Sequence alignment for CL0055

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754ASANQAGKRLEPRKRTRSIRSRQDLDTMHRVVVSVDVDSLTTLMGNIMTLAGSGGRGSLLTAGDVEKNPGPQMTRENKAP
CAPSD_NCBVS/1-608MDANV.........QIRPAR..............................................NNP...........
CAPSD_HASV/2-647GDAGVASQRPHNRRGTRNVR............................................................

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226------------------------RR-----------------------------RYRRRRHRPRSHLGQILRR------
Q27W03_PCV1/5-227------------------------RR-----------------------------RYRRRRTRPRSHLGNILRR------
A3FEQ4_9CIRC/3-256------------------------RS-----------------------------TYRRAYRA.......RRRR------
Q3HUU1_GOCV/5-247------------------------RA-----------------------------RPRSLYYR.......RRRA------
Q1L2D2_9CIRC/1-237------------------------ML-----------------------------LSRRRWRRGLRP...RYRR------
CAPSD_CACV/7-243------------------------QV-----------------------------ARRRRPLAPRRR...RWRR------
Q0H9S8_9CIRC/4-236------------------------QV-----------------------------ARRRRQTQAIRR...RWRR------
Q06J73_9CIRC/8-245------------------------HF-----------------------------LIQRRMRHWRRRRHLRMRR------
Q9DXG3_BFDV/11-242------------------------TF-----------------------------QIRRRYARP......Y.RG------
Q69EZ5_BFDV/7-239------------------------IF-----------------------------QIRRRYARP......YVRR------
Q9DXG0_BFDV/11-242------------------------IF-----------------------------QIRR.IARP......RYRR------
Q9DXF4_BFDV/3-235------------------------HF-----------------------------QIRRRYARP......Y.RR------

PF02956

A7VLZ2_9VIRU/1-506-----------MPF.WWARR....KR..WWRGRR.....................RPFYRRRYHYKKRRP..RR......
Q9WT88_9VIRU/1-603-----------MA..YWFRR.........WGWRPRR..RWRRWRRRR..RRLPRRRTRRAVRGLGRRRKPRVRR..RRRT
Q91CY9_9VIRU/1-581-----------MAFRWWWWR....RR.PQRRWTRRR...WRRL.RTR........RPRRTVRRRRRRPRV...R..RRRW
A7VLY0_9VIRU/1-515-----------MPF.WWARR....KK..PWYSN......................WNRYRRRYKRRRWPR..RR..RRRI
Q9JGT1_9VIRU/1-585-----------MAYRWWRRR....SR..RWRRRRWR..RWRRRRRP.........RRRRPARRCRRRRTV..RR..RRR.
Q80QT8_9VIRU/1-595-----------MA..WWGRW....RR...WRWRPRR...WRRRRRRR....VPRRRAQRPVRRRRRRVR.......RRRW
CAPSD_TTVB1/1-533-----------MPPFYYRRR.........WYSNPWR...................RKRLRFRRRRLRRPI..RKRFRR..
A7VM00_9VIRU/1-509-----------MAF.WWYRR....NK..PWFGR......................YKRRRTRRYKRTWRT..RR..RRP.
Q9JG61_9VIRU/1-534-----------MPPFNYYRR....R....YFYRPRR...................YRRRWFTTWRPRQTL..RRRFRR..
Q91PS3_9VIRU/1-581-----------MWWNWW..K....RR..RWR.PRRR.WRT.RR.RRRLPV.....WRRRRTTRYARRRRV..RRLRRRR.
CAPSD_TTVV4/1-560-----------M...WWWRR....RF...WR.PKRR.WRWRRR.RRRPLA.....RRRRRPARLARRPRV...R..RRRF
Q91C93_9VIRU/1-546-----------MPW..........RN...YYYRRRR...................RPRRFWRRRFRTPIY..RRFWRR..
Q2F827_9VIRU/1-589-----------MAWSWWWRR....RK..RWWPRRRR..RWRRF.RTR........RARRAVPRRRRRRRV...R..RRRW
Q91CY5_9VIRU/1-584-----------MAWRWWWQR....RR..RWWPRRRR..RWRRL.RRR........RPRRPVRRRRRRATV...R..RRRW
Q8V7G9_9VIRU/1-572-----------MAW..YRYR....RR..PWRRRRRPRWGLRRR............RFRRSFRGRGRRRYV..SRWSRRRY
Q99A78_9VIRU/1-584-----------MAYGWWARR....RR..RWRRWKRR..PWRRRWRT.........RRRRPRRRYRRRRHV..RR..RRR.
Q6H9C2_9VIRU/1-573-----------MAWGFWGRR....RRWRRWRARRRR...WRPR.RR.........RRRRPTRRFRARRRV..RR..RG..
CAPSD_TTVT1/1-433-----------MRF....RY....RK...WR........................RPRRLFRSRRRRGYA..RRRWRRRA
Q9JG80_9VIRU/1-589-----------MAWGWWRRW....RR...WPARRWRRRRRRRPVRRR........RAGRPARRYRRRRTV...RTRRRRW
A7VLZ6_9VIRU/1-506-----------MPF.WWRRR....RR..FWTNRR.....................FTYKRRKRYPRRYN...RR......
Q6H9D2_9VIRU/1-557-----------M...WWWRR....RR...WRAPWRR.RRW..R.RRRPRT.....RRFRRAARRPRRPRV...R..RPRR
Q6H999_9VIRU/1-471-----------M....................................................................
Q77JT5_9VIRU/1-606-----------MAWRRWRWR....PW...WRRRRRR..RWRRR.RRRP.......RRRRPYRR.RRPRRV..RR..RR..
Q91PS7_9VIRU/1-585-----------MWWNRW..K....RY..RWR.PLRR.WRT.YR.RRRPLR.....WRRRGAARRPRRRRV..RRW.RRR.
CAPSD_TTVV9/1-555-----------MPWWPWRRW....RR...WR...RRRGNWRRRVAPR........RYRRTARRARRRRKAV.RR..RRRR
Q9JG47_9VIRU/1-553-----------MPF.....Y....KRWRRWRWRR.....................RPRRLWRRRFRRPLY..RRFWRR..
A7VLW0_9VIRU/1-507-----------MAF.WWRRR....RK..PWFG...........................RWRRYRRRTNYKPRR..KRRR
Q0ZLH9_9VIRU/1-573-----------MAWRWWWRR....RR..PW.....R.WRW.RR.RRRPARR....RRRRRPARRARRPRV..RRW.RRR.
Q5ENW7_9VIRU/1-501-----------MAP.....T....RR...WRR.......................RFGRRRRRYRKRRYGWRRRYYRYRP
A7VLX2_9VIRU/1-509-----------MPF.WWARR....RK..PWYGRF.....................RRRYRYRPYKKR.....RR..RRR.
Q80AR5_9VIRU/1-594-----------MAWGWWLKR.WRRRKKPAWKKWRTR..RWRRF.RRR........RPKRTYGRRRRRRTV......RRRR
Q91CZ2_9VIRU/1-601-----------MAYSYWWRR....RR...WPW..RG..RWRRW.RRR..RRIPRRRPRRPVRRYRRR.PV..RR..KRRW
CAPSD_TTVG1/1-514-----------MPF.WWGRR....NK..FWYG.............................RNYRRKKRRFPKR..RKRR
Q98Y63_9VIRU/1-581-----------MAWRWWWAR....RR.PNRRWTRRR...WRRL.RTR........RPRRPVRRRRRRPRV...R..RRRW
Q9QU36_9VIRU/1-529-----------MPYFY........RR...WFPRRR....................RFRRSWRRRIRGPFR..RKYWR...
A7VM12_9VIRU/1-509-----------MPF.WWRRR....RK..PWYG.......................RFRYRRRFQTKRRRN..RR......
A7VLV6_9VIRU/1-508-----------MPF.WWARR....RR..PWFGRY......................KRYKTRRYRRRFRP..KR..HRY.
Q9JG50_9VIRU/1-535-----------MPPYNYYRW....NNWRRPTYRRRR...................WRRRQYRRRRPRPFIR.RRFWR...
A7VLW4_9VIRU/1-507-----------MPF.WWNRR....RK..NWWG........................YKYKTRKYRRRRWP..RR..RRQT
A7VM04_9VIRU/1-513-----------MPF.YWRRR....RK..FWWGKA.....................RPRWRFQRYRRKTT...RR..RRRR
A7VLY4_9VIRU/1-498-----------MPF.WWNRR....KR..WWRGAR.....................RPWYKRKRYTRRYR...RR......
CAPSD_TTVD1/1-324-----------MAY....FR....RN..FYGGRRHY...................YRRRNAYTRRRYRRV..RR......
Q91CZ6_9VIRU/1-596-----------MA..YWWRR....RR...WPW..RR..RWRRR.GRR..RRVPRRRYRRPVRRYRKRYTV..RR..RRRR
A7VM08_9VIRU/1-506-----------MPF.WWTRR....RK..PWFGT......................WRQRRYRRRRRRTTY..KR..RKP.
CAPSD_TTVV3/1-573-----------MAWYWWRRR....RRRGWWKPRRRR...WRRR.RA.........RRRGPARRHRARRRV..RR..RR..
Q91D00_9VIRU/1-593-----------MAWRWWWRRRWKPRRRPAWTKYRRR..RWRRL.RPR........RPRRLARGRRRRRTV......RRRR
Q99AR5_9VIRU/1-604-----------MA..WWGRW....RR...WPRRRWR..RWRRRRRRR....LPTRRTRRAVRGLGRRPRKTVRR..RRRR
Q9DTD2_9VIRU/1-559-----------MAFWWWRRR....RR.ARWRRRAAA.RRWRRR.RP.........RRRRAARRAGRRRRV..RR..RR..
Q91D04_9VIRU/1-591-----------MAWTWWWQR....RR.RRWPWRRRR...WRRL.RTR........RPRRLVRRRRKRYRV..RR..RRRW
CAPSD_TTVV8/1-571-----------MAWP.WRRR....RW..RWRRRRPRWRRWRRR.RT.........WRRRP.RRAVRRRRV..RR..R...
Q5ENX0_9VIRU/1-603-----------MAWWGW.......RRRWGWRPRWRRRRRWTRR.RRR....VPARRPRRPVRRHRKRYRV...R..RRRW
O90364_9VIRU/1-590-----------MAYGWWRRR....RR..RWRRWRPR..PWRPRWRT.........RRRRPARRRGHRRNV..RR..RRRG
Q9IFV0_9VIRU/1-583-----------MAWRWWWRR....RR..RWP.RRRR.TTW.RR.RPRP.......RRRRRTARTRRRGRV..RRW.RRR.
Q9QUE7_9VIRU/1-586-----------MAYGWWRRR....RR..RWKRWRRR.PRWRRPWRT.........RRRRPARRRGRRGTV..RR..RRR.
A8DMR2_9VIRU/1-531-----------MPY..............YWRGWRRR...................RRRRFWRRRAGAPFRR.RRYWRY..
Q9DUH8_9VIRU/1-609-----------MPWGWW.......RR...WRRRPRRWRRWRRWGRR.........RTRWGLRTRRARAAV...R..RRRR
A7VLW8_9VIRU/1-511-----------MPF.WWGRR....RK..YWWGRR.....................FTRPKYRRYQ.......RR..RKR.
Q99AQ3_9VIRU/1-582-----------MS..WWGWR....RR...WWWKPRR..RWRRR.RARRPRRLPRRRYRRPTRRYRGR.RV..RR..RRAG

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------LRSTAD
POLG_RHDVF/1768-2065--------------------------------------------------------------------------GKARAA
CAPSD_FCVUR/112-395--------------------------------------------------------------------------....KA
CAPSD_NVN68/2-294--------------------------------------------------------------------------MMASKD

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINV
POL2_CPMVS/460-832MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNI
POL2_BPMV/447-819METNLFKLSLDDVETPKGSMLDLKISQSKIALPKNTVGGTILRSDLLANFLTEGNFRASVDLQRTHRIKGMIKMVATVGI
Q9Z006_9SECO/476-846Q........TNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLN.ELSKHSAVHTGLLNMLSKIPGSLKVKINCQV
O12663_9SECO/321-691Q........TNNFAIESATETMRLLFSGHASIPLNVIPGTKITVAYLN.ELSKHSAVHTGLLNMLSKIPGSLKVKINCQV
Q9YWK0_9SECO/363-735NELDLAQLSLDDTSSLRGSVLQTKLATSRVILSKTMVGNTILRENLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINV
POL2_CPSMV/437-806D...LFKRNLDDVSTISDTMLGAMIGQTKVVIPKTLVAGTVLKSGPLSDVMQQGSFRSTIALQRTHIITGKIHVVAMLET
POL2_RCMV/407-778TDTDLFKLSLDDTSSPKGSLLDTRFAQKKVLIPKAMAGGADLLSSNLYDVLSGSSFRASLALARTHVVEGKIRCICTINL
Q9YWJ9_9SECO/452-824NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINV
Q66170_CPMVS/343-715MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNI

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------RNRRRRPRRGSR-----SAPSSADANFRVLSQQLS-RLNK--------T-----------------

PF01318

CAPSD_BMV/2-188--------------------------------STSGTGKMTRAQRRAAA-RRNR--------W-----------------

PF03566

Q80IX5_PRVFL/54-754NMSVRAQNVTVSNSRRRRRKNRKPRK.....QVEQATILKPQLLPGESV-APSG--------G-----------------
CAPSD_NCBVS/1-608.....SQGNQGRNNNNKRRRRRRGLKLPPVVAPITSPGQMAEPANHANT-RVNR--------G-----------------
CAPSD_HASV/2-647...VSANTVTVNGRRNQRR..RTGRQVSPPDNFTAAAQDLAQSLDANTV-TFPA--------N-----------------

PF01829

CAPSD_NODAM/42-399----------MAATNNMLKMSAPGLDFLK--CAFASPDFSTDPGKGIPD-KFQG--------L-----------------

PF08435

Q91H09_9CALI/305-535----------LTNLDGSPIDPTDDTP-----GPLGCPDFTGLLYGVASQ.RGPG........D-----------------
Q8JMP1_9CALI/305-540----------LTYPNGASYDPTDEVP-----APLGTQDFSGMLYGVLTQ.DNVNV....STGE-----------------
Q8B4Z2_9CALI/297-515----------LFQPNQEDFHAGSA.P-----APFGFPDFSECSVTFVVS............SA-----------------
Q917X1_9CALI/305-538----------ITNLNGTQFDPTDDVP-----APLGVPDFAGEVFGVLSQ.RNRGE.....SNP-----------------
Q9IV43_9CALI/304-537----------LTELDGSPFLAFEA.P-----APTGFPDLGTSDWHIEMS.LNSNS.....QSS-----------------
Q8VA02_9CALI/306-539----------LTELDGSPYHAFES.P-----APVGFPDLGECDWHMEAS.PTTQ.......FN-----------------
Q9IV49_9CALI/306-538----------ITNTDGTPIDPTEDTP-----GPIGSPDFQGILFGVASQ.RNKNE.....QNP-----------------
Q6EAX3_9CALI/306-538----------LTNLNGTPFDPTEDVP-----APLGTPDFTGLLFGVASQ.RNVGS.....NPN-----------------
Q8BAC6_9CALI/304-534----------LTNLDGSPIDPTDDMP-----APLGTPDFQAMLYGVASQ.RSSR.......DN-----------------
Q6WQW7_9CALI/296-512----------LLEPDESAFVVGER.P-----ATLGFPDFSQCVLNLLLA............DG-----------------
Q6B7R3_9CALI/303-535----------LVHPNGATYDPTEDVP-----APFGTQDFRGILYGVLTQ.NPRAS.....GDE-----------------
Q6EAW7_9CALI/305-538----------VSNLNGTPFDPTDDVP-----APLGMPDFSGQIFGVVSQ.RDTG......TNP-----------------
Q66418_9CALI/306-538----------LTELDGSAYHAFES.P-----APIGFPDIGDCDWHMSAT.ATNN.......FT-----------------
Q80FL2_9CALI/317-546----------LDNLNGTPYDPAEDXP-----GPLGTPDFQGIVFGVASQ.RNSD........G-----------------
Q9IV42_9CALI/305-535----------LSEVDGTPFIPLES.P-----APVGFPDLGSCDWHVNFTFQAQN.........-----------------
Q6XDL5_9CALI/307-546----------VTNLNGTPFDPTEDVP-----APLGTPDFSGQIYGVISQ.RNTNTVPGEGNLP-----------------
Q6B7R2_9CALI/304-538----------LSELDGSPYHAFES.P-----APVGFPDLGHCDWHVSSF.KADQ.......NS-----------------
Q917X4_9CALI/305-533----------VTNANGTPFDPTEDAP-----APLGTPDFLANIYGVTSQ.RNPD........N-----------------
Q783W9_9CALI/306-535----------LENLDGSPVDPTDEVP-----APLGTPDFQAQLFGVISQ.RSSD........N-----------------
Q80J94_9CALI/309-538----------LIEQDGSAYVPGDR.A-----APLGYPDFSGQL.EIEVQ.TETTKT..GDKLK-----------------
Q913B6_9CALI/305-540----------ITNLNGSPFDPSEDIP-----APLGVPDFQGRVFGVISQ.RDKQNAA.GHSEP-----------------
Q8JW44_9CALI/304-539----------LTEVDGKPFMAFDS.P-----APVGFPDFGKCDWHMRIS.KTPNN.....TSS-----------------
Q83876_9CALI/301-524----------LTELDGTPFHPFEG.P-----APIGFPDLGGCDWHINMT...........QFG-----------------
Q9IV48_9CALI/306-533----------LTELDGTPYHAFES.P-----APLGFPDIGACDWHVFNF.QSGS.......NS-----------------
Q8V713_9CALI/316-545----------LENLDGSPYDPTDDIP-----AVLGSPDFQGVMFGILSQ.RNTD........G-----------------
Q91I85_9CALI/304-538----------LTELDGSPFMAFAA.P-----APAGFPDLGSCDWHIEMS.KIPNS.....STQ-----------------
Q8JXJ0_9CALI/304-537----------LTELDGSPFLAFEA.P-----APAGFPDLGKCDWHVEMSLYQDN.......NH-----------------
Q783X1_9CALI/315-545----------LKNLDGTPYDPTDEVP-----AVLGAIDFKGTVFGVASQ.RNTTG....SSVG-----------------
Q783Y0_9CALI/305-533----------VTNINGTPFDPTEDVP-----APLGTPDFSGKLFGVLSQ.RDHD........N-----------------

PF02226

POLG_HRV8A/2-69----------------------------------GAQVSRQNVGTHSTQNSVSN--------------------------
POLG_POL1M/2-69----------------------------------GAQVSSQKVGAHENSNRAYG--------------------------

PF11492

Q7T7T5_HARNA/2003-2059------------------------------GDEYETAKTSPLSISGTLT-------------T-----------------
POLS_CRPVC/291-340------------------------------LETNNSPSTALGQISEGLT-------------T-----------------
Q2HWK2_RSET1/357-413------------------------------SQSGKQDEYGEGVLSKPAS-------------A-----------------
POLS_ABPVR/340-396------------------------------....KTENPKIGPISELAT-------------G-----------------

PF08935

Q9WJ28_PTV1F/119-191----------------------------------GTGTSRMENGNTNNS-------------------------------
Q9DLK1_FMDVP/202-285----------------------------------GAGQSSPTTGSQNQS-------------------------------

PF01766

POLS_IBDVU/9-452QQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPG--------F-----------------
POLS_DXV96/2-442NTTNEYLKTLLNPAQFISDIPDDIMIRHVNSAQTITYNLKSGASGTGLIVVYPN--------T-----------------
POLS_BSNV/7-428NTQIRYLNSLLVPETGSTSIPDDTLDRHCLKTETTTENLVAALGGSGLIVLFPN--------S-----------------
POLS_IPNVJ/5-453KATATYLRSIMLPENGPASIPDDITERHILKQETSSYNLEVSESGSGLLVCFPG--------A-----------------

PF02443

Q5Y4T0_PCV2/5-226----------RPWLVHPR..HRYRWRRK..-.......NGIFNTRLSRTIGYTVK..-----------------------
Q27W03_PCV1/5-227----------RPYLAHPAFGNRYRWRRK..-.......TGIFNSRLSTEFVLTIK..-----------------------
A3FEQ4_9CIRC/3-256----------RGLRR......RLRRRRLRI-GRPRRRFS.VVTFKVTRHTVFGFFGS-----------------------
Q3HUU1_GOCV/5-247----------ANRRR......RYRRRRLHI-GRIRSKYT.IFNVKQTQNISFTFF..-----------------------
Q1L2D2_9CIRC/1-237----------RHYRR......RRRTRRLPR-NRRGHRANRVYYFRLRHSVKVTLQ.K-----------------------
CAPSD_CACV/7-243----------RYWXR......R...RRIPA-NRRGHRTNRVYRFRFVREFGQVLQ.K-----------------------
Q0H9S8_9CIRC/4-236----------RHWRR..........RRL.T-NRRGHRTNRVYRFKFVRMYRQECA..-----------------------
Q06J73_9CIRC/8-245----------RHWRR......R...RRIPA-NRRGHRTNRIYRIKLVRQYQQILG.K-----------------------
Q9DXG3_BFDV/11-242----------RHIR.......RYRRRRRHF-RRRRFSTNRIYTLRLTRQFQFKIN.K-----------------------
Q69EZ5_BFDV/7-239----------RHIR.......RYRRRRRHF-RRRRFTTNRIYTLRFKRQFKFQIE.K-----------------------
Q9DXG0_BFDV/11-242----------RHIR.......RYRPRRTYF-RRRRFSTNRIYTLRLKRQFKFEIR.K-----------------------
Q9DXF4_BFDV/3-235----------RHIRR.....YRYRQRRRHF-CRRRFTTNRLYTIRLKREFKFDIN.K-----------------------

PF02956

A7VLZ2_9VIRU/1-506RLYKRKHR..RTYRRRRKSFRKVRRKRRTL.PLKQWQPETIRKCKVKGIGIHTLGVE...GTQYRCYTANKYEYTIA...
Q9WT88_9VIRU/1-603RRRTY.....RRGWRRRRYIR.RGRRKKKL.ILTQWNPAIVKRCNIKGGLPIIICGE...PRAAFNYGYHMEDYTPQ...
Q91CY9_9VIRU/1-581GRRRGRRRLYRRTYRKR......RKRRKKM.TLKMWNPSTIRACNIRGFIALVVCGH...TRAGCNYAIHSEDYIPQ...
A7VLY0_9VIRU/1-515PYGRRR........RRRRRKRKVRRKRQRI.IVKQWQPESIVKCEIKGLGCLVAGAQ...GRQPFCYTNSKYEYPQP...
Q9JGT1_9VIRU/1-585GR.WTRTY..RRWRRKG.....RRRSKKKL.IIRQWQPNYRRRCNIVGYMPLLICGE...NTVARNYATHSDDCYFP...
Q80QT8_9VIRU/1-595GRRRW.....RRGYRRRLRLRRRRRRRKKI.ILTQWNPAKVRKCTIRGVLPMILAGA...GRFAFNYGLHSDDITVQKPL
CAPSD_TTVB1/1-533..........RRWVRRRRFFR.FKRKLRKI.RIDQWQPETIRKCHVKGNLCLLTCGR...GNINHNYILTSESYVPT...
A7VM00_9VIRU/1-509.IRRRRNR..RTNRRRRRRRYKVRRKQKKI.TLKQWQPESIKKCKIKGTGQIVLGAE...GTQFRCFTVYKNEFTNP...
Q9JG61_9VIRU/1-534..........RRWVRKRRFFKYKKRKLKKI.RLSQWQPDSIRKCTIKGQLCLLTCGI...GRINNNFTLTAESYVPI...
Q91PS3_9VIRU/1-581RRGWAR....RRYLRARR....RVKRRKKI.KLTQWNPTVVKKCVVKGYLPLLICGTGTTGTTYRNYGSHMHDYRKY...
CAPSD_TTVV4/1-560QWGRPR....RYRPRRRR....RRRKRQKI.KLKQWNPAVTKFCRIIGYYPLIICGE...GTTVRNYNVHSQDYVQY...
Q91C93_9VIRU/1-546..........RYRVRKRH....FKRKLSKL.TIQEWQPPSIRKLTIKGYYPLFQSTR...DRLSNNMITYLESIAPH...
Q2F827_9VIRU/1-589GRRRRRRRV.FYKRRRRKTGRLYRKPKKKL.VLTQWHPTTVRNCSIRGLVPLVLCGH...TQGGRNFALRSDDYPKQ...
Q91CY5_9VIRU/1-584RGRRGRRTYTRRAVRRR......RRPKKKL.VLTQWSPQTVRNCTIRGIVPMVICGH...TRAGRNFAIHSEDFTSQ...
Q8V7G9_9VIRU/1-572RRRRR.....RGRRRRGR....RRRKRQTL.IPRQWQPDVTKKCFITGWMPLIICGT...GHTQFNFITHEEDIPGA...
Q99A78_9VIRU/1-584GR.WRRRY..RKWRRKG.....RRRGKKKI.IIRQWQPNYRRRCNIIGYMPVLICGN...NTVSRNYATHSDDSYLP...
Q6H9C2_9VIRU/1-573GR.WRRRY..RKWRRGRR....RRTHRKKI.VIKQWQPNFIRRCYIIGYLPLIFCGE...NTTAQNFATRSDDMISK...
CAPSD_TTVT1/1-433WGRRRRVR..RYRRRR......GGTKRQYISSIMQWNPQHRHLCYIKGITWLCAARADRMSWPGIKQIAATDSTRYW...
Q9JG80_9VIRU/1-589GRRRYRRGWRRRTYVRKGR...HRKKKKRL.ILRQWQPATRRRCTITGYLPIVFCGH...TKGNKNYALHSDDYTPQ...
A7VLZ6_9VIRU/1-506.YGRRRNYR.RPARRRRRKLRKVRRKKKQI.AVKQWQPESITKCKILGHSALVVGAE...GKQMFCYTTNKNIAVPP...
Q6H9D2_9VIRU/1-557RRGWAR....RYRLRRRR....RRRRRRKL.ILTQWQPAKIRKCLVIGYLALVLCGN...GTFSKNYASHSDDYVQK...
Q6H999_9VIRU/1-471..................................KG............................................
Q77JT5_9VIRU/1-606GR.WRRAY..RRWGRRRR....RRRHKKKL.VLTQWQPAVVKRCLIVGFDPLIICGI...NRTIFNYTTHSEDFTFN...
Q91PS7_9VIRU/1-585RRAWGR....RRYIRRRR....LRRRRKKI.PITQWNPSVVRKCVVTGYIPLLICGTGTTGTTYKNYGSHAADYKKY...
CAPSD_TTVV9/1-555RVRRRGYY..RRYRRR......RRYKRRLL.ILKQWQPTTNLRLTVKGLIPVVVMGK...GKTQNNFGQWEQTVPLE...
Q9JG47_9VIRU/1-553..........KYRVR........KRKLKYL.PLRQWQPHYINKLKVQGWYPLAISTK...DRLSNNLNLYLESIAPH...
A7VLW0_9VIRU/1-507IYRRRRNY..RTTKGRRRRRYKVRRKQQKI.LVKQWQPECIRKCKIKGLGTIVLGAE...GTQYRCYTDYLDEWTNP...
Q0ZLH9_9VIRU/1-573.RVWAP....RPYIRRRR....RSFRRKKI.KITQWNPAVTKKCTVTGYLPVIYCGTGDIGTTFQNFGSHMNEYKQY...
Q5ENW7_9VIRU/1-501RDYRR.....RWLVRRRRRSVYRRGGRRAR.PYRLFNPKVMRRVVIRGWWPILQCLK...GQEALRYRPLQWDTERQWRV
A7VLX2_9VIRU/1-509RFTRRRNF..KASRRRRRRRYEVRRKRQKI.VLKQWQPESIKKCKVKGFGCLVLGAE...GRQFYCWTNEASNYPQP...
Q80AR5_9VIRU/1-594VRRLR.....RRGWTRRRYIR.RRRRKKKL.VLTQWNPQDVRRCTIRGIIPLIMCGA...NTASFNYGMHSDDSTPQ...
Q91CZ2_9VIRU/1-601GRRGRRRRYTRRYRRRLT....VRRKRNKL.RLSVWQPQNIRYCAIKGLFPILICGH...GKSAGNYAIHSDDFITS...
CAPSD_TTVG1/1-514FYRRTKYR..RPARRRRRRRRKVRRKKKTL.IVRQWQPDSIVLCKIKGYDSIIWGAE...GTQFQCSTHEMYEYTRQ...
Q98Y63_9VIRU/1-581GRRRGRRRFYRRRFKKR......RRRRRKL.TLKMWNPSTIRACNIKGAINLVMCGH...TQAGRNYAIRSEDFYPQ...
Q9QU36_9VIRU/1-529..........RHWVRRYS....RKRKLSKL.NIKEWQPITIRKTKVKGLYPAFLCND...QRIGNNAIQYLDSIAPH...
A7VM12_9VIRU/1-509RFTRRRNRRVTRRRRRRTRHQKVRRKKNKI.PVLQWQPDSIRKCHIKGQGTLVVGAE...GTQMFCYTRDKFKYIPP...
A7VLV6_9VIRU/1-508PFRRRR.......RRRRRRRYKVRRKKKKI.VIQQWQPESIKKCKIKGFGCLVLGSQ...GTQYLCYTNEAANYVPP...
Q9JG50_9VIRU/1-535..........RHTVRRRR....IKKKLKKI.KIYEWQPTVIKKCHIKGTIPLIQGGK...DRQGFNYAQYQDSYIPS...
A7VLW4_9VIRU/1-507LYRRRRPT..RTNRRRRRRHRKVKRKRKTL.TVKQWQPESIRKCKIIGLEPQLLGAE...GSQIDCFTVVKTDYVPA...
A7VM04_9VIRU/1-513PARKRAH...RYAGRRRRRRYKVRRKRQKI.PLFQWQPDKIVKCKIKGVTTLVLGAE...GKQLVCYTNVKTANTPA...
A7VLY4_9VIRU/1-498IYKNRRRR..PTRRRRRRRHTKVRRKRQTI.PVRQWQPERIVRCKIKGISVIVLGGE...GKQFQCYTNEATTWTPL...
CAPSD_TTVD1/1-324..........RHRGRRFPYFKQGKRRRTRL..LHVTDPRYKAHCTITGWVPIAMTRI...QLISQPFTV...DTLSP...
Q91CZ6_9VIRU/1-596GRRGRPRR..RLYRRRYT....LRRKRKRL.IIKQWQPNNIRKCRITGMLPMVICGH...GMSANNYAIRSDDTETM...
A7VM08_9VIRU/1-506RYNRRRPR..RLTRRRRRRKYKVRRKQKKI.HLTQWQPDRIRKCKIKGRGTLIMGAQ...GRQYMCYTNVKDRLTPS...
CAPSD_TTVV3/1-573GR.WRRRY..RRWRRRGG....RRRHRKKL.IIKQWQPNFIRHCYIIGYMPLIICGE...NTFSHNYATHSDDMLST...
Q91D00_9VIRU/1-593VRRLRR....RRGWTRRRYL..RRRKRRKL.ILTQWNPNIVRRCSIKGIIPLTMCGA...NTASFNYGMHSDDSTPQ...
Q99AR5_9VIRU/1-604PRRTY.....RRGWRRRRYIRRRRGRRKKL.TLTMWNPNIVRRCNIEGGLPLILCGE...NRAAFNYAYHSEDYTEQ...
Q9DTD2_9VIRU/1-559GR.WRRAH..RRWRRRRG....RRRHKRKL.IIRQWQPPYTRRCYIVGYLPLIMCGE...NCFSKNFATHSDDIDCS...
Q91D04_9VIRU/1-591GRRRGRRTYLRRRLKK.......RKRRKKL.RLTQWNPSTIRGCTIKGMAPLIICGH...TMAGNNFAIRMEDYVSQ...
CAPSD_TTVV8/1-571GRGWRRLY..RRYRRRRG....RRTYKKKP.VLTQWQPTVRRRCFIIGYMPLIICGE...NLTSKNYASHADDFVKD...
Q5ENX0_9VIRU/1-603GR........RYTRRGRLRLRRRRRRRKKI.VLTQWNPQTVRRCYIRGLMPVIWAGM...GSGGKNYAVRSDDYTQS...
O90364_9VIRU/1-590GR.WRRRY..RRWKRKG.....RRRKKAKI.IIRQWQPNYRRRCNIVGYIPVLICGE...NTVSRNYATHSDDTNYP...
Q9IFV0_9VIRU/1-583GRGWRR....RTYIRRRR....R..RKKKI.NIQQWNPATVKKCVVTGYVPLLICGTGTTGTTYKNYGSHINDYTKF...
Q9QUE7_9VIRU/1-586GR.WRRRY..RRWRRKG.....RRRRKKKL.IIRQWQPNYTRKCNIVGYMPVIMCGE...NTLIRNYATHADDCYWP...
A8DMR2_9VIRU/1-531..........RYRVRR......LRRKPKKL.PIKQWQPTKMRRLTVTGKYPLFEGTS...ERIGNNNTQSIDTIAPY...
Q9DUH8_9VIRU/1-609GRVRRRARGGRRYHYRRRFRRRRARRRKKI.VLTQWNPQTVRKCLIRGMFPILWCGS...GAAGKNYALHMDDYTPS...
A7VLW8_9VIRU/1-511PIRRRKPR..RTYRRRYRRRKKVRRKRKTL.LVRQWNPDSILTCKIKGFLDILMGAD...GNQYQCYTQNRYSMPPP...
Q99AQ3_9VIRU/1-582GWRGR.RRYSRRYSRRLT....VRRKKKKL.TLKIWQPQNIRRCKIRGLLPLLICGH...TRSAFNYAIHSDDKTPQ...

PF02248

Q66170_CPMVS/720-899--------------------------CAEASD--VYSPC---MIASTPPAP...FS------------------------
Q9YWJ9_9SECO/828-1009--------------------------MVQQLG--TYNPI---WMVRTPLES.TAQQ------------------------
POL2_CPMVS/837-1016--------------------------CAEASD--VYSPC---MIASTPPAP...FS------------------------
POL2_BPMV/821-1004--------------------------SISQQT--VWNQM---ATVRTPLNFDSSKQ------------------------
POL2_CPSMV/808-988--------------------------SGQTQQ--VWNKI---WRIGTPP...QATD------------------------
POL2_RCMV/786-964--------------------------VRTTDG--VYSTC---FRVRTPLA....LK------------------------
Q66179_APMV/2-185--------------------------CSPCIN--VWSEF---CALDIPVVD.TTKV------------------------
POL2_APMV/802-985--------------------------CSPCIN--VWSEF---CALDIPVVD.TTKV------------------------
POL2_SQMVM/622-803--------------------------MVQQLG--TYNPI---WMVRTPLES.TAQQ------------------------
Q9YWK0_9SECO/739-920--------------------------MVQQLG--TYNPI---WMVRTPLES.TAPQ------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------SFEDDYF.VWVDF...SEFTLDK....EEI------------------------
POL2_BRSV/1176-1338--------------------------INYKQRF.AWCLLECLDNSKASP....IKV------------------------
Q86631_9SECO/418-544--------------------------IATRLQF.LWASF...SGFAPVVPEAPRTW------------------------
POL2_ARMV/344-502--------------------------SFPNDYF.LWVDF...SSFTVDV....EEY------------------------
Q88483_9SECO/1172-1336--------------------------INYNQHF.AWFMLEHLDTNTTGA....VSL------------------------
A2ID55_9SECO/610-780--------------------------MYQTMEF.SWVTL...SAFLQGT....ATI------------------------
Q80JS8_BRAV/347-511--------------------------IGLIREF.NWATI...NNFKSDD....IAF------------------------
A0A9J6_ARMV/960-1118--------------------------AFPNDFF.LWVDF...SAFTIDQ....EEF------------------------
CAPSD_TRSV/351-511--------------------------FSSSELY.NWFTL...TNLKPDANTGVVNF------------------------
POL2_GCMV/1150-1316--------------------------INYDQRF.AWFTLLRPPDPKLSK...ILKL------------------------
Q6XPY1_9SECO/164-322--------------------------INYKQAF.GWFTL.VRRSTTNKE....IAL------------------------
Q6XFY6_9SECO/157-316--------------------------TFPNDYF.LWVDF...SAFTVDE....EEY------------------------
Q9IV56_9SECO/980-1138--------------------------LVAEIGS.LWCRV...TSFLKED....VDI------------------------
Q65624_9SECO/386-551--------------------------IGNVLLF.NWATI...SEMTNLT.....RF------------------------
POL2_CNSV/1022-1185--------------------------INFTQRF.GWFAV..EPTTSTGA....IKL------------------------
Q64959_9SECO/338-502--------------------------INYKQRF.GWFMI.SPSDKTTTE....LDF------------------------
Q20LA0_9SECO/942-1102--------------------------SEKGQMH.AWFRV...HNILVDN....LSF------------------------
A3FEN2_9SECO/348-507--------------------------IAGEQQF.NWCSF...RNFKIDD....WRF------------------------
Q9ELS0_9SECO/148-312--------------------------LQYSEMSCNWAEI...SAIVGTG....QTI------------------------
Q9QAH0_9SECO/350-510--------------------------GDRSVGS.AWFRI...NNIADDN....LVF------------------------
Q24M89_9SECO/943-1103--------------------------PERGQMH.AWFRM...NNIQVDN....LSF------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------QASN------------DKVSDGP-----TY------------------------
Q999Y9_CARMV/250-348--------------------------QASN------------DKVSDGP-----TY------------------------
Q4JGW6_CARMV/250-348--------------------------QASN------------DKVSDGP-----TY------------------------
Q8JJU7_CARMV/250-348--------------------------QASN------------DKVSDGP-----TY------------------------
CAPSD_CARMS/250-348--------------------------QASN------------DKVSDGP-----TY------------------------
Q999Z1_CARMV/250-348--------------------------QASN------------DKVSDGP-----TY------------------------
CAPSD_CARMV/250-348--------------------------QASN------------DKVSDGP-----TY------------------------
Q7TG55_CARMV/250-348--------------------------QASN------------DKVSDGP-----TY------------------------

PF00073

Q9WMA0_9PICO/49-215---------------------DQSSVHTAEVGSHQI.......EPLKTSVDKPGSKK-TQ--------------------
POLG_AEVCA/45-212---------------------DQSSVSTATMGSLQDVQYRT.......AVDIPGSRV-TQ--------------------
POLG_CXA9/93-300---------------------TTQECANVVVGYGRWPTYLR..DDEATAEDQPTQPD-VA--------------------
POLG_CXB3N/93-302---------------------TTQECANVVVGYGVWPDYLK..DSEATAEDQPTQPD-VA--------------------
POLG_CXB4J/93-300---------------------TTQECANVVVGYGVWPDYLS..DEEATAEDQPTQPD-VA--------------------
POLG_CXA21/93-308---------------------TTQEAANAIVAYGEWPTYIN..DSEANPVDAPTEPD-VS--------------------
POLG_POL1M/93-308---------------------TTQEAANSVVAYGRWPEYLR..DSEANPVDQPTEPD-VA--------------------
POLG_POL3L/93-307---------------------TTQEAANSVVAYGRWPEFIR..DDEANPVDQPTEPD-VA--------------------
POLG_HE701/93-288---------------------VTQEAANICCAYGEWPTYLP..DNEAVAIDKPTQPE-TS--------------------
POLG_BOVEV/93-285---------------------TTQEAANICVAYGCWPAKLS..DTDATSVDKPTEPG-VS--------------------
POLG_HRV14/93-299---------------------TTQEAANAVVCYAEWPEYLP..DVDASDVNKTSKPD-TS--------------------
POLG_HRV2/93-302---------------------TSQDVANAIVAYGVWPHYLS..SKDASAIDKPSQPD-TS--------------------
POLG_HRV8A/93-302---------------------TSQDTANAVVAYGVWPSYLT..PDDATAIDKPTQPD-TS--------------------
POLG_HRV1B/93-301---------------------TSQDVANAVVGYGVWPHYLT..PQDATAIDKPTQPD-TS--------------------
POLG_FMDV1/311-475---------------------TTQSSVGVTYGYSTEEDHVA..GPNTSGLETRV...-VQ--------------------
POLG_FMDVT/311-475---------------------TTQSSVGVTFGYATAEDSTS..GPNTSGLETRV...-HQ--------------------
POLG_FMDVO/311-475---------------------TTQSSVGVTYGYATAEDFVS..GPNTSGLETRV...-VQ--------------------
POLG_EMCV/161-359---------------------........TPSQQWAVLSVM..VPFMMESIRHHVLT-LL--------------------
POLG_TMEVB/172-382---------------------NTQSTVGRLCGYGKSHHG....EHPASCADTATDKV-LA--------------------
POLG_ENMGO/162-361---------------------NTQSTVGRLVGYGTVHDG....EHPASCADTASEKI-LA--------------------
POLG_FMDVO/533-691---------------------VFNPPRNQLPGRFTNLLDVAEACPTFLRFEGGV...-..--------------------
POLG_FMDV1/533-692---------------------VYNPPKTNYPGRFTNLLDVAEACPTFLRFDDG.KP.-..--------------------
POLG_EMCV/420-582---------------------TPVAPSNYMVGEYKDFLEIAQ.IPTFIGNKIPN...-..--------------------
POLG_TMEVB/443-606---------------------TISTPSDYMCGEFSDLLELCK.LPTFLG.....NPN-TN--------------------
POLG_HE701/347-515---------------------FSPTPEMHIPGQVHSMLEIV..QIESMMEINNVN.D-AS--------------------
POLG_HRV2/358-522---------------------YHPTKEISIPGEVKNLVEIC..QVDSLVPINNTDTY-IN--------------------
POLG_HRV8A/364-529---------------------FHPTKEIFIPGQVRNLIEMC..QVDTLIPVNNTQEN-VR--------------------
POLG_HRV1B/360-525---------------------YHPTKEISIPGEVKNLIEMC..QVDTLIPVNNVGTN-VG--------------------
POLG_BOVEV/345-515---------------------FQPTLEIFIPGKVNNLLEIA..QVESILEANNRE.G-VE--------------------
POLG_CXA21/369-534---------------------FDVTPPIHIPGEVKNMMELA..EIDTLIPMNAVDGK-VN--------------------
POLG_CXA9/358-524---------------------FDVTPSMNIPGEVKNLMEIA..EVDSVVPVNNVQDT-TD--------------------
POLG_CXB4J/358-524---------------------FDVTPEMNIPGQVRNLMEIA..EVDSVVPINNLKAN-LM--------------------
POLG_CXB3N/360-526---------------------YDVTPEMRIPGEVKNLMEIA..EVDSVVPVQNVGEK-VN--------------------
POLG_CXB1J/360-526---------------------FDVTPEMQIPGRVNNLMEIA..EVDSVVPVNNTDNN-VN--------------------
POLG_FMDVO/725-872---------------------......TTSAGESADPVTTT..VENYGGETQIQRRQ-HT--------------------
POLG_FMDV1/726-878---------------------......TTTTGESADPVTTT..VENYGGDTQVQRRH-HT--------------------
POLG_BOVEV/610-775---------------------DESMIETRTIVPTHGIHETS..VESFFGRSSLV...-..--------------------
POLG_HRV8A/621-792---------------------PEDMIETRYVITDQTRDETS..IESFLGRSGCI...-AM--------------------
POLG_HRV2/614-772---------------------PEDVIETRYVQTSQTRDEMS..LESFLGRSGCIHES-KL--------------------
POLG_HRV1B/627-786---------------------..........MTSQTRDEMS..IESFLGRSGCV...-..--------------------
POLG_HE701/609-781---------------------....IQTRTVINMHGTAECL..VENFLGRSALV...-CM--------------------
POLG_HRV14/614-787---------------------PSDSIETRTTYMHFNGSETD..VECFLGRAACV..H-VT--------------------
POLG_CXA9/612-783---------------------PSDTMQTRHVKNYHSRSEST..VENFLGRSACV...-..--------------------
POLG_CXB4J/612-783---------------------PSDTMQTRHVHNYHSRSESS..IENFLCRSACV...-..--------------------
POLG_SVDVU/612-782---------------------PSDTMQTRHVKNYHSRSEST..VENFLCRSACV...-..--------------------
POLG_CXB3N/630-782---------------------................SEST..IENFLCRSACV...-..--------------------
POLG_POL1M/636-806---------------------PSDTVQTRHVVQHRSRSESS..IESFFARGACV...-..--------------------
POLG_CXA21/642-812---------------------.........VINYKTRSESC..LESFFGRAACV...-..--------------------
POLG_CXA24/646-809---------------------.........VVNYKTRSEST..LESFFGRSACV...-.T--------------------

PF00915

CAPSD_VESVA/137-421.VNSNF.TFRAESDGPGSTEIVTEEQGT.IVQQQPAPAPTALATLATASTGKSVEQ..EW--------------------
POLG_RHDVF/1768-2065PQGEAAGTATTASVPGTTTDGMDPGVVATTSVITAENSSASIATAGIGGPPQQVDQQETW--------------------
CAPSD_FCVUR/112-395.WDPNLPLFRLEADD...GSITAPEQGT.VVGGVIAEPSSQMSTAADMASGKSVDS..EW--------------------
CAPSD_NVN68/2-294........ATSSVDGASGAGQLVPEVNA.SDPLAMDPVAGSSTAVATAGQVNPID...PW--------------------

PF08762

Q8B107_ALPV/599-804---------------------T..SSA.LTVGEKVTSLRQI--LKRFHLIYSNL----T.--------------------
O56051_9VIRU/590-790---------------------TFNASM.LMMGEKVTSFRQL--IKRFSAI....----..--------------------
Q56QP7_9VIRU/684-855---------------------SPNAVMGKIAGERLVNLRPL--LRCFRSLGG..----..--------------------
O36967_9VIRU/668-900---------------------S..PEA.HCIGEKIMSIRQL--IKRFGMALNSL----NL--------------------
Q5UBY1_9VIRU/79-259---------------------NMEALL.KGSGEQIMNLRSL--LRTFRTISENW----NL--------------------
Q6ITS9_9VIRU/106-313---------------------NPNISL.LISGEVFTNFRNL--IKRVNFRKATT----LN--------------------
Q4JFT2_9VIRU/834-1009---------------------T...ML.TTMGEQFVSLRML--TRR........----..--------------------

PF00729

CAPSD_PNLV/47-266------------------------------GRVVTAPVSSAALI.RYKAPSL------N....GNSMD------------
CAPSD_MCMVK/23-222------------------------------RAIRANPPVPRPNPQRNRPPPA------G.........------------
CAPSD_PMVK/39-236------------------------------YVTTLGP..........SRPRM------G.....QGQG------------
CAPSD_RCNMV/24-213------------------------------VKTVAIPFAKTQII.KTVNP..------......PPKP------------
CAPSD_CARMS/51-245------------------------------TPAILAFTPRRPRM.TNSPPRT------SRNSPGQAGK------------
CAPSD_SBMVA/46-262------------------------------AGVSMAPIAQGTMV.RLREPSL------R.....TAGG------------
CAPSD_TBSVC/76-269------------------------------GGAIMAPVAVTRQL.VGSKPKF------T....GRTSG------------
CAPSD_POLVP/66-257------------------------------.GAIAAPVANTRII.RASKPKF------T.....RSKG------------
CAPSD_OCSVU/111-308------------------------------.GTTAAPVSISRNINRRSKPSI------K.....MMGD------------
CAPSD_TNVA/61-272------------------------------GGYIVAPTSGGVVT.RPIVPKF------S.....NRGD------------

PF11729

CAPSD_SJNNV/1-340--------------------------MVRKGDKKLAKPPTTKAA-NSQPRRR------ATQRRRSGRA------------

PF00894

CAPSD_PLRV1/70-207-------------------------------------------------------------------E------------
CAPSD_PEMVW/53-187-------------------------------------------------------------------D------------
CAPSD_BYDVP/62-199-------------------------------------------------------------------E------------

PF03014

CAPSD_HEVCH/41-659----------------FWGDRADSQPFAIPYIHPTNPFAPDVTAAAGAGPRV------RQPARPLGSA------------

PF03115

CAPSD_HASV1/1-416----------------MASKSNKQVTVEVSNNGRSRSKSRARSQSRGRDKSVKITVNSRNRARRQPGR------------

PF00983

COAT_TYMV/8-177-----------------------------------APQDRTVTV-ATVLPAV-------------PGP------------

PF02247

POL2_SQMVM/246-618PENTGCALAICFNSGITGA.ADTDIYTTSSQNAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAH..FAVQCVTGWT
POL2_CPMVS/460-832SDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR..MTVICVSGWT
POL2_BPMV/447-819PENTGIALACAMNSSIRGR.ASSDIYTICSQDCELWNPACTKAMTMSFNPNPCSDAWSLEFLKRTGFH..CDIICVTGWT
Q9Z006_9SECO/476-846APTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPYVEFCFQAFFLCRLVEHALFRVFQICSCGGHTDIVQVA
O12663_9SECO/321-691APTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPFVEFIFKPFSCADWWNMHYLGSFKCAPVVVIQTLSKWL
Q9YWK0_9SECO/363-735PENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVWNPACEKAVELSFNPNPCSDAWNFVFLQKTKAH..FAVQCVTGWT
POL2_CPSMV/437-806AVNTGLGLAICFNSGIRGK.ASADIYATCSQDAMIWNPSCTKVMQYAFNPNPCSDGWSLAFLERTGYH..CVVTCVTGWT
POL2_RCMV/407-778PENTGCCLAITVNSSNRGQ.FSTDIYTTGSQDRILWNPACSKNCDFSFNPNPCGTAWSLEFLRRTKFH..LSVTCVSGWS
Q9YWJ9_9SECO/452-824PENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAH..FAVQCVTGWT
Q66170_CPMVS/343-715SDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR..MTVICVSGWT

PF03391

CAPSD_TRSV/179-344-------------------------------PTMTWPIQL.GDTFAID--------------------------------
POL2_RRVS/768-936-------------------------------PTFVWPPKP.TDISLLK--------------------------------
POL2_BRAV/1268-1433-------------------------------PTLVLPQAFGGDLPLDL--------------------------------
Q65029_ARMV/745-916-------------------------------PNFIYSADA.FNGSLKF--------------------------------
POL2_ARMVS/792-963-------------------------------PNFIYSADA.FNGSLKF--------------------------------
Q67703_GFLV/166-336-------------------------------PTLVFDPGV.FNGKFQF--------------------------------
POL2_GFLV/771-941-------------------------------PTLVFDPGV.FNGKFQF--------------------------------
POL2_BRSV/1007-1170-------------------------------QPLSYPIEA.RHLTDLN--------------------------------
POL2_GCMV/981-1144-------------------------------SIVTYPISL.EHLKDIE--------------------------------
POL2_TORVR/1497-1662-------------------------------PFITLPHIF.NRLDIGY--------------------------------
Q88483_9SECO/1003-1166-------------------------------NPLTYPIKP.GHLEDLD--------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215---------------------------------------------------------LAAGRPTINH------PTFVGS-

PF01318

CAPSD_BMV/2-188---------------------------------------------------------TARVQPVIVE------PLAAGQ-

PF03566

Q80IX5_PRVFL/54-754---------------------------------------------------------RGTMDPPVHEICAQSIDPSEGAV
CAPSD_NCBVS/1-608---------------------------------------------------------RTRV.RGLRQ.AMMESPMAATSE
CAPSD_HASV/2-647---------------------------------------------------------ISSM.PEFRNWAKGKIDLDSDSI

PF01829

CAPSD_NODAM/42-399---------------------------------------------------------VLPKKHCLTQ----SITFTPGK-

PF08435

Q91H09_9CALI/305-535---------------------------------------------------------ATRAHEARIDTGSDTFAPKIGQ-
Q8JMP1_9CALI/305-540---------------------------------------------------------AKNAKGIYISTTSGKFTPKVGS-
Q8B4Z2_9CALI/297-515---------------------------------------------------------TTVGERTVNARNQQNFTPALGH-
Q917X1_9CALI/305-538---------------------------------------------------------ANRAHDAVVATYSDKYTPKLGL-
Q9IV43_9CALI/304-537---------------------------------------------------------GNPILLRDIQPNSSDFVPHLGS-
Q8VA02_9CALI/306-539---------------------------------------------------------TGDVIKQINVKQESAFAPHLGT-
Q9IV49_9CALI/306-538---------------------------------------------------------ATRAQEVNINTGGDQYAPKLAQ-
Q6EAX3_9CALI/306-538---------------------------------------------------------TTRAHEAVVSTTSSQFVPKLGS-
Q8BAC6_9CALI/304-534---------------------------------------------------------ATRAHDAQIDTAGDTFAPKIGQ-
Q6WQW7_9CALI/296-512---------------------------------------------------------TGVWHQTLDVKNQQHFTPGIGQ-
Q6B7R3_9CALI/303-535---------------------------------------------------------AANSQGVYISSTSEKFTPKLGT-
Q6EAW7_9CALI/305-538---------------------------------------------------------ANRAHDAVLATYSAKYTPKLGS-
Q66418_9CALI/306-538---------------------------------------------------------GSSNEYQILIKQESAFAPHLGH-
Q80FL2_9CALI/317-546---------------------------------------------------------TTRAHEAKVDTRTGRFTPKLGS-
Q9IV42_9CALI/305-535---------------------------------------------------------QDPSQSVTFATNDASFVPYLGS-
Q6XDL5_9CALI/307-546---------------------------------------------------------ANRAHEAVIATYSPKFTPKLGN-
Q6B7R2_9CALI/304-538---------------------------------------------------------SGDPISRLDIKQGASFAPHLGS-
Q917X4_9CALI/305-533---------------------------------------------------------TCRAHDGILATWSPKFTPKLGS-
Q783W9_9CALI/306-535---------------------------------------------------------ATRAHEARVNTNDPTFAPQIAQ-
Q80J94_9CALI/309-538---------------------------------------------------------VTTFEMILGPTTNADQAPYQGR-
Q913B6_9CALI/305-540---------------------------------------------------------ANRGHDAVVPTYTAQYTPKLGQ-
Q8JW44_9CALI/304-539---------------------------------------------------------GDPMRSVSVQTNVQGFVPHLGS-
Q83876_9CALI/301-524---------------------------------------------------------HSSQTQYDVDTTPDTSVPHLGS-
Q9IV48_9CALI/306-533---------------------------------------------------------FEGSHVQVRYKAKCPICTXLGS-
Q8V713_9CALI/316-545---------------------------------------------------------QTRAHEAKVDTRAARFAPKLGF-
Q91I85_9CALI/304-538---------------------------------------------------------SNPIVVNSVKPNSQQFVPHLSS-
Q8JXJ0_9CALI/304-537---------------------------------------------------------ADPIVLHAIEPNSSSFVPHLGS-
Q783X1_9CALI/315-545---------------------------------------------------------ATRAHEVHIDTTNPRYTPKLGS-
Q783Y0_9CALI/305-533---------------------------------------------------------ACRSHDAVIATNSAKFTPKLGA-

PF02226

POLG_HRV8A/2-69-----------------------------------------------------------------------------GS-
POLG_POL1M/2-69-----------------------------------------------------------------------------GS-

PF11492

Q7T7T5_HARNA/2003-2059---------------------------------------------------------VANVAAAASS------LPHIGA-
POLS_CRPVC/291-340---------------------------------------------------------.......LSH------IPVLGN-
Q2HWK2_RSET1/357-413---------------------------------------------------------VARLAGRLKD------VPIIGT-
POLS_ABPVR/340-396---------------------------------------------------------VNKVANGIER------IPVIGE-

PF08935

Q9WJ28_PTV1F/119-191-----------------------------------------------------------------------------GN-
Q9DLK1_FMDVP/202-285-----------------------------------------------------------------------------GN-

PF01766

POLS_IBDVU/9-452---------------------------------------------------------PGSIVGAHYTLQ.SNGNYKFDQ-
POLS_DXV96/2-442---------------------------------------------------------PSSISGFHYIWDSATSNWVFDQ-
POLS_BSNV/7-428---------------------------------------------------------PSGLLGAHYTKT.PQGSLIFDK-
POLS_IPNVJ/5-453---------------------------------------------------------PGSRVGAHYRWNLNQTALEFDQ-

PF02443

Q5Y4T0_PCV2/5-226-------------.ATTVRTPSWNVDMMRFNINDFLPPG.......................GGSNPLTVPFEYYRI---
Q27W03_PCV1/5-227-------------..GGYSQPSWNVNYLKFNIGQFLPPS.......................GGTNPLPLPFQYYRI---
A3FEQ4_9CIRC/3-256-------------GTGPTATGRWQSLSLEDGAQYTDPPAQGNNICGLNMRWAMFGDTNSYMQGNKPQYHYPYDYYII---
Q3HUU1_GOCV/5-247-------------GTGSPEKNKWQAMSLEAVQSSGTSPKP.....GINLRFAVFGDR...LPGTGNQYHYPFDYYMI---
Q1L2D2_9CIRC/1-237-------------DEG..GSFKYGTDVFTFTLEDVLNPT........................GGDSLKLPFEDYKI---
CAPSD_CACV/7-243-------------GTGG.SQLSFGTDGINIILDDFL.DW........................GTINWRLPFEDYRI---
Q0H9S8_9CIRC/4-236-------------GSGD.TTLKWATDGLNIMLDDFL.DW........................GTINWRLPFEDYRI---
Q06J73_9CIRC/8-245-------------AENA.GAFRFGTDGVTIILKDFF.PE........................GK...ELPFEDYRI---
Q9DXG3_BFDV/11-242-------------QTTSVGNLIFNADYITFALDDFL.QA........................VPNPHTLNFEDYRI---
Q69EZ5_BFDV/7-239-------------QTTATATMTWKSDYITFALSDFL.GN........................TTNPQTLNFEHYRI---
Q9DXG0_BFDV/11-242-------------QTTQPGNLIWNADYVTFTLENFL.TN........................TPNPSALNFEDYRI---
Q9DXF4_BFDV/3-235-------------QTTQTGQIIWNSDYVTFALSDFL.TA.........................PNPTGWPFEDYRI---

PF02956

A7VLZ2_9VIRU/1-506.K.........QPSGGGFGVERYTLEYLYKEHKAGNNVW---------TTSNVNLDLVRYTGCRFIFWRHPHIDFVGVYS
Q9WT88_9VIRU/1-603.P.........FPFGGGMSTVTFSLKALYDQYLKHQNRW---------TFSNDQLDLARYRGCKLRFYRSPVCDFIVHYN
Q91CY9_9VIRU/1-581.L.........RPYGGSFSTTTWSLKLLFDEYLKFRNKW---------SYPNTELNLARYRGATFTFYRDPKVDYIVVYN
A7VLY0_9VIRU/1-515.K.........APGGGGFGAELFTLQYLYDEWVARRNIW---------TKTNDYKDLVRFTGATFYLYKHPTTDFIFNYN
Q9JGT1_9VIRU/1-585.G..........PFGGGMTTDKFTLRILYDEYKRFMNYW---------TASNEDLNLCRYLGCTLYVFRHPEVDFIIIIN
Q80QT8_9VIRU/1-595NQ.........NPHGGGMSTVTFSLQVLYDQHQRFLNQW---------SYPNDQLDLARYRGCSFSFYRHPEVDFIAQFD
CAPSD_TTVB1/1-533.S.........EPGGGSWSILQMTTRVLYDEYKAARNWW---------TKSNSLLPLTKYIRCKLKFYRSDQTDYIVTIQ
A7VM00_9VIRU/1-509.K.........VATGGGFGVELFSLKYLYQEYLARNNIW---------TSTNAYRDFCRYTGSSFTFFRHPDTDFIIVYD
Q9JG61_9VIRU/1-534.S.........EPGGGGWSIMQITLRALYDEYEHYRNWW---------TTSNCGLPLVKYTGCSIKFYNSNDTDYIVTVQ
Q91PS3_9VIRU/1-581.D..........PFGGGISTMQFNLSILFDEYMKHRCTW---------SKSNVDLELIRYRGCSFKLYRHEKCDFFFTYS
CAPSD_TTVV4/1-560.E..........SYGGGMTTTMFNLKVPYEQFQLHQNFW---------TRSNIDLDLVRYHSVKFTFFRHPKVDFIVKFN
Q91C93_9VIRU/1-546.Y.........VPGGGGFSISCFSLNTLYKEHLKLHNWW---------TKTNDNYPLIRYNGCTLKLFKSEKVDYIFYYQ
Q2F827_9VIRU/1-589.G.........SPYGGSFSTTTWNLRVLFDEHQKHHNTW---------SYPNNQLDLGRYKGCTFYFYRDKKTDYIVKFQ
Q91CY5_9VIRU/1-584.I.........KPHGGSFSTTTWSLKVCWDEHQKFMNRW---------SYPNTQLDLARYLGVTFYFYRDQKTDYIVQWS
Q8V7G9_9VIRU/1-572.G.........ASYGGNLTNITITLGGLYEQYMLHRNHW---------SRSNYDLELARYLGFTLKCYRHATVDYILTYS
Q99A78_9VIRU/1-584.G..........PFGGGMTTDKFTLRILYDEYCRFMNYW---------TASNEDLDLCRYRGCTLWFFRHPDVDFIILIN
Q6H9C2_9VIRU/1-573.G..........PYGGGMTTTKFTLRILYDEFTRFMNFW---------TVSNEDLDLCRYVGCKLIFFKHPTVDFIVQIN
CAPSD_TTVT1/1-433.S.........TILVGGCGVLTLSMDWFFFENLRWRNRW---------SHSNVGYDLARYMGTHLYFPPLADIWYIVWTD
Q9JG80_9VIRU/1-589.G.........QAFGGALSTTSFSLKVLFDQHQRGLNKW---------SFPNDQLDLARYRGCKFYFYRTKQTDWIGQYD
A7VLZ6_9VIRU/1-506.K.........SPYGGGFGVEQYSLNYLYEEYTFHNNYW---------TKSNILKDLCRFLWLKIIFFRDNKTDFIVSYD
Q6H9D2_9VIRU/1-557.G..........PFGGGLSSMRFNMRILYDQFKRHLNFW---------THTNQDLDLVRYRGCTMTFYRHPEVDFIVKFN
Q6H999_9VIRU/1-471............PFGGGHSTMRFSLYILFEERLRHMNFW---------TRSNDNLELTRYLGASVKIYRHPDQDFIVIYN
Q77JT5_9VIRU/1-606.N.........DSFGGGLCTAQYTLRILFQEKLAQHNFW---------SASNEDLDLARYLGATIVLYRHPTVDFLVRIR
Q91PS7_9VIRU/1-585.D..........PFGGGYSTMQFTLETLFDEWVKHRCTW---------SRSNKDLELVRYLGGSFTLYRHPKCDFIFRYN
CAPSD_TTVV9/1-555.G.........ESYGGSFTIRKFTLQTLYEDYLKLRNRW---------SRSNTDLELIRYTGLNLRLYRHEFSDYIVHYS
Q9JG47_9VIRU/1-553.Y.........LHGGGGFTICNFSLMTLYQENLVCRNWW---------TKGNENMPLIRYLGCEITLYRQAEVDYMVYVH
A7VLW0_9VIRU/1-507.K.........VPGGGGFGCELFTLRYLYKMYLARKNIW---------TFSNKYKDLVRYTGTRFTFFRHPETDFILAYD
Q0ZLH9_9VIRU/1-573.N..........AAGGGFSTMLFTMQNLYEEYQKHRCRW---------SKSNQDLDLCRYLDCKLTFYRSPNTDFIVGYN
Q5ENW7_9VIRU/1-501RSDFEDQYGYLVQYGGGWGSGDVTLEGLYQEHLLWRNSW---------SKGNDGMDLVRYFGCVVYLYPLKDQDYWFWWD
A7VLX2_9VIRU/1-509.K.........APGGGGFGCEVITLEYLYQQYKAHNCIF---------TASNHYKDPVRYTGCEIILYRHPYVDFVVTYS
Q80AR5_9VIRU/1-594.P.........EKFGGGMSTVTFSLFVLYDQYTRHLNRW---------SYPNDQLDLARYKGCKFKFYRDTNTDFIVTYD
Q91CZ2_9VIRU/1-601.R.........FSFGGGLSTTSYSLKLLFDQNLRGLNRW---------TASNDQLDLARYLGAIFWFYRDQKTDYIVQYD
CAPSD_TTVG1/1-514.K.........YPGGGGFGVQLYSLEYLYDQWKLRNNIW---------TKTNQLKDLCRYLKCVMTFYRHQHIDFVIVYE
Q98Y63_9VIRU/1-581.I.........QSFGGSFSTTTWSLRVLFDEYQKFHNFW---------TYPNTQLDLCRYKYAIFTFYRDPKVDYIVIYN
Q9QU36_9VIRU/1-529.H.........FPGGGGFGIIQFTLQGLYEQFIKATNWW---------TQTNCSLPLIRYNFCKLKFYRTANVDYVVKII
A7VM12_9VIRU/1-509.K.........TPYGGGFGAEKFTLSYLYEEYTFHNNVW---------TATNLYKDLCRYLYCKIIFFRHPDTDFVINYS
A7VLV6_9VIRU/1-508.K.........SPGGGGFGCEYITLEYLYKQWKAHNCIW---------TASNNYKDLCRYTGCTITLFRHKYIDFIFCYS
Q9JG50_9VIRU/1-535.H.........KGGGGTWSIMVFSLGALYEEWERLNNVW---------TKTNNGLPFARYCGCRFKFYRQEYYDYIVHYS
A7VLW4_9VIRU/1-507.K.........LPWGGGFSLQNYTLKYLYSEYTYHNNIW---------TSSNNQKDLCRYTGGYIKLFRHETQDFIISYD
A7VM04_9VIRU/1-513.K.........APGGGGFGCEQFSLDSLYADYKLRKNVW---------TKSNILLDLCRYLFVKISFYRHPETDFIVTWH
A7VLY4_9VIRU/1-498.R.........TPGGGGFGVEKYTLSHLYDQYKFGNNIW---------TKTNILTDLVQYLGCKFVFYRHQYVDFIVKYS
CAPSD_TTVD1/1-324.F.........HVYPGGYGYGVFTLEAMYKEHLMKRNRW---------SRSNAGFDLGRYLGTWLTLVPHPYFSYLFYYD
Q91CZ6_9VIRU/1-596.K.........FSFGGGFSTTTFTLKVLYDQHLRGMNKW---------STSNDILDLARYLGCDFYFYRDKHTDYIVQYD
A7VM08_9VIRU/1-506.R.........APAGGGFGVERFTLEYLYRQWKARNNIW---------TATNKNTDLVRYLGCRFSFYRHPDTDFIVNFS
CAPSD_TTVV3/1-573.G..........PYGGGMTTTKFTLRILFDEYQRHLNFW---------TVSNQDLDLARYLGTKIIFFRHPTVDFVVQIH
Q91D00_9VIRU/1-593.P.........EKFGGGMSTVTFSLYVLYDQFTRHMNRW---------SYSNDQLDLARYRGCSFKLYRNPTTDFIVQYD
Q99AR5_9VIRU/1-604.P.........FPFGGGMSTTTFSLRGLYDQYTKHMNRW---------TFSNDQLDLARYRGCKFRFYRHPTCDFIVHYN
Q9DTD2_9VIRU/1-559.V..........AYGGGMTATQFTLRILYDEFQRHLNYW---------TASNNDLDLARYLGATITFFRHPDVDFIVQIH
Q91D04_9VIRU/1-591.I.........RPFGGSFSTTTWSLKVLWDEHTRFHNTW---------SYPNTQLDLARFKGVNFYFYRDKDTDFIVTYS
CAPSD_TTVV8/1-571.G..........PFGGGMTTMQFSLRILYDEFLRFLNIW---------THSNQDLDLARYHGFKLTLYRHPTVDFIVIIR
Q5ENX0_9VIRU/1-603............SFGGSFGTETFSLRVLFDQYQRGFNKW---------SHTNKDLDLALYYGCRFRFYRHDRTDFIVSFT
O90364_9VIRU/1-590.G..........PFGGGMTTDKFTLRILYDEYKRFMNYW---------TASNEDLDLCRYLGVNLYFFRHPDVDFIIKIN
Q9IFV0_9VIRU/1-583.D..........PFGGGFSTLMFNLRILFDEYKKQRCRW---------SRSNDELELVRYLGCSFTLYREQNVDFLFKYN
Q9QUE7_9VIRU/1-586.G..........PFGGGMATQKFTPRILYDDYKRFMNYW---------TSSNEDLDLCRYRGVTLYFFRHPDVDFIILIN
A8DMR2_9VIRU/1-531.L.........FPSGGLFSITVFTLKGLYELHLKARNWW---------SISNCNLPLIKYRGCKITLYRNVDVDYVTVYT
Q9DUH8_9VIRU/1-609...........GGFGGSFSLTTFNLRALYDEHMKGRNRW---------SHTNEDLELALYFGCRFTFYRHPTTDFIVTFS
A7VLW8_9VIRU/1-511.K.........HPCGGGFSVDRFTLQWLYDQWRLRQNIW---------TKPNTYKDLCRFIVAKITLYRHKTTDFIVQYS
Q99AQ3_9VIRU/1-582.Q.........QSFGGGLSTVSFSLKVLFDPNQRGLNRW---------SASNDQLDLARYTGCTFWFYRHKKTDFIVQYD

PF02248

Q66170_CPMVS/720-899--------------------------------------D------------------VTAVTFDLINGKITPVGDD.NWN
Q9YWJ9_9SECO/828-1009--------------------------------------N------------------FASFTADLMESTISGDSTG.NWN
POL2_CPMVS/837-1016--------------------------------------D------------------VTAVTFDLINGKITPVGDD.NWN
POL2_BPMV/821-1004--------------------------------------S------------------FCQFSVDLLGGGISVDKTG.DWI
POL2_CPSMV/808-988--------------------------------------G------------------LFSFSIDLLGVELVTDGQE.GAV
POL2_RCMV/786-964--------------------------------------D------------------SGSFTCDLIGGGITTDSNT.GWN
Q66179_APMV/2-185--------------------------------------N------------------FAQYSLDLVNPTVSANASGRNWR
POL2_APMV/802-985--------------------------------------N------------------FAQYSLDLVNPTVSANASGRNWR
POL2_SQMVM/622-803--------------------------------------N------------------FASFTADLMESTISGDSTG.NWN
Q9YWK0_9SECO/739-920--------------------------------------N------------------FASFTADLMESTVSGDSTG.NWS

PF03688

A5H0K4_GFLV/264-422--------------------------------------E------------------IGSRFFDFT........SS-TCR
POL2_BRSV/1176-1338--------------------------------------K------------------IPSRIGNLS........SK-HVK
Q86631_9SECO/418-544--------------------------------------M------------------IPCRLSDYK........VE-GAT
POL2_ARMV/344-502--------------------------------------V------------------IGSRFFDIS........ST-TST
Q88483_9SECO/1172-1336--------------------------------------K------------------IPARMANLT........SK-EVQ
A2ID55_9SECO/610-780--------------------------------------L------------------LPSRPATITRFGESSAENR-NFT
Q80JS8_BRAV/347-511--------------------------------------A------------------IPARLSDLV........LT-CGE
A0A9J6_ARMV/960-1118--------------------------------------V------------------VGSRFFDFT........ST-TCT
CAPSD_TRSV/351-511--------------------------------------D------------------IPGYIHDFA........SK-DAT
POL2_GCMV/1150-1316--------------------------------------T------------------LPSRVCNIA........YK-EAT
Q6XPY1_9SECO/164-322--------------------------------------K------------------IPSRIANIE........YK-EAE
Q6XFY6_9SECO/157-316--------------------------------------V------------------IGSRFFDIS........SS-TST
Q9IV56_9SECO/980-1138--------------------------------------P------------------IRARIYDIA........AK-DCT
Q65624_9SECO/386-551--------------------------------------Q------------------IPARLSDLV........LP-GQT
POL2_CNSV/1022-1185--------------------------------------K------------------IWPVSNHLE........SE-DMK
Q64959_9SECO/338-502--------------------------------------K------------------IPSRIGNIG........VK-NTK
Q20LA0_9SECO/942-1102--------------------------------------N------------------IPGRIEDIR......ALAG-SYD
A3FEN2_9SECO/348-507--------------------------------------E------------------WPARLPDIL........DD-KSE
Q9ELS0_9SECO/148-312--------------------------------------I------------------VPNHICDWK........LS-NAT
Q9QAH0_9SECO/350-510--------------------------------------N------------------IPGRIEDII......AAAG-EVD
Q24M89_9SECO/943-1103--------------------------------------S------------------IPGRIEDMS......ALAG-SYD

PF08462

Q5ZF43_CARMV/250-348--------------------------------------V------------------VPSV-------------------
Q999Y9_CARMV/250-348--------------------------------------V------------------VPSV-------------------
Q4JGW6_CARMV/250-348--------------------------------------V------------------VPSV-------------------
Q8JJU7_CARMV/250-348--------------------------------------V------------------VPSV-------------------
CAPSD_CARMS/250-348--------------------------------------V------------------VPSV-------------------
Q999Z1_CARMV/250-348--------------------------------------V------------------VPSV-------------------
CAPSD_CARMV/250-348--------------------------------------V------------------VPSV-------------------
Q7TG55_CARMV/250-348--------------------------------------V------------------VPSV-------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------G------------------EKFFLIHSADWLTTHALFH-EVA
POLG_AEVCA/45-212--------------------------------------G------------------ERFFLIDQREWNSTQSEWQ-LLG
POLG_CXA9/93-300--------------------------------------T------------------CRFYTLDSIKWEKGSVGW.-...
POLG_CXB3N/93-302--------------------------------------T------------------CRFYTLDSVQWQKTSPGW.-...
POLG_CXB4J/93-300--------------------------------------T------------------CRFYTLNSVKWEMQSAGW.-...
POLG_CXA21/93-308--------------------------------------S------------------NRFYTLESVSWKTTSRGW.-...
POLG_POL1M/93-308--------------------------------------A------------------CRFYTLDTVSWTKESRGW.-...
POLG_POL3L/93-307--------------------------------------T------------------CRFYTLDTVMWGKESKGW.-...
POLG_HE701/93-288--------------------------------------T------------------DRFYTLKSKKWESNSTGW.-...
POLG_BOVEV/93-285--------------------------------------A------------------DAFYTLRSKPWQADSKGW.-...
POLG_HRV14/93-299--------------------------------------V------------------CRFYTLDSKTWTTGSKGW.-...
POLG_HRV2/93-302--------------------------------------S------------------NRFYTLRSVTWSSSSKGW.-...
POLG_HRV8A/93-302--------------------------------------S------------------NRFYTLDSRSWTSASSGW.-...
POLG_HRV1B/93-301--------------------------------------S------------------NRFYTLESKHWNGDSKGW.-...
POLG_FMDV1/311-475--------------------------------------A------------------ERFFKKFLFDWTTDKPFGY-...
POLG_FMDVT/311-475--------------------------------------A------------------ERFFKMALFDWVPSQNFGH-...
POLG_FMDVO/311-475--------------------------------------A------------------ERFFKTHLFDWVTSDSFGR-CH.
POLG_EMCV/161-359--------------------------------------Q------------------KRFWRWKGTTPSRLMIGHQ-HKS
POLG_TMEVB/172-382--------------------------------------A------------------ERYYTIDLASWTTSQEAFS-...
POLG_ENMGO/162-361--------------------------------------V------------------ERYYTFKVNDWTSTQKPFE-...
POLG_FMDVO/533-691--------------------------------------.------------------..PYVTTKTDSDRVLAQF.-...
POLG_FMDV1/533-692--------------------------------------.------------------...YVVTRADDTRLLAKF.-...
POLG_EMCV/420-582--------------------------------------.------------------.AVPYIEASNTAVKTQPLA-...
POLG_TMEVB/443-606--------------------------------------N------------------KRYPYFSATNSVPATSMV.-...
POLG_HE701/347-515--------------------------------------G------------------VERLRVQISAQSDMDQLLF-...
POLG_HRV2/358-522--------------------------------------S------------------ENMYSVVLQSSINAPDKIF-...
POLG_HRV8A/364-529--------------------------------------S------------------VNMYTVDLRTQVDLAKEVF-...
POLG_HRV1B/360-525--------------------------------------N------------------ISMYTVQLGNQMDMAQEVF-...
POLG_BOVEV/345-515--------------------------------------G------------------VERYVIPVSVQDALDAQIY-...
POLG_CXA21/369-534--------------------------------------T------------------MEMYQIPLNDNLSKAPIF.-...
POLG_CXA9/358-524--------------------------------------Q------------------MEMFRIPVTINAPLQQQVF-...
POLG_CXB4J/358-524--------------------------------------T------------------MEAYRVQVRSTDEMGGQIF-...
POLG_CXB3N/360-526--------------------------------------S------------------MEAYQIPVRSNEGSGTQVF-...
POLG_CXB1J/360-526--------------------------------------G------------------LKAYQIPVQSNSDNRRQVF-...
POLG_FMDVO/725-872--------------------------------------D------------------VSFIMDRFVKVTPQNQINI-...
POLG_FMDV1/726-878--------------------------------------D------------------VGFIMDRFVKINSLSPTHV-...
POLG_BOVEV/610-775--------------------------------------.------------------.GMPLLATGTSIT......-...
POLG_HRV8A/621-792--------------------------------------I------------------EFNTSSDKTEHDKIGKGFK-...
POLG_HRV2/614-772--------------------------------------E------------------VTLANYNKENFT.......-...
POLG_HRV1B/627-786--------------------------------------H------------------ISRIKVDYNDYNGVNKNFT-...
POLG_HE701/609-781--------------------------------------R------------------SFEYKNHSTSTSSIQKNFF-...
POLG_HRV14/614-787--------------------------------------E------------------IQNKDATGIDNHREAKLFN-...
POLG_CXA9/612-783--------------------------------------.------------------..YMEEYKTTDKHVNKKFV-...
POLG_CXB4J/612-783--------------------------------------.------------------..IYIKYSSAESNNLKRYA-...
POLG_SVDVU/612-782--------------------------------------.------------------...FYTTYKNHDSDGDNFA-...
POLG_CXB3N/630-782--------------------------------------.------------------...YFTEYKN..SGAKRYA-...
POLG_POL1M/636-806--------------------------------------.------------------.TIMTVDNPASTTNKDKLF-A..
POLG_CXA21/642-812--------------------------------------.------------------.TILSLTNSSKSGEEKKHF-N..
POLG_CXA24/646-809--------------------------------------M------------------LEVENFNATTEADKKKQFT-...

PF00915

CAPSD_VESVA/137-421--------------------------------------M------------------TFFSYHTSINWSTVESQ..-.GK
POLG_RHDVF/1768-2065--------------------------------------R------------------TNFYYNDVFTWSVADAP..-.GS
CAPSD_FCVUR/112-395--------------------------------------E------------------AFFSFHTSVNWSTSETQ..-.GK
CAPSD_NVN68/2-294--------------------------------------I------------------INNFVQAPQGEFTISPNNT-PGD

PF08762

Q8B107_ALPV/599-804--------------------------------------T------------------STKNNNLYRINSFKTPKPI-...
O56051_9VIRU/590-790--------------------------------------.------------------..TPPTQNRYWEFTQPFWI-NTN
Q56QP7_9VIRU/684-855--------------------------------------.------------------....ITLDRAGQILSERVY-...
O36967_9VIRU/668-900--------------------------------------I------------------SDAPNTLIAPFSVQHPTPV-...
Q5UBY1_9VIRU/79-259--------------------------------------A------------------PNTKTALTDLTDVAD....-...
Q6ITS9_9VIRU/106-313--------------------------------------G------------------KRISDTFDINSLIEAPRLD-IAQ
Q4JFT2_9VIRU/834-1009--------------------------------------.------------------.SSPVDILRGDLVTLPGIS-...

PF00729

CAPSD_PNLV/47-266--------------------------------------S------------------VRLASKSLVIE........-...
CAPSD_MCMVK/23-222--------------------------------------.------------------TTCSMSEILLAVSATTA.D-QIL
CAPSD_PMVK/39-236--------------------------------------W------------------QKLSHEEIILQVNSSTAAD-TIQ
CAPSD_RCNMV/24-213--------------------------------------A------------------RGILHTQLVMSVVGSVQ..-...
CAPSD_CARMS/51-245--------------------------------------S------------------MTMSKTELLCTVKGTTGVI-P..
CAPSD_SBMVA/46-262--------------------------------------V------------------TVLTHSELSTE........-...
CAPSD_TBSVC/76-269--------------------------------------S------------------VTVTHREYLSQVNNSTG..-...
CAPSD_POLVP/66-257--------------------------------------S------------------VTIAHRELLGQFNNSSG..-...
CAPSD_OCSVU/111-308--------------------------------------A------------------VVISHSEMLGAINSGTPSS-NVT
CAPSD_TNVA/61-272--------------------------------------S------------------TIVRNTEILNN.......Q-ILA

PF11729

CAPSD_SJNNV/1-340--------------------------------------D------------------APLAKASTITGFGRATNDV-HIS

PF00894

CAPSD_PLRV1/70-207--------------------------------------T------------------FVFTKDNLVGNTQGS--------
CAPSD_PEMVW/53-187--------------------------------------.------------------FSMVHGPFNGNATGT--------
CAPSD_BYDVP/62-199--------------------------------------V------------------FVFSVDNLKANSSGA--------

PF03014

CAPSD_HEVCH/41-659--------------------------------------W------------------RDQAQRPAAASRRRPTTAG-AAP

PF03115

CAPSD_HASV1/1-416--------------------------------------D------------------KRQSSQRVRNIVNKQLRKQ-GVT

PF00983

COAT_TYMV/8-177--------------------------------------S------------------PLTIKQPFQSE------------

PF02247

POL2_SQMVM/246-618TTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRW------------------MGKLSFPQGPARVLKRMPL-AIG
POL2_CPMVS/460-832LSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRW------------------MGKLTFPQGVTSEVRRMPL-SIG
POL2_BPMV/447-819ATPMQDVQVTIDWFISSQECVPRTYCVLNPQNPFVLNRW------------------MGKLTFPQGTSRSVKRMPL-SIG
Q9Z006_9SECO/476-846ERSEVDARISFAIYYEPTITLPKQIATLEHAPAFMFRKE------------------LGTLAFKQG.ELVAYSFEV-NFG
O12663_9SECO/321-691NSPKVDARISFAIYYEPSIVLPKQIATLEHAPAFMFRKE------------------LGTLAFKQG.ERVAYSFEV-NFG
Q9YWK0_9SECO/363-735TTPLTDLALVLTWHIDRNLCVPETLTISSAHASFPINRW------------------MGKLSFPQGPARVLKRMPL-AIG
POL2_CPSMV/437-806GTPLQDTFMTINWHISREACVPKIYTIFDPEPDMMLNRW------------------MGRAIFPQQSTQVVRRMPL-SIG
POL2_RCMV/407-778AQPQTDIAMTMDWYVSNKPCVPCIYNVGTPGQNVWVNRW------------------MGKLSFPQGSQNQLKQMPL-AIG
Q9YWJ9_9SECO/452-824TTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRW------------------MGKLSFPQGPARVLKRMPL-AIG
Q66170_CPMVS/343-715LSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRW------------------MGKLTFPQGVTSEVRRMPL-SIG

PF03391

CAPSD_TRSV/179-344--------------------------------------R------------------YYEAKEIKLDGSTSMLSIS-YNF
POL2_RRVS/768-936--------------------------------------E------------------VWGPYRFTLDGTEAKESFA-IMP
POL2_BRAV/1268-1433--------------------------------------W------------------RGPYTFPLGGGTKRLSTSL-DIG
Q65029_ARMV/745-916--------------------------------------L------------------TIPPLEYDLSATSAYKSVS-LLL
POL2_ARMVS/792-963--------------------------------------L------------------TIPPLEYDLSATSAYKSVS-LLL
Q67703_GFLV/166-336--------------------------------------L------------------TCPPIFFDLTAVTALKSAG-LTL
POL2_GFLV/771-941--------------------------------------L------------------TCPPIFFDLTAVTALRSAG-LTL
POL2_BRSV/1007-1170--------------------------------------L------------------MLAPKQIAVGTYAMITFPV-SLA
POL2_GCMV/981-1144--------------------------------------I------------------MLPPRQMAIGNAGSINFPL-SFA
POL2_TORVR/1497-1662--------------------------------------W------------------RGPTEIDLTSTPAPNAYRL-LFG
Q88483_9SECO/1003-1166--------------------------------------L------------------VLKSGSIAIGTYTMTKVPV-SLA

PF03689

A3FEM9_9SECO/10-101--------------------------------------A------------------AFLGKVTCAKDAKGGTLLH-TLD
Q9QAH4_9SECO/9-99--------------------------------------L------------------LYYESVDVPKDTLAGTLLT-RID
Q09G89_GFLV/608-698--------------------------------------L------------------AGRGVIYIPKDCQANRYLG-TLN
Q9JGK5_SDV/160-249--------------------------------------H------------------LFTKNLEIPSTADFCKELA-RYQ
Q9IV56_9SECO/636-727--------------------------------------L------------------VGVKWVSVPKDAKQSAFLG-THN
A1YYW2_BRAV/156-247--------------------------------------L------------------AFAKMYQCKKDAKAGHVLA-TVD
Q65624_9SECO/45-137--------------------------------------I------------------AHVVQGWVPKDATKGRVLE-AIN
Q6JX06_9SECO/849-939--------------------------------------F------------------VFVHTIDLPNAVTVGTVLA-KID
Q20LA0_9SECO/601-691--------------------------------------L------------------LYYESVNVPRDTLEGTRLA-RID
POL2_BRSV/842-932--------------------------------------Y------------------AFGETIELPATVTPGTVLA-VFN
A0A9J8_ARMV/580-670--------------------------------------L------------------AGRGSVQVPKDCQAGKYLK-TLD
Q6JX05_9SECO/604-694--------------------------------------L------------------AGRGSVQVPKDCRKDAFLK-TLD
Q9Z0D6_SDV/74-163--------------------------------------H------------------LFTENLAIPSTADFCKELA-RYN
Q9QRA5_9SECO/10-101--------------------------------------A------------------AYVGRVTCAKDAKGGTLLH-TLN
Q86631_9SECO/85-173--------------------------------------W------------------SAVTPFKCAAEAAENTILA-RWS
POL2_GCMV/815-905--------------------------------------F------------------AFIHTIDLPTAVTEGQVLA-KID
A2ID55_9SECO/270-361--------------------------------------L------------------MSATSYNVSKDVAAGVVIG-RLN
Q64959_9SECO/4-94--------------------------------------F------------------AFSQRITYPAARTVGTVIG-TLD
Q8B5P7_TRSV/12-103--------------------------------------C------------------CGTLSFKVPKDAKKGKHLG-TYD
Q88483_9SECO/838-928--------------------------------------F------------------ACGETIILPATSASGSILA-KID
POL2_CNSV/688-778--------------------------------------F------------------VFTQLITVPAASTKGNVLA-GVD

PF00760

CAPSD_CMVFN/11-215----------------------------------E----RCRPGYTFTS------ITLKPP-------KID------RGS

PF01318

CAPSD_BMV/2-188----------------------------------GKA-IKAIAGYSISK------WEASSD-------AIT------AKA

PF03566

Q80IX5_PRVFL/54-754GWFYKYMDPAGAVESGKALGEFSKVPDGLLRYSVDAE-QRPIVTIECPT------VSESDL-------PLD------GKL
CAPSD_NCBVS/1-608AWIHDYLDPDGEYKTS.L..DDGKIPDGAIPQSTCGQ-FRGTVGARYPG------LNSTTL-------PLD------GGT
CAPSD_HASV/2-647GWYFKYLDPAGATESARAVGEYSKIPDGLVKFSVDAE-IREIYNEECPV------VTDVSV-------PLD------GRQ

PF01829

CAPSD_NODAM/42-399---------------------QTMLLVAPIPGIACLK-AEANVGASFSG------VPLASV-------EFPGFDQLFGTS

PF08435

Q91H09_9CALI/305-535-----------------------VRFYSTS.....SD.FETNQPTHFTP------IGIYIE----------------GNS
Q8JMP1_9CALI/305-540-----------------------IGLHSIT.....EH.VHPNQQSRFTP------VGVAVN----------------EN.
Q8B4Z2_9CALI/297-515-----------------------ITFDEEAP....ADLFRACFRNLWEP------T.....----------------...
Q917X1_9CALI/305-538-----------------------VQIGTWNT....ND..VENQPTKFTP------IGLNEV----------------ANG
Q9IV43_9CALI/304-537-----------------------VSVTTAIDT..AGD.TLGTIQWTSQP------SNVTPV----------------P..
Q8VA02_9CALI/306-539-----------------------IQADGLSDVSVNTN.MIAKLGWVSPV------SDGHKG----------------...
Q9IV49_9CALI/306-538-----------------------VKFFSES.....QD.FEVHQPTVFTP------VGVAGD----------------PS.
Q6EAX3_9CALI/306-538-----------------------VNFGSTS.....TD.FQLQQPTKFTP------VGIKIE----------------SG.
Q8BAC6_9CALI/304-534-----------------------VRFKSSS.....DD.FDLHDPTKFTP------IGVNVD----------------DQ.
Q6WQW7_9CALI/296-512-----------------------VTLS........GDVPRVRSRARLDY------VSSTSQ----------------ES.
Q6B7R3_9CALI/303-535-----------------------IGLHQVQ.....GH.HSQHQQSKFTP------LGVAVN----------------GN.
Q6EAW7_9CALI/305-538-----------------------VQIGTWDT....ED.LLERQPVKFTP------VGLNEI----------------GQD
Q66418_9CALI/306-538-----------------------VQADNLSAG.ANTD.LIVSLSWISPV------SDQHRH----------------...
Q80FL2_9CALI/317-546-----------------------LVISTDS.....ED.FQQNKPTRFTP------VGVGVD----------------RE.
Q9IV42_9CALI/305-535-----------------------ISLTTGETF.HAGD.IIGSLGWISSP------RLIIHN----------------SM.
Q6XDL5_9CALI/307-546-----------------------IQFSTWET....QD.VSSGQPTKFTP------VGLASV----------------DAN
Q6B7R2_9CALI/304-538-----------------------IEYTTSQNP..DGG.QLGTLTWISSP------SDDTPG----------------HG.
Q917X4_9CALI/305-533-----------------------VVLGTWED....RD.FDINQPTRFTP------VGLYDT----------------D..
Q783W9_9CALI/306-535-----------------------VRFKSPS.....ND.FFDNEPIKFTP------VGISVD----------------SQ.
Q80J94_9CALI/309-538-----------------------VFASVTAAA..SLD..LVDGRVRAVP------RSIYGF----------------QD.
Q913B6_9CALI/305-540-----------------------IQIGTWQT....DD.LQVNQPVKFTP------VGLNDT----------------E..
Q8JW44_9CALI/304-539-----------------------IQFDEVFNH.PTGD.YIGTIEWISQP------STPPGT----------------...
Q83876_9CALI/301-524-----------------------IQANGIGS....GN.YIGVLSWVSPP------SHPSGS----------------...
Q9IV48_9CALI/306-533-----------------------IEFTSDQDP..AGD.QLGTLAWVSPS------TSGA..----------------...
Q8V713_9CALI/316-545-----------------------VVATVES.....TD.FHANQPSRFTP------VGLGGD----------------TN.
Q91I85_9CALI/304-538-----------------------ITLDDNVSS..GGD.YIGTIQWTSPP------SDSGGA----------------...
Q8JXJ0_9CALI/304-537-----------------------VSFKENVNV..AGD.YVCTIQYTSPP------SDPHNP----------------NA.
Q783X1_9CALI/315-545-----------------------VLMYSES.....SD.FDDGQPTRFTP------IGMGAD----------------...
Q783Y0_9CALI/305-533-----------------------IQIGTWEE....DD.VHINQPTKFTP------VGLFEN----------------E..

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452---------------------MLLTAQNLPASYNYCRLVSRSLTVRSST------LPGGVY-------ALNGTINAVTFQ
POLS_DXV96/2-442---------------------YIYTAQELKDSYDYGRLISGSLSIKSST------LPAGVY-------ALNGTFNAVWFQ
POLS_BSNV/7-428---------------------AITTSQDLKKAYNYARLVSRIVQVRSST------LPAGVY-------ALNGTFNGVTYI
POLS_IPNVJ/5-453---------------------WLETSQDLKKAFNYGRLISRKYDIQSST------LPAGLY-------ALNGTLNAATFE

PF02443

Q5Y4T0_PCV2/5-226---------------------------------------RKVKVEFWPC------SPITQ.-------GDR---------
Q27W03_PCV1/5-227---------------------------------------RKAKYEFYPR------DPITS.-------NQR---------
A3FEQ4_9CIRC/3-256---------------------------------------KGVAVTLRPA------YNIYQ.-------KSK---------
Q3HUU1_GOCV/5-247---------------------------------------RMVKVELRPA------YNPFT.-------RVR---------
Q1L2D2_9CIRC/1-237---------------------------------------VLVKVEMRPL------GENST.-------EWK---------
CAPSD_CACV/7-243---------------------------------------RLAKVEMRPL------NESWE.-------EWK---------
Q0H9S8_9CIRC/4-236---------------------------------------RLAKFEMRPL------NENWG.-------SWH---------
Q06J73_9CIRC/8-245---------------------------------------RLAKVEGIPR------REDWT.-------HWE---------
Q9DXG3_BFDV/11-242---------------------------------------KLAKMEMRPT------GGHYTV-------QSD---------
Q69EZ5_BFDV/7-239---------------------------------------KLAKMEMRPT------YGFGSI-------TQE---------
Q9DXG0_BFDV/11-242---------------------------------------KLAKMEMKPT------WGHYSI-------ATE---------
Q9DXF4_BFDV/3-235---------------------------------------KLAKMEMKPT------WGHSYT-------NSE---------

PF02956

A7VLZ2_9VIRU/1-506RNYPMQLQKYTYPDTHPQQIMLAKHKFFIPSLLTKPHGKRYVKIKIKPP------TQMSN--------KWFFQE------
Q9WT88_9VIRU/1-603LIPPLKMNQFTSPNTHPGLLMLSKHKIIIPSFQTRPGGRRFVKIRLNPP------KLFED--------KWYTQQ------
Q91CY9_9VIRU/1-581TVPPFKLNKYSCPMLHPGMMMQYKKKVLIPSYQTKPKGKAKIRLRIKPP------VLFED--------KWYTQQ------
A7VLY0_9VIRU/1-515NQPPFLLEKDFYNDLHPQMLLLAKHHRVIPSRQRKPLGKPYIKVKIKPP------KQMLT--------EWFFQQ------
Q9JGT1_9VIRU/1-585TSPPFLDTEITGPSIHPGMMALNKRARWIPSLKNRPGRKHYVKIKVGAP------RMFTD--------KWYPQT------
Q80QT8_9VIRU/1-595NVPPMKMDELTAPNTHPALLLQSKKKVKIYSWKTRPWGKKKVTVRVGPP------KLFED--------KWYSQH------
CAPSD_TTVB1/1-533RTGPFEVTLESYLSTQPSRHLMNHKAFIVPKLGRGPNKETYVKKIVRPP------ALFQS--------KWYFSQ------
A7VM00_9VIRU/1-509IQPPFTINKHTYMMTHPHFLLQRKHKKILLSKSTNPNGKLTKRIKIKPP------KMLQT--------KWYFQE------
Q9JG61_9VIRU/1-534RTGPFEVDRDSYLNTQPSRHMMNKNSFIVPKLNPNKKRKPYIRKKYKPP------ALLQN--------KWYFAQ------
Q91PS3_9VIRU/1-581RKPPFKDSQLTGPSLHPGMLMNRRKKIILLSFKTRPKGHSTKTIRIPPP------TLFAD--------RWYFQK------
CAPSD_TTVV4/1-560RNPPFTDSVLTGPMLHPGVLMNSKRKILIPSWETRPRGKKRIPVRIGPP------RLFTD--------HWYFQR------
Q91C93_9VIRU/1-546RHYPMKASALMYTSTQPQILLLNNRKRIVKCKANNKKTKPYIRLRIPPP------SQLKT--------KWYFQR------
Q2F827_9VIRU/1-589RRGPFKINKYSSPMAHPGMMMLDKMKILVPSFDTRPGGRRRVKVTIRPP------TLLED--------KWYTQQ------
Q91CY5_9VIRU/1-584RNPPFKLNKYSSPMYHPGMMMQARKKLMVPSFQTRPRGRKRYRVRIRPP------NMFAD--------KWYTQE------
Q8V7G9_9VIRU/1-572RTTPFETNELSHMLTHPLLMLLNKHHRVIPSLKTRPKGKRSVRIHIKPP------KLMIN--------KWYFAK------
Q99A78_9VIRU/1-584TMSPFLDTQLTGPSIHPGLMALNKRARWIPSLKSRPGRKHVVKIRVGAP------RMFTD--------KWYPQS------
Q6H9C2_9VIRU/1-573TQPPFLDTHLTAASIHPGIMMLSKRHILIPSLKTRPSRKHRVVVRVGAP------RLFQD--------KWYPQS------
CAPSD_TTVT1/1-433TEF.VDQPKKVMSYTHPWILLMTKKHKVIKPRKWNGKGK...KIFLKPP------AVFNS--------AWYTSD------
Q9JG80_9VIRU/1-589ISEPYKLDKYSCPNYHPGNLIKAKHKFLIPSYDTNPKGRQKIIVKIPPP------DLFVD--------KWYTQE------
A7VLZ6_9VIRU/1-506RNPPFNLTKFTYPGAHPQQMLLQKHHKLILSQMTKNPNKLTKKFKIKPP------RQMIS--------KWFFTK------
Q6H9D2_9VIRU/1-557RKPPFLDTIVSGPAMHPGMLMTTKHKILVKSFKTKPKGKGTVKVRIRPP------TLFDD--------RWYFQH------
Q6H999_9VIRU/1-471RRTPLGGNIYTAPSLHPGNAILAKHKILVPSLQTRPKGRKAIRLRIAPP------TLFTD--------KWYFQK------
Q77JT5_9VIRU/1-606TSPPFEDTDMTAMTLHPGMMMLAKKTIKIPSLKTRPSRKHVVRIRVGAP------KLFED--------KWYPQN------
Q91PS7_9VIRU/1-585RKPPFKDTQITGPSLHPGILMTRRKKKIIKSFLTRPRGRATKRVRFKPP------TLYTD--------KWYFQK------
CAPSD_TTVV9/1-555LETPMEVGLESHMLAHPLKMIMSSKHVTVPSLLTKKGGRRYLRLKIPPP------KLMMT--------QWYFQK------
Q9JG47_9VIRU/1-553NSYPMSANLLTYQSTCPQVMLMNNRTKIMPCKRYNRNKKPYKKFFVKPP------SQLQN--------KWYFQK------
A7VLW0_9VIRU/1-507IQPPFHITKWTYMSIHPQMLLLRKHKKLLLSTATKPNGKLTTRFKIRPP------KQLVT--------KWFFQK------
Q0ZLH9_9VIRU/1-573RKPPFIDTQITRCTLHPGMLIQERKKVIIPSFQTRPKGRIKRKIKVRPP------TLFTD--------KWYFQR------
Q5ENW7_9VIRU/1-501TDFKELYAENIKEYSQPSVMMMAKRTRIVIARERAPHRRKVRKIFIPPP------SRDTT--------QWQFQT------
A7VLX2_9VIRU/1-509NQPPFSINQFTYPDIHPQNLLLRKHKKIVLSRATKPHGKLTVKIKIKPP------KLLST--------RWFFQK------
Q80AR5_9VIRU/1-594INPPMKNTELSGPNTHPGMLMQQKRKILVPSWDAYPKGRKYVLAKIPPP------KLFED--------HWYTQP------
Q91CZ2_9VIRU/1-601ISEPFKIDKDSSPSFHPGILMKSKHKVLVPSFQTWPKGRSKVKLKIKPP------KMFVD--------KWYTQE------
CAPSD_TTVG1/1-514RQPPFEIDKLTYMKYHPYMLLQRKHKIILPSQTTNPRGKLKKKKTIKPP------KQMLS--------KWFFQQ------
Q98Y63_9VIRU/1-581TNPPFKINKYSSPFLHPGLMMLQKKKILIPSFQTKPGGKSRIKVKIKPP------ALFED--------KWYTQQ------
Q9QU36_9VIRU/1-529RCYPLKATHDLYMQTQPSILMRDKHSILIPCMKNGRNRKTYKTIKVRPP------TQMTN--------GWFFQK------
A7VM12_9VIRU/1-509RQPPWELSKYTYPSCHPHQMLLDKHKVVIFSQASKPHGKYKYKLRIKPP------KQLIT--------KWFFTK------
A7VLV6_9VIRU/1-508VMPPFDINKLTYPDIQPQNLLLRQRHKLILSQASNPKGKLRVKVKIKPP------KTMQT--------KWYFQK------
Q9JG50_9VIRU/1-535ICYPMTDTEDQHLNSQPHRLIQGRKKIVVHRYNKQIHKKPYVKKRIRPP------AMLQS--------HWYFQQ------
A7VLW4_9VIRU/1-507LQPPHELSKYTFPSCHPHQMLLQKRHKILLSKQSNPNGKLYKKIKFKPP------KQMIN--------KWLFTK------
A7VM04_9VIRU/1-513RQPPFDISKEIYAACHPQNMLLAKHKMLILSKFTNPKGKLKKTRKVKPP------KQMLN--------KWFFQE------
A7VLY4_9VIRU/1-498RNLPMTIEKLTYPHTHPQALLLSRHKRIIPSRVTKPHGKNRVIIKIKPT------RVVLK--------KWFFQE------
CAPSD_TTVD1/1-324..PEYGNTFEFKKLIHPAIMITHPKTILVLSNKRGGNRRKWPRMWIPRP------AIFAD--------GWEFQK------
Q91CZ6_9VIRU/1-596TAAPFTIDKDSSANYHPGVLIKARKKVLVPSYDTHPKGRAKIKIHIEPP------KMFVD--------KWYAQH------
A7VM08_9VIRU/1-506RQPPFNIDKYTYMSMQPQEMLLGKHKKIILSKLTKPTGRIKHTLKIGPP------KLLTN--------KWMFQE------
CAPSD_TTVV3/1-573TQPPFQDTEITAPSIHPGMLILSKKHILIPSLKTRPSKKHYVKVRVGAP------RLFQD--------KWYPQS------
Q91D00_9VIRU/1-593NNPPMKNTILSSPNTHPGMLMQQKHRILVPSWQTFPRGRKYVKVKIPPP------KLFED--------HWYTQP------
Q99AR5_9VIRU/1-604LVPPLKMNQFTSPNTHPGLLMLTKHKIIIPSFLTRPGGRRFVKIRLPPP------KLFED--------KWYTQQ------
Q9DTD2_9VIRU/1-559TSPPFRDTEMTGPSIHPGMLMLKKHRLLIPSLKTRPGRKHRITVRIGAP------KTFED--------KWYPQT------
Q91D04_9VIRU/1-591SVPPFKMDKYSSAMLHPGTLMQRKKKILIPSFTTRPRGRKKVKLHIKPP------VLFED--------KWYTQQ------
CAPSD_TTVV8/1-571NSPPFEDTELTGPNTHPGMLMLRHKKILVPSLRTRPSRRHKITVRIGPP------KLFED--------KWYSQT------
Q5ENX0_9VIRU/1-603NNPPMKTNQYTAPMTHPGMLMRAKHKILIPSRLTRPRGKKYISVRIRPP------KLFQH--------KWYTQS------
O90364_9VIRU/1-590TMPPFLDTELTAPRLHPGMLALDKRARWIPSLKSIPGKKHYIKIRVGAP------KMFTD--------KWYPQT------
Q9IFV0_9VIRU/1-583RRQPFSDSQLTGPSLHPGIIMKQKRKVIVPSYKTKPKGRPVKRIRIKPP------TLFTD--------RWYFQK------
Q9QUE7_9VIRU/1-586TTPPFVDTEITGPSIHPGMMALNKRARFIPSLKTRPGRRHIVKIRVGAP------KLYED--------KWYPQS------
A8DMR2_9VIRU/1-531RCGSLTATEELYRSCQPSLLLLNKHKKVLTCKKNNNKRKISKTIKIPPP------TLMQN--------KWYFQK------
Q9DUH8_9VIRU/1-609NTPPMMSNQYTAPLAHPGMLMRSKYKLLLPSFKTRPGGKKTVSVRIRPP------KLFNH--------KWYAQS------
A7VLW8_9VIRU/1-511RQPPFLIDKWTYMQYHPYMLLQSKHTKIIPSEQTNPKGRLKKKLIIRPP------KQMLS--------KWFFQR------
Q99AQ3_9VIRU/1-582VSAPFKLDKNSCPSYHPFMLMKAKHKVLIPSFDTKPKGREKIKLRIQPP------KMFID--------KWYTQE------

PF02248

Q66170_CPMVS/720-899TH-----------------------------------------------------IYNPPI-------MNVLRT------
Q9YWJ9_9SECO/828-1009IT-----------------------------------------------------VYPSPI-------ANLLKV------
POL2_CPMVS/837-1016TH-----------------------------------------------------IYNPPI-------MNVLRT------
POL2_BPMV/821-1004TL-----------------------------------------------------VQNSPI-------SNLLRV------
POL2_CPSMV/808-988SV-----------------------------------------------------LSSSPV-------ANLLRT------
POL2_RCMV/786-964LT-----------------------------------------------------ALNTPV-------ANLLRT------
Q66179_APMV/2-185FV-----------------------------------------------------LIPSPM-------VYLLQT------
POL2_APMV/802-985FV-----------------------------------------------------LIPSPM-------VYLLQT------
POL2_SQMVM/622-803IT-----------------------------------------------------VYPSPI-------ANLLKV------
Q9YWK0_9SECO/739-920IT-----------------------------------------------------AYPSPI-------SNLLKV------

PF03688

A5H0K4_GFLV/264-422VA-----------------------------------------------------MGENPF-------AAMIAC------
POL2_BRSV/1176-1338VT-----------------------------------------------------NFVNAL-------AILCAT------
Q86631_9SECO/418-544LK-----------------------------------------------------MEAHPL-------ARLVAS------
POL2_ARMV/344-502VA-----------------------------------------------------LGDNPF-------AHMIAC------
Q88483_9SECO/1172-1336VT-----------------------------------------------------NFVNAL-------AIMCAT------
A2ID55_9SECO/610-780AT-----------------------------------------------------INANPF-------HYILNS------
Q80JS8_BRAV/347-511VT-----------------------------------------------------MSTNPL-------ALLIGS------
A0A9J6_ARMV/960-1118VA-----------------------------------------------------LGTNPF-------AHMIAC------
CAPSD_TRSV/351-511VT-----------------------------------------------------LASNPL-------SWLVAA------
POL2_GCMV/1150-1316VT-----------------------------------------------------NYVNAF-------AIMCAT------
Q6XPY1_9SECO/164-322VI-----------------------------------------------------NHVNAF-------SIMCAT------
Q6XFY6_9SECO/157-316VA-----------------------------------------------------LGNNPF-------AHMIAC------
Q9IV56_9SECO/980-1138LE-----------------------------------------------------LATNPF-------SKMIAA------
Q65624_9SECO/386-551VT-----------------------------------------------------MRRNAL-------ANLIRS------
POL2_CNSV/1022-1185VT-----------------------------------------------------GYTNAF-------LQMCQT------
Q64959_9SECO/338-502CV-----------------------------------------------------NFTNAF-------AIMCAT------
Q20LA0_9SECO/942-1102TT-----------------------------------------------------NYVNPT-------SLLFSV------
A3FEN2_9SECO/348-507VL-----------------------------------------------------LRQHPL-------SLLISS------
Q9ELS0_9SECO/148-312VA-----------------------------------------------------LKNNPL-------SAIFGA------
Q9QAH0_9SECO/350-510VT-----------------------------------------------------NYVNPT-------SLLFSV------
Q24M89_9SECO/943-1103IT-----------------------------------------------------NYVNPA-------SLLFSV------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215KL----------------------------------------DVVKLLY......NEQFAV-------QGLLRY------
POLG_AEVCA/45-212KI----------------------------------------DIVKELL......DQSYAV-------DGLLKY------
POLG_CXA9/93-300..----------------------------------------.WWKFPEAL....SDMGLF-------GQNMQY------
POLG_CXB3N/93-302..----------------------------------------.WWKLPDAL....SNLGLF-------GQNMQY------
POLG_CXB4J/93-300..----------------------------------------.WWKFPDAL....SEMGLF-------GQNMQY------
POLG_CXA21/93-308..----------------------------------------.WWKLPDCL....KDMGMF-------GQNMYY------
POLG_POL1M/93-308..----------------------------------------.WWKLPDAL....RDMGLF-------GQNMYY------
POLG_POL3L/93-307..----------------------------------------.WWKLPDAL....RDMGLF-------GQNMYY------
POLG_HE701/93-288..----------------------------------------.WWKLPDAL....NQIGMF-------GQNVQY------
POLG_BOVEV/93-285..----------------------------------------.YWKLPDAL....NNTGMF-------GQNAQF------
POLG_HRV14/93-299..----------------------------------------.CWKLPDAL....KDMGVF-------GQNMFF------
POLG_HRV2/93-302..----------------------------------------.WWKLPDAL....KDMGIF-------GENMFY------
POLG_HRV8A/93-302..----------------------------------------.WWKLPDAL....KNMGIF-------GENMFY------
POLG_HRV1B/93-301..----------------------------------------.WWKLPDAL....KEMGIF-------GENMYY------
POLG_FMDV1/311-475..----------------------------------------.LTKLELPT....DHHGVF-------GHLVDS------
POLG_FMDVT/311-475..----------------------------------------.MHKVVLPH....EPKGVY-------GGLVKS------
POLG_FMDVO/311-475..----------------------------------------.LLELPT......DHKGVY-------GSLTDS------
POLG_EMCV/161-359PL----------------------------------------STSAFPFLTSCP.VKMVVS-------LVALRR------
POLG_TMEVB/172-382..----------------------------------------.HIRIPLPHVLAGEDGGVF-------GATLRR------
POLG_ENMGO/162-361..----------------------------------------.YIRIPLPHVLSGEDGGVF-------GATLRR------
POLG_FMDVO/533-691..----------------------------------------.DMSLAAKQ....MSNTFL-------AGLAQY------
POLG_FMDV1/533-692..----------------------------------------.DVSLAAKH....MSNTYL-------SGIAQY------
POLG_EMCV/420-582..----------------------------------------.TYQVTLSCSC..LANTFL-------AALSRN------
POLG_TMEVB/443-606..----------------------------------------.DYQVALSCSC..MANSML-------AAVARN------
POLG_HE701/347-515..----------------------------------------.NIPLDIQLEGP.LRNTLL-------GNISRY------
POLG_HRV2/358-522..----------------------------------------.SIRTDV.ASQP.LATTLI-------GEISSY------
POLG_HRV8A/364-529..----------------------------------------.SIPVDI.ASQP.LATTLI-------GELASY------
POLG_HRV1B/360-525..----------------------------------------.AIKVDI.TSQP.LATTLI-------GEIASY------
POLG_BOVEV/345-515..----------------------------------------.ALRLELGGSGP.LSSSLL-------GTLAKH------
POLG_CXA21/369-534..----------------------------------------.CLSLSPASDKR.LSHTML-------GEILNY------
POLG_CXA9/358-524..----------------------------------------.GLRLQPGLDSV.FKHTLL-------GEILNY------
POLG_CXB4J/358-524..----------------------------------------.GFPLQPGASSV.LQRTLL-------GEILNY------
POLG_CXB3N/360-526..----------------------------------------.GFPLQPGYSSV.FSRTLL-------GEILNY------
POLG_CXB1J/360-526..----------------------------------------.GFPLQPGANNV.LNRTLL-------GEILNY------
POLG_FMDVO/725-872..----------------------------------------.LDLMQI......PSHTLV-------GALLRA------
POLG_FMDV1/726-878..----------------------------------------.IDLMQT......HKHGIV-------GALLRA------
POLG_BOVEV/610-775..----------------------------------------.NWRIDF......REFVQL-------RAKMSW------
POLG_HRV8A/621-792..----------------------------------------.TWKVSL......QEMAQI-------RRKYEL------
POLG_HRV2/614-772..----------------------------------------.VWAINL......QEMAQI-------RRKFEL------
POLG_HRV1B/627-786..----------------------------------------.TWKITL......QEMAQI-------RRKFEL------
POLG_HE701/609-781..----------------------------------------.IWTLNT......RELVQI-------RRKMEL------
POLG_HRV14/614-787..----------------------------------------.DWKINL......SSLVQL-------RKKLEL------
POLG_CXA9/612-783..----------------------------------------.AWPINT......KQMVQM-------RRKLEM------
POLG_CXB4J/612-783..----------------------------------------.EWVINT......RQVAQL-------RRKMEM------
POLG_SVDVU/612-782..----------------------------------------.YWVINT......RQVAQL-------RRKLEM------
POLG_CXB3N/630-782..----------------------------------------.EWVLTP......RQAAQL-------RRKLEF------
POLG_POL1M/636-806..----------------------------------------.VWKITY......KDTVQL-------RRKLEF------
POLG_CXA21/642-812..----------------------------------------.IWNITY......TDTVQL-------RRKLEF------
POLG_CXA24/646-809..----------------------------------------.TWAITY......TDTVQL-------RRKLEF------

PF00915

CAPSD_VESVA/137-421VL----------------------------------------YSQALNP------SINPYL-------DHISKL------
POLG_RHDVF/1768-2065IL----------------------------------------YTVQHSP------QNNPFT-------AVLSQM------
CAPSD_FCVUR/112-395IL----------------------------------------FKQSLGP------LLNPYL-------EHLSKL------
CAPSD_NVN68/2-294VL----------------------------------------FDLSLGP------HLNPFL-------LHLSQM------

PF08762

Q8B107_ALPV/599-804..----------------------------------------..AAQATM-----VNIDLY.......SYYSYI------
O56051_9VIRU/590-790RL----------------------------------------EGVTQEGS-----SDIDGI.......SWFASL------
Q56QP7_9VIRU/684-855..----------------------------------------.......W-----HYKDYV.......SILSYL------
O36967_9VIRU/668-900..----------------------------------------....VAPA-----EPMSLF.......EYYYFI------
Q5UBY1_9VIRU/79-259..----------------------------------------.......K-----EGRDYM.......SYLSYL------
Q6ITS9_9VIRU/106-313YV----------------------------------------DTETKEAK-----YGFSYFWSAPTTLNIVAEM------
Q4JFT2_9VIRU/834-1009..----------------------------------------..FGTDNS-----LRQSLV.......NIISYM------

PF00729

CAPSD_PNLV/47-266AV--------KVGIEYQV------------------------SVVPLVP------..CIQH-------TWLSGV------
CAPSD_MCMVK/23-222EI--------PVCAGIDF------------------------PA.GTSP------RYIGAA-------KWLAAQ------
CAPSD_PMVK/39-236TI--------PIIPRLSV------------------------PA.GDKP------IYSGSA-------PHLRTI------
CAPSD_RCNMV/24-213.M--------RTNNGKSN------------------------QRFRLNP------SNPALF-------PTLAYE------
CAPSD_CARMS/51-245..--------......SF------------------------EDWVVSP------RNVAVF-------PQLSLL------
CAPSD_SBMVA/46-262.L--------SVTNAIVI------------------------TSELVMP------..YTMG-------TWLRGV------
CAPSD_TBSVC/76-269.F--------QVNGGIVG------------------------NLLQLNP------LNGTLF-------SWLPAI------
CAPSD_POLVP/66-257.L--------VVNGGVSG------------------------NLYRINP------SNPVVF-------PWLQGI------
CAPSD_OCSVU/111-308AF--------RCTG....------------------------..YRANP------GMSTIF-------PWLSAT------
CAPSD_TNVA/61-272AL--------GAFNTTNS------------------------ALIAAAP------......-------SWLASI------

PF11729

CAPSD_SJNNV/1-340GMSRIAQAVVPAGTGTDG------------------------KIVVDST------IVPELL-------PRLGHA------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------FTFGP------SLSDCP-------AFKDGI------
CAPSD_PEMVW/53-187--------------------------------------------VKFGP------S.SDCQ-------CIK.GN------
CAPSD_BYDVP/62-199--------------------------------------------IKFGP------SLSQCP-------ALSDGI------

PF03014

CAPSD_HEVCH/41-659LTAVAPAHDTPPVPDVDSRGAILRRQYNLSTSPLTSSVATGTNLVLYAA------PLSPLL-------PLQDGTNTHIMA

PF03115

CAPSD_HASV1/1-416GPKPAICQRATATLGTVG--------SNTSGTTEIEACILLNPVLVKDA------TGSTQF-------GPVQAL------

PF00983

COAT_TYMV/8-177----------VLFAGTKD---------------------------AEAS------LTIANI-------DSVSTL------

PF02247

POL2_SQMVM/246-618GG----------------------------------------A-GTKDA------ILMNMP-------NAVISL------
POL2_CPMVS/460-832GG----------------------------------------A-GATQA------FLANMP-------NSWISM------
POL2_BPMV/447-819GG----------------------------------------A-GAKSA------ILMNMP-------NAVLSM------
Q9Z006_9SECO/476-846KP----------------------------------------Q-TDGKE------VTSTFA-------SAYCGL------
O12663_9SECO/321-691KP----------------------------------------Q-TDGKE------VTSTFA-------SSYCGL------
Q9YWK0_9SECO/363-735GG----------------------------------------A-GTKDA------ILMNMP-------NAVISL------
POL2_CPSMV/437-806GG----------------------------------------A-GAKNS------ILMNLP-------NAILSM------
POL2_RCMV/407-778GG----------------------------------------A-GAKNS------ILMNMT-------NAFLSL------
Q9YWJ9_9SECO/452-824GG----------------------------------------A-GTKDA------ILMNMP-------NAVISL------
Q66170_CPMVS/343-715GG----------------------------------------A-GATQA------FLANMP-------NSWISM------

PF03391

CAPSD_TRSV/179-344GG----------------------------------------PVKHSKK------HAISYS-------RAVMSR------
POL2_RRVS/768-936GT----------------------------------------AILHGQQ------IVRTFP-------RVVAAH------
POL2_BRAV/1268-1433TS----------------------------------------TTTVSGW------RTVSFP-------AAYALF------
Q65029_ARMV/745-916GQ----------------------------------------TLVDGTH------KVYNFN-------NTLLSY------
POL2_ARMVS/792-963GQ----------------------------------------TLVDGTH------KVYNFN-------NTLLSY------
Q67703_GFLV/166-336GQ----------------------------------------VPMVGTT------RVYNLN-------STLVSC------
POL2_GFLV/771-941GQ----------------------------------------VPMVGTT------KVYNLN-------STLVSC------
POL2_BRSV/1007-1170AK----------------------------------------LQSTSGR------TAYSYA-------AGLLSH------
POL2_GCMV/981-1144VQ----------------------------------------QKSSSGR------IAYSYA-------AGLLSH------
POL2_TORVR/1497-1662LS----------------------------------------TVISGNM------STLNAN-------QALLRF------
Q88483_9SECO/1003-1166MR----------------------------------------VDSAAKR------QAYSYA-------AGVLSH------

PF03689

A3FEM9_9SECO/10-101II----------------------------------------K-ECKSQ------NLLRYK-------EWQRQG------
Q9QAH4_9SECO/9-99VR----------------------------------------A-KAATF------DSAVWR-------QWVRDG------
Q09G89_GFLV/608-698IR----------------------------------------D-MISDF------KGVQYE-------KWITAG------
Q9JGK5_SDV/160-249VM----------------------------------------A-EAMNY------RSASYY-------SRLLSG------
Q9IV56_9SECO/636-727FR----------------------------------------E-IAKEY------AGEFYN-------RWVYNR------
A1YYW2_BRAV/156-247IQ----------------------------------------T-RVFED------NRRVAL-------DWLAHG------
Q65624_9SECO/45-137LR----------------------------------------E-DIATS------DNLVKY-------EWLAKG------
Q6JX06_9SECO/849-939IL----------------------------------------E-KIKTT------HSAVCA-------EWVQMG------
Q20LA0_9SECO/601-691LR----------------------------------------A-KAQEM------DSAVWR-------QWVKDG------
POL2_BRSV/842-932IF----------------------------------------D-KIQET------NTKVCS-------KWLEQG------
A0A9J8_ARMV/580-670LR----------------------------------------D-MISGF------SGIQYE-------KWITAG------
Q6JX05_9SECO/604-694MR----------------------------------------S-MTAGF------AGIQYE-------KWITSG------
Q9Z0D6_SDV/74-163VL----------------------------------------A-KATSF------KSASYY-------SRLLSG------
Q9QRA5_9SECO/10-101VI----------------------------------------E-ACKSM------SLLRYK-------EWQRQG------
Q86631_9SECO/85-173LR----------------------------------------S-IISES------GTDAWT-------KWQREL------
POL2_GCMV/815-905IF----------------------------------------K-KIQDA------KSMVCV-------QWMQAG------
A2ID55_9SECO/270-361LV----------------------------------------E-RARVD------NTIPYL-------EWLSKG------
Q64959_9SECO/4-94IF----------------------------------------A-LITTT------NSRVCA-------EWLERG------
Q8B5P7_TRSV/12-103IR----------------------------------------Q-ALMDY------GGLHSQ-------EWCAKG------
Q88483_9SECO/838-928LI----------------------------------------S-LIKNT------NTRVCS-------EWLMDG------
POL2_CNSV/688-778IL----------------------------------------A-NARTT------MSGFYM-------RWLQKG------

PF00760

CAPSD_CMVFN/11-215YYGKRLLLPD------SV-TEYDK--------------------------KL-VSRIQIRVNPLPK-------FDSTVWV

PF01318

CAPSD_BMV/2-188TNAMSITLPH------ELSSEKNK--------------------------ELKVGRVLLWLGLLPS-------VAGRIKA

PF03566

Q80IX5_PRVFL/54-754WRVSFISFPAFRLNFIALANINNE..------------------------ALTLETRNTFIQTLNNITNWRD.LGTGQWA
CAPSD_NCBVS/1-608WPLLVMHLPFFRHPLLFITTTSNTEV------------------------EVTNADLDAFANDWNNRTDWTE.ATYPSWA
CAPSD_HASV/2-647WSLSIFSFPMFRTAYVAVANVENK..------------------------EMSLDVVNDLIEWLNNLADWRYVVDSEQWI

PF01829

CAPSD_NODAM/42-399ATDTAANVTAFRYASMAAGVYPTSNL------------------------MQFAGSIQVYKIPLKQ-------VLNSYSQ

PF08435

Q91H09_9CALI/305-535SDFNQWQLPRYGGHLANNNHLAPAVS------------------------PLFPGEQILFFRS-----------------
Q8JMP1_9CALI/305-540TPFQQWVLPHYAGSLALNTNLAPAVA------------------------PTFPGEQLLFFRS-----------------
Q8B4Z2_9CALI/297-515.EHSFWRIPDYRADV.LGSDFAPSVS------------------------APGVGETLLFFMC-----------------
Q917X1_9CALI/305-538HRFEQWTLPRYSGALTLNMNLAPAVA------------------------PLFPGERLLFFRS-----------------
Q9IV43_9CALI/304-537.DVNFWTIPQYGSSLAEASQLAPVVY------------------------PPGFGEAIVYFMS-----------------
Q8VA02_9CALI/306-539.DVDPWVIPRYGSTLTEAAQLAPPIY------------------------PPGFGEAIVFFMS-----------------
Q9IV49_9CALI/306-538HPFRQWTLPRYGGHLTNNIHLAPAVA------------------------PLFPGEQILFFRS-----------------
Q6EAX3_9CALI/306-538HEFDQWALPRYSGHLTLNMNLAPPIA------------------------PNFPGEQLLFFRS-----------------
Q8BAC6_9CALI/304-534HPFRQWSLPNYGGHLALNNHLAPAVT------------------------PLFPGEQILFFRS-----------------
Q6WQW7_9CALI/296-512....FWVLPDYRTDV.LGSEFAPAVS------------------------APGVGETILFFMG-----------------
Q6B7R3_9CALI/303-535TPFRQWELPNYSGALTLNTNLAPAVG------------------------PNFPGEQILFFRS-----------------
Q6EAW7_9CALI/305-538KHFDQWVLPNYSGALGLNMHLAPAVS------------------------PLFPGERLLFFRS-----------------
Q66418_9CALI/306-538.DVDPWVIPRYGSSLTEAAQLAPPIY------------------------PPGFGEAIVFFMS-----------------
Q80FL2_9CALI/317-546EEFDQWSLPDYSGPITHNMNLAPAVA------------------------PNFPGEQLLFFRS-----------------
Q9IV42_9CALI/305-535....FGTIPKYGSSLPDVTHLAPAVF------------------------PPGFGEVILYFYS-----------------
Q6XDL5_9CALI/307-546SHFDQWTLPSYSGALTLNMNLAPSVA------------------------PVFPGECLLFFRS-----------------
Q6B7R2_9CALI/304-538.TINLWKIPSYGSTVTESVHLAPPIY------------------------PPGFGETLVNLMS-----------------
Q917X4_9CALI/305-533.HFNQWALPNYSGALTLNMNLAPSVA------------------------PLFPGEQLLFFRS-----------------
Q783W9_9CALI/306-535NSYNQWLLPRYGGHLTNNTHLAPSVS------------------------PMFPGEQILFFRS-----------------
Q80J94_9CALI/309-538......TIPEYNDGL..LVPLAPPIG------------------------PFLPGEVLLRFRT-----------------
Q913B6_9CALI/305-540.HFNQWVVPRYAGALNLNTNLAPSVA------------------------PVFPGERLLFFRS-----------------
Q8JW44_9CALI/304-539.DINLWEIPDYGSSLSQAANLAPPVF------------------------PPGFGEALVYFVS-----------------
Q83876_9CALI/301-524.QVDLWKIPNYGSSITEATHLAPSVY------------------------SPGFGEVLVFFMS-----------------
Q9IV48_9CALI/306-533.RVDPWKIPSYGSTVTESTHLAPLIF------------------------PPGFGEAIVYFMS-----------------
Q8V713_9CALI/316-545RDFNQWQLPAYGGALTNNTNLAPPVM------------------------PVYPGEQLLFFRS-----------------
Q91I85_9CALI/304-538.NTNFWKIPDYGSSLAEASQLAPAVY------------------------PPGFNEVIVYFMA-----------------
Q8JXJ0_9CALI/304-537.DVDFWSIPDYGSNLAEASQLAPVVY------------------------PPGFGEAIVYFMS-----------------
Q783X1_9CALI/315-545.DWHQWELPEYSGHLTLNMNLAPAVA------------------------PAFPGERILFFRS-----------------
Q783Y0_9CALI/305-533.GFNQWTLPNYSGALTLNMGLAPPVA------------------------PTFPGERILFFRS-----------------

PF02226

POLG_HRV8A/2-69-SLNYFNINYFKDAASSGAS------------------------------------------------------------
POLG_POL1M/2-69-TINYTTINYYRDSASNAAS------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--TGVINYNFYSNSYTDAVDL...SG------------------------AMSSQ-------------------------
Q9DLK1_FMDVP/202-285--TGSIINNYYMQQYQNSMDTQLGDN------------------------AISGG-------------------------

PF01766

POLS_IBDVU/9-452GSLSELTDVSYNGLMSATANINDKIG------------------------NVLVGEGVTVLSLPTSYDLGYVRLGDPIPA
POLS_DXV96/2-442GTLSEVSDYSYDRILSITSNPLDKVG------------------------NVLVGDGIEVLSLPQGFNNPYVRLGDKSPS
POLS_BSNV/7-428GSLSEIKDLDYNSLLSATANINDKVG------------------------NVLVGDGVAVLSLPAGSDLPYVRLGDEVPS
POLS_IPNVJ/5-453GSLSEVESLTYNSLMSLTTNPQDKVN------------------------NQLVTKGITVLNLPTGFDKPYVRLEDETPQ

PF02443

Q5Y4T0_PCV2/5-226-------------------GVGSTAV------------------------ILDDNFV..TK--------ANALT------
Q27W03_PCV1/5-227-------------------GVGSTVV------------------------ILDANFV..TP--------STNLA------
A3FEQ4_9CIRC/3-256-------------------TQGSTII------------------------DKDGQIVR.TS--------TTGWA------
Q3HUU1_GOCV/5-247-------------------TQGSTYI------------------------DKEGNITTTTS--------GSEWN------
Q1L2D2_9CIRC/1-237-------------------GLGHTVP------------------------ITDARLMNFVK--------KKGLA------
CAPSD_CACV/7-243-------------------GFGHNVP------------------------IQDNHLEDFFK--------KTRLD------
Q0H9S8_9CIRC/4-236-------------------GIGHNVP------------------------IQDNHLEDFFK--------KPGLE------
Q06J73_9CIRC/8-245-------------------GAGVTVP------------------------IQDQHLRDFFK--------KTRLT------
Q9DXG3_BFDV/11-242-------------------GFGHTAV------------------------IQDSRITRFKT--------IADQT------
Q69EZ5_BFDV/7-239-------------------GFGHTAV------------------------IQDSRISKFKT--------TADQN------
Q9DXG0_BFDV/11-242-------------------GFGHTAV------------------------IQDSRIEKFKT--------RADQS------
Q9DXF4_BFDV/3-235-------------------GFGHTAV------------------------IQDSRISKFKT--------TADQT------

PF02956

A7VLZ2_9VIRU/1-506-GFSDTGLVQIHTAA-CDLRYAHLGC------------------------CNTNQLASFLT.LNTDFYQYAAWG......
Q9WT88_9VIRU/1-603-DLCKVPLVSITATA-ADLRYPFCSP------------------------QTNNPCTTFQV.LRK.NYNTVIGT......
Q91CY9_9VIRU/1-581-DLCPVNLLSLAVSA-CSFLHPFIPP------------------------ESDNICITFQV.LRD.FYYTQMSV......
A7VLY0_9VIRU/1-515-DFATQGLFSIHAAA-ANMQWAYYNP------------------------DQQSRCLTLYS.LNIKFFANTDWS......
Q9JGT1_9VIRU/1-585-DLCDMTLLTIFASA-ADMQYPFGSP------------------------LTDTIVVSFQV.LQS.MYNDCLSV......
Q80QT8_9VIRU/1-595-ELCKVPLVSWRLTA-ADMRFPFCSP------------------------LTDNPCYTFQV.LHE.EYYNVIGT......
CAPSD_TTVB1/1-533-DIYNTPLFILTVSS-CSLDQMYAPQ------------------------DQISTNISLFS.LNTNVFQINNWH....KQ
A7VM00_9VIRU/1-509-ELAEFGLVAIHAAA-CNFRYPWLAC------------------------CNENLIITLYY.LQPSFWSHTEWA......
Q9JG61_9VIRU/1-534-DILNTPLILFTTSS-CSLDQMYAPN------------------------DQISTNITFLS.LNTNIFQNPYWE.LDDNQ
Q91PS3_9VIRU/1-581-DFAKVPLVNIGASI-GNLRFPFCRP------------------------QTENTCVYFQV.LSN.AWNNMLSI......
CAPSD_TTVV4/1-560-DFCGVPLLTVNATA-CNLRYPFGSP------------------------QTKNICIYFLV.LAS.IYNDKVSI......
Q91C93_9VIRU/1-546-DIANLPLLLTIATA-CSLDRPYLNS------------------------QSISNTVGFKT.LNYEAFLNRGFK.NIPTT
Q2F827_9VIRU/1-589-DLAPVNLVSLVVSA-ASFIHPFSQP------------------------QTNNICTTFQV.LKD.MYYDCIGI......
Q91CY5_9VIRU/1-584-DLCPVPLVQLVVSA-ASFMHPFCSP------------------------LTNNPCITFQV.LKD.NYYSCIGV......
Q8V7G9_9VIRU/1-572-DLCNIGPCQIYATG-LELSNPWLRS------------------------GTNSPVIGFWV.LKNHLYDGNLSN......
Q99A78_9VIRU/1-584-DLCDLPLLTIFASA-ADMQYPFGSP------------------------LTDSVVVGFQV.LQS.MYNDCLSI......
Q6H9C2_9VIRU/1-573-DLCDTVLLSIFATA-CDLQYPFGSP------------------------LTDNPCVNFQI.LGP.QYKKHLSI......
CAPSD_TTVT1/1-433-KWCGAGLGRIYFSF-LNPFKQIMHT------------------------NQTEQSFPFAIELGNTDYDKPPNN......
Q9JG80_9VIRU/1-589-DLCSVNLVSLAVSA-ASFLHPFGSP------------------------QTDNPCYTFQV.LKE.FYNQAIGF......
A7VLZ6_9VIRU/1-506-PFAKYPLLSLKASA-LDLRHSYLGC------------------------CNENSQVYFFY.LNHGFYKQTNWG......
Q6H9D2_9VIRU/1-557-DICKTTLFTISATP-CDLRFPFCSP------------------------QTDNPCVNFLV.LAG.VYNGKLSI......
Q6H999_9VIRU/1-471-DIADLTLFNIMAVE-ADLRFPFCSP------------------------QTGNTCISFQV.LNS.VYNNYLSI......
Q77JT5_9VIRU/1-606-ELCDVTLLTIQATT-ADFQYPFGSP------------------------LTNSPCCNFQV.LNS.NYDNAHSI......
Q91PS7_9VIRU/1-585-DICNLPLVNIAASA-CSLRFPFCSP------------------------QTDNTCVNFQV.LSK.RFNTMLSI......
CAPSD_TTVV9/1-555-EFCQVGLVLLSIST-ATLMHPWMAP------------------------FVNSPALTIYA.VNHKTYSDMSIL......
Q9JG47_9VIRU/1-553-ELSNVPLMQVMATT-CSLDRMYLSS------------------------SSVSTTMGFVS.LDTNGFMERYMK.DNGTA
A7VLW0_9VIRU/1-507-DFAQYGLVAIAAAA-CNLRYPWLAC------------------------CNENLIITLRY.LQPQFYHNSAWA......
Q0ZLH9_9VIRU/1-573-DLCKVPLVTVSASA-ASLRFPFGSP------------------------QTENYCIYFQV.LDP.WYHTRLSI......
Q5ENW7_9VIRU/1-501-DFCNRKLFTWAAGL-IDMQKPF...------------------------............DANGAFRNAWWL......
A7VLX2_9VIRU/1-509-EMSSVPLVQLSAAA-CDFNYPRIGC------------------------CNVSQVMTIFF.LNPQFWGQTDWG......
Q80AR5_9VIRU/1-594-DLCKVPLVTLRSTA-ADLKHPFCSP------------------------QTNNPCTTFQV.LRD.KYNDMIGF......
Q91CZ2_9VIRU/1-601-DLCTVTLVSLVVSL-ASFQHPFCRP------------------------LTDNPCVTFQV.LQN.FYNNVIGY......
CAPSD_TTVG1/1-514-QFAKYDLLLIAAAA-CSLRYPRIGC------------------------CNENRMITLYC.LNTKFYQDTEWG......
Q98Y63_9VIRU/1-581-DLCPVNLLSLAVSA-CSFIHPFCSP------------------------ESDTICMTFQV.LRE.FYYTHLTV......
Q9QU36_9VIRU/1-529-DLCNFPLLVILATA-ASFDRYYTNS------------------------KAKSTTIGFIS.LNTLTFQYHNWQ.DPPTT
A7VM12_9VIRU/1-509-PFSNYGLLFLKGSA-MNLRYSYLSA------------------------SNENMLVNISS.LNPQWYVNTDWA......
A7VLV6_9VIRU/1-508-QIAELPLVQLQAAA-CDVPFVRIGC------------------------CNPSQVSTIYF.LNPQFYYDTDWG......
Q9JG50_9VIRU/1-535-EICNTGLLLITTSI-CNLNNYWLSN------------------------NHLSNNISFWS.VNTRLFSNPNFQNTDSTV
A7VLW4_9VIRU/1-507-NFTPASLIVLKTAV-CNFSHANLSG------------------------KNQNMLVSLIS.LNLSFYKNPAWA......
A7VM04_9VIRU/1-513-HFSHEPLLMIQATA-ANLNYVNLGC------------------------CNTNQMCTFFY.INPGFYQIANWG......
A7VLY4_9VIRU/1-498-TFDTTGLCSIYAAA-CDLNYPHIGA------------------------TSQNQIITLFG.LNQSFYSKGNWG......
CAPSD_TTVD1/1-324-DLCQHGLFAFGWAW-VDLDRPWMAD------------------------ISKPA....QT.IDPSTYDKK.........
Q91CZ6_9VIRU/1-596-DLCDVELVSFVVSL-ASFQHPFCRP------------------------QTDNPCVTFQV.LQN.FYNKCIGT......
A7VM08_9VIRU/1-506-QFATQDLVQIAGTA-CNFRYPTLGC------------------------CNENRILNLFA.LDTGFYQNVDWM......
CAPSD_TTVV3/1-573-ELCDVTLLVIYATA-CDLQYPFGSP------------------------QTDNVCVNFQI.LGQ.PYYQHLKT......
Q91D00_9VIRU/1-593-DLCKVPLVTLRSTA-ADFRHPFCSP------------------------QTNNPCTTFQV.LRE.NYNEVLGL......
Q99AR5_9VIRU/1-604-DLCKQPLVTLTATA-ASLRYPFCSP------------------------QTNNPNCTFQV.LRK.NYHKVIGT......
Q9DTD2_9VIRU/1-559-DLCDVILVVIYATA-ADFTFPFGSP------------------------LTNTHCVNFQV.LGS.DYNDILSI......
Q91D04_9VIRU/1-591-DLCDVNLLSLAVSA-ASFRHPFCPP------------------------QTDNICITFQV.LKD.FYYTQMSV......
CAPSD_TTVV8/1-571-DICDVILATVYATA-CDLQYPFGSP------------------------LTENYCISFQV.LGS.AYNNLISN......
Q5ENX0_9VIRU/1-603-DLCSVSLVQLNLTA-ADLKHPFGSP------------------------LTDTPCVSFQV.LGD.LYNECLNI......
O90364_9VIRU/1-590-DLCDMVLLTVYATA-ADIPYPFGSP------------------------LTDSVVVNFQV.LQS.MYDKYISI......
Q9IFV0_9VIRU/1-583-DFSNFPLVTISASA-ASLRFPFCSP------------------------QTGNICIYFQI.LDPYWYNRRMSI......
Q9QUE7_9VIRU/1-586-ELCDVPLLTVYATA-ADMQYPFGSP------------------------LTDTPVVTFQV.LRS.MYNDALST......
A8DMR2_9VIRU/1-531-DFAKYPLVMILSAA-LSLDRYYTSA------------------------NSISSTIGFAS.INTTIFQYSDFKSPNLTQ
Q9DUH8_9VIRU/1-609-DLCDVNLVQFTVTA-ADFMHPFGSP------------------------LTETPCVTFQV.LGD.LYNKCLNIDLPKVD
A7VLW8_9VIRU/1-511-QFATADLFQLVTAA-CSLNYPRLGC------------------------CNENRTLTLYY.INPYFYQYSDWG......
Q99AQ3_9VIRU/1-582-DLCPVILVTLVATA-ASFTHPFCSP------------------------QTANPCITFQV.LKE.FYYQAMGY......

PF02248

Q66170_CPMVS/720-899--------AAWKSGT-IHVQLN----------------------------VRG.AGVKRADWDGQVFVYL----------
Q9YWJ9_9SECO/828-1009--------AAWKKGT-IRFQLI----------------------------CRG.AAVKQSDWAASARIDL----------
POL2_CPMVS/837-1016--------AAWKSGT-IHVQLN----------------------------VRG.AGVKRADWDGQVFVYL----------
POL2_BPMV/821-1004--------AAWKKGC-LMVKVV----------------------------MSGNAAVKRSDWASLVQVFL----------
POL2_CPSMV/808-988--------AAWKCGT-LHVKVV----------------------------MTGRVTTTRANWASHTQMSL----------
POL2_RCMV/786-964--------AAWKRGT-IHVQVA----------------------------MFG.STVKRSDWTSTVQLFL----------
Q66179_APMV/2-185--------SDWKRGK-LHFKLK----------------------------ILGKSNVKRSEWSSTSRIDV----------
POL2_APMV/802-985--------SDWKRGK-LHFKLK----------------------------ILGKSNVKRSEWSSTSRIDV----------
POL2_SQMVM/622-803--------AAWKKGT-IRFQLI----------------------------CRG.AAVKQSDWAASARIDL----------
Q9YWK0_9SECO/739-920--------AAWKKGT-IRFQLI----------------------------CRG.AAVKQSDWAASARIDL----------

PF03688

A5H0K4_GFLV/264-422--------HGLHSGI.LDLKFQWSL.------------------------NTEFGKSSGSITITKLVGDK----------
POL2_BRSV/1176-1338--------TGMHHGN.CTIHFSWLWH------------------------PAELGKQLGRLKFVQ.....----------
Q86631_9SECO/418-544--------RGMFQGT.MRFILRWTF.------------------------...ASSLTTPTTYVQLVHKF----------
POL2_ARMV/344-502--------HGLHHGI.LDLKLMWDL.------------------------EGEFGKSSGGVTITKLCGDK----------
Q88483_9SECO/1172-1336--------TGMHFGK.CTLHFSWGWY------------------------RGKLADQSGA...VSLQTGM----------
A2ID55_9SECO/610-780--------CAFFKGS.VELIVRFGVS------------------------NVALSNLCGRVLFRT...KF----------
Q80JS8_BRAV/347-511--------CGFFRGN.LTIVLEWAT.------------------------FLKAGDKEGTVQLTTCRGMI----------
A0A9J6_ARMV/960-1118--------HGLHRGV.LELKLEWSL.------------------------VEEFGKSTGSVILTHLVGDK----------
CAPSD_TRSV/351-511--------TGWHYGE.VDLCISWSR.------------------------SKQAQAQEGSVSITTNYRDW----------
POL2_GCMV/1150-1316--------TGMHAGK.CILHFSWTL.------------------------.NKGTSFKDLQGHISFYSGM----------
Q6XPY1_9SECO/164-322--------TGMQWGSPFALHLDSHM.------------------------........TQADDQKICESH----------
Q6XFY6_9SECO/157-316--------HGLHCGT.LELKFMWSLG------------------------TTTYGGSSGSVIFTKLCGDK----------
Q9IV56_9SECO/980-1138--------TGFLEGQ.VTLSVSWST.------------------------NVEASKIKGHIIFVVYDADL----------
Q65624_9SECO/386-551--------CGFFRGR.VTFVFQWTL.------------------------NVAHIVPTATMQILTAVGRV----------
POL2_CNSV/1022-1185--------STMHFGS.VIIHFSWTL.------------------------FGGTTNAATAGGVVTIAEGF----------
Q64959_9SECO/338-502--------TGMHWGR.CILHFTWSWH------------------------RNTEAGKNAR....EISQSR----------
Q20LA0_9SECO/942-1102--------TGLHGGV.IRLHITWSP.------------------------KTTLGESKGTLKYMQYLYN.----------
A3FEN2_9SECO/348-507--------TGFFTGR.AIFVFQWGL.------------------------NTTAGNMKGSFSARLAFGKG----------
Q9ELS0_9SECO/148-312--------CGYFRGK.LEMSLTWTA.------------------------NGKLSDAGSRLWIGKCWGDP----------
Q9QAH0_9SECO/350-510--------TGLHGGI.IRLHITWCP.------------------------NTNLGESKGTLKYMQYLYH.----------
Q24M89_9SECO/943-1103--------TGLHGGT.IRLHVTWCP.------------------------KTNLGESKGTLKYMQYLYH.----------

PF08462

Q5ZF43_CARMV/250-348------------NGN-----------------------------------ELQLRVVAAGKWCIIVRGTV----------
Q999Y9_CARMV/250-348------------NGN-----------------------------------ELQLRVVAAGKWCIIVRGTV----------
Q4JGW6_CARMV/250-348------------NGN-----------------------------------ELQLRVVAAGKWCIIVRGTI----------
Q8JJU7_CARMV/250-348------------NGN-----------------------------------ELQLRVVAAGKWCIIVRGTV----------
CAPSD_CARMS/250-348------------NGN-----------------------------------ELQLRVVAAGKWCIIVRGTV----------
Q999Z1_CARMV/250-348------------NGN-----------------------------------ELRLRVVAAGKWCIIVRGTV----------
CAPSD_CARMV/250-348------------NGN-----------------------------------ELQLRVVAAGKWCIIVRGTV----------
Q7TG55_CARMV/250-348------------NGN-----------------------------------ELQLRVVAAGRWCIIVRGTV----------

PF00073

Q9WMA0_9PICO/49-215--------HTYARFG-IEIQVQIN.P---------------.........TPFQQGGLICAMVPG--DQS..........
POLG_AEVCA/45-212--------HSYARFG-LDVIVQIN.P---------------.........TSFQAGGLIAALVPY--DQV..........
POLG_CXA9/93-300--------HYLGRAG-YTIHLQCN.A---------------.........SKFHQGCLLVVCVPE--AEM..........
POLG_CXB3N/93-302--------HYLGRTG-YTVHVQCN.A---------------.........SKFHQGCLLVVCVPE--AEM..........
POLG_CXB4J/93-300--------HYLGRSG-YTIHVQCN.A---------------.........SKFHQGCLLVVCVPE--AEM..........
POLG_CXA21/93-308--------HYLGRSG-YTIHVQCN.A---------------.........SKFHQGALGVFLIPE--FVM..........
POLG_POL1M/93-308--------HYLGRSG-YTVHVQCN.A---------------.........SKFHQGALGVFAVPE--MCL..........
POLG_POL3L/93-307--------HYLGRSG-YTVHVQCN.A---------------.........SKFHQGALGVFAIPE--YCL..........
POLG_HE701/93-288--------HYLYRSG-FLCHVQCN.A---------------.........TKFHQGTLLIVAIPE--HQI..........
POLG_BOVEV/93-285--------HYIYRGG-WAVHVQCN.A---------------.........TKFHQGTLLVLAIPE--HQI..........
POLG_HRV14/93-299--------HSLGRSG-YTVHVQCN.A---------------.........TKFHSGCLLVVVIPE--HQL..........
POLG_HRV2/93-302--------HYLGRSG-YTIHVQCN.A---------------.........SKFHQGTLIVALIPE--HQI..........
POLG_HRV8A/93-302--------HFLGRSG-YTIHVQCN.S---------------.........SKFHQGLLIVAAIPE--HQL..........
POLG_HRV1B/93-301--------HFLGRSG-YTVHVQCN.A---------------.........SKFHQGTLLVAMIPE--HQL..........
POLG_FMDV1/311-475--------YAYMRNG-WDVEVSAV.G---------------.........NQFNGGCLLVAMVPE--WKA..........
POLG_FMDVT/311-475--------YAYMRNG-WDVEVTAV.G---------------.........NQFNGGCLLVALVPE--MGD..........
POLG_FMDVO/311-475--------YAYMRNG-WDVEVTAV.G---------------.........NQFNGGCLLVAMVPE--LYS..........
POLG_EMCV/161-359--------HYLVKTG-WRVQVQCN.A---------------.........SQFHAGGLLVFMAPE--YPT..........
POLG_TMEVB/172-382--------HYLCKTG-WRVQVQCN.A---------------.........SQFHAGSLLVFMAPE--FYTGKGTKTGTME
POLG_ENMGO/162-361--------HYLVKTG-WRVQVQCN.A---------------.........SQFHAGSLLVFMAPE--YPT..........
POLG_FMDVO/533-691--------YTQYSGT-INLHFMFT.G---------------.........PTDAKARYMVAYAPP--GME..........
POLG_FMDV1/533-692--------YTQYSGT-INLHFMFT.G---------------.........STDSKARYMVAYIPP--GVE..........
POLG_EMCV/420-582--------FAQYRGS-LVYTFVFT.G---------------.........TAMMKGKFLIAYTPP--GAG..........
POLG_TMEVB/443-606--------FNQYRGS-LNFLFVFT.G---------------.........AAMVKGKFLIAYTPP--GAG..........
POLG_HE701/347-515--------YTHWSGS-LEMTFMFC.G---------------.........SFMTTGKLIICYTPP--GGS..........
POLG_HRV2/358-522--------FTHWTGS-LRFSFMFC.G---------------.........TANTTVKLLLAYTPP--GIA..........
POLG_HRV8A/364-529--------YTHWTGS-LRFSFMFC.G---------------.........SASSTLKLLIAYTPP--GVG..........
POLG_HRV1B/360-525--------YTHWTGS-LRFSFMFC.G---------------.........TANTTLKLLLAYTPP--GID..........
POLG_BOVEV/345-515--------YTQWSGS-VEITCMFT.G---------------.........TFMTTGKVLLAYTPP--GGD..........
POLG_CXA21/369-534--------YTHWTGS-IRFTFLFC.G---------------.........SMMATGKLLLSYSPP--GAK..........
POLG_CXA9/358-524--------YAHWSGS-MKLTFVFC.G---------------.........SAMATGKFLIAYSPP--GAN..........
POLG_CXB4J/358-524--------YTHWSGS-LKLTFVFC.G---------------.........SAMATGKFLLAYSPP--GAG..........
POLG_CXB3N/360-526--------YTHWSGS-IKLTFMFC.G---------------.........SAMATGKFLLAYSPP--GAG..........
POLG_CXB1J/360-526--------YTHWSGS-IKLTFMFC.G---------------.........SAMATGKFLLAYSPP--GAG..........
POLG_FMDVO/725-872--------STYYFSD-LEIAVKHE.G---------------.................DLTWVPN--GAP..........
POLG_FMDV1/726-878--------ATYYFSD-LEIVVRHD.G---------------.................NLTWVPN--GAP..........
POLG_BOVEV/610-775--------FTYMRFD-VEFTIIATSS---------------TGQNV....TTEQHTTYQVMYVPP--GAP..........
POLG_HRV8A/621-792--------FTYTRFD-SEITIVTA.A---------------AAQG.....NDSGHIVLQFMYVPP--GAP..........
POLG_HRV2/614-772--------FTYTRFD-SEITLVPC.I---------------SALS.....QDIGHITMQYMYVPP--GAP..........
POLG_HRV1B/627-786--------FTYVRFD-SEVTLVPC.I---------------AGRG.....DDIGHVVMQYMYVPP--GAP..........
POLG_HE701/609-781--------FTYLRFD-TEITIVPTLR---------------LFSSSNVSFSGLPNLTLQAMYVPT--GAR..........
POLG_HRV14/614-787--------FTYVRFD-SEYTILAT.A---------------SQPDSA...NYSSNLVVQAMYVPP--GAP..........
POLG_CXA9/612-783--------FTYLRFD-MEVTFVIT.S---------------RQDPGTTLAQDMPVLTRQIMYVPP--GGP..........
POLG_CXB4J/612-783--------FTYIRCD-MELTFVIT.S---------------HQEMSTATNSDVPVQTHQIMYVPP--GGP..........
POLG_SVDVU/612-782--------FTYARFD-LELTFVIT.S---------------TQEQPTVRGQDAPVLTHQIMYVPP--GGP..........
POLG_CXB3N/630-782--------FTYVRFD-LELTFVIT.S---------------TQQPSTTQNQDAQILTHQIMYVPP--GGP..........
POLG_POL1M/636-806--------FTYSRFD-MELTFVVT.A---------------NFTETNN..GHALNQVYQIMYVPP--GAP..........
POLG_CXA21/642-812--------FTYSRFD-LEMTFVFT.E---------------NYPSTAS..GEVRNQCDQIMYIPP--GAP..........
POLG_CXA24/646-809--------FTYSRFD-LEMTFVIT.E---------------RYYTSNT..GYARNQVYQLMYIPP--GAP..........

PF00915

CAPSD_VESVA/137-421--------YSTWSGG-IDVRFTVS-G------------------------SGVFGGKLAALLVPP..GVE-PIESVSMLQ
POLG_RHDVF/1768-2065--------YAGWAGG-MQFRFIVA-G------------------------SGVFGGRLVRAVIPP..GIE-IGPGLEVRQ
CAPSD_FCVUR/112-395--------YVAWSGS-VEVRFSIS-G------------------------SGVFGGKLAAIVVPP..GVD-PIQSTSMLQ
CAPSD_NVN68/2-294--------YNGWVGN-MRVRIMLA-G------------------------NAFTAGKIIVSCIPPGFGSH-NLTIAQATL

PF08762

Q8B107_ALPV/599-804--------FAYYRGS-FRFKIAPFENKVYAARIR......LIPENGATEANAGPVQEDNTVIDETRTAAD----------
O56051_9VIRU/590-790--------YAFYRGS-MRYKIAPLSNASPLV.........VALKPNSLYSGVRVIDTNGTWTYPDYKGAE----------
Q56QP7_9VIRU/684-855--------YRFSRGG-YRYKFFADDN...................EQGQVMSTLVKNYHK.DHATSTGPS----------
O36967_9VIRU/668-900--------YGFWRGG-MRFKLQAVRTNSAETSVKTDTTWTVNLWNSVQDSFNSLINVFSTTDYPIKSTGA----------
Q5UBY1_9VIRU/79-259--------YRFYRGG-RRYKFFNTTA...............LKQSQTCYIRSFLTPRYYTPDNTNNDGPS----------
Q6ITS9_9VIRU/106-313--------YALYRGG-VRVKVVTEKG............................VDFVRATVSPQQTYGS----------
Q4JFT2_9VIRU/834-1009--------YRFTHGS-ISYKIIPKNKG............................DLYITTTSPDSIETS----------

PF00729

CAPSD_PNLV/47-266--ACYWSKYRWRSCR-LVYIPYC--S------------------------SSFTGY-VSMGLSYD--YAD----------
CAPSD_MCMVK/23-222--SQMWNTIVFNSVR-ITWETFT--A------------------------DTTSGY-ISMAFLSD--YML----------
CAPSD_PMVK/39-236--GSAFAIHRWRALS-FEWIPSC--P------------------------TTTPGN-LVLRFYPN--YST----------
CAPSD_RCNMV/24-213--AANYDMYRLKKLT-LRYVPLV--T------------------------VQNSGR-VAMIWDPD--SQD----------
CAPSD_CARMS/51-245--ATNFNKYRITALT-VKYSPAC--S------------------------FETNGR-VALGFNDD--ASD----------
CAPSD_SBMVA/46-262--AANWSKYSLLSVR-YTYLPSC--P------------------------STTSGS-IHMGFQYD--MAD----------
CAPSD_TBSVC/76-269--ASNFDQYTFNSVV-LHYVPLC--S------------------------TTEVGR-VAIYFDKD--SED----------
CAPSD_POLVP/66-257--AASFDQYKFDRVQ-LQYVPMC--A------------------------TTETGR-VAIYFDKD--QQD----------
CAPSD_OCSVU/111-308--AVNYEKYKFRRLS-FTLVPLV--S------------------------TNYSGR-IGVGFDYD--SSD----------
CAPSD_TNVA/61-272--ADLYSKYRWLSCE-IIYIPKC--P------------------------TTTSGS-IAMAFTYD--RND----------

PF11729

CAPSD_SJNNV/1-340--ARIFQRYAVETLE-FEIQPMC--P------------------------ANTGGG-YVAGFLPD--PTD----------

PF00894

CAPSD_PLRV1/70-207--LKAYHEYKITSIL-LQFVSEA--S------------------------STSSGS-IAYELDPH--.CK----------
CAPSD_PEMVW/53-187--LAAYQKYRIVWLK-VVYQSEA--A------------------------ATDRGC-IAYHVDTS--TTK----------
CAPSD_BYDVP/62-199--LKSYHRYKITSIR-VEFKSHA--S------------------------ANTAGA-IFIELDTA--.CK----------

PF03014

CAPSD_HEVCH/41-659TEASNYAQYRVVRAT-IRYRPLV--P------------------------NAVGGYAISISFWPQ--TTT----------

PF03115

CAPSD_HASV1/1-416--GAQYSMWKLKYLN-VKLTSMVG-A------------------------SAVNGTVSGVSLNPT--TTP----------

PF00983

COAT_TYMV/8-177--TTFYRHASLESLW-VTIHPTLQ-A------------------------PTFPTT-VGVCWVPA--NSP----------

PF02247

POL2_SQMVM/246-618--------HRYFRGD-FVFEITKM-S------------------------SPYIKATIAFFIAFG--DIT----------
POL2_CPMVS/460-832--------WRYFRGE-LHFEVTKM-S------------------------SPYIKATVTFLIAFG--NLS----------
POL2_BPMV/447-819--------WRYFVGD-LVFEVSKM-T------------------------SPYIKCTVSFFIAFG--NLA----------
Q9Z006_9SECO/476-846--------SQYIQSD-VILDFTLM-S------------------------SPMIGGTFSIAYVAG--AYI----------
O12663_9SECO/321-691--------SQYMQSD-VILDFTLM-S------------------------SPMIGGTFSIAYVAG--AYI----------
Q9YWK0_9SECO/363-735--------HRYFRGD-FVFEITKM-S------------------------SPYIKATIAFFIAFG--DIT----------
POL2_CPSMV/437-806--------WRYFKAD-LEFELIKM-S------------------------SPYINATIAFFVAFG--DLS----------
POL2_RCMV/407-778--------WRYFHGD-LVFEVQKM-S------------------------SPFIKSTVTFFIGFG--GLP----------
Q9YWJ9_9SECO/452-824--------HRYFRGD-FVFEITKM-S------------------------SPYIKATIAFFIAFG--DIT----------
Q66170_CPMVS/343-715--------WRYFRGE-LHFEVTKM-S------------------------SPYIKATVTFLIAFG--NLS----------

PF03391

CAPSD_TRSV/179-344--------NLGWSGT-ISGSVKSV-S------------------------SLFCTASFVIFPWEC--EAP----------
POL2_RRVS/768-936--------FRSWTGK-VRMSIQEV-S------------------------SIFLTGTYMVGVSW.--NAT----------
POL2_BRAV/1268-1433--------LQGHGGS-LVGEVVHT-G------------------------SAAVSCALHLCISFG--GAP----------
Q65029_ARMV/745-916--------YLGIGGI-VKGKVHVC-S------------------------PCTYGIVLRVVSEWN--GVT----------
POL2_ARMVS/792-963--------YLGIGGI-VKGKVHVC-S------------------------PCTYGIVLRVVSEWN--GVT----------
Q67703_GFLV/166-336--------VLGMGGT-IRGKVHIC-A------------------------PIFYSIVLWVVSEWN--GTT----------
POL2_GFLV/771-941--------VLGMGGT-VRGRVHIC-A------------------------PIFYSIVLWVVSEWN--GTT----------
POL2_BRSV/1007-1170--------FLGVGGT-IHFVVRTT-S------------------------SAFVTSKLRIA.LW.--GTV----------
POL2_GCMV/981-1144--------FLGIGGT-IHFKIQCT-S------------------------SAFVTARLRVA.LW.--GDT----------
POL2_TORVR/1497-1662--------FQGSNGT-LHGRIKKI-G------------------------TALTTCSLLLSLRHK--DAS----------
Q88483_9SECO/1003-1166--------FLGVGGD-IIFSVHST-A------------------------STFVSCSLRVA.LW.--GTI----------

PF03689

A3FEM9_9SECO/10-101--------..FLHGK-LRLRCFIP-T------------------------NIFCGHSMMCS-------------------
Q9QAH4_9SECO/9-99--------..CLKPK-IKVRITAA-T------------------------SCFSGIVLGVC-------------------
Q09G89_GFLV/608-698--------..LVMPT-FKIVIRLP-A------------------------NAFTGLTWVMS-------------------
Q9JGK5_SDV/160-249--------VAILRPH-FKFVCRLV-T------------------------PILESIPLMIV-------------------
Q9IV56_9SECO/636-727--------..NISPC-ILVRCHLP-K------------------------MPFLGLTLGMC-------------------
A1YYW2_BRAV/156-247--------..LASFK-YDLQLTVG-S------------------------NPFVGVTLGIT-------------------
Q65624_9SECO/45-137--------..LIHPD-LKLRMTVG-Q------------------------NPFVGISIGIC-------------------
Q6JX06_9SECO/849-939--------..YMDRN-LKLISHLA-P------------------------SQFCGVAIWYV-------------------
Q20LA0_9SECO/601-691--------..CMKPR-IKVRISAA-S------------------------SCFSGVVLGIC-------------------
POL2_BRSV/842-932--------..YVSQN-LTAISHLA-P------------------------NAFSGIAIWYI-------------------
A0A9J8_ARMV/580-670--------..LIMPD-FKVVIRYP-A------------------------NAFTGITWVMS-------------------
Q6JX05_9SECO/604-694--------..LCMPK-FEVVIRYP-P------------------------NAFTGLTWVMS-------------------
Q9Z0D6_SDV/74-163--------VAILRPH-FKFTFRLV-T------------------------PILESIPLLVV-------------------
Q9QRA5_9SECO/10-101--------..FVHGE-LRLRCFIP-T------------------------NIFCGHSMMCT-------------------
Q86631_9SECO/85-173--------..PTTFL-VTGTIAMS-V------------------------NIMAGTTLGLV-------------------
POL2_GCMV/815-905--------..YVNKN-LTFISHLA-P------------------------SQFCGVAIWYI-------------------
A2ID55_9SECO/270-361--------..MVHPK-LEVEILAP-T------------------------NMFMGTTIGVV-------------------
Q64959_9SECO/4-94--------..YVDRN-ILMVSHLF-T------------------------SPYLGMAIWYV-------------------
Q8B5P7_TRSV/12-103--------..IVNPT-FTVRMHAP-R------------------------NAFAGLSIACT-------------------
Q88483_9SECO/838-928--------..YVSQN-LRAVSHLA-P------------------------NSFSGISIWYI-------------------
POL2_CNSV/688-778--------..YIDTN-LKLICHLP-R------------------------APFAGMSFFVL-------------------

PF00760

CAPSD_CMVFN/11-215TVR-------------------KVPASSD-----------LSVAAISAMF------------------------------

PF01318

CAPSD_BMV/2-188CVA-------------------EKQAQAE-----------AAF-QVALAV------------------------------

PF03566

Q80IX5_PRVFL/54-754QFA..PGWYYSIYVLPNTYAMAEIGDRTD.....SVTQFRKVYKGITFEFNAPTLIDQGWWVGAHIPVKPQSETIPAAER
CAPSD_NCBVS/1-608QVG..NVFY....MVVPTEALTDVPPPTQLGVSGLLESYRLTSSGVTAYFNAPTLVNQGVAVIAQF..QPDKEHQKENPD
CAPSD_HASV/2-647NFTNDTTYYVRIRVLRPTY...DVPDPTE.GLVRTVSDYRLTYKAITCEANMPTLVDQGFWIGGQYALTPTSLPQYDVS.

PF01829

CAPSD_NODAM/42-399TVA-------------------TVPPTNL-------AQNTIAIDGLEALDALPNNNYSGSFIEGCYSQSVCNEPEFEFHP

PF08435

Q91H09_9CALI/305-535----------------------FIPGA.S--------G..HTNGEMDCLL------------------------------
Q8JMP1_9CALI/305-540----------------------RVPCV.Q--------GLQGQDAFIDCLL------------------------------
Q8B4Z2_9CALI/297-515----------------------NVPRL.N--------G..VNPGPCPCLL------------------------------
Q917X1_9CALI/305-538----------------------YVPLK.G--------G..FGNPAIDCLV------------------------------
Q9IV43_9CALI/304-537----------------------PIPGPNT--------A..HKPNLVPCLL------------------------------
Q8VA02_9CALI/306-539----------------------DFPIA.H--------G..TNGLSVPCTI------------------------------
Q9IV49_9CALI/306-538----------------------QIPSS.G--------G..HELGYMDCLV------------------------------
Q6EAX3_9CALI/306-538----------------------NVPCA.G--------G..VSDGVIDCLL------------------------------
Q8BAC6_9CALI/304-534----------------------HIPSA.G--------G..HTDGAIDCLL------------------------------
Q6WQW7_9CALI/296-512----------------------KAPVQ.G--------P....SNPLPCLL------------------------------
Q6B7R3_9CALI/303-535----------------------NVPSV.Q--------G..GQPIEIDCLI------------------------------
Q6EAW7_9CALI/305-538----------------------YIPLK.G--------G..HGDPFIDCLV------------------------------
Q66418_9CALI/306-538----------------------DFPVV.S--------G..VNGMRIPCTL------------------------------
Q80FL2_9CALI/317-546----------------------QLPXS.G--------G..ISKGILDCLV------------------------------
Q9IV42_9CALI/305-535----------------------IFPGS.G--------Q..PSQLQVPCLL------------------------------
Q6XDL5_9CALI/307-546----------------------FIPLK.G--------G..YGNPAIDCLM------------------------------
Q6B7R2_9CALI/304-538----------------------NFPIGHT--------N..SNMAQVPCTL------------------------------
Q917X4_9CALI/305-533----------------------HIPLK.G--------G..TSNGAIDCLL------------------------------
Q783W9_9CALI/306-535----------------------FMPGA.S--------G..HTDGAIDCLL------------------------------
Q80J94_9CALI/309-538----------------------YMRQIDT--------A.DAAAEAIDCAL------------------------------
Q913B6_9CALI/305-540----------------------YLPLK.G--------G..YGNPAIDCLL------------------------------
Q8JW44_9CALI/304-539----------------------AFPGPNN--------R..SAPNDVPCLL------------------------------
Q83876_9CALI/301-524----------------------KIPGP.G--------G.....DSLPCLL------------------------------
Q9IV48_9CALI/306-533----------------------DFPIV.S--------G...NTAQIPCTL------------------------------
Q8V713_9CALI/316-545----------------------QLPSS.G--------G..VVAGWLDCLL------------------------------
Q91I85_9CALI/304-538----------------------SIPGPNQ--------S..GSPNLVPCLL------------------------------
Q8JXJ0_9CALI/304-537----------------------RVPGWNR--------T..NRLNLVPCLL------------------------------
Q783X1_9CALI/315-545----------------------VVPSA.G--------G..YGSGQIDCLI------------------------------
Q783Y0_9CALI/305-533----------------------HIPLK.G--------G..VADPVIDCLL------------------------------

PF02226

POLG_HRV8A/2-69----------------------RLDFSQD---------------------------------------------------
POLG_POL1M/2-69----------------------KQDFSQD---------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059----------------------FSK....---------------------------------------------------
POLS_CRPVC/291-340----------------------IFS....---------------------------------------------------
Q2HWK2_RSET1/357-413----------------------YAR....---------------------------------------------------
POLS_ABPVR/340-396----------------------MAKPVTS---------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191----------------------ESNAAEN-----------AASGPTSLLK------------------------------
Q9DLK1_FMDVP/202-285----------------------SNEGSTD-----------TTSTHTNNTQ------------------------------

PF01766

POLS_IBDVU/9-452IGLDPKMV.ATCDSSDRPRVY-TITAADDYQFSSQYQAGGVTITLFSANIDAITSLSI..GGELVFQ...TS--------
POLS_DXV96/2-442TLSSPTHITNTSQNLATGGAY-MIP.......VTTVPGQGFHNKEFSINVDSVGPVDILWSGQMTMQ.....--------
POLS_BSNV/7-428SAGV.....ARCSPSDRPRHY-NAN.......NKQVQVGTTDTKTNGFNIDATTPTEV..TVDMQIA...QI--------
POLS_IPNVJ/5-453GPQSMNGARMRCTAAIAPRRY-EIDLPSER..LPTVAATGTPTTIYEGNADIVNSTAV..TGDITFQLEAEP--------

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506......................NPKNPYIPTEQDKWYRP..........................YRIVEP---------
Q9WT88_9VIRU/1-603.....................SVKDQESTQDFENWLYKTD.......................SHYQTFAT---------
Q91CY9_9VIRU/1-581................TPTTTTSLNQKDEKIFSDHLYKNP.......................EYWQSHHT---------
A7VLY0_9VIRU/1-515......................ATHTGTQM......YFP..........................YNAWPH---------
Q9JGT1_9VIRU/1-585.................LPSNFVEPSGKGKLLYDKIRKHL.......................PYYNTTQT---------
Q80QT8_9VIRU/1-595..................SALLTPTNATYTNFEKWLYGKC.......................THYQTFAT---------
CAPSD_TTVB1/1-533PYTTKAASTLE.TYLYCYHNGHEPTQELKWKDIILLGNM........................TNYTDGKK---------
A7VM00_9VIRU/1-509......................QYSTSA........YNPQ.........................GHLHPM---------
Q9JG61_9VIRU/1-534PYFPKVTGTINNIGLYTMGNGGNIKNMKNWKQLIPLYQT........................QLYKKEHN---------
Q91PS3_9VIRU/1-581....................AHPHTENNWQYITETLLKT...HWHSNQRKGTMANYDSRDRVGVVFNTFKT---------
CAPSD_TTVV4/1-560....................AKDEVTKNYDTLVDAIKKSPQGL....................TVFNTFKT---------
Q91C93_9VIRU/1-546GYFPKPNTRYF.....ITQTHSTDPKNVPIGSLIFLGNT........................NLLTLGTK---------
Q2F827_9VIRU/1-589.....................NSTLTTKYENLFNKLYSKC.......................CYFETFQT---------
Q91CY5_9VIRU/1-584...................NSLETHKNSYTKLQEWLYKTN.......................TFFETTQV---------
Q8V7G9_9VIRU/1-572.......................IASGEQLTARQTLFTT........................KLLPSNNT---------
Q99A78_9VIRU/1-584..................LPENFNGNGKGKALHDNITKYL.......................PNYNTTQT---------
Q6H9C2_9VIRU/1-573....................SSTMDESNKAHYEQNLFKKT.......................ELYNTFQT---------
CAPSD_TTVT1/1-433.......................................................................---------
Q9JG80_9VIRU/1-589......................SATQDKIDNVFNILYQNN.......................SYWESNIT---------
A7VLZ6_9VIRU/1-506......................QYSTTP.....................................YRPSNE---------
Q6H9D2_9VIRU/1-557....................EPTNVESQYNSLLSAIETNTQG.....................TLFNTFKT---------
Q6H999_9VIRU/1-471.................NTFNNDNSDSKLKEFLNKAFPTTGTKGTSL................NALNTFRT---------
Q77JT5_9VIRU/1-606..................LNLSNEPTNKWHTYRNNCYKFLLEQY...................SYYNTKQV---------
Q91PS7_9VIRU/1-585....................SPDYPKKNYDSFVKTYLKNAQEHWNQN.KKGTLDNYNDPNRLLTVFNTFKT---------
CAPSD_TTVV9/1-555....................PSNNQGSTKNELIETLYTAE.......................HTYNPMAQ---------
Q9JG47_9VIRU/1-553PYSPLTGQIIF.....AAPNGDNVITNIPLGQCILLGTV........................TDYTPGTQ---------
A7VLW0_9VIRU/1-507......................QTTKE.........YNPV.........................YGTQPM---------
Q0ZLH9_9VIRU/1-573....................TGGKPAEYWTQLKAYLTQG....WGRS....TNNAGYQHGPLGTYFNTLKT---------
Q5ENW7_9VIRU/1-501......................EQRNDQGEMKYIELWGRV.......................PPQGDSEL---------
A7VLX2_9VIRU/1-509......................QYMAHA.....................................YMNIAT---------
Q80AR5_9VIRU/1-594..............PFNYNPSDTNQTKTLQDFEKWLYSSS.......................THYQTFAT---------
Q91CZ2_9VIRU/1-601.....................SSSDTLVDNVFTSLLYSKA.......................SFWQSHLT---------
CAPSD_TTVG1/1-514......................TTKQAPHY......FKP..........................YATINK---------
Q98Y63_9VIRU/1-581................TPTTTTSTPEKDKKIFNDQLYSNA.......................NFYQSLHA---------
Q9QU36_9VIRU/1-529GYKPQDNMWFW.....GTLNGSDDPNEEPLTNLIYLGGT........................NNHTKGIP---------
A7VM12_9VIRU/1-509......................RARQDTQG......YLP..........................QPNM..---------
A7VLV6_9VIRU/1-508......................ATKNHA.....................................YMYIRT---------
Q9JG50_9VIRU/1-535GYTPKDGVYLY......GTYNGTPTQNLTWMHMIYLGNT........................HKYQQGLA---------
A7VLW4_9VIRU/1-507......................QALTASG.......YKP..........................YDNIPS---------
A7VM04_9VIRU/1-513......................ATTTTG........YIP..........................YSGYPT---------
A7VLY4_9VIRU/1-498......................AVVQTG.....................................YQPYPS---------
CAPSD_TTVD1/1-324.......................................................................---------
Q91CZ6_9VIRU/1-596...................SVNLSDSTFDSIFRDYLYKIG.......................SFYQQVLV---------
A7VM08_9VIRU/1-506......................QARQTGVG......YKP..........................YSTIDK---------
CAPSD_TTVV3/1-573..................ALGLTEKTTYENHYKNNLYKKI.......................KFYNTTET---------
Q91D00_9VIRU/1-593..............PYANTGSNNEVKIKIDNFENWLYNSS.......................VHYQTFQT---------
Q99AR5_9VIRU/1-604.....................SSTNSEDVTPFENWLYNTA.......................SHYQTFAT---------
Q9DTD2_9VIRU/1-559.....................LPDKLKSKESKIEKIYKNI.......................AYYNTKQT---------
Q91D04_9VIRU/1-591..................TPDTAGQEKDIEIFEKHLFKNP.......................QFYQTVHT---------
CAPSD_TTVV8/1-571.....................TLNPNEEQQDIKSAIYNNV.......................NAYLTRIT---------
Q5ENX0_9VIRU/1-603....DLPETEKDSLTKLKNSSTDEYSKNLQKLLQQLYTNG.......................QYWQTFIT---------
O90364_9VIRU/1-590.....................LPDQKSQSKSLLSNIANYI.......................PFYNTTQT---------
Q9IFV0_9VIRU/1-583....................TPDLLKSNYESFFSVLNTK....FSSSPLYPNVATTVPSGPIGTVFNTFKT---------
Q9QUE7_9VIRU/1-586.................LPSNFENASSPGQKLYKEISTYL.......................PYYNTTET---------
A8DMR2_9VIRU/1-531PYKPNDEYWLRT....WTNQTITNFSAVETQRVILLGNT........................NDYQPGEP---------
Q9DUH8_9VIRU/1-609TVKNASSPHTKIQVKLTDNSGNPTNKEAVKTLYEQLFSYG.......................QYWQTFIT---------
A7VLW8_9VIRU/1-511......................QVKEHANY......YKP..........................YNSIAD---------
Q99AQ3_9VIRU/1-582......................GTPETTMSTIWNTLYTTS.......................TYWQSHLT---------

PF02248

Q66170_CPMVS/720-899---------------------------------------------------------------------RQ---------
Q9YWJ9_9SECO/828-1009---------------------------------------------------------------------IN---------
POL2_CPMVS/837-1016---------------------------------------------------------------------RQ---------
POL2_BPMV/821-1004---------------------------------------------------------------------TN---------
POL2_CPSMV/808-988---------------------------------------------------------------------VN---------
POL2_RCMV/786-964---------------------------------------------------------------------RQ---------
Q66179_APMV/2-185---------------------------------------------------------------------RR---------
POL2_APMV/802-985---------------------------------------------------------------------RR---------
POL2_SQMVM/622-803---------------------------------------------------------------------IN---------
Q9YWK0_9SECO/739-920---------------------------------------------------------------------VN---------

PF03688

A5H0K4_GFLV/264-422---------------------------------------------------------------------AM---------
POL2_BRSV/1176-1338---------------------------------------------------------------------GM---------
Q86631_9SECO/418-544---------------------------------------------------------------------GT---------
POL2_ARMV/344-502---------------------------------------------------------------------AT---------
Q88483_9SECO/1172-1336---------------------------------------------------------------------GR---------
A2ID55_9SECO/610-780---------------------------------------------------------------------GN---------
Q80JS8_BRAV/347-511---------------------------------------------------------------------DD---------
A0A9J6_ARMV/960-1118---------------------------------------------------------------------AT---------
CAPSD_TRSV/351-511---------------------------------------------------------------------GA---------
POL2_GCMV/1150-1316---------------------------------------------------------------------GD---------
Q6XPY1_9SECO/164-322---------------------------------------------------------------------SA---------
Q6XFY6_9SECO/157-316---------------------------------------------------------------------AT---------
Q9IV56_9SECO/980-1138---------------------------------------------------------------------VN---------
Q65624_9SECO/386-551---------------------------------------------------------------------GN---------
POL2_CNSV/1022-1185---------------------------------------------------------------------GP---------
Q64959_9SECO/338-502---------------------------------------------------------------------LE---------
Q20LA0_9SECO/942-1102---------------------------------------------------------------------..---------
A3FEN2_9SECO/348-507---------------------------------------------------------------------VE---------
Q9ELS0_9SECO/148-312---------------------------------------------------------------------KR---------
Q9QAH0_9SECO/350-510---------------------------------------------------------------------..---------
Q24M89_9SECO/943-1103---------------------------------------------------------------------..---------

PF08462

Q5ZF43_CARMV/250-348---------------------------------------------------------------------EG---------
Q999Y9_CARMV/250-348---------------------------------------------------------------------EG---------
Q4JGW6_CARMV/250-348---------------------------------------------------------------------EG---------
Q8JJU7_CARMV/250-348---------------------------------------------------------------------EG---------
CAPSD_CARMS/250-348---------------------------------------------------------------------EG---------
Q999Z1_CARMV/250-348---------------------------------------------------------------------EG---------
CAPSD_CARMV/250-348---------------------------------------------------------------------EG---------
Q7TG55_CARMV/250-348---------------------------------------------------------------------EG---------

PF00073

Q9WMA0_9PICO/49-215..................YGSI...............................----------------..---------
POLG_AEVCA/45-212.................DIESI...............................----------------..---------
POLG_CXA9/93-300.GGAVVGQ..AFSATAMANGDKAYEF.TSATQSDQTK.VQTAIHN....AGMG----------------VG---------
POLG_CXB3N/93-302.GCATLDN..TPSSAELLGGDTAKEFADKPVASGSNKLVQRVVYN....AGMG----------------VG---------
POLG_CXB4J/93-300.GCTNAEN..APAYGDLCGGETAKSF.EQNAATGKTA.VQTAVCN....AGMG----------------VG---------
POLG_CXA21/93-308.ACNTESKTSYVSYINANPGERGGEFTNTYNPSNTDVSEGRQFAALDYLLGSG----------------VL---------
POLG_POL1M/93-308.AGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNG----------------TL---------
POLG_POL3L/93-307.AGDSDKQR.YTSYANANPGERGGKFYSQFNKDNAVTSPKREFCPVDYLLGCG----------------VL---------
POLG_HE701/93-288...GKKGTGTSASFAEVMKGAEGGVFEQPYLLDD..................G----------------TS---------
POLG_BOVEV/93-285......ATQEQPAFDRTMPGSEGGTFQEPFWLED..................G----------------TS---------
POLG_HRV14/93-299.ASHEGGNV.SVKYTFTHPGERGIDL...SSANEVGGPVKDVIYN....MN.G----------------TL---------
POLG_HRV2/93-302.ASALHGNV.NVGYNYTHPGETGREVKAETRLNPDLQPTEEYWLN....FD.G----------------TL---------
POLG_HRV8A/93-302.ASATSGNV.SVGYNHTHPGEQGREVVPSRTSSDNKRPSDDSWLN....FD.G----------------TL---------
POLG_HRV1B/93-301.ASAKNGSV.TAGYNLTHPGEAGR.VVGQQRDANLRQPSDDSWLN....FD.G----------------TL---------
POLG_FMDV1/311-475................FDTREK...............................----------------..---------
POLG_FMDVT/311-475................ISDREK...............................----------------..---------
POLG_FMDVO/311-475.................IQKRE...............................----------------..---------
POLG_EMCV/161-359.LDAFAMDNRW.SKDNLPNGTRTQTNKKGPFAMD..................H----------------QN---------
POLG_TMEVB/172-382PSDPFTMDTEWRSPQGAPTGYRYDS.RTGFFATN..................H----------------QN---------
POLG_ENMGO/162-361.LDVFAMDNRW.SKDNLPNGTRTQTNRKGPFAMD..................H----------------QN---------
POLG_FMDVO/533-691.................PPKTP...............................----------------..---------
POLG_FMDV1/533-692................TPPDTP...............................----------------..---------
POLG_EMCV/420-582.................KPTSR...............................----------------..---------
POLG_TMEVB/443-606.................KPTTR...............................----------------..---------
POLG_HE701/347-515.................SPTDR...............................----------------..---------
POLG_HRV2/358-522.................EPTTR...............................----------------..---------
POLG_HRV8A/364-529.................KPKSR...............................----------------..---------
POLG_HRV1B/360-525.................KPATR...............................----------------..---------
POLG_BOVEV/345-515.................MPRNR...............................----------------..---------
POLG_CXA21/369-534.................PPTNR...............................----------------..---------
POLG_CXA9/358-524.................PPKTR...............................----------------..---------
POLG_CXB4J/358-524.................APDSR...............................----------------..---------
POLG_CXB3N/360-526.................APTKR...............................----------------..---------
POLG_CXB1J/360-526.................VPKNR...............................----------------..---------
POLG_FMDVO/725-872.....................................................----------------EK---------
POLG_FMDV1/726-878.....................................................----------------EA---------
POLG_BOVEV/610-775.................VPSNQ..............................D----------------SF---------
POLG_HRV8A/621-792.................VPEKR..............................D----------------DY---------
POLG_HRV2/614-772.................VPNSR..............................D----------------DY---------
POLG_HRV1B/627-786.................IPKTR..............................N----------------DF---------
POLG_HE701/609-781.................KPSSQ..............................D----------------SF---------
POLG_HRV14/614-787.................NPKEW..............................D----------------DY---------
POLG_CXA9/612-783.................IPAKV..............................D----------------DY---------
POLG_CXB4J/612-783.................VPTSV..............................N----------------DY---------
POLG_SVDVU/612-782.................VPTKV..............................N----------------SY---------
POLG_CXB3N/630-782.................VPDKV..............................D----------------SY---------
POLG_POL1M/636-806.................VPEKW..............................D----------------DY---------
POLG_CXA21/642-812.................RPSSW..............................D----------------DY---------
POLG_CXA24/646-809.................RPTAW..............................D----------------DY---------

PF00915

CAPSD_VESVA/137-421YPHVLFDARQTEPVIFTIPDIRKTLFHSMD.ETDTTKLVIMVY....KNGADT..KTTCSITVETRPSADF---------
POLG_RHDVF/1768-2065FPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGS..TSAIQVTVETRPSEDF---------
CAPSD_FCVUR/112-395YPHVLFDARQVEPVIFTIPDLRSTLYHLMS.DTDTTSLVIMVYNDLINPYANDSNSSGCIVTVETKPGSDF---------
CAPSD_NVN68/2-294FPHVIADVRTLDPIEVPLEDVRNVLFHNNDRNQQTMRLVCMLYTPLRTGGGTG.DSFVVAGRVMTCPSPDF---------

PF08762

Q8B107_ALPV/599-804--V............YMPRNLEGTFEFQV----------------------------------------PH---------
O56051_9VIRU/590-790--V............FMTPN.EGIHELSI----------------------------------------PY---------
Q56QP7_9VIRU/684-855--H............MTYNNLNPVHEIMI----------------------------------------PY---------
O36967_9VIRU/668-900--LPAGTSGFGNSMTYIDPEVEGFMEFEI----------------------------------------PY---------
Q5UBY1_9VIRU/79-259--H............ITYPVLNPVHEVEV----------------------------------------PY---------
Q6ITS9_9VIRU/106-313--EVAPTTHISTPLAIEQIPIKGVAEFQI----------------------------------------PY---------
Q4JFT2_9VIRU/834-1009--TSAYQFDTNRAMHYINTSLNPMAQISL----------------------------------------PY---------

PF00729

CAPSD_PNLV/47-266------------------------------------------------------------------AIPSD---------
CAPSD_MCMVK/23-222------------------------------------------------------------------SIP..---------
CAPSD_PMVK/39-236------------------------------------------------------------------ETPKT---------
CAPSD_RCNMV/24-213------------------------------------------------------------------SAPQS---------
CAPSD_CARMS/51-245------------------------------------------------------------------TPPTT---------
CAPSD_SBMVA/46-262------------------------------------------------------------------TLPVS---------
CAPSD_TBSVC/76-269------------------------------------------------------------------PEPAD---------
CAPSD_POLVP/66-257------------------------------------------------------------------VEPAD---------
CAPSD_OCSVU/111-308------------------------------------------------------------------LVPGN---------
CAPSD_TNVA/61-272------------------------------------------------------------------AAPTA---------

PF11729

CAPSD_SJNNV/1-340-------------------------------NDHTFDALQATRGAVVAKWWESRTVRPQYTRTLLWTSTGK---------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659-------------------------------TPTSVDMNSITSTDVRILVQPGIASEH--------VIPSE---------

PF03115

CAPSD_HASV1/1-416-------------------------------TSTSWSGLGARKHLDVTVGKNATF-----------KLKPS---------

PF00983

COAT_TYMV/8-177------------------------------------------------------------------VTPAQ---------

PF02247

POL2_SQMVM/246-618------------------------------------------------------------------EEMTN---------
POL2_CPMVS/460-832------------------------------------------------------------------DAFGF---------
POL2_BPMV/447-819------------------------------------------------------------------DDTIN---------
Q9Z006_9SECO/476-846------------------------------------------------------------------EKVGN---------
O12663_9SECO/321-691------------------------------------------------------------------EKVGN---------
Q9YWK0_9SECO/363-735------------------------------------------------------------------EEMTN---------
POL2_CPSMV/437-806------------------------------------------------------------------DDTVN---------
POL2_RCMV/407-778------------------------------------------------------------------FSEN.---------
Q9YWJ9_9SECO/452-824------------------------------------------------------------------EEMTN---------
Q66170_CPMVS/343-715------------------------------------------------------------------DAFGF---------

PF03391

CAPSD_TRSV/179-344------------------------------------------------------------------PTLRQ---------
POL2_RRVS/768-936------------------------------------------------------------------ADLAD---------
POL2_BRAV/1268-1433------------------------------------------------------------------PTLEE---------
Q65029_ARMV/745-916------------------------------------------------------------------NNWNQ---------
POL2_ARMVS/792-963------------------------------------------------------------------NNWNQ---------
Q67703_GFLV/166-336------------------------------------------------------------------MDWNE---------
POL2_GFLV/771-941------------------------------------------------------------------MDWNE---------
POL2_BRSV/1007-1170------------------------------------------------------------------PETDQ---------
POL2_GCMV/981-1144------------------------------------------------------------------ITLEQ---------
POL2_TORVR/1497-1662------------------------------------------------------------------LTLET---------
Q88483_9SECO/1003-1166------------------------------------------------------------------PTTEE---------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215---------------------------------------------------------------ADGASPVLVYQYAASG-

PF01318

CAPSD_BMV/2-188---------------------------------------------------------------ADSSKEVVAAMYT----

PF03566

Q80IX5_PRVFL/54-754FSAGSMTVSASNAIFQPSNTVARIVWSITPLPVATVALTTGTGGTNNTSGKFFSVEIDGNV..NSVWTFTAPASILAEG.
CAPSD_NCBVS/1-608IVAGTTQTGGT...................LQLGGSGPNYTLTMTIGDQVEFGG.........AAIPLPTVSMGPMPES.
CAPSD_HASV/2-647...EAYALHTLTFARPSSAAALAFVWA..GLPQGGTAPAGTPAWEQASSGGYLTWRHNGTTFPAGSVSYVLPEGFALERY

PF01829

CAPSD_NODAM/42-399I--------------------------------------------------------------MEGYASVPPANVTNAQ-

PF08435

Q91H09_9CALI/305-535---------------------------------------------------------------PQEFVQHFYQEAATAR-
Q8JMP1_9CALI/305-540---------------------------------------------------------------PQEWVNHFYQEAAPSQ-
Q8B4Z2_9CALI/297-515---------------------------------------------------------------PQEWITHFVSERAALQ-
Q917X1_9CALI/305-538---------------------------------------------------------------PQEWVQHFYQESAPSL-
Q9IV43_9CALI/304-537---------------------------------------------------------------PQEFVTHFVSEQAPSM-
Q8VA02_9CALI/306-539---------------------------------------------------------------PQEFVTHFVNEQAPTR-
Q9IV49_9CALI/306-538---------------------------------------------------------------PQEWVQHFYQEAATAQ-
Q6EAX3_9CALI/306-538---------------------------------------------------------------PQEWIQHFYQESAPSQ-
Q8BAC6_9CALI/304-534---------------------------------------------------------------PQEWIEHFYQEAAPSQ-
Q6WQW7_9CALI/296-512---------------------------------------------------------------PLEWVFHFASERPTKQ-
Q6B7R3_9CALI/303-535---------------------------------------------------------------PQEWVSHFYQESAPSQ-
Q6EAW7_9CALI/305-538---------------------------------------------------------------PQEWIQHFYQESAPAQ-
Q66418_9CALI/306-538---------------------------------------------------------------PQEYVAHFVNEQAPTR-
Q80FL2_9CALI/317-546---------------------------------------------------------------PQEWVQHFYQESAPAQ-
Q9IV42_9CALI/305-535---------------------------------------------------------------PQEFITHFCNEQAPIA-
Q6XDL5_9CALI/307-546---------------------------------------------------------------PQEWVQHLYQESAPSL-
Q6B7R2_9CALI/304-538---------------------------------------------------------------PQEFVAHFVNEQAPVR-
Q917X4_9CALI/305-533---------------------------------------------------------------PQEWVQHFYQESAPSS-
Q783W9_9CALI/306-535---------------------------------------------------------------PQEWVAHFYQEAATAQ-
Q80J94_9CALI/309-538---------------------------------------------------------------PQEFVSWFASNAFTVQ-
Q913B6_9CALI/305-540---------------------------------------------------------------PQEWVQHFYQEAAPSM-
Q8JW44_9CALI/304-539---------------------------------------------------------------PQEYITHFVSEQAPTM-
Q83876_9CALI/301-524---------------------------------------------------------------PQGYISHLASEQAPTV-
Q9IV48_9CALI/306-533---------------------------------------------------------------PQEFVSHFVEQQAPIR-
Q8V713_9CALI/316-545---------------------------------------------------------------PQEWVQHFFQESATSQ-
Q91I85_9CALI/304-538---------------------------------------------------------------PQEYITHFISEQAPIQ-
Q8JXJ0_9CALI/304-537---------------------------------------------------------------PQEFIGHFVSEQAPAI-
Q783X1_9CALI/315-545---------------------------------------------------------------PQEWVQHFYQEAAPSQ-
Q783Y0_9CALI/305-533---------------------------------------------------------------HQEWIQHLYQESAPSQ-

PF02226

POLG_HRV8A/2-69---------------------------------------------------------------PSKFTDPV---------
POLG_POL1M/2-69---------------------------------------------------------------PSKFTEPI---------

PF11492

Q7T7T5_HARNA/2003-2059---------------------------------------------------------------ATEIVARAGASAA----
POLS_CRPVC/291-340---------------------------------------------------------------TPAWISAKAADLA----
Q2HWK2_RSET1/357-413---------------------------------------------------------------ATEIGAGAVGKIA----
POLS_ABPVR/340-396---------------------------------------------------------------TIKWVADKIGSVA----

PF08935

Q9WJ28_PTV1F/119-191---------------------------------------------------------------........AGINAAAR-
Q9DLK1_FMDVP/202-285---------------------------------------------------------------NNDWFSKLANTAFSGL-

PF01766

POLS_IBDVU/9-452---------------------------------------------------------------VQGLILGATIYLIGFD-
POLS_DXV96/2-442---------------------------------------------------------------.DEWTVTANYQPLNIS-
POLS_BSNV/7-428---------------------------------------------------------------AAGKTLTVTVKLMGLT-
POLS_IPNVJ/5-453---------------------------------------------------------------VNETRFDFILQFLGLD-

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------YDPYVNYSSRH-
Q27W03_PCV1/5-227--------------------------------------------------------------------YDPYINYSSRH-
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------IDPYGSTSSRR-
Q3HUU1_GOCV/5-247--------------------------------------------------------------------VDPYAAMSSRK-
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------DDPLANWDGAL-
CAPSD_CACV/7-243--------------------------------------------------------------------ADPLANWDGAR-
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------TDPLANWDGAR-
Q06J73_9CIRC/8-245--------------------------------------------------------------------VDPLANWDGAR-
Q9DXG3_BFDV/11-242--------------------------------------------------------------------QDPLAPFDGAK-
Q69EZ5_BFDV/7-239--------------------------------------------------------------------QDPLAPFDGAR-
Q9DXG0_BFDV/11-242--------------------------------------------------------------------QDPLAPFDGAK-
Q9DXF4_BFDV/3-235--------------------------------------------------------------------QDPLAPFDGAR-

PF02956

A7VLZ2_9VIRU/1-506---------------------------------------------------------------VTEV.EDVKGNKKTIT.
Q9WT88_9VIRU/1-603---------------------------------------------------------------EAQLGRIPAFNPDGTK.
Q91CY9_9VIRU/1-581---------------------------------------------------------------AARL.STSQKPALRNK.
A7VLY0_9VIRU/1-515---------------------------------------------------------------TKGL.TFWTIDSKGNK.
Q9JGT1_9VIRU/1-585---------------------------------------------------------------QAQL.KRYIDNQST...
Q80QT8_9VIRU/1-595---------------------------------------------------------------DTRL.APQTTSKYKPD.
CAPSD_TTVB1/1-533---------------------------------------------------------------YNTS.GTTPLDLFKTE.
A7VM00_9VIRU/1-509---------------------------------------------------------------PETL.TFKGKIDNREYT
Q9JG61_9VIRU/1-534---------------------------------------------------------------TNGTDWTTNFSDLSQP.
Q91PS3_9VIRU/1-581---------------------------------------------------------------QEHI.QNPNFQTDKEQ.
CAPSD_TTVV4/1-560---------------------------------------------------------------QEHM.QEPSSETCKET.
Q91C93_9VIRU/1-546---------------------------------------------------------------IQDA.CPSSTENEWKN.
Q2F827_9VIRU/1-589---------------------------------------------------------------IAQL.NPGFKAAKKTT.
Q91CY5_9VIRU/1-584---------------------------------------------------------------IAQL.SPSFAPAYKPN.
Q8V7G9_9VIRU/1-572---------------------------------------------------------------KDEW.QYAYTPL.....
Q99A78_9VIRU/1-584---------------------------------------------------------------LAQL.KPYIDNTSTGS.
Q6H9C2_9VIRU/1-573---------------------------------------------------------------IAQL.KETGNISGITPT
CAPSD_TTVT1/1-433---------------------------------------------------------------.................
Q9JG80_9VIRU/1-589---------------------------------------------------------------PFYV.INVKKGSNTAD.
A7VLZ6_9VIRU/1-506---------------------------------------------------------------INTV.YYKDKTGNKKQ.
Q6H9D2_9VIRU/1-557---------------------------------------------------------------PEMI.KCPAAGKAPET.
Q6H999_9VIRU/1-471---------------------------------------------------------------EGCI.SHPQLKKPNPQ.
Q77JT5_9VIRU/1-606---------------------------------------------------------------VAQL.KYKWNPNQNPT.
Q91PS7_9VIRU/1-585---------------------------------------------------------------EEHL.YDPSAKETKNT.
CAPSD_TTVV9/1-555---------------------------------------------------------------RIWG.NIKPQNTNF...
Q9JG47_9VIRU/1-553---------------------------------------------------------------LSSI.TLNTGALSPPS.
A7VLW0_9VIRU/1-507---------------------------------------------------------------KKTL.TFNYIIGNQRGT
Q0ZLH9_9VIRU/1-573---------------------------------------------------------------SEHI.RQPPADNYKQA.
Q5ENW7_9VIRU/1-501---------------------------------------------------------------PKKK.EFSTGTDNPNY.
A7VLX2_9VIRU/1-509---------------------------------------------------------------GVAL.TGTYKDKQDKP.
Q80AR5_9VIRU/1-594---------------------------------------------------------------EANL.RPRQYNADGGA.
Q91CZ2_9VIRU/1-601---------------------------------------------------------------PSYV.KKINNNPDGSSI
CAPSD_TTVG1/1-514---------------------------------------------------------------SMIFVSNYGGKKTEYN.
Q98Y63_9VIRU/1-581---------------------------------------------------------------SAFL.NIAQAPAIHGH.
Q9QU36_9VIRU/1-529---------------------------------------------------------------VKNQ.SNYASQPNM...
A7VM12_9VIRU/1-509---------------------------------------------------------------NKSL.SYKNKTKGGSE.
A7VLV6_9VIRU/1-508---------------------------------------------------------------GVSL.TGTYKGKDGKD.
Q9JG50_9VIRU/1-535---------------------------------------------------------------PIDMSGPTSNQIKALH.
A7VLW4_9VIRU/1-507---------------------------------------------------------------DLPF.VVKQANKEVQKY
A7VM04_9VIRU/1-513---------------------------------------------------------------ATIY.TWNYKQWQTGQ.
A7VLY4_9VIRU/1-498---------------------------------------------------------------VTTF.TYKTAATKQVE.
CAPSD_TTVD1/1-324---------------------------------------------------------------.................
Q91CZ6_9VIRU/1-596---------------------------------------------------------------PSYI.KRITHNPDGST.
A7VM08_9VIRU/1-506---------------------------------------------------------------RLTF.HYKTATGSSTVQ
CAPSD_TTVV3/1-573---------------------------------------------------------------IAQL.KPLVDATTNQT.
Q91D00_9VIRU/1-593---------------------------------------------------------------EQMF.RPKQYNADGST.
Q99AR5_9VIRU/1-604---------------------------------------------------------------EAQVGRIPSFNPDGTK.
Q9DTD2_9VIRU/1-559---------------------------------------------------------------IAHL.KITDNCKNTQT.
Q91D04_9VIRU/1-591---------------------------------------------------------------QGII.SKTRRTAKFSTS
CAPSD_TTVV8/1-571---------------------------------------------------------------ESHM.ANLISKAPPKQ.
Q5ENX0_9VIRU/1-603---------------------------------------------------------------GPFIKDTMQANNYQQK.
O90364_9VIRU/1-590---------------------------------------------------------------IAQL.KPFIDAGNITS.
Q9IFV0_9VIRU/1-583---------------------------------------------------------------QEHV.VDPRWDTVKKQ.
Q9QUE7_9VIRU/1-586---------------------------------------------------------------IAQL.KRYVENTEKNG.
A8DMR2_9VIRU/1-531---------------------------------------------------------------MGDE.KAHYEDYFKTK.
Q9DUH8_9VIRU/1-609---------------------------------------------------------------DFMT.ANPPKYDNGNN.
A7VLW8_9VIRU/1-511---------------------------------------------------------------LEFW.SGNTKNPTKYK.
Q99AQ3_9VIRU/1-582---------------------------------------------------------------PQFV.RMPKNNPDNTA.

PF02248

Q66170_CPMVS/720-899---------------------------------------------------------------SMNPESYD-ARTFV---
Q9YWJ9_9SECO/828-1009---------------------------------------------------------------NLSNKALP-ARSWY---
POL2_CPMVS/837-1016---------------------------------------------------------------SMNPESYD-ARTFV---
POL2_BPMV/821-1004---------------------------------------------------------------SNSTEHFD-ACRWT---
POL2_CPSMV/808-988---------------------------------------------------------------SDNAQHYE-AQKWS---
POL2_RCMV/786-964---------------------------------------------------------------SMNTSSYD-ARVWV---
Q66179_APMV/2-185---------------------------------------------------------------APGTEYLN-AITVF---
POL2_APMV/802-985---------------------------------------------------------------APGTEYLN-AITVF---
POL2_SQMVM/622-803---------------------------------------------------------------NLSNKALP-ARSWY---
Q9YWK0_9SECO/739-920---------------------------------------------------------------NLSNKALP-ARSWY---

PF03688

A5H0K4_GFLV/264-422---------------------------------------------------------------GLDGPSQI-.....---
POL2_BRSV/1176-1338---------------------------------------------------------------GINNEHIG-..DTM---
Q86631_9SECO/418-544---------------------------------------------------------------TTSSESYL-.....---
POL2_ARMV/344-502---------------------------------------------------------------GMDGASRV-.....---
Q88483_9SECO/1172-1336---------------------------------------------------------------AAVAEHFG-..GKH---
A2ID55_9SECO/610-780---------------------------------------------------------------MRRNRGFI-LEERT---
Q80JS8_BRAV/347-511---------------------------------------------------------------VKGVRNAI-.QKKV---
A0A9J6_ARMV/960-1118---------------------------------------------------------------GLDGGSRV-.....---
CAPSD_TRSV/351-511---------------------------------------------------------------YWQGQARI-.....---
POL2_GCMV/1150-1316---------------------------------------------------------------STIGEHHG-..EFH---
Q6XPY1_9SECO/164-322---------------------------------------------------------------GITTEHIG-..DIK---
Q6XFY6_9SECO/157-316---------------------------------------------------------------GLDGGSEV-.....---
Q9IV56_9SECO/980-1138---------------------------------------------------------------SFDGASTV-.....---
Q65624_9SECO/386-551---------------------------------------------------------------AETNGSQI-LQSWI---
POL2_CNSV/1022-1185---------------------------------------------------------------E...EENF-RGHCR---
Q64959_9SECO/338-502---------------------------------------------------------------WVIVLQHI-ILGIR---
Q20LA0_9SECO/942-1102---------------------------------------------------------------.TSTNNYF-GDQAT---
A3FEN2_9SECO/348-507---------------------------------------------------------------EIEQTSTV-.....---
Q9ELS0_9SECO/148-312---------------------------------------------------------------AEVLESTV-.....---
Q9QAH0_9SECO/350-510---------------------------------------------------------------.TATENFF-GDQAT---
Q24M89_9SECO/943-1103---------------------------------------------------------------.TNTVSYY-GDQAT---

PF08462

Q5ZF43_CARMV/250-348---------------------------------------------------------------GFTKPTLV-GPGIS---
Q999Y9_CARMV/250-348---------------------------------------------------------------GFTKPTLI-GPGIS---
Q4JGW6_CARMV/250-348---------------------------------------------------------------GFTKPTLI-GPGIS---
Q8JJU7_CARMV/250-348---------------------------------------------------------------GFTKPTLV-GPGIS---
CAPSD_CARMS/250-348---------------------------------------------------------------GFTKPTLI-GPGIS---
Q999Z1_CARMV/250-348---------------------------------------------------------------GFTKPTLV-GPGIS---
CAPSD_CARMV/250-348---------------------------------------------------------------GFTKPTLI-GPGIS---
Q7TG55_CARMV/250-348---------------------------------------------------------------GFTKPTLI-GPGIS---

PF00073

Q9WMA0_9PICO/49-215---------------------------------------------------------------.ASLTVYP-HGLLN---
POLG_AEVCA/45-212---------------------------------------------------------------.AAMTTYC-HGKLN---
POLG_CXA9/93-300---------------------------------------------------------------VGNLTIYP-HQWIN---
POLG_CXB3N/93-302---------------------------------------------------------------VGNLTIFP-HQWIN---
POLG_CXB4J/93-300---------------------------------------------------------------VGNLTIYP-HQWIN---
POLG_CXA21/93-308---------------------------------------------------------------AGNAFVYP-HQIIN---
POLG_POL1M/93-308---------------------------------------------------------------LGNAFVFP-HQIIN---
POLG_POL3L/93-307---------------------------------------------------------------LGNAFVYP-HQIIN---
POLG_HE701/93-288---------------------------------------------------------------LACALVYP-HQWIN---
POLG_BOVEV/93-285---------------------------------------------------------------LGNSLIYP-HQWIN---
POLG_HRV14/93-299---------------------------------------------------------------LGNLLIFP-HQFIN---
POLG_HRV2/93-302---------------------------------------------------------------LGNITIFP-HQFIN---
POLG_HRV8A/93-302---------------------------------------------------------------LGNLPIYP-HQYIN---
POLG_HRV1B/93-301---------------------------------------------------------------LGNLLIFP-HQFIN---
POLG_FMDV1/311-475---------------------------------------------------------------.YQLTLFP-HQFIS---
POLG_FMDVT/311-475---------------------------------------------------------------.YQLTLYP-HQFIN---
POLG_FMDVO/311-475---------------------------------------------------------------LYQLTLFP-HQFIN---
POLG_EMCV/161-359---------------------------------------------------------------FWQWTLYP-HQFLN---
POLG_TMEVB/172-382---------------------------------------------------------------QWQWTVYP-HQILN---
POLG_ENMGO/162-361---------------------------------------------------------------FWQWTLYP-HQFLN---
POLG_FMDVO/533-691---------------------------------------------------------------.EAAAHCI-HAEWD---
POLG_FMDV1/533-692---------------------------------------------------------------.EEAAHCI-HAEWD---
POLG_EMCV/420-582---------------------------------------------------------------.DQAMQAT-YAIWD---
POLG_TMEVB/443-606---------------------------------------------------------------.DQAMQST-YAIWD---
POLG_HE701/347-515---------------------------------------------------------------.MQAMLAT-HVVWD---
POLG_HRV2/358-522---------------------------------------------------------------.KDAMLGT-HVIWD---
POLG_HRV8A/364-529---------------------------------------------------------------.REAMLGT-HLVWD---
POLG_HRV1B/360-525---------------------------------------------------------------.KDAMLGT-HVVWD---
POLG_BOVEV/345-515---------------------------------------------------------------.EEAMLGT-HVVWD---
POLG_CXA21/369-534---------------------------------------------------------------.KDAMLGT-HIIWD---
POLG_CXA9/358-524---------------------------------------------------------------.KDAMLGT-HIIWD---
POLG_CXB4J/358-524---------------------------------------------------------------.KNAMLGT-HVIWD---
POLG_CXB3N/360-526---------------------------------------------------------------.VDAMLGT-HVIWD---
POLG_CXB1J/360-526---------------------------------------------------------------.RDAMLGT-HVIWD---
POLG_FMDVO/725-872---------------------------------------------------------------ALDNTTNP-TAYHK---
POLG_FMDV1/726-878---------------------------------------------------------------ALSNTSNP-TAYNK---
POLG_BOVEV/610-775---------------------------------------------------------------QWQSGCNP-SVFAD---
POLG_HRV8A/621-792---------------------------------------------------------------TWQSGTNA-SVFWQ---
POLG_HRV2/614-772---------------------------------------------------------------AWQSGTNA-SVFWQ---
POLG_HRV1B/627-786---------------------------------------------------------------SWQSGTNM-SIFWQ---
POLG_HE701/609-781---------------------------------------------------------------EWQSACNP-SVFFK---
POLG_HRV14/614-787---------------------------------------------------------------TWQSASNP-SVFFK---
POLG_CXA9/612-783---------------------------------------------------------------AWQTSTNP-SIFWT---
POLG_CXB4J/612-783---------------------------------------------------------------VWQTSTNP-SIFWT---
POLG_SVDVU/612-782---------------------------------------------------------------SWQTSTNP-SVFWT---
POLG_CXB3N/630-782---------------------------------------------------------------VWQTSTNP-SVFWT---
POLG_POL1M/636-806---------------------------------------------------------------TWQTSSNP-SIFYT---
POLG_CXA21/642-812---------------------------------------------------------------TWQSSSNP-SIFYM---
POLG_CXA24/646-809---------------------------------------------------------------TWQSSSNP-SVFYT---

PF00915

CAPSD_VESVA/137-421---------------------------------------------------------------TFALLKPP-GSLIK---
POLG_RHDVF/1768-2065---------------------------------------------------------------EFVMIRAP-SSKTV---
CAPSD_FCVUR/112-395---------------------------------------------------------------KFHLLKPP-GSMLT---
CAPSD_NVN68/2-294---------------------------------------------------------------NFLFLVPP-..TVE---

PF08762

Q8B107_ALPV/599-804---------------------------------------------------------------YSRYPLLP-NTA..---
O56051_9VIRU/590-790---------------------------------------------------------------YSSY...P-VTLTT---
Q56QP7_9VIRU/684-855---------------------------------------------------------------YSQYRKIP-IS...---
O36967_9VIRU/668-900---------------------------------------------------------------YNISHISP-ATTYV---
Q5UBY1_9VIRU/79-259---------------------------------------------------------------YCQYRKLP-IASTS---
Q6ITS9_9VIRU/106-313---------------------------------------------------------------YA.....P-CLSSS---
Q4JFT2_9VIRU/834-1009---------------------------------------------------------------YS.....P-AENLV---

PF00729

CAPSD_PNLV/47-266---------------------------------------------------------------ETEMSALK-GYTTTSA-
CAPSD_MCMVK/23-222---------------------------------------------------------------.TGVEDVA-RIVPSAT-
CAPSD_PMVK/39-236---------------------------------------------------------------LTDLMDSE-SLVLVPS-
CAPSD_RCNMV/24-213---------------------------------------------------------------RQEISAYS-RSVSTAV-
CAPSD_CARMS/51-245---------------------------------------------------------------KVGFYDLG-KHVETAA-
CAPSD_SBMVA/46-262---------------------------------------------------------------VNQLSNLR-GYVSGQV-
CAPSD_TBSVC/76-269---------------------------------------------------------------RVELANYS-VLKETAP-
CAPSD_POLVP/66-257---------------------------------------------------------------RVELANMG-HWTESAP-
CAPSD_OCSVU/111-308---------------------------------------------------------------RQEFYALS-NHCENMP-
CAPSD_TNVA/61-272---------------------------------------------------------------RAQLSQSY-KAINFPP-

PF11729

CAPSD_SJNNV/1-340---------------------------------------------------------------EQRLTSPG-RLVLLCV-

PF00894

CAPSD_PLRV1/70-207------------------------------------------------------------------VSSLQ-SYVNK---
CAPSD_PEMVW/53-187------------------------------------------------------------------KAADV-VLLDT---
CAPSD_BYDVP/62-199------------------------------------------------------------------QSALG-SYINS---

PF03014

CAPSD_HEVCH/41-659---------------------------------------------------------------RLHYRNQGWRSVETSG-

PF03115

CAPSD_HASV1/1-416---------------------------------------------------------------DLGGPRDG-WWLTNTN-

PF00983

COAT_TYMV/8-177---------------------------------------------------------------ITKTYGGQ-IFC-----

PF02247

POL2_SQMVM/246-618---------------------------------------------------------------...LESFP-HKLVQFR-
POL2_CPMVS/460-832---------------------------------------------------------------...YESFP-HRIVQFA-
POL2_BPMV/447-819---------------------------------------------------------------...FEAFP-HKLVQFG-
Q9Z006_9SECO/476-846---------------------------------------------------------------MQILDSLP-HIDFTFS-
O12663_9SECO/321-691---------------------------------------------------------------MQILDSLP-HIDFTFS-
Q9YWK0_9SECO/363-735---------------------------------------------------------------...LESFP-HKLVQFA-
POL2_CPSMV/437-806---------------------------------------------------------------...FEAFP-HKLIVFS-
POL2_RCMV/407-778---------------------------------------------------------------...LEDFP-NKLIQFG-
Q9YWJ9_9SECO/452-824---------------------------------------------------------------...LESFP-HKLVQFA-
Q66170_CPMVS/343-715---------------------------------------------------------------...YESFP-HRIVQFA-

PF03391

CAPSD_TRSV/179-344------------------------------------------------------------------VLWGP-HQIMHG.-
POL2_RRVS/768-936------------------------------------------------------------------IVTRK-HWIVKS.-
POL2_BRAV/1268-1433------------------------------------------------------------------ALVFP-GFRLPSG-
Q65029_ARMV/745-916------------------------------------------------------------------LFKYP-GCYIEE.-
POL2_ARMVS/792-963------------------------------------------------------------------LFKYP-GCYIEE.-
Q67703_GFLV/166-336------------------------------------------------------------------LFKYP-GVYVEE.-
POL2_GFLV/771-941------------------------------------------------------------------LFKYP-GVYVEE.-
POL2_BRSV/1007-1170------------------------------------------------------------------LAQMP-HVDVEV.-
POL2_GCMV/981-1144------------------------------------------------------------------LSQMP-HVDCDV.-
POL2_TORVR/1497-1662------------------------------------------------------------------AYQRP-HYILA..-
Q88483_9SECO/1003-1166------------------------------------------------------------------LAQIP-HVDVTL.-

PF03689

A3FEM9_9SECO/10-101------------------------------------------------------------------LDAFG-RYD-----
Q9QAH4_9SECO/9-99------------------------------------------------------------------FDAYR-RI.-----
Q09G89_GFLV/608-698------------------------------------------------------------------FDAYN-RI.-----
Q9JGK5_SDV/160-249------------------------------------------------------------------WDDLS-QF.-----
Q9IV56_9SECO/636-727------------------------------------------------------------------ADFYN-RIK-----
A1YYW2_BRAV/156-247------------------------------------------------------------------IDAFD-RLL-----
Q65624_9SECO/45-137------------------------------------------------------------------CDYFG-RLS-----
Q6JX06_9SECO/849-939------------------------------------------------------------------FDAYG-HI.-----
Q20LA0_9SECO/601-691------------------------------------------------------------------FDAYR-RI.-----
POL2_BRSV/842-932------------------------------------------------------------------FDAYG-KI.-----
A0A9J8_ARMV/580-670------------------------------------------------------------------FDAYN-RI.-----
Q6JX05_9SECO/604-694------------------------------------------------------------------FDAYN-RI.-----
Q9Z0D6_SDV/74-163------------------------------------------------------------------WDDLS-EL.-----
Q9QRA5_9SECO/10-101------------------------------------------------------------------LDAFN-RYD-----
Q86631_9SECO/85-173------------------------------------------------------------------CDVFN-RSK-----
POL2_GCMV/815-905------------------------------------------------------------------FDAYG-KI.-----
A2ID55_9SECO/270-361------------------------------------------------------------------LDVAN-RLG-----
Q64959_9SECO/4-94------------------------------------------------------------------FDAYG-HI.-----
Q8B5P7_TRSV/12-103------------------------------------------------------------------FDDYK-RID-----
Q88483_9SECO/838-928------------------------------------------------------------------FDAYG-KI.-----
POL2_CNSV/688-778------------------------------------------------------------------IDGTG-YL.-----

PF00760

CAPSD_CMVFN/11-215----------VQANNKLLYDL-----------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754.......EPFAEEGDTTSFSM.......TTI......TADTVVYSVSSSLTGSSVIVRGVTKGSGVSITPVTVGIDTEAV
CAPSD_NCBVS/1-608.......GQLVFQTANLTFDV..GNTITITT......TLPPGSVTGMWQFTASNGTD.TVTVDAGARLYAFGANLDASEL
CAPSD_HASV/2-647DPNDGSWTDFASAGDTVTFRQVAVDEVVVTNNPAGGGSAPTFTVRVPPSNAYTNTVFRNTLLET............RPSS

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------G....T
POLS_DXV96/2-442--------------------------------------------------------------------------G....T
POLS_BSNV/7-428--------------------------------------------------------------------------G....A
POLS_IPNVJ/5-453--------------------------------------------------------------------------NDVPVV

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506...T.......................................VFTPYTE..............................
Q9WT88_9VIRU/1-603...NTKQQSWQDNWSKKNSPWTGNSGTYP...QTTSEMYKIP.YDSNFGFPTYR.........AQKDYILER..RQCNFN
Q91CY9_9VIRU/1-581...EEIPNDHGYLNTTPTDSTFRTG..................NNTIYGQPSYR.........PNYTKLTKI..REWYFT
A7VLY0_9VIRU/1-515...TPHSI...................................KPQNYNQ..............................
Q9JGT1_9VIRU/1-585.......TDTWNSYLNTKKFSTNESPKTD...INSIGGPYTTYSDTWYKGTAYIQ.........KITEVPPK..AAELYY
Q80QT8_9VIRU/1-595...GQPLTSSELTWDQSAFNSFKTK..................ADSNYGYCTYNPNGST....QLVEKIKGY..RNQRFR
CAPSD_TTVB1/1-533...NKPY....................................WGNVFTNLNQDQ.........................
A7VM00_9VIRU/1-509WNMSPF.....................................ISDKYTN..............................
Q9JG61_9VIRU/1-534...NK......................................WANPFSYSAHEETN.......................
Q91PS3_9VIRU/1-581...VSTPYTYDT...............................VTSLWGDYVYKES........IIDSFKTN..ATNYYN
CAPSD_TTVV4/1-560...QKTNPPFKYEN.............................LSSLWGDKIYKES........TFNSFKTN..AENLWK
Q91C93_9VIRU/1-546...QFEKYLQTEKN.............................WGNPFTPEYLDED........................
Q2F827_9VIRU/1-589...NGSGSTAATLGDAVTELKNPNGTFYT...G..........NNSTFGCCTYK.........PTKEIGSNA..NKWFWH
Q91CY5_9VIRU/1-584...GTNNNTHKPLGGMVPELKYNNAGFHT...G..........NNPVFGMCKYK.........PSTLTMQNA..NKWFWE
Q8V7G9_9VIRU/1-572.........MKTFYTQAANTAAHNI..................TDKTYNWKNYK............THYDKV..QQTWTT
Q99A78_9VIRU/1-584.......TNNWSSYVNTSKFTTASKTITT.....SAEGPYYTFADTWYRGTAYNN.........SITNVPLQ..AAQLYH
Q6H9C2_9VIRU/1-573WTEVQNSTTLNQAGNNATDS.......................RDTWYKGNTYNE.........KISELAQI..TRNRFK
CAPSD_TTVT1/1-433................................................................................
Q9JG80_9VIRU/1-589...YLSPQITDSNFRKK..........................VNTNYNWYTYNAK.......SNKDNLHKL..RQAYFK
A7VLZ6_9VIRU/1-506...IGP..FNT................................TATAYDD..............................
Q6H9D2_9VIRU/1-557...GDISTNCYKK..............................LDSAWGDTIWNQN........TIANFKKN..TDNLWN
Q6H999_9VIRU/1-471...INKPLDSQYFAP............................LDALWGDPIYY..........NDLNEKKS..LKDIIE
Q77JT5_9VIRU/1-606...MPNTSNASLSKKPDDLTKTKTTNEYP...H..........WDTLYGGLAYGHSTVTPGTTSSPTDLKTQMLTGNEFY
Q91PS7_9VIRU/1-585...TNTDAAGNKYNT............................VTSLWGDYIYKET........VVDNFINN..AKNYFE
CAPSD_TTVV9/1-555...........................................TPENYWNKWNE..........IHTKIKTN..RQSELT
Q9JG47_9VIRU/1-553...DWGTFKSASKAIYNAYYQHKY...................WGNPFFTNWFHGD........................
A7VLW0_9VIRU/1-507YTMSNS.....................................DISDYDS..............................
Q0ZLH9_9VIRU/1-573...NKDTTYYGR...............................VDSHWGDHVYQQT........IIQAMEEN..QSNMYT
Q5ENW7_9VIRU/1-501...NVQDNEEKNIYPIIIYVDQKDQ..................KPRKKYCVCYNKTLNRWRLGQ................
A7VLX2_9VIRU/1-509...QNITVGDYT...............................GENPYYS..............................
Q80AR5_9VIRU/1-594...NPNYAQLQSKWTTTIYAKK.....................TDSNFGYTSYNFSGD.....QGYKYVTEI..RQWYWT
Q91CZ2_9VIRU/1-601SQRVGTMPDMTEYNKWVSNTNIGTGFVNS...N..........VSVHYNYCQYN.........PNHTHLTTL..RQYYFF
CAPSD_TTVG1/1-514...IGQWIETDIPGEG...........................NLARYYR..............................
Q98Y63_9VIRU/1-581...NGIPNNSRYLSSTGTETSFRTG..................NNSIYGQPNYK.........PIPEKLTEI..RKWFFK
Q9QU36_9VIRU/1-529...........................................WGNIFHEDYLFGT........................
A7VM12_9VIRU/1-509...TTTQMPST................................SFTSYSA..............................
A7VLV6_9VIRU/1-508...HEKIIGEWKKM.............................GEAQYYE..............................
Q9JG50_9VIRU/1-535...EKQN....................................WGNPFHYNFANK.........................
A7VLW4_9VIRU/1-507MKPQ.......................................ATTDYST..............................
A7VM04_9VIRU/1-513...GGQ..PFT................................KPQTYNQ..............................
A7VLY4_9VIRU/1-498...TFN.....................................KPTTYEA..............................
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596...GGTLSTLTAYNEWVTGTGP.NKFIPG...N..........TSVHYNFCTYN.........PKYDNLKAL..RSYYFH
A7VM08_9VIRU/1-506V..........................................DQSDETK..............................
CAPSD_TTVV3/1-573...WSHYVNPNKLTTTPTSEITH....................NNTWYRGNAYND.........KITDLPEI..VKKSYY
Q91D00_9VIRU/1-593...WKDYKSMLSTWTSQIYNKK.....................TDSNYGYASYDFS.......KGKEFATQM..RQHYWV
Q99AR5_9VIRU/1-604...NTKESEWQNYWSKKGEPWNPNSSYPH...TTTNQMYKIP.FDSNYGFPTYK.........PIKEYMLQR..RAWSFK
Q9DTD2_9VIRU/1-559...DITNTKH.................................NDTQYKGNTYVD.........EINQVRKD..TGDKFI
Q91D04_9VIRU/1-591NNTLGSDTNITPYLEQPTATNHKNTLSTG..............NNSIYGLPSYN.........PIPDKLKKI..QEWFWK
CAPSD_TTVV8/1-571...VLKSSDGSLQTDH...........................NDTQFGGNPYNTNQF......TTTTVNKIIQGAQNYL
Q5ENX0_9VIRU/1-603...KTNYTKTNFYTTRDATGDTAFVSN................ADSNYLYATYHPE.......NIETKLYKI..RENYFQ
O90364_9VIRU/1-590....GTAATTWGSYINTTKFTTTATTTYTYPGTTTNTVTMYSSNDSWYRGTVYNN.........QIKELPKK..AAELYS
Q9IFV0_9VIRU/1-583...STGSQWSNTF..............................VDSHWGDHIYENTSSKS....ILTAMKDN..ATKMYD
Q9QUE7_9VIRU/1-586....TTPNPWQSKYVNTTAFTTALNVTTE........KPYTTFSDSWYRGTVYKE.........TITEVPLA..AAKLYQ
A8DMR2_9VIRU/1-531...TK......................................WGNPFYAPYFEPEPQKIFMIK................
Q9DUH8_9VIRU/1-609...KKLFNDNDYNTFKTTFLTK.....................KDSGYLFASYNPA.......QVAENIKNI..RDQNFA
A7VLW8_9VIRU/1-511...PKDEIEKATDPP............................STAKYYA..............................
Q99AQ3_9VIRU/1-582...NTEANKFNEWVDKTFKTG......................KLVKYNYNQYK.........PDIEKLTLL..RQYYFR

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266---------------------------------------------------------WAGSEGIKMLSYP----------
CAPSD_MCMVK/23-222---------------------------------------------------------IALKNRGPSIVMP----------
CAPSD_PMVK/39-236---------------------------------------------------------LSGKTYRPKIETR----------
CAPSD_RCNMV/24-213---------------------------------------------------------YEKC.........----------
CAPSD_CARMS/51-245---------------------------------------------------------QTAK.........----------
CAPSD_SBMVA/46-262---------------------------------------------------------WSGSSGLCYINGT----------
CAPSD_TBSVC/76-269---------------------------------------------------------WAEA.........----------
CAPSD_POLVP/66-257---------------------------------------------------------WCES.........----------
CAPSD_OCSVU/111-308---------------------------------------------------------WQES.........----------
CAPSD_TNVA/61-272---------------------------------------------------------YAGYDGAAYLNSN----------

PF11729

CAPSD_SJNNV/1-340-------------------------------------------GSNTDVVNVSVMCRWSVRLSVPSLETP----------

PF00894

CAPSD_PLRV1/70-207---------------------------------------------------------FQITKGGAKTYQA----------
CAPSD_PEMVW/53-187---------------------------------------------------------WNIRSNGSATFGR----------
CAPSD_BYDVP/62-199---------------------------------------------------------FTISKTASKTFRS----------

PF03014

CAPSD_HEVCH/41-659-------------------------------------------VAEEEATSGLVMLCIHGSLVNSYTNTPYTGALGLLDF

PF03115

CAPSD_HASV1/1-416-------------------------------------------DNASDTLGPSIEIHTLGRTMSSYKNEQFTGGLFLVEL

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754NRL...SIEMPALTTEEVTTNVPKYEQFLCKESGGAYIVHYKMNNPVFEMTGEENFGGFQFHYPGYDPENNALGLRGIVD
CAPSD_NCBVS/1-608NLQDINSIKIPPTNMNQMMQATPKTIQFQLNETKGFY.MPLRAFQPVFEMTMATSYGPVRWKTPRTTVVDYHRAIGGLQD
CAPSD_HASV/2-647RRL...ELPMPPADFGQTVANNPKIEQSLLKETLGCYLVHSKMRNPVFQLTPASSFGAVSFNNPGYERTRDLPDYTGIRD

PF01829

CAPSD_NODAM/42-399----------------------------------------------------ASMFTNLTFSGARYTGLGDMDAIAILVT

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452AVITRA.VAADN..GLTAGTDNLMPFNI....VIPTSEITQPITSIKLEIVT.SKSGGQAGDQMSWSASGSLAVTIHGGN
POLS_DXV96/2-442LIANSQRTLTWSNTGVSNGSHYMNMNNLNVS.LFHENPPPEPVAAIKININYGNNTNGDS....SFSVDSSFTINVIGGA
POLS_BSNV/7-428KVASRSETVSGN..GGT........FHFSTTAVFGETEITQPVVGVQVL....AKTNGD.....PIVVDSYVGVTVHGGN
POLS_IPNVJ/5-453TVTSSTLVTADNYRGASA..........KFTQSIPTEMITKPITRVKLAYQLNQQTAIANAATLGAKGPASVSFSSGNGN

PF02443

Q5Y4T0_PCV2/5-226-------------------------------TIPQPFPYHSRYFTPKPVLDR----------------------------
Q27W03_PCV1/5-227-------------------------------TIRQPFTYHSRYFTPKPELDQ----------------------------
A3FEQ4_9CIRC/3-256-------------------------------TWDPSRIH.RRYFVPKP....----------------------------
Q3HUU1_GOCV/5-247-------------------------------TWSPHRYH.KRVFIPKP....----------------------------
Q1L2D2_9CIRC/1-237-------------------------------KWDQRKGF.KRLVRPKPQL..----------------------------
CAPSD_CACV/7-243-------------------------------KWDLRKGF.KRLFKPRPQL..----------------------------
Q0H9S8_9CIRC/4-236-------------------------------QWDLRKGF.KRLFRPRPQI..----------------------------
Q06J73_9CIRC/8-245-------------------------------KWTLRKGF.KRLFRPRPQL..----------------------------
Q9DXG3_BFDV/11-242-------------------------------KWFVSRGF.KRLLRPKPQI..----------------------------
Q69EZ5_BFDV/7-239-------------------------------KWYLSRGF.KRLLRPKPQI..----------------------------
Q9DXG0_BFDV/11-242-------------------------------KWYLSRGF.KRLLRPKPQI..----------------------------
Q9DXF4_BFDV/3-235-------------------------------KWYLNKGF.KRLLRPKPQI..----------------------------

PF02956

A7VLZ2_9VIRU/1-506...............................TITYNKGWFQPALLQAKQITKPSQAN.............PPLKGARYN.
Q9WT88_9VIRU/1-603YEV....NNPVSKKVWPQPSTTTPTVD....YYEYHCGWFSNIFIGPNRY.NLQ.FQ.............TAYVDTTYN.
Q91CY9_9VIRU/1-581QEN.........TDNPIHGSYLKPTLN....SVDYHLGKYSAIFLSPYRT.NTQ.FD.............TAYQDVTYN.
A7VLY0_9VIRU/1-515...............................SVNYLQGFFSQYVLQAQKITDADDNVPAKYEQYSAAMSTLLIAAFRYN.
Q9JGT1_9VIRU/1-585KQT...........EQLIGATFTGSTR....YLHYTGGLYTSIWLSAGRS.YFE.TH.............GPDTDITYN.
Q80QT8_9VIRU/1-595WLT......SYTGTNHINDTFAKGKHQ....EYEYHLGWYSNIFLGNLRH.NLA.FS.............PAYIDITYN.
CAPSD_TTVB1/1-533...............................DVIIYYGTKPKQDDNWTSTAPILPIT.............SLYVECRYN.
A7VM00_9VIRU/1-509...............................SLNKDSGWFNPKVLNAYTVLKGDQRQSL...........VPCGVLRYN.
Q9JG61_9VIRU/1-534...............................DVQIFYGTPPTETTYNTQP.QLQTIT.............GLYQECRYN.
Q91PS3_9VIRU/1-581SRK..............GTQITASK......FLNHKTGIFSPIFLSRQRL.APD.FP.............GFYTEVIYN.
CAPSD_TTVV4/1-560ARS..............KHTLLGSK......ELNFKTGMYSAIFLTNGRL.SPD.YP.............GIYIEVVYN.
Q91C93_9VIRU/1-546...............................NYNIWITNKTPQELKAKYKSNTDKLHSSDTDTFWTLKRVPSVLDCRYN.
Q2F827_9VIRU/1-589QLT........ATDSDTLGQYGRASIK....YMEYHTGIYSSIFLSPLRS.NLE.FP.............TAYQDVTYN.
Q91CY5_9VIRU/1-584NLQ.........VENDLQSKYGKANLT....CMEYHTGIYSSIFLSPQR..NLQ.FP.............AAYLDVTYN.
Q8V7G9_9VIRU/1-572KAQFNYDLVKEEYKTVYPTTATFPPEWSNRQYLEHDYGLFSPYFLTPNRY.STE.WH.............MPITYVRYN.
Q99A78_9VIRU/1-584DTT...........KKLLGTTFTGGSP....YLEYHGGLYSSIWLSAGRS.YFE.TK.............GTYTDITYN.
Q6H9C2_9VIRU/1-573NAT..........KTALPNYPTIMSTD....LYEYHSGIYSSIYLSAGRS.YFE.TT.............GAYSDIIYN.
CAPSD_TTVT1/1-433...............................SYDFKDTNEVKKVWN........................TAGKKYYYR.
Q9JG80_9VIRU/1-589QLT.SEGPQHTSSDNGYASQWTTPSTD....AYEYHLGMFSTIFLAPDR..PVPRFP.............CAYQDVTYN.
A7VLZ6_9VIRU/1-506...............................SVSYTKGYFQPPFLQTQFVCTSSMCDVKAGY........LPINVAIYN.
Q6H9D2_9VIRU/1-557AGH..............NQTMTGSK......YLNYRTGIYSAIFLSAGRL.SPD.FP.............GLYDDIVYN.
Q6H999_9VIRU/1-471NILIKNMITYHEKLREFPNSYQGNK......AFCHLTGIYSPPYLNQGRI.SPEIF..............GLYTEIIYN.
Q77JT5_9VIRU/1-606TTAGKKLIDTFHPIPYYENGSSKANTN....IFDYYTGMYSSIFLSSGRS.NPE.VK.............GSYTDISYN.
Q91PS7_9VIRU/1-585SRK..............GNIVMSNE......YLNHKTGLYSPIFLSNSRL.SPD.FP.............GFYIDVLYN.
CAPSD_TTVV9/1-555QLKQMRKRLELTTENDYQDP...........NFGLSYGLYSPLLLYPEMYFPEQS...............KVYQKARYN.
Q9JG47_9VIRU/1-553...............................QRMIATGKTLKELCQIYKDDDITTAKLKEGFIFKE....QKWVELRYN.
A7VLW0_9VIRU/1-507...............................SVSISKGWFQPKILNAYEVKDNTVTQAL...........TPCGVLRYN.
Q0ZLH9_9VIRU/1-573KRA..............LHTFLGSQ......YLNFKSGLFSSIFLDNARL.SPD.FK.............GMYQEVVYN.
Q5ENW7_9VIRU/1-501...............................ASTLKIGNLKGLVLRQLMNQEMT................YIWKEGEYSA
A7VLX2_9VIRU/1-509...............................SINYTGGWFDTRFLNSYEIKKKNTQQWLGY.........LPVGVARYN.
Q80AR5_9VIRU/1-594QLT.....SWTQTAPHINSTFANATHP....EFEYHAGWYSNIFIGPNRF.NIQ.FK.............VAYMDVTYN.
Q91CZ2_9VIRU/1-601WET.HPAAANKTPVTHVPITTTKPTKD....WWEYRLGLFSPIFLSPLRSSNIE.WP.............FAYRDIIYN.
CAPSD_TTVG1/1-514...............................SISKEGGYFSPKILQAYQTKVKSVDYKP...........LPIVLGRYN.
Q98Y63_9VIRU/1-581QAT.........TPNEIHGTYGKPTYD....AVDYHLGKYSPIFLSPYRT.NTQ.FP.............TAYMDVTYN.
Q9QU36_9VIRU/1-529...............................SQIYVSNKTPQEVVNYIVSHQTQKVKEYTGITPRTL...PLTVECRYN.
A7VM12_9VIRU/1-509...............................SVSYDNGWFNKNFLRAIELQSPTGTKLGQ..........LPLNYGRYN.
A7VLV6_9VIRU/1-508...............................SINYDTGWFNSQFLSSYKIEKTSTKQPYAH.........LPIGVARYN.
Q9JG50_9VIRU/1-535...............................QVRFFISSKNPTTIQDTDLNNPISNTTILDE........PVFQECRYN.
A7VLW4_9VIRU/1-507...............................SISYDDGWFGPLFLSAIKIGKIEQATAT...........HQIIQARYN.
A7VM04_9VIRU/1-513...............................SVNYNTGFFSKQMLEAVQLTTDQTGQRPLGM........NPVNICRYN.
A7VLY4_9VIRU/1-498...............................SVSYTTGWFNPKLMQLTEYVTPQQLA.............KPVLAFRYN.
CAPSD_TTVD1/1-324..............................................................................N.
Q91CZ6_9VIRU/1-596WETVQSVATSNFNAQHVPITSTMPTKD....YWEYRIGMFSPTFLSPYRTSPIENWP.............MAYRDISYN.
A7VM08_9VIRU/1-506...............................WLTYEGGWFQPKILQAYKVTLNGADKAL...........LPLVPIRYN.
CAPSD_TTVV3/1-573KAT...........ELAIPEAVKPTTD....LFEYHAGIYSSIFLSPGRA.YFE.TP.............GAYQDIIYN.
Q91D00_9VIRU/1-593QLT.....QLTATVPHIGPTYSNTTTP....EYEYHAGWYSPVFIGPNRH.NIQ.FR.............TAYMDVTYN.
Q99AR5_9VIRU/1-604YET....DNPVSKKIWPQPTTTKPTID....YYEYHAGWFSNIFIGPNRH.SLQ.FQ.............TAYVDTTYN.
Q9DTD2_9VIRU/1-559KAT..........SLALSNSWVKPTTN....DLEYHTGMYSSIFLSSGRS.NPE.LK.............GPYTDVCYN.
Q91D04_9VIRU/1-591QET........DKENLVTGSYQTPTNK....SVSYHLGKYSPIFLSSYRT.NLQ.FI.............TAYTDVTYN.
CAPSD_TTVV8/1-571TTI........KTHLQPNNSAINPNTQW...HLEYHAGIYSAPFLSAGRL.NPE.IK.............GLYTDITYN.
Q5ENX0_9VIRU/1-603LSI....GKNDVFGDHTSQYRGATQ......LLEYHLGIYSPIFLHPGRS.NIQ.MW.............TAYRDIVYN.
O90364_9VIRU/1-590KAT...........KTLLGNTFTTEDC....TLEYHGGLYSSIWLSPGRS.YFE.TP.............GAYTDIKYN.
Q9IFV0_9VIRU/1-583RRK..............RDTYLGSK......YLNYRTGLYSSIFLANERT.SPD.FP.............GLYQEVVYN.
Q9QUE7_9VIRU/1-586NQT...........KKLLSTTFTGGSE....YLEYHGGLYSSIWLSAGRS.YFE.TK.............GAYTDICYN.
A8DMR2_9VIRU/1-531...............................NLNKLQTANPTEKIQNLNCTLLPPEK.............TVLTICRYN.
Q9DUH8_9VIRU/1-609LTT....GKNDVFGDSKAQYHNATH......LLDYKLGIYSPVFLHPGRS.NIQ.MW.............TAYRDIVYN.
A7VLW8_9VIRU/1-511...............................SINYNTGYFSTKVLNAFKVMVNSKESKP...........LPLGVARYN.
Q99AQ3_9VIRU/1-582WET.......QHTGVAVPPTWTTPTTD....RYEYHVGMFSPIFLTPYRSAGLD.FP.............YAYADVTYN.

PF02248

Q66170_CPMVS/720-899------------------------------ISQPGSAMLNFS--------------------------------------
Q9YWJ9_9SECO/828-1009------------------------------ITKPRGGDIEFD--------------------------------------
POL2_CPMVS/837-1016------------------------------ISQPGSAMLNFS--------------------------------------
POL2_BPMV/821-1004------------------------------KSEPHSWELIFP--------------------------------------
POL2_CPSMV/808-988------------------------------VSTPHAWEKEFS--------------------------------------
POL2_RCMV/786-964------------------------------ISKPGAAILEFS--------------------------------------
Q66179_APMV/2-185------------------------------TAEPHADEINFE--------------------------------------
POL2_APMV/802-985------------------------------TAEPHADEINFE--------------------------------------
POL2_SQMVM/622-803------------------------------ITKPRGGDIEFD--------------------------------------
Q9YWK0_9SECO/739-920------------------------------ITKPRGGDIEFD--------------------------------------

PF03688

A5H0K4_GFLV/264-422------------------------------.FALQRLEGTTE--------------------------------------
POL2_BRSV/1176-1338------------------------------CYNSLSNTHSVP--------------------------------------
Q86631_9SECO/418-544------------------------------............--------------------------------------
POL2_ARMV/344-502------------------------------.CALQNMGCETE--------------------------------------
Q88483_9SECO/1172-1336------------------------------NFCYPATSFSLP--------------------------------------
A2ID55_9SECO/610-780------------------------------AAAPFTKDVVIP--------------------------------------
Q80JS8_BRAV/347-511------------------------------VNLSLVGSISRY--------------------------------------
A0A9J6_ARMV/960-1118------------------------------.CAIQDMGCLTE--------------------------------------
CAPSD_TRSV/351-511------------------------------.YDLRRTEAEIP--------------------------------------
POL2_GCMV/1150-1316------------------------------LGGPLSSSLAVP--------------------------------------
Q6XPY1_9SECO/164-322------------------------------MCGVLATSQVIP--------------------------------------
Q6XFY6_9SECO/157-316------------------------------.IALQELSHTTS--------------------------------------
Q9IV56_9SECO/980-1138------------------------------.VPMAKGSFKCL--------------------------------------
Q65624_9SECO/386-551------------------------------VPVSQVFEKEVE--------------------------------------
POL2_CNSV/1022-1185------------------------------NLSIYEGRATVP--------------------------------------
Q64959_9SECO/338-502------------------------------GILVYDNAYSIP--------------------------------------
Q20LA0_9SECO/942-1102------------------------------RGLIDLEGFYCE--------------------------------------
A3FEN2_9SECO/348-507------------------------------QPLVGACEARIP--------------------------------------
Q9ELS0_9SECO/148-312------------------------------TNVYIPGSCSFV--------------------------------------
Q9QAH0_9SECO/350-510------------------------------CGIIDQDGFTVD--------------------------------------
Q24M89_9SECO/943-1103------------------------------RGLIDPDGFKCE--------------------------------------

PF08462

Q5ZF43_CARMV/250-348------------------------------GDVDYESARPIA--------------------------------------
Q999Y9_CARMV/250-348------------------------------GDVDYESARPIA--------------------------------------
Q4JGW6_CARMV/250-348------------------------------GDVDYESARPIA--------------------------------------
Q8JJU7_CARMV/250-348------------------------------GDVDYESARPIA--------------------------------------
CAPSD_CARMS/250-348------------------------------GDVDYESARPIA--------------------------------------
Q999Z1_CARMV/250-348------------------------------GNVDYESARPIA--------------------------------------
CAPSD_CARMV/250-348------------------------------GDVDYESARPIA--------------------------------------
Q7TG55_CARMV/250-348------------------------------GDVDYESARPIA--------------------------------------

PF00073

Q9WMA0_9PICO/49-215------------------------------CNINNVVRIKVP--------------------------------------
POLG_AEVCA/45-212------------------------------CNINNVVRMKVP--------------------------------------
POLG_CXA9/93-300------------------------------LRTNNSATIVMP--------------------------------------
POLG_CXB3N/93-302------------------------------LRTNNSATIVMP--------------------------------------
POLG_CXB4J/93-300------------------------------LRTNNSATIVMP--------------------------------------
POLG_CXA21/93-308------------------------------LRTNNSATIVVP--------------------------------------
POLG_POL1M/93-308------------------------------LRTNNCATLVLP--------------------------------------
POLG_POL3L/93-307------------------------------LRTNNSATIVLP--------------------------------------
POLG_HE701/93-288------------------------------LRTNNSATIVLP--------------------------------------
POLG_BOVEV/93-285------------------------------LRTNNSATLILP--------------------------------------
POLG_HRV14/93-299------------------------------LRTNNTATIVIP--------------------------------------
POLG_HRV2/93-302------------------------------LRSNNSATIIAP--------------------------------------
POLG_HRV8A/93-302------------------------------LRTNNSATLILP--------------------------------------
POLG_HRV1B/93-301------------------------------LRSNNSATLIVP--------------------------------------
POLG_FMDV1/311-475------------------------------PRTNMTAHITVP--------------------------------------
POLG_FMDVT/311-475------------------------------PRTNMTAHITVP--------------------------------------
POLG_FMDVO/311-475------------------------------PRTNMTAHITVP--------------------------------------
POLG_EMCV/161-359------------------------------LRTNTTVDLEVP--------------------------------------
POLG_TMEVB/172-382------------------------------LRTNTTVDLEVP--------------------------------------
POLG_ENMGO/162-361------------------------------LRTNTTVDLEVP--------------------------------------
POLG_FMDVO/533-691------------------------------TGLNSKFTFSIP--------------------------------------
POLG_FMDV1/533-692------------------------------TGLNSKFTFSIP--------------------------------------
POLG_EMCV/420-582------------------------------LGLNSSYSFTVP--------------------------------------
POLG_TMEVB/443-606------------------------------LGLNSSFNFTAP--------------------------------------
POLG_HE701/347-515------------------------------FGLQSSITIIIP--------------------------------------
POLG_HRV2/358-522------------------------------VGLQSTISMVVP--------------------------------------
POLG_HRV8A/364-529------------------------------VGLQSTASLVVP--------------------------------------
POLG_HRV1B/360-525------------------------------VGLQSTISLVVP--------------------------------------
POLG_BOVEV/345-515------------------------------FGLQSSITLVIP--------------------------------------
POLG_CXA21/369-534------------------------------LGLQSSCSMVAP--------------------------------------
POLG_CXA9/358-524------------------------------IGLQSSCVLCVP--------------------------------------
POLG_CXB4J/358-524------------------------------VGLQSSCVLCVP--------------------------------------
POLG_CXB3N/360-526------------------------------VGLQSSCVLCIP--------------------------------------
POLG_CXB1J/360-526------------------------------VGLQSSCVLCVP--------------------------------------
POLG_FMDVO/725-872------------------------------...APLTRLALP--------------------------------------
POLG_FMDV1/726-878------------------------------...APFTRLALP--------------------------------------
POLG_BOVEV/610-775------------------------------TD.GPPAQFSVP--------------------------------------
POLG_HRV8A/621-792------------------------------EG.QPYPRFTIP--------------------------------------
POLG_HRV2/614-772------------------------------HG.QAYPRFSLP--------------------------------------
POLG_HRV1B/627-786------------------------------HG.QPFPRFSLP--------------------------------------
POLG_HE701/609-781------------------------------IN.DPPARLTIP--------------------------------------
POLG_HRV14/614-787------------------------------VG..DTSRFSVP--------------------------------------
POLG_CXA9/612-783------------------------------EG.NAPARMSIP--------------------------------------
POLG_CXB4J/612-783------------------------------EG.NAPPRMSIP--------------------------------------
POLG_SVDVU/612-782------------------------------EG.SAPPRMSIP--------------------------------------
POLG_CXB3N/630-782------------------------------EG.NAPPRMSIP--------------------------------------
POLG_POL1M/636-806------------------------------YG.TAPARISVP--------------------------------------
POLG_CXA21/642-812------------------------------YG.NAPPRMSIP--------------------------------------
POLG_CXA24/646-809------------------------------YG.SAPPRISIP--------------------------------------

PF00915

CAPSD_VESVA/137-421------------------------------HGSIPS..DLIP--------------------------------------
POLG_RHDVF/1768-2065------------------------------DSISPAGLLTTP--------------------------------------
CAPSD_FCVUR/112-395------------------------------HGSVPS..DLIP--------------------------------------
CAPSD_NVN68/2-294------------------------------QKTRP...FTLP--------------------------------------

PF08762

Q8B107_ALPV/599-804------------------------------.GSIPVIGVQDL--------------------------------------
O56051_9VIRU/590-790------------------------------YNSTD....SDV--------------------------------------
Q56QP7_9VIRU/684-855------------------------------.........GEV--------------------------------------
O36967_9VIRU/668-900------------------------------RGTESPITINSV--------------------------------------
Q5UBY1_9VIRU/79-259------------------------------D...........--------------------------------------
Q6ITS9_9VIRU/106-313------------------------------FRANS....ETF--------------------------------------
Q4JFT2_9VIRU/834-1009------------------------------IDSKSFPQLSDL--------------------------------------

PF00729

CAPSD_PNLV/47-266------------------------------TGAVPSGAVVLSLDCASMSKPWY---------------------------
CAPSD_MCMVK/23-222------------------------------QN.........RTVFRCIQAGQF---------------------------
CAPSD_PMVK/39-236------------------------------GN.........PPELRNIDATAF---------------------------
CAPSD_RCNMV/24-213------------------------------...........SLTIPADNQWRF---------------------------
CAPSD_CARMS/51-245------------------------------...........DLVIPVDGKTRF---------------------------
CAPSD_SBMVA/46-262------------------------------RCLDTANAITTTLDVGQLGKKWY---------------------------
CAPSD_TBSVC/76-269------------------------------...........MLRVPTDKIKRF---------------------------
CAPSD_POLVP/66-257------------------------------...........TLNVPVDNVKRF---------------------------
CAPSD_OCSVU/111-308------------------------------...........TVEIKCDNAYRF---------------------------
CAPSD_TNVA/61-272------------------------------QGAGSAIAV..QLDVTKLDKPWY---------------------------

PF11729

CAPSD_SJNNV/1-340------------------------------EDTTAPITTQAPLHNDSINNGYT---------------------------

PF00894

CAPSD_PLRV1/70-207------------------------------RMINGV-----EWHDSSEDQCRI---------------------------
CAPSD_PEMVW/53-187------------------------------EILGDQ-----PWYESNKDQFFF---------------------------
CAPSD_BYDVP/62-199------------------------------EAINGK-----EFQESTIDQFWM---------------------------

PF03014

CAPSD_HEVCH/41-659ALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKDLYFTSTNGVGEIGRGIALTLFNLADTLLGG

PF03115

CAPSD_HASV1/1-416ASEWCFTGYAANPNLVNLVKSTDNQVSVTFEGSAGS-----PLIMNVPEGSHF---------------------------

PF00983

COAT_TYMV/8-177--------------------------------IGGAINTLSPLIVKCPLEM-----------------------------

PF02247

POL2_SQMVM/246-618------------------------------EIQGRT.TITFTQSEFLTAWSTQ---------------------------
POL2_CPMVS/460-832------------------------------EVEEKC.TLVFSQQEFVTAWSTQ---------------------------
POL2_BPMV/447-819------------------------------EIQEKV.VLKFSQEEFLTAWSTQ---------------------------
Q9Z006_9SECO/476-846------------------------------SGSKSTRSVRFPKEVFGVYQALD---------------------------
O12663_9SECO/321-691------------------------------AGSKSTRSVRFPKEIFGVYQALD---------------------------
Q9YWK0_9SECO/363-735------------------------------EIQGRT.TITFTQGEFLTAWSTQ---------------------------
POL2_CPSMV/437-806------------------------------DKQDRT.TISFSKDEFLMAWSTQ---------------------------
POL2_RCMV/407-778------------------------------EVQERV.EITFTRKEFLTAWSTQ---------------------------
Q9YWJ9_9SECO/452-824------------------------------EIQGRT.TITFTQSEFLTAWSTQ---------------------------
Q66170_CPMVS/343-715------------------------------EVEEKC.TLVFSQQEFVTAWSTQ---------------------------

PF03391

CAPSD_TRSV/179-344------------------------------DGQFEI-AIKTR---------LH---------------------------
POL2_RRVS/768-936------------------------------NEIFEV-DLYCP---------YG---------------------------
POL2_BRAV/1268-1433------------------------------EGKFHI-KVQTP---------YG---------------------------
Q65029_ARMV/745-916------------------------------DGSFAI-EIRSP---------YH---------------------------
POL2_ARMVS/792-963------------------------------DGSFAI-EIRSP---------YH---------------------------
Q67703_GFLV/166-336------------------------------DGSSEV-KIRSP---------YH---------------------------
POL2_GFLV/771-941------------------------------DGSFEV-KIRSP---------YH---------------------------
POL2_BRSV/1007-1170------------------------------NVDASL-QIQSP---------FF---------------------------
POL2_GCMV/981-1144------------------------------DVVSSL-KIQSP---------FY---------------------------
POL2_TORVR/1497-1662------------------------------DGQGAF-SLPIS---------TP---------------------------
Q88483_9SECO/1003-1166------------------------------DAKATL-QIQSP---------FF---------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215----------SAMR--ADIGDMRKYAVL--------------VYSKDDALETDELV------------------------

PF01318

CAPSD_BMV/2-188----------DAFRG-ATLGDLLNLQIY--------------LYA-SEAVPAKAVV------------------------

PF03566

Q80IX5_PRVFL/54-754TFENNFSSAVVHFWG-ISQSATIVCKTYDGWEGTTNAGSTVGQFAHTGAEEEDEVVQLA---------------------
CAPSD_NCBVS/1-608TIDSNFAIGVAAMTG-MSTSTVPYFKVFRRFEAIPAEGSPWGPFASATPPKDDVALTVA---------------------
CAPSD_HASV/2-647SFDQNMSTAVAHFRS-LSHSCSIVTKTYQGWEGVTNVNTPFGQFAHAGLLKNEEILCLA---------------------

PF01829

CAPSD_NODAM/42-399TPTGAVNTAVLKVWACVEYRPNPNSTLY--------------EFARESPANDEYALAAY---------------------

PF08435

Q91H09_9CALI/305-535-----SEVALLRFVNPDTGRALFESKLH-----------------------KQGFMTI.---------------------
Q8JMP1_9CALI/305-540-----ADVALIRYVNPDTGRTLFEAKLH-----------------------RSGFITV.---------------------
Q8B4Z2_9CALI/297-515-----SDVALLNYVNPNTGRVLFEAKLY-----------------------ANGFLTV.---------------------
Q917X1_9CALI/305-538-----GDVALVRYVNPDTGRVLFEAKLH-----------------------KGGFLTV.---------------------
Q9IV43_9CALI/304-537-----GEAALVHYVDPDTNRNLGEFKLY-----------------------PEGFITC.---------------------
Q8VA02_9CALI/306-539-----GEAALLHYLDPDTHRNLGEFKLY-----------------------PDGFMTCV---------------------
Q9IV49_9CALI/306-538-----SEVALIRFINPDTGRVLFEAKLH-----------------------KQGFITV.---------------------
Q6EAX3_9CALI/306-538-----SDVALIRYVNPDTGRTLFEAKLH-----------------------RTGYITV.---------------------
Q8BAC6_9CALI/304-534-----SDIALVRFINPDTGRVLLEAKLH-----------------------KQGFLTV.---------------------
Q6WQW7_9CALI/296-512-----SDVALLNYINPDTGRVLFEAKLY-----------------------SSGFLTV.---------------------
Q6B7R3_9CALI/303-535-----SDVALVRYVNPDTGRTIFEAKLH-----------------------RQGFITI.---------------------
Q6EAW7_9CALI/305-538-----SSVALLRYVNPDTGRTLFEAKLH-----------------------KEGFITV.---------------------
Q66418_9CALI/306-538-----GEAALLHYVDPDTHRNLGEFKMY-----------------------PEGFMTCV---------------------
Q80FL2_9CALI/317-546-----TQVALVRYVNXDTGRVLFEAKLH-----------------------KLGFMXI.---------------------
Q9IV42_9CALI/305-535-----GEAALLHYVDPDTGRNLGEFKLY-----------------------PDGFMTCV---------------------
Q6XDL5_9CALI/307-546-----SDVALVRYVNPETGRTLFEAKLH-----------------------RNGFLTV.---------------------
Q6B7R2_9CALI/304-538-----GDAALLHYVDPDTHRNLGEFKLY-----------------------PEGYITCV---------------------
Q917X4_9CALI/305-533-----TDVALIRYTNPDTGRVLFEAKLH-----------------------RQGFITV.---------------------
Q783W9_9CALI/306-535-----TDVALIRFVNPDTGRVLFEGKLH-----------------------KQGFITI.---------------------
Q80J94_9CALI/309-538-----SEALLLRYRNTLTGQLLFECKLY-----------------------NEGYIAL.---------------------
Q913B6_9CALI/305-540-----SEVALVRYINPDTGRALFEAKLH-----------------------RAGFMTV.---------------------
Q8JW44_9CALI/304-539-----GDAALLHYVDPDTNRNLGEFKLY-----------------------PGGYLTCV---------------------
Q83876_9CALI/301-524-----GEGPLLHYVDPDTDRNLGEFKAY-----------------------PDGFLTCV---------------------
Q9IV48_9CALI/306-533-----GEAALLHYVDPDTHRNLGEFKLY-----------------------PDGFITC.---------------------
Q8V713_9CALI/316-545-----SDVALVRYVNPTTGRVLFEAKLH-----------------------KQGFLTV.---------------------
Q91I85_9CALI/304-538-----GEAALLHYVDPDTNRNLGEFKLY-----------------------PGGYLTCV---------------------
Q8JXJ0_9CALI/304-537-----GEAALLHYVDPDTNRNLGEFKLY-----------------------PEGFITC.---------------------
Q783X1_9CALI/315-545-----SAVALIRYVNPDTGRNIFEAKLH-----------------------REGFITV.---------------------
Q783Y0_9CALI/305-533-----SDVALIRFTNPDTGRVLFEAKLH-----------------------RSGYITV.---------------------

PF02226

POLG_HRV8A/2-69---------------------------------------------------KDVLEKGI---------------------
POLG_POL1M/2-69---------------------------------------------------KDVLIKTA---------------------

PF11492

Q7T7T5_HARNA/2003-2059-------------------------KLF-------------------------GY-------------------------
POLS_CRPVC/291-340-------------------------KLF-------------------------GF-------------------------
Q2HWK2_RSET1/357-413-------------------------SLF-------------------------GY-------------------------
POLS_ABPVR/340-396-------------------------AIF-------------------------GW-------------------------

PF08935

Q9WJ28_PTV1F/119-191-----------------------IGPLL----------------------------------------------------
Q9DLK1_FMDVP/202-285-----------------------FGALL----------------------------------------------------

PF01766

POLS_IBDVU/9-452YPGALRPVTLVAYERVATGSVVTVAGVS----------------NFELIPNPELAKNLV---------------------
POLS_DXV96/2-442TIGVNSPTVGVGYQGVAEGTAITISGIN----------------NYELVPNPDLQKNLP---------------------
POLS_BSNV/7-428MPGTLRPVTIIAYESVATGSVLTLSGIS----------------NYELIPNPELAKNIQ---------------------
POLS_IPNVJ/5-453VPGVLRPITLVAYEKMTPQSILTVAGVS----------------NYELIPNPDLLKNMV---------------------

PF02443

Q5Y4T0_PCV2/5-226TIDYFQPN.NKRN--------------------------QLWLRL-----------------------------------
Q27W03_PCV1/5-227TIDWFHPN.NKRN--------------------------QLWLHL-----------------------------------
A3FEQ4_9CIRC/3-256TIQGAGQG.STYS--------------------------TFFLGG-----------------------------------
Q3HUU1_GOCV/5-247TIQQGGTGTNIWS--------------------------TWYTPG-----------------------------------
Q1L2D2_9CIRC/1-237VITDLSTA.NETA--------------------------ALWLNS-----------------------------------
CAPSD_CACV/7-243SVTDTDAA.NVTA--------------------------ALWLNN-----------------------------------
Q0H9S8_9CIRC/4-236SITDTDAG.NVTA--------------------------ALWLTN-----------------------------------
Q06J73_9CIRC/8-245SVTDTDTA.NTTA--------------------------ALWLNN-----------------------------------
Q9DXG3_BFDV/11-242TIEDLTTA.NQSA--------------------------ALWLNS-----------------------------------
Q69EZ5_BFDV/7-239TLTDLTTA.NQSA--------------------------ALWLNS-----------------------------------
Q9DXG0_BFDV/11-242MMNDLSTA.NQSA--------------------------ALWLNS-----------------------------------
Q9DXF4_BFDV/3-235TINDLTTV.NQSA--------------------------ALWLNS-----------------------------------

PF02956

A7VLZ2_9VIRU/1-506PTLDTGENTAVWL.TNVVNQSYYP...PKTDLDLFVQGLPLWQLLLG..FPDWVRQKK.KDPTFLQSYYLCFHCDAIEP.
Q9WT88_9VIRU/1-603PLMDKGKGNKIWF.QYLSKKGTDY...NEKQCYCTLEDMPLWAICFG..YTDYVETQLGPNVDHETAGLIIMICPYTQPP
Q91CY9_9VIRU/1-581PNTDKGKGNKIWI.QSCTKESTIL....DNACRCVIEDMPLWAMVNG..YLEFCDSEL.PGANIYNTYIVVVICPYTKPQ
A7VLY0_9VIRU/1-515PEEDTGQGNVVWLTSTLSNTHWER...PQL.SDLVIVGKPLWLSFYG..FESFIQKTK.HDKGWLLSGFYVCKCPYLKTL
Q9JGT1_9VIRU/1-585PFSDRGEGNMLWI.DWLTKEDSQY...SKTQSKCLIENLPLWAAIYG..FKEYCSKVT.GDTNIEHNCKCVIRSPYTIPQ
Q80QT8_9VIRU/1-595PIVDKGQGNKVWF.QYLTKETTEF...KAEQAKCVIENLPLYCAFFG..YEDYLQRTLGPYQDVETVGIVCFICPYTEPA
CAPSD_TTVB1/1-533PFKDKGTGNKVYL.VPTDSGLGSF.LTLPTKSELIITDLPLWLITWG..WIEWLKKSR.PVAHIEEEYQVVIQSKYIHP.
A7VM00_9VIRU/1-509PYTDTGRGNKMWV.NSVLVGAWQE...PKD.TDLVMEGYPLWAMLYG..YTSLLKQVK.SKTVPFAGSMIVVKSPALYRV
Q9JG61_9VIRU/1-534PFKDKGTGNIFYL.KSTKTQQGSF.LSLPTDNRILLKDFPIWLATWG..WISWLLKSK.PVHYLEEDYHLVIQSPYIYP.
Q91PS3_9VIRU/1-581PANDKGVGNKIWM.DWCTKNDSQW...TDRQSVVPIVDIPLWAAVMG..YSDYCRKYY.QGTNVLKEARLTVICPYTEPP
CAPSD_TTVV4/1-560PLLGQGEGNMIWL.EWCPKKTKQY...NERQCYNLIQHVPLWAAIHG..YMDFCKKTF.KDNNLDKNTRVVLICPYTRPQ
Q91C93_9VIRU/1-546PFRDDNR.NEVYLLKITEQNSYDY..HEPPKPELIAKDLPLWACLWG..YIDYQKKAA.TYTEIDTTCICVILSHSLDPT
Q2F827_9VIRU/1-589PLTDRGIGNRIWY.QYSTKENTTF...NETQCKCVLSDLPLWSMFYG..YVDFIESELGISAEIHNFGIVCVQCPYTFPP
Q91CY5_9VIRU/1-584PNCDRGIGNKIWF.QYSTKMTTDF...EQKQCKCVLENIPLWSAFHG..YPDFIEQELSISAEIHNFGLVCFICPYTFPP
Q8V7G9_9VIRU/1-572PLADKGIGNRIYM.QWCSESSSSF...EPTKSKCMLQDMPLYMLTYG..YLDYVVKCT.GVKSAWTDMRVAIRSPYTFPQ
Q99A78_9VIRU/1-584PFTDRGQGNMVWI.DWVSKYDSVY...SKTQSKCLIENLPLWASVYG..YAEYCSKST.GDTNIEQNCRVVIRSPFTNPQ
Q6H9C2_9VIRU/1-573PFTDKGTGNIIWI.DYLTKEDTIF...VKNKSKCEIMDMPLWAACTG..YTEFCAKYT.GDSAIIYNARIVIRCPYTEPM
CAPSD_TTVT1/1-433ADWDTGDGNAIMLPNTLSPT.......TPASWLLLEWDAPYWLWFWGKTYQDFVSSHT.PEGNPYYGQIYVKWWPITNPY
Q9JG80_9VIRU/1-589PLMDKGVGNHIWF.QYNTKADTQLIVSAPSPCKAHIEDIPLWAAFYG..YSDFIESELGPFVDAETVGLVCVICPYTKPP
A7VLZ6_9VIRU/1-506PMQDSSQGNAIYL.VSTLTNTWDQ...PPKDSSILIQGMPIWLGLFG..YLDYVRQVK.KDKTWLESHVLVLKSPAIFTF
Q6H9D2_9VIRU/1-557PTTDEGIGNIVWI.DWCTKADCNF...NETQSKGVIKDIPLWAALFG..YVDFLKKTF.KDDQLDKTARLTLISPYTKPQ
Q6H999_9VIRU/1-471PYTDKGTGNKVWM.DPLTKENNIY...KEGQSKCLLTDMPLWTLLFG..YTDWCKKDT.NNWDLPLNYRLVLICPYTFPK
Q77JT5_9VIRU/1-606PLTDKGVGNMIWI.DWLTKGDTVY...DPKKSKCLLSDFPLWSLCYG..YPDYCRKQT.GDSGIYYDYRVLIRCPYTYPQ
Q91PS7_9VIRU/1-585PANDKGIGNKIWM.DWCTKNDSTW...RDTPQKLPVVDIPLWAALLG..YSDYCTKYF.NDKGLIKEARLTIICPYTQPP
CAPSD_TTVV9/1-555PLLDQGIGNVVWT.EPLTKKTCDY....ASQAYNVIKDAPLYLALFG..YIDICSKLA.KDKSFYLSNRVCVKCPYTVPQ
Q9JG47_9VIRU/1-553PWADKGKGNMVYL.LPINEHQHSYGWAPPTNKDIITQDLPLNILLWG..YLDFHRKAK.TYNDIDTTCLLVIKSPYLYPK
A7VLW0_9VIRU/1-507PADDDGQGNKLWV.VNTLTYNWKI...PTD.DDLILEGYPLWLMLYG..YTSFLYQVK.ADKNPFSSSLIVVKSSALQRV
Q0ZLH9_9VIRU/1-573PFNDRGVGNKVWV.QWCTNEDTIF...KDLPGRVPVVDLPLWCALMG..YSDYCKKYF.HDDGFLKEARITIISPYTNPP
Q5ENW7_9VIRU/1-501PFVQRWKGSRFAV.IDARKADQEN............PKVSTWPIEGTWNTQDTVLKDV......................
A7VLX2_9VIRU/1-509PNEDTGEGNEVWL.TSIQKGHFDK...PSKTPDFLLIGLPLWMAFYG..FWNYLEYTT.KAKDIFKTHMFVVKCPAIKRL
Q80AR5_9VIRU/1-594PINDKGHLNRVWF.QYSTKPTTDF...VEKQAKCLLQNLPLWSMLFG..YSEYVESQLGPFQDHGTVGLVIVQCPYTVPP
Q91CZ2_9VIRU/1-601PLMDKGVGNMMWY.QYNTKPDTQF...SPTSCRAVLEDKPIWSMAYG..YADFLLSILGEHDDVDFHGLVCIICPYTRPP
CAPSD_TTVG1/1-514PAIDDGKGNKIYL.QTIMNGHWGL...PQKTPDYIIEEVPLWLGFWG..YYNYLKQTR..TEAIFPLHMFVVQSKYIQTQ
Q98Y63_9VIRU/1-581PNVDKGKGNKIWL.QSVTKETSDF...DSRSCRCIIENLPMWAMVNG..YSDFAESEL..GSEVHAVYVCCIICPYTKPM
Q9QU36_9VIRU/1-529PFNDKSTGNNTFF.VSNHADQTKW..QPIDNPDTQTPNLPIWLTTWG..LMDWYKKAG.IISQPELNYMVVFECPYISSN
A7VM12_9VIRU/1-509PTRDKGIGNKIYI.ISTIADSWGP...PTTDKNVLIENLPLWLGLYG..YISYLETIK.PPD.WLKSSLIVLVSDAIYHS
A7VLV6_9VIRU/1-508PDQDTGQGNEVWL.ATIFKGHYDK...PTVTDDFVIRGLPLWMAFYG..YWSYLKYKT.KDKGVFTNHMFVVKCPAIKPM
Q9JG50_9VIRU/1-535PYKDKGYGNEAYFLSNVIAKKKAW..DPPDNKLLYNSGYPCWLLPWG..WLDWQLKLK.QINQIGINYNYIFKTDQILP.
A7VLW4_9VIRU/1-507PNIDSGVGNQIYC.ASTHAYSWAP...PSKDKQLLIEGMPLWLGLFG..YYSFVRSVK..SEDFMKAHVICIKSPALYCY
A7VM04_9VIRU/1-513PTLDSGKGNAIWL.VSSHANTYRE...PITDKTLIFEGLPLYMLLYG..YLSYVQKVK.NVRDFLNNYTLCMRSPALFPY
A7VLY4_9VIRU/1-498AQLDNGKGNSVWF.KSILTEDFSK...PKVDSDLIISDMPIWQALYG..FTDFIKAVK.PDPNFLASYILLIETRFVEPF
CAPSD_TTVD1/1-324DMINK.VPNMWWK.......................EAANDWLTEWG.................................
Q91CZ6_9VIRU/1-596PLNDKVVGNKLWL.QSIVKADTQF...HIPSCTYVLEDKPLWAACFG..YRDFIKSVK.EKQDPDFEYIVCVICPYTIPP
A7VM08_9VIRU/1-506PAADDGTGNLVTI.VDLVAGHWTG...NYT.EAYTIKNIPLWMALHG..YASYVQAKS.GDKGILTHSMIIVSSNAITRL
CAPSD_TTVV3/1-573PFTDKGIGNIVWI.DWLSKSDAVY...SEKQSKCGIFDLPLWAAFFG..YAEFCSKST.GDTAIAYNSRVCVRCPYTEPQ
Q91D00_9VIRU/1-593PLNDKGQFNRVWF.QYSTKPTTDF...NNTQCKCVLENIPLWSALFG..YSEYVESQLGPFQDHGTVGVVVVQCPYTVPP
Q99AR5_9VIRU/1-604PLNDKGKGNKIWF.QYHSKVNTDL...RDRGIYCLLEDMPLWSMTFG..YSDYVSTQLGPNVDHETQGLVCIICPYTEPP
Q9DTD2_9VIRU/1-559PLVDKGIGNIVWL.DWCSKEDSKF...DETKSKVPIRDMPLWAALFG..YAEYASKET.GDTAINTNARLTLICPYTDPM
Q91D04_9VIRU/1-591PLNDKGKGNQIWV.QYVTKPDTIF...NERQCKCHIVDIPLWAAFHG..YIDFIQSELGIQEEILNIAIIVVICPYTKPK
CAPSD_TTVV8/1-571PMMDKGTGNKIWC.DSLTKADMKY...TEGRSKYLIENLPLWAAVWG..YLDYCTKTS.GDAAFHYNYRVTLISPYTSPM
Q5ENX0_9VIRU/1-603PLLDKGEGNRIWF.QYHTKKDNRY...SVPNCHWMLENLPLWSLLHG..YSEYLESQV.KYGDLRKEGKVLITCPYTKPP
O90364_9VIRU/1-590PFTDRGEGNMLWI.DWLSKKNMNY...DKVQSKCLVSDLPLWASAYG..YVEFCAKST.GDQNIHMNARLLIRSPFTDPQ
Q9IFV0_9VIRU/1-583PLVDEGEGNIVWI.DWCSKDDTTF...RDLPQRYAVKDIPLWAAFMG..YRDYVTKAL.HDPGLSKEVRVTIICPYTKPK
Q9QUE7_9VIRU/1-586PYTDRGEGNMVWI.DWLSKTDSRY...DKTRSKCLIEKLPLWAAVYG..YPEYCAKST.GDSNIDMNARVVIRCPYTVPQ
A8DMR2_9VIRU/1-531PQNDRSAHNALYA.SPVTTARTKW..GATTKPELNTEGLPLWLLSFG..FHDWLLKSE.KVQRLDLDYVYVILSDYITP.
Q9DUH8_9VIRU/1-609PFLDKGEGNKVWY.QYHTKTDNKY...DPTKCRYMVEDLPLWSLLHG..YADYIISQI.KYGDPLVEGKVLIRCPYTRPA
A7VLW8_9VIRU/1-511PVEDDGKGNEIWV.ASIHSNAYAK...PAE.DNLNFNGYPLWLAFWG..YWSYLQKIK..DKSFFALHYFVVKSPYIYTA
Q99AQ3_9VIRU/1-582PLTDKGVGNRMWY.QYNTKIDTQF...DAKCCKCVLEDMPLYAMAFG..HADFLEQEIGEYQDLEANGYVCVISPYTKPP

PF02248

Q66170_CPMVS/720-899-----------------------------FDIIGPNSGFEFAE--SPWANQTTWYLECV---------------------
Q9YWJ9_9SECO/828-1009-----------------------------LEIAGPNNGFEMAN--SSWAFQTTWYLEIA---------------------
POL2_CPMVS/837-1016-----------------------------FDIIGPNSGFEFAE--SPWANQTTWYLECV---------------------
POL2_BPMV/821-1004-----------------------------IEVCGPNNGFEMWS--SEWANQTSWHLSFL---------------------
POL2_CPSMV/808-988-----------------------------IDICGPNRGFEMWR--SSWSNQTTWILEFT---------------------
POL2_RCMV/786-964-----------------------------FDVEGPNNGFEMWE--ANWASQTSWFLEFL---------------------
Q66179_APMV/2-185-----------------------------IEICGPNNGFEMWN--ADFGNQLSWMANVV---------------------
POL2_APMV/802-985-----------------------------IEICGPNNGFEMWN--ADFGNQLSWMANVV---------------------
POL2_SQMVM/622-803-----------------------------LEIAGPNNGFEMAN--SSWAFQTTWYLEIA---------------------
Q9YWK0_9SECO/739-920-----------------------------LEIAGPNNGFEMAN--SSWAFQTTWYLEIA---------------------

PF03688

A5H0K4_GFLV/264-422-----------------------------LL-IGNFAGANPNS..HFSLYSR..WMAIK---------------------
POL2_BRSV/1176-1338-----------------------------FQ-FGSFAGPITSG..GKADEAEN.WIEIQ---------------------
Q86631_9SECO/418-544-----------------------------..-.......................TKLR---------------------
POL2_ARMV/344-502-----------------------------LY-IGNYAGANPNT..ALSLYSR..WLAIK---------------------
Q88483_9SECO/1172-1336-----------------------------FQ-FGSFAGPISCG..GAPMAAEN.WIELI---------------------
A2ID55_9SECO/610-780-----------------------------LT-VGDHSGVASMV..ARNSEEQ..YVEMV---------------------
Q80JS8_BRAV/347-511-----------------------------LN-VGDFTGYAQSG..GQVGYDEI.FLEFS---------------------
A0A9J6_ARMV/960-1118-----------------------------LF-VGNFAGPNPNT..ALDAYSR..WLAIK---------------------
CAPSD_TRSV/351-511-----------------------------IF-LGSYAGATPSG..ALGKQN...YVRIS---------------------
POL2_GCMV/1150-1316-----------------------------FE-FGSFAGPVTSG..GTPFTSEN.WLRVE---------------------
Q6XPY1_9SECO/164-322-----------------------------FE-IGSFAGPVTSG..GTPFESEN.WIRVW---------------------
Q6XFY6_9SECO/157-316-----------------------------MY-IGNFAGVNPNT..ALSLYSR..WFAIK---------------------
Q9IV56_9SECO/980-1138-----------------------------LN-CKTSARGTTSA..DPSLLTA..WMMIK---------------------
Q65624_9SECO/386-551-----------------------------MD-LTDYPGFNTSG..GIGADHDQPYIDIA---------------------
POL2_CNSV/1022-1185-----------------------------LE-LGTFAGPTPLK..KLDFKYRN.WIRFT---------------------
Q64959_9SECO/338-502-----------------------------FE-FGSFAGPVISG..GTPNEAEN.WVRVQ---------------------
Q20LA0_9SECO/942-1102-----------------------------LR-CGDFFGATNVN..VAGDVE...GLAIH---------------------
A3FEN2_9SECO/348-507-----------------------------VE-FKTYTGYTTSG..PPGSMEP..YIYVR---------------------
Q9ELS0_9SECO/148-312-----------------------------LD-VGDYTGCNKPGNMPASLTNETQHINIW---------------------
Q9QAH0_9SECO/350-510-----------------------------IA-CGDFFGATRVG..LPGEVE...RLGIY---------------------
Q24M89_9SECO/943-1103-----------------------------LR-CGDFFGATNIA..MVGDVE...RLAIH---------------------

PF08462

Q5ZF43_CARMV/250-348-----------------------------ICELVTQMEGQILKITKTTAEQPLQWVVYR---------------------
Q999Y9_CARMV/250-348-----------------------------ICVLVTQMEGQILKITKTSAGQPLQWVVYR---------------------
Q4JGW6_CARMV/250-348-----------------------------ICELVTQMEGQILKITKTAAEQPLQWVVYR---------------------
Q8JJU7_CARMV/250-348-----------------------------ICELVTQMEGQILKIAKTSAEQPLQVVVYR---------------------
CAPSD_CARMS/250-348-----------------------------ICELVTQMEGQMLKITKTSAEQPLKVVVYR---------------------
Q999Z1_CARMV/250-348-----------------------------ICELVTQMEGQMLHITKTSAEQPLQWVVYR---------------------
CAPSD_CARMV/250-348-----------------------------VCELVTQMEGQILKITKTSAEQPLQWVVYR---------------------
Q7TG55_CARMV/250-348-----------------------------ICELVTQMEGQILNITKTSAEQPLQWVVYR---------------------

PF00073

Q9WMA0_9PICO/49-215-----------------------------FIYTRGAYH------------------FKD---------------------
POLG_AEVCA/45-212-----------------------------YIYSRGCYN------------------LRN---------------------
POLG_CXA9/93-300-----------------------------YINSVPMDN------------------MFR---------------------
POLG_CXB3N/93-302-----------------------------YTNSVPMDN------------------MFR---------------------
POLG_CXB4J/93-300-----------------------------YINSVPMDN------------------MFR---------------------
POLG_CXA21/93-308-----------------------------YVNSLVIDC------------------MAK---------------------
POLG_POL1M/93-308-----------------------------YVNSLSIDS------------------MVK---------------------
POLG_POL3L/93-307-----------------------------YVNALAIDS------------------MVK---------------------
POLG_HE701/93-288-----------------------------WMNSAPMDF------------------ALR---------------------
POLG_BOVEV/93-285-----------------------------YVNAIPMDS------------------AIR---------------------
POLG_HRV14/93-299-----------------------------YINSVPIDS------------------MTR---------------------
POLG_HRV2/93-302-----------------------------YVNAVPMDS------------------MRS---------------------
POLG_HRV8A/93-302-----------------------------YVNAVPMDS------------------MLR---------------------
POLG_HRV1B/93-301-----------------------------YVNAVPMDS------------------MLR---------------------
POLG_FMDV1/311-475-----------------------------YLGVNRYDQ------------------YKK---------------------
POLG_FMDVT/311-475-----------------------------YVGVNRYDQ------------------YKQ---------------------
POLG_FMDVO/311-475-----------------------------FVGVNRYDQ------------------YKV---------------------
POLG_EMCV/161-359-----------------------------YVNIAPTSS------------------WTQ---------------------
POLG_TMEVB/172-382-----------------------------YVNVAPSSS------------------WTQ---------------------
POLG_ENMGO/162-361-----------------------------YVNIAPTSS------------------WTQ---------------------
POLG_FMDVO/533-691-----------------------------YLSAADYAY------------------TAS---------------------
POLG_FMDV1/533-692-----------------------------YVSAADYAY------------------TAS---------------------
POLG_EMCV/420-582-----------------------------FISPTHFRM------------------VGT---------------------
POLG_TMEVB/443-606-----------------------------FISPTHYRQ------------------TSY---------------------
POLG_HE701/347-515-----------------------------WISGSHYRM------------------FNT---------------------
POLG_HRV2/358-522-----------------------------WISASHYRN------------------TSP---------------------
POLG_HRV8A/364-529-----------------------------WVSASHFRF------------------TTP---------------------
POLG_HRV1B/360-525-----------------------------WVSASHFRL------------------TAN---------------------
POLG_BOVEV/345-515-----------------------------WISASHFRG------------------VSN---------------------
POLG_CXA21/369-534-----------------------------WISNTVYRR------------------CAR---------------------
POLG_CXA9/358-524-----------------------------WISQTHYRL------------------VQQ---------------------
POLG_CXB4J/358-524-----------------------------WISQTHYRY------------------VVD---------------------
POLG_CXB3N/360-526-----------------------------WISQTHYRF------------------VAS---------------------
<