-515-----------------------------FQPTLEIFIPGKVNNLLEIA..QVESILEANNRE.G-VEGVERYVIPVSVQ
POLG_CXA21/369-534-----------------------------FDVTPPIHIPGEVKNMMELA..EIDTLIPMNAVDGK-VNTMEMYQIPLNDN
POLG_CXA9/358-524-----------------------------FDVTPSMNIPGEVKNLMEIA..EVDSVVPVNNVQDT-TDQMEMFRIPVTIN
POLG_CXB4J/358-524-----------------------------FDVTPEMNIPGQVRNLMEIA..EVDSVVPINNLKAN-LMTMEAYRVQVRST
POLG_CXB3N/360-526-----------------------------YDVTPEMRIPGEVKNLMEIA..EVDSVVPVQNVGEK-VNSMEAYQIPVRSN
POLG_CXB1J/360-526-----------------------------FDVTPEMQIPGRVNNLMEIA..EVDSVVPVNNTDNN-VNGLKAYQIPVQSN
POLG_FMDVO/725-872-----------------------------......TTSAGESADPVTTT..VENYGGETQIQRRQ-HTDVSFIMDRFVKV
POLG_FMDV1/726-878-----------------------------......TTTTGESADPVTTT..VENYGGDTQVQRRH-HTDVGFIMDRFVKI
POLG_BOVEV/610-775-----------------------------DESMIETRTIVPTHGIHETS..VESFFGRSSLV...-....GMPLLATGTS
POLG_HRV8A/621-792-----------------------------PEDMIETRYVITDQTRDETS..IESFLGRSGCI...-AMIEFNTSSDKTEH
POLG_HRV2/614-772-----------------------------PEDVIETRYVQTSQTRDEMS..LESFLGRSGCIHES-KLEVTLANYNKENF
POLG_HRV1B/627-786-----------------------------..........MTSQTRDEMS..IESFLGRSGCV...-..HISRIKVDYNDY
POLG_HE701/609-781-----------------------------....IQTRTVINMHGTAECL..VENFLGRSALV...-CMRSFEYKNHSTST
POLG_HRV14/614-787-----------------------------PSDSIETRTTYMHFNGSETD..VECFLGRAACV..H-VTEIQNKDATGIDN
POLG_CXA9/612-783-----------------------------PSDTMQTRHVKNYHSRSEST..VENFLGRSACV...-.....YMEEYKTTD
POLG_CXB4J/612-783-----------------------------PSDTMQTRHVHNYHSRSESS..IENFLCRSACV...-.....IYIKYSSAE
POLG_SVDVU/612-782-----------------------------PSDTMQTRHVKNYHSRSEST..VENFLCRSACV...-......FYTTYKNH
POLG_CXB3N/630-782-----------------------------................SEST..IENFLCRSACV...-......YFTEYKN.
POLG_POL1M/636-806-----------------------------PSDTVQTRHVVQHRSRSESS..IESFFARGACV...-....TIMTVDNPAS
POLG_CXA21/642-812-----------------------------.........VINYKTRSESC..LESFFGRAACV...-....TILSLTNSSK
POLG_CXA24/646-809-----------------------------.........VVNYKTRSEST..LESFFGRSACV...-.TMLEVENFNATTE

PF00915

CAPSD_VESVA/137-421--LRSTAD.VNSNF.TFRAESDGPGSTEIVTEEQGT.IVQQQPAPAPTALATLATASTGKSVEQ..EWMTFFSYHTSINW
POLG_RHDVF/1768-2065--GKARAAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVITAENSSASIATAGIGGPPQQVDQQETWRTNFYYNDVFTW
CAPSD_FCVUR/112-395--....KA.WDPNLPLFRLEADD...GSITAPEQGT.VVGGVIAEPSSQMSTAADMASGKSVDS..EWEAFFSFHTSVNW
CAPSD_NVN68/2-294--MMASKD........ATSSVDGASGAGQLVPEVNA.SDPLAMDPVAGSSTAVATAGQVNPID...PWIINNFVQAPQGE

PF08762

Q8B107_ALPV/599-804-----------------------------T..SSA.LTVGEKVTSLRQI--LKRFHLIYSNL----T.TSTKNNNLYRIN
O56051_9VIRU/590-790-----------------------------TFNASM.LMMGEKVTSFRQL--IKRFSAI....----.....TPPTQNRYW
Q56QP7_9VIRU/684-855-----------------------------SPNAVMGKIAGERLVNLRPL--LRCFRSLGG..----.......ITLDRAG
O36967_9VIRU/668-900-----------------------------S..PEA.HCIGEKIMSIRQL--IKRFGMALNSL----NLISDAPNTLIAPF
Q5UBY1_9VIRU/79-259-----------------------------NMEALL.KGSGEQIMNLRSL--LRTFRTISENW----NLAPNTKTALTDLT
Q6ITS9_9VIRU/106-313-----------------------------NPNISL.LISGEVFTNFRNL--IKRVNFRKATT----LNGKRISDTFDINS
Q4JFT2_9VIRU/834-1009-----------------------------T...ML.TTMGEQFVSLRML--TRR........----....SSPVDILRGD

PF02247

POL2_SQMVM/246-618FLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQNAIVWNPACEKAVELTFN
POL2_CPMVS/460-832VVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTWNPGCKKNFSFTFN
POL2_BPMV/447-819FLTEGNFRASVDLQRTHRIKGMIKMVATVGIPENTGIALACAMNSSIRGR.ASSDIYTICSQDCELWNPACTKAMTMSFN
Q9Z006_9SECO/476-846ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPYVEFCFQ
O12663_9SECO/321-691ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPFVEFIFK
Q9YWK0_9SECO/363-735FLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVWNPACEKAVELSFN
POL2_CPSMV/437-806VMQQGSFRSTIALQRTHIITGKIHVVAMLETAVNTGLGLAICFNSGIRGK.ASADIYATCSQDAMIWNPSCTKVMQYAFN
POL2_RCMV/407-778VLSGSSFRASLALARTHVVEGKIRCICTINLPENTGCCLAITVNSSNRGQ.FSTDIYTTGSQDRILWNPACSKNCDFSFN
Q9YWJ9_9SECO/452-824FLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVWNPACEKAVELTFN
Q66170_CPMVS/343-715VVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTWNPGCKKNFSFTFN

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------PTMTWPIQL.GDTFAID-
POL2_RRVS/768-936--------------------------------------------------------------PTFVWPPKP.TDISLLK-
POL2_BRAV/1268-1433--------------------------------------------------------------PTLVLPQAFGGDLPLDL-
Q65029_ARMV/745-916--------------------------------------------------------------PNFIYSADA.FNGSLKF-
POL2_ARMVS/792-963--------------------------------------------------------------PNFIYSADA.FNGSLKF-
Q67703_GFLV/166-336--------------------------------------------------------------PTLVFDPGV.FNGKFQF-
POL2_GFLV/771-941--------------------------------------------------------------PTLVFDPGV.FNGKFQF-
POL2_BRSV/1007-1170--------------------------------------------------------------QPLSYPIEA.RHLTDLN-
POL2_GCMV/981-1144--------------------------------------------------------------SIVTYPISL.EHLKDIE-
POL2_TORVR/1497-1662--------------------------------------------------------------PFITLPHIF.NRLDIGY-
Q88483_9SECO/1003-1166--------------------------------------------------------------NPLTYPIKP.GHLEDLD-

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------RNRRRRPRRGSR-----SAPSSADANFRVLSQQLS-RLNK--------TLAAGRPTINH------P

PF01318

CAPSD_BMV/2-188--------------------------------STSGTGKMTRAQRRAAA-RRNR--------WTARVQPVIVE------P

PF03566

Q80IX5_PRVFL/54-754NMSVRAQNVTVSNSRRRRRKNRKPRK.....QVEQATILKPQLLPGESV-APSG--------GRGTMDPPVHEICAQSID
CAPSD_NCBVS/1-608.....SQGNQGRNNNNKRRRRRRGLKLPPVVAPITSPGQMAEPANHANT-RVNR--------GRTRV.RGLRQ.AMMESP
CAPSD_HASV/2-647...VSANTVTVNGRRNQRR..RTGRQVSPPDNFTAAAQDLAQSLDANTV-TFPA--------NISSM.PEFRNWAKGKID

PF01829

CAPSD_NODAM/42-399----------MAATNNMLKMSAPGLDFLK--CAFASPDFSTDPGKGIPD-KFQG--------LVLPKKHCLTQ----SIT

PF08435

Q91H09_9CALI/305-535----------LTNLDGSPIDPTDDTP-----GPLGCPDFTGLLYGVASQ.RGPG........DATRAHEARIDTGSDTFA
Q8JMP1_9CALI/305-540----------LTYPNGASYDPTDEVP-----APLGTQDFSGMLYGVLTQ.DNVNV....STGEAKNAKGIYISTTSGKFT
Q8B4Z2_9CALI/297-515----------LFQPNQEDFHAGSA.P-----APFGFPDFSECSVTFVVS............SATTVGERTVNARNQQNFT
Q917X1_9CALI/305-538----------ITNLNGTQFDPTDDVP-----APLGVPDFAGEVFGVLSQ.RNRGE.....SNPANRAHDAVVATYSDKYT
Q9IV43_9CALI/304-537----------LTELDGSPFLAFEA.P-----APTGFPDLGTSDWHIEMS.LNSNS.....QSSGNPILLRDIQPNSSDFV
Q8VA02_9CALI/306-539----------LTELDGSPYHAFES.P-----APVGFPDLGECDWHMEAS.PTTQ.......FNTGDVIKQINVKQESAFA
Q9IV49_9CALI/306-538----------ITNTDGTPIDPTEDTP-----GPIGSPDFQGILFGVASQ.RNKNE.....QNPATRAQEVNINTGGDQYA
Q6EAX3_9CALI/306-538----------LTNLNGTPFDPTEDVP-----APLGTPDFTGLLFGVASQ.RNVGS.....NPNTTRAHEAVVSTTSSQFV
Q8BAC6_9CALI/304-534----------LTNLDGSPIDPTDDMP-----APLGTPDFQAMLYGVASQ.RSSR.......DNATRAHDAQIDTAGDTFA
Q6WQW7_9CALI/296-512----------LLEPDESAFVVGER.P-----ATLGFPDFSQCVLNLLLA............DGTGVWHQTLDVKNQQHFT
Q6B7R3_9CALI/303-535----------LVHPNGATYDPTEDVP-----APFGTQDFRGILYGVLTQ.NPRAS.....GDEAANSQGVYISSTSEKFT
Q6EAW7_9CALI/305-538----------VSNLNGTPFDPTDDVP-----APLGMPDFSGQIFGVVSQ.RDTG......TNPANRAHDAVLATYSAKYT
Q66418_9CALI/306-538----------LTELDGSAYHAFES.P-----APIGFPDIGDCDWHMSAT.ATNN.......FTGSSNEYQILIKQESAFA
Q80FL2_9CALI/317-546----------LDNLNGTPYDPAEDXP-----GPLGTPDFQGIVFGVASQ.RNSD........GTTRAHEAKVDTRTGRFT
Q9IV42_9CALI/305-535----------LSEVDGTPFIPLES.P-----APVGFPDLGSCDWHVNFTFQAQN.........QDPSQSVTFATNDASFV
Q6XDL5_9CALI/307-546----------VTNLNGTPFDPTEDVP-----APLGTPDFSGQIYGVISQ.RNTNTVPGEGNLPANRAHEAVIATYSPKFT
Q6B7R2_9CALI/304-538----------LSELDGSPYHAFES.P-----APVGFPDLGHCDWHVSSF.KADQ.......NSSGDPISRLDIKQGASFA
Q917X4_9CALI/305-533----------VTNANGTPFDPTEDAP-----APLGTPDFLANIYGVTSQ.RNPD........NTCRAHDGILATWSPKFT
Q783W9_9CALI/306-535----------LENLDGSPVDPTDEVP-----APLGTPDFQAQLFGVISQ.RSSD........NATRAHEARVNTNDPTFA
Q80J94_9CALI/309-538----------LIEQDGSAYVPGDR.A-----APLGYPDFSGQL.EIEVQ.TETTKT..GDKLKVTTFEMILGPTTNADQA
Q913B6_9CALI/305-540----------ITNLNGSPFDPSEDIP-----APLGVPDFQGRVFGVISQ.RDKQNAA.GHSEPANRGHDAVVPTYTAQYT
Q8JW44_9CALI/304-539----------LTEVDGKPFMAFDS.P-----APVGFPDFGKCDWHMRIS.KTPNN.....TSSGDPMRSVSVQTNVQGFV
Q83876_9CALI/301-524----------LTELDGTPFHPFEG.P-----APIGFPDLGGCDWHINMT...........QFGHSSQTQYDVDTTPDTSV
Q9IV48_9CALI/306-533----------LTELDGTPYHAFES.P-----APLGFPDIGACDWHVFNF.QSGS.......NSFEGSHVQVRYKAKCPIC
Q8V713_9CALI/316-545----------LENLDGSPYDPTDDIP-----AVLGSPDFQGVMFGILSQ.RNTD........GQTRAHEAKVDTRAARFA
Q91I85_9CALI/304-538----------LTELDGSPFMAFAA.P-----APAGFPDLGSCDWHIEMS.KIPNS.....STQSNPIVVNSVKPNSQQFV
Q8JXJ0_9CALI/304-537----------LTELDGSPFLAFEA.P-----APAGFPDLGKCDWHVEMSLYQDN.......NHADPIVLHAIEPNSSSFV
Q783X1_9CALI/315-545----------LKNLDGTPYDPTDEVP-----AVLGAIDFKGTVFGVASQ.RNTTG....SSVGATRAHEVHIDTTNPRYT
Q783Y0_9CALI/305-533----------VTNINGTPFDPTEDVP-----APLGTPDFSGKLFGVLSQ.RDHD........NACRSHDAVIATNSAKFT

PF02226

POLG_HRV8A/2-69----------------------------------GAQVSRQNVGTHSTQNSVSN--------------------------
POLG_POL1M/2-69----------------------------------GAQVSSQKVGAHENSNRAYG--------------------------

PF11492

Q7T7T5_HARNA/2003-2059------------------------------GDEYETAKTSPLSISGTLT-------------TVANVAAAASS------L
POLS_CRPVC/291-340------------------------------LETNNSPSTALGQISEGLT-------------T.......LSH------I
Q2HWK2_RSET1/357-413------------------------------SQSGKQDEYGEGVLSKPAS-------------AVARLAGRLKD------V
POLS_ABPVR/340-396------------------------------....KTENPKIGPISELAT-------------GVNKVANGIER------I

PF08935

Q9WJ28_PTV1F/119-191----------------------------------GTGTSRMENGNTNNS-------------------------------
Q9DLK1_FMDVP/202-285----------------------------------GAGQSSPTTGSQNQS-------------------------------

PF01766

POLS_IBDVU/9-452QQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPG--------FPGSIVGAHYTLQ.SNGN
POLS_DXV96/2-442NTTNEYLKTLLNPAQFISDIPDDIMIRHVNSAQTITYNLKSGASGTGLIVVYPN--------TPSSISGFHYIWDSATSN
POLS_BSNV/7-428NTQIRYLNSLLVPETGSTSIPDDTLDRHCLKTETTTENLVAALGGSGLIVLFPN--------SPSGLLGAHYTKT.PQGS
POLS_IPNVJ/5-453KATATYLRSIMLPENGPASIPDDITERHILKQETSSYNLEVSESGSGLLVCFPG--------APGSRVGAHYRWNLNQTA

PF02248

Q66170_CPMVS/720-899----------------------------------CAEASD--VYSPC----------------MIASTPPAP...FSDVT
Q9YWJ9_9SECO/828-1009----------------------------------MVQQLG--TYNPI----------------WMVRTPLES.TAQQNFA
POL2_CPMVS/837-1016----------------------------------CAEASD--VYSPC----------------MIASTPPAP...FSDVT
POL2_BPMV/821-1004----------------------------------SISQQT--VWNQM----------------ATVRTPLNFDSSKQSFC
POL2_CPSMV/808-988----------------------------------SGQTQQ--VWNKI----------------WRIGTPP...QATDGLF
POL2_RCMV/786-964----------------------------------VRTTDG--VYSTC----------------FRVRTPLA....LKDSG
Q66179_APMV/2-185----------------------------------CSPCIN--VWSEF----------------CALDIPVVD.TTKVNFA
POL2_APMV/802-985----------------------------------CSPCIN--VWSEF----------------CALDIPVVD.TTKVNFA
POL2_SQMVM/622-803----------------------------------MVQQLG--TYNPI----------------WMVRTPLES.TAQQNFA
Q9YWK0_9SECO/739-920----------------------------------MVQQLG--TYNPI----------------WMVRTPLES.TAPQNFA

PF03688

A5H0K4_GFLV/264-422----------------------------------SFEDDYF.VWVDF..-------------.SEFTLDK....EEIEIG
POL2_BRSV/1176-1338----------------------------------INYKQRF.AWCLLEC-------------LDNSKASP....IKVKIP
Q86631_9SECO/418-544----------------------------------IATRLQF.LWASF..-------------.SGFAPVVPEAPRTWMIP
POL2_ARMV/344-502----------------------------------SFPNDYF.LWVDF..-------------.SSFTVDV....EEYVIG
Q88483_9SECO/1172-1336----------------------------------INYNQHF.AWFMLEH-------------LDTNTTGA....VSLKIP
A2ID55_9SECO/610-780----------------------------------MYQTMEF.SWVTL..-------------.SAFLQGT....ATILLP
Q80JS8_BRAV/347-511----------------------------------IGLIREF.NWATI..-------------.NNFKSDD....IAFAIP
A0A9J6_ARMV/960-1118----------------------------------AFPNDFF.LWVDF..-------------.SAFTIDQ....EEFVVG
CAPSD_TRSV/351-511----------------------------------FSSSELY.NWFTL..-------------.TNLKPDANTGVVNFDIP
POL2_GCMV/1150-1316----------------------------------INYDQRF.AWFTLLR-------------PPDPKLSK...ILKLTLP
Q6XPY1_9SECO/164-322----------------------------------INYKQAF.GWFTL.V-------------RRSTTNKE....IALKIP
Q6XFY6_9SECO/157-316----------------------------------TFPNDYF.LWVDF..-------------.SAFTVDE....EEYVIG
Q9IV56_9SECO/980-1138----------------------------------LVAEIGS.LWCRV..-------------.TSFLKED....VDIPIR
Q65624_9SECO/386-551----------------------------------IGNVLLF.NWATI..-------------.SEMTNLT.....RFQIP
POL2_CNSV/1022-1185----------------------------------INFTQRF.GWFAV..-------------EPTTSTGA....IKLKIW
Q64959_9SECO/338-502----------------------------------INYKQRF.GWFMI.S-------------PSDKTTTE....LDFKIP
Q20LA0_9SECO/942-1102----------------------------------SEKGQMH.AWFRV..-------------.HNILVDN....LSFNIP
A3FEN2_9SECO/348-507----------------------------------IAGEQQF.NWCSF..-------------.RNFKIDD....WRFEWP
Q9ELS0_9SECO/148-312----------------------------------LQYSEMSCNWAEI..-------------.SAIVGTG....QTIIVP
Q9QAH0_9SECO/350-510----------------------------------GDRSVGS.AWFRI..-------------.NNIADDN....LVFNIP
Q24M89_9SECO/943-1103----------------------------------PERGQMH.AWFRM..-------------.NNIQVDN....LSFSIP

PF08462

Q5ZF43_CARMV/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP
Q999Y9_CARMV/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP
Q4JGW6_CARMV/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP
Q8JJU7_CARMV/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP
CAPSD_CARMS/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP
Q999Z1_CARMV/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP
CAPSD_CARMV/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP
Q7TG55_CARMV/250-348----------------------------------QASN-------------------------DKVSDGP-----TYVVP

PF02443

Q5Y4T0_PCV2/5-226IGYTVK..------------------------------------.ATTVRTPSWNVDMMRFNINDFLPPG..........
Q27W03_PCV1/5-227FVLTIK..------------------------------------..GGYSQPSWNVNYLKFNIGQFLPPS..........
A3FEQ4_9CIRC/3-256TVFGFFGS------------------------------------GTGPTATGRWQSLSLEDGAQYTDPPAQGNNICGLNM
Q3HUU1_GOCV/5-247ISFTFF..------------------------------------GTGSPEKNKWQAMSLEAVQSSGTSPKP.....GINL
Q1L2D2_9CIRC/1-237VKVTLQ.K------------------------------------DEG..GSFKYGTDVFTFTLEDVLNPT..........
CAPSD_CACV/7-243FGQVLQ.K------------------------------------GTGG.SQLSFGTDGINIILDDFL.DW..........
Q0H9S8_9CIRC/4-236YRQECA..------------------------------------GSGD.TTLKWATDGLNIMLDDFL.DW..........
Q06J73_9CIRC/8-245YQQILG.K------------------------------------AENA.GAFRFGTDGVTIILKDFF.PE..........
Q9DXG3_BFDV/11-242FQFKIN.K------------------------------------QTTSVGNLIFNADYITFALDDFL.QA..........
Q69EZ5_BFDV/7-239FKFQIE.K------------------------------------QTTATATMTWKSDYITFALSDFL.GN..........
Q9DXG0_BFDV/11-242FKFEIR.K------------------------------------QTTQPGNLIWNADYVTFTLENFL.TN..........
Q9DXF4_BFDV/3-235FKFDIN.K------------------------------------QTTQTGQIIWNSDYVTFALSDFL.TA..........

PF02956

A7VLZ2_9VIRU/1-506GIHTLGVE...GTQYRCYTANKYEYTIA....K.........QPSGGGFGVERYTLEYLYKEHKAGNNVW---------T
Q9WT88_9VIRU/1-603LPIIICGE...PRAAFNYGYHMEDYTPQ....P.........FPFGGGMSTVTFSLKALYDQYLKHQNRW---------T
Q91CY9_9VIRU/1-581IALVVCGH...TRAGCNYAIHSEDYIPQ....L.........RPYGGSFSTTTWSLKLLFDEYLKFRNKW---------S
A7VLY0_9VIRU/1-515GCLVAGAQ...GRQPFCYTNSKYEYPQP....K.........APGGGGFGAELFTLQYLYDEWVARRNIW---------T
Q9JGT1_9VIRU/1-585MPLLICGE...NTVARNYATHSDDCYFP....G..........PFGGGMTTDKFTLRILYDEYKRFMNYW---------T
Q80QT8_9VIRU/1-595LPMILAGA...GRFAFNYGLHSDDITVQKPLNQ.........NPHGGGMSTVTFSLQVLYDQHQRFLNQW---------S
CAPSD_TTVB1/1-533LCLLTCGR...GNINHNYILTSESYVPT....S.........EPGGGSWSILQMTTRVLYDEYKAARNWW---------T
A7VM00_9VIRU/1-509GQIVLGAE...GTQFRCFTVYKNEFTNP....K.........VATGGGFGVELFSLKYLYQEYLARNNIW---------T
Q9JG61_9VIRU/1-534LCLLTCGI...GRINNNFTLTAESYVPI....S.........EPGGGGWSIMQITLRALYDEYEHYRNWW---------T
Q91PS3_9VIRU/1-581LPLLICGTGTTGTTYRNYGSHMHDYRKY....D..........PFGGGISTMQFNLSILFDEYMKHRCTW---------S
CAPSD_TTVV4/1-560YPLIICGE...GTTVRNYNVHSQDYVQY....E..........SYGGGMTTTMFNLKVPYEQFQLHQNFW---------T
Q91C93_9VIRU/1-546YPLFQSTR...DRLSNNMITYLESIAPH....Y.........VPGGGGFSISCFSLNTLYKEHLKLHNWW---------T
Q2F827_9VIRU/1-589VPLVLCGH...TQGGRNFALRSDDYPKQ....G.........SPYGGSFSTTTWNLRVLFDEHQKHHNTW---------S
Q91CY5_9VIRU/1-584VPMVICGH...TRAGRNFAIHSEDFTSQ....I.........KPHGGSFSTTTWSLKVCWDEHQKFMNRW---------S
Q8V7G9_9VIRU/1-572MPLIICGT...GHTQFNFITHEEDIPGA....G.........ASYGGNLTNITITLGGLYEQYMLHRNHW---------S
Q99A78_9VIRU/1-584MPVLICGN...NTVSRNYATHSDDSYLP....G..........PFGGGMTTDKFTLRILYDEYCRFMNYW---------T
Q6H9C2_9VIRU/1-573LPLIFCGE...NTTAQNFATRSDDMISK....G..........PYGGGMTTTKFTLRILYDEFTRFMNFW---------T
CAPSD_TTVT1/1-433TWLCAARADRMSWPGIKQIAATDSTRYW....S.........TILVGGCGVLTLSMDWFFFENLRWRNRW---------S
Q9JG80_9VIRU/1-589LPIVFCGH...TKGNKNYALHSDDYTPQ....G.........QAFGGALSTTSFSLKVLFDQHQRGLNKW---------S
A7VLZ6_9VIRU/1-506SALVVGAE...GKQMFCYTTNKNIAVPP....K.........SPYGGGFGVEQYSLNYLYEEYTFHNNYW---------T
Q6H9D2_9VIRU/1-557LALVLCGN...GTFSKNYASHSDDYVQK....G..........PFGGGLSSMRFNMRILYDQFKRHLNFW---------T
Q6H999_9VIRU/1-471...........................................PFGGGHSTMRFSLYILFEERLRHMNFW---------T
Q77JT5_9VIRU/1-606DPLIICGI...NRTIFNYTTHSEDFTFN....N.........DSFGGGLCTAQYTLRILFQEKLAQHNFW---------S
Q91PS7_9VIRU/1-585IPLLICGTGTTGTTYKNYGSHAADYKKY....D..........PFGGGYSTMQFTLETLFDEWVKHRCTW---------S
CAPSD_TTVV9/1-555IPVVVMGK...GKTQNNFGQWEQTVPLE....G.........ESYGGSFTIRKFTLQTLYEDYLKLRNRW---------S
Q9JG47_9VIRU/1-553YPLAISTK...DRLSNNLNLYLESIAPH....Y.........LHGGGGFTICNFSLMTLYQENLVCRNWW---------T
A7VLW0_9VIRU/1-507GTIVLGAE...GTQYRCYTDYLDEWTNP....K.........VPGGGGFGCELFTLRYLYKMYLARKNIW---------T
Q0ZLH9_9VIRU/1-573LPVIYCGTGDIGTTFQNFGSHMNEYKQY....N..........AAGGGFSTMLFTMQNLYEEYQKHRCRW---------S
Q5ENW7_9VIRU/1-501WPILQCLK...GQEALRYRPLQWDTERQWRVRSDFEDQYGYLVQYGGGWGSGDVTLEGLYQEHLLWRNSW---------S
A7VLX2_9VIRU/1-509GCLVLGAE...GRQFYCWTNEASNYPQP....K.........APGGGGFGCEVITLEYLYQQYKAHNCIF---------T
Q80AR5_9VIRU/1-594IPLIMCGA...NTASFNYGMHSDDSTPQ....P.........EKFGGGMSTVTFSLFVLYDQYTRHLNRW---------S
Q91CZ2_9VIRU/1-601FPILICGH...GKSAGNYAIHSDDFITS....R.........FSFGGGLSTTSYSLKLLFDQNLRGLNRW---------T
CAPSD_TTVG1/1-514DSIIWGAE...GTQFQCSTHEMYEYTRQ....K.........YPGGGGFGVQLYSLEYLYDQWKLRNNIW---------T
Q98Y63_9VIRU/1-581INLVMCGH...TQAGRNYAIRSEDFYPQ....I.........QSFGGSFSTTTWSLRVLFDEYQKFHNFW---------T
Q9QU36_9VIRU/1-529YPAFLCND...QRIGNNAIQYLDSIAPH....H.........FPGGGGFGIIQFTLQGLYEQFIKATNWW---------T
A7VM12_9VIRU/1-509GTLVVGAE...GTQMFCYTRDKFKYIPP....K.........TPYGGGFGAEKFTLSYLYEEYTFHNNVW---------T
A7VLV6_9VIRU/1-508GCLVLGSQ...GTQYLCYTNEAANYVPP....K.........SPGGGGFGCEYITLEYLYKQWKAHNCIW---------T
Q9JG50_9VIRU/1-535IPLIQGGK...DRQGFNYAQYQDSYIPS....H.........KGGGGTWSIMVFSLGALYEEWERLNNVW---------T
A7VLW4_9VIRU/1-507EPQLLGAE...GSQIDCFTVVKTDYVPA....K.........LPWGGGFSLQNYTLKYLYSEYTYHNNIW---------T
A7VM04_9VIRU/1-513TTLVLGAE...GKQLVCYTNVKTANTPA....K.........APGGGGFGCEQFSLDSLYADYKLRKNVW---------T
A7VLY4_9VIRU/1-498SVIVLGGE...GKQFQCYTNEATTWTPL....R.........TPGGGGFGVEKYTLSHLYDQYKFGNNIW---------T
CAPSD_TTVD1/1-324VPIAMTRI...QLISQPFTV...DTLSP....F.........HVYPGGYGYGVFTLEAMYKEHLMKRNRW---------S
Q91CZ6_9VIRU/1-596LPMVICGH...GMSANNYAIRSDDTETM....K.........FSFGGGFSTTTFTLKVLYDQHLRGMNKW---------S
A7VM08_9VIRU/1-506GTLIMGAQ...GRQYMCYTNVKDRLTPS....R.........APAGGGFGVERFTLEYLYRQWKARNNIW---------T
CAPSD_TTVV3/1-573MPLIICGE...NTFSHNYATHSDDMLST....G..........PYGGGMTTTKFTLRILFDEYQRHLNFW---------T
Q91D00_9VIRU/1-593IPLTMCGA...NTASFNYGMHSDDSTPQ....P.........EKFGGGMSTVTFSLYVLYDQFTRHMNRW---------S
Q99AR5_9VIRU/1-604LPLILCGE...NRAAFNYAYHSEDYTEQ....P.........FPFGGGMSTTTFSLRGLYDQYTKHMNRW---------T
Q9DTD2_9VIRU/1-559LPLIMCGE...NCFSKNFATHSDDIDCS....V..........AYGGGMTATQFTLRILYDEFQRHLNYW---------T
Q91D04_9VIRU/1-591APLIICGH...TMAGNNFAIRMEDYVSQ....I.........RPFGGSFSTTTWSLKVLWDEHTRFHNTW---------S
CAPSD_TTVV8/1-571MPLIICGE...NLTSKNYASHADDFVKD....G..........PFGGGMTTMQFSLRILYDEFLRFLNIW---------T
Q5ENX0_9VIRU/1-603MPVIWAGM...GSGGKNYAVRSDDYTQS...............SFGGSFGTETFSLRVLFDQYQRGFNKW---------S
O90364_9VIRU/1-590IPVLICGE...NTVSRNYATHSDDTNYP....G..........PFGGGMTTDKFTLRILYDEYKRFMNYW---------T
Q9IFV0_9VIRU/1-583VPLLICGTGTTGTTYKNYGSHINDYTKF....D..........PFGGGFSTLMFNLRILFDEYKKQRCRW---------S
Q9QUE7_9VIRU/1-586MPVIMCGE...NTLIRNYATHADDCYWP....G..........PFGGGMATQKFTPRILYDDYKRFMNYW---------T
A8DMR2_9VIRU/1-531YPLFEGTS...ERIGNNNTQSIDTIAPY....L.........FPSGGLFSITVFTLKGLYELHLKARNWW---------S
Q9DUH8_9VIRU/1-609FPILWCGS...GAAGKNYALHMDDYTPS..............GGFGGSFSLTTFNLRALYDEHMKGRNRW---------S
A7VLW8_9VIRU/1-511LDILMGAD...GNQYQCYTQNRYSMPPP....K.........HPCGGGFSVDRFTLQWLYDQWRLRQNIW---------T
Q99AQ3_9VIRU/1-582LPLLICGH...TRSAFNYAIHSDDKTPQ....Q.........QSFGGGLSTVSFSLKVLFDPNQRGLNRW---------S

PF00729

CAPSD_PNLV/47-266SLVIE...........AV--------KVGIEYQV------------------------SVVPLVP..CIQ----------
CAPSD_MCMVK/23-222EILLAVSATTA.DQILEI--------PVCAGIDF------------------------PA.GTSPRYIGA----------
CAPSD_PMVK/39-236EIILQVNSSTAADTIQTI--------PIIPRLSV------------------------PA.GDKPIYSGS----------
CAPSD_RCNMV/24-213QLVMSVVGSVQ......M--------RTNNGKSN------------------------QRFRLNPSNPAL----------
CAPSD_CARMS/51-245ELLCTVKGTTGVIP....--------......SF------------------------EDWVVSPRNVAV----------
CAPSD_SBMVA/46-262ELSTE............L--------SVTNAIVI------------------------TSELVMP..YTM----------
CAPSD_TBSVC/76-269EYLSQVNNSTG......F--------QVNGGIVG------------------------NLLQLNPLNGTL----------
CAPSD_POLVP/66-257ELLGQFNNSSG......L--------VVNGGVSG------------------------NLYRINPSNPVV----------
CAPSD_OCSVU/111-308EMLGAINSGTPSSNVTAF--------RCTG....------------------------..YRANPGMSTI----------
CAPSD_TNVA/61-272EILNN.......QILAAL--------GAFNTTNS------------------------ALIAAAP.....----------

PF11729

CAPSD_SJNNV/1-340STITGFGRATNDVHISGMSRIAQAVVPAGTGTDG------------------------KIVVDSTIVPEL----------

PF00894

CAPSD_PLRV1/70-207NLVGNTQGS---------------------------------------------------FTFGPSLSDC----------
CAPSD_PEMVW/53-187PFNGNATGT---------------------------------------------------VKFGPS.SDC----------
CAPSD_BYDVP/62-199NLKANSSGA---------------------------------------------------IKFGPSLSQC----------

PF03014

CAPSD_HEVCH/41-659PAAASRRRPTTAGAAPLTAVAPAHDTPPVPDVDSRGAILRRQYNLSTSPLTSSVATGTNLVLYAAPLSPL----------

PF03115

CAPSD_HASV1/1-416RVRNIVNKQLRKQGVTGPKPAICQRATATLGTVG--------SNTSGTTEIEACILLNPVLVKDATGSTQ----------

PF00983

COAT_TYMV/8-177PFQSE---------------------VLFAGTKD---------------------------AEASLTIAN----------

PF00073

Q9WMA0_9PICO/49-215LTTHA------------------------------------------LFHEVAKLDVVKLLY......NE----------
POLG_AEVCA/45-212NSTQS------------------------------------------EWQLLGKIDIVKELL......DQ----------
POLG_CXA9/93-300EKGSV------------------------------------------GW.......WWKFPEAL....SD----------
POLG_CXB3N/93-302QKTSP------------------------------------------GW.......WWKLPDAL....SN----------
POLG_CXB4J/93-300EMQSA------------------------------------------GW.......WWKFPDAL....SE----------
POLG_CXA21/93-308KTTSR------------------------------------------GW.......WWKLPDCL....KD----------
POLG_POL1M/93-308TKESR------------------------------------------GW.......WWKLPDAL....RD----------
POLG_POL3L/93-307GKESK------------------------------------------GW.......WWKLPDAL....RD----------
POLG_HE701/93-288ESNST------------------------------------------GW.......WWKLPDAL....NQ----------
POLG_BOVEV/93-285QADSK------------------------------------------GW.......YWKLPDAL....NN----------
POLG_HRV14/93-299TTGSK------------------------------------------GW.......CWKLPDAL....KD----------
POLG_HRV2/93-302SSSSK------------------------------------------GW.......WWKLPDAL....KD----------
POLG_HRV8A/93-302TSASS------------------------------------------GW.......WWKLPDAL....KN----------
POLG_HRV1B/93-301NGDSK------------------------------------------GW.......WWKLPDAL....KE----------
POLG_FMDV1/311-475TTDKP------------------------------------------FGY......LTKLELPT....DH----------
POLG_FMDVT/311-475VPSQN------------------------------------------FGH......MHKVVLPH....EP----------
POLG_FMDVO/311-475VTSDS------------------------------------------FGRCH....LLELPT......DH----------
POLG_EMCV/161-359SRLMI------------------------------------------GHQHKSPLSTSAFPFLTSCP.VK----------
POLG_TMEVB/172-382TTSQE------------------------------------------AFS......HIRIPLPHVLAGED----------
POLG_ENMGO/162-361TSTQK------------------------------------------PFE......YIRIPLPHVLSGED----------
POLG_FMDVO/533-691DRVLA------------------------------------------QF.......DMSLAAKQ....MS----------
POLG_FMDV1/533-692TRLLA------------------------------------------KF.......DVSLAAKH....MS----------
POLG_EMCV/420-582AVKTQ------------------------------------------PLA......TYQVTLSCSC..LA----------
POLG_TMEVB/443-606VPATS------------------------------------------MV.......DYQVALSCSC..MA----------
POLG_HE701/347-515SDMDQ------------------------------------------LLF......NIPLDIQLEGP.LR----------
POLG_HRV2/358-522INAPD------------------------------------------KIF......SIRTDV.ASQP.LA----------
POLG_HRV8A/364-529VDLAK------------------------------------------EVF......SIPVDI.ASQP.LA----------
POLG_HRV1B/360-525MDMAQ------------------------------------------EVF......AIKVDI.TSQP.LA----------
POLG_BOVEV/345-515DALDA------------------------------------------QIY......ALRLELGGSGP.LS----------
POLG_CXA21/369-534LSKAP------------------------------------------IF.......CLSLSPASDKR.LS----------
POLG_CXA9/358-524APLQQ------------------------------------------QVF......GLRLQPGLDSV.FK----------
POLG_CXB4J/358-524DEMGG------------------------------------------QIF......GFPLQPGASSV.LQ----------
POLG_CXB3N/360-526EGSGT------------------------------------------QVF......GFPLQPGYSSV.FS----------
POLG_CXB1J/360-526SDNRR------------------------------------------QVF......GFPLQPGANNV.LN----------
POLG_FMDVO/725-872TPQNQ------------------------------------------INI......LDLMQI......PS----------
POLG_FMDV1/726-878NSLSP------------------------------------------THV......IDLMQT......HK----------
POLG_BOVEV/610-775IT...------------------------------------------.........NWRIDF......RE----------
POLG_HRV8A/621-792DKIGK------------------------------------------GFK......TWKVSL......QE----------
POLG_HRV2/614-772T....------------------------------------------.........VWAINL......QE----------
POLG_HRV1B/627-786NGVNK------------------------------------------NFT......TWKITL......QE----------
POLG_HE701/609-781SSIQK------------------------------------------NFF......IWTLNT......RE----------
POLG_HRV14/614-787HREAK------------------------------------------LFN......DWKINL......SS----------
POLG_CXA9/612-783KHVNK------------------------------------------KFV......AWPINT......KQ----------
POLG_CXB4J/612-783SNNLK------------------------------------------RYA......EWVINT......RQ----------
POLG_SVDVU/612-782DSDGD------------------------------------------NFA......YWVINT......RQ----------
POLG_CXB3N/630-782.SGAK------------------------------------------RYA......EWVLTP......RQ----------
POLG_POL1M/636-806TTNKD------------------------------------------KLFA.....VWKITY......KD----------
POLG_CXA21/642-812SGEEK------------------------------------------KHFN.....IWNITY......TD----------
POLG_CXA24/646-809ADKKK------------------------------------------QFT......TWAITY......TD----------

PF00915

CAPSD_VESVA/137-421STVES------------------------------------------Q...GKVLYSQALNP------SI----------
POLG_RHDVF/1768-2065SVADA------------------------------------------P...GSILYTVQHSP------QN----------
CAPSD_FCVUR/112-395STSET------------------------------------------Q...GKILFKQSLGP------LL----------
CAPSD_NVN68/2-294FTISP------------------------------------------NNTPGDVLFDLSLGP------HL----------

PF08762

Q8B107_ALPV/599-804SFKTP------------------------------------------KPI.......AAQATM-----VN----------
O56051_9VIRU/590-790EFTQP------------------------------------------FWINTNRLEGVTQEGS-----SD----------
Q56QP7_9VIRU/684-855QILSE------------------------------------------RVY............W-----HY----------
O36967_9VIRU/668-900SVQHP------------------------------------------TPV.........VAPA-----EP----------
Q5UBY1_9VIRU/79-259DVAD.------------------------------------------...............K-----EG----------
Q6ITS9_9VIRU/106-313LIEAP------------------------------------------RLDIAQYVDTETKEAK-----YG----------
Q4JFT2_9VIRU/834-1009LVTLP------------------------------------------GIS.......FGTDNS-----LR----------

PF02247

POL2_SQMVM/246-618PNPCGDAWNFVFLQQTKAH..FAVQCVTGWTTTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRW----------
POL2_CPMVS/460-832PNPCGDSWSAEMISRSRVR..MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRW----------
POL2_BPMV/447-819PNPCSDAWSLEFLKRTGFH..CDIICVTGWTATPMQDVQVTIDWFISSQECVPRTYCVLNPQNPFVLNRW----------
Q9Z006_9SECO/476-846AFFLCRLVEHALFRVFQICSCGGHTDIVQVAERSEVDARISFAIYYEPTITLPKQIATLEHAPAFMFRKE----------
O12663_9SECO/321-691PFSCADWWNMHYLGSFKCAPVVVIQTLSKWLNSPKVDARISFAIYYEPSIVLPKQIATLEHAPAFMFRKE----------
Q9YWK0_9SECO/363-735PNPCSDAWNFVFLQKTKAH..FAVQCVTGWTTTPLTDLALVLTWHIDRNLCVPETLTISSAHASFPINRW----------
POL2_CPSMV/437-806PNPCSDGWSLAFLERTGYH..CVVTCVTGWTGTPLQDTFMTINWHISREACVPKIYTIFDPEPDMMLNRW----------
POL2_RCMV/407-778PNPCGTAWSLEFLRRTKFH..LSVTCVSGWSAQPQTDIAMTMDWYVSNKPCVPCIYNVGTPGQNVWVNRW----------
Q9YWJ9_9SECO/452-824PNPCGDAWNFVFLQQTKAH..FAVQCVTGWTTTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRW----------
Q66170_CPMVS/343-715PNPCGDSWSAEMISRSRVR..MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRW----------

PF03391

CAPSD_TRSV/179-344---------------------------------------------------------------------R----------
POL2_RRVS/768-936---------------------------------------------------------------------E----------
POL2_BRAV/1268-1433---------------------------------------------------------------------W----------
Q65029_ARMV/745-916---------------------------------------------------------------------L----------
POL2_ARMVS/792-963---------------------------------------------------------------------L----------
Q67703_GFLV/166-336---------------------------------------------------------------------L----------
POL2_GFLV/771-941---------------------------------------------------------------------L----------
POL2_BRSV/1007-1170---------------------------------------------------------------------L----------
POL2_GCMV/981-1144---------------------------------------------------------------------I----------
POL2_TORVR/1497-1662---------------------------------------------------------------------W----------
Q88483_9SECO/1003-1166---------------------------------------------------------------------L----------

PF03689

A3FEM9_9SECO/10-101---------------------------------------------------------------------A----------
Q9QAH4_9SECO/9-99---------------------------------------------------------------------L----------
Q09G89_GFLV/608-698---------------------------------------------------------------------L----------
Q9JGK5_SDV/160-249---------------------------------------------------------------------H----------
Q9IV56_9SECO/636-727---------------------------------------------------------------------L----------
A1YYW2_BRAV/156-247---------------------------------------------------------------------L----------
Q65624_9SECO/45-137---------------------------------------------------------------------I----------
Q6JX06_9SECO/849-939---------------------------------------------------------------------F----------
Q20LA0_9SECO/601-691---------------------------------------------------------------------L----------
POL2_BRSV/842-932---------------------------------------------------------------------Y----------
A0A9J8_ARMV/580-670---------------------------------------------------------------------L----------
Q6JX05_9SECO/604-694---------------------------------------------------------------------L----------
Q9Z0D6_SDV/74-163---------------------------------------------------------------------H----------
Q9QRA5_9SECO/10-101---------------------------------------------------------------------A----------
Q86631_9SECO/85-173---------------------------------------------------------------------W----------
POL2_GCMV/815-905---------------------------------------------------------------------F----------
A2ID55_9SECO/270-361---------------------------------------------------------------------L----------
Q64959_9SECO/4-94---------------------------------------------------------------------F----------
Q8B5P7_TRSV/12-103---------------------------------------------------------------------C----------
Q88483_9SECO/838-928---------------------------------------------------------------------F----------
POL2_CNSV/688-778---------------------------------------------------------------------F----------

PF00760

CAPSD_CMVFN/11-215TFVGS-----------------------------------E----RCRPGYTFTSITLKPPKID----------------

PF01318

CAPSD_BMV/2-188LAAGQ-----------------------------------GKA-IKAIAGYSISKWEASSDAIT----------------

PF03566

Q80IX5_PRVFL/54-754PSEGAVGWFYKYMDPAGAVESGKALGEFSKVPDGLLRYSVDAE-QRPIVTIECPTVSESDLPLD----------------
CAPSD_NCBVS/1-608MAATSEAWIHDYLDPDGEYKTS.L..DDGKIPDGAIPQSTCGQ-FRGTVGARYPGLNSTTLPLD----------------
CAPSD_HASV/2-647LDSDSIGWYFKYLDPAGATESARAVGEYSKIPDGLVKFSVDAE-IREIYNEECPVVTDVSVPLD----------------

PF01829

CAPSD_NODAM/42-399FTPGK----------------------QTMLLVAPIPGIACLK-AEANVGASFSGVPLASVEFPGFDQLF----------

PF08435

Q91H09_9CALI/305-535PKIGQ------------------------VRFYSTS.....SD.FETNQPTHFTPIGIYIE-------------------
Q8JMP1_9CALI/305-540PKVGS------------------------IGLHSIT.....EH.VHPNQQSRFTPVGVAVN-------------------
Q8B4Z2_9CALI/297-515PALGH------------------------ITFDEEAP....ADLFRACFRNLWEPT.....-------------------
Q917X1_9CALI/305-538PKLGL------------------------VQIGTWNT....ND..VENQPTKFTPIGLNEV-------------------
Q9IV43_9CALI/304-537PHLGS------------------------VSVTTAIDT..AGD.TLGTIQWTSQPSNVTPV-------------------
Q8VA02_9CALI/306-539PHLGT------------------------IQADGLSDVSVNTN.MIAKLGWVSPVSDGHKG-------------------
Q9IV49_9CALI/306-538PKLAQ------------------------VKFFSES.....QD.FEVHQPTVFTPVGVAGD-------------------
Q6EAX3_9CALI/306-538PKLGS------------------------VNFGSTS.....TD.FQLQQPTKFTPVGIKIE-------------------
Q8BAC6_9CALI/304-534PKIGQ------------------------VRFKSSS.....DD.FDLHDPTKFTPIGVNVD-------------------
Q6WQW7_9CALI/296-512PGIGQ------------------------VTLS........GDVPRVRSRARLDYVSSTSQ-------------------
Q6B7R3_9CALI/303-535PKLGT------------------------IGLHQVQ.....GH.HSQHQQSKFTPLGVAVN-------------------
Q6EAW7_9CALI/305-538PKLGS------------------------VQIGTWDT....ED.LLERQPVKFTPVGLNEI-------------------
Q66418_9CALI/306-538PHLGH------------------------VQADNLSAG.ANTD.LIVSLSWISPVSDQHRH-------------------
Q80FL2_9CALI/317-546PKLGS------------------------LVISTDS.....ED.FQQNKPTRFTPVGVGVD-------------------
Q9IV42_9CALI/305-535PYLGS------------------------ISLTTGETF.HAGD.IIGSLGWISSPRLIIHN-------------------
Q6XDL5_9CALI/307-546PKLGN------------------------IQFSTWET....QD.VSSGQPTKFTPVGLASV-------------------
Q6B7R2_9CALI/304-538PHLGS------------------------IEYTTSQNP..DGG.QLGTLTWISSPSDDTPG-------------------
Q917X4_9CALI/305-533PKLGS------------------------VVLGTWED....RD.FDINQPTRFTPVGLYDT-------------------
Q783W9_9CALI/306-535PQIAQ------------------------VRFKSPS.....ND.FFDNEPIKFTPVGISVD-------------------
Q80J94_9CALI/309-538PYQGR------------------------VFASVTAAA..SLD..LVDGRVRAVPRSIYGF-------------------
Q913B6_9CALI/305-540PKLGQ------------------------IQIGTWQT....DD.LQVNQPVKFTPVGLNDT-------------------
Q8JW44_9CALI/304-539PHLGS------------------------IQFDEVFNH.PTGD.YIGTIEWISQPSTPPGT-------------------
Q83876_9CALI/301-524PHLGS------------------------IQANGIGS....GN.YIGVLSWVSPPSHPSGS-------------------
Q9IV48_9CALI/306-533TXLGS------------------------IEFTSDQDP..AGD.QLGTLAWVSPSTSGA..-------------------
Q8V713_9CALI/316-545PKLGF------------------------VVATVES.....TD.FHANQPSRFTPVGLGGD-------------------
Q91I85_9CALI/304-538PHLSS------------------------ITLDDNVSS..GGD.YIGTIQWTSPPSDSGGA-------------------
Q8JXJ0_9CALI/304-537PHLGS------------------------VSFKENVNV..AGD.YVCTIQYTSPPSDPHNP-------------------
Q783X1_9CALI/315-545PKLGS------------------------VLMYSES.....SD.FDDGQPTRFTPIGMGAD-------------------
Q783Y0_9CALI/305-533PKLGA------------------------IQIGTWEE....DD.VHINQPTKFTPVGLFEN-------------------

PF02226

POLG_HRV8A/2-69---GS---------------------------------------------------------------------------
POLG_POL1M/2-69---GS---------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059PHIGA---------------------------------------------------------------------------
POLS_CRPVC/291-340PVLGN---------------------------------------------------------------------------
Q2HWK2_RSET1/357-413PIIGT---------------------------------------------------------------------------
POLS_ABPVR/340-396PVIGE---------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191---GN---------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285---GN---------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452YKFDQ----------------------MLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAV----------
POLS_DXV96/2-442WVFDQ----------------------YIYTAQELKDSYDYGRLISGSLSIKSSTLPAGVYALNGTFNAV----------
POLS_BSNV/7-428LIFDK----------------------AITTSQDLKKAYNYARLVSRIVQVRSSTLPAGVYALNGTFNGV----------
POLS_IPNVJ/5-453LEFDQ----------------------WLETSQDLKKAFNYGRLISRKYDIQSSTLPAGLYALNGTLNAA----------

PF02248

Q66170_CPMVS/720-899AVTFD---------------------------------------------LINGKITPVGDD.NWNTHIY----------
Q9YWJ9_9SECO/828-1009SFTAD---------------------------------------------LMESTISGDSTG.NWNITVY----------
POL2_CPMVS/837-1016AVTFD---------------------------------------------LINGKITPVGDD.NWNTHIY----------
POL2_BPMV/821-1004QFSVD---------------------------------------------LLGGGISVDKTG.DWITLVQ----------
POL2_CPSMV/808-988SFSID---------------------------------------------LLGVELVTDGQE.GAVSVLS----------
POL2_RCMV/786-964SFTCD---------------------------------------------LIGGGITTDSNT.GWNLTAL----------
Q66179_APMV/2-185QYSLD---------------------------------------------LVNPTVSANASGRNWRFVLI----------
POL2_APMV/802-985QYSLD---------------------------------------------LVNPTVSANASGRNWRFVLI----------
POL2_SQMVM/622-803SFTAD---------------------------------------------LMESTISGDSTG.NWNITVY----------
Q9YWK0_9SECO/739-920SFTAD---------------------------------------------LMESTVSGDSTG.NWSITAY----------

PF03688

A5H0K4_GFLV/264-422SRFFD---------------------------------------------FT........SS-TCRVAMG----------
POL2_BRSV/1176-1338SRIGN---------------------------------------------LS........SK-HVKVTNF----------
Q86631_9SECO/418-544CRLSD---------------------------------------------YK........VE-GATLKME----------
POL2_ARMV/344-502SRFFD---------------------------------------------IS........ST-TSTVALG----------
Q88483_9SECO/1172-1336ARMAN---------------------------------------------LT........SK-EVQVTNF----------
A2ID55_9SECO/610-780SRPAT---------------------------------------------ITRFGESSAENR-NFTATIN----------
Q80JS8_BRAV/347-511ARLSD---------------------------------------------LV........LT-CGEVTMS----------
A0A9J6_ARMV/960-1118SRFFD---------------------------------------------FT........ST-TCTVALG----------
CAPSD_TRSV/351-511GYIHD---------------------------------------------FA........SK-DATVTLA----------
POL2_GCMV/1150-1316SRVCN---------------------------------------------IA........YK-EATVTNY----------
Q6XPY1_9SECO/164-322SRIAN---------------------------------------------IE........YK-EAEVINH----------
Q6XFY6_9SECO/157-316SRFFD---------------------------------------------IS........SS-TSTVALG----------
Q9IV56_9SECO/980-1138ARIYD---------------------------------------------IA........AK-DCTLELA----------
Q65624_9SECO/386-551ARLSD---------------------------------------------LV........LP-GQTVTMR----------
POL2_CNSV/1022-1185PVSNH---------------------------------------------LE........SE-DMKVTGY----------
Q64959_9SECO/338-502SRIGN---------------------------------------------IG........VK-NTKCVNF----------
Q20LA0_9SECO/942-1102GRIED---------------------------------------------IR......ALAG-SYDTTNY----------
A3FEN2_9SECO/348-507ARLPD---------------------------------------------IL........DD-KSEVLLR----------
Q9ELS0_9SECO/148-312NHICD---------------------------------------------WK........LS-NATVALK----------
Q9QAH0_9SECO/350-510GRIED---------------------------------------------II......AAAG-EVDVTNY----------
Q24M89_9SECO/943-1103GRIED---------------------------------------------MS......ALAG-SYDITNY----------

PF08462

Q5ZF43_CARMV/250-348SV------------------------------------------------------------------------------
Q999Y9_CARMV/250-348SV------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348SV------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348SV------------------------------------------------------------------------------
CAPSD_CARMS/250-348SV------------------------------------------------------------------------------
Q999Z1_CARMV/250-348SV------------------------------------------------------------------------------
CAPSD_CARMV/250-348SV------------------------------------------------------------------------------
Q7TG55_CARMV/250-348SV------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226.........-------...--------.GGSNPLTVPFEYYRI-------------------------------------
Q27W03_PCV1/5-227.........-------...--------.GGTNPLPLPFQYYRI-------------------------------------
A3FEQ4_9CIRC/3-256RWAMFGDTN-------SYM--------QGNKPQYHYPYDYYII-------------------------------------
Q3HUU1_GOCV/5-247RFAVFGDR.-------..L--------PGTGNQYHYPFDYYMI-------------------------------------
Q1L2D2_9CIRC/1-237.........-------...--------..GGDSLKLPFEDYKI-------------------------------------
CAPSD_CACV/7-243.........-------...--------..GTINWRLPFEDYRI-------------------------------------
Q0H9S8_9CIRC/4-236.........-------...--------..GTINWRLPFEDYRI-------------------------------------
Q06J73_9CIRC/8-245.........-------...--------..GK...ELPFEDYRI-------------------------------------
Q9DXG3_BFDV/11-242.........-------...--------..VPNPHTLNFEDYRI-------------------------------------
Q69EZ5_BFDV/7-239.........-------...--------..TTNPQTLNFEHYRI-------------------------------------
Q9DXG0_BFDV/11-242.........-------...--------..TPNPSALNFEDYRI-------------------------------------
Q9DXF4_BFDV/3-235.........-------...--------...PNPTGWPFEDYRI-------------------------------------

PF02956

A7VLZ2_9VIRU/1-506TSNVNLDLV-------RYT--------GCRFIFWRHPHIDFVGVYSRN-----------------------YPMQLQKYT
Q9WT88_9VIRU/1-603FSNDQLDLA-------RYR--------GCKLRFYRSPVCDFIVHYNLI-----------------------PPLKMNQFT
Q91CY9_9VIRU/1-581YPNTELNLA-------RYR--------GATFTFYRDPKVDYIVVYNTV-----------------------PPFKLNKYS
A7VLY0_9VIRU/1-515KTNDYKDLV-------RFT--------GATFYLYKHPTTDFIFNYNNQ-----------------------PPFLLEKDF
Q9JGT1_9VIRU/1-585ASNEDLNLC-------RYL--------GCTLYVFRHPEVDFIIIINTS-----------------------PPFLDTEIT
Q80QT8_9VIRU/1-595YPNDQLDLA-------RYR--------GCSFSFYRHPEVDFIAQFDNV-----------------------PPMKMDELT
CAPSD_TTVB1/1-533KSNSLLPLT-------KYI--------RCKLKFYRSDQTDYIVTIQRT-----------------------GPFEVTLES
A7VM00_9VIRU/1-509STNAYRDFC-------RYT--------GSSFTFFRHPDTDFIIVYDIQ-----------------------PPFTINKHT
Q9JG61_9VIRU/1-534TSNCGLPLV-------KYT--------GCSIKFYNSNDTDYIVTVQRT-----------------------GPFEVDRDS
Q91PS3_9VIRU/1-581KSNVDLELI-------RYR--------GCSFKLYRHEKCDFFFTYSRK-----------------------PPFKDSQLT
CAPSD_TTVV4/1-560RSNIDLDLV-------RYH--------SVKFTFFRHPKVDFIVKFNRN-----------------------PPFTDSVLT
Q91C93_9VIRU/1-546KTNDNYPLI-------RYN--------GCTLKLFKSEKVDYIFYYQRH-----------------------YPMKASALM
Q2F827_9VIRU/1-589YPNNQLDLG-------RYK--------GCTFYFYRDKKTDYIVKFQRR-----------------------GPFKINKYS
Q91CY5_9VIRU/1-584YPNTQLDLA-------RYL--------GVTFYFYRDQKTDYIVQWSRN-----------------------PPFKLNKYS
Q8V7G9_9VIRU/1-572RSNYDLELA-------RYL--------GFTLKCYRHATVDYILTYSRT-----------------------TPFETNELS
Q99A78_9VIRU/1-584ASNEDLDLC-------RYR--------GCTLWFFRHPDVDFIILINTM-----------------------SPFLDTQLT
Q6H9C2_9VIRU/1-573VSNEDLDLC-------RYV--------GCKLIFFKHPTVDFIVQINTQ-----------------------PPFLDTHLT
CAPSD_TTVT1/1-433HSNVGYDLA-------RYM--------GTHLYFPPLADIWYIVWTDTE-----------------------F.VDQPKKV
Q9JG80_9VIRU/1-589FPNDQLDLA-------RYR--------GCKFYFYRTKQTDWIGQYDIS-----------------------EPYKLDKYS
A7VLZ6_9VIRU/1-506KSNILKDLC-------RFL--------WLKIIFFRDNKTDFIVSYDRN-----------------------PPFNLTKFT
Q6H9D2_9VIRU/1-557HTNQDLDLV-------RYR--------GCTMTFYRHPEVDFIVKFNRK-----------------------PPFLDTIVS
Q6H999_9VIRU/1-471RSNDNLELT-------RYL--------GASVKIYRHPDQDFIVIYNRR-----------------------TPLGGNIYT
Q77JT5_9VIRU/1-606ASNEDLDLA-------RYL--------GATIVLYRHPTVDFLVRIRTS-----------------------PPFEDTDMT
Q91PS7_9VIRU/1-585RSNKDLELV-------RYL--------GGSFTLYRHPKCDFIFRYNRK-----------------------PPFKDTQIT
CAPSD_TTVV9/1-555RSNTDLELI-------RYT--------GLNLRLYRHEFSDYIVHYSLE-----------------------TPMEVGLES
Q9JG47_9VIRU/1-553KGNENMPLI-------RYL--------GCEITLYRQAEVDYMVYVHNS-----------------------YPMSANLLT
A7VLW0_9VIRU/1-507FSNKYKDLV-------RYT--------GTRFTFFRHPETDFILAYDIQ-----------------------PPFHITKWT
Q0ZLH9_9VIRU/1-573KSNQDLDLC-------RYL--------DCKLTFYRSPNTDFIVGYNRK-----------------------PPFIDTQIT
Q5ENW7_9VIRU/1-501KGNDGMDLV-------RYF--------GCVVYLYPLKDQDYWFWWDTD-----------------------FKELYAENI
A7VLX2_9VIRU/1-509ASNHYKDPV-------RYT--------GCEIILYRHPYVDFVVTYSNQ-----------------------PPFSINQFT
Q80AR5_9VIRU/1-594YPNDQLDLA-------RYK--------GCKFKFYRDTNTDFIVTYDIN-----------------------PPMKNTELS
Q91CZ2_9VIRU/1-601ASNDQLDLA-------RYL--------GAIFWFYRDQKTDYIVQYDIS-----------------------EPFKIDKDS
CAPSD_TTVG1/1-514KTNQLKDLC-------RYL--------KCVMTFYRHQHIDFVIVYERQ-----------------------PPFEIDKLT
Q98Y63_9VIRU/1-581YPNTQLDLC-------RYK--------YAIFTFYRDPKVDYIVIYNTN-----------------------PPFKINKYS
Q9QU36_9VIRU/1-529QTNCSLPLI-------RYN--------FCKLKFYRTANVDYVVKIIRC-----------------------YPLKATHDL
A7VM12_9VIRU/1-509ATNLYKDLC-------RYL--------YCKIIFFRHPDTDFVINYSRQ-----------------------PPWELSKYT
A7VLV6_9VIRU/1-508ASNNYKDLC-------RYT--------GCTITLFRHKYIDFIFCYSVM-----------------------PPFDINKLT
Q9JG50_9VIRU/1-535KTNNGLPFA-------RYC--------GCRFKFYRQEYYDYIVHYSIC-----------------------YPMTDTEDQ
A7VLW4_9VIRU/1-507SSNNQKDLC-------RYT--------GGYIKLFRHETQDFIISYDLQ-----------------------PPHELSKYT
A7VM04_9VIRU/1-513KSNILLDLC-------RYL--------FVKISFYRHPETDFIVTWHRQ-----------------------PPFDISKEI
A7VLY4_9VIRU/1-498KTNILTDLV-------QYL--------GCKFVFYRHQYVDFIVKYSRN-----------------------LPMTIEKLT
CAPSD_TTVD1/1-324RSNAGFDLG-------RYL--------GTWLTLVPHPYFSYLFYYD..-----------------------PEYGNTFEF
Q91CZ6_9VIRU/1-596TSNDILDLA-------RYL--------GCDFYFYRDKHTDYIVQYDTA-----------------------APFTIDKDS
A7VM08_9VIRU/1-506ATNKNTDLV-------RYL--------GCRFSFYRHPDTDFIVNFSRQ-----------------------PPFNIDKYT
CAPSD_TTVV3/1-573VSNQDLDLA-------RYL--------GTKIIFFRHPTVDFVVQIHTQ-----------------------PPFQDTEIT
Q91D00_9VIRU/1-593YSNDQLDLA-------RYR--------GCSFKLYRNPTTDFIVQYDNN-----------------------PPMKNTILS
Q99AR5_9VIRU/1-604FSNDQLDLA-------RYR--------GCKFRFYRHPTCDFIVHYNLV-----------------------PPLKMNQFT
Q9DTD2_9VIRU/1-559ASNNDLDLA-------RYL--------GATITFFRHPDVDFIVQIHTS-----------------------PPFRDTEMT
Q91D04_9VIRU/1-591YPNTQLDLA-------RFK--------GVNFYFYRDKDTDFIVTYSSV-----------------------PPFKMDKYS
CAPSD_TTVV8/1-571HSNQDLDLA-------RYH--------GFKLTLYRHPTVDFIVIIRNS-----------------------PPFEDTELT
Q5ENX0_9VIRU/1-603HTNKDLDLA-------LYY--------GCRFRFYRHDRTDFIVSFTNN-----------------------PPMKTNQYT
O90364_9VIRU/1-590ASNEDLDLC-------RYL--------GVNLYFFRHPDVDFIIKINTM-----------------------PPFLDTELT
Q9IFV0_9VIRU/1-583RSNDELELV-------RYL--------GCSFTLYREQNVDFLFKYNRR-----------------------QPFSDSQLT
Q9QUE7_9VIRU/1-586SSNEDLDLC-------RYR--------GVTLYFFRHPDVDFIILINTT-----------------------PPFVDTEIT
A8DMR2_9VIRU/1-531ISNCNLPLI-------KYR--------GCKITLYRNVDVDYVTVYTRC-----------------------GSLTATEEL
Q9DUH8_9VIRU/1-609HTNEDLELA-------LYF--------GCRFTFYRHPTTDFIVTFSNT-----------------------PPMMSNQYT
A7VLW8_9VIRU/1-511KPNTYKDLC-------RFI--------VAKITLYRHKTTDFIVQYSRQ-----------------------PPFLIDKWT
Q99AQ3_9VIRU/1-582ASNDQLDLA-------RYT--------GCTFWFYRHKKTDFIVQYDVS-----------------------APFKLDKNS

PF00729

CAPSD_PNLV/47-266-----HTWL-------SGV--------ACYWSKYRWRSCRLVYIPYC------------------------SSSFTGY-V
CAPSD_MCMVK/23-222-----AKWL-------AAQ--------SQMWNTIVFNSVRITWETFT------------------------ADTTSGY-I
CAPSD_PMVK/39-236-----APHL-------RTI--------GSAFAIHRWRALSFEWIPSC------------------------PTTTPGN-L
CAPSD_RCNMV/24-213-----FPTL-------AYE--------AANYDMYRLKKLTLRYVPLV------------------------TVQNSGR-V
CAPSD_CARMS/51-245-----FPQL-------SLL--------ATNFNKYRITALTVKYSPAC------------------------SFETNGR-V
CAPSD_SBMVA/46-262-----GTWL-------RGV--------AANWSKYSLLSVRYTYLPSC------------------------PSTTSGS-I
CAPSD_TBSVC/76-269-----FSWL-------PAI--------ASNFDQYTFNSVVLHYVPLC------------------------STTEVGR-V
CAPSD_POLVP/66-257-----FPWL-------QGI--------AASFDQYKFDRVQLQYVPMC------------------------ATTETGR-V
CAPSD_OCSVU/111-308-----FPWL-------SAT--------AVNYEKYKFRRLSFTLVPLV------------------------STNYSGR-I
CAPSD_TNVA/61-272-----.SWL-------ASI--------ADLYSKYRWLSCEIIYIPKC------------------------PTTTSGS-I

PF11729

CAPSD_SJNNV/1-340-----LPRL-------GHA--------ARIFQRYAVETLEFEIQPMC------------------------PANTGGG-Y

PF00894

CAPSD_PLRV1/70-207-----PAFK-------DGI--------LKAYHEYKITSILLQFVSEA------------------------SSTSSGS-I
CAPSD_PEMVW/53-187-----QCIK-------.GN--------LAAYQKYRIVWLKVVYQSEA------------------------AATDRGC-I
CAPSD_BYDVP/62-199-----PALS-------DGI--------LKSYHRYKITSIRVEFKSHA------------------------SANTAGA-I

PF03014

CAPSD_HEVCH/41-659-----LPLQ-------DGTNTHIMATEASNYAQYRVVRATIRYRPLV------------------------PNAVGGYAI

PF03115

CAPSD_HASV1/1-416-----FGPV-------QAL--------GAQYSMWKLKYLNVKLTSMVG-----------------------ASAVNGTVS

PF00983

COAT_TYMV/8-177-----IDSV-------STL--------TTFYRHASLESLWVTIHPTLQ-----------------------APTFPTT-V

PF00073

Q9WMA0_9PICO/49-215-----QFAV-------QGL--------LRYHTYARFG-IEIQVQIN.P---------------.........TPFQQGGL
POLG_AEVCA/45-212-----SYAV-------DGL--------LKYHSYARFG-LDVIVQIN.P---------------.........TSFQAGGL
POLG_CXA9/93-300-----MGLF-------GQN--------MQYHYLGRAG-YTIHLQCN.A---------------.........SKFHQGCL
POLG_CXB3N/93-302-----LGLF-------GQN--------MQYHYLGRTG-YTVHVQCN.A---------------.........SKFHQGCL
POLG_CXB4J/93-300-----MGLF-------GQN--------MQYHYLGRSG-YTIHVQCN.A---------------.........SKFHQGCL
POLG_CXA21/93-308-----MGMF-------GQN--------MYYHYLGRSG-YTIHVQCN.A---------------.........SKFHQGAL
POLG_POL1M/93-308-----MGLF-------GQN--------MYYHYLGRSG-YTVHVQCN.A---------------.........SKFHQGAL
POLG_POL3L/93-307-----MGLF-------GQN--------MYYHYLGRSG-YTVHVQCN.A---------------.........SKFHQGAL
POLG_HE701/93-288-----IGMF-------GQN--------VQYHYLYRSG-FLCHVQCN.A---------------.........TKFHQGTL
POLG_BOVEV/93-285-----TGMF-------GQN--------AQFHYIYRGG-WAVHVQCN.A---------------.........TKFHQGTL
POLG_HRV14/93-299-----MGVF-------GQN--------MFFHSLGRSG-YTVHVQCN.A---------------.........TKFHSGCL
POLG_HRV2/93-302-----MGIF-------GEN--------MFYHYLGRSG-YTIHVQCN.A---------------.........SKFHQGTL
POLG_HRV8A/93-302-----MGIF-------GEN--------MFYHFLGRSG-YTIHVQCN.S---------------.........SKFHQGLL
POLG_HRV1B/93-301-----MGIF-------GEN--------MYYHFLGRSG-YTVHVQCN.A---------------.........SKFHQGTL
POLG_FMDV1/311-475-----HGVF-------GHL--------VDSYAYMRNG-WDVEVSAV.G---------------.........NQFNGGCL
POLG_FMDVT/311-475-----KGVY-------GGL--------VKSYAYMRNG-WDVEVTAV.G---------------.........NQFNGGCL
POLG_FMDVO/311-475-----KGVY-------GSL--------TDSYAYMRNG-WDVEVTAV.G---------------.........NQFNGGCL
POLG_EMCV/161-359-----MVVS-------LVA--------LRRHYLVKTG-WRVQVQCN.A---------------.........SQFHAGGL
POLG_TMEVB/172-382-----GGVF-------GAT--------LRRHYLCKTG-WRVQVQCN.A---------------.........SQFHAGSL
POLG_ENMGO/162-361-----GGVF-------GAT--------LRRHYLVKTG-WRVQVQCN.A---------------.........SQFHAGSL
POLG_FMDVO/533-691-----NTFL-------AGL--------AQYYTQYSGT-INLHFMFT.G---------------.........PTDAKARY
POLG_FMDV1/533-692-----NTYL-------SGI--------AQYYTQYSGT-INLHFMFT.G---------------.........STDSKARY
POLG_EMCV/420-582-----NTFL-------AAL--------SRNFAQYRGS-LVYTFVFT.G---------------.........TAMMKGKF
POLG_TMEVB/443-606-----NSML-------AAV--------ARNFNQYRGS-LNFLFVFT.G---------------.........AAMVKGKF
POLG_HE701/347-515-----NTLL-------GNI--------SRYYTHWSGS-LEMTFMFC.G---------------.........SFMTTGKL
POLG_HRV2/358-522-----TTLI-------GEI--------SSYFTHWTGS-LRFSFMFC.G---------------.........TANTTVKL
POLG_HRV8A/364-529-----TTLI-------GEL--------ASYYTHWTGS-LRFSFMFC.G---------------.........SASSTLKL
POLG_HRV1B/360-525-----TTLI-------GEI--------ASYYTHWTGS-LRFSFMFC.G---------------.........TANTTLKL
POLG_BOVEV/345-515-----SSLL-------GTL--------AKHYTQWSGS-VEITCMFT.G---------------.........TFMTTGKV
POLG_CXA21/369-534-----HTML-------GEI--------LNYYTHWTGS-IRFTFLFC.G---------------.........SMMATGKL
POLG_CXA9/358-524-----HTLL-------GEI--------LNYYAHWSGS-MKLTFVFC.G---------------.........SAMATGKF
POLG_CXB4J/358-524-----RTLL-------GEI--------LNYYTHWSGS-LKLTFVFC.G---------------.........SAMATGKF
POLG_CXB3N/360-526-----RTLL-------GEI--------LNYYTHWSGS-IKLTFMFC.G---------------.........SAMATGKF
POLG_CXB1J/360-526-----RTLL-------GEI--------LNYYTHWSGS-IKLTFMFC.G---------------.........SAMATGKF
POLG_FMDVO/725-872-----HTLV-------GAL--------LRASTYYFSD-LEIAVKHE.G---------------.................
POLG_FMDV1/726-878-----HGIV-------GAL--------LRAATYYFSD-LEIVVRHD.G---------------.................
POLG_BOVEV/610-775-----FVQL-------RAK--------MSWFTYMRFD-VEFTIIATSS---------------TGQNV....TTEQHTTY
POLG_HRV8A/621-792-----MAQI-------RRK--------YELFTYTRFD-SEITIVTA.A---------------AAQG.....NDSGHIVL
POLG_HRV2/614-772-----MAQI-------RRK--------FELFTYTRFD-SEITLVPC.I---------------SALS.....QDIGHITM
POLG_HRV1B/627-786-----MAQI-------RRK--------FELFTYVRFD-SEVTLVPC.I---------------AGRG.....DDIGHVVM
POLG_HE701/609-781-----LVQI-------RRK--------MELFTYLRFD-TEITIVPTLR---------------LFSSSNVSFSGLPNLTL
POLG_HRV14/614-787-----LVQL-------RKK--------LELFTYVRFD-SEYTILAT.A---------------SQPDSA...NYSSNLVV
POLG_CXA9/612-783-----MVQM-------RRK--------LEMFTYLRFD-MEVTFVIT.S---------------RQDPGTTLAQDMPVLTR
POLG_CXB4J/612-783-----VAQL-------RRK--------MEMFTYIRCD-MELTFVIT.S---------------HQEMSTATNSDVPVQTH
POLG_SVDVU/612-782-----VAQL-------RRK--------LEMFTYARFD-LELTFVIT.S---------------TQEQPTVRGQDAPVLTH
POLG_CXB3N/630-782-----AAQL-------RRK--------LEFFTYVRFD-LELTFVIT.S---------------TQQPSTTQNQDAQILTH
POLG_POL1M/636-806-----TVQL-------RRK--------LEFFTYSRFD-MELTFVVT.A---------------NFTETNN..GHALNQVY
POLG_CXA21/642-812-----TVQL-------RRK--------LEFFTYSRFD-LEMTFVFT.E---------------NYPSTAS..GEVRNQCD
POLG_CXA24/646-809-----TVQL-------RRK--------LEFFTYSRFD-LEMTFVIT.E---------------RYYTSNT..GYARNQVY

PF00915

CAPSD_VESVA/137-421-----NPYL-------DHI--------SKLYSTWSGG-IDVRFTVS-G------------------------SGVFGGKL
POLG_RHDVF/1768-2065-----NPFT-------AVL--------SQMYAGWAGG-MQFRFIVA-G------------------------SGVFGGRL
CAPSD_FCVUR/112-395-----NPYL-------EHL--------SKLYVAWSGS-VEVRFSIS-G------------------------SGVFGGKL
CAPSD_NVN68/2-294-----NPFL-------LHL--------SQMYNGWVGN-MRVRIMLA-G------------------------NAFTAGKI

PF08762

Q8B107_ALPV/599-804-----IDLY.......SYY--------SYIFAYYRGS-FRFKIAPFENKVYAARIR......LIPENGATEANAGPVQED
O56051_9VIRU/590-790-----IDGI.......SWF--------ASLYAFYRGS-MRYKIAPLSNASPLV.........VALKPNSLYSGVRVIDTN
Q56QP7_9VIRU/684-855-----KDYV.......SIL--------SYLYRFSRGG-YRYKFFADDN...................EQGQVMSTLVKNY
O36967_9VIRU/668-900-----MSLF.......EYY--------YFIYGFWRGG-MRFKLQAVRTNSAETSVKTDTTWTVNLWNSVQDSFNSLINVF
Q5UBY1_9VIRU/79-259-----RDYM.......SYL--------SYLYRFYRGG-RRYKFFNTTA...............LKQSQTCYIRSFLTPRY
Q6ITS9_9VIRU/106-313-----FSYFWSAPTTLNIV--------AEMYALYRGG-VRVKVVTEKG............................VDFV
Q4JFT2_9VIRU/834-1009-----QSLV.......NII--------SYMYRFTHGS-ISYKIIPKNKG............................DLY

PF02247

POL2_SQMVM/246-618-----MGKL-------SFP--------QGPARVLKRM-PLAIGGGA-G-----------------------TKDAILMNM
POL2_CPMVS/460-832-----MGKL-------TFP--------QGVTSEVRRM-PLSIGGGA-G-----------------------ATQAFLANM
POL2_BPMV/447-819-----MGKL-------TFP--------QGTSRSVKRM-PLSIGGGA-G-----------------------AKSAILMNM
Q9Z006_9SECO/476-846-----LGTL-------AFK--------QG.ELVAYSF-EVNFGKPQ-T-----------------------DGKEVTSTF
O12663_9SECO/321-691-----LGTL-------AFK--------QG.ERVAYSF-EVNFGKPQ-T-----------------------DGKEVTSTF
Q9YWK0_9SECO/363-735-----MGKL-------SFP--------QGPARVLKRM-PLAIGGGA-G-----------------------TKDAILMNM
POL2_CPSMV/437-806-----MGRA-------IFP--------QQSTQVVRRM-PLSIGGGA-G-----------------------AKNSILMNL
POL2_RCMV/407-778-----MGKL-------SFP--------QGSQNQLKQM-PLAIGGGA-G-----------------------AKNSILMNM
Q9YWJ9_9SECO/452-824-----MGKL-------SFP--------QGPARVLKRM-PLAIGGGA-G-----------------------TKDAILMNM
Q66170_CPMVS/343-715-----MGKL-------TFP--------QGVTSEVRRM-PLSIGGGA-G-----------------------ATQAFLANM

PF03391

CAPSD_TRSV/179-344-----YYEA-------KEI--------KLDGSTSMLS-ISYNFGGPVK-----------------------HSKKHAISY
POL2_RRVS/768-936-----VWGP-------YRF--------TLDGTEAKES-FAIMPGTAIL-----------------------HGQQIVRTF
POL2_BRAV/1268-1433-----RGPY-------TFP--------LGGGTKRLST-SLDIGTSTTT-----------------------VSGWRTVSF
Q65029_ARMV/745-916-----TIPP-------LEY--------DLSATSAYKS-VSLLLGQTLV-----------------------DGTHKVYNF
POL2_ARMVS/792-963-----TIPP-------LEY--------DLSATSAYKS-VSLLLGQTLV-----------------------DGTHKVYNF
Q67703_GFLV/166-336-----TCPP-------IFF--------DLTAVTALKS-AGLTLGQVPM-----------------------VGTTRVYNL
POL2_GFLV/771-941-----TCPP-------IFF--------DLTAVTALRS-AGLTLGQVPM-----------------------VGTTKVYNL
POL2_BRSV/1007-1170-----MLAP-------KQI--------AVGTYAMITF-PVSLAAKLQS-----------------------TSGRTAYSY
POL2_GCMV/981-1144-----MLPP-------RQM--------AIGNAGSINF-PLSFAVQQKS-----------------------SSGRIAYSY
POL2_TORVR/1497-1662-----RGPT-------EID--------LTSTPAPNAY-RLLFGLSTVI-----------------------SGNMSTLNA
Q88483_9SECO/1003-1166-----VLKS-------GSI--------AIGTYTMTKV-PVSLAMRVDS-----------------------AAKRQAYSY

PF03689

A3FEM9_9SECO/10-101-----AFLG-------KVT--------CAKDAKGGTL-LHTLDIIK-E-----------------------CKSQNLLRY
Q9QAH4_9SECO/9-99-----LYYE-------SVD--------VPKDTLAGTL-LTRIDVRA-K-----------------------AATFDSAVW
Q09G89_GFLV/608-698-----AGRG-------VIY--------IPKDCQANRY-LGTLNIRD-M-----------------------ISDFKGVQY
Q9JGK5_SDV/160-249-----LFTK-------NLE--------IPSTADFCKE-LARYQVMA-E-----------------------AMNYRSASY
Q9IV56_9SECO/636-727-----VGVK-------WVS--------VPKDAKQSAF-LGTHNFRE-I-----------------------AKEYAGEFY
A1YYW2_BRAV/156-247-----AFAK-------MYQ--------CKKDAKAGHV-LATVDIQT-R-----------------------VFEDNRRVA
Q65624_9SECO/45-137-----AHVV-------QGW--------VPKDATKGRV-LEAINLRE-D-----------------------IATSDNLVK
Q6JX06_9SECO/849-939-----VFVH-------TID--------LPNAVTVGTV-LAKIDILE-K-----------------------IKTTHSAVC
Q20LA0_9SECO/601-691-----LYYE-------SVN--------VPRDTLEGTR-LARIDLRA-K-----------------------AQEMDSAVW
POL2_BRSV/842-932-----AFGE-------TIE--------LPATVTPGTV-LAVFNIFD-K-----------------------IQETNTKVC
A0A9J8_ARMV/580-670-----AGRG-------SVQ--------VPKDCQAGKY-LKTLDLRD-M-----------------------ISGFSGIQY
Q6JX05_9SECO/604-694-----AGRG-------SVQ--------VPKDCRKDAF-LKTLDMRS-M-----------------------TAGFAGIQY
Q9Z0D6_SDV/74-163-----LFTE-------NLA--------IPSTADFCKE-LARYNVLA-K-----------------------ATSFKSASY
Q9QRA5_9SECO/10-101-----AYVG-------RVT--------CAKDAKGGTL-LHTLNVIE-A-----------------------CKSMSLLRY
Q86631_9SECO/85-173-----SAVT-------PFK--------CAAEAAENTI-LARWSLRS-I-----------------------ISESGTDAW
POL2_GCMV/815-905-----AFIH-------TID--------LPTAVTEGQV-LAKIDIFK-K-----------------------IQDAKSMVC
A2ID55_9SECO/270-361-----MSAT-------SYN--------VSKDVAAGVV-IGRLNLVE-R-----------------------ARVDNTIPY
Q64959_9SECO/4-94-----AFSQ-------RIT--------YPAARTVGTV-IGTLDIFA-L-----------------------ITTTNSRVC
Q8B5P7_TRSV/12-103-----CGTL-------SFK--------VPKDAKKGKH-LGTYDIRQ-A-----------------------LMDYGGLHS
Q88483_9SECO/838-928-----ACGE-------TII--------LPATSASGSI-LAKIDLIS-L-----------------------IKNTNTRVC
POL2_CNSV/688-778-----VFTQ-------LIT--------VPAASTKGNV-LAGVDILA-N-----------------------ARTTMSGFY

PF00760

CAPSD_CMVFN/11-215-----RGSY-------YGK--------RLLLPD-------SV-TEYDK-------------------------KL-VSRI

PF01318

CAPSD_BMV/2-188-----AKAT-------NAM--------SITLPH-------ELSSEKNK-------------------------ELKVGRV

PF03566

Q80IX5_PRVFL/54-754-----GKLW-------RVS--------FISFPAFRLN-FIALANINNE-----------------------..ALTLETR
CAPSD_NCBVS/1-608-----GGTW-------PLL--------VMHLPFFRHP-LLFITTTSNT-----------------------EVEVTNADL
CAPSD_HASV/2-647-----GRQW-------SLS--------IFSFPMFRTA-YVAVANVENK-----------------------..EMSLDVV

PF01829

CAPSD_NODAM/42-399-----GTSA-------TDT--------AANVTAFRYA-SMAAGVYPTS-----------------------NLMQFAGSI

PF08435

Q91H09_9CALI/305-535-----GNSS-------DFN--------QWQLPRYGGH-LANNNHLAPA-----------------------VSPLFPGEQ
Q8JMP1_9CALI/305-540-----EN.T-------PFQ--------QWVLPHYAGS-LALNTNLAPA-----------------------VAPTFPGEQ
Q8B4Z2_9CALI/297-515-----....-------EHS--------FWRIPDYRAD-V.LGSDFAPS-----------------------VSAPGVGET
Q917X1_9CALI/305-538-----ANGH-------RFE--------QWTLPRYSGA-LTLNMNLAPA-----------------------VAPLFPGER
Q9IV43_9CALI/304-537-----P...-------DVN--------FWTIPQYGSS-LAEASQLAPV-----------------------VYPPGFGEA
Q8VA02_9CALI/306-539-----....-------DVD--------PWVIPRYGST-LTEAAQLAPP-----------------------IYPPGFGEA
Q9IV49_9CALI/306-538-----PS.H-------PFR--------QWTLPRYGGH-LTNNIHLAPA-----------------------VAPLFPGEQ
Q6EAX3_9CALI/306-538-----SG.H-------EFD--------QWALPRYSGH-LTLNMNLAPP-----------------------IAPNFPGEQ
Q8BAC6_9CALI/304-534-----DQ.H-------PFR--------QWSLPNYGGH-LALNNHLAPA-----------------------VTPLFPGEQ
Q6WQW7_9CALI/296-512-----ES..-------...--------FWVLPDYRTD-V.LGSEFAPA-----------------------VSAPGVGET
Q6B7R3_9CALI/303-535-----GN.T-------PFR--------QWELPNYSGA-LTLNTNLAPA-----------------------VGPNFPGEQ
Q6EAW7_9CALI/305-538-----GQDK-------HFD--------QWVLPNYSGA-LGLNMHLAPA-----------------------VSPLFPGER
Q66418_9CALI/306-538-----....-------DVD--------PWVIPRYGSS-LTEAAQLAPP-----------------------IYPPGFGEA
Q80FL2_9CALI/317-546-----RE.E-------EFD--------QWSLPDYSGP-ITHNMNLAPA-----------------------VAPNFPGEQ
Q9IV42_9CALI/305-535-----SM..-------...--------FGTIPKYGSS-LPDVTHLAPA-----------------------VFPPGFGEV
Q6XDL5_9CALI/307-546-----DANS-------HFD--------QWTLPSYSGA-LTLNMNLAPS-----------------------VAPVFPGEC
Q6B7R2_9CALI/304-538-----HG..-------TIN--------LWKIPSYGST-VTESVHLAPP-----------------------IYPPGFGET
Q917X4_9CALI/305-533-----D...-------HFN--------QWALPNYSGA-LTLNMNLAPS-----------------------VAPLFPGEQ
Q783W9_9CALI/306-535-----SQ.N-------SYN--------QWLLPRYGGH-LTNNTHLAPS-----------------------VSPMFPGEQ
Q80J94_9CALI/309-538-----QD..-------...--------..TIPEYNDG-L..LVPLAPP-----------------------IGPFLPGEV
Q913B6_9CALI/305-540-----E...-------HFN--------QWVVPRYAGA-LNLNTNLAPS-----------------------VAPVFPGER
Q8JW44_9CALI/304-539-----....-------DIN--------LWEIPDYGSS-LSQAANLAPP-----------------------VFPPGFGEA
Q83876_9CALI/301-524-----....-------QVD--------LWKIPNYGSS-ITEATHLAPS-----------------------VYSPGFGEV
Q9IV48_9CALI/306-533-----....-------RVD--------PWKIPSYGST-VTESTHLAPL-----------------------IFPPGFGEA
Q8V713_9CALI/316-545-----TN.R-------DFN--------QWQLPAYGGA-LTNNTNLAPP-----------------------VMPVYPGEQ
Q91I85_9CALI/304-538-----....-------NTN--------FWKIPDYGSS-LAEASQLAPA-----------------------VYPPGFNEV
Q8JXJ0_9CALI/304-537-----NA..-------DVD--------FWSIPDYGSN-LAEASQLAPV-----------------------VYPPGFGEA
Q783X1_9CALI/315-545-----....-------DWH--------QWELPEYSGH-LTLNMNLAPA-----------------------VAPAFPGER
Q783Y0_9CALI/305-533-----E...-------GFN--------QWTLPNYSGA-LTLNMGLAPP-----------------------VAPTFPGER

PF02226

POLG_HRV8A/2-69----------------SLN--------YFNINYFKDA-ASSGAS------------------------------------
POLG_POL1M/2-69----------------TIN--------YTTINYYRDS-ASNAAS------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191-----------------TG--------VINYNFYSNS-YTDAVDL...-----------------------SGAMSSQ--
Q9DLK1_FMDVP/202-285-----------------TG--------SIINNYYMQQ-YQNSMDTQLG-----------------------DNAISGG--

PF01766

POLS_IBDVU/9-452-----TFQG-------SLS--------ELTDVSYNGL-MSATANINDK-----------------------IGNVLVGEG
POLS_DXV96/2-442-----WFQG-------TLS--------EVSDYSYDRI-LSITSNPLDK-----------------------VGNVLVGDG
POLS_BSNV/7-428-----TYIG-------SLS--------EIKDLDYNSL-LSATANINDK-----------------------VGNVLVGDG
POLS_IPNVJ/5-453-----TFEG-------SLS--------EVESLTYNSL-MSLTTNPQDK-----------------------VNNQLVTKG

PF02248

Q66170_CPMVS/720-899-----NPPI-------MNV--------LRTAAWKSGT-IHVQLN---------------------------VRG.AGVKR
Q9YWJ9_9SECO/828-1009-----PSPI-------ANL--------LKVAAWKKGT-IRFQLI---------------------------CRG.AAVKQ
POL2_CPMVS/837-1016-----NPPI-------MNV--------LRTAAWKSGT-IHVQLN---------------------------VRG.AGVKR
POL2_BPMV/821-1004-----NSPI-------SNL--------LRVAAWKKGC-LMVKVV---------------------------MSGNAAVKR
POL2_CPSMV/808-988-----SSPV-------ANL--------LRTAAWKCGT-LHVKVV---------------------------MTGRVTTTR
POL2_RCMV/786-964-----NTPV-------ANL--------LRTAAWKRGT-IHVQVA---------------------------MFG.STVKR
Q66179_APMV/2-185-----PSPM-------VYL--------LQTSDWKRGK-LHFKLK---------------------------ILGKSNVKR
POL2_APMV/802-985-----PSPM-------VYL--------LQTSDWKRGK-LHFKLK---------------------------ILGKSNVKR
POL2_SQMVM/622-803-----PSPI-------ANL--------LKVAAWKKGT-IRFQLI---------------------------CRG.AAVKQ
Q9YWK0_9SECO/739-920-----PSPI-------SNL--------LKVAAWKKGT-IRFQLI---------------------------CRG.AAVKQ

PF03688

A5H0K4_GFLV/264-422-----ENPF-------AAM--------IACHGLHSGI.LDLKFQWSL.-----------------------NTEFGKSSG
POL2_BRSV/1176-1338-----VNAL-------AIL--------CATTGMHHGN.CTIHFSWLWH-----------------------PAELGKQLG
Q86631_9SECO/418-544-----AHPL-------ARL--------VASRGMFQGT.MRFILRWTF.-----------------------...ASSLTT
POL2_ARMV/344-502-----DNPF-------AHM--------IACHGLHHGI.LDLKLMWDL.-----------------------EGEFGKSSG
Q88483_9SECO/1172-1336-----VNAL-------AIM--------CATTGMHFGK.CTLHFSWGWY-----------------------RGKLADQSG
A2ID55_9SECO/610-780-----ANPF-------HYI--------LNSCAFFKGS.VELIVRFGVS-----------------------NVALSNLCG
Q80JS8_BRAV/347-511-----TNPL-------ALL--------IGSCGFFRGN.LTIVLEWAT.-----------------------FLKAGDKEG
A0A9J6_ARMV/960-1118-----TNPF-------AHM--------IACHGLHRGV.LELKLEWSL.-----------------------VEEFGKSTG
CAPSD_TRSV/351-511-----SNPL-------SWL--------VAATGWHYGE.VDLCISWSR.-----------------------SKQAQAQEG
POL2_GCMV/1150-1316-----VNAF-------AIM--------CATTGMHAGK.CILHFSWTL.-----------------------.NKGTSFKD
Q6XPY1_9SECO/164-322-----VNAF-------SIM--------CATTGMQWGSPFALHLDSHM.-----------------------........T
Q6XFY6_9SECO/157-316-----NNPF-------AHM--------IACHGLHCGT.LELKFMWSLG-----------------------TTTYGGSSG
Q9IV56_9SECO/980-1138-----TNPF-------SKM--------IAATGFLEGQ.VTLSVSWST.-----------------------NVEASKIKG
Q65624_9SECO/386-551-----RNAL-------ANL--------IRSCGFFRGR.VTFVFQWTL.-----------------------NVAHIVPTA
POL2_CNSV/1022-1185-----TNAF-------LQM--------CQTSTMHFGS.VIIHFSWTL.-----------------------FGGTTNAAT
Q64959_9SECO/338-502-----TNAF-------AIM--------CATTGMHWGR.CILHFTWSWH-----------------------RNTEAGKNA
Q20LA0_9SECO/942-1102-----VNPT-------SLL--------FSVTGLHGGV.IRLHITWSP.-----------------------KTTLGESKG
A3FEN2_9SECO/348-507-----QHPL-------SLL--------ISSTGFFTGR.AIFVFQWGL.-----------------------NTTAGNMKG
Q9ELS0_9SECO/148-312-----NNPL-------SAI--------FGACGYFRGK.LEMSLTWTA.-----------------------NGKLSDAGS
Q9QAH0_9SECO/350-510-----VNPT-------SLL--------FSVTGLHGGI.IRLHITWCP.-----------------------NTNLGESKG
Q24M89_9SECO/943-1103-----VNPA-------SLL--------FSVTGLHGGT.IRLHVTWCP.-----------------------KTNLGESKG

PF08462

Q5ZF43_CARMV/250-348----------------------------------NGN----------------------------------ELQLRVVAA
Q999Y9_CARMV/250-348----------------------------------NGN----------------------------------ELQLRVVAA
Q4JGW6_CARMV/250-348----------------------------------NGN----------------------------------ELQLRVVAA
Q8JJU7_CARMV/250-348----------------------------------NGN----------------------------------ELQLRVVAA
CAPSD_CARMS/250-348----------------------------------NGN----------------------------------ELQLRVVAA
Q999Z1_CARMV/250-348----------------------------------NGN----------------------------------ELRLRVVAA
CAPSD_CARMV/250-348----------------------------------NGN----------------------------------ELQLRVVAA
Q7TG55_CARMV/250-348----------------------------------NGN----------------------------------ELQLRVVAA

PF02443

Q5Y4T0_PCV2/5-226----------------------------RKVKVEFWPCSPITQ.GDR-------------------------------GV
Q27W03_PCV1/5-227----------------------------RKAKYEFYPRDPITS.NQR-------------------------------GV
A3FEQ4_9CIRC/3-256----------------------------KGVAVTLRPAYNIYQ.KSK-------------------------------TQ
Q3HUU1_GOCV/5-247----------------------------RMVKVELRPAYNPFT.RVR-------------------------------TQ
Q1L2D2_9CIRC/1-237----------------------------VLVKVEMRPLGENST.EWK-------------------------------GL
CAPSD_CACV/7-243----------------------------RLAKVEMRPLNESWE.EWK-------------------------------GF
Q0H9S8_9CIRC/4-236----------------------------RLAKFEMRPLNENWG.SWH-------------------------------GI
Q06J73_9CIRC/8-245----------------------------RLAKVEGIPRREDWT.HWE-------------------------------GA
Q9DXG3_BFDV/11-242----------------------------KLAKMEMRPTGGHYTVQSD-------------------------------GF
Q69EZ5_BFDV/7-239----------------------------KLAKMEMRPTYGFGSITQE-------------------------------GF
Q9DXG0_BFDV/11-242----------------------------KLAKMEMKPTWGHYSIATE-------------------------------GF
Q9DXF4_BFDV/3-235----------------------------KLAKMEMKPTWGHSYTNSE-------------------------------GF

PF02956

A7VLZ2_9VIRU/1-506YPDTHPQQIMLAKHKFFIPSLLTKPHGKRYVKIKIKPPTQMSN-KWFFQ-----------EGFSDTGLVQIHTAACDLRY
Q9WT88_9VIRU/1-603SPNTHPGLLMLSKHKIIIPSFQTRPGGRRFVKIRLNPPKLFED-KWYTQ-----------QDLCKVPLVSITATAADLRY
Q91CY9_9VIRU/1-581CPMLHPGMMMQYKKKVLIPSYQTKPKGKAKIRLRIKPPVLFED-KWYTQ-----------QDLCPVNLLSLAVSACSFLH
A7VLY0_9VIRU/1-515YNDLHPQMLLLAKHHRVIPSRQRKPLGKPYIKVKIKPPKQMLT-EWFFQ-----------QDFATQGLFSIHAAAANMQW
Q9JGT1_9VIRU/1-585GPSIHPGMMALNKRARWIPSLKNRPGRKHYVKIKVGAPRMFTD-KWYPQ-----------TDLCDMTLLTIFASAADMQY
Q80QT8_9VIRU/1-595APNTHPALLLQSKKKVKIYSWKTRPWGKKKVTVRVGPPKLFED-KWYSQ-----------HELCKVPLVSWRLTAADMRF
CAPSD_TTVB1/1-533YLSTQPSRHLMNHKAFIVPKLGRGPNKETYVKKIVRPPALFQS-KWYFS-----------QDIYNTPLFILTVSSCSLDQ
A7VM00_9VIRU/1-509YMMTHPHFLLQRKHKKILLSKSTNPNGKLTKRIKIKPPKMLQT-KWYFQ-----------EELAEFGLVAIHAAACNFRY
Q9JG61_9VIRU/1-534YLNTQPSRHMMNKNSFIVPKLNPNKKRKPYIRKKYKPPALLQN-KWYFA-----------QDILNTPLILFTTSSCSLDQ
Q91PS3_9VIRU/1-581GPSLHPGMLMNRRKKIILLSFKTRPKGHSTKTIRIPPPTLFAD-RWYFQ-----------KDFAKVPLVNIGASIGNLRF
CAPSD_TTVV4/1-560GPMLHPGVLMNSKRKILIPSWETRPRGKKRIPVRIGPPRLFTD-HWYFQ-----------RDFCGVPLLTVNATACNLRY
Q91C93_9VIRU/1-546YTSTQPQILLLNNRKRIVKCKANNKKTKPYIRLRIPPPSQLKT-KWYFQ-----------RDIANLPLLLTIATACSLDR
Q2F827_9VIRU/1-589SPMAHPGMMMLDKMKILVPSFDTRPGGRRRVKVTIRPPTLLED-KWYTQ-----------QDLAPVNLVSLVVSAASFIH
Q91CY5_9VIRU/1-584SPMYHPGMMMQARKKLMVPSFQTRPRGRKRYRVRIRPPNMFAD-KWYTQ-----------EDLCPVPLVQLVVSAASFMH
Q8V7G9_9VIRU/1-572HMLTHPLLMLLNKHHRVIPSLKTRPKGKRSVRIHIKPPKLMIN-KWYFA-----------KDLCNIGPCQIYATGLELSN
Q99A78_9VIRU/1-584GPSIHPGLMALNKRARWIPSLKSRPGRKHVVKIRVGAPRMFTD-KWYPQ-----------SDLCDLPLLTIFASAADMQY
Q6H9C2_9VIRU/1-573AASIHPGIMMLSKRHILIPSLKTRPSRKHRVVVRVGAPRLFQD-KWYPQ-----------SDLCDTVLLSIFATACDLQY
CAPSD_TTVT1/1-433MSYTHPWILLMTKKHKVIKPRKWNGKGK...KIFLKPPAVFNS-AWYTS-----------DKWCGAGLGRIYFSFLNPFK
Q9JG80_9VIRU/1-589CPNYHPGNLIKAKHKFLIPSYDTNPKGRQKIIVKIPPPDLFVD-KWYTQ-----------EDLCSVNLVSLAVSAASFLH
A7VLZ6_9VIRU/1-506YPGAHPQQMLLQKHHKLILSQMTKNPNKLTKKFKIKPPRQMIS-KWFFT-----------KPFAKYPLLSLKASALDLRH
Q6H9D2_9VIRU/1-557GPAMHPGMLMTTKHKILVKSFKTKPKGKGTVKVRIRPPTLFDD-RWYFQ-----------HDICKTTLFTISATPCDLRF
Q6H999_9VIRU/1-471APSLHPGNAILAKHKILVPSLQTRPKGRKAIRLRIAPPTLFTD-KWYFQ-----------KDIADLTLFNIMAVEADLRF
Q77JT5_9VIRU/1-606AMTLHPGMMMLAKKTIKIPSLKTRPSRKHVVRIRVGAPKLFED-KWYPQ-----------NELCDVTLLTIQATTADFQY
Q91PS7_9VIRU/1-585GPSLHPGILMTRRKKKIIKSFLTRPRGRATKRVRFKPPTLYTD-KWYFQ-----------KDICNLPLVNIAASACSLRF
CAPSD_TTVV9/1-555HMLAHPLKMIMSSKHVTVPSLLTKKGGRRYLRLKIPPPKLMMT-QWYFQ-----------KEFCQVGLVLLSISTATLMH
Q9JG47_9VIRU/1-553YQSTCPQVMLMNNRTKIMPCKRYNRNKKPYKKFFVKPPSQLQN-KWYFQ-----------KELSNVPLMQVMATTCSLDR
A7VLW0_9VIRU/1-507YMSIHPQMLLLRKHKKLLLSTATKPNGKLTTRFKIRPPKQLVT-KWFFQ-----------KDFAQYGLVAIAAAACNLRY
Q0ZLH9_9VIRU/1-573RCTLHPGMLIQERKKVIIPSFQTRPKGRIKRKIKVRPPTLFTD-KWYFQ-----------RDLCKVPLVTVSASAASLRF
Q5ENW7_9VIRU/1-501KEYSQPSVMMMAKRTRIVIARERAPHRRKVRKIFIPPPSRDTT-QWQFQ-----------TDFCNRKLFTWAAGLIDMQK
A7VLX2_9VIRU/1-509YPDIHPQNLLLRKHKKIVLSRATKPHGKLTVKIKIKPPKLLST-RWFFQ-----------KEMSSVPLVQLSAAACDFNY
Q80AR5_9VIRU/1-594GPNTHPGMLMQQKRKILVPSWDAYPKGRKYVLAKIPPPKLFED-HWYTQ-----------PDLCKVPLVTLRSTAADLKH
Q91CZ2_9VIRU/1-601SPSFHPGILMKSKHKVLVPSFQTWPKGRSKVKLKIKPPKMFVD-KWYTQ-----------EDLCTVTLVSLVVSLASFQH
CAPSD_TTVG1/1-514YMKYHPYMLLQRKHKIILPSQTTNPRGKLKKKKTIKPPKQMLS-KWFFQ-----------QQFAKYDLLLIAAAACSLRY
Q98Y63_9VIRU/1-581SPFLHPGLMMLQKKKILIPSFQTKPGGKSRIKVKIKPPALFED-KWYTQ-----------QDLCPVNLLSLAVSACSFIH
Q9QU36_9VIRU/1-529YMQTQPSILMRDKHSILIPCMKNGRNRKTYKTIKVRPPTQMTN-GWFFQ-----------KDLCNFPLLVILATAASFDR
A7VM12_9VIRU/1-509YPSCHPHQMLLDKHKVVIFSQASKPHGKYKYKLRIKPPKQLIT-KWFFT-----------KPFSNYGLLFLKGSAMNLRY
A7VLV6_9VIRU/1-508YPDIQPQNLLLRQRHKLILSQASNPKGKLRVKVKIKPPKTMQT-KWYFQ-----------KQIAELPLVQLQAAACDVPF
Q9JG50_9VIRU/1-535HLNSQPHRLIQGRKKIVVHRYNKQIHKKPYVKKRIRPPAMLQS-HWYFQ-----------QEICNTGLLLITTSICNLNN
A7VLW4_9VIRU/1-507FPSCHPHQMLLQKRHKILLSKQSNPNGKLYKKIKFKPPKQMIN-KWLFT-----------KNFTPASLIVLKTAVCNFSH
A7VM04_9VIRU/1-513YAACHPQNMLLAKHKMLILSKFTNPKGKLKKTRKVKPPKQMLN-KWFFQ-----------EHFSHEPLLMIQATAANLNY
A7VLY4_9VIRU/1-498YPHTHPQALLLSRHKRIIPSRVTKPHGKNRVIIKIKPTRVVLK-KWFFQ-----------ETFDTTGLCSIYAAACDLNY
CAPSD_TTVD1/1-324KKLIHPAIMITHPKTILVLSNKRGGNRRKWPRMWIPRPAIFAD-GWEFQ-----------KDLCQHGLFAFGWAWVDLDR
Q91CZ6_9VIRU/1-596SANYHPGVLIKARKKVLVPSYDTHPKGRAKIKIHIEPPKMFVD-KWYAQ-----------HDLCDVELVSFVVSLASFQH
A7VM08_9VIRU/1-506YMSMQPQEMLLGKHKKIILSKLTKPTGRIKHTLKIGPPKLLTN-KWMFQ-----------EQFATQDLVQIAGTACNFRY
CAPSD_TTVV3/1-573APSIHPGMLILSKKHILIPSLKTRPSKKHYVKVRVGAPRLFQD-KWYPQ-----------SELCDVTLLVIYATACDLQY
Q91D00_9VIRU/1-593SPNTHPGMLMQQKHRILVPSWQTFPRGRKYVKVKIPPPKLFED-HWYTQ-----------PDLCKVPLVTLRSTAADFRH
Q99AR5_9VIRU/1-604SPNTHPGLLMLTKHKIIIPSFLTRPGGRRFVKIRLPPPKLFED-KWYTQ-----------QDLCKQPLVTLTATAASLRY
Q9DTD2_9VIRU/1-559GPSIHPGMLMLKKHRLLIPSLKTRPGRKHRITVRIGAPKTFED-KWYPQ-----------TDLCDVILVVIYATAADFTF
Q91D04_9VIRU/1-591SAMLHPGTLMQRKKKILIPSFTTRPRGRKKVKLHIKPPVLFED-KWYTQ-----------QDLCDVNLLSLAVSAASFRH
CAPSD_TTVV8/1-571GPNTHPGMLMLRHKKILVPSLRTRPSRRHKITVRIGPPKLFED-KWYSQ-----------TDICDVILATVYATACDLQY
Q5ENX0_9VIRU/1-603APMTHPGMLMRAKHKILIPSRLTRPRGKKYISVRIRPPKLFQH-KWYTQ-----------SDLCSVSLVQLNLTAADLKH
O90364_9VIRU/1-590APRLHPGMLALDKRARWIPSLKSIPGKKHYIKIRVGAPKMFTD-KWYPQ-----------TDLCDMVLLTVYATAADIPY
Q9IFV0_9VIRU/1-583GPSLHPGIIMKQKRKVIVPSYKTKPKGRPVKRIRIKPPTLFTD-RWYFQ-----------KDFSNFPLVTISASAASLRF
Q9QUE7_9VIRU/1-586GPSIHPGMMALNKRARFIPSLKTRPGRRHIVKIRVGAPKLYED-KWYPQ-----------SELCDVPLLTVYATAADMQY
A8DMR2_9VIRU/1-531YRSCQPSLLLLNKHKKVLTCKKNNNKRKISKTIKIPPPTLMQN-KWYFQ-----------KDFAKYPLVMILSAALSLDR
Q9DUH8_9VIRU/1-609APLAHPGMLMRSKYKLLLPSFKTRPGGKKTVSVRIRPPKLFNH-KWYAQ-----------SDLCDVNLVQFTVTAADFMH
A7VLW8_9VIRU/1-511YMQYHPYMLLQSKHTKIIPSEQTNPKGRLKKKLIIRPPKQMLS-KWFFQ-----------RQFATADLFQLVTAACSLNY
Q99AQ3_9VIRU/1-582CPSYHPFMLMKAKHKVLIPSFDTKPKGREKIKLRIQPPKMFID-KWYTQ-----------EDLCPVILVTLVATAASFTH

PF00729

CAPSD_PNLV/47-266SMGLSYDYAD------------------------------------AIP--------------------SDETEMSALK-
CAPSD_MCMVK/23-222SMAFLSDYML------------------------------------SIP--------------------...TGVEDVA-
CAPSD_PMVK/39-236VLRFYPNYST------------------------------------ETP--------------------KTLTDLMDSE-
CAPSD_RCNMV/24-213AMIWDPDSQD------------------------------------SAP--------------------QSRQEISAYS-
CAPSD_CARMS/51-245ALGFNDDASD------------------------------------TPP--------------------TTKVGFYDLG-
CAPSD_SBMVA/46-262HMGFQYDMAD------------------------------------TLP--------------------VSVNQLSNLR-
CAPSD_TBSVC/76-269AIYFDKDSED------------------------------------PEP--------------------ADRVELANYS-
CAPSD_POLVP/66-257AIYFDKDQQD------------------------------------VEP--------------------ADRVELANMG-
CAPSD_OCSVU/111-308GVGFDYDSSD------------------------------------LVP--------------------GNRQEFYALS-
CAPSD_TNVA/61-272AMAFTYDRND------------------------------------AAP--------------------TARAQLSQSY-

PF11729

CAPSD_SJNNV/1-340VAGFLPDPTDNDHTFDALQATRGAVVAKWWESRTVRPQYTRTL-LWTST--------------------GKEQRLTSPG-

PF00894

CAPSD_PLRV1/70-207AYELDPH.CK----------------------------------------------------------------VSSLQ-
CAPSD_PEMVW/53-187AYHVDTSTTK----------------------------------------------------------------KAADV-
CAPSD_BYDVP/62-199FIELDTA.CK----------------------------------------------------------------QSALG-

PF03014

CAPSD_HEVCH/41-659SISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASEH---------VIP--------------------SERLHYRNQGW

PF03115

CAPSD_HASV1/1-416GVSLNPTTTPTSTSWSGLGARKHLDVTVGKNATF------------KLK--------------------PSDLGGPRDG-

PF00983

COAT_TYMV/8-177GVCWVPANSP------------------------------------VTP--------------------AQITKTYGGQ-

PF00073

Q9WMA0_9PICO/49-215ICAMVPG---------------------------------------DQS............................YGS
POLG_AEVCA/45-212IAALVPY---------------------------------------DQV...........................DIES
POLG_CXA9/93-300LVVCVPE---------------------------------------AEM...........GGAVVGQ..AFSATAMANGD
POLG_CXB3N/93-302LVVCVPE---------------------------------------AEM...........GCATLDN..TPSSAELLGGD
POLG_CXB4J/93-300LVVCVPE---------------------------------------AEM...........GCTNAEN..APAYGDLCGGE
POLG_CXA21/93-308GVFLIPE---------------------------------------FVM...........ACNTESKTSYVSYINANPGE
POLG_POL1M/93-308GVFAVPE---------------------------------------MCL...........AGDSNTTTMHTSYQNANPGE
POLG_POL3L/93-307GVFAIPE---------------------------------------YCL...........AGDSDKQR.YTSYANANPGE
POLG_HE701/93-288LIVAIPE---------------------------------------HQI.............GKKGTGTSASFAEVMKGA
POLG_BOVEV/93-285LVLAIPE---------------------------------------HQI................ATQEQPAFDRTMPGS
POLG_HRV14/93-299LVVVIPE---------------------------------------HQL...........ASHEGGNV.SVKYTFTHPGE
POLG_HRV2/93-302IVALIPE---------------------------------------HQI...........ASALHGNV.NVGYNYTHPGE
POLG_HRV8A/93-302IVAAIPE---------------------------------------HQL...........ASATSGNV.SVGYNHTHPGE
POLG_HRV1B/93-301LVAMIPE---------------------------------------HQL...........ASAKNGSV.TAGYNLTHPGE
POLG_FMDV1/311-475LVAMVPE---------------------------------------WKA..........................FDTRE
POLG_FMDVT/311-475LVALVPE---------------------------------------MGD..........................ISDRE
POLG_FMDVO/311-475LVAMVPE---------------------------------------LYS...........................IQKR
POLG_EMCV/161-359LVFMAPE---------------------------------------YPT...........LDAFAMDNRW.SKDNLPNGT
POLG_TMEVB/172-382LVFMAPE---------------------------------------FYTGKGTKTGTMEPSDPFTMDTEWRSPQGAPTGY
POLG_ENMGO/162-361LVFMAPE---------------------------------------YPT...........LDVFAMDNRW.SKDNLPNGT
POLG_FMDVO/533-691MVAYAPP---------------------------------------GME...........................PPKT
POLG_FMDV1/533-692MVAYIPP---------------------------------------GVE..........................TPPDT
POLG_EMCV/420-582LIAYTPP---------------------------------------GAG...........................KPTS
POLG_TMEVB/443-606LIAYTPP---------------------------------------GAG...........................KPTT
POLG_HE701/347-515IICYTPP---------------------------------------GGS...........................SPTD
POLG_HRV2/358-522LLAYTPP---------------------------------------GIA...........................EPTT
POLG_HRV8A/364-529LIAYTPP---------------------------------------GVG...........................KPKS
POLG_HRV1B/360-525LLAYTPP---------------------------------------GID...........................KPAT
POLG_BOVEV/345-515LLAYTPP---------------------------------------GGD...........................MPRN
POLG_CXA21/369-534LLSYSPP---------------------------------------GAK...........................PPTN
POLG_CXA9/358-524LIAYSPP---------------------------------------GAN...........................PPKT
POLG_CXB4J/358-524LLAYSPP---------------------------------------GAG...........................APDS
POLG_CXB3N/360-526LLAYSPP---------------------------------------GAG...........................APTK
POLG_CXB1J/360-526LLAYSPP---------------------------------------GAG...........................VPKN
POLG_FMDVO/725-872DLTWVPN---------------------------------------GAP...............................
POLG_FMDV1/726-878NLTWVPN---------------------------------------GAP...............................
POLG_BOVEV/610-775QVMYVPP---------------------------------------GAP...........................VPSN
POLG_HRV8A/621-792QFMYVPP---------------------------------------GAP...........................VPEK
POLG_HRV2/614-772QYMYVPP---------------------------------------GAP...........................VPNS
POLG_HRV1B/627-786QYMYVPP---------------------------------------GAP...........................IPKT
POLG_HE701/609-781QAMYVPT---------------------------------------GAR...........................KPSS
POLG_HRV14/614-787QAMYVPP---------------------------------------GAP...........................NPKE
POLG_CXA9/612-783QIMYVPP---------------------------------------GGP...........................IPAK
POLG_CXB4J/612-783QIMYVPP---------------------------------------GGP...........................VPTS
POLG_SVDVU/612-782QIMYVPP---------------------------------------GGP...........................VPTK
POLG_CXB3N/630-782QIMYVPP---------------------------------------GGP...........................VPDK
POLG_POL1M/636-806QIMYVPP---------------------------------------GAP...........................VPEK
POLG_CXA21/642-812QIMYIPP---------------------------------------GAP...........................RPSS
POLG_CXA24/646-809QLMYIPP---------------------------------------GAP...........................RPTA

PF00915

CAPSD_VESVA/137-421AALLVPP..-------------------------------------GVE-PIESVSMLQYPHVLFDARQTEPVIFTIPDI
POLG_RHDVF/1768-2065VRAVIPP..-------------------------------------GIE-IGPGLEVRQFPHVVIDARSLEPVTITMPDL
CAPSD_FCVUR/112-395AAIVVPP..-------------------------------------GVD-PIQSTSMLQYPHVLFDARQVEPVIFTIPDL
CAPSD_NVN68/2-294IVSCIPPGF-------------------------------------GSH-NLTIAQATLFPHVIADVRTLDPIEVPLEDV

PF08762

Q8B107_ALPV/599-804NTVIDETRT-------------------------------------AAD------------V............YMPRNL
O56051_9VIRU/590-790GTWTYPDYK-------------------------------------GAE------------V............FMTPN.
Q56QP7_9VIRU/684-855HK.DHATST-------------------------------------GPS------------H............MTYNNL
O36967_9VIRU/668-900STTDYPIKS-------------------------------------TGA------------LPAGTSGFGNSMTYIDPEV
Q5UBY1_9VIRU/79-259YTPDNTNND-------------------------------------GPS------------H............ITYPVL
Q6ITS9_9VIRU/106-313RATVSPQQT-------------------------------------YGS------------EVAPTTHISTPLAIEQIPI
Q4JFT2_9VIRU/834-1009ITTTSPDSI-------------------------------------ETS------------TSAYQFDTNRAMHYINTSL

PF02247

POL2_SQMVM/246-618PNAVISLHR-------------------------------------YFR-----------GDFV--------FEITKMSS
POL2_CPMVS/460-832PNSWISMWR-------------------------------------YFR-----------GELH--------FEVTKMSS
POL2_BPMV/447-819PNAVLSMWR-------------------------------------YFV-----------GDLV--------FEVSKMTS
Q9Z006_9SECO/476-846ASAYCGLSQ-------------------------------------YIQ-----------SDVI--------LDFTLMSS
O12663_9SECO/321-691ASSYCGLSQ-------------------------------------YMQ-----------SDVI--------LDFTLMSS
Q9YWK0_9SECO/363-735PNAVISLHR-------------------------------------YFR-----------GDFV--------FEITKMSS
POL2_CPSMV/437-806PNAILSMWR-------------------------------------YFK-----------ADLE--------FELIKMSS
POL2_RCMV/407-778TNAFLSLWR-------------------------------------YFH-----------GDLV--------FEVQKMSS
Q9YWJ9_9SECO/452-824PNAVISLHR-------------------------------------YFR-----------GDFV--------FEITKMSS
Q66170_CPMVS/343-715PNSWISMWR-------------------------------------YFR-----------GELH--------FEVTKMSS

PF03391

CAPSD_TRSV/179-344SRAVMSRNL-------------------------------------GWS-----------GTIS--------GSVKSVSS
POL2_RRVS/768-936PRVVAAHFR-------------------------------------SWT-----------GKVR--------MSIQEVSS
POL2_BRAV/1268-1433PAAYALFLQ-------------------------------------GHG-----------GSLV--------GEVVHTGS
Q65029_ARMV/745-916NNTLLSYYL-------------------------------------GIG-----------GIVK--------GKVHVCSP
POL2_ARMVS/792-963NNTLLSYYL-------------------------------------GIG-----------GIVK--------GKVHVCSP
Q67703_GFLV/166-336NSTLVSCVL-------------------------------------GMG-----------GTIR--------GKVHICAP
POL2_GFLV/771-941NSTLVSCVL-------------------------------------GMG-----------GTVR--------GRVHICAP
POL2_BRSV/1007-1170AAGLLSHFL-------------------------------------GVG-----------GTIH--------FVVRTTSS
POL2_GCMV/981-1144AAGLLSHFL-------------------------------------GIG-----------GTIH--------FKIQCTSS
POL2_TORVR/1497-1662NQALLRFFQ-------------------------------------GSN-----------GTLH--------GRIKKIGT
Q88483_9SECO/1003-1166AAGVLSHFL-------------------------------------GVG-----------GDII--------FSVHSTAS

PF03689

A3FEM9_9SECO/10-101KEWQRQG..-------------------------------------FLH-----------GKLR--------LRCFIPTN
Q9QAH4_9SECO/9-99RQWVRDG..-------------------------------------CLK-----------PKIK--------VRITAATS
Q09G89_GFLV/608-698EKWITAG..-------------------------------------LVM-----------PTFK--------IVIRLPAN
Q9JGK5_SDV/160-249YSRLLSGVA-------------------------------------ILR-----------PHFK--------FVCRLVTP
Q9IV56_9SECO/636-727NRWVYNR..-------------------------------------NIS-----------PCIL--------VRCHLPKM
A1YYW2_BRAV/156-247LDWLAHG..-------------------------------------LAS-----------FKYD--------LQLTVGSN
Q65624_9SECO/45-137YEWLAKG..-------------------------------------LIH-----------PDLK--------LRMTVGQN
Q6JX06_9SECO/849-939AEWVQMG..-------------------------------------YMD-----------RNLK--------LISHLAPS
Q20LA0_9SECO/601-691RQWVKDG..-------------------------------------CMK-----------PRIK--------VRISAASS
POL2_BRSV/842-932SKWLEQG..-------------------------------------YVS-----------QNLT--------AISHLAPN
A0A9J8_ARMV/580-670EKWITAG..-------------------------------------LIM-----------PDFK--------VVIRYPAN
Q6JX05_9SECO/604-694EKWITSG..-------------------------------------LCM-----------PKFE--------VVIRYPPN
Q9Z0D6_SDV/74-163YSRLLSGVA-------------------------------------ILR-----------PHFK--------FTFRLVTP
Q9QRA5_9SECO/10-101KEWQRQG..-------------------------------------FVH-----------GELR--------LRCFIPTN
Q86631_9SECO/85-173TKWQREL..-------------------------------------PTT-----------FLVT--------GTIAMSVN
POL2_GCMV/815-905VQWMQAG..-------------------------------------YVN-----------KNLT--------FISHLAPS
A2ID55_9SECO/270-361LEWLSKG..-------------------------------------MVH-----------PKLE--------VEILAPTN
Q64959_9SECO/4-94AEWLERG..-------------------------------------YVD-----------RNIL--------MVSHLFTS
Q8B5P7_TRSV/12-103QEWCAKG..-------------------------------------IVN-----------PTFT--------VRMHAPRN
Q88483_9SECO/838-928SEWLMDG..-------------------------------------YVS-----------QNLR--------AVSHLAPN
POL2_CNSV/688-778MRWLQKG..-------------------------------------YID-----------TNLK--------LICHLPRA

PF00760

CAPSD_CMVFN/11-215QIRVNPLPK-------FDSTVWVTVR--------------------KVP-----------ASSD-----------LSVAA

PF01318

CAPSD_BMV/2-188LLWLGLLPS-------VAGRIKACVA--------------------EKQ-----------AQAE-----------AAF-Q

PF03566

Q80IX5_PRVFL/54-754NTFIQTLNNITNWRD.LGTGQWAQFA..PGWYYSIYVLPNTYA-MAEIG-----------DRTD.....SVTQFRKVYKG
CAPSD_NCBVS/1-608DAFANDWNNRTDWTE.ATYPSWAQVG..NVFY....MVVPTEA-LTDVP-----------PPTQLGVSGLLESYRLTSSG
CAPSD_HASV/2-647NDLIEWLNNLADWRYVVDSEQWINFTNDTTYYVRIRVLRPTY.-..DVP-----------DPTE.GLVRTVSDYRLTYKA

PF01829

CAPSD_NODAM/42-399QVYKIPLKQ-------VLNSYSQTVA--------------------TVP-----------PTNL-------AQNTIAIDG

PF08435

Q91H09_9CALI/305-535ILFFRS----------------------------------------FIP-----------GA.S--------G..HTNGE
Q8JMP1_9CALI/305-540LLFFRS----------------------------------------RVP-----------CV.Q--------GLQGQDAF
Q8B4Z2_9CALI/297-515LLFFMC----------------------------------------NVP-----------RL.N--------G..VNPGP
Q917X1_9CALI/305-538LLFFRS----------------------------------------YVP-----------LK.G--------G..FGNPA
Q9IV43_9CALI/304-537IVYFMS----------------------------------------PIP-----------GPNT--------A..HKPNL
Q8VA02_9CALI/306-539IVFFMS----------------------------------------DFP-----------IA.H--------G..TNGLS
Q9IV49_9CALI/306-538ILFFRS----------------------------------------QIP-----------SS.G--------G..HELGY
Q6EAX3_9CALI/306-538LLFFRS----------------------------------------NVP-----------CA.G--------G..VSDGV
Q8BAC6_9CALI/304-534ILFFRS----------------------------------------HIP-----------SA.G--------G..HTDGA
Q6WQW7_9CALI/296-512ILFFMG----------------------------------------KAP-----------VQ.G--------P....SNP
Q6B7R3_9CALI/303-535ILFFRS----------------------------------------NVP-----------SV.Q--------G..GQPIE
Q6EAW7_9CALI/305-538LLFFRS----------------------------------------YIP-----------LK.G--------G..HGDPF
Q66418_9CALI/306-538IVFFMS----------------------------------------DFP-----------VV.S--------G..VNGMR
Q80FL2_9CALI/317-546LLFFRS----------------------------------------QLP-----------XS.G--------G..ISKGI
Q9IV42_9CALI/305-535ILYFYS----------------------------------------IFP-----------GS.G--------Q..PSQLQ
Q6XDL5_9CALI/307-546LLFFRS----------------------------------------FIP-----------LK.G--------G..YGNPA
Q6B7R2_9CALI/304-538LVNLMS----------------------------------------NFP-----------IGHT--------N..SNMAQ
Q917X4_9CALI/305-533LLFFRS----------------------------------------HIP-----------LK.G--------G..TSNGA
Q783W9_9CALI/306-535ILFFRS----------------------------------------FMP-----------GA.S--------G..HTDGA
Q80J94_9CALI/309-538LLRFRT----------------------------------------YMR-----------QIDT--------A.DAAAEA
Q913B6_9CALI/305-540LLFFRS----------------------------------------YLP-----------LK.G--------G..YGNPA
Q8JW44_9CALI/304-539LVYFVS----------------------------------------AFP-----------GPNN--------R..SAPND
Q83876_9CALI/301-524LVFFMS----------------------------------------KIP-----------GP.G--------G.....DS
Q9IV48_9CALI/306-533IVYFMS----------------------------------------DFP-----------IV.S--------G...NTAQ
Q8V713_9CALI/316-545LLFFRS----------------------------------------QLP-----------SS.G--------G..VVAGW
Q91I85_9CALI/304-538IVYFMA----------------------------------------SIP-----------GPNQ--------S..GSPNL
Q8JXJ0_9CALI/304-537IVYFMS----------------------------------------RVP-----------GWNR--------T..NRLNL
Q783X1_9CALI/315-545ILFFRS----------------------------------------VVP-----------SA.G--------G..YGSGQ
Q783Y0_9CALI/305-533ILFFRS----------------------------------------HIP-----------LK.G--------G..VADPV

PF02226

POLG_HRV8A/2-69----------------------------------------------RLD-----------FSQD----------------
POLG_POL1M/2-69----------------------------------------------KQD-----------FSQD----------------

PF11492

Q7T7T5_HARNA/2003-2059----------------------------------------------FSK-----------....----------------
POLS_CRPVC/291-340----------------------------------------------IFS-----------....----------------
Q2HWK2_RSET1/357-413----------------------------------------------YAR-----------....----------------
POLS_ABPVR/340-396----------------------------------------------MAK-----------PVTS----------------

PF08935

Q9WJ28_PTV1F/119-191----------------------------------------------ESN-----------AAEN-----------AASGP
Q9DLK1_FMDVP/202-285----------------------------------------------SNE-----------GSTD-----------TTSTH

PF01766

POLS_IBDVU/9-452VTVLSLPTSYDLGYVRLGDPIPAIGLDPKMV.ATCDSSDRPRV-Y-TIT-----------AADDYQFSSQYQAGGVTITL
POLS_DXV96/2-442IEVLSLPQGFNNPYVRLGDKSPSTLSSPTHITNTSQNLATGGA-Y-MIP-----------.......VTTVPGQGFHNKE
POLS_BSNV/7-428VAVLSLPAGSDLPYVRLGDEVPSSAGV.....ARCSPSDRPRH-Y-NAN-----------.......NKQVQVGTTDTKT
POLS_IPNVJ/5-453ITVLNLPTGFDKPYVRLEDETPQGPQSMNGARMRCTAAIAPRR-Y-EID-----------LPSER..LPTVAATGTPTTI

PF02248

Q66170_CPMVS/720-899ADWDGQVFV-------------------------------------YLR-----------QSMN--------PESYDART
Q9YWJ9_9SECO/828-1009SDWAASARI-------------------------------------DLI-----------NNLS--------NKALPARS
POL2_CPMVS/837-1016ADWDGQVFV-------------------------------------YLR-----------QSMN--------PESYDART
POL2_BPMV/821-1004SDWASLVQV-------------------------------------FLT-----------NSNS--------TEHFDACR
POL2_CPSMV/808-988ANWASHTQM-------------------------------------SLV-----------NSDN--------AQHYEAQK
POL2_RCMV/786-964SDWTSTVQL-------------------------------------FLR-----------QSMN--------TSSYDARV
Q66179_APMV/2-185SEWSSTSRI-------------------------------------DVR-----------RAPG--------TEYLNAIT
POL2_APMV/802-985SEWSSTSRI-------------------------------------DVR-----------RAPG--------TEYLNAIT
POL2_SQMVM/622-803SDWAASARI-------------------------------------DLI-----------NNLS--------NKALPARS
Q9YWK0_9SECO/739-920SDWAASARI-------------------------------------DLV-----------NNLS--------NKALPARS

PF03688

A5H0K4_GFLV/264-422SITITKLVG-------------------------------------DKA-----------MGLD--------GPSQI...
POL2_BRSV/1176-1338RLKFVQ...-------------------------------------..G-----------MGIN--------NEHIG..D
Q86631_9SECO/418-544PTTYVQLVH-------------------------------------KFG-----------TTTS--------SESYL...
POL2_ARMV/344-502GVTITKLCG-------------------------------------DKA-----------TGMD--------GASRV...
Q88483_9SECO/1172-1336A...VSLQT-------------------------------------GMG-----------RAAV--------AEHFG..G
A2ID55_9SECO/610-780RVLFRT...-------------------------------------KFG-----------NMRR--------NRGFILEE
Q80JS8_BRAV/347-511TVQLTTCRG-------------------------------------MID-----------DVKG--------VRNAI.QK
A0A9J6_ARMV/960-1118SVILTHLVG-------------------------------------DKA-----------TGLD--------GGSRV...
CAPSD_TRSV/351-511SVSITTNYR-------------------------------------DWG-----------AYWQ--------GQARI...
POL2_GCMV/1150-1316LQGHISFYS-------------------------------------GMG-----------DSTI--------GEHHG..E
Q6XPY1_9SECO/164-322QADDQKICE-------------------------------------SHS-----------AGIT--------TEHIG..D
Q6XFY6_9SECO/157-316SVIFTKLCG-------------------------------------DKA-----------TGLD--------GGSEV...
Q9IV56_9SECO/980-1138HIIFVVYDA-------------------------------------DLV-----------NSFD--------GASTV...
Q65624_9SECO/386-551TMQILTAVG-------------------------------------RVG-----------NAET--------NGSQILQS
POL2_CNSV/1022-1185AGGVVTIAE-------------------------------------GFG-----------PE..--------.EENFRGH
Q64959_9SECO/338-502R....EISQ-------------------------------------SRL-----------EWVI--------VLQHIILG
Q20LA0_9SECO/942-1102TLKYMQYLY-------------------------------------N..-----------..TS--------TNNYFGDQ
A3FEN2_9SECO/348-507SFSARLAFG-------------------------------------KGV-----------EEIE--------QTSTV...
Q9ELS0_9SECO/148-312RLWIGKCWG-------------------------------------DPK-----------RAEV--------LESTV...
Q9QAH0_9SECO/350-510TLKYMQYLY-------------------------------------H..-----------..TA--------TENFFGDQ
Q24M89_9SECO/943-1103TLKYMQYLY-------------------------------------H..-----------..TN--------TVSYYGDQ

PF08462

Q5ZF43_CARMV/250-348GKWCIIVRG-------------------------------------TVE-----------GGFT--------KPTLVGPG
Q999Y9_CARMV/250-348GKWCIIVRG-------------------------------------TVE-----------GGFT--------KPTLIGPG
Q4JGW6_CARMV/250-348GKWCIIVRG-------------------------------------TIE-----------GGFT--------KPTLIGPG
Q8JJU7_CARMV/250-348GKWCIIVRG-------------------------------------TVE-----------GGFT--------KPTLVGPG
CAPSD_CARMS/250-348GKWCIIVRG-------------------------------------TVE-----------GGFT--------KPTLIGPG
Q999Z1_CARMV/250-348GKWCIIVRG-------------------------------------TVE-----------GGFT--------KPTLVGPG
CAPSD_CARMV/250-348GKWCIIVRG-------------------------------------TVE-----------GGFT--------KPTLIGPG
Q7TG55_CARMV/250-348GRWCIIVRG-------------------------------------TVE-----------GGFT--------KPTLIGPG

PF02443

Q5Y4T0_PCV2/5-226GSTAVILDDNFV..TK--------ANALT---------------------------------------------------
Q27W03_PCV1/5-227GSTVVILDANFV..TP--------STNLA---------------------------------------------------
A3FEQ4_9CIRC/3-256GSTIIDKDGQIVR.TS--------TTGWA---------------------------------------------------
Q3HUU1_GOCV/5-247GSTYIDKEGNITTTTS--------GSEWN---------------------------------------------------
Q1L2D2_9CIRC/1-237GHTVPITDARLMNFVK--------KKGLA---------------------------------------------------
CAPSD_CACV/7-243GHNVPIQDNHLEDFFK--------KTRLD---------------------------------------------------
Q0H9S8_9CIRC/4-236GHNVPIQDNHLEDFFK--------KPGLE---------------------------------------------------
Q06J73_9CIRC/8-245GVTVPIQDQHLRDFFK--------KTRLT---------------------------------------------------
Q9DXG3_BFDV/11-242GHTAVIQDSRITRFKT--------IADQT---------------------------------------------------
Q69EZ5_BFDV/7-239GHTAVIQDSRISKFKT--------TADQN---------------------------------------------------
Q9DXG0_BFDV/11-242GHTAVIQDSRIEKFKT--------RADQS---------------------------------------------------
Q9DXF4_BFDV/3-235GHTAVIQDSRISKFKT--------TADQT---------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506AHLGCCNTNQLASFLT.LNTDFYQYAAWG............................NPKNPYIPTEQDKWYRP......
Q9WT88_9VIRU/1-603PFCSPQTNNPCTTFQV.LRK.NYNTVIGT...........................SVKDQESTQDFENWLYKTD.....
Q91CY9_9VIRU/1-581PFIPPESDNICITFQV.LRD.FYYTQMSV......................TPTTTTSLNQKDEKIFSDHLYKNP.....
A7VLY0_9VIRU/1-515AYYNPDQQSRCLTLYS.LNIKFFANTDWS............................ATHTGTQM......YFP......
Q9JGT1_9VIRU/1-585PFGSPLTDTIVVSFQV.LQS.MYNDCLSV.......................LPSNFVEPSGKGKLLYDKIRKHL.....
Q80QT8_9VIRU/1-595PFCSPLTDNPCYTFQV.LHE.EYYNVIGT........................SALLTPTNATYTNFEKWLYGKC.....
CAPSD_TTVB1/1-533MYAPQDQISTNISLFS.LNTNVFQINNWH....KQPYTTKAASTLE.TYLYCYHNGHEPTQELKWKDIILLGNM......
A7VM00_9VIRU/1-509PWLACCNENLIITLYY.LQPSFWSHTEWA............................QYSTSA........YNPQ.....
Q9JG61_9VIRU/1-534MYAPNDQISTNITFLS.LNTNIFQNPYWE.LDDNQPYFPKVTGTINNIGLYTMGNGGNIKNMKNWKQLIPLYQT......
Q91PS3_9VIRU/1-581PFCRPQTENTCVYFQV.LSN.AWNNMLSI..........................AHPHTENNWQYITETLLKT...HWH
CAPSD_TTVV4/1-560PFGSPQTKNICIYFLV.LAS.IYNDKVSI..........................AKDEVTKNYDTLVDAIKKSPQGL..
Q91C93_9VIRU/1-546PYLNSQSISNTVGFKT.LNYEAFLNRGFK.NIPTTGYFPKPNTRYF.....ITQTHSTDPKNVPIGSLIFLGNT......
Q2F827_9VIRU/1-589PFSQPQTNNICTTFQV.LKD.MYYDCIGI...........................NSTLTTKYENLFNKLYSKC.....
Q91CY5_9VIRU/1-584PFCSPLTNNPCITFQV.LKD.NYYSCIGV.........................NSLETHKNSYTKLQEWLYKTN.....
Q8V7G9_9VIRU/1-572PWLRSGTNSPVIGFWV.LKNHLYDGNLSN.............................IASGEQLTARQTLFTT......
Q99A78_9VIRU/1-584PFGSPLTDSVVVGFQV.LQS.MYNDCLSI........................LPENFNGNGKGKALHDNITKYL.....
Q6H9C2_9VIRU/1-573PFGSPLTDNPCVNFQI.LGP.QYKKHLSI..........................SSTMDESNKAHYEQNLFKKT.....
CAPSD_TTVT1/1-433QIMHTNQTEQSFPFAIELGNTDYDKPPNN...................................................
Q9JG80_9VIRU/1-589PFGSPQTDNPCYTFQV.LKE.FYNQAIGF............................SATQDKIDNVFNILYQNN.....
A7VLZ6_9VIRU/1-506SYLGCCNENSQVYFFY.LNHGFYKQTNWG............................QYSTTP.................
Q6H9D2_9VIRU/1-557PFCSPQTDNPCVNFLV.LAG.VYNGKLSI..........................EPTNVESQYNSLLSAIETNTQG...
Q6H999_9VIRU/1-471PFCSPQTGNTCISFQV.LNS.VYNNYLSI.......................NTFNNDNSDSKLKEFLNKAFPTTGTKGT
Q77JT5_9VIRU/1-606PFGSPLTNSPCCNFQV.LNS.NYDNAHSI........................LNLSNEPTNKWHTYRNNCYKFLLEQY.
Q91PS7_9VIRU/1-585PFCSPQTDNTCVNFQV.LSK.RFNTMLSI..........................SPDYPKKNYDSFVKTYLKNAQEHWN
CAPSD_TTVV9/1-555PWMAPFVNSPALTIYA.VNHKTYSDMSIL..........................PSNNQGSTKNELIETLYTAE.....
Q9JG47_9VIRU/1-553MYLSSSSVSTTMGFVS.LDTNGFMERYMK.DNGTAPYSPLTGQIIF.....AAPNGDNVITNIPLGQCILLGTV......
A7VLW0_9VIRU/1-507PWLACCNENLIITLRY.LQPQFYHNSAWA............................QTTKE.........YNPV.....
Q0ZLH9_9VIRU/1-573PFGSPQTENYCIYFQV.LDP.WYHTRLSI..........................TGGKPAEYWTQLKAYLTQG....WG
Q5ENW7_9VIRU/1-501PF...............DANGAFRNAWWL............................EQRNDQGEMKYIELWGRV.....
A7VLX2_9VIRU/1-509PRIGCCNVSQVMTIFF.LNPQFWGQTDWG............................QYMAHA.................
Q80AR5_9VIRU/1-594PFCSPQTNNPCTTFQV.LRD.KYNDMIGF....................PFNYNPSDTNQTKTLQDFEKWLYSSS.....
Q91CZ2_9VIRU/1-601PFCRPLTDNPCVTFQV.LQN.FYNNVIGY...........................SSSDTLVDNVFTSLLYSKA.....
CAPSD_TTVG1/1-514PRIGCCNENRMITLYC.LNTKFYQDTEWG............................TTKQAPHY......FKP......
Q98Y63_9VIRU/1-581PFCSPESDTICMTFQV.LRE.FYYTHLTV......................TPTTTTSTPEKDKKIFNDQLYSNA.....
Q9QU36_9VIRU/1-529YYTNSKAKSTTIGFIS.LNTLTFQYHNWQ.DPPTTGYKPQDNMWFW.....GTLNGSDDPNEEPLTNLIYLGGT......
A7VM12_9VIRU/1-509SYLSASNENMLVNISS.LNPQWYVNTDWA............................RARQDTQG......YLP......
A7VLV6_9VIRU/1-508VRIGCCNPSQVSTIYF.LNPQFYYDTDWG............................ATKNHA.................
Q9JG50_9VIRU/1-535YWLSNNHLSNNISFWS.VNTRLFSNPNFQNTDSTVGYTPKDGVYLY......GTYNGTPTQNLTWMHMIYLGNT......
A7VLW4_9VIRU/1-507ANLSGKNQNMLVSLIS.LNLSFYKNPAWA............................QALTASG.......YKP......
A7VM04_9VIRU/1-513VNLGCCNTNQMCTFFY.INPGFYQIANWG............................ATTTTG........YIP......
A7VLY4_9VIRU/1-498PHIGATSQNQIITLFG.LNQSFYSKGNWG............................AVVQTG.................
CAPSD_TTVD1/1-324PWMADISKPA....QT.IDPSTYDKK......................................................
Q91CZ6_9VIRU/1-596PFCRPQTDNPCVTFQV.LQN.FYNKCIGT.........................SVNLSDSTFDSIFRDYLYKIG.....
A7VM08_9VIRU/1-506PTLGCCNENRILNLFA.LDTGFYQNVDWM............................QARQTGVG......YKP......
CAPSD_TTVV3/1-573PFGSPQTDNVCVNFQI.LGQ.PYYQHLKT........................ALGLTEKTTYENHYKNNLYKKI.....
Q91D00_9VIRU/1-593PFCSPQTNNPCTTFQV.LRE.NYNEVLGL....................PYANTGSNNEVKIKIDNFENWLYNSS.....
Q99AR5_9VIRU/1-604PFCSPQTNNPNCTFQV.LRK.NYHKVIGT...........................SSTNSEDVTPFENWLYNTA.....
Q9DTD2_9VIRU/1-559PFGSPLTNTHCVNFQV.LGS.DYNDILSI...........................LPDKLKSKESKIEKIYKNI.....
Q91D04_9VIRU/1-591PFCPPQTDNICITFQV.LKD.FYYTQMSV........................TPDTAGQEKDIEIFEKHLFKNP.....
CAPSD_TTVV8/1-571PFGSPLTENYCISFQV.LGS.AYNNLISN...........................TLNPNEEQQDIKSAIYNNV.....
Q5ENX0_9VIRU/1-603PFGSPLTDTPCVSFQV.LGD.LYNECLNI..........DLPETEKDSLTKLKNSSTDEYSKNLQKLLQQLYTNG.....
O90364_9VIRU/1-590PFGSPLTDSVVVNFQV.LQS.MYDKYISI...........................LPDQKSQSKSLLSNIANYI.....
Q9IFV0_9VIRU/1-583PFCSPQTGNICIYFQI.LDPYWYNRRMSI..........................TPDLLKSNYESFFSVLNTK....FS
Q9QUE7_9VIRU/1-586PFGSPLTDTPVVTFQV.LRS.MYNDALST.......................LPSNFENASSPGQKLYKEISTYL.....
A8DMR2_9VIRU/1-531YYTSANSISSTIGFAS.INTTIFQYSDFKSPNLTQPYKPNDEYWLRT....WTNQTITNFSAVETQRVILLGNT......
Q9DUH8_9VIRU/1-609PFGSPLTETPCVTFQV.LGD.LYNKCLNIDLPKVDTVKNASSPHTKIQVKLTDNSGNPTNKEAVKTLYEQLFSYG.....
A7VLW8_9VIRU/1-511PRLGCCNENRTLTLYY.INPYFYQYSDWG............................QVKEHANY......YKP......
Q99AQ3_9VIRU/1-582PFCSPQTANPCITFQV.LKE.FYYQAMGY............................GTPETTMSTIWNTLYTTS.....

PF00729

CAPSD_PNLV/47-266GYTTTSA--------------WAGSEGIKMLSYP----------------------------------------TGAVPS
CAPSD_MCMVK/23-222RIVPSAT--------------IALKNRGPSIVMP----------------------------------------QN....
CAPSD_PMVK/39-236SLVLVPS--------------LSGKTYRPKIETR----------------------------------------GN....
CAPSD_RCNMV/24-213RSVSTAV--------------YEKC.........----------------------------------------......
CAPSD_CARMS/51-245KHVETAA--------------QTAK.........----------------------------------------......
CAPSD_SBMVA/46-262GYVSGQV--------------WSGSSGLCYINGT----------------------------------------RCLDTA
CAPSD_TBSVC/76-269VLKETAP--------------WAEA.........----------------------------------------......
CAPSD_POLVP/66-257HWTESAP--------------WCES.........----------------------------------------......
CAPSD_OCSVU/111-308NHCENMP--------------WQES.........----------------------------------------......
CAPSD_TNVA/61-272KAINFPP--------------YAGYDGAAYLNSN----------------------------------------QGAGSA

PF11729

CAPSD_SJNNV/1-340RLVLLCVGSNTDVVNVSVMCRWSVRLSVPSLETP----------------------------------------EDTTAP

PF00894

CAPSD_PLRV1/70-207SYVNK----------------FQITKGGAKTYQA----------------------------------------RMINGV
CAPSD_PEMVW/53-187VLLDT----------------WNIRSNGSATFGR----------------------------------------EILGDQ
CAPSD_BYDVP/62-199SYINS----------------FTISKTASKTFRS----------------------------------------EAINGK

PF03014

CAPSD_HEVCH/41-659RSVETSGVAEEEATSGLVMLCIHGSLVNSYTNTPYTGALGLLDFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGT

PF03115

CAPSD_HASV1/1-416WWLTNTNDNASDTLGPSIEIHTLGRTMSSYKNEQFTGGLFLVELASEWCFTGYAANPNLVNLVKSTDNQVSVTFEGSAGS

PF00983

COAT_TYMV/8-177IFC-------------------------------------------------------------------------IGGA

PF00073

Q9WMA0_9PICO/49-215I...............................------------------------------------------------
POLG_AEVCA/45-212I...............................------------------------------------------------
POLG_CXA9/93-300KAYEF.TSATQSDQTK.VQTAIHN....AGMG------------------------------------------------
POLG_CXB3N/93-302TAKEFADKPVASGSNKLVQRVVYN....AGMG------------------------------------------------
POLG_CXB4J/93-300TAKSF.EQNAATGKTA.VQTAVCN....AGMG------------------------------------------------
POLG_CXA21/93-308RGGEFTNTYNPSNTDVSEGRQFAALDYLLGSG------------------------------------------------
POLG_POL1M/93-308KGGTFTGTFTPDNNQTSPARRFCPVDYLLGNG------------------------------------------------
POLG_POL3L/93-307RGGKFYSQFNKDNAVTSPKREFCPVDYLLGCG------------------------------------------------
POLG_HE701/93-288EGGVFEQPYLLDD..................G------------------------------------------------
POLG_BOVEV/93-285EGGTFQEPFWLED..................G------------------------------------------------
POLG_HRV14/93-299RGIDL...SSANEVGGPVKDVIYN....MN.G------------------------------------------------
POLG_HRV2/93-302TGREVKAETRLNPDLQPTEEYWLN....FD.G------------------------------------------------
POLG_HRV8A/93-302QGREVVPSRTSSDNKRPSDDSWLN....FD.G------------------------------------------------
POLG_HRV1B/93-301AGR.VVGQQRDANLRQPSDDSWLN....FD.G------------------------------------------------
POLG_FMDV1/311-475K...............................------------------------------------------------
POLG_FMDVT/311-475K...............................------------------------------------------------
POLG_FMDVO/311-475E...............................------------------------------------------------
POLG_EMCV/161-359RTQTNKKGPFAMD..................H------------------------------------------------
POLG_TMEVB/172-382RYDS.RTGFFATN..................H------------------------------------------------
POLG_ENMGO/162-361RTQTNRKGPFAMD..................H------------------------------------------------
POLG_FMDVO/533-691P...............................------------------------------------------------
POLG_FMDV1/533-692P...............................------------------------------------------------
POLG_EMCV/420-582R...............................------------------------------------------------
POLG_TMEVB/443-606R...............................------------------------------------------------
POLG_HE701/347-515R...............................------------------------------------------------
POLG_HRV2/358-522R...............................------------------------------------------------
POLG_HRV8A/364-529R...............................------------------------------------------------
POLG_HRV1B/360-525R...............................------------------------------------------------
POLG_BOVEV/345-515R...............................------------------------------------------------
POLG_CXA21/369-534R...............................------------------------------------------------
POLG_CXA9/358-524R...............................------------------------------------------------
POLG_CXB4J/358-524R...............................------------------------------------------------
POLG_CXB3N/360-526R...............................------------------------------------------------
POLG_CXB1J/360-526R...............................------------------------------------------------
POLG_FMDVO/725-872................................------------------------------------------------
POLG_FMDV1/726-878................................------------------------------------------------
POLG_BOVEV/610-775Q..............................D------------------------------------------------
POLG_HRV8A/621-792R..............................D------------------------------------------------
POLG_HRV2/614-772R..............................D------------------------------------------------
POLG_HRV1B/627-786R..............................N------------------------------------------------
POLG_HE701/609-781Q..............................D------------------------------------------------
POLG_HRV14/614-787W..............................D------------------------------------------------
POLG_CXA9/612-783V..............................D------------------------------------------------
POLG_CXB4J/612-783V..............................N------------------------------------------------
POLG_SVDVU/612-782V..............................N------------------------------------------------
POLG_CXB3N/630-782V..............................D------------------------------------------------
POLG_POL1M/636-806W..............................D------------------------------------------------
POLG_CXA21/642-812W..............................D------------------------------------------------
POLG_CXA24/646-809W..............................D------------------------------------------------

PF00915

CAPSD_VESVA/137-421RKTLFHSMD.ETDTTKLVIMVY....KNGADT..KTTCSITVETRPSA--------------------------------
POLG_RHDVF/1768-2065RPNMYHPTGDPGLVPTLVLSVYNNLINPFGGS..TSAIQVTVETRPSE--------------------------------
CAPSD_FCVUR/112-395RSTLYHLMS.DTDTTSLVIMVYNDLINPYANDSNSSGCIVTVETKPGS--------------------------------
CAPSD_NVN68/2-294RNVLFHNNDRNQQTMRLVCMLYTPLRTGGGTG.DSFVVAGRVMTCPSP--------------------------------

PF08762

Q8B107_ALPV/599-804EGTFEFQV------------------------------------------------------------------------
O56051_9VIRU/590-790EGIHELSI------------------------------------------------------------------------
Q56QP7_9VIRU/684-855NPVHEIMI------------------------------------------------------------------------
O36967_9VIRU/668-900EGFMEFEI------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259NPVHEVEV------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313KGVAEFQI------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009NPMAQISL------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618PYIKA---------------------------------------------------------------------------
POL2_CPMVS/460-832PYIKA---------------------------------------------------------------------------
POL2_BPMV/447-819PYIKC---------------------------------------------------------------------------
Q9Z006_9SECO/476-846PMIGG---------------------------------------------------------------------------
O12663_9SECO/321-691PMIGG---------------------------------------------------------------------------
Q9YWK0_9SECO/363-735PYIKA---------------------------------------------------------------------------
POL2_CPSMV/437-806PYINA---------------------------------------------------------------------------
POL2_RCMV/407-778PFIKS---------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824PYIKA---------------------------------------------------------------------------
Q66170_CPMVS/343-715PYIKA---------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344LFCTA---------------------------------------------------------------------------
POL2_RRVS/768-936IFLTG---------------------------------------------------------------------------
POL2_BRAV/1268-1433AAVSC---------------------------------------------------------------------------
Q65029_ARMV/745-916CTYGI---------------------------------------------------------------------------
POL2_ARMVS/792-963CTYGI---------------------------------------------------------------------------
Q67703_GFLV/166-336IFYSI---------------------------------------------------------------------------
POL2_GFLV/771-941IFYSI---------------------------------------------------------------------------
POL2_BRSV/1007-1170AFVTS---------------------------------------------------------------------------
POL2_GCMV/981-1144AFVTA---------------------------------------------------------------------------
POL2_TORVR/1497-1662ALTTC---------------------------------------------------------------------------
Q88483_9SECO/1003-1166TFVSC---------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101IFCGH---------------------------------------------------------------------------
Q9QAH4_9SECO/9-99CFSGI---------------------------------------------------------------------------
Q09G89_GFLV/608-698AFTGL---------------------------------------------------------------------------
Q9JGK5_SDV/160-249ILESI---------------------------------------------------------------------------
Q9IV56_9SECO/636-727PFLGL---------------------------------------------------------------------------
A1YYW2_BRAV/156-247PFVGV---------------------------------------------------------------------------
Q65624_9SECO/45-137PFVGI---------------------------------------------------------------------------
Q6JX06_9SECO/849-939QFCGV---------------------------------------------------------------------------
Q20LA0_9SECO/601-691CFSGV---------------------------------------------------------------------------
POL2_BRSV/842-932AFSGI---------------------------------------------------------------------------
A0A9J8_ARMV/580-670AFTGI---------------------------------------------------------------------------
Q6JX05_9SECO/604-694AFTGL---------------------------------------------------------------------------
Q9Z0D6_SDV/74-163ILESI---------------------------------------------------------------------------
Q9QRA5_9SECO/10-101IFCGH---------------------------------------------------------------------------
Q86631_9SECO/85-173IMAGT---------------------------------------------------------------------------
POL2_GCMV/815-905QFCGV---------------------------------------------------------------------------
A2ID55_9SECO/270-361MFMGT---------------------------------------------------------------------------
Q64959_9SECO/4-94PYLGM---------------------------------------------------------------------------
Q8B5P7_TRSV/12-103AFAGL---------------------------------------------------------------------------
Q88483_9SECO/838-928SFSGI---------------------------------------------------------------------------
POL2_CNSV/688-778PFAGM---------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215ISAMF---------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188VALAV---------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754ITFEFNAPTLIDQGWWVGAHIPVKPQSETIPAAERFSAGSMTVSASNAIFQPSNTVARIVWSITPLPVATVALTTGTGGT
CAPSD_NCBVS/1-608VTAYFNAPTLVNQGVAVIAQF..QPDKEHQKENPDIVAGTTQTGGT...................LQLGGSGPNYTLTMT
CAPSD_HASV/2-647ITCEANMPTLVDQGFWIGGQYALTPTSLPQYDVS....EAYALHTLTFARPSSAAALAFVWA..GLPQGGTAPAGTPAWE

PF01829

CAPSD_NODAM/42-399LEALDALPNNNYSGSFIEGCYSQSVCNEPEFEFHPI--------------------------------------------

PF08435

Q91H09_9CALI/305-535MDCLL---------------------------------------------------------------------------
Q8JMP1_9CALI/305-540IDCLL---------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515CPCLL---------------------------------------------------------------------------
Q917X1_9CALI/305-538IDCLV---------------------------------------------------------------------------
Q9IV43_9CALI/304-537VPCLL---------------------------------------------------------------------------
Q8VA02_9CALI/306-539VPCTI---------------------------------------------------------------------------
Q9IV49_9CALI/306-538MDCLV---------------------------------------------------------------------------
Q6EAX3_9CALI/306-538IDCLL---------------------------------------------------------------------------
Q8BAC6_9CALI/304-534IDCLL---------------------------------------------------------------------------
Q6WQW7_9CALI/296-512LPCLL---------------------------------------------------------------------------
Q6B7R3_9CALI/303-535IDCLI---------------------------------------------------------------------------
Q6EAW7_9CALI/305-538IDCLV---------------------------------------------------------------------------
Q66418_9CALI/306-538IPCTL---------------------------------------------------------------------------
Q80FL2_9CALI/317-546LDCLV---------------------------------------------------------------------------
Q9IV42_9CALI/305-535VPCLL---------------------------------------------------------------------------
Q6XDL5_9CALI/307-546IDCLM---------------------------------------------------------------------------
Q6B7R2_9CALI/304-538VPCTL---------------------------------------------------------------------------
Q917X4_9CALI/305-533IDCLL---------------------------------------------------------------------------
Q783W9_9CALI/306-535IDCLL---------------------------------------------------------------------------
Q80J94_9CALI/309-538IDCAL---------------------------------------------------------------------------
Q913B6_9CALI/305-540IDCLL---------------------------------------------------------------------------
Q8JW44_9CALI/304-539VPCLL---------------------------------------------------------------------------
Q83876_9CALI/301-524LPCLL---------------------------------------------------------------------------
Q9IV48_9CALI/306-533IPCTL---------------------------------------------------------------------------
Q8V713_9CALI/316-545LDCLL---------------------------------------------------------------------------
Q91I85_9CALI/304-538VPCLL---------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537VPCLL---------------------------------------------------------------------------
Q783X1_9CALI/315-545IDCLI---------------------------------------------------------------------------
Q783Y0_9CALI/305-533IDCLL---------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191TSLLK---------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285TNNTQ---------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452FSANIDAITSLSI..GGELVFQ...TS-----------------------------------------------------
POLS_DXV96/2-442FSINVDSVGPVDILWSGQMTMQ.....-----------------------------------------------------
POLS_BSNV/7-428NGFNIDATTPTEV..TVDMQIA...QI-----------------------------------------------------
POLS_IPNVJ/5-453YEGNADIVNSTAV..TGDITFQLEAEP-----------------------------------------------------

PF02248

Q66170_CPMVS/720-899FVISQ---------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009WYITK---------------------------------------------------------------------------
POL2_CPMVS/837-1016FVISQ---------------------------------------------------------------------------
POL2_BPMV/821-1004WTKSE---------------------------------------------------------------------------
POL2_CPSMV/808-988WSVST---------------------------------------------------------------------------
POL2_RCMV/786-964WVISK---------------------------------------------------------------------------
Q66179_APMV/2-185VFTAE---------------------------------------------------------------------------
POL2_APMV/802-985VFTAE---------------------------------------------------------------------------
POL2_SQMVM/622-803WYITK---------------------------------------------------------------------------
Q9YWK0_9SECO/739-920WYITK---------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422...FA---------------------------------------------------------------------------
POL2_BRSV/1176-1338TMCYN---------------------------------------------------------------------------
Q86631_9SECO/418-544.....---------------------------------------------------------------------------
POL2_ARMV/344-502...CA---------------------------------------------------------------------------
Q88483_9SECO/1172-1336KHNFC---------------------------------------------------------------------------
A2ID55_9SECO/610-780RTAAA---------------------------------------------------------------------------
Q80JS8_BRAV/347-511KVVNL---------------------------------------------------------------------------
A0A9J6_ARMV/960-1118...CA---------------------------------------------------------------------------
CAPSD_TRSV/351-511...YD---------------------------------------------------------------------------
POL2_GCMV/1150-1316FHLGG---------------------------------------------------------------------------
Q6XPY1_9SECO/164-322IKMCG---------------------------------------------------------------------------
Q6XFY6_9SECO/157-316...IA---------------------------------------------------------------------------
Q9IV56_9SECO/980-1138...VP---------------------------------------------------------------------------
Q65624_9SECO/386-551WIVPV---------------------------------------------------------------------------
POL2_CNSV/1022-1185CRNLS---------------------------------------------------------------------------
Q64959_9SECO/338-502IRGIL---------------------------------------------------------------------------
Q20LA0_9SECO/942-1102ATRGL---------------------------------------------------------------------------
A3FEN2_9SECO/348-507..QPL---------------------------------------------------------------------------
Q9ELS0_9SECO/148-312..TNV---------------------------------------------------------------------------
Q9QAH0_9SECO/350-510ATCGI---------------------------------------------------------------------------
Q24M89_9SECO/943-1103ATRGL---------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348ISGDV---------------------------------------------------------------------------
Q999Y9_CARMV/250-348ISGDV---------------------------------------------------------------------------
Q4JGW6_CARMV/250-348ISGDV---------------------------------------------------------------------------
Q8JJU7_CARMV/250-348ISGDV---------------------------------------------------------------------------
CAPSD_CARMS/250-348ISGDV---------------------------------------------------------------------------
Q999Z1_CARMV/250-348ISGNV---------------------------------------------------------------------------
CAPSD_CARMV/250-348ISGDV---------------------------------------------------------------------------
Q7TG55_CARMV/250-348ISGDV---------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226-------------------------------YDPYVNYSSRH--------------------------------------
Q27W03_PCV1/5-227-------------------------------YDPYINYSSRH--------------------------------------
A3FEQ4_9CIRC/3-256-------------------------------IDPYGSTSSRR--------------------------------------
Q3HUU1_GOCV/5-247-------------------------------VDPYAAMSSRK--------------------------------------
Q1L2D2_9CIRC/1-237-------------------------------DDPLANWDGAL--------------------------------------
CAPSD_CACV/7-243-------------------------------ADPLANWDGAR--------------------------------------
Q0H9S8_9CIRC/4-236-------------------------------TDPLANWDGAR--------------------------------------
Q06J73_9CIRC/8-245-------------------------------VDPLANWDGAR--------------------------------------
Q9DXG3_BFDV/11-242-------------------------------QDPLAPFDGAK--------------------------------------
Q69EZ5_BFDV/7-239-------------------------------QDPLAPFDGAR--------------------------------------
Q9DXG0_BFDV/11-242-------------------------------QDPLAPFDGAK--------------------------------------
Q9DXF4_BFDV/3-235-------------------------------QDPLAPFDGAR--------------------------------------

PF02956

A7VLZ2_9VIRU/1-506....................YRIVEPVTEV.EDVKGNKKTIT....T.................................
Q9WT88_9VIRU/1-603..................SHYQTFATEAQLGRIPAFNPDGTK....NTKQQSWQDNWSKKNSPWTGNSGTYP...QTTSE
Q91CY9_9VIRU/1-581..................EYWQSHHTAARL.STSQKPALRNK....EEIPNDHGYLNTTPTDSTFRTG............
A7VLY0_9VIRU/1-515....................YNAWPHTKGL.TFWTIDSKGNK....TPHSI.............................
Q9JGT1_9VIRU/1-585..................PYYNTTQTQAQL.KRYIDNQST..........TDTWNSYLNTKKFSTNESPKTD...INSIG
Q80QT8_9VIRU/1-595..................THYQTFATDTRL.APQTTSKYKPD....GQPLTSSELTWDQSAFNSFKTK............
CAPSD_TTVB1/1-533..................TNYTDGKKYNTS.GTTPLDLFKTE....NKPY..............................
A7VM00_9VIRU/1-509....................GHLHPMPETL.TFKGKIDNREYTWNMSPF...............................
Q9JG61_9VIRU/1-534..................QLYKKEHNTNGTDWTTNFSDLSQP....NK................................
Q91PS3_9VIRU/1-581SNQRKGTMANYDSRDRVGVVFNTFKTQEHI.QNPNFQTDKEQ....VSTPYTYDT.........................
CAPSD_TTVV4/1-560..................TVFNTFKTQEHM.QEPSSETCKET....QKTNPPFKYEN.......................
Q91C93_9VIRU/1-546..................NLLTLGTKIQDA.CPSSTENEWKN....QFEKYLQTEKN.......................
Q2F827_9VIRU/1-589..................CYFETFQTIAQL.NPGFKAAKKTT....NGSGSTAATLGDAVTELKNPNGTFYT...G....
Q91CY5_9VIRU/1-584..................TFFETTQVIAQL.SPSFAPAYKPN....GTNNNTHKPLGGMVPELKYNNAGFHT...G....
Q8V7G9_9VIRU/1-572..................KLLPSNNTKDEW.QYAYTPL..............MKTFYTQAANTAAHNI............
Q99A78_9VIRU/1-584..................PNYNTTQTLAQL.KPYIDNTSTGS........TNNWSSYVNTSKFTTASKTITT.....SAE
Q6H9C2_9VIRU/1-573..................ELYNTFQTIAQL.KETGNISGITPTWTEVQNSTTLNQAGNNATDS.................
CAPSD_TTVT1/1-433................................................................................
Q9JG80_9VIRU/1-589..................SYWESNITPFYV.INVKKGSNTAD....YLSPQITDSNFRKK....................
A7VLZ6_9VIRU/1-506....................YRPSNEINTV.YYKDKTGNKKQ....IGP..FNT..........................
Q6H9D2_9VIRU/1-557..................TLFNTFKTPEMI.KCPAAGKAPET....GDISTNCYKK........................
Q6H999_9VIRU/1-471SL................NALNTFRTEGCI.SHPQLKKPNPQ....INKPLDSQYFAP......................
Q77JT5_9VIRU/1-606..................SYYNTKQVVAQL.KYKWNPNQNPT....MPNTSNASLSKKPDDLTKTKTTNEYP...H....
Q91PS7_9VIRU/1-585QN.KKGTLDNYNDPNRLLTVFNTFKTEEHL.YDPSAKETKNT....TNTDAAGNKYNT......................
CAPSD_TTVV9/1-555..................HTYNPMAQRIWG.NIKPQNTNF........................................
Q9JG47_9VIRU/1-553..................TDYTPGTQLSSI.TLNTGALSPPS....DWGTFKSASKAIYNAYYQHKY.............
A7VLW0_9VIRU/1-507....................YGTQPMKKTL.TFNYIIGNQRGTYTMSNS...............................
Q0ZLH9_9VIRU/1-573RS....TNNAGYQHGPLGTYFNTLKTSEHI.RQPPADNYKQA....NKDTTYYGR.........................
Q5ENW7_9VIRU/1-501..................PPQGDSELPKKK.EFSTGTDNPNY....NVQDNEEKNIYPIIIYVDQKDQ............
A7VLX2_9VIRU/1-509....................YMNIATGVAL.TGTYKDKQDKP....QNITVGDYT.........................
Q80AR5_9VIRU/1-594..................THYQTFATEANL.RPRQYNADGGA....NPNYAQLQSKWTTTIYAKK...............
Q91CZ2_9VIRU/1-601..................SFWQSHLTPSYV.KKINNNPDGSSISQRVGTMPDMTEYNKWVSNTNIGTGFVNS...N....
CAPSD_TTVG1/1-514....................YATINKSMIFVSNYGGKKTEYN....IGQWIETDIPGEG.....................
Q98Y63_9VIRU/1-581..................NFYQSLHASAFL.NIAQAPAIHGH....NGIPNNSRYLSSTGTETSFRTG............
Q9QU36_9VIRU/1-529..................NNHTKGIPVKNQ.SNYASQPNM........................................
A7VM12_9VIRU/1-509....................QPNM..NKSL.SYKNKTKGGSE....TTTQMPST..........................
A7VLV6_9VIRU/1-508....................YMYIRTGVSL.TGTYKGKDGKD....HEKIIGEWKKM.......................
Q9JG50_9VIRU/1-535..................HKYQQGLAPIDMSGPTSNQIKALH....EKQN..............................
A7VLW4_9VIRU/1-507....................YDNIPSDLPF.VVKQANKEVQKYMKPQ.................................
A7VM04_9VIRU/1-513....................YSGYPTATIY.TWNYKQWQTGQ....GGQ..PFT..........................
A7VLY4_9VIRU/1-498....................YQPYPSVTTF.TYKTAATKQVE....TFN...............................
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596..................SFYQQVLVPSYI.KRITHNPDGST....GGTLSTLTAYNEWVTGTGP.NKFIPG...N....
A7VM08_9VIRU/1-506....................YSTIDKRLTF.HYKTATGSSTVQV....................................
CAPSD_TTVV3/1-573..................KFYNTTETIAQL.KPLVDATTNQT....WSHYVNPNKLTTTPTSEITH..............
Q91D00_9VIRU/1-593..................VHYQTFQTEQMF.RPKQYNADGST....WKDYKSMLSTWTSQIYNKK...............
Q99AR5_9VIRU/1-604..................SHYQTFATEAQVGRIPSFNPDGTK....NTKESEWQNYWSKKGEPWNPNSSYPH...TTTNQ
Q9DTD2_9VIRU/1-559..................AYYNTKQTIAHL.KITDNCKNTQT....DITNTKH...........................
Q91D04_9VIRU/1-591..................QFYQTVHTQGII.SKTRRTAKFSTSNNTLGSDTNITPYLEQPTATNHKNTLSTG........
CAPSD_TTVV8/1-571..................NAYLTRITESHM.ANLISKAPPKQ....VLKSSDGSLQTDH.....................
Q5ENX0_9VIRU/1-603..................QYWQTFITGPFIKDTMQANNYQQK....KTNYTKTNFYTTRDATGDTAFVSN..........
O90364_9VIRU/1-590..................PFYNTTQTIAQL.KPFIDAGNITS.....GTAATTWGSYINTTKFTTTATTTYTYPGTTTNT
Q9IFV0_9VIRU/1-583SSPLYPNVATTVPSGPIGTVFNTFKTQEHV.VDPRWDTVKKQ....STGSQWSNTF........................
Q9QUE7_9VIRU/1-586..................PYYNTTETIAQL.KRYVENTEKNG.....TTPNPWQSKYVNTTAFTTALNVTTE........
A8DMR2_9VIRU/1-531..................NDYQPGEPMGDE.KAHYEDYFKTK....TK................................
Q9DUH8_9VIRU/1-609..................QYWQTFITDFMT.ANPPKYDNGNN....KKLFNDNDYNTFKTTFLTK...............
A7VLW8_9VIRU/1-511....................YNSIADLEFW.SGNTKNPTKYK....PKDEIEKATDPP......................
Q99AQ3_9VIRU/1-582..................TYWQSHLTPQFV.RMPKNNPDNTA....NTEANKFNEWVDKTFKTG................

PF00729

CAPSD_PNLV/47-266GAVVL-------------SLDCASMSKPWY--------------------------------------------------
CAPSD_MCMVK/23-222.....-------------RTVFRCIQAGQF--------------------------------------------------
CAPSD_PMVK/39-236.....-------------PPELRNIDATAF--------------------------------------------------
CAPSD_RCNMV/24-213.....-------------SLTIPADNQWRF--------------------------------------------------
CAPSD_CARMS/51-245.....-------------DLVIPVDGKTRF--------------------------------------------------
CAPSD_SBMVA/46-262NAITT-------------TLDVGQLGKKWY--------------------------------------------------
CAPSD_TBSVC/76-269.....-------------MLRVPTDKIKRF--------------------------------------------------
CAPSD_POLVP/66-257.....-------------TLNVPVDNVKRF--------------------------------------------------
CAPSD_OCSVU/111-308.....-------------TVEIKCDNAYRF--------------------------------------------------
CAPSD_TNVA/61-272IAV..-------------QLDVTKLDKPWY--------------------------------------------------

PF11729

CAPSD_SJNNV/1-340ITTQA-------------PLHNDSINNGYT--------------------------------------------------

PF00894

CAPSD_PLRV1/70-207------------------EWHDSSEDQCRI--------------------------------------------------
CAPSD_PEMVW/53-187------------------PWYESNKDQFFF--------------------------------------------------
CAPSD_BYDVP/62-199------------------EFQESTIDQFWM--------------------------------------------------

PF03014

CAPSD_HEVCH/41-659AELTT-------------TAATRFMKDLYFTSTNGVGEIGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPVVSAN

PF03115

CAPSD_HASV1/1-416------------------PLIMNVPEGSHF---------------------------------------------ARTVL

PF00983

COAT_TYMV/8-177INTLS-------------PLIVKCPLEM----------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215------------------...ASLTVYPHG--------------------------------------------------
POLG_AEVCA/45-212------------------...AAMTTYCHG--------------------------------------------------
POLG_CXA9/93-300------------------VGVGNLTIYPHQ--------------------------------------------------
POLG_CXB3N/93-302------------------VGVGNLTIFPHQ--------------------------------------------------
POLG_CXB4J/93-300------------------VGVGNLTIYPHQ--------------------------------------------------
POLG_CXA21/93-308------------------VLAGNAFVYPHQ--------------------------------------------------
POLG_POL1M/93-308------------------TLLGNAFVFPHQ--------------------------------------------------
POLG_POL3L/93-307------------------VLLGNAFVYPHQ--------------------------------------------------
POLG_HE701/93-288------------------TSLACALVYPHQ--------------------------------------------------
POLG_BOVEV/93-285------------------TSLGNSLIYPHQ--------------------------------------------------
POLG_HRV14/93-299------------------TLLGNLLIFPHQ--------------------------------------------------
POLG_HRV2/93-302------------------TLLGNITIFPHQ--------------------------------------------------
POLG_HRV8A/93-302------------------TLLGNLPIYPHQ--------------------------------------------------
POLG_HRV1B/93-301------------------TLLGNLLIFPHQ--------------------------------------------------
POLG_FMDV1/311-475------------------...YQLTLFPHQ--------------------------------------------------
POLG_FMDVT/311-475------------------...YQLTLYPHQ--------------------------------------------------
POLG_FMDVO/311-475------------------..LYQLTLFPHQ--------------------------------------------------
POLG_EMCV/161-359------------------QNFWQWTLYPHQ--------------------------------------------------
POLG_TMEVB/172-382------------------QNQWQWTVYPHQ--------------------------------------------------
POLG_ENMGO/162-361------------------QNFWQWTLYPHQ--------------------------------------------------
POLG_FMDVO/533-691------------------...EAAAHCIHA--------------------------------------------------
POLG_FMDV1/533-692------------------...EEAAHCIHA--------------------------------------------------
POLG_EMCV/420-582------------------...DQAMQATYA--------------------------------------------------
POLG_TMEVB/443-606------------------...DQAMQSTYA--------------------------------------------------
POLG_HE701/347-515------------------...MQAMLATHV--------------------------------------------------
POLG_HRV2/358-522------------------...KDAMLGTHV--------------------------------------------------
POLG_HRV8A/364-529------------------...REAMLGTHL--------------------------------------------------
POLG_HRV1B/360-525------------------...KDAMLGTHV--------------------------------------------------
POLG_BOVEV/345-515------------------...EEAMLGTHV--------------------------------------------------
POLG_CXA21/369-534------------------...KDAMLGTHI--------------------------------------------------
POLG_CXA9/358-524------------------...KDAMLGTHI--------------------------------------------------
POLG_CXB4J/358-524------------------...KNAMLGTHV--------------------------------------------------
POLG_CXB3N/360-526------------------...VDAMLGTHV--------------------------------------------------
POLG_CXB1J/360-526------------------...RDAMLGTHV--------------------------------------------------
POLG_FMDVO/725-872------------------EKALDNTTNPTA--------------------------------------------------
POLG_FMDV1/726-878------------------EAALSNTSNPTA--------------------------------------------------
POLG_BOVEV/610-775------------------SFQWQSGCNPSV--------------------------------------------------
POLG_HRV8A/621-792------------------DYTWQSGTNASV--------------------------------------------------
POLG_HRV2/614-772------------------DYAWQSGTNASV--------------------------------------------------
POLG_HRV1B/627-786------------------DFSWQSGTNMSI--------------------------------------------------
POLG_HE701/609-781------------------SFEWQSACNPSV--------------------------------------------------
POLG_HRV14/614-787------------------DYTWQSASNPSV--------------------------------------------------
POLG_CXA9/612-783------------------DYAWQTSTNPSI--------------------------------------------------
POLG_CXB4J/612-783------------------DYVWQTSTNPSI--------------------------------------------------
POLG_SVDVU/612-782------------------SYSWQTSTNPSV--------------------------------------------------
POLG_CXB3N/630-782------------------SYVWQTSTNPSV--------------------------------------------------
POLG_POL1M/636-806------------------DYTWQTSSNPSI--------------------------------------------------
POLG_CXA21/642-812------------------DYTWQSSSNPSI--------------------------------------------------
POLG_CXA24/646-809------------------DYTWQSSSNPSV--------------------------------------------------

PF00915

CAPSD_VESVA/137-421------------------DFTFALLKPPGS--------------------------------------------------
POLG_RHDVF/1768-2065------------------DFEFVMIRAPSS--------------------------------------------------
CAPSD_FCVUR/112-395------------------DFKFHLLKPPGS--------------------------------------------------
CAPSD_NVN68/2-294------------------DFNFLFLVPP..--------------------------------------------------

PF08762

Q8B107_ALPV/599-804------------------PHYSRYPLLPNT--------------------------------------------------
O56051_9VIRU/590-790------------------PYYSSY...PVT--------------------------------------------------
Q56QP7_9VIRU/684-855------------------PYYSQYRKIPIS--------------------------------------------------
O36967_9VIRU/668-900------------------PYYNISHISPAT--------------------------------------------------
Q5UBY1_9VIRU/79-259------------------PYYCQYRKLPIA--------------------------------------------------
Q6ITS9_9VIRU/106-313------------------PYYA.....PCL--------------------------------------------------
Q4JFT2_9VIRU/834-1009------------------PYYS.....PAE--------------------------------------------------

PF02247

POL2_SQMVM/246-618------------------TIAFFIAFGDIT--------------------------------------------------
POL2_CPMVS/460-832------------------TVTFLIAFGNLS--------------------------------------------------
POL2_BPMV/447-819------------------TVSFFIAFGNLA--------------------------------------------------
Q9Z006_9SECO/476-846------------------TFSIAYVAGAYI--------------------------------------------------
O12663_9SECO/321-691------------------TFSIAYVAGAYI--------------------------------------------------
Q9YWK0_9SECO/363-735------------------TIAFFIAFGDIT--------------------------------------------------
POL2_CPSMV/437-806------------------TIAFFVAFGDLS--------------------------------------------------
POL2_RCMV/407-778------------------TVTFFIGFGGLP--------------------------------------------------
Q9YWJ9_9SECO/452-824------------------TIAFFIAFGDIT--------------------------------------------------
Q66170_CPMVS/343-715------------------TVTFLIAFGNLS--------------------------------------------------

PF03391

CAPSD_TRSV/179-344------------------SFVIFPWECEAP--------------------------------------------------
POL2_RRVS/768-936------------------TYMVGVSW.NAT--------------------------------------------------
POL2_BRAV/1268-1433------------------ALHLCISFGGAP--------------------------------------------------
Q65029_ARMV/745-916------------------VLRVVSEWNGVT--------------------------------------------------
POL2_ARMVS/792-963------------------VLRVVSEWNGVT--------------------------------------------------
Q67703_GFLV/166-336------------------VLWVVSEWNGTT--------------------------------------------------
POL2_GFLV/771-941------------------VLWVVSEWNGTT--------------------------------------------------
POL2_BRSV/1007-1170------------------KLRIA.LW.GTV--------------------------------------------------
POL2_GCMV/981-1144------------------RLRVA.LW.GDT--------------------------------------------------
POL2_TORVR/1497-1662------------------SLLLSLRHKDAS--------------------------------------------------
Q88483_9SECO/1003-1166------------------SLRVA.LW.GTI--------------------------------------------------

PF03689

A3FEM9_9SECO/10-101------------------SMMCS---------------------------------------------------------
Q9QAH4_9SECO/9-99------------------VLGVC---------------------------------------------------------
Q09G89_GFLV/608-698------------------TWVMS---------------------------------------------------------
Q9JGK5_SDV/160-249------------------PLMIV---------------------------------------------------------
Q9IV56_9SECO/636-727------------------TLGMC---------------------------------------------------------
A1YYW2_BRAV/156-247------------------TLGIT---------------------------------------------------------
Q65624_9SECO/45-137------------------SIGIC---------------------------------------------------------
Q6JX06_9SECO/849-939------------------AIWYV---------------------------------------------------------
Q20LA0_9SECO/601-691------------------VLGIC---------------------------------------------------------
POL2_BRSV/842-932------------------AIWYI---------------------------------------------------------
A0A9J8_ARMV/580-670------------------TWVMS---------------------------------------------------------
Q6JX05_9SECO/604-694------------------TWVMS---------------------------------------------------------
Q9Z0D6_SDV/74-163------------------PLLVV---------------------------------------------------------
Q9QRA5_9SECO/10-101------------------SMMCT---------------------------------------------------------
Q86631_9SECO/85-173------------------TLGLV---------------------------------------------------------
POL2_GCMV/815-905------------------AIWYI---------------------------------------------------------
A2ID55_9SECO/270-361------------------TIGVV---------------------------------------------------------
Q64959_9SECO/4-94------------------AIWYV---------------------------------------------------------
Q8B5P7_TRSV/12-103------------------SIACT---------------------------------------------------------
Q88483_9SECO/838-928------------------SIWYI---------------------------------------------------------
POL2_CNSV/688-778------------------SFFVL---------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215------------------ADGASPVLVYQY--------------------------------------------------

PF01318

CAPSD_BMV/2-188------------------ADSSKEVVAAMY--------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754NNTSGKFFSVEIDGNV..NSVWTFTAPASI--------------------------------------------------
CAPSD_NCBVS/1-608IGDQVEFGG.........AAIPLPTVSMGP--------------------------------------------------
CAPSD_HASV/2-647QASSGGYLTWRHNGTTFPAGSVSYVLPEGF--------------------------------------------------

PF01829

CAPSD_NODAM/42-399------------------MEGYASVPPANV--------------------------------------------------

PF08435

Q91H09_9CALI/305-535------------------PQEFVQHFYQEA--------------------------------------------------
Q8JMP1_9CALI/305-540------------------PQEWVNHFYQEA--------------------------------------------------
Q8B4Z2_9CALI/297-515------------------PQEWITHFVSER--------------------------------------------------
Q917X1_9CALI/305-538------------------PQEWVQHFYQES--------------------------------------------------
Q9IV43_9CALI/304-537------------------PQEFVTHFVSEQ--------------------------------------------------
Q8VA02_9CALI/306-539------------------PQEFVTHFVNEQ--------------------------------------------------
Q9IV49_9CALI/306-538------------------PQEWVQHFYQEA--------------------------------------------------
Q6EAX3_9CALI/306-538------------------PQEWIQHFYQES--------------------------------------------------
Q8BAC6_9CALI/304-534------------------PQEWIEHFYQEA--------------------------------------------------
Q6WQW7_9CALI/296-512------------------PLEWVFHFASER--------------------------------------------------
Q6B7R3_9CALI/303-535------------------PQEWVSHFYQES--------------------------------------------------
Q6EAW7_9CALI/305-538------------------PQEWIQHFYQES--------------------------------------------------
Q66418_9CALI/306-538------------------PQEYVAHFVNEQ--------------------------------------------------
Q80FL2_9CALI/317-546------------------PQEWVQHFYQES--------------------------------------------------
Q9IV42_9CALI/305-535------------------PQEFITHFCNEQ--------------------------------------------------
Q6XDL5_9CALI/307-546------------------PQEWVQHLYQES--------------------------------------------------
Q6B7R2_9CALI/304-538------------------PQEFVAHFVNEQ--------------------------------------------------
Q917X4_9CALI/305-533------------------PQEWVQHFYQES--------------------------------------------------
Q783W9_9CALI/306-535------------------PQEWVAHFYQEA--------------------------------------------------
Q80J94_9CALI/309-538------------------PQEFVSWFASNA--------------------------------------------------
Q913B6_9CALI/305-540------------------PQEWVQHFYQEA--------------------------------------------------
Q8JW44_9CALI/304-539------------------PQEYITHFVSEQ--------------------------------------------------
Q83876_9CALI/301-524------------------PQGYISHLASEQ--------------------------------------------------
Q9IV48_9CALI/306-533------------------PQEFVSHFVEQQ--------------------------------------------------
Q8V713_9CALI/316-545------------------PQEWVQHFFQES--------------------------------------------------
Q91I85_9CALI/304-538------------------PQEYITHFISEQ--------------------------------------------------
Q8JXJ0_9CALI/304-537------------------PQEFIGHFVSEQ--------------------------------------------------
Q783X1_9CALI/315-545------------------PQEWVQHFYQEA--------------------------------------------------
Q783Y0_9CALI/305-533------------------HQEWIQHLYQES--------------------------------------------------

PF02226

POLG_HRV8A/2-69------------------PSKFTDPV------------------------------------------------------
POLG_POL1M/2-69------------------PSKFTEPI------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059------------------ATEIVARAGASA--------------------------------------------------
POLS_CRPVC/291-340------------------TPAWISAKAADL--------------------------------------------------
Q2HWK2_RSET1/357-413------------------ATEIGAGAVGKI--------------------------------------------------
POLS_ABPVR/340-396------------------TIKWVADKIGSV--------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191------------------........AGIN--------------------------------------------------
Q9DLK1_FMDVP/202-285------------------NNDWFSKLANTA--------------------------------------------------

PF01766

POLS_IBDVU/9-452------------------VQGLILGATIYL--------------------------------------------------
POLS_DXV96/2-442------------------.DEWTVTANYQP--------------------------------------------------
POLS_BSNV/7-428------------------AAGKTLTVTVKL--------------------------------------------------
POLS_IPNVJ/5-453------------------VNETRFDFILQF--------------------------------------------------

PF02248

Q66170_CPMVS/720-899------------------PGSAMLNFSFDI--------------------------------------------------
Q9YWJ9_9SECO/828-1009------------------PRGGDIEFDLEI--------------------------------------------------
POL2_CPMVS/837-1016------------------PGSAMLNFSFDI--------------------------------------------------
POL2_BPMV/821-1004------------------PHSWELIFPIEV--------------------------------------------------
POL2_CPSMV/808-988------------------PHAWEKEFSIDI--------------------------------------------------
POL2_RCMV/786-964------------------PGAAILEFSFDV--------------------------------------------------
Q66179_APMV/2-185------------------PHADEINFEIEI--------------------------------------------------
POL2_APMV/802-985------------------PHADEINFEIEI--------------------------------------------------
POL2_SQMVM/622-803------------------PRGGDIEFDLEI--------------------------------------------------
Q9YWK0_9SECO/739-920------------------PRGGDIEFDLEI--------------------------------------------------

PF03688

A5H0K4_GFLV/264-422------------------LQRLEGTTELL---------------------------------------------------
POL2_BRSV/1176-1338------------------SLSNTHSVPFQ---------------------------------------------------
Q86631_9SECO/418-544------------------...........---------------------------------------------------
POL2_ARMV/344-502------------------LQNMGCETELY---------------------------------------------------
Q88483_9SECO/1172-1336------------------YPATSFSLPFQ---------------------------------------------------
A2ID55_9SECO/610-780------------------PFTKDVVIPLT---------------------------------------------------
Q80JS8_BRAV/347-511------------------SLVGSISRYLN---------------------------------------------------
A0A9J6_ARMV/960-1118------------------IQDMGCLTELF---------------------------------------------------
CAPSD_TRSV/351-511------------------LRRTEAEIPIF---------------------------------------------------
POL2_GCMV/1150-1316------------------PLSSSLAVPFE---------------------------------------------------
Q6XPY1_9SECO/164-322------------------VLATSQVIPFE---------------------------------------------------
Q6XFY6_9SECO/157-316------------------LQELSHTTSMY---------------------------------------------------
Q9IV56_9SECO/980-1138------------------MAKGSFKCLLN---------------------------------------------------
Q65624_9SECO/386-551------------------SQVFEKEVEMD---------------------------------------------------
POL2_CNSV/1022-1185------------------IYEGRATVPLE---------------------------------------------------
Q64959_9SECO/338-502------------------VYDNAYSIPFE---------------------------------------------------
Q20LA0_9SECO/942-1102------------------IDLEGFYCELR---------------------------------------------------
A3FEN2_9SECO/348-507------------------VGACEARIPVE---------------------------------------------------
Q9ELS0_9SECO/148-312------------------YIPGSCSFVLD---------------------------------------------------
Q9QAH0_9SECO/350-510------------------IDQDGFTVDIA---------------------------------------------------
Q24M89_9SECO/943-1103------------------IDPDGFKCELR---------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348------------------DYESARPIAICE--------------------------------------------------
Q999Y9_CARMV/250-348------------------DYESARPIAICV--------------------------------------------------
Q4JGW6_CARMV/250-348------------------DYESARPIAICE--------------------------------------------------
Q8JJU7_CARMV/250-348------------------DYESARPIAICE--------------------------------------------------
CAPSD_CARMS/250-348------------------DYESARPIAICE--------------------------------------------------
Q999Z1_CARMV/250-348------------------DYESARPIAICE--------------------------------------------------
CAPSD_CARMV/250-348------------------DYESARPIAVCE--------------------------------------------------
Q7TG55_CARMV/250-348------------------DYESARPIAICE--------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506......VFTP---------------------------------------------------------------YTE....
Q9WT88_9VIRU/1-603MYKIP.YDSN---------------------------------------------------------------FGFPTYR
Q91CY9_9VIRU/1-581......NNTI---------------------------------------------------------------YGQPSYR
A7VLY0_9VIRU/1-515......KPQN---------------------------------------------------------------YNQ....
Q9JGT1_9VIRU/1-585GPYTTYSDTW---------------------------------------------------------------YKGTAYI
Q80QT8_9VIRU/1-595......ADSN---------------------------------------------------------------YGYCTYN
CAPSD_TTVB1/1-533......WGNV---------------------------------------------------------------FTNLNQD
A7VM00_9VIRU/1-509......ISDK---------------------------------------------------------------YTN....
Q9JG61_9VIRU/1-534......WANP---------------------------------------------------------------FSYSAHE
Q91PS3_9VIRU/1-581......VTSL---------------------------------------------------------------WGDYVYK
CAPSD_TTVV4/1-560......LSSL---------------------------------------------------------------WGDKIYK
Q91C93_9VIRU/1-546......WGNP---------------------------------------------------------------FTPEYLD
Q2F827_9VIRU/1-589......NNST---------------------------------------------------------------FGCCTYK
Q91CY5_9VIRU/1-584......NNPV---------------------------------------------------------------FGMCKYK
Q8V7G9_9VIRU/1-572......TDKT---------------------------------------------------------------YNWKNYK
Q99A78_9VIRU/1-584GPYYTFADTW---------------------------------------------------------------YRGTAYN
Q6H9C2_9VIRU/1-573......RDTW---------------------------------------------------------------YKGNTYN
CAPSD_TTVT1/1-433..........---------------------------------------------------------------.......
Q9JG80_9VIRU/1-589......VNTN---------------------------------------------------------------YNWYTYN
A7VLZ6_9VIRU/1-506......TATA---------------------------------------------------------------YDD....
Q6H9D2_9VIRU/1-557......LDSA---------------------------------------------------------------WGDTIWN
Q6H999_9VIRU/1-471......LDAL---------------------------------------------------------------WGDPIYY
Q77JT5_9VIRU/1-606......WDTL---------------------------------------------------------------YGGLAYG
Q91PS7_9VIRU/1-585......VTSL---------------------------------------------------------------WGDYIYK
CAPSD_TTVV9/1-555......TPEN---------------------------------------------------------------YWNKWNE
Q9JG47_9VIRU/1-553......WGNP---------------------------------------------------------------FFTNWFH
A7VLW0_9VIRU/1-507......DISD---------------------------------------------------------------YDS....
Q0ZLH9_9VIRU/1-573......VDSH---------------------------------------------------------------WGDHVYQ
Q5ENW7_9VIRU/1-501......KPRK---------------------------------------------------------------KYCVCYN
A7VLX2_9VIRU/1-509......GENP---------------------------------------------------------------YYS....
Q80AR5_9VIRU/1-594......TDSN---------------------------------------------------------------FGYTSYN
Q91CZ2_9VIRU/1-601......VSVH---------------------------------------------------------------YNYCQYN
CAPSD_TTVG1/1-514......NLAR---------------------------------------------------------------YYR....
Q98Y63_9VIRU/1-581......NNSI---------------------------------------------------------------YGQPNYK
Q9QU36_9VIRU/1-529......WGNI---------------------------------------------------------------FHEDYLF
A7VM12_9VIRU/1-509......SFTS---------------------------------------------------------------YSA....
A7VLV6_9VIRU/1-508......GEAQ---------------------------------------------------------------YYE....
Q9JG50_9VIRU/1-535......WGNP---------------------------------------------------------------FHYNFAN
A7VLW4_9VIRU/1-507......ATTD---------------------------------------------------------------YST....
A7VM04_9VIRU/1-513......KPQT---------------------------------------------------------------YNQ....
A7VLY4_9VIRU/1-498......KPTT---------------------------------------------------------------YEA....
CAPSD_TTVD1/1-324..........---------------------------------------------------------------.......
Q91CZ6_9VIRU/1-596......TSVH---------------------------------------------------------------YNFCTYN
A7VM08_9VIRU/1-506......DQSD---------------------------------------------------------------ETK....
CAPSD_TTVV3/1-573......NNTW---------------------------------------------------------------YRGNAYN
Q91D00_9VIRU/1-593......TDSN---------------------------------------------------------------YGYASYD
Q99AR5_9VIRU/1-604MYKIP.FDSN---------------------------------------------------------------YGFPTYK
Q9DTD2_9VIRU/1-559......NDTQ---------------------------------------------------------------YKGNTYV
Q91D04_9VIRU/1-591......NNSI---------------------------------------------------------------YGLPSYN
CAPSD_TTVV8/1-571......NDTQ---------------------------------------------------------------FGGNPYN
Q5ENX0_9VIRU/1-603......ADSN---------------------------------------------------------------YLYATYH
O90364_9VIRU/1-590VTMYSSNDSW---------------------------------------------------------------YRGTVYN
Q9IFV0_9VIRU/1-583......VDSH---------------------------------------------------------------WGDHIYE
Q9QUE7_9VIRU/1-586KPYTTFSDSW---------------------------------------------------------------YRGTVYK
A8DMR2_9VIRU/1-531......WGNP---------------------------------------------------------------FYAPYFE
Q9DUH8_9VIRU/1-609......KDSG---------------------------------------------------------------YLFASYN
A7VLW8_9VIRU/1-511......STAK---------------------------------------------------------------YYA....
Q99AQ3_9VIRU/1-582......KLVK---------------------------------------------------------------YNYNQYK

PF00729

CAPSD_PNLV/47-266------PYIS----------------------------------------------------------------------
CAPSD_MCMVK/23-222------AALG----------------------------------------------------------------------
CAPSD_PMVK/39-236------SAL.----------------------------------------------------------------------
CAPSD_RCNMV/24-213------VADN----------------------------------------------------------------------
CAPSD_CARMS/51-245------IRDS----------------------------------------------------------------------
CAPSD_SBMVA/46-262------PFKT----------------------------------------------------------------------
CAPSD_TBSVC/76-269------CDDS----------------------------------------------------------------------
CAPSD_POLVP/66-257------MNDN----------------------------------------------------------------------
CAPSD_OCSVU/111-308------TGTH----------------------------------------------------------------------
CAPSD_TNVA/61-272------PTIS----------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340------GFRS----------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207------LWKG----------------------------------------------------------------------
CAPSD_PEMVW/53-187------LYRG----------------------------------------------------------------------
CAPSD_BYDVP/62-199------LYKA----------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659GEPTVKLYTS----------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416ARSTTPTTLA----------------------------------------------------------------------

PF00983

COAT_TYMV/8-177------MNPR----------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215------LLNC----------------------------------------------------------------------
POLG_AEVCA/45-212------KLNC----------------------------------------------------------------------
POLG_CXA9/93-300------WINL----------------------------------------------------------------------
POLG_CXB3N/93-302------WINL----------------------------------------------------------------------
POLG_CXB4J/93-300------WINL----------------------------------------------------------------------
POLG_CXA21/93-308------IINL----------------------------------------------------------------------
POLG_POL1M/93-308------IINL----------------------------------------------------------------------
POLG_POL3L/93-307------IINL----------------------------------------------------------------------
POLG_HE701/93-288------WINL----------------------------------------------------------------------
POLG_BOVEV/93-285------WINL----------------------------------------------------------------------
POLG_HRV14/93-299------FINL----------------------------------------------------------------------
POLG_HRV2/93-302------FINL----------------------------------------------------------------------
POLG_HRV8A/93-302------YINL----------------------------------------------------------------------
POLG_HRV1B/93-301------FINL----------------------------------------------------------------------
POLG_FMDV1/311-475------FISP----------------------------------------------------------------------
POLG_FMDVT/311-475------FINP----------------------------------------------------------------------
POLG_FMDVO/311-475------FINP----------------------------------------------------------------------
POLG_EMCV/161-359------FLNL----------------------------------------------------------------------
POLG_TMEVB/172-382------ILNL----------------------------------------------------------------------
POLG_ENMGO/162-361------FLNL----------------------------------------------------------------------
POLG_FMDVO/533-691------EWDT----------------------------------------------------------------------
POLG_FMDV1/533-692------EWDT----------------------------------------------------------------------
POLG_EMCV/420-582------IWDL----------------------------------------------------------------------
POLG_TMEVB/443-606------IWDL----------------------------------------------------------------------
POLG_HE701/347-515------VWDF----------------------------------------------------------------------
POLG_HRV2/358-522------IWDV----------------------------------------------------------------------
POLG_HRV8A/364-529------VWDV----------------------------------------------------------------------
POLG_HRV1B/360-525------VWDV----------------------------------------------------------------------
POLG_BOVEV/345-515------VWDF----------------------------------------------------------------------
POLG_CXA21/369-534------IWDL----------------------------------------------------------------------
POLG_CXA9/358-524------IWDI----------------------------------------------------------------------
POLG_CXB4J/358-524------IWDV----------------------------------------------------------------------
POLG_CXB3N/360-526------IWDV----------------------------------------------------------------------
POLG_CXB1J/360-526------IWDV----------------------------------------------------------------------
POLG_FMDVO/725-872------YHK.----------------------------------------------------------------------
POLG_FMDV1/726-878------YNK.----------------------------------------------------------------------
POLG_BOVEV/610-775------FADT----------------------------------------------------------------------
POLG_HRV8A/621-792------FWQE----------------------------------------------------------------------
POLG_HRV2/614-772------FWQH----------------------------------------------------------------------
POLG_HRV1B/627-786------FWQH----------------------------------------------------------------------
POLG_HE701/609-781------FFKI----------------------------------------------------------------------
POLG_HRV14/614-787------FFKV----------------------------------------------------------------------
POLG_CXA9/612-783------FWTE----------------------------------------------------------------------
POLG_CXB4J/612-783------FWTE----------------------------------------------------------------------
POLG_SVDVU/612-782------FWTE----------------------------------------------------------------------
POLG_CXB3N/630-782------FWTE----------------------------------------------------------------------
POLG_POL1M/636-806------FYTY----------------------------------------------------------------------
POLG_CXA21/642-812------FYMY----------------------------------------------------------------------
POLG_CXA24/646-809------FYTY----------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421------LIKH----------------------------------------------------------------------
POLG_RHDVF/1768-2065------KTVD----------------------------------------------------------------------
CAPSD_FCVUR/112-395------MLTH----------------------------------------------------------------------
CAPSD_NVN68/2-294------TVEQ----------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804------A...----------------------------------------------------------------------
O56051_9VIRU/590-790------LTTY----------------------------------------------------------------------
Q56QP7_9VIRU/684-855------....----------------------------------------------------------------------
O36967_9VIRU/668-900------TYVR----------------------------------------------------------------------
Q5UBY1_9VIRU/79-259------STSD----------------------------------------------------------------------
Q6ITS9_9VIRU/106-313------SSSF----------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009------NLVI----------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618------EEMT----------------------------------------------------------------------
POL2_CPMVS/460-832------DAFG----------------------------------------------------------------------
POL2_BPMV/447-819------DDTI----------------------------------------------------------------------
Q9Z006_9SECO/476-846------EKVG----------------------------------------------------------------------
O12663_9SECO/321-691------EKVG----------------------------------------------------------------------
Q9YWK0_9SECO/363-735------EEMT----------------------------------------------------------------------
POL2_CPSMV/437-806------DDTV----------------------------------------------------------------------
POL2_RCMV/407-778------FSEN----------------------------------------------------------------------
Q9YWJ9_9SECO/452-824------EEMT----------------------------------------------------------------------
Q66170_CPMVS/343-715------DAFG----------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344------PTLR----------------------------------------------------------------------
POL2_RRVS/768-936------ADLA----------------------------------------------------------------------
POL2_BRAV/1268-1433------PTLE----------------------------------------------------------------------
Q65029_ARMV/745-916------NNWN----------------------------------------------------------------------
POL2_ARMVS/792-963------NNWN----------------------------------------------------------------------
Q67703_GFLV/166-336------MDWN----------------------------------------------------------------------
POL2_GFLV/771-941------MDWN----------------------------------------------------------------------
POL2_BRSV/1007-1170------PETD----------------------------------------------------------------------
POL2_GCMV/981-1144------ITLE----------------------------------------------------------------------
POL2_TORVR/1497-1662------LTLE----------------------------------------------------------------------
Q88483_9SECO/1003-1166------PTTE----------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215------AASG-----------VQANNKLLYDL------------------------------------------------

PF01318

CAPSD_BMV/2-188------T-------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754------LAEG........EPFAEEGDTTSFSM.......TTI......TADTVVYSVSSSLTGSSVIVRGVTKGSGVSIT
CAPSD_NCBVS/1-608------MPES........GQLVFQTANLTFDV..GNTITITT......TLPPGSVTGMWQFTASNGTD.TVTVDAGARLY
CAPSD_HASV/2-647------ALERYDPNDGSWTDFASAGDTVTFRQVAVDEVVVTNNPAGGGSAPTFTVRVPPSNAYTNTVFRNTLLET.....

PF01829

CAPSD_NODAM/42-399------TNAQ----------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535------ATAR----------------------------------------------------------------------
Q8JMP1_9CALI/305-540------APSQ----------------------------------------------------------------------
Q8B4Z2_9CALI/297-515------AALQ----------------------------------------------------------------------
Q917X1_9CALI/305-538------APSL----------------------------------------------------------------------
Q9IV43_9CALI/304-537------APSM----------------------------------------------------------------------
Q8VA02_9CALI/306-539------APTR----------------------------------------------------------------------
Q9IV49_9CALI/306-538------ATAQ----------------------------------------------------------------------
Q6EAX3_9CALI/306-538------APSQ----------------------------------------------------------------------
Q8BAC6_9CALI/304-534------APSQ----------------------------------------------------------------------
Q6WQW7_9CALI/296-512------PTKQ----------------------------------------------------------------------
Q6B7R3_9CALI/303-535------APSQ----------------------------------------------------------------------
Q6EAW7_9CALI/305-538------APAQ----------------------------------------------------------------------
Q66418_9CALI/306-538------APTR----------------------------------------------------------------------
Q80FL2_9CALI/317-546------APAQ----------------------------------------------------------------------
Q9IV42_9CALI/305-535------APIA----------------------------------------------------------------------
Q6XDL5_9CALI/307-546------APSL----------------------------------------------------------------------
Q6B7R2_9CALI/304-538------APVR----------------------------------------------------------------------
Q917X4_9CALI/305-533------APSS----------------------------------------------------------------------
Q783W9_9CALI/306-535------ATAQ----------------------------------------------------------------------
Q80J94_9CALI/309-538------FTVQ----------------------------------------------------------------------
Q913B6_9CALI/305-540------APSM----------------------------------------------------------------------
Q8JW44_9CALI/304-539------APTM----------------------------------------------------------------------
Q83876_9CALI/301-524------APTV----------------------------------------------------------------------
Q9IV48_9CALI/306-533------APIR----------------------------------------------------------------------
Q8V713_9CALI/316-545------ATSQ----------------------------------------------------------------------
Q91I85_9CALI/304-538------APIQ----------------------------------------------------------------------
Q8JXJ0_9CALI/304-537------APAI----------------------------------------------------------------------
Q783X1_9CALI/315-545------APSQ----------------------------------------------------------------------
Q783Y0_9CALI/305-533------APSQ----------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059------A-------------------------------------------------------------------------
POLS_CRPVC/291-340------A-------------------------------------------------------------------------
Q2HWK2_RSET1/357-413------A-------------------------------------------------------------------------
POLS_ABPVR/340-396------A-------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191------AAAR----------------------------------------------------------------------
Q9DLK1_FMDVP/202-285------FSGL----------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452------IGFD----------------------------------------------------------------------
POLS_DXV96/2-442------LNIS----------------------------------------------------------------------
POLS_BSNV/7-428------MGLT----------------------------------------------------------------------
POLS_IPNVJ/5-453------LGLD----------------------------------------------------------------------

PF02248

Q66170_CPMVS/720-899------IGPN----------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009------AGPN----------------------------------------------------------------------
POL2_CPMVS/837-1016------IGPN----------------------------------------------------------------------
POL2_BPMV/821-1004------CGPN----------------------------------------------------------------------
POL2_CPSMV/808-988------CGPN----------------------------------------------------------------------
POL2_RCMV/786-964------EGPN----------------------------------------------------------------------
Q66179_APMV/2-185------CGPN----------------------------------------------------------------------
POL2_APMV/802-985------CGPN----------------------------------------------------------------------
POL2_SQMVM/622-803------AGPN----------------------------------------------------------------------
Q9YWK0_9SECO/739-920------AGPN----------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422------IGNF----------------------------------------------------------------------
POL2_BRSV/1176-1338------FGSF----------------------------------------------------------------------
Q86631_9SECO/418-544------....----------------------------------------------------------------------
POL2_ARMV/344-502------IGNY----------------------------------------------------------------------
Q88483_9SECO/1172-1336------FGSF----------------------------------------------------------------------
A2ID55_9SECO/610-780------VGDH----------------------------------------------------------------------
Q80JS8_BRAV/347-511------VGDF----------------------------------------------------------------------
A0A9J6_ARMV/960-1118------VGNF----------------------------------------------------------------------
CAPSD_TRSV/351-511------LGSY----------------------------------------------------------------------
POL2_GCMV/1150-1316------FGSF----------------------------------------------------------------------
Q6XPY1_9SECO/164-322------IGSF----------------------------------------------------------------------
Q6XFY6_9SECO/157-316------IGNF----------------------------------------------------------------------
Q9IV56_9SECO/980-1138------CKTS----------------------------------------------------------------------
Q65624_9SECO/386-551------LTDY----------------------------------------------------------------------
POL2_CNSV/1022-1185------LGTF----------------------------------------------------------------------
Q64959_9SECO/338-502------FGSF----------------------------------------------------------------------
Q20LA0_9SECO/942-1102------CGDF----------------------------------------------------------------------
A3FEN2_9SECO/348-507------FKTY----------------------------------------------------------------------
Q9ELS0_9SECO/148-312------VGDY----------------------------------------------------------------------
Q9QAH0_9SECO/350-510------CGDF----------------------------------------------------------------------
Q24M89_9SECO/943-1103------CGDF----------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348------LVTQ----------------------------------------------------------------------
Q999Y9_CARMV/250-348------LVTQ----------------------------------------------------------------------
Q4JGW6_CARMV/250-348------LVTQ----------------------------------------------------------------------
Q8JJU7_CARMV/250-348------LVTQ----------------------------------------------------------------------
CAPSD_CARMS/250-348------LVTQ----------------------------------------------------------------------
Q999Z1_CARMV/250-348------LVTQ----------------------------------------------------------------------
CAPSD_CARMV/250-348------LVTQ----------------------------------------------------------------------
Q7TG55_CARMV/250-348------LVTQ----------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226---------------------------------------------------------TIPQPFPYHSRYFTPKPVLDR--
Q27W03_PCV1/5-227---------------------------------------------------------TIRQPFTYHSRYFTPKPELDQ--
A3FEQ4_9CIRC/3-256---------------------------------------------------------TWDPSRIH.RRYFVPKP....--
Q3HUU1_GOCV/5-247---------------------------------------------------------TWSPHRYH.KRVFIPKP....--
Q1L2D2_9CIRC/1-237---------------------------------------------------------KWDQRKGF.KRLVRPKPQL..--
CAPSD_CACV/7-243---------------------------------------------------------KWDLRKGF.KRLFKPRPQL..--
Q0H9S8_9CIRC/4-236---------------------------------------------------------QWDLRKGF.KRLFRPRPQI..--
Q06J73_9CIRC/8-245---------------------------------------------------------KWTLRKGF.KRLFRPRPQL..--
Q9DXG3_BFDV/11-242---------------------------------------------------------KWFVSRGF.KRLLRPKPQI..--
Q69EZ5_BFDV/7-239---------------------------------------------------------KWYLSRGF.KRLLRPKPQI..--
Q9DXG0_BFDV/11-242---------------------------------------------------------KWYLSRGF.KRLLRPKPQI..--
Q9DXF4_BFDV/3-235---------------------------------------------------------KWYLNKGF.KRLLRPKPQI..--

PF02956

A7VLZ2_9VIRU/1-506.........................................................TITYNKGWFQPALLQAKQITKPS
Q9WT88_9VIRU/1-603.........AQKDYILER..RQCNFNYEV....NNPVSKKVWPQPSTTTPTVD....YYEYHCGWFSNIFIGPNRY.NLQ
Q91CY9_9VIRU/1-581.........PNYTKLTKI..REWYFTQEN.........TDNPIHGSYLKPTLN....SVDYHLGKYSAIFLSPYRT.NTQ
A7VLY0_9VIRU/1-515.........................................................SVNYLQGFFSQYVLQAQKITDAD
Q9JGT1_9VIRU/1-585Q.........KITEVPPK..AAELYYKQT...........EQLIGATFTGSTR....YLHYTGGLYTSIWLSAGRS.YFE
Q80QT8_9VIRU/1-595PNGST....QLVEKIKGY..RNQRFRWLT......SYTGTNHINDTFAKGKHQ....EYEYHLGWYSNIFLGNLRH.NLA
CAPSD_TTVB1/1-533Q........................................................DVIIYYGTKPKQDDNWTSTAPIL
A7VM00_9VIRU/1-509.........................................................SLNKDSGWFNPKVLNAYTVLKGD
Q9JG61_9VIRU/1-534ETN......................................................DVQIFYGTPPTETTYNTQP.QLQ
Q91PS3_9VIRU/1-581ES........IIDSFKTN..ATNYYNSRK..............GTQITASK......FLNHKTGIFSPIFLSRQRL.APD
CAPSD_TTVV4/1-560ES........TFNSFKTN..AENLWKARS..............KHTLLGSK......ELNFKTGMYSAIFLTNGRL.SPD
Q91C93_9VIRU/1-546ED.......................................................NYNIWITNKTPQELKAKYKSNTD
Q2F827_9VIRU/1-589.........PTKEIGSNA..NKWFWHQLT........ATDSDTLGQYGRASIK....YMEYHTGIYSSIFLSPLRS.NLE
Q91CY5_9VIRU/1-584.........PSTLTMQNA..NKWFWENLQ.........VENDLQSKYGKANLT....CMEYHTGIYSSIFLSPQR..NLQ
Q8V7G9_9VIRU/1-572............THYDKV..QQTWTTKAQFNYDLVKEEYKTVYPTTATFPPEWSNRQYLEHDYGLFSPYFLTPNRY.STE
Q99A78_9VIRU/1-584N.........SITNVPLQ..AAQLYHDTT...........KKLLGTTFTGGSP....YLEYHGGLYSSIWLSAGRS.YFE
Q6H9C2_9VIRU/1-573E.........KISELAQI..TRNRFKNAT..........KTALPNYPTIMSTD....LYEYHSGIYSSIYLSAGRS.YFE
CAPSD_TTVT1/1-433.........................................................SYDFKDTNEVKKVWN........
Q9JG80_9VIRU/1-589AK.......SNKDNLHKL..RQAYFKQLT.SEGPQHTSSDNGYASQWTTPSTD....AYEYHLGMFSTIFLAPDR..PVP
A7VLZ6_9VIRU/1-506.........................................................SVSYTKGYFQPPFLQTQFVCTSS
Q6H9D2_9VIRU/1-557QN........TIANFKKN..TDNLWNAGH..............NQTMTGSK......YLNYRTGIYSAIFLSAGRL.SPD
Q6H999_9VIRU/1-471..........NDLNEKKS..LKDIIENILIKNMITYHEKLREFPNSYQGNK......AFCHLTGIYSPPYLNQGRI.SPE
Q77JT5_9VIRU/1-606HSTVTPGTTSSPTDLKTQMLTGNEFYTTAGKKLIDTFHPIPYYENGSSKANTN....IFDYYTGMYSSIFLSSGRS.NPE
Q91PS7_9VIRU/1-585ET........VVDNFINN..AKNYFESRK..............GNIVMSNE......YLNHKTGLYSPIFLSNSRL.SPD
CAPSD_TTVV9/1-555..........IHTKIKTN..RQSELTQLKQMRKRLELTTENDYQDP...........NFGLSYGLYSPLLLYPEMYFPEQ
Q9JG47_9VIRU/1-553GD.......................................................QRMIATGKTLKELCQIYKDDDIT
A7VLW0_9VIRU/1-507.........................................................SVSISKGWFQPKILNAYEVKDNT
Q0ZLH9_9VIRU/1-573QT........IIQAMEEN..QSNMYTKRA..............LHTFLGSQ......YLNFKSGLFSSIFLDNARL.SPD
Q5ENW7_9VIRU/1-501KTLNRWRLGQ...............................................ASTLKIGNLKGLVLRQLMNQEMT
A7VLX2_9VIRU/1-509.........................................................SINYTGGWFDTRFLNSYEIKKKN
Q80AR5_9VIRU/1-594FSGD.....QGYKYVTEI..RQWYWTQLT.....SWTQTAPHINSTFANATHP....EFEYHAGWYSNIFIGPNRF.NIQ
Q91CZ2_9VIRU/1-601.........PNHTHLTTL..RQYYFFWET.HPAAANKTPVTHVPITTTKPTKD....WWEYRLGLFSPIFLSPLRSSNIE
CAPSD_TTVG1/1-514.........................................................SISKEGGYFSPKILQAYQTKVKS
Q98Y63_9VIRU/1-581.........PIPEKLTEI..RKWFFKQAT.........TPNEIHGTYGKPTYD....AVDYHLGKYSPIFLSPYRT.NTQ
Q9QU36_9VIRU/1-529GT.......................................................SQIYVSNKTPQEVVNYIVSHQTQ
A7VM12_9VIRU/1-509.........................................................SVSYDNGWFNKNFLRAIELQSPT
A7VLV6_9VIRU/1-508.........................................................SINYDTGWFNSQFLSSYKIEKTS
Q9JG50_9VIRU/1-535K........................................................QVRFFISSKNPTTIQDTDLNNPI
A7VLW4_9VIRU/1-507.........................................................SISYDDGWFGPLFLSAIKIGKIE
A7VM04_9VIRU/1-513.........................................................SVNYNTGFFSKQMLEAVQLTTDQ
A7VLY4_9VIRU/1-498.........................................................SVSYTTGWFNPKLMQLTEYVTPQ
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596.........PKYDNLKAL..RSYYFHWETVQSVATSNFNAQHVPITSTMPTKD....YWEYRIGMFSPTFLSPYRTSPIE
A7VM08_9VIRU/1-506.........................................................WLTYEGGWFQPKILQAYKVTLNG
CAPSD_TTVV3/1-573D.........KITDLPEI..VKKSYYKAT...........ELAIPEAVKPTTD....LFEYHAGIYSSIFLSPGRA.YFE
Q91D00_9VIRU/1-593FS.......KGKEFATQM..RQHYWVQLT.....QLTATVPHIGPTYSNTTTP....EYEYHAGWYSPVFIGPNRH.NIQ
Q99AR5_9VIRU/1-604.........PIKEYMLQR..RAWSFKYET....DNPVSKKIWPQPTTTKPTID....YYEYHAGWFSNIFIGPNRH.SLQ
Q9DTD2_9VIRU/1-559D.........EINQVRKD..TGDKFIKAT..........SLALSNSWVKPTTN....DLEYHTGMYSSIFLSSGRS.NPE
Q91D04_9VIRU/1-591.........PIPDKLKKI..QEWFWKQET........DKENLVTGSYQTPTNK....SVSYHLGKYSPIFLSSYRT.NLQ
CAPSD_TTVV8/1-571TNQF......TTTTVNKIIQGAQNYLTTI........KTHLQPNNSAINPNTQW...HLEYHAGIYSAPFLSAGRL.NPE
Q5ENX0_9VIRU/1-603PE.......NIETKLYKI..RENYFQLSI....GKNDVFGDHTSQYRGATQ......LLEYHLGIYSPIFLHPGRS.NIQ
O90364_9VIRU/1-590N.........QIKELPKK..AAELYSKAT...........KTLLGNTFTTEDC....TLEYHGGLYSSIWLSPGRS.YFE
Q9IFV0_9VIRU/1-583NTSSKS....ILTAMKDN..ATKMYDRRK..............RDTYLGSK......YLNYRTGLYSSIFLANERT.SPD
Q9QUE7_9VIRU/1-586E.........TITEVPLA..AAKLYQNQT...........KKLLSTTFTGGSE....YLEYHGGLYSSIWLSAGRS.YFE
A8DMR2_9VIRU/1-531PEPQKIFMIK...............................................NLNKLQTANPTEKIQNLNCTLLP
Q9DUH8_9VIRU/1-609PA.......QVAENIKNI..RDQNFALTT....GKNDVFGDSKAQYHNATH......LLDYKLGIYSPVFLHPGRS.NIQ
A7VLW8_9VIRU/1-511.........................................................SINYNTGYFSTKVLNAFKVMVNS
Q99AQ3_9VIRU/1-582.........PDIEKLTLL..RQYYFRWET.......QHTGVAVPPTWTTPTTD....RYEYHVGMFSPIFLTPYRSAGLD

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754PVTVGIDTEAVNRL...SIEMPALTTEEVTTNVPKYEQFLCKESGGAYIVHYKMNNPVFEMTGEENFGGFQFHYPGYDPE
CAPSD_NCBVS/1-608AFGANLDASELNLQDINSIKIPPTNMNQMMQATPKTIQFQLNETKGFY.MPLRAFQPVFEMTMATSYGPVRWKTPRTTVV
CAPSD_HASV/2-647.......RPSSRRL...ELPMPPADFGQTVANNPKIEQSLLKETLGCYLVHSKMRNPVFQLTPASSFGAVSFNNPGYERT

PF01829

CAPSD_NODAM/42-399---------------------------------------------------------------ASMFTNLTFSGARYTGL

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452-----G....TAVITRA.VAADN..GLTAGTDNLMPFNI....VIPTSEITQPITSIKLEIVT.SKSGGQAGDQMSWSAS
POLS_DXV96/2-442-----G....TLIANSQRTLTWSNTGVSNGSHYMNMNNLNVS.LFHENPPPEPVAAIKININYGNNTNGDS....SFSVD
POLS_BSNV/7-428-----G....AKVASRSETVSGN..GGT........FHFSTTAVFGETEITQPVVGVQVL....AKTNGD.....PIVVD
POLS_IPNVJ/5-453-----NDVPVVTVTSSTLVTADNYRGASA..........KFTQSIPTEMITKPITRVKLAYQLNQQTAIANAATLGAKGP

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------------------TIDYFQPN.NKRN--------------------------QLWLRL---------
Q27W03_PCV1/5-227--------------------------TIDWFHPN.NKRN--------------------------QLWLHL---------
A3FEQ4_9CIRC/3-256--------------------------TIQGAGQG.STYS--------------------------TFFLGG---------
Q3HUU1_GOCV/5-247--------------------------TIQQGGTGTNIWS--------------------------TWYTPG---------
Q1L2D2_9CIRC/1-237--------------------------VITDLSTA.NETA--------------------------ALWLNS---------
CAPSD_CACV/7-243--------------------------SVTDTDAA.NVTA--------------------------ALWLNN---------
Q0H9S8_9CIRC/4-236--------------------------SITDTDAG.NVTA--------------------------ALWLTN---------
Q06J73_9CIRC/8-245--------------------------SVTDTDTA.NTTA--------------------------ALWLNN---------
Q9DXG3_BFDV/11-242--------------------------TIEDLTTA.NQSA--------------------------ALWLNS---------
Q69EZ5_BFDV/7-239--------------------------TLTDLTTA.NQSA--------------------------ALWLNS---------
Q9DXG0_BFDV/11-242--------------------------MMNDLSTA.NQSA--------------------------ALWLNS---------
Q9DXF4_BFDV/3-235--------------------------TINDLTTV.NQSA--------------------------ALWLNS---------

PF02956

A7VLZ2_9VIRU/1-506QAN.............PPLKGARYN.PTLDTGENTAVWL.TNVVNQSYYP...PKTDLDLFVQGLPLWQLLLG..FPDWV
Q9WT88_9VIRU/1-603.FQ.............TAYVDTTYN.PLMDKGKGNKIWF.QYLSKKGTDY...NEKQCYCTLEDMPLWAICFG..YTDYV
Q91CY9_9VIRU/1-581.FD.............TAYQDVTYN.PNTDKGKGNKIWI.QSCTKESTIL....DNACRCVIEDMPLWAMVNG..YLEFC
A7VLY0_9VIRU/1-515DNVPAKYEQYSAAMSTLLIAAFRYN.PEEDTGQGNVVWLTSTLSNTHWER...PQL.SDLVIVGKPLWLSFYG..FESFI
Q9JGT1_9VIRU/1-585.TH.............GPDTDITYN.PFSDRGEGNMLWI.DWLTKEDSQY...SKTQSKCLIENLPLWAAIYG..FKEYC
Q80QT8_9VIRU/1-595.FS.............PAYIDITYN.PIVDKGQGNKVWF.QYLTKETTEF...KAEQAKCVIENLPLYCAFFG..YEDYL
CAPSD_TTVB1/1-533PIT.............SLYVECRYN.PFKDKGTGNKVYL.VPTDSGLGSF.LTLPTKSELIITDLPLWLITWG..WIEWL
A7VM00_9VIRU/1-509QRQSL...........VPCGVLRYN.PYTDTGRGNKMWV.NSVLVGAWQE...PKD.TDLVMEGYPLWAMLYG..YTSLL
Q9JG61_9VIRU/1-534TIT.............GLYQECRYN.PFKDKGTGNIFYL.KSTKTQQGSF.LSLPTDNRILLKDFPIWLATWG..WISWL
Q91PS3_9VIRU/1-581.FP.............GFYTEVIYN.PANDKGVGNKIWM.DWCTKNDSQW...TDRQSVVPIVDIPLWAAVMG..YSDYC
CAPSD_TTVV4/1-560.YP.............GIYIEVVYN.PLLGQGEGNMIWL.EWCPKKTKQY...NERQCYNLIQHVPLWAAIHG..YMDFC
Q91C93_9VIRU/1-546KLHSSDTDTFWTLKRVPSVLDCRYN.PFRDDNR.NEVYLLKITEQNSYDY..HEPPKPELIAKDLPLWACLWG..YIDYQ
Q2F827_9VIRU/1-589.FP.............TAYQDVTYN.PLTDRGIGNRIWY.QYSTKENTTF...NETQCKCVLSDLPLWSMFYG..YVDFI
Q91CY5_9VIRU/1-584.FP.............AAYLDVTYN.PNCDRGIGNKIWF.QYSTKMTTDF...EQKQCKCVLENIPLWSAFHG..YPDFI
Q8V7G9_9VIRU/1-572.WH.............MPITYVRYN.PLADKGIGNRIYM.QWCSESSSSF...EPTKSKCMLQDMPLYMLTYG..YLDYV
Q99A78_9VIRU/1-584.TK.............GTYTDITYN.PFTDRGQGNMVWI.DWVSKYDSVY...SKTQSKCLIENLPLWASVYG..YAEYC
Q6H9C2_9VIRU/1-573.TT.............GAYSDIIYN.PFTDKGTGNIIWI.DYLTKEDTIF...VKNKSKCEIMDMPLWAACTG..YTEFC
CAPSD_TTVT1/1-433................TAGKKYYYR.ADWDTGDGNAIMLPNTLSPT.......TPASWLLLEWDAPYWLWFWGKTYQDFV
Q9JG80_9VIRU/1-589RFP.............CAYQDVTYN.PLMDKGVGNHIWF.QYNTKADTQLIVSAPSPCKAHIEDIPLWAAFYG..YSDFI
A7VLZ6_9VIRU/1-506MCDVKAGY........LPINVAIYN.PMQDSSQGNAIYL.VSTLTNTWDQ...PPKDSSILIQGMPIWLGLFG..YLDYV
Q6H9D2_9VIRU/1-557.FP.............GLYDDIVYN.PTTDEGIGNIVWI.DWCTKADCNF...NETQSKGVIKDIPLWAALFG..YVDFL
Q6H999_9VIRU/1-471IF..............GLYTEIIYN.PYTDKGTGNKVWM.DPLTKENNIY...KEGQSKCLLTDMPLWTLLFG..YTDWC
Q77JT5_9VIRU/1-606.VK.............GSYTDISYN.PLTDKGVGNMIWI.DWLTKGDTVY...DPKKSKCLLSDFPLWSLCYG..YPDYC
Q91PS7_9VIRU/1-585.FP.............GFYIDVLYN.PANDKGIGNKIWM.DWCTKNDSTW...RDTPQKLPVVDIPLWAALLG..YSDYC
CAPSD_TTVV9/1-555S...............KVYQKARYN.PLLDQGIGNVVWT.EPLTKKTCDY....ASQAYNVIKDAPLYLALFG..YIDIC
Q9JG47_9VIRU/1-553TAKLKEGFIFKE....QKWVELRYN.PWADKGKGNMVYL.LPINEHQHSYGWAPPTNKDIITQDLPLNILLWG..YLDFH
A7VLW0_9VIRU/1-507VTQAL...........TPCGVLRYN.PADDDGQGNKLWV.VNTLTYNWKI...PTD.DDLILEGYPLWLMLYG..YTSFL
Q0ZLH9_9VIRU/1-573.FK.............GMYQEVVYN.PFNDRGVGNKVWV.QWCTNEDTIF...KDLPGRVPVVDLPLWCALMG..YSDYC
Q5ENW7_9VIRU/1-501................YIWKEGEYSAPFVQRWKGSRFAV.IDARKADQEN............PKVSTWPIEGTWNTQDTV
A7VLX2_9VIRU/1-509TQQWLGY.........LPVGVARYN.PNEDTGEGNEVWL.TSIQKGHFDK...PSKTPDFLLIGLPLWMAFYG..FWNYL
Q80AR5_9VIRU/1-594.FK.............VAYMDVTYN.PINDKGHLNRVWF.QYSTKPTTDF...VEKQAKCLLQNLPLWSMLFG..YSEYV
Q91CZ2_9VIRU/1-601.WP.............FAYRDIIYN.PLMDKGVGNMMWY.QYNTKPDTQF...SPTSCRAVLEDKPIWSMAYG..YADFL
CAPSD_TTVG1/1-514VDYKP...........LPIVLGRYN.PAIDDGKGNKIYL.QTIMNGHWGL...PQKTPDYIIEEVPLWLGFWG..YYNYL
Q98Y63_9VIRU/1-581.FP.............TAYMDVTYN.PNVDKGKGNKIWL.QSVTKETSDF...DSRSCRCIIENLPMWAMVNG..YSDFA
Q9QU36_9VIRU/1-529KVKEYTGITPRTL...PLTVECRYN.PFNDKSTGNNTFF.VSNHADQTKW..QPIDNPDTQTPNLPIWLTTWG..LMDWY
A7VM12_9VIRU/1-509GTKLGQ..........LPLNYGRYN.PTRDKGIGNKIYI.ISTIADSWGP...PTTDKNVLIENLPLWLGLYG..YISYL
A7VLV6_9VIRU/1-508TKQPYAH.........LPIGVARYN.PDQDTGQGNEVWL.ATIFKGHYDK...PTVTDDFVIRGLPLWMAFYG..YWSYL
Q9JG50_9VIRU/1-535SNTTILDE........PVFQECRYN.PYKDKGYGNEAYFLSNVIAKKKAW..DPPDNKLLYNSGYPCWLLPWG..WLDWQ
A7VLW4_9VIRU/1-507QATAT...........HQIIQARYN.PNIDSGVGNQIYC.ASTHAYSWAP...PSKDKQLLIEGMPLWLGLFG..YYSFV
A7VM04_9VIRU/1-513TGQRPLGM........NPVNICRYN.PTLDSGKGNAIWL.VSSHANTYRE...PITDKTLIFEGLPLYMLLYG..YLSYV
A7VLY4_9VIRU/1-498QLA.............KPVLAFRYN.AQLDNGKGNSVWF.KSILTEDFSK...PKVDSDLIISDMPIWQALYG..FTDFI
CAPSD_TTVD1/1-324........................N.DMINK.VPNMWWK.......................EAANDWLTEWG.......
Q91CZ6_9VIRU/1-596NWP.............MAYRDISYN.PLNDKVVGNKLWL.QSIVKADTQF...HIPSCTYVLEDKPLWAACFG..YRDFI
A7VM08_9VIRU/1-506ADKAL...........LPLVPIRYN.PAADDGTGNLVTI.VDLVAGHWTG...NYT.EAYTIKNIPLWMALHG..YASYV
CAPSD_TTVV3/1-573.TP.............GAYQDIIYN.PFTDKGIGNIVWI.DWLSKSDAVY...SEKQSKCGIFDLPLWAAFFG..YAEFC
Q91D00_9VIRU/1-593.FR.............TAYMDVTYN.PLNDKGQFNRVWF.QYSTKPTTDF...NNTQCKCVLENIPLWSALFG..YSEYV
Q99AR5_9VIRU/1-604.FQ.............TAYVDTTYN.PLNDKGKGNKIWF.QYHSKVNTDL...RDRGIYCLLEDMPLWSMTFG..YSDYV
Q9DTD2_9VIRU/1-559.LK.............GPYTDVCYN.PLVDKGIGNIVWL.DWCSKEDSKF...DETKSKVPIRDMPLWAALFG..YAEYA
Q91D04_9VIRU/1-591.FI.............TAYTDVTYN.PLNDKGKGNQIWV.QYVTKPDTIF...NERQCKCHIVDIPLWAAFHG..YIDFI
CAPSD_TTVV8/1-571.IK.............GLYTDITYN.PMMDKGTGNKIWC.DSLTKADMKY...TEGRSKYLIENLPLWAAVWG..YLDYC
Q5ENX0_9VIRU/1-603.MW.............TAYRDIVYN.PLLDKGEGNRIWF.QYHTKKDNRY...SVPNCHWMLENLPLWSLLHG..YSEYL
O90364_9VIRU/1-590.TP.............GAYTDIKYN.PFTDRGEGNMLWI.DWLSKKNMNY...DKVQSKCLVSDLPLWASAYG..YVEFC
Q9IFV0_9VIRU/1-583.FP.............GLYQEVVYN.PLVDEGEGNIVWI.DWCSKDDTTF...RDLPQRYAVKDIPLWAAFMG..YRDYV
Q9QUE7_9VIRU/1-586.TK.............GAYTDICYN.PYTDRGEGNMVWI.DWLSKTDSRY...DKTRSKCLIEKLPLWAAVYG..YPEYC
A8DMR2_9VIRU/1-531PEK.............TVLTICRYN.PQNDRSAHNALYA.SPVTTARTKW..GATTKPELNTEGLPLWLLSFG..FHDWL
Q9DUH8_9VIRU/1-609.MW.............TAYRDIVYN.PFLDKGEGNKVWY.QYHTKTDNKY...DPTKCRYMVEDLPLWSLLHG..YADYI
A7VLW8_9VIRU/1-511KESKP...........LPLGVARYN.PVEDDGKGNEIWV.ASIHSNAYAK...PAE.DNLNFNGYPLWLAFWG..YWSYL
Q99AQ3_9VIRU/1-582.FP.............YAYADVTYN.PLTDKGVGNRMWY.QYNTKIDTQF...DAKCCKCVLEDMPLYAMAFG..HADFL

PF00729

CAPSD_PNLV/47-266----------------AVAATNLGEKQPELLNQYTPARAFIG---------------------TGGGMQ-----------
CAPSD_MCMVK/23-222----------------SAADKQMYSP..........GRFIVA---------------------I...PK-----------
CAPSD_PMVK/39-236----------------SDEDKGDYSV..........GRLVVG---------------------S...SK-----------
CAPSD_RCNMV/24-213----------------TTVDRKLVDF..........GQLLFV---------------------T...HS-----------
CAPSD_CARMS/51-245----------------ASDDAKLVDF..........GRLVLS---------------------T.YGFD-----------
CAPSD_SBMVA/46-262----------------STDFTTAVGVNVNIATPLVPARLIIA---------------------M.LDGS-----------
CAPSD_TBSVC/76-269----------------STSDHKLIDL..........GQLGIA---------------------T...YG-----------
CAPSD_POLVP/66-257----------------TTTDRKLVDL..........GQIGLA---------------------T...YG-----------
CAPSD_OCSVU/111-308----------------VAADNKLIDL..........GQVVVM---------------------S...DS-----------
CAPSD_TNVA/61-272----------------SAGFGALSVL...DQNQFCPASLVVA---------------------S..DGG-----------

PF11729

CAPSD_SJNNV/1-340----------------ILLGATQLDLAPANAVFVTDKPLPID---------------------YNLGVGDVDRAVYWHLR

PF00894

CAPSD_PLRV1/70-207----------------N---------------------------------------------------------------
CAPSD_PEMVW/53-187----------------T---------------------------------------------------------------
CAPSD_BYDVP/62-199----------------N---------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659----------------VENAQQDKGIAIPHDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAE

PF03115

CAPSD_HASV1/1-416----------------RAGERTTSDTVWQVLNTAVSAAELV----------------------TPPPFNWLVKGGWWFVK

PF00983

COAT_TYMV/8-177----------------VKDSIQYLDS----------PKLLIS--------------------------------------

PF00073

Q9WMA0_9PICO/49-215----------------NINNVVRIKVPFIYTRGAYH------------------------------------------FK
POLG_AEVCA/45-212----------------NINNVVRMKVPYIYSRGCYN------------------------------------------LR
POLG_CXA9/93-300----------------RTNNSATIVMPYINSVPMDN------------------------------------------MF
POLG_CXB3N/93-302----------------RTNNSATIVMPYTNSVPMDN------------------------------------------MF
POLG_CXB4J/93-300----------------RTNNSATIVMPYINSVPMDN------------------------------------------MF
POLG_CXA21/93-308----------------RTNNSATIVVPYVNSLVIDC------------------------------------------MA
POLG_POL1M/93-308----------------RTNNCATLVLPYVNSLSIDS------------------------------------------MV
POLG_POL3L/93-307----------------RTNNSATIVLPYVNALAIDS------------------------------------------MV
POLG_HE701/93-288----------------RTNNSATIVLPWMNSAPMDF------------------------------------------AL
POLG_BOVEV/93-285----------------RTNNSATLILPYVNAIPMDS------------------------------------------AI
POLG_HRV14/93-299----------------RTNNTATIVIPYINSVPIDS------------------------------------------MT
POLG_HRV2/93-302----------------RSNNSATIIAPYVNAVPMDS------------------------------------------MR
POLG_HRV8A/93-302----------------RTNNSATLILPYVNAVPMDS------------------------------------------ML
POLG_HRV1B/93-301----------------RSNNSATLIVPYVNAVPMDS------------------------------------------ML
POLG_FMDV1/311-475----------------RTNMTAHITVPYLGVNRYDQ------------------------------------------YK
POLG_FMDVT/311-475----------------RTNMTAHITVPYVGVNRYDQ------------------------------------------YK
POLG_FMDVO/311-475----------------RTNMTAHITVPFVGVNRYDQ------------------------------------------YK
POLG_EMCV/161-359----------------RTNTTVDLEVPYVNIAPTSS------------------------------------------WT
POLG_TMEVB/172-382----------------RTNTTVDLEVPYVNVAPSSS------------------------------------------WT
POLG_ENMGO/162-361----------------RTNTTVDLEVPYVNIAPTSS------------------------------------------WT
POLG_FMDVO/533-691----------------GLNSKFTFSIPYLSAADYAY------------------------------------------TA
POLG_FMDV1/533-692----------------GLNSKFTFSIPYVSAADYAY------------------------------------------TA
POLG_EMCV/420-582----------------GLNSSYSFTVPFISPTHFRM------------------------------------------VG
POLG_TMEVB/443-606----------------GLNSSFNFTAPFISPTHYRQ------------------------------------------TS
POLG_HE701/347-515----------------GLQSSITIIIPWISGSHYRM------------------------------------------FN
POLG_HRV2/358-522----------------GLQSTISMVVPWISASHYRN------------------------------------------TS
POLG_HRV8A/364-529----------------GLQSTASLVVPWVSASHFRF------------------------------------------TT
POLG_HRV1B/360-525----------------GLQSTISLVVPWVSASHFRL------------------------------------------TA
POLG_BOVEV/345-515----------------GLQSSITLVIPWISASHFRG------------------------------------------VS
POLG_CXA21/369-534----------------GLQSSCSMVAPWISNTVYRR------------------------------------------CA
POLG_CXA9/358-524----------------GLQSSCVLCVPWISQTHYRL------------------------------------------VQ
POLG_CXB4J/358-524----------------GLQSSCVLCVPWISQTHYRY------------------------------------------VV
POLG_CXB3N/360-526----------------GLQSSCVLCIPWISQTHYRF------------------------------------------VA
POLG_CXB1J/360-526----------------GLQSSCVLCVPWISQTHYRY------------------------------------------VV
POLG_FMDVO/725-872----------------..APLTRLALPYTAPHRVLA------------------------------------------TV
POLG_FMDV1/726-878----------------..APFTRLALPYTAPHRVLA------------------------------------------TV
POLG_BOVEV/610-775----------------D.GPPAQFSVPFMSSANAYS------------------------------------------TV
POLG_HRV8A/621-792----------------G.QPYPRFTIPFMSIASAYY------------------------------------------MF
POLG_HRV2/614-772----------------G.QAYPRFSLPFLSVASAYY------------------------------------------MF
POLG_HRV1B/627-786----------------G.QPFPRFSLPFLSIASAYY------------------------------------------MF
POLG_HE701/609-781----------------N.DPPARLTIPFMSINSAYA------------------------------------------NF
POLG_HRV14/614-787----------------G..DTSRFSVPYVGLASAYN------------------------------------------CF
POLG_CXA9/612-783----------------G.NAPARMSIPFISIGNAYS------------------------------------------NF
POLG_CXB4J/612-783----------------G.NAPPRMSIPFMSIGNAYT------------------------------------------MF
POLG_SVDVU/612-782----------------G.SAPPRMSIPFIGIGNAYS------------------------------------------MF
POLG_CXB3N/630-782----------------G.NAPPRMSIPFLSIGNAYS------------------------------------------NF
POLG_POL1M/636-806----------------G.TAPARISVPYVGISNAYS------------------------------------------HF
POLG_CXA21/642-812----------------G.NAPPRMSIPYVGIANAYS------------------------------------------HF
POLG_CXA24/646-809----------------G.SAPPRISIPYVGIANAYS------------------------------------------HF

PF00915

CAPSD_VESVA/137-421----------------GSIPS..DLIPRNSAHWLGN.RW------------------------WSMISGFSVQP...RVF
POLG_RHDVF/1768-2065----------------SISPAGLLTTPVLTGVGNDN.RW------------------------NGQIVGLQPVP...GGF
CAPSD_FCVUR/112-395----------------GSVPS..DLIPKTSSLWIGN.RF------------------------WSDITDFVIRP...FVF
CAPSD_NVN68/2-294----------------KTRP...FTLPNLPLSSLSNSRA------------------------PLPISSMGISPDNVQSV

PF08762

Q8B107_ALPV/599-804----------------GSIPVIGVQDLIQ.RNLVSVNIL------------------------TEAETT.......KALF
O56051_9VIRU/590-790----------------NSTD....SDVLDARNGFNRVIA------------------------RFHSDT.......SAYV
Q56QP7_9VIRU/684-855----------------........GEVELIKGKIQTPVE------------------------KGIKGE..........L
O36967_9VIRU/668-900----------------GTESPITINSVLR.GHLPPQIVA------------------------VAPQGTIATTDVVNAQF
Q5UBY1_9VIRU/79-259----------------..............KGYDASLMY------------------------YSNVGT.......NQIV
Q6ITS9_9VIRU/106-313----------------RANS....ETFYYSSGRNNLDIS------------------------TSPPSI.......NRYY
Q4JFT2_9VIRU/834-1009----------------DSKSFPQLSDL.........SIS------------------------NLERTE.......NEYF

PF02247

POL2_SQMVM/246-618----------------N...LESFPHKLVQFREIQGRT.TITFTQSEFLTAWSTQVLSTVNPQKDGCPHLYA------LL
POL2_CPMVS/460-832----------------F...YESFPHRIVQFAEVEEKC.TLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYA------II
POL2_BPMV/447-819----------------N...FEAFPHKLVQFGEIQEKV.VLKFSQEEFLTAWSTQVRPATTLLADGCPYLYA------MV
Q9Z006_9SECO/476-846----------------NMQILDSLPHIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFV------LY
O12663_9SECO/321-691----------------NMQILDSLPHIDFTFSAGSKSTRSVRFPKEIFGVYQALDRWDLDSARGDDVSGNFV------LY
Q9YWK0_9SECO/363-735----------------N...LESFPHKLVQFAEIQGRT.TITFTQGEFLTAWSTQVLSTVNPQKDGCPHLYA------LL
POL2_CPSMV/437-806----------------N...FEAFPHKLIVFSDKQDRT.TISFSKDEFLMAWSTQVRPDTKLSEDGCPYLYA------IT
POL2_RCMV/407-778----------------....LEDFPNKLIQFGEVQERV.EITFTRKEFLTAWSTQVDPAGPVAGDGCPYLCA------MV
Q9YWJ9_9SECO/452-824----------------N...LESFPHKLVQFAEIQGRT.TITFTQSEFLTAWSTQVLSTVDPQKDGCPHLYA------LL
Q66170_CPMVS/343-715----------------F...YESFPHRIVQFAEVEEKC.TLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYA------II

PF03391

CAPSD_TRSV/179-344----------------Q---VLWGPHQIMHG.DGQFEI-AIKTR---------LHSAAT.TEEGFGRLGILP......LS
POL2_RRVS/768-936----------------D---IVTRKHWIVKS.NEIFEV-DLYCP---------YGENPTFTGQANGKPFIIVHK....LG
POL2_BRAV/1268-1433----------------E---ALVFPGFRLPSGEGKFHI-KVQTP---------YGRLSTLTPDCALYVYLAG........
Q65029_ARMV/745-916----------------Q---LFKYPGCYIEE.DGSFAI-EIRSP---------YHRTPLRLIDAQSASSFTSTLNFYAIS
POL2_ARMVS/792-963----------------Q---LFKYPGCYIEE.DGSFAI-EIRSP---------YHRTPLRLIDAQSASSFTSTLNFYAIS
Q67703_GFLV/166-336----------------E---LFKYPGVYVEE.DGSSEV-KIRSP---------YHRTPARLLAGQSQRDMSS.LNFYAIA
POL2_GFLV/771-941----------------E---LFKYPGVYVEE.DGSFEV-KIRSP---------YHRTPARLLAGQSQRDMSS.LNFYAIA
POL2_BRSV/1007-1170----------------Q---LAQMPHVDVEV.NVDASL-QIQSP---------FFSTAN.FGNSGSAFYVST......LC
POL2_GCMV/981-1144----------------Q---LSQMPHVDCDV.DVVSSL-KIQSP---------FYATAN.FGDSGARFWVTP......MS
POL2_TORVR/1497-1662----------------T---AYQRPHYILA..DGQGAF-SLPIS---------TPHAATSFLEDMLRLEIFA......IA
Q88483_9SECO/1003-1166----------------E---LAQIPHVDVTL.DAKATL-QIQSP---------FFATAN.FGDDGTAFYIAT......LC

PF03689

A3FEM9_9SECO/10-101--------------------LDAFGRYD----------------------------------------------------
Q9QAH4_9SECO/9-99--------------------FDAYRRI.----------------------------------------------------
Q09G89_GFLV/608-698--------------------FDAYNRI.----------------------------------------------------
Q9JGK5_SDV/160-249--------------------WDDLSQF.----------------------------------------------------
Q9IV56_9SECO/636-727--------------------ADFYNRIK----------------------------------------------------
A1YYW2_BRAV/156-247--------------------IDAFDRLL----------------------------------------------------
Q65624_9SECO/45-137--------------------CDYFGRLS----------------------------------------------------
Q6JX06_9SECO/849-939--------------------FDAYGHI.----------------------------------------------------
Q20LA0_9SECO/601-691--------------------FDAYRRI.----------------------------------------------------
POL2_BRSV/842-932--------------------FDAYGKI.----------------------------------------------------
A0A9J8_ARMV/580-670--------------------FDAYNRI.----------------------------------------------------
Q6JX05_9SECO/604-694--------------------FDAYNRI.----------------------------------------------------
Q9Z0D6_SDV/74-163--------------------WDDLSEL.----------------------------------------------------
Q9QRA5_9SECO/10-101--------------------LDAFNRYD----------------------------------------------------
Q86631_9SECO/85-173--------------------CDVFNRSK----------------------------------------------------
POL2_GCMV/815-905--------------------FDAYGKI.----------------------------------------------------
A2ID55_9SECO/270-361--------------------LDVANRLG----------------------------------------------------
Q64959_9SECO/4-94--------------------FDAYGHI.----------------------------------------------------
Q8B5P7_TRSV/12-103--------------------FDDYKRID----------------------------------------------------
Q88483_9SECO/838-928--------------------FDAYGKI.----------------------------------------------------
POL2_CNSV/688-778--------------------IDGTGYL.----------------------------------------------------

PF00760

CAPSD_CMVFN/11-215---------------------SAMR--ADIGDMRKYAVL--------------VYSKDDALETDELV-----------LH

PF01318

CAPSD_BMV/2-188---------------------DAFRG-ATLGDLLNLQIY--------------LYA-SEAVPAKAVV-----------VH

PF03566

Q80IX5_PRVFL/54-754NNALGLRGIVDTFENNFSSAVVHFWG-ISQSATIVCKTYDGWEGTTNAGSTVGQFAHTGAEEEDEVVQLANR------LQ
CAPSD_NCBVS/1-608DYHRAIGGLQDTIDSNFAIGVAAMTG-MSTSTVPYFKVFRRFEAIPAEGSPWGPFASATPPKDDVALTVART------WT
CAPSD_HASV/2-647RDLPDYTGIRDSFDQNMSTAVAHFRS-LSHSCSIVTKTYQGWEGVTNVNTPFGQFAHAGLLKNEEILCLADD------LA

PF01829

CAPSD_NODAM/42-399GDMDAIAILVTTPTGAVNTAVLKVWACVEYRPNPNSTLY--------------EFARESPANDEYALAAYRK------IA

PF08435

Q91H09_9CALI/305-535----------------SEVALLRFVNPDTGRALFESKLH-----------------------KQGFMTI..A------SS
Q8JMP1_9CALI/305-540----------------ADVALIRYVNPDTGRTLFEAKLH-----------------------RSGFITV..S------HT
Q8B4Z2_9CALI/297-515----------------SDVALLNYVNPNTGRVLFEAKLY-----------------------ANGFLTV..N------LG
Q917X1_9CALI/305-538----------------GDVALVRYVNPDTGRVLFEAKLH-----------------------KGGFLTV..S------ST
Q9IV43_9CALI/304-537----------------GEAALVHYVDPDTNRNLGEFKLY-----------------------PEGFITC..V------PN
Q8VA02_9CALI/306-539----------------GEAALLHYLDPDTHRNLGEFKLY-----------------------PDGFMTCVPN------SS
Q9IV49_9CALI/306-538----------------SEVALIRFINPDTGRVLFEAKLH-----------------------KQGFITV..A------HT
Q6EAX3_9CALI/306-538----------------SDVALIRYVNPDTGRTLFEAKLH-----------------------RTGYITV..A------HS
Q8BAC6_9CALI/304-534----------------SDIALVRFINPDTGRVLLEAKLH-----------------------KQGFLTV..A------AS
Q6WQW7_9CALI/296-512----------------SDVALLNYINPDTGRVLFEAKLY-----------------------SSGFLTV..N------LG
Q6B7R3_9CALI/303-535----------------SDVALVRYVNPDTGRTIFEAKLH-----------------------RQGFITI..A------AT
Q6EAW7_9CALI/305-538----------------SSVALLRYVNPDTGRTLFEAKLH-----------------------KEGFITV..S------ST
Q66418_9CALI/306-538----------------GEAALLHYVDPDTHRNLGEFKMY-----------------------PEGFMTCVPN------SS
Q80FL2_9CALI/317-546----------------TQVALVRYVNXDTGRVLFEAKLH-----------------------KLGFMXI..A------KD
Q9IV42_9CALI/305-535----------------GEAALLHYVDPDTGRNLGEFKLY-----------------------PDGFMTCVPN------SV
Q6XDL5_9CALI/307-546----------------SDVALVRYVNPETGRTLFEAKLH-----------------------RNGFLTV..A------RN
Q6B7R2_9CALI/304-538----------------GDAALLHYVDPDTHRNLGEFKLY-----------------------PEGYITCVPN------TG
Q917X4_9CALI/305-533----------------TDVALIRYTNPDTGRVLFEAKLH-----------------------RQGFITV..A------NS
Q783W9_9CALI/306-535----------------TDVALIRFVNPDTGRVLFEGKLH-----------------------KQGFITI..S------NS
Q80J94_9CALI/309-538----------------SEALLLRYRNTLTGQLLFECKLY-----------------------NEGYIAL..S------YS
Q913B6_9CALI/305-540----------------SEVALVRYINPDTGRALFEAKLH-----------------------RAGFMTV..S------SN
Q8JW44_9CALI/304-539----------------GDAALLHYVDPDTNRNLGEFKLY-----------------------PGGYLTCVPN------GV
Q83876_9CALI/301-524----------------GEGPLLHYVDPDTDRNLGEFKAY-----------------------PDGFLTCVPN------GA
Q9IV48_9CALI/306-533----------------GEAALLHYVDPDTHRNLGEFKLY-----------------------PDGFITC.VP------NT
Q8V713_9CALI/316-545----------------SDVALVRYVNPTTGRVLFEAKLH-----------------------KQGFLTV..A------AS
Q91I85_9CALI/304-538----------------GEAALLHYVDPDTNRNLGEFKLY-----------------------PGGYLTCVPN------SS
Q8JXJ0_9CALI/304-537----------------GEAALLHYVDPDTNRNLGEFKLY-----------------------PEGFITC..V------PN
Q783X1_9CALI/315-545----------------SAVALIRYVNPDTGRNIFEAKLH-----------------------REGFITV..A------NS
Q783Y0_9CALI/305-533----------------SDVALIRFTNPDTGRVLFEAKLH-----------------------RSGYITV..A------NT

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------KDVLEKGIPT------LQ
POLG_POL1M/2-69--------------------------------------------------------------KDVLIKTAPM------LN

PF11492

Q7T7T5_HARNA/2003-2059------------------------------------KLF-------------------------GY--------------
POLS_CRPVC/291-340------------------------------------KLF-------------------------GF--------------
Q2HWK2_RSET1/357-413------------------------------------SLF-------------------------GY--------------
POLS_ABPVR/340-396------------------------------------AIF-------------------------GW--------------

PF08935

Q9WJ28_PTV1F/119-191----------------------------------IGPLL-----------------------------------------
Q9DLK1_FMDVP/202-285----------------------------------FGALL-----------------------------------------

PF01766

POLS