Sequence alignment for CL0055

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754--------------------------------------------------------------------------------
CAPSD_NCBVS/1-608--------------------------------------------------------------------------------
CAPSD_HASV/2-647--------------------------------------------------------------------------------

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226-------------RR-----------------------------RYRRRRHRPRSHLGQILRR----------------R
Q27W03_PCV1/5-227-------------RR-----------------------------RYRRRRTRPRSHLGNILRR----------------R
A3FEQ4_9CIRC/3-256-------------RS-----------------------------TYRRAYRA.......RRRR----------------R
Q3HUU1_GOCV/5-247-------------RA-----------------------------RPRSLYYR.......RRRA----------------A
Q1L2D2_9CIRC/1-237-------------ML-----------------------------LSRRRWRRGLRP...RYRR----------------R
CAPSD_CACV/7-243-------------QV-----------------------------ARRRRPLAPRRR...RWRR----------------R
Q0H9S8_9CIRC/4-236-------------QV-----------------------------ARRRRQTQAIRR...RWRR----------------R
Q06J73_9CIRC/8-245-------------HF-----------------------------LIQRRMRHWRRRRHLRMRR----------------R
Q9DXG3_BFDV/11-242-------------TF-----------------------------QIRRRYARP......Y.RG----------------R
Q69EZ5_BFDV/7-239-------------IF-----------------------------QIRRRYARP......YVRR----------------R
Q9DXG0_BFDV/11-242-------------IF-----------------------------QIRR.IARP......RYRR----------------R
Q9DXF4_BFDV/3-235-------------HF-----------------------------QIRRRYARP......Y.RR----------------R

PF02956

A7VLZ2_9VIRU/1-506MPF.WWARR....KR..WWRGRR.....................RPFYRRRYHYKKRRP..RR......RLYKRKHR..R
Q9WT88_9VIRU/1-603MA..YWFRR.........WGWRPRR..RWRRWRRRR..RRLPRRRTRRAVRGLGRRRKPRVRR..RRRTRRRTY.....R
Q91CY9_9VIRU/1-581MAFRWWWWR....RR.PQRRWTRRR...WRRL.RTR........RPRRTVRRRRRRPRV...R..RRRWGRRRGRRRLYR
A7VLY0_9VIRU/1-515MPF.WWARR....KK..PWYSN......................WNRYRRRYKRRRWPR..RR..RRRIPYGRRR.....
Q9JGT1_9VIRU/1-585MAYRWWRRR....SR..RWRRRRWR..RWRRRRRP.........RRRRPARRCRRRRTV..RR..RRR.GR.WTRTY..R
Q80QT8_9VIRU/1-595MA..WWGRW....RR...WRWRPRR...WRRRRRRR....VPRRRAQRPVRRRRRRVR.......RRRWGRRRW.....R
CAPSD_TTVB1/1-533MPPFYYRRR.........WYSNPWR...................RKRLRFRRRRLRRPI..RKRFRR............R
A7VM00_9VIRU/1-509MAF.WWYRR....NK..PWFGR......................YKRRRTRRYKRTWRT..RR..RRP..IRRRRNR..R
Q9JG61_9VIRU/1-534MPPFNYYRR....R....YFYRPRR...................YRRRWFTTWRPRQTL..RRRFRR............R
Q91PS3_9VIRU/1-581MWWNWW..K....RR..RWR.PRRR.WRT.RR.RRRLPV.....WRRRRTTRYARRRRV..RRLRRRR.RRGWAR....R
CAPSD_TTVV4/1-560M...WWWRR....RF...WR.PKRR.WRWRRR.RRRPLA.....RRRRRPARLARRPRV...R..RRRFQWGRPR....R
Q91C93_9VIRU/1-546MPW..........RN...YYYRRRR...................RPRRFWRRRFRTPIY..RRFWRR............R
Q2F827_9VIRU/1-589MAWSWWWRR....RK..RWWPRRRR..RWRRF.RTR........RARRAVPRRRRRRRV...R..RRRWGRRRRRRRV.F
Q91CY5_9VIRU/1-584MAWRWWWQR....RR..RWWPRRRR..RWRRL.RRR........RPRRPVRRRRRRATV...R..RRRWRGRRGRRTYTR
Q8V7G9_9VIRU/1-572MAW..YRYR....RR..PWRRRRRPRWGLRRR............RFRRSFRGRGRRRYV..SRWSRRRYRRRRR.....R
Q99A78_9VIRU/1-584MAYGWWARR....RR..RWRRWKRR..PWRRRWRT.........RRRRPRRRYRRRRHV..RR..RRR.GR.WRRRY..R
Q6H9C2_9VIRU/1-573MAWGFWGRR....RRWRRWRARRRR...WRPR.RR.........RRRRPTRRFRARRRV..RR..RG..GR.WRRRY..R
CAPSD_TTVT1/1-433MRF....RY....RK...WR........................RPRRLFRSRRRRGYA..RRRWRRRAWGRRRRVR..R
Q9JG80_9VIRU/1-589MAWGWWRRW....RR...WPARRWRRRRRRRPVRRR........RAGRPARRYRRRRTV...RTRRRRWGRRRYRRGWRR
A7VLZ6_9VIRU/1-506MPF.WWRRR....RR..FWTNRR.....................FTYKRRKRYPRRYN...RR.......YGRRRNYR.R
Q6H9D2_9VIRU/1-557M...WWWRR....RR...WRAPWRR.RRW..R.RRRPRT.....RRFRRAARRPRRPRV...R..RPRRRRGWAR....R
Q6H999_9VIRU/1-471M...............................................................................
Q77JT5_9VIRU/1-606MAWRRWRWR....PW...WRRRRRR..RWRRR.RRRP.......RRRRPYRR.RRPRRV..RR..RR..GR.WRRAY..R
Q91PS7_9VIRU/1-585MWWNRW..K....RY..RWR.PLRR.WRT.YR.RRRPLR.....WRRRGAARRPRRRRV..RRW.RRR.RRAWGR....R
CAPSD_TTVV9/1-555MPWWPWRRW....RR...WR...RRRGNWRRRVAPR........RYRRTARRARRRRKAV.RR..RRRRRVRRRGYY..R
Q9JG47_9VIRU/1-553MPF.....Y....KRWRRWRWRR.....................RPRRLWRRRFRRPLY..RRFWRR............K
A7VLW0_9VIRU/1-507MAF.WWRRR....RK..PWFG...........................RWRRYRRRTNYKPRR..KRRRIYRRRRNY..R
Q0ZLH9_9VIRU/1-573MAWRWWWRR....RR..PW.....R.WRW.RR.RRRPARR....RRRRRPARRARRPRV..RRW.RRR..RVWAP....R
Q5ENW7_9VIRU/1-501MAP.....T....RR...WRR.......................RFGRRRRRYRKRRYGWRRRYYRYRPRDYRR.....R
A7VLX2_9VIRU/1-509MPF.WWARR....RK..PWYGRF.....................RRRYRYRPYKKR.....RR..RRR.RFTRRRNF..K
Q80AR5_9VIRU/1-594MAWGWWLKR.WRRRKKPAWKKWRTR..RWRRF.RRR........RPKRTYGRRRRRRTV......RRRRVRRLR.....R
Q91CZ2_9VIRU/1-601MAYSYWWRR....RR...WPW..RG..RWRRW.RRR..RRIPRRRPRRPVRRYRRR.PV..RR..KRRWGRRGRRRRYTR
CAPSD_TTVG1/1-514MPF.WWGRR....NK..FWYG.............................RNYRRKKRRFPKR..RKRRFYRRTKYR..R
Q98Y63_9VIRU/1-581MAWRWWWAR....RR.PNRRWTRRR...WRRL.RTR........RPRRPVRRRRRRPRV...R..RRRWGRRRGRRRFYR
Q9QU36_9VIRU/1-529MPYFY........RR...WFPRRR....................RFRRSWRRRIRGPFR..RKYWR.............R
A7VM12_9VIRU/1-509MPF.WWRRR....RK..PWYG.......................RFRYRRRFQTKRRRN..RR......RFTRRRNRRVT
A7VLV6_9VIRU/1-508MPF.WWARR....RR..PWFGRY......................KRYKTRRYRRRFRP..KR..HRY.PFRRRR.....
Q9JG50_9VIRU/1-535MPPYNYYRW....NNWRRPTYRRRR...................WRRRQYRRRRPRPFIR.RRFWR.............R
A7VLW4_9VIRU/1-507MPF.WWNRR....RK..NWWG........................YKYKTRKYRRRRWP..RR..RRQTLYRRRRPT..R
A7VM04_9VIRU/1-513MPF.YWRRR....RK..FWWGKA.....................RPRWRFQRYRRKTT...RR..RRRRPARKRAH...R
A7VLY4_9VIRU/1-498MPF.WWNRR....KR..WWRGAR.....................RPWYKRKRYTRRYR...RR......IYKNRRRR..P
CAPSD_TTVD1/1-324MAY....FR....RN..FYGGRRHY...................YRRRNAYTRRRYRRV..RR................R
Q91CZ6_9VIRU/1-596MA..YWWRR....RR...WPW..RR..RWRRR.GRR..RRVPRRRYRRPVRRYRKRYTV..RR..RRRRGRRGRPRR..R
A7VM08_9VIRU/1-506MPF.WWTRR....RK..PWFGT......................WRQRRYRRRRRRTTY..KR..RKP.RYNRRRPR..R
CAPSD_TTVV3/1-573MAWYWWRRR....RRRGWWKPRRRR...WRRR.RA.........RRRGPARRHRARRRV..RR..RR..GR.WRRRY..R
Q91D00_9VIRU/1-593MAWRWWWRRRWKPRRRPAWTKYRRR..RWRRL.RPR........RPRRLARGRRRRRTV......RRRRVRRLRR....R
Q99AR5_9VIRU/1-604MA..WWGRW....RR...WPRRRWR..RWRRRRRRR....LPTRRTRRAVRGLGRRPRKTVRR..RRRRPRRTY.....R
Q9DTD2_9VIRU/1-559MAFWWWRRR....RR.ARWRRRAAA.RRWRRR.RP.........RRRRAARRAGRRRRV..RR..RR..GR.WRRAH..R
Q91D04_9VIRU/1-591MAWTWWWQR....RR.RRWPWRRRR...WRRL.RTR........RPRRLVRRRRKRYRV..RR..RRRWGRRRGRRTYLR
CAPSD_TTVV8/1-571MAWP.WRRR....RW..RWRRRRPRWRRWRRR.RT.........WRRRP.RRAVRRRRV..RR..R...GRGWRRLY..R
Q5ENX0_9VIRU/1-603MAWWGW.......RRRWGWRPRWRRRRRWTRR.RRR....VPARRPRRPVRRHRKRYRV...R..RRRWGR........R
O90364_9VIRU/1-590MAYGWWRRR....RR..RWRRWRPR..PWRPRWRT.........RRRRPARRRGHRRNV..RR..RRRGGR.WRRRY..R
Q9IFV0_9VIRU/1-583MAWRWWWRR....RR..RWP.RRRR.TTW.RR.RPRP.......RRRRRTARTRRRGRV..RRW.RRR.GRGWRR....R
Q9QUE7_9VIRU/1-586MAYGWWRRR....RR..RWKRWRRR.PRWRRPWRT.........RRRRPARRRGRRGTV..RR..RRR.GR.WRRRY..R
A8DMR2_9VIRU/1-531MPY..............YWRGWRRR...................RRRRFWRRRAGAPFRR.RRYWRY............R
Q9DUH8_9VIRU/1-609MPWGWW.......RR...WRRRPRRWRRWRRWGRR.........RTRWGLRTRRARAAV...R..RRRRGRVRRRARGGR
A7VLW8_9VIRU/1-511MPF.WWGRR....RK..YWWGRR.....................FTRPKYRRYQ.......RR..RKR.PIRRRKPR..R
Q99AQ3_9VIRU/1-582MS..WWGWR....RR...WWWKPRR..RWRRR.RARRPRRLPRRRYRRPTRRYRGR.RV..RR..RRAGGWRGR.RRYSR

PF02247

POL2_SQMVM/246-618NELDLAQLS-----------------------------------LDDTSSLRGTALQTKLATSRIILSKTMVGNTVLRED
POL2_CPMVS/460-832MEQNLFALS-----------------------------------LDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDE
POL2_BPMV/447-819METNLFKLS-----------------------------------LDDVETPKGSMLDLKISQSKIALPKNTVGGTILRSD
Q9Z006_9SECO/476-846Q........-----------------------------------TNNFAIESATETMRLLFSGYASIPLNVIPGTKITVA
O12663_9SECO/321-691Q........-----------------------------------TNNFAIESATETMRLLFSGHASIPLNVIPGTKITVA
Q9YWK0_9SECO/363-735NELDLAQLS-----------------------------------LDDTSSLRGSVLQTKLATSRVILSKTMVGNTILREN
POL2_CPSMV/437-806D...LFKRN-----------------------------------LDDVSTISDTMLGAMIGQTKVVIPKTLVAGTVLKSG
POL2_RCMV/407-778TDTDLFKLS-----------------------------------LDDTSSPKGSLLDTRFAQKKVLIPKAMAGGADLLSS
Q9YWJ9_9SECO/452-824NELDLAQLS-----------------------------------LDDTSSLRGTALQTKLATSRIILSKTMVGNTVLRED
Q66170_CPMVS/343-715MEQNLFALS-----------------------------------LDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDE

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754-----ASANQAGKRLEPRKRTRSIRSRQDLDTMHRVVVSVDVDSLTTLMGNIMTLAGSGGRGSLLTAGDVEKNPGPQMTR
CAPSD_NCBVS/1-608-----MDANV.........QIRPAR..............................................NNP......
CAPSD_HASV/2-647-----GDAGVASQRPHNRRGTRNVR.......................................................

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------GRVVTAPVSSAALI.RYKAPSL--------------------------------------
CAPSD_MCMVK/23-222--------------------RAIRANPPVPRPNPQRNRPPPA--------------------------------------
CAPSD_PMVK/39-236--------------------YVTTLGP..........SRPRM--------------------------------------
CAPSD_RCNMV/24-213--------------------VKTVAIPFAKTQII.KTVNP..--------------------------------------
CAPSD_CARMS/51-245--------------------TPAILAFTPRRPRM.TNSPPRT--------------------------------------
CAPSD_SBMVA/46-262--------------------AGVSMAPIAQGTMV.RLREPSL--------------------------------------
CAPSD_TBSVC/76-269--------------------GGAIMAPVAVTRQL.VGSKPKF--------------------------------------
CAPSD_POLVP/66-257--------------------.GAIAAPVANTRII.RASKPKF--------------------------------------
CAPSD_OCSVU/111-308--------------------.GTTAAPVSISRNINRRSKPSI--------------------------------------
CAPSD_TNVA/61-272--------------------GGYIVAPTSGGVVT.RPIVPKF--------------------------------------

PF11729

CAPSD_SJNNV/1-340----------------MVRKGDKKLAKPPTTKAA-NSQPRRR--------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659------FWGDRADSQPFAIPYIHPTNPFAPDVTAAAGAGPRV--------------------------------------

PF03115

CAPSD_HASV1/1-416------MASKSNKQVTVEVSNNGRSRSKSRARSQSRGRDKSV--------------------------------------

PF00983

COAT_TYMV/8-177-------------------------APQDRTVTV-ATVLPAV--------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226PWLVHPR..HRYRWRRK..-.......NGIFNTRLSRTIGYTVK..----------------------------------
Q27W03_PCV1/5-227PYLAHPAFGNRYRWRRK..-.......TGIFNSRLSTEFVLTIK..----------------------------------
A3FEQ4_9CIRC/3-256GLRR......RLRRRRLRI-GRPRRRFS.VVTFKVTRHTVFGFFGS----------------------------------
Q3HUU1_GOCV/5-247NRRR......RYRRRRLHI-GRIRSKYT.IFNVKQTQNISFTFF..----------------------------------
Q1L2D2_9CIRC/1-237HYRR......RRRTRRLPR-NRRGHRANRVYYFRLRHSVKVTLQ.K----------------------------------
CAPSD_CACV/7-243YWXR......R...RRIPA-NRRGHRTNRVYRFRFVREFGQVLQ.K----------------------------------
Q0H9S8_9CIRC/4-236HWRR..........RRL.T-NRRGHRTNRVYRFKFVRMYRQECA..----------------------------------
Q06J73_9CIRC/8-245HWRR......R...RRIPA-NRRGHRTNRIYRIKLVRQYQQILG.K----------------------------------
Q9DXG3_BFDV/11-242HIR.......RYRRRRRHF-RRRRFSTNRIYTLRLTRQFQFKIN.K----------------------------------
Q69EZ5_BFDV/7-239HIR.......RYRRRRRHF-RRRRFTTNRIYTLRFKRQFKFQIE.K----------------------------------
Q9DXG0_BFDV/11-242HIR.......RYRPRRTYF-RRRRFSTNRIYTLRLKRQFKFEIR.K----------------------------------
Q9DXF4_BFDV/3-235HIRR.....YRYRQRRRHF-CRRRFTTNRLYTIRLKREFKFDIN.K----------------------------------

PF02956

A7VLZ2_9VIRU/1-506TYRRRRKSFRKVRRKRRTL.PLKQWQPETIRKCKVKGIGIHTLGVE...GTQYRCYTANKYEYTIA....K.........
Q9WT88_9VIRU/1-603RGWRRRRYIR.RGRRKKKL.ILTQWNPAIVKRCNIKGGLPIIICGE...PRAAFNYGYHMEDYTPQ....P.........
Q91CY9_9VIRU/1-581RTYRKR......RKRRKKM.TLKMWNPSTIRACNIRGFIALVVCGH...TRAGCNYAIHSEDYIPQ....L.........
A7VLY0_9VIRU/1-515...RRRRRKRKVRRKRQRI.IVKQWQPESIVKCEIKGLGCLVAGAQ...GRQPFCYTNSKYEYPQP....K.........
Q9JGT1_9VIRU/1-585RWRRKG.....RRRSKKKL.IIRQWQPNYRRRCNIVGYMPLLICGE...NTVARNYATHSDDCYFP....G.........
Q80QT8_9VIRU/1-595RGYRRRLRLRRRRRRRKKI.ILTQWNPAKVRKCTIRGVLPMILAGA...GRFAFNYGLHSDDITVQKPLNQ.........
CAPSD_TTVB1/1-533RWVRRRRFFR.FKRKLRKI.RIDQWQPETIRKCHVKGNLCLLTCGR...GNINHNYILTSESYVPT....S.........
A7VM00_9VIRU/1-509TNRRRRRRRYKVRRKQKKI.TLKQWQPESIKKCKIKGTGQIVLGAE...GTQFRCFTVYKNEFTNP....K.........
Q9JG61_9VIRU/1-534RWVRKRRFFKYKKRKLKKI.RLSQWQPDSIRKCTIKGQLCLLTCGI...GRINNNFTLTAESYVPI....S.........
Q91PS3_9VIRU/1-581RYLRARR....RVKRRKKI.KLTQWNPTVVKKCVVKGYLPLLICGTGTTGTTYRNYGSHMHDYRKY....D.........
CAPSD_TTVV4/1-560YRPRRRR....RRRKRQKI.KLKQWNPAVTKFCRIIGYYPLIICGE...GTTVRNYNVHSQDYVQY....E.........
Q91C93_9VIRU/1-546YRVRKRH....FKRKLSKL.TIQEWQPPSIRKLTIKGYYPLFQSTR...DRLSNNMITYLESIAPH....Y.........
Q2F827_9VIRU/1-589YKRRRRKTGRLYRKPKKKL.VLTQWHPTTVRNCSIRGLVPLVLCGH...TQGGRNFALRSDDYPKQ....G.........
Q91CY5_9VIRU/1-584RAVRRR......RRPKKKL.VLTQWSPQTVRNCTIRGIVPMVICGH...TRAGRNFAIHSEDFTSQ....I.........
Q8V7G9_9VIRU/1-572GRRRRGR....RRRKRQTL.IPRQWQPDVTKKCFITGWMPLIICGT...GHTQFNFITHEEDIPGA....G.........
Q99A78_9VIRU/1-584KWRRKG.....RRRGKKKI.IIRQWQPNYRRRCNIIGYMPVLICGN...NTVSRNYATHSDDSYLP....G.........
Q6H9C2_9VIRU/1-573KWRRGRR....RRTHRKKI.VIKQWQPNFIRRCYIIGYLPLIFCGE...NTTAQNFATRSDDMISK....G.........
CAPSD_TTVT1/1-433YRRRR......GGTKRQYISSIMQWNPQHRHLCYIKGITWLCAARADRMSWPGIKQIAATDSTRYW....S.........
Q9JG80_9VIRU/1-589RTYVRKGR...HRKKKKRL.ILRQWQPATRRRCTITGYLPIVFCGH...TKGNKNYALHSDDYTPQ....G.........
A7VLZ6_9VIRU/1-506PARRRRRKLRKVRRKKKQI.AVKQWQPESITKCKILGHSALVVGAE...GKQMFCYTTNKNIAVPP....K.........
Q6H9D2_9VIRU/1-557YRLRRRR....RRRRRRKL.ILTQWQPAKIRKCLVIGYLALVLCGN...GTFSKNYASHSDDYVQK....G.........
Q6H999_9VIRU/1-471.......................KG.......................................................
Q77JT5_9VIRU/1-606RWGRRRR....RRRHKKKL.VLTQWQPAVVKRCLIVGFDPLIICGI...NRTIFNYTTHSEDFTFN....N.........
Q91PS7_9VIRU/1-585RYIRRRR....LRRRRKKI.PITQWNPSVVRKCVVTGYIPLLICGTGTTGTTYKNYGSHAADYKKY....D.........
CAPSD_TTVV9/1-555RYRRR......RRYKRRLL.ILKQWQPTTNLRLTVKGLIPVVVMGK...GKTQNNFGQWEQTVPLE....G.........
Q9JG47_9VIRU/1-553YRVR........KRKLKYL.PLRQWQPHYINKLKVQGWYPLAISTK...DRLSNNLNLYLESIAPH....Y.........
A7VLW0_9VIRU/1-507TTKGRRRRRYKVRRKQQKI.LVKQWQPECIRKCKIKGLGTIVLGAE...GTQYRCYTDYLDEWTNP....K.........
Q0ZLH9_9VIRU/1-573PYIRRRR....RSFRRKKI.KITQWNPAVTKKCTVTGYLPVIYCGTGDIGTTFQNFGSHMNEYKQY....N.........
Q5ENW7_9VIRU/1-501WLVRRRRRSVYRRGGRRAR.PYRLFNPKVMRRVVIRGWWPILQCLK...GQEALRYRPLQWDTERQWRVRSDFEDQYGYL
A7VLX2_9VIRU/1-509ASRRRRRRRYEVRRKRQKI.VLKQWQPESIKKCKVKGFGCLVLGAE...GRQFYCWTNEASNYPQP....K.........
Q80AR5_9VIRU/1-594RGWTRRRYIR.RRRRKKKL.VLTQWNPQDVRRCTIRGIIPLIMCGA...NTASFNYGMHSDDSTPQ....P.........
Q91CZ2_9VIRU/1-601RYRRRLT....VRRKRNKL.RLSVWQPQNIRYCAIKGLFPILICGH...GKSAGNYAIHSDDFITS....R.........
CAPSD_TTVG1/1-514PARRRRRRRRKVRRKKKTL.IVRQWQPDSIVLCKIKGYDSIIWGAE...GTQFQCSTHEMYEYTRQ....K.........
Q98Y63_9VIRU/1-581RRFKKR......RRRRRKL.TLKMWNPSTIRACNIKGAINLVMCGH...TQAGRNYAIRSEDFYPQ....I.........
Q9QU36_9VIRU/1-529HWVRRYS....RKRKLSKL.NIKEWQPITIRKTKVKGLYPAFLCND...QRIGNNAIQYLDSIAPH....H.........
A7VM12_9VIRU/1-509RRRRRRTRHQKVRRKKNKI.PVLQWQPDSIRKCHIKGQGTLVVGAE...GTQMFCYTRDKFKYIPP....K.........
A7VLV6_9VIRU/1-508..RRRRRRRYKVRRKKKKI.VIQQWQPESIKKCKIKGFGCLVLGSQ...GTQYLCYTNEAANYVPP....K.........
Q9JG50_9VIRU/1-535HTVRRRR....IKKKLKKI.KIYEWQPTVIKKCHIKGTIPLIQGGK...DRQGFNYAQYQDSYIPS....H.........
A7VLW4_9VIRU/1-507TNRRRRRRHRKVKRKRKTL.TVKQWQPESIRKCKIIGLEPQLLGAE...GSQIDCFTVVKTDYVPA....K.........
A7VM04_9VIRU/1-513YAGRRRRRRYKVRRKRQKI.PLFQWQPDKIVKCKIKGVTTLVLGAE...GKQLVCYTNVKTANTPA....K.........
A7VLY4_9VIRU/1-498TRRRRRRRHTKVRRKRQTI.PVRQWQPERIVRCKIKGISVIVLGGE...GKQFQCYTNEATTWTPL....R.........
CAPSD_TTVD1/1-324HRGRRFPYFKQGKRRRTRL..LHVTDPRYKAHCTITGWVPIAMTRI...QLISQPFTV...DTLSP....F.........
Q91CZ6_9VIRU/1-596LYRRRYT....LRRKRKRL.IIKQWQPNNIRKCRITGMLPMVICGH...GMSANNYAIRSDDTETM....K.........
A7VM08_9VIRU/1-506LTRRRRRRKYKVRRKQKKI.HLTQWQPDRIRKCKIKGRGTLIMGAQ...GRQYMCYTNVKDRLTPS....R.........
CAPSD_TTVV3/1-573RWRRRGG....RRRHRKKL.IIKQWQPNFIRHCYIIGYMPLIICGE...NTFSHNYATHSDDMLST....G.........
Q91D00_9VIRU/1-593RGWTRRRYL..RRRKRRKL.ILTQWNPNIVRRCSIKGIIPLTMCGA...NTASFNYGMHSDDSTPQ....P.........
Q99AR5_9VIRU/1-604RGWRRRRYIRRRRGRRKKL.TLTMWNPNIVRRCNIEGGLPLILCGE...NRAAFNYAYHSEDYTEQ....P.........
Q9DTD2_9VIRU/1-559RWRRRRG....RRRHKRKL.IIRQWQPPYTRRCYIVGYLPLIMCGE...NCFSKNFATHSDDIDCS....V.........
Q91D04_9VIRU/1-591RRLKK.......RKRRKKL.RLTQWNPSTIRGCTIKGMAPLIICGH...TMAGNNFAIRMEDYVSQ....I.........
CAPSD_TTVV8/1-571RYRRRRG....RRTYKKKP.VLTQWQPTVRRRCFIIGYMPLIICGE...NLTSKNYASHADDFVKD....G.........
Q5ENX0_9VIRU/1-603YTRRGRLRLRRRRRRRKKI.VLTQWNPQTVRRCYIRGLMPVIWAGM...GSGGKNYAVRSDDYTQS..............
O90364_9VIRU/1-590RWKRKG.....RRRKKAKI.IIRQWQPNYRRRCNIVGYIPVLICGE...NTVSRNYATHSDDTNYP....G.........
Q9IFV0_9VIRU/1-583TYIRRRR....R..RKKKI.NIQQWNPATVKKCVVTGYVPLLICGTGTTGTTYKNYGSHINDYTKF....D.........
Q9QUE7_9VIRU/1-586RWRRKG.....RRRRKKKL.IIRQWQPNYTRKCNIVGYMPVIMCGE...NTLIRNYATHADDCYWP....G.........
A8DMR2_9VIRU/1-531YRVRR......LRRKPKKL.PIKQWQPTKMRRLTVTGKYPLFEGTS...ERIGNNNTQSIDTIAPY....L.........
Q9DUH8_9VIRU/1-609RYHYRRRFRRRRARRRKKI.VLTQWNPQTVRKCLIRGMFPILWCGS...GAAGKNYALHMDDYTPS..............
A7VLW8_9VIRU/1-511TYRRRYRRRKKVRRKRKTL.LVRQWNPDSILTCKIKGFLDILMGAD...GNQYQCYTQNRYSMPPP....K.........
Q99AQ3_9VIRU/1-582RYSRRLT....VRRKKKKL.TLKIWQPQNIRRCKIRGLLPLLICGH...TRSAFNYAIHSDDKTPQ....Q.........

PF02247

POL2_SQMVM/246-618LLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQ--------------
POL2_CPMVS/460-832YLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK.YSTDVYTICSQ--------------
POL2_BPMV/447-819LLANFLTEGNFRASVDLQRTHRIKGMIKMVATVGIPENTGIALACAMNSSIRGR.ASSDIYTICSQ--------------
Q9Z006_9SECO/476-846YLN.ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGI--------------
O12663_9SECO/321-691YLN.ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGI--------------
Q9YWK0_9SECO/363-735LLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQ--------------
POL2_CPSMV/437-806PLSDVMQQGSFRSTIALQRTHIITGKIHVVAMLETAVNTGLGLAICFNSGIRGK.ASADIYATCSQ--------------
POL2_RCMV/407-778NLYDVLSGSSFRASLALARTHVVEGKIRCICTINLPENTGCCLAITVNSSNRGQ.FSTDIYTTGSQ--------------
Q9YWJ9_9SECO/452-824LLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQ--------------
Q66170_CPMVS/343-715YLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK.YSTDVYTICSQ--------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215-------------------RNRRRRPRRGSR-----SAPSSADANFRVLSQQLS-RLNK--------TLAAGRPTINH--

PF01318

CAPSD_BMV/2-188-------------------------------------STSGTGKMTRAQRRAAA-RRNR--------WTARVQPVIVE--

PF03566

Q80IX5_PRVFL/54-754ENKAPNMSVRAQNVTVSNSRRRRRKNRKPRK.....QVEQATILKPQLLPGESV-APSG--------GRGTMDPPVHEIC
CAPSD_NCBVS/1-608..........SQGNQGRNNNNKRRRRRRGLKLPPVVAPITSPGQMAEPANHANT-RVNR--------GRTRV.RGLRQ.A
CAPSD_HASV/2-647........VSANTVTVNGRRNQRR..RTGRQVSPPDNFTAAAQDLAQSLDANTV-TFPA--------NISSM.PEFRNWA

PF01829

CAPSD_NODAM/42-399---------------MAATNNMLKMSAPGLDFLK--CAFASPDFSTDPGKGIPD-KFQG--------LVLPKKHCLTQ--

PF08435

Q91H09_9CALI/305-535---------------LTNLDGSPIDPTDDTP-----GPLGCPDFTGLLYGVASQ.RGPG........DATRAHEARIDTG
Q8JMP1_9CALI/305-540---------------LTYPNGASYDPTDEVP-----APLGTQDFSGMLYGVLTQ.DNVNV....STGEAKNAKGIYISTT
Q8B4Z2_9CALI/297-515---------------LFQPNQEDFHAGSA.P-----APFGFPDFSECSVTFVVS............SATTVGERTVNARN
Q917X1_9CALI/305-538---------------ITNLNGTQFDPTDDVP-----APLGVPDFAGEVFGVLSQ.RNRGE.....SNPANRAHDAVVATY
Q9IV43_9CALI/304-537---------------LTELDGSPFLAFEA.P-----APTGFPDLGTSDWHIEMS.LNSNS.....QSSGNPILLRDIQPN
Q8VA02_9CALI/306-539---------------LTELDGSPYHAFES.P-----APVGFPDLGECDWHMEAS.PTTQ.......FNTGDVIKQINVKQ
Q9IV49_9CALI/306-538---------------ITNTDGTPIDPTEDTP-----GPIGSPDFQGILFGVASQ.RNKNE.....QNPATRAQEVNINTG
Q6EAX3_9CALI/306-538---------------LTNLNGTPFDPTEDVP-----APLGTPDFTGLLFGVASQ.RNVGS.....NPNTTRAHEAVVSTT
Q8BAC6_9CALI/304-534---------------LTNLDGSPIDPTDDMP-----APLGTPDFQAMLYGVASQ.RSSR.......DNATRAHDAQIDTA
Q6WQW7_9CALI/296-512---------------LLEPDESAFVVGER.P-----ATLGFPDFSQCVLNLLLA............DGTGVWHQTLDVKN
Q6B7R3_9CALI/303-535---------------LVHPNGATYDPTEDVP-----APFGTQDFRGILYGVLTQ.NPRAS.....GDEAANSQGVYISST
Q6EAW7_9CALI/305-538---------------VSNLNGTPFDPTDDVP-----APLGMPDFSGQIFGVVSQ.RDTG......TNPANRAHDAVLATY
Q66418_9CALI/306-538---------------LTELDGSAYHAFES.P-----APIGFPDIGDCDWHMSAT.ATNN.......FTGSSNEYQILIKQ
Q80FL2_9CALI/317-546---------------LDNLNGTPYDPAEDXP-----GPLGTPDFQGIVFGVASQ.RNSD........GTTRAHEAKVDTR
Q9IV42_9CALI/305-535---------------LSEVDGTPFIPLES.P-----APVGFPDLGSCDWHVNFTFQAQN.........QDPSQSVTFATN
Q6XDL5_9CALI/307-546---------------VTNLNGTPFDPTEDVP-----APLGTPDFSGQIYGVISQ.RNTNTVPGEGNLPANRAHEAVIATY
Q6B7R2_9CALI/304-538---------------LSELDGSPYHAFES.P-----APVGFPDLGHCDWHVSSF.KADQ.......NSSGDPISRLDIKQ
Q917X4_9CALI/305-533---------------VTNANGTPFDPTEDAP-----APLGTPDFLANIYGVTSQ.RNPD........NTCRAHDGILATW
Q783W9_9CALI/306-535---------------LENLDGSPVDPTDEVP-----APLGTPDFQAQLFGVISQ.RSSD........NATRAHEARVNTN
Q80J94_9CALI/309-538---------------LIEQDGSAYVPGDR.A-----APLGYPDFSGQL.EIEVQ.TETTKT..GDKLKVTTFEMILGPTT
Q913B6_9CALI/305-540---------------ITNLNGSPFDPSEDIP-----APLGVPDFQGRVFGVISQ.RDKQNAA.GHSEPANRGHDAVVPTY
Q8JW44_9CALI/304-539---------------LTEVDGKPFMAFDS.P-----APVGFPDFGKCDWHMRIS.KTPNN.....TSSGDPMRSVSVQTN
Q83876_9CALI/301-524---------------LTELDGTPFHPFEG.P-----APIGFPDLGGCDWHINMT...........QFGHSSQTQYDVDTT
Q9IV48_9CALI/306-533---------------LTELDGTPYHAFES.P-----APLGFPDIGACDWHVFNF.QSGS.......NSFEGSHVQVRYKA
Q8V713_9CALI/316-545---------------LENLDGSPYDPTDDIP-----AVLGSPDFQGVMFGILSQ.RNTD........GQTRAHEAKVDTR
Q91I85_9CALI/304-538---------------LTELDGSPFMAFAA.P-----APAGFPDLGSCDWHIEMS.KIPNS.....STQSNPIVVNSVKPN
Q8JXJ0_9CALI/304-537---------------LTELDGSPFLAFEA.P-----APAGFPDLGKCDWHVEMSLYQDN.......NHADPIVLHAIEPN
Q783X1_9CALI/315-545---------------LKNLDGTPYDPTDEVP-----AVLGAIDFKGTVFGVASQ.RNTTG....SSVGATRAHEVHIDTT
Q783Y0_9CALI/305-533---------------VTNINGTPFDPTEDVP-----APLGTPDFSGKLFGVLSQ.RDHD........NACRSHDAVIATN

PF02226

POLG_HRV8A/2-69---------------------------------------GAQVSRQNVGTHSTQNSVSN---------------------
POLG_POL1M/2-69---------------------------------------GAQVSSQKVGAHENSNRAYG---------------------

PF11492

Q7T7T5_HARNA/2003-2059-----------------------------------GDEYETAKTSPLSISGTLT-------------TVANVAAAASS--
POLS_CRPVC/291-340-----------------------------------LETNNSPSTALGQISEGLT-------------T.......LSH--
Q2HWK2_RSET1/357-413-----------------------------------SQSGKQDEYGEGVLSKPAS-------------AVARLAGRLKD--
POLS_ABPVR/340-396-----------------------------------....KTENPKIGPISELAT-------------GVNKVANGIER--

PF08935

Q9WJ28_PTV1F/119-191---------------------------------------GTGTSRMENGNTNNS--------------------------
Q9DLK1_FMDVP/202-285---------------------------------------GAGQSSPTTGSQNQS--------------------------

PF01766

POLS_IBDVU/9-452-----QQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPG--------FPGSIVGAHYTLQ
POLS_DXV96/2-442-----NTTNEYLKTLLNPAQFISDIPDDIMIRHVNSAQTITYNLKSGASGTGLIVVYPN--------TPSSISGFHYIWD
POLS_BSNV/7-428-----NTQIRYLNSLLVPETGSTSIPDDTLDRHCLKTETTTENLVAALGGSGLIVLFPN--------SPSGLLGAHYTKT
POLS_IPNVJ/5-453-----KATATYLRSIMLPENGPASIPDDITERHILKQETSSYNLEVSESGSGLLVCFPG--------APGSRVGAHYRWN

PF02248

Q66170_CPMVS/720-899-----------------------------------------------CAEASD--VYSPC---MIASTPPAP...-----
Q9YWJ9_9SECO/828-1009-----------------------------------------------MVQQLG--TYNPI---WMVRTPLES.TA-----
POL2_CPMVS/837-1016-----------------------------------------------CAEASD--VYSPC---MIASTPPAP...-----
POL2_BPMV/821-1004-----------------------------------------------SISQQT--VWNQM---ATVRTPLNFDSS-----
POL2_CPSMV/808-988-----------------------------------------------SGQTQQ--VWNKI---WRIGTPP...QA-----
POL2_RCMV/786-964-----------------------------------------------VRTTDG--VYSTC---FRVRTPLA....-----
Q66179_APMV/2-185-----------------------------------------------CSPCIN--VWSEF---CALDIPVVD.TT-----
POL2_APMV/802-985-----------------------------------------------CSPCIN--VWSEF---CALDIPVVD.TT-----
POL2_SQMVM/622-803-----------------------------------------------MVQQLG--TYNPI---WMVRTPLES.TA-----
Q9YWK0_9SECO/739-920-----------------------------------------------MVQQLG--TYNPI---WMVRTPLES.TA-----

PF03688

A5H0K4_GFLV/264-422-----------------------------------------------SFEDDYF.VWVDF...SEFTLDK....E-----
POL2_BRSV/1176-1338-----------------------------------------------INYKQRF.AWCLLECLDNSKASP....I-----
Q86631_9SECO/418-544-----------------------------------------------IATRLQF.LWASF...SGFAPVVPEAPR-----
POL2_ARMV/344-502-----------------------------------------------SFPNDYF.LWVDF...SSFTVDV....E-----
Q88483_9SECO/1172-1336-----------------------------------------------INYNQHF.AWFMLEHLDTNTTGA....V-----
A2ID55_9SECO/610-780-----------------------------------------------MYQTMEF.SWVTL...SAFLQGT....A-----
Q80JS8_BRAV/347-511-----------------------------------------------IGLIREF.NWATI...NNFKSDD....I-----
A0A9J6_ARMV/960-1118-----------------------------------------------AFPNDFF.LWVDF...SAFTIDQ....E-----
CAPSD_TRSV/351-511-----------------------------------------------FSSSELY.NWFTL...TNLKPDANTGVV-----
POL2_GCMV/1150-1316-----------------------------------------------INYDQRF.AWFTLLRPPDPKLSK...IL-----
Q6XPY1_9SECO/164-322-----------------------------------------------INYKQAF.GWFTL.VRRSTTNKE....I-----
Q6XFY6_9SECO/157-316-----------------------------------------------TFPNDYF.LWVDF...SAFTVDE....E-----
Q9IV56_9SECO/980-1138-----------------------------------------------LVAEIGS.LWCRV...TSFLKED....V-----
Q65624_9SECO/386-551-----------------------------------------------IGNVLLF.NWATI...SEMTNLT.....-----
POL2_CNSV/1022-1185-----------------------------------------------INFTQRF.GWFAV..EPTTSTGA....I-----
Q64959_9SECO/338-502-----------------------------------------------INYKQRF.GWFMI.SPSDKTTTE....L-----
Q20LA0_9SECO/942-1102-----------------------------------------------SEKGQMH.AWFRV...HNILVDN....L-----
A3FEN2_9SECO/348-507-----------------------------------------------IAGEQQF.NWCSF...RNFKIDD....W-----
Q9ELS0_9SECO/148-312-----------------------------------------------LQYSEMSCNWAEI...SAIVGTG....Q-----
Q9QAH0_9SECO/350-510-----------------------------------------------GDRSVGS.AWFRI...NNIADDN....L-----
Q24M89_9SECO/943-1103-----------------------------------------------PERGQMH.AWFRM...NNIQVDN....L-----

PF08462

Q5ZF43_CARMV/250-348-----------------------------------------------QASN------------DKVSDGP----------
Q999Y9_CARMV/250-348-----------------------------------------------QASN------------DKVSDGP----------
Q4JGW6_CARMV/250-348-----------------------------------------------QASN------------DKVSDGP----------
Q8JJU7_CARMV/250-348-----------------------------------------------QASN------------DKVSDGP----------
CAPSD_CARMS/250-348-----------------------------------------------QASN------------DKVSDGP----------
Q999Z1_CARMV/250-348-----------------------------------------------QASN------------DKVSDGP----------
CAPSD_CARMV/250-348-----------------------------------------------QASN------------DKVSDGP----------
Q7TG55_CARMV/250-348-----------------------------------------------QASN------------DKVSDGP----------

PF00729

CAPSD_PNLV/47-266-------------------------------------------N....GNSMDSVRLASKSLVIE...........AV--
CAPSD_MCMVK/23-222-------------------------------------------G..........TTCSMSEILLAVSATTA.DQILEI--
CAPSD_PMVK/39-236-------------------------------------------G.....QGQGWQKLSHEEIILQVNSSTAADTIQTI--
CAPSD_RCNMV/24-213-------------------------------------------......PPKPARGILHTQLVMSVVGSVQ......M--
CAPSD_CARMS/51-245-------------------------------------------SRNSPGQAGKSMTMSKTELLCTVKGTTGVIP....--
CAPSD_SBMVA/46-262-------------------------------------------R.....TAGGVTVLTHSELSTE............L--
CAPSD_TBSVC/76-269-------------------------------------------T....GRTSGSVTVTHREYLSQVNNSTG......F--
CAPSD_POLVP/66-257-------------------------------------------T.....RSKGSVTIAHRELLGQFNNSSG......L--
CAPSD_OCSVU/111-308-------------------------------------------K.....MMGDAVVISHSEMLGAINSGTPSSNVTAF--
CAPSD_TNVA/61-272-------------------------------------------S.....NRGDSTIVRNTEILNN.......QILAAL--

PF11729

CAPSD_SJNNV/1-340-------------------------------------------ATQRRRSGRADAPLAKASTITGFGRATNDVHISGMSR

PF00894

CAPSD_PLRV1/70-207----------------------------------------------------ETFVFTKDNLVGNTQGS-----------
CAPSD_PEMVW/53-187----------------------------------------------------D.FSMVHGPFNGNATGT-----------
CAPSD_BYDVP/62-199----------------------------------------------------EVFVFSVDNLKANSSGA-----------

PF03014

CAPSD_HEVCH/41-659-------------------------------------------RQPARPLGSAWRDQAQRPAAASRRRPTTAGAAPLTAV

PF03115

CAPSD_HASV1/1-416-------------------------------------KITVNSRNRARRQPGRDKRQSSQRVRNIVNKQLRKQGVTGPKP

PF00983

COAT_TYMV/8-177--------------------------------------------------PGPSPLTIKQPFQSE---------------

PF00073

Q9WMA0_9PICO/49-215----------------------------------------DQSSVHTAEVGSHQI.......EPLKTSVDKPGSKK-TQG
POLG_AEVCA/45-212----------------------------------------DQSSVSTATMGSLQDVQYRT.......AVDIPGSRV-TQG
POLG_CXA9/93-300----------------------------------------TTQECANVVVGYGRWPTYLR..DDEATAEDQPTQPD-VAT
POLG_CXB3N/93-302----------------------------------------TTQECANVVVGYGVWPDYLK..DSEATAEDQPTQPD-VAT
POLG_CXB4J/93-300----------------------------------------TTQECANVVVGYGVWPDYLS..DEEATAEDQPTQPD-VAT
POLG_CXA21/93-308----------------------------------------TTQEAANAIVAYGEWPTYIN..DSEANPVDAPTEPD-VSS
POLG_POL1M/93-308----------------------------------------TTQEAANSVVAYGRWPEYLR..DSEANPVDQPTEPD-VAA
POLG_POL3L/93-307----------------------------------------TTQEAANSVVAYGRWPEFIR..DDEANPVDQPTEPD-VAT
POLG_HE701/93-288----------------------------------------VTQEAANICCAYGEWPTYLP..DNEAVAIDKPTQPE-TST
POLG_BOVEV/93-285----------------------------------------TTQEAANICVAYGCWPAKLS..DTDATSVDKPTEPG-VSA
POLG_HRV14/93-299----------------------------------------TTQEAANAVVCYAEWPEYLP..DVDASDVNKTSKPD-TSV
POLG_HRV2/93-302----------------------------------------TSQDVANAIVAYGVWPHYLS..SKDASAIDKPSQPD-TSS
POLG_HRV8A/93-302----------------------------------------TSQDTANAVVAYGVWPSYLT..PDDATAIDKPTQPD-TSS
POLG_HRV1B/93-301----------------------------------------TSQDVANAVVGYGVWPHYLT..PQDATAIDKPTQPD-TSS
POLG_FMDV1/311-475----------------------------------------TTQSSVGVTYGYSTEEDHVA..GPNTSGLETRV...-VQA
POLG_FMDVT/311-475----------------------------------------TTQSSVGVTFGYATAEDSTS..GPNTSGLETRV...-HQA
POLG_FMDVO/311-475----------------------------------------TTQSSVGVTYGYATAEDFVS..GPNTSGLETRV...-VQA
POLG_EMCV/161-359----------------------------------------........TPSQQWAVLSVM..VPFMMESIRHHVLT-LLQ
POLG_TMEVB/172-382----------------------------------------NTQSTVGRLCGYGKSHHG....EHPASCADTATDKV-LAA
POLG_ENMGO/162-361----------------------------------------NTQSTVGRLVGYGTVHDG....EHPASCADTASEKI-LAV
POLG_FMDVO/533-691----------------------------------------VFNPPRNQLPGRFTNLLDVAEACPTFLRFEGGV...-...
POLG_FMDV1/533-692----------------------------------------VYNPPKTNYPGRFTNLLDVAEACPTFLRFDDG.KP.-...
POLG_EMCV/420-582----------------------------------------TPVAPSNYMVGEYKDFLEIAQ.IPTFIGNKIPN...-...
POLG_TMEVB/443-606----------------------------------------TISTPSDYMCGEFSDLLELCK.LPTFLG.....NPN-TNN
POLG_HE701/347-515----------------------------------------FSPTPEMHIPGQVHSMLEIV..QIESMMEINNVN.D-ASG
POLG_HRV2/358-522----------------------------------------YHPTKEISIPGEVKNLVEIC..QVDSLVPINNTDTY-INS
POLG_HRV8A/364-529----------------------------------------FHPTKEIFIPGQVRNLIEMC..QVDTLIPVNNTQEN-VRS
POLG_HRV1B/360-525----------------------------------------YHPTKEISIPGEVKNLIEMC..QVDTLIPVNNVGTN-VGN
POLG_BOVEV/345-515----------------------------------------FQPTLEIFIPGKVNNLLEIA..QVESILEANNRE.G-VEG
POLG_CXA21/369-534----------------------------------------FDVTPPIHIPGEVKNMMELA..EIDTLIPMNAVDGK-VNT
POLG_CXA9/358-524----------------------------------------FDVTPSMNIPGEVKNLMEIA..EVDSVVPVNNVQDT-TDQ
POLG_CXB4J/358-524----------------------------------------FDVTPEMNIPGQVRNLMEIA..EVDSVVPINNLKAN-LMT
POLG_CXB3N/360-526----------------------------------------YDVTPEMRIPGEVKNLMEIA..EVDSVVPVQNVGEK-VNS
POLG_CXB1J/360-526----------------------------------------FDVTPEMQIPGRVNNLMEIA..EVDSVVPVNNTDNN-VNG
POLG_FMDVO/725-872----------------------------------------......TTSAGESADPVTTT..VENYGGETQIQRRQ-HTD
POLG_FMDV1/726-878----------------------------------------......TTTTGESADPVTTT..VENYGGDTQVQRRH-HTD
POLG_BOVEV/610-775----------------------------------------DESMIETRTIVPTHGIHETS..VESFFGRSSLV...-...
POLG_HRV8A/621-792----------------------------------------PEDMIETRYVITDQTRDETS..IESFLGRSGCI...-AMI
POLG_HRV2/614-772----------------------------------------PEDVIETRYVQTSQTRDEMS..LESFLGRSGCIHES-KLE
POLG_HRV1B/627-786----------------------------------------..........MTSQTRDEMS..IESFLGRSGCV...-..H
POLG_HE701/609-781----------------------------------------....IQTRTVINMHGTAECL..VENFLGRSALV...-CMR
POLG_HRV14/614-787----------------------------------------PSDSIETRTTYMHFNGSETD..VECFLGRAACV..H-VTE
POLG_CXA9/612-783----------------------------------------PSDTMQTRHVKNYHSRSEST..VENFLGRSACV...-...
POLG_CXB4J/612-783----------------------------------------PSDTMQTRHVHNYHSRSESS..IENFLCRSACV...-...
POLG_SVDVU/612-782----------------------------------------PSDTMQTRHVKNYHSRSEST..VENFLCRSACV...-...
POLG_CXB3N/630-782----------------------------------------................SEST..IENFLCRSACV...-...
POLG_POL1M/636-806----------------------------------------PSDTVQTRHVVQHRSRSESS..IESFFARGACV...-...
POLG_CXA21/642-812----------------------------------------.........VINYKTRSESC..LESFFGRAACV...-...
POLG_CXA24/646-809----------------------------------------.........VVNYKTRSEST..LESFFGRSACV...-.TM

PF00915

CAPSD_VESVA/137-421-------------LRSTAD.VNSNF.TFRAESDGPGSTEIVTEEQGT.IVQQQPAPAPTALATLATASTGKSVEQ..EWM
POLG_RHDVF/1768-2065-------------GKARAAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVITAENSSASIATAGIGGPPQQVDQQETWR
CAPSD_FCVUR/112-395-------------....KA.WDPNLPLFRLEADD...GSITAPEQGT.VVGGVIAEPSSQMSTAADMASGKSVDS..EWE
CAPSD_NVN68/2-294-------------MMASKD........ATSSVDGASGAGQLVPEVNA.SDPLAMDPVAGSSTAVATAGQVNPID...PWI

PF08762

Q8B107_ALPV/599-804----------------------------------------T..SSA.LTVGEKVTSLRQI--LKRFHLIYSNL----T.T
O56051_9VIRU/590-790----------------------------------------TFNASM.LMMGEKVTSFRQL--IKRFSAI....----...
Q56QP7_9VIRU/684-855----------------------------------------SPNAVMGKIAGERLVNLRPL--LRCFRSLGG..----...
O36967_9VIRU/668-900----------------------------------------S..PEA.HCIGEKIMSIRQL--IKRFGMALNSL----NLI
Q5UBY1_9VIRU/79-259----------------------------------------NMEALL.KGSGEQIMNLRSL--LRTFRTISENW----NLA
Q6ITS9_9VIRU/106-313----------------------------------------NPNISL.LISGEVFTNFRNL--IKRVNFRKATT----LNG
Q4JFT2_9VIRU/834-1009----------------------------------------T...ML.TTMGEQFVSLRML--TRR........----...

PF02443

Q5Y4T0_PCV2/5-226--.ATTVRTPSWNVDMMRFNINDFLPPG.......................GGSNPLTVP--FEYYRI------------
Q27W03_PCV1/5-227--..GGYSQPSWNVNYLKFNIGQFLPPS.......................GGTNPLPLP--FQYYRI------------
A3FEQ4_9CIRC/3-256--GTGPTATGRWQSLSLEDGAQYTDPPAQGNNICGLNMRWAMFGDTNSYMQGNKPQYHYP--YDYYII------------
Q3HUU1_GOCV/5-247--GTGSPEKNKWQAMSLEAVQSSGTSPKP.....GINLRFAVFGDR...LPGTGNQYHYP--FDYYMI------------
Q1L2D2_9CIRC/1-237--DEG..GSFKYGTDVFTFTLEDVLNPT........................GGDSLKLP--FEDYKI------------
CAPSD_CACV/7-243--GTGG.SQLSFGTDGINIILDDFL.DW........................GTINWRLP--FEDYRI------------
Q0H9S8_9CIRC/4-236--GSGD.TTLKWATDGLNIMLDDFL.DW........................GTINWRLP--FEDYRI------------
Q06J73_9CIRC/8-245--AENA.GAFRFGTDGVTIILKDFF.PE........................GK...ELP--FEDYRI------------
Q9DXG3_BFDV/11-242--QTTSVGNLIFNADYITFALDDFL.QA........................VPNPHTLN--FEDYRI------------
Q69EZ5_BFDV/7-239--QTTATATMTWKSDYITFALSDFL.GN........................TTNPQTLN--FEHYRI------------
Q9DXG0_BFDV/11-242--QTTQPGNLIWNADYVTFTLENFL.TN........................TPNPSALN--FEDYRI------------
Q9DXF4_BFDV/3-235--QTTQTGQIIWNSDYVTFALSDFL.TA.........................PNPTGWP--FEDYRI------------

PF02956

A7VLZ2_9VIRU/1-506QPSGGGFGVERYTLEYLYKEHKAGNNVW---------TTSNVNLDLVRYTGCRFIFWRHP--HIDFVGVYSRNYPMQLQK
Q9WT88_9VIRU/1-603FPFGGGMSTVTFSLKALYDQYLKHQNRW---------TFSNDQLDLARYRGCKLRFYRSP--VCDFIVHYNLIPPLKMNQ
Q91CY9_9VIRU/1-581RPYGGSFSTTTWSLKLLFDEYLKFRNKW---------SYPNTELNLARYRGATFTFYRDP--KVDYIVVYNTVPPFKLNK
A7VLY0_9VIRU/1-515APGGGGFGAELFTLQYLYDEWVARRNIW---------TKTNDYKDLVRFTGATFYLYKHP--TTDFIFNYNNQPPFLLEK
Q9JGT1_9VIRU/1-585.PFGGGMTTDKFTLRILYDEYKRFMNYW---------TASNEDLNLCRYLGCTLYVFRHP--EVDFIIIINTSPPFLDTE
Q80QT8_9VIRU/1-595NPHGGGMSTVTFSLQVLYDQHQRFLNQW---------SYPNDQLDLARYRGCSFSFYRHP--EVDFIAQFDNVPPMKMDE
CAPSD_TTVB1/1-533EPGGGSWSILQMTTRVLYDEYKAARNWW---------TKSNSLLPLTKYIRCKLKFYRSD--QTDYIVTIQRTGPFEVTL
A7VM00_9VIRU/1-509VATGGGFGVELFSLKYLYQEYLARNNIW---------TSTNAYRDFCRYTGSSFTFFRHP--DTDFIIVYDIQPPFTINK
Q9JG61_9VIRU/1-534EPGGGGWSIMQITLRALYDEYEHYRNWW---------TTSNCGLPLVKYTGCSIKFYNSN--DTDYIVTVQRTGPFEVDR
Q91PS3_9VIRU/1-581.PFGGGISTMQFNLSILFDEYMKHRCTW---------SKSNVDLELIRYRGCSFKLYRHE--KCDFFFTYSRKPPFKDSQ
CAPSD_TTVV4/1-560.SYGGGMTTTMFNLKVPYEQFQLHQNFW---------TRSNIDLDLVRYHSVKFTFFRHP--KVDFIVKFNRNPPFTDSV
Q91C93_9VIRU/1-546VPGGGGFSISCFSLNTLYKEHLKLHNWW---------TKTNDNYPLIRYNGCTLKLFKSE--KVDYIFYYQRHYPMKASA
Q2F827_9VIRU/1-589SPYGGSFSTTTWNLRVLFDEHQKHHNTW---------SYPNNQLDLGRYKGCTFYFYRDK--KTDYIVKFQRRGPFKINK
Q91CY5_9VIRU/1-584KPHGGSFSTTTWSLKVCWDEHQKFMNRW---------SYPNTQLDLARYLGVTFYFYRDQ--KTDYIVQWSRNPPFKLNK
Q8V7G9_9VIRU/1-572ASYGGNLTNITITLGGLYEQYMLHRNHW---------SRSNYDLELARYLGFTLKCYRHA--TVDYILTYSRTTPFETNE
Q99A78_9VIRU/1-584.PFGGGMTTDKFTLRILYDEYCRFMNYW---------TASNEDLDLCRYRGCTLWFFRHP--DVDFIILINTMSPFLDTQ
Q6H9C2_9VIRU/1-573.PYGGGMTTTKFTLRILYDEFTRFMNFW---------TVSNEDLDLCRYVGCKLIFFKHP--TVDFIVQINTQPPFLDTH
CAPSD_TTVT1/1-433TILVGGCGVLTLSMDWFFFENLRWRNRW---------SHSNVGYDLARYMGTHLYFPPLA--DIWYIVWTDTEF.VDQPK
Q9JG80_9VIRU/1-589QAFGGALSTTSFSLKVLFDQHQRGLNKW---------SFPNDQLDLARYRGCKFYFYRTK--QTDWIGQYDISEPYKLDK
A7VLZ6_9VIRU/1-506SPYGGGFGVEQYSLNYLYEEYTFHNNYW---------TKSNILKDLCRFLWLKIIFFRDN--KTDFIVSYDRNPPFNLTK
Q6H9D2_9VIRU/1-557.PFGGGLSSMRFNMRILYDQFKRHLNFW---------THTNQDLDLVRYRGCTMTFYRHP--EVDFIVKFNRKPPFLDTI
Q6H999_9VIRU/1-471.PFGGGHSTMRFSLYILFEERLRHMNFW---------TRSNDNLELTRYLGASVKIYRHP--DQDFIVIYNRRTPLGGNI
Q77JT5_9VIRU/1-606DSFGGGLCTAQYTLRILFQEKLAQHNFW---------SASNEDLDLARYLGATIVLYRHP--TVDFLVRIRTSPPFEDTD
Q91PS7_9VIRU/1-585.PFGGGYSTMQFTLETLFDEWVKHRCTW---------SRSNKDLELVRYLGGSFTLYRHP--KCDFIFRYNRKPPFKDTQ
CAPSD_TTVV9/1-555ESYGGSFTIRKFTLQTLYEDYLKLRNRW---------SRSNTDLELIRYTGLNLRLYRHE--FSDYIVHYSLETPMEVGL
Q9JG47_9VIRU/1-553LHGGGGFTICNFSLMTLYQENLVCRNWW---------TKGNENMPLIRYLGCEITLYRQA--EVDYMVYVHNSYPMSANL
A7VLW0_9VIRU/1-507VPGGGGFGCELFTLRYLYKMYLARKNIW---------TFSNKYKDLVRYTGTRFTFFRHP--ETDFILAYDIQPPFHITK
Q0ZLH9_9VIRU/1-573.AAGGGFSTMLFTMQNLYEEYQKHRCRW---------SKSNQDLDLCRYLDCKLTFYRSP--NTDFIVGYNRKPPFIDTQ
Q5ENW7_9VIRU/1-501VQYGGGWGSGDVTLEGLYQEHLLWRNSW---------SKGNDGMDLVRYFGCVVYLYPLK--DQDYWFWWDTDFKELYAE
A7VLX2_9VIRU/1-509APGGGGFGCEVITLEYLYQQYKAHNCIF---------TASNHYKDPVRYTGCEIILYRHP--YVDFVVTYSNQPPFSINQ
Q80AR5_9VIRU/1-594EKFGGGMSTVTFSLFVLYDQYTRHLNRW---------SYPNDQLDLARYKGCKFKFYRDT--NTDFIVTYDINPPMKNTE
Q91CZ2_9VIRU/1-601FSFGGGLSTTSYSLKLLFDQNLRGLNRW---------TASNDQLDLARYLGAIFWFYRDQ--KTDYIVQYDISEPFKIDK
CAPSD_TTVG1/1-514YPGGGGFGVQLYSLEYLYDQWKLRNNIW---------TKTNQLKDLCRYLKCVMTFYRHQ--HIDFVIVYERQPPFEIDK
Q98Y63_9VIRU/1-581QSFGGSFSTTTWSLRVLFDEYQKFHNFW---------TYPNTQLDLCRYKYAIFTFYRDP--KVDYIVIYNTNPPFKINK
Q9QU36_9VIRU/1-529FPGGGGFGIIQFTLQGLYEQFIKATNWW---------TQTNCSLPLIRYNFCKLKFYRTA--NVDYVVKIIRCYPLKATH
A7VM12_9VIRU/1-509TPYGGGFGAEKFTLSYLYEEYTFHNNVW---------TATNLYKDLCRYLYCKIIFFRHP--DTDFVINYSRQPPWELSK
A7VLV6_9VIRU/1-508SPGGGGFGCEYITLEYLYKQWKAHNCIW---------TASNNYKDLCRYTGCTITLFRHK--YIDFIFCYSVMPPFDINK
Q9JG50_9VIRU/1-535KGGGGTWSIMVFSLGALYEEWERLNNVW---------TKTNNGLPFARYCGCRFKFYRQE--YYDYIVHYSICYPMTDTE
A7VLW4_9VIRU/1-507LPWGGGFSLQNYTLKYLYSEYTYHNNIW---------TSSNNQKDLCRYTGGYIKLFRHE--TQDFIISYDLQPPHELSK
A7VM04_9VIRU/1-513APGGGGFGCEQFSLDSLYADYKLRKNVW---------TKSNILLDLCRYLFVKISFYRHP--ETDFIVTWHRQPPFDISK
A7VLY4_9VIRU/1-498TPGGGGFGVEKYTLSHLYDQYKFGNNIW---------TKTNILTDLVQYLGCKFVFYRHQ--YVDFIVKYSRNLPMTIEK
CAPSD_TTVD1/1-324HVYPGGYGYGVFTLEAMYKEHLMKRNRW---------SRSNAGFDLGRYLGTWLTLVPHP--YFSYLFYYD..PEYGNTF
Q91CZ6_9VIRU/1-596FSFGGGFSTTTFTLKVLYDQHLRGMNKW---------STSNDILDLARYLGCDFYFYRDK--HTDYIVQYDTAAPFTIDK
A7VM08_9VIRU/1-506APAGGGFGVERFTLEYLYRQWKARNNIW---------TATNKNTDLVRYLGCRFSFYRHP--DTDFIVNFSRQPPFNIDK
CAPSD_TTVV3/1-573.PYGGGMTTTKFTLRILFDEYQRHLNFW---------TVSNQDLDLARYLGTKIIFFRHP--TVDFVVQIHTQPPFQDTE
Q91D00_9VIRU/1-593EKFGGGMSTVTFSLYVLYDQFTRHMNRW---------SYSNDQLDLARYRGCSFKLYRNP--TTDFIVQYDNNPPMKNTI
Q99AR5_9VIRU/1-604FPFGGGMSTTTFSLRGLYDQYTKHMNRW---------TFSNDQLDLARYRGCKFRFYRHP--TCDFIVHYNLVPPLKMNQ
Q9DTD2_9VIRU/1-559.AYGGGMTATQFTLRILYDEFQRHLNYW---------TASNNDLDLARYLGATITFFRHP--DVDFIVQIHTSPPFRDTE
Q91D04_9VIRU/1-591RPFGGSFSTTTWSLKVLWDEHTRFHNTW---------SYPNTQLDLARFKGVNFYFYRDK--DTDFIVTYSSVPPFKMDK
CAPSD_TTVV8/1-571.PFGGGMTTMQFSLRILYDEFLRFLNIW---------THSNQDLDLARYHGFKLTLYRHP--TVDFIVIIRNSPPFEDTE
Q5ENX0_9VIRU/1-603.SFGGSFGTETFSLRVLFDQYQRGFNKW---------SHTNKDLDLALYYGCRFRFYRHD--RTDFIVSFTNNPPMKTNQ
O90364_9VIRU/1-590.PFGGGMTTDKFTLRILYDEYKRFMNYW---------TASNEDLDLCRYLGVNLYFFRHP--DVDFIIKINTMPPFLDTE
Q9IFV0_9VIRU/1-583.PFGGGFSTLMFNLRILFDEYKKQRCRW---------SRSNDELELVRYLGCSFTLYREQ--NVDFLFKYNRRQPFSDSQ
Q9QUE7_9VIRU/1-586.PFGGGMATQKFTPRILYDDYKRFMNYW---------TSSNEDLDLCRYRGVTLYFFRHP--DVDFIILINTTPPFVDTE
A8DMR2_9VIRU/1-531FPSGGLFSITVFTLKGLYELHLKARNWW---------SISNCNLPLIKYRGCKITLYRNV--DVDYVTVYTRCGSLTATE
Q9DUH8_9VIRU/1-609GGFGGSFSLTTFNLRALYDEHMKGRNRW---------SHTNEDLELALYFGCRFTFYRHP--TTDFIVTFSNTPPMMSNQ
A7VLW8_9VIRU/1-511HPCGGGFSVDRFTLQWLYDQWRLRQNIW---------TKPNTYKDLCRFIVAKITLYRHK--TTDFIVQYSRQPPFLIDK
Q99AQ3_9VIRU/1-582QSFGGGLSTVSFSLKVLFDPNQRGLNRW---------SASNDQLDLARYTGCTFWFYRHK--KTDFIVQYDVSAPFKLDK

PF02247

POL2_SQMVM/246-618-------------------------------------NAIVWNPACEKAVELTFNPNPCG--DAWNFVFLQQTKAH..FA
POL2_CPMVS/460-832-------------------------------------DSMTWNPGCKKNFSFTFNPNPCG--DSWSAEMISRSRVR..MT
POL2_BPMV/447-819-------------------------------------DCELWNPACTKAMTMSFNPNPCS--DAWSLEFLKRTGFH..CD
Q9Z006_9SECO/476-846-------------------------------------QHYKWNPAIEPYVEFCFQAFFLC--RLVEHALFRVFQICSCGG
O12663_9SECO/321-691-------------------------------------QHYKWNPAIEPFVEFIFKPFSCA--DWWNMHYLGSFKCAPVVV
Q9YWK0_9SECO/363-735-------------------------------------DAIVWNPACEKAVELSFNPNPCS--DAWNFVFLQKTKAH..FA
POL2_CPSMV/437-806-------------------------------------DAMIWNPSCTKVMQYAFNPNPCS--DGWSLAFLERTGYH..CV
POL2_RCMV/407-778-------------------------------------DRILWNPACSKNCDFSFNPNPCG--TAWSLEFLRRTKFH..LS
Q9YWJ9_9SECO/452-824-------------------------------------DAIVWNPACEKAVELTFNPNPCG--DAWNFVFLQQTKAH..FA
Q66170_CPMVS/343-715-------------------------------------DSMTWNPGCKKNFSFTFNPNPCG--DSWSAEMISRSRVR..MT

PF03391

CAPSD_TRSV/179-344-------------------------------------PTMTWPIQL.GDTFAID--------------------------
POL2_RRVS/768-936-------------------------------------PTFVWPPKP.TDISLLK--------------------------
POL2_BRAV/1268-1433-------------------------------------PTLVLPQAFGGDLPLDL--------------------------
Q65029_ARMV/745-916-------------------------------------PNFIYSADA.FNGSLKF--------------------------
POL2_ARMVS/792-963-------------------------------------PNFIYSADA.FNGSLKF--------------------------
Q67703_GFLV/166-336-------------------------------------PTLVFDPGV.FNGKFQF--------------------------
POL2_GFLV/771-941-------------------------------------PTLVFDPGV.FNGKFQF--------------------------
POL2_BRSV/1007-1170-------------------------------------QPLSYPIEA.RHLTDLN--------------------------
POL2_GCMV/981-1144-------------------------------------SIVTYPISL.EHLKDIE--------------------------
POL2_TORVR/1497-1662-------------------------------------PFITLPHIF.NRLDIGY--------------------------
Q88483_9SECO/1003-1166-------------------------------------NPLTYPIKP.GHLEDLD--------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215----PTFVGS-----------------------------------E----RCRPGYTFTSITLKPPKID------RGSYY

PF01318

CAPSD_BMV/2-188----PLAAGQ-----------------------------------GKA-IKAIAGYSISKWEASSDAIT------AKATN

PF03566

Q80IX5_PRVFL/54-754AQSIDPSEGAVGWFYKYMDPAGAVESGKALGEFSKVPDGLLRYSVDAE-QRPIVTIECPTVSESDLPLD------GKLWR
CAPSD_NCBVS/1-608MMESPMAATSEAWIHDYLDPDGEYKTS.L..DDGKIPDGAIPQSTCGQ-FRGTVGARYPGLNSTTLPLD------GGTWP
CAPSD_HASV/2-647KGKIDLDSDSIGWYFKYLDPAGATESARAVGEYSKIPDGLVKFSVDAE-IREIYNEECPVVTDVSVPLD------GRQWS

PF01829

CAPSD_NODAM/42-399--SITFTPGK----------------------QTMLLVAPIPGIACLK-AEANVGASFSGVPLASVEFPGFDQLFGTSAT

PF08435

Q91H09_9CALI/305-535SDTFAPKIGQ------------------------VRFYSTS.....SD.FETNQPTHFTPIGIYIE---------GNSSD
Q8JMP1_9CALI/305-540SGKFTPKVGS------------------------IGLHSIT.....EH.VHPNQQSRFTPVGVAVN---------EN.TP
Q8B4Z2_9CALI/297-515QQNFTPALGH------------------------ITFDEEAP....ADLFRACFRNLWEPT.....---------....E
Q917X1_9CALI/305-538SDKYTPKLGL------------------------VQIGTWNT....ND..VENQPTKFTPIGLNEV---------ANGHR
Q9IV43_9CALI/304-537SSDFVPHLGS------------------------VSVTTAIDT..AGD.TLGTIQWTSQPSNVTPV---------P...D
Q8VA02_9CALI/306-539ESAFAPHLGT------------------------IQADGLSDVSVNTN.MIAKLGWVSPVSDGHKG---------....D
Q9IV49_9CALI/306-538GDQYAPKLAQ------------------------VKFFSES.....QD.FEVHQPTVFTPVGVAGD---------PS.HP
Q6EAX3_9CALI/306-538SSQFVPKLGS------------------------VNFGSTS.....TD.FQLQQPTKFTPVGIKIE---------SG.HE
Q8BAC6_9CALI/304-534GDTFAPKIGQ------------------------VRFKSSS.....DD.FDLHDPTKFTPIGVNVD---------DQ.HP
Q6WQW7_9CALI/296-512QQHFTPGIGQ------------------------VTLS........GDVPRVRSRARLDYVSSTSQ---------ES...
Q6B7R3_9CALI/303-535SEKFTPKLGT------------------------IGLHQVQ.....GH.HSQHQQSKFTPLGVAVN---------GN.TP
Q6EAW7_9CALI/305-538SAKYTPKLGS------------------------VQIGTWDT....ED.LLERQPVKFTPVGLNEI---------GQDKH
Q66418_9CALI/306-538ESAFAPHLGH------------------------VQADNLSAG.ANTD.LIVSLSWISPVSDQHRH---------....D
Q80FL2_9CALI/317-546TGRFTPKLGS------------------------LVISTDS.....ED.FQQNKPTRFTPVGVGVD---------RE.EE
Q9IV42_9CALI/305-535DASFVPYLGS------------------------ISLTTGETF.HAGD.IIGSLGWISSPRLIIHN---------SM...
Q6XDL5_9CALI/307-546SPKFTPKLGN------------------------IQFSTWET....QD.VSSGQPTKFTPVGLASV---------DANSH
Q6B7R2_9CALI/304-538GASFAPHLGS------------------------IEYTTSQNP..DGG.QLGTLTWISSPSDDTPG---------HG..T
Q917X4_9CALI/305-533SPKFTPKLGS------------------------VVLGTWED....RD.FDINQPTRFTPVGLYDT---------D...H
Q783W9_9CALI/306-535DPTFAPQIAQ------------------------VRFKSPS.....ND.FFDNEPIKFTPVGISVD---------SQ.NS
Q80J94_9CALI/309-538NADQAPYQGR------------------------VFASVTAAA..SLD..LVDGRVRAVPRSIYGF---------QD...
Q913B6_9CALI/305-540TAQYTPKLGQ------------------------IQIGTWQT....DD.LQVNQPVKFTPVGLNDT---------E...H
Q8JW44_9CALI/304-539VQGFVPHLGS------------------------IQFDEVFNH.PTGD.YIGTIEWISQPSTPPGT---------....D
Q83876_9CALI/301-524PDTSVPHLGS------------------------IQANGIGS....GN.YIGVLSWVSPPSHPSGS---------....Q
Q9IV48_9CALI/306-533KCPICTXLGS------------------------IEFTSDQDP..AGD.QLGTLAWVSPSTSGA..---------....R
Q8V713_9CALI/316-545AARFAPKLGF------------------------VVATVES.....TD.FHANQPSRFTPVGLGGD---------TN.RD
Q91I85_9CALI/304-538SQQFVPHLSS------------------------ITLDDNVSS..GGD.YIGTIQWTSPPSDSGGA---------....N
Q8JXJ0_9CALI/304-537SSSFVPHLGS------------------------VSFKENVNV..AGD.YVCTIQYTSPPSDPHNP---------NA..D
Q783X1_9CALI/315-545NPRYTPKLGS------------------------VLMYSES.....SD.FDDGQPTRFTPIGMGAD---------....D
Q783Y0_9CALI/305-533SAKFTPKLGA------------------------IQIGTWEE....DD.VHINQPTKFTPVGLFEN---------E...G

PF02226

POLG_HRV8A/2-69--------GS---------------------------------------------------------------------S
POLG_POL1M/2-69--------GS---------------------------------------------------------------------T

PF11492

Q7T7T5_HARNA/2003-2059----LPHIGA----------------------------------------------------------------------
POLS_CRPVC/291-340----IPVLGN----------------------------------------------------------------------
Q2HWK2_RSET1/357-413----VPIIGT----------------------------------------------------------------------
POLS_ABPVR/340-396----IPVIGE----------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------GN----------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------GN----------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452.SNGNYKFDQ----------------------MLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGS
POLS_DXV96/2-442SATSNWVFDQ----------------------YIYTAQELKDSYDYGRLISGSLSIKSSTLPAGVYALNGTFNAVWFQGT
POLS_BSNV/7-428.PQGSLIFDK----------------------AITTSQDLKKAYNYARLVSRIVQVRSSTLPAGVYALNGTFNGVTYIGS
POLS_IPNVJ/5-453LNQTALEFDQ----------------------WLETSQDLKKAFNYGRLISRKYDIQSSTLPAGLYALNGTLNAATFEGS

PF02248

Q66170_CPMVS/720-899-------------------------------------------------------------FSDVTAVTFDLINGKITPV
Q9YWJ9_9SECO/828-1009-------------------------------------------------------------QQNFASFTADLMESTISGD
POL2_CPMVS/837-1016-------------------------------------------------------------FSDVTAVTFDLINGKITPV
POL2_BPMV/821-1004-------------------------------------------------------------KQSFCQFSVDLLGGGISVD
POL2_CPSMV/808-988-------------------------------------------------------------TDGLFSFSIDLLGVELVTD
POL2_RCMV/786-964-------------------------------------------------------------LKDSGSFTCDLIGGGITTD
Q66179_APMV/2-185-------------------------------------------------------------KVNFAQYSLDLVNPTVSAN
POL2_APMV/802-985-------------------------------------------------------------KVNFAQYSLDLVNPTVSAN
POL2_SQMVM/622-803-------------------------------------------------------------QQNFASFTADLMESTISGD
Q9YWK0_9SECO/739-920-------------------------------------------------------------PQNFASFTADLMESTVSGD

PF03688

A5H0K4_GFLV/264-422-------------------------------------------------------------EIEIGSRFFDFT.......
POL2_BRSV/1176-1338-------------------------------------------------------------KVKIPSRIGNLS.......
Q86631_9SECO/418-544-------------------------------------------------------------TWMIPCRLSDYK.......
POL2_ARMV/344-502-------------------------------------------------------------EYVIGSRFFDIS.......
Q88483_9SECO/1172-1336-------------------------------------------------------------SLKIPARMANLT.......
A2ID55_9SECO/610-780-------------------------------------------------------------TILLPSRPATITRFGESSA
Q80JS8_BRAV/347-511-------------------------------------------------------------AFAIPARLSDLV.......
A0A9J6_ARMV/960-1118-------------------------------------------------------------EFVVGSRFFDFT.......
CAPSD_TRSV/351-511-------------------------------------------------------------NFDIPGYIHDFA.......
POL2_GCMV/1150-1316-------------------------------------------------------------KLTLPSRVCNIA.......
Q6XPY1_9SECO/164-322-------------------------------------------------------------ALKIPSRIANIE.......
Q6XFY6_9SECO/157-316-------------------------------------------------------------EYVIGSRFFDIS.......
Q9IV56_9SECO/980-1138-------------------------------------------------------------DIPIRARIYDIA.......
Q65624_9SECO/386-551-------------------------------------------------------------RFQIPARLSDLV.......
POL2_CNSV/1022-1185-------------------------------------------------------------KLKIWPVSNHLE.......
Q64959_9SECO/338-502-------------------------------------------------------------DFKIPSRIGNIG.......
Q20LA0_9SECO/942-1102-------------------------------------------------------------SFNIPGRIEDIR......A
A3FEN2_9SECO/348-507-------------------------------------------------------------RFEWPARLPDIL.......
Q9ELS0_9SECO/148-312-------------------------------------------------------------TIIVPNHICDWK.......
Q9QAH0_9SECO/350-510-------------------------------------------------------------VFNIPGRIEDII......A
Q24M89_9SECO/943-1103-------------------------------------------------------------SFSIPGRIEDMS......A

PF08462

Q5ZF43_CARMV/250-348-------------------------------------------------------------TYVVPSV------------
Q999Y9_CARMV/250-348-------------------------------------------------------------TYVVPSV------------
Q4JGW6_CARMV/250-348-------------------------------------------------------------TYVVPSV------------
Q8JJU7_CARMV/250-348-------------------------------------------------------------TYVVPSV------------
CAPSD_CARMS/250-348-------------------------------------------------------------TYVVPSV------------
Q999Z1_CARMV/250-348-------------------------------------------------------------TYVVPSV------------
CAPSD_CARMV/250-348-------------------------------------------------------------TYVVPSV------------
Q7TG55_CARMV/250-348-------------------------------------------------------------TYVVPSV------------

PF00729

CAPSD_PNLV/47-266------KVGI---------------EYQV------------------------SVVPLVP..CIQHTWLSGV--------
CAPSD_MCMVK/23-222------PVCA---------------GIDF------------------------PA.GTSPRYIGAAKWLAAQ--------
CAPSD_PMVK/39-236------PIIP---------------RLSV------------------------PA.GDKPIYSGSAPHLRTI--------
CAPSD_RCNMV/24-213------RTNN---------------GKSN------------------------QRFRLNPSNPALFPTLAYE--------
CAPSD_CARMS/51-245------....---------------..SF------------------------EDWVVSPRNVAVFPQLSLL--------
CAPSD_SBMVA/46-262------SVTN---------------AIVI------------------------TSELVMP..YTMGTWLRGV--------
CAPSD_TBSVC/76-269------QVNG---------------GIVG------------------------NLLQLNPLNGTLFSWLPAI--------
CAPSD_POLVP/66-257------VVNG---------------GVSG------------------------NLYRINPSNPVVFPWLQGI--------
CAPSD_OCSVU/111-308------RCTG---------------....------------------------..YRANPGMSTIFPWLSAT--------
CAPSD_TNVA/61-272------GAFN---------------TTNS------------------------ALIAAAP......SWLASI--------

PF11729

CAPSD_SJNNV/1-340IAQAVVPAGT---------------GTDG------------------------KIVVDSTIVPELLPRLGHA--------

PF00894

CAPSD_PLRV1/70-207-------------------------------------------------------FTFGPSLSDCPAFKDGI--------
CAPSD_PEMVW/53-187-------------------------------------------------------VKFGPS.SDCQCIK.GN--------
CAPSD_BYDVP/62-199-------------------------------------------------------IKFGPSLSQCPALSDGI--------

PF03014

CAPSD_HEVCH/41-659APAHDTPPVP---------------DVDSRGAILRRQYNLSTSPLTSSVATGTNLVLYAAPLSPLLPLQDGTNTHIMATE

PF03115

CAPSD_HASV1/1-416AICQRATATL---------------GTVG--------SNTSGTTEIEACILLNPVLVKDATGSTQFGPVQAL--------

PF00983

COAT_TYMV/8-177------VLFA---------------GTKD---------------------------AEASLTIANIDSVSTL--------

PF00073

Q9WMA0_9PICO/49-215EKFF---------------------------------------------------------LIHSADWLTTHALFHEVAK
POLG_AEVCA/45-212ERFF---------------------------------------------------------LIDQREWNSTQSEWQLLGK
POLG_CXA9/93-300CRFY---------------------------------------------------------TLDSIKWEKGSVGW.....
POLG_CXB3N/93-302CRFY---------------------------------------------------------TLDSVQWQKTSPGW.....
POLG_CXB4J/93-300CRFY---------------------------------------------------------TLNSVKWEMQSAGW.....
POLG_CXA21/93-308NRFY---------------------------------------------------------TLESVSWKTTSRGW.....
POLG_POL1M/93-308CRFY---------------------------------------------------------TLDTVSWTKESRGW.....
POLG_POL3L/93-307CRFY---------------------------------------------------------TLDTVMWGKESKGW.....
POLG_HE701/93-288DRFY---------------------------------------------------------TLKSKKWESNSTGW.....
POLG_BOVEV/93-285DAFY---------------------------------------------------------TLRSKPWQADSKGW.....
POLG_HRV14/93-299CRFY---------------------------------------------------------TLDSKTWTTGSKGW.....
POLG_HRV2/93-302NRFY---------------------------------------------------------TLRSVTWSSSSKGW.....
POLG_HRV8A/93-302NRFY---------------------------------------------------------TLDSRSWTSASSGW.....
POLG_HRV1B/93-301NRFY---------------------------------------------------------TLESKHWNGDSKGW.....
POLG_FMDV1/311-475ERFF---------------------------------------------------------KKFLFDWTTDKPFGY....
POLG_FMDVT/311-475ERFF---------------------------------------------------------KMALFDWVPSQNFGH....
POLG_FMDVO/311-475ERFF---------------------------------------------------------KTHLFDWVTSDSFGRCH..
POLG_EMCV/161-359KRFW---------------------------------------------------------RWKGTTPSRLMIGHQHKSP
POLG_TMEVB/172-382ERYY---------------------------------------------------------TIDLASWTTSQEAFS....
POLG_ENMGO/162-361ERYY---------------------------------------------------------TFKVNDWTSTQKPFE....
POLG_FMDVO/533-691..PY---------------------------------------------------------VTTKTDSDRVLAQF.....
POLG_FMDV1/533-692...Y---------------------------------------------------------VVTRADDTRLLAKF.....
POLG_EMCV/420-582.AVP---------------------------------------------------------YIEASNTAVKTQPLA....
POLG_TMEVB/443-606KRYP---------------------------------------------------------YFSATNSVPATSMV.....
POLG_HE701/347-515VERL---------------------------------------------------------RVQISAQSDMDQLLF....
POLG_HRV2/358-522ENMY---------------------------------------------------------SVVLQSSINAPDKIF....
POLG_HRV8A/364-529VNMY---------------------------------------------------------TVDLRTQVDLAKEVF....
POLG_HRV1B/360-525ISMY---------------------------------------------------------TVQLGNQMDMAQEVF....
POLG_BOVEV/345-515VERY---------------------------------------------------------VIPVSVQDALDAQIY....
POLG_CXA21/369-534MEMY---------------------------------------------------------QIPLNDNLSKAPIF.....
POLG_CXA9/358-524MEMF---------------------------------------------------------RIPVTINAPLQQQVF....
POLG_CXB4J/358-524MEAY---------------------------------------------------------RVQVRSTDEMGGQIF....
POLG_CXB3N/360-526MEAY---------------------------------------------------------QIPVRSNEGSGTQVF....
POLG_CXB1J/360-526LKAY---------------------------------------------------------QIPVQSNSDNRRQVF....
POLG_FMDVO/725-872VSFI---------------------------------------------------------MDRFVKVTPQNQINI....
POLG_FMDV1/726-878VGFI---------------------------------------------------------MDRFVKINSLSPTHV....
POLG_BOVEV/610-775.GMP---------------------------------------------------------LLATGTSIT..........
POLG_HRV8A/621-792EFNT---------------------------------------------------------SSDKTEHDKIGKGFK....
POLG_HRV2/614-772VTLA---------------------------------------------------------NYNKENFT...........
POLG_HRV1B/627-786ISRI---------------------------------------------------------KVDYNDYNGVNKNFT....
POLG_HE701/609-781SFEY---------------------------------------------------------KNHSTSTSSIQKNFF....
POLG_HRV14/614-787IQNK---------------------------------------------------------DATGIDNHREAKLFN....
POLG_CXA9/612-783..YM---------------------------------------------------------EEYKTTDKHVNKKFV....
POLG_CXB4J/612-783..IY---------------------------------------------------------IKYSSAESNNLKRYA....
POLG_SVDVU/612-782...F---------------------------------------------------------YTTYKNHDSDGDNFA....
POLG_CXB3N/630-782...Y---------------------------------------------------------FTEYKN..SGAKRYA....
POLG_POL1M/636-806.TIM---------------------------------------------------------TVDNPASTTNKDKLFA...
POLG_CXA21/642-812.TIL---------------------------------------------------------SLTNSSKSGEEKKHFN...
POLG_CXA24/646-809LEVE---------------------------------------------------------NFNATTEADKKKQFT....

PF00915

CAPSD_VESVA/137-421TFFS---------------------------------------------------------YHTSINWSTVESQ...GKV
POLG_RHDVF/1768-2065TNFY---------------------------------------------------------YNDVFTWSVADAP...GSI
CAPSD_FCVUR/112-395AFFS---------------------------------------------------------FHTSVNWSTSETQ...GKI
CAPSD_NVN68/2-294INNF---------------------------------------------------------VQAPQGEFTISPNNTPGDV

PF08762

Q8B107_ALPV/599-804STKN---------------------------------------------------------NNLYRINSFKTPKPI....
O56051_9VIRU/590-790..TP---------------------------------------------------------PTQNRYWEFTQPFWINTNR
Q56QP7_9VIRU/684-855....---------------------------------------------------------ITLDRAGQILSERVY....
O36967_9VIRU/668-900SDAP---------------------------------------------------------NTLIAPFSVQHPTPV....
Q5UBY1_9VIRU/79-259PNTK---------------------------------------------------------TALTDLTDVAD........
Q6ITS9_9VIRU/106-313KRIS---------------------------------------------------------DTFDINSLIEAPRLDIAQY
Q4JFT2_9VIRU/834-1009.SSP---------------------------------------------------------VDILRGDLVTLPGIS....

PF02443

Q5Y4T0_PCV2/5-226---------------------------------------------RKVKVEFWPCSPITQ.GDR----------------
Q27W03_PCV1/5-227---------------------------------------------RKAKYEFYPRDPITS.NQR----------------
A3FEQ4_9CIRC/3-256---------------------------------------------KGVAVTLRPAYNIYQ.KSK----------------
Q3HUU1_GOCV/5-247---------------------------------------------RMVKVELRPAYNPFT.RVR----------------
Q1L2D2_9CIRC/1-237---------------------------------------------VLVKVEMRPLGENST.EWK----------------
CAPSD_CACV/7-243---------------------------------------------RLAKVEMRPLNESWE.EWK----------------
Q0H9S8_9CIRC/4-236---------------------------------------------RLAKFEMRPLNENWG.SWH----------------
Q06J73_9CIRC/8-245---------------------------------------------RLAKVEGIPRREDWT.HWE----------------
Q9DXG3_BFDV/11-242---------------------------------------------KLAKMEMRPTGGHYTVQSD----------------
Q69EZ5_BFDV/7-239---------------------------------------------KLAKMEMRPTYGFGSITQE----------------
Q9DXG0_BFDV/11-242---------------------------------------------KLAKMEMKPTWGHYSIATE----------------
Q9DXF4_BFDV/3-235---------------------------------------------KLAKMEMKPTWGHSYTNSE----------------

PF02956

A7VLZ2_9VIRU/1-506YTYPDTHPQQ---------------IMLAKHKFFIPSLLTKPHGKRYVKIKIKPPTQMSN-KWFFQEGFSDTGLVQIHTA
Q9WT88_9VIRU/1-603FTSPNTHPGL---------------LMLSKHKIIIPSFQTRPGGRRFVKIRLNPPKLFED-KWYTQQDLCKVPLVSITAT
Q91CY9_9VIRU/1-581YSCPMLHPGM---------------MMQYKKKVLIPSYQTKPKGKAKIRLRIKPPVLFED-KWYTQQDLCPVNLLSLAVS
A7VLY0_9VIRU/1-515DFYNDLHPQM---------------LLLAKHHRVIPSRQRKPLGKPYIKVKIKPPKQMLT-EWFFQQDFATQGLFSIHAA
Q9JGT1_9VIRU/1-585ITGPSIHPGM---------------MALNKRARWIPSLKNRPGRKHYVKIKVGAPRMFTD-KWYPQTDLCDMTLLTIFAS
Q80QT8_9VIRU/1-595LTAPNTHPAL---------------LLQSKKKVKIYSWKTRPWGKKKVTVRVGPPKLFED-KWYSQHELCKVPLVSWRLT
CAPSD_TTVB1/1-533ESYLSTQPSR---------------HLMNHKAFIVPKLGRGPNKETYVKKIVRPPALFQS-KWYFSQDIYNTPLFILTVS
A7VM00_9VIRU/1-509HTYMMTHPHF---------------LLQRKHKKILLSKSTNPNGKLTKRIKIKPPKMLQT-KWYFQEELAEFGLVAIHAA
Q9JG61_9VIRU/1-534DSYLNTQPSR---------------HMMNKNSFIVPKLNPNKKRKPYIRKKYKPPALLQN-KWYFAQDILNTPLILFTTS
Q91PS3_9VIRU/1-581LTGPSLHPGM---------------LMNRRKKIILLSFKTRPKGHSTKTIRIPPPTLFAD-RWYFQKDFAKVPLVNIGAS
CAPSD_TTVV4/1-560LTGPMLHPGV---------------LMNSKRKILIPSWETRPRGKKRIPVRIGPPRLFTD-HWYFQRDFCGVPLLTVNAT
Q91C93_9VIRU/1-546LMYTSTQPQI---------------LLLNNRKRIVKCKANNKKTKPYIRLRIPPPSQLKT-KWYFQRDIANLPLLLTIAT
Q2F827_9VIRU/1-589YSSPMAHPGM---------------MMLDKMKILVPSFDTRPGGRRRVKVTIRPPTLLED-KWYTQQDLAPVNLVSLVVS
Q91CY5_9VIRU/1-584YSSPMYHPGM---------------MMQARKKLMVPSFQTRPRGRKRYRVRIRPPNMFAD-KWYTQEDLCPVPLVQLVVS
Q8V7G9_9VIRU/1-572LSHMLTHPLL---------------MLLNKHHRVIPSLKTRPKGKRSVRIHIKPPKLMIN-KWYFAKDLCNIGPCQIYAT
Q99A78_9VIRU/1-584LTGPSIHPGL---------------MALNKRARWIPSLKSRPGRKHVVKIRVGAPRMFTD-KWYPQSDLCDLPLLTIFAS
Q6H9C2_9VIRU/1-573LTAASIHPGI---------------MMLSKRHILIPSLKTRPSRKHRVVVRVGAPRLFQD-KWYPQSDLCDTVLLSIFAT
CAPSD_TTVT1/1-433KVMSYTHPWI---------------LLMTKKHKVIKPRKWNGKGK...KIFLKPPAVFNS-AWYTSDKWCGAGLGRIYFS
Q9JG80_9VIRU/1-589YSCPNYHPGN---------------LIKAKHKFLIPSYDTNPKGRQKIIVKIPPPDLFVD-KWYTQEDLCSVNLVSLAVS
A7VLZ6_9VIRU/1-506FTYPGAHPQQ---------------MLLQKHHKLILSQMTKNPNKLTKKFKIKPPRQMIS-KWFFTKPFAKYPLLSLKAS
Q6H9D2_9VIRU/1-557VSGPAMHPGM---------------LMTTKHKILVKSFKTKPKGKGTVKVRIRPPTLFDD-RWYFQHDICKTTLFTISAT
Q6H999_9VIRU/1-471YTAPSLHPGN---------------AILAKHKILVPSLQTRPKGRKAIRLRIAPPTLFTD-KWYFQKDIADLTLFNIMAV
Q77JT5_9VIRU/1-606MTAMTLHPGM---------------MMLAKKTIKIPSLKTRPSRKHVVRIRVGAPKLFED-KWYPQNELCDVTLLTIQAT
Q91PS7_9VIRU/1-585ITGPSLHPGI---------------LMTRRKKKIIKSFLTRPRGRATKRVRFKPPTLYTD-KWYFQKDICNLPLVNIAAS
CAPSD_TTVV9/1-555ESHMLAHPLK---------------MIMSSKHVTVPSLLTKKGGRRYLRLKIPPPKLMMT-QWYFQKEFCQVGLVLLSIS
Q9JG47_9VIRU/1-553LTYQSTCPQV---------------MLMNNRTKIMPCKRYNRNKKPYKKFFVKPPSQLQN-KWYFQKELSNVPLMQVMAT
A7VLW0_9VIRU/1-507WTYMSIHPQM---------------LLLRKHKKLLLSTATKPNGKLTTRFKIRPPKQLVT-KWFFQKDFAQYGLVAIAAA
Q0ZLH9_9VIRU/1-573ITRCTLHPGM---------------LIQERKKVIIPSFQTRPKGRIKRKIKVRPPTLFTD-KWYFQRDLCKVPLVTVSAS
Q5ENW7_9VIRU/1-501NIKEYSQPSV---------------MMMAKRTRIVIARERAPHRRKVRKIFIPPPSRDTT-QWQFQTDFCNRKLFTWAAG
A7VLX2_9VIRU/1-509FTYPDIHPQN---------------LLLRKHKKIVLSRATKPHGKLTVKIKIKPPKLLST-RWFFQKEMSSVPLVQLSAA
Q80AR5_9VIRU/1-594LSGPNTHPGM---------------LMQQKRKILVPSWDAYPKGRKYVLAKIPPPKLFED-HWYTQPDLCKVPLVTLRST
Q91CZ2_9VIRU/1-601DSSPSFHPGI---------------LMKSKHKVLVPSFQTWPKGRSKVKLKIKPPKMFVD-KWYTQEDLCTVTLVSLVVS
CAPSD_TTVG1/1-514LTYMKYHPYM---------------LLQRKHKIILPSQTTNPRGKLKKKKTIKPPKQMLS-KWFFQQQFAKYDLLLIAAA
Q98Y63_9VIRU/1-581YSSPFLHPGL---------------MMLQKKKILIPSFQTKPGGKSRIKVKIKPPALFED-KWYTQQDLCPVNLLSLAVS
Q9QU36_9VIRU/1-529DLYMQTQPSI---------------LMRDKHSILIPCMKNGRNRKTYKTIKVRPPTQMTN-GWFFQKDLCNFPLLVILAT
A7VM12_9VIRU/1-509YTYPSCHPHQ---------------MLLDKHKVVIFSQASKPHGKYKYKLRIKPPKQLIT-KWFFTKPFSNYGLLFLKGS
A7VLV6_9VIRU/1-508LTYPDIQPQN---------------LLLRQRHKLILSQASNPKGKLRVKVKIKPPKTMQT-KWYFQKQIAELPLVQLQAA
Q9JG50_9VIRU/1-535DQHLNSQPHR---------------LIQGRKKIVVHRYNKQIHKKPYVKKRIRPPAMLQS-HWYFQQEICNTGLLLITTS
A7VLW4_9VIRU/1-507YTFPSCHPHQ---------------MLLQKRHKILLSKQSNPNGKLYKKIKFKPPKQMIN-KWLFTKNFTPASLIVLKTA
A7VM04_9VIRU/1-513EIYAACHPQN---------------MLLAKHKMLILSKFTNPKGKLKKTRKVKPPKQMLN-KWFFQEHFSHEPLLMIQAT
A7VLY4_9VIRU/1-498LTYPHTHPQA---------------LLLSRHKRIIPSRVTKPHGKNRVIIKIKPTRVVLK-KWFFQETFDTTGLCSIYAA
CAPSD_TTVD1/1-324EFKKLIHPAI---------------MITHPKTILVLSNKRGGNRRKWPRMWIPRPAIFAD-GWEFQKDLCQHGLFAFGWA
Q91CZ6_9VIRU/1-596DSSANYHPGV---------------LIKARKKVLVPSYDTHPKGRAKIKIHIEPPKMFVD-KWYAQHDLCDVELVSFVVS
A7VM08_9VIRU/1-506YTYMSMQPQE---------------MLLGKHKKIILSKLTKPTGRIKHTLKIGPPKLLTN-KWMFQEQFATQDLVQIAGT
CAPSD_TTVV3/1-573ITAPSIHPGM---------------LILSKKHILIPSLKTRPSKKHYVKVRVGAPRLFQD-KWYPQSELCDVTLLVIYAT
Q91D00_9VIRU/1-593LSSPNTHPGM---------------LMQQKHRILVPSWQTFPRGRKYVKVKIPPPKLFED-HWYTQPDLCKVPLVTLRST
Q99AR5_9VIRU/1-604FTSPNTHPGL---------------LMLTKHKIIIPSFLTRPGGRRFVKIRLPPPKLFED-KWYTQQDLCKQPLVTLTAT
Q9DTD2_9VIRU/1-559MTGPSIHPGM---------------LMLKKHRLLIPSLKTRPGRKHRITVRIGAPKTFED-KWYPQTDLCDVILVVIYAT
Q91D04_9VIRU/1-591YSSAMLHPGT---------------LMQRKKKILIPSFTTRPRGRKKVKLHIKPPVLFED-KWYTQQDLCDVNLLSLAVS
CAPSD_TTVV8/1-571LTGPNTHPGM---------------LMLRHKKILVPSLRTRPSRRHKITVRIGPPKLFED-KWYSQTDICDVILATVYAT
Q5ENX0_9VIRU/1-603YTAPMTHPGM---------------LMRAKHKILIPSRLTRPRGKKYISVRIRPPKLFQH-KWYTQSDLCSVSLVQLNLT
O90364_9VIRU/1-590LTAPRLHPGM---------------LALDKRARWIPSLKSIPGKKHYIKIRVGAPKMFTD-KWYPQTDLCDMVLLTVYAT
Q9IFV0_9VIRU/1-583LTGPSLHPGI---------------IMKQKRKVIVPSYKTKPKGRPVKRIRIKPPTLFTD-RWYFQKDFSNFPLVTISAS
Q9QUE7_9VIRU/1-586ITGPSIHPGM---------------MALNKRARFIPSLKTRPGRRHIVKIRVGAPKLYED-KWYPQSELCDVPLLTVYAT
A8DMR2_9VIRU/1-531ELYRSCQPSL---------------LLLNKHKKVLTCKKNNNKRKISKTIKIPPPTLMQN-KWYFQKDFAKYPLVMILSA
Q9DUH8_9VIRU/1-609YTAPLAHPGM---------------LMRSKYKLLLPSFKTRPGGKKTVSVRIRPPKLFNH-KWYAQSDLCDVNLVQFTVT
A7VLW8_9VIRU/1-511WTYMQYHPYM---------------LLQSKHTKIIPSEQTNPKGRLKKKLIIRPPKQMLS-KWFFQRQFATADLFQLVTA
Q99AQ3_9VIRU/1-582NSCPSYHPFM---------------LMKAKHKVLIPSFDTKPKGREKIKLRIQPPKMFID-KWYTQEDLCPVILVTLVAT

PF02247

POL2_SQMVM/246-618VQCVTGWTTT---------------PLTDLALVLTWHIDRSLCVPKTLTISSAHASFPIN-RWMGKLSFPQGPARVLKRM
POL2_CPMVS/460-832VICVSGWTLS---------------PTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLN-RWMGKLTFPQGVTSEVRRM
POL2_BPMV/447-819IICVTGWTAT---------------PMQDVQVTIDWFISSQECVPRTYCVLNPQNPFVLN-RWMGKLTFPQGTSRSVKRM
Q9Z006_9SECO/476-846HTDIVQVAER---------------SEVDARISFAIYYEPTITLPKQIATLEHAPAFMFR-KELGTLAFKQG.ELVAYSF
O12663_9SECO/321-691IQTLSKWLNS---------------PKVDARISFAIYYEPSIVLPKQIATLEHAPAFMFR-KELGTLAFKQG.ERVAYSF
Q9YWK0_9SECO/363-735VQCVTGWTTT---------------PLTDLALVLTWHIDRNLCVPETLTISSAHASFPIN-RWMGKLSFPQGPARVLKRM
POL2_CPSMV/437-806VTCVTGWTGT---------------PLQDTFMTINWHISREACVPKIYTIFDPEPDMMLN-RWMGRAIFPQQSTQVVRRM
POL2_RCMV/407-778VTCVSGWSAQ---------------PQTDIAMTMDWYVSNKPCVPCIYNVGTPGQNVWVN-RWMGKLSFPQGSQNQLKQM
Q9YWJ9_9SECO/452-824VQCVTGWTTT---------------PLTDLALVLTWHIDRSLCVPKTLTISSAHASFPIN-RWMGKLSFPQGPARVLKRM
Q66170_CPMVS/343-715VICVSGWTLS---------------PTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLN-RWMGKLTFPQGVTSEVRRM

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------RYYEAKEIKLDGSTSMLS
POL2_RRVS/768-936--------------------------------------------------------------EVWGPYRFTLDGTEAKES
POL2_BRAV/1268-1433--------------------------------------------------------------WRGPYTFPLGGGTKRLST
Q65029_ARMV/745-916--------------------------------------------------------------LTIPPLEYDLSATSAYKS
POL2_ARMVS/792-963--------------------------------------------------------------LTIPPLEYDLSATSAYKS
Q67703_GFLV/166-336--------------------------------------------------------------LTCPPIFFDLTAVTALKS
POL2_GFLV/771-941--------------------------------------------------------------LTCPPIFFDLTAVTALRS
POL2_BRSV/1007-1170--------------------------------------------------------------LMLAPKQIAVGTYAMITF
POL2_GCMV/981-1144--------------------------------------------------------------IMLPPRQMAIGNAGSINF
POL2_TORVR/1497-1662--------------------------------------------------------------WRGPTEIDLTSTPAPNAY
Q88483_9SECO/1003-1166--------------------------------------------------------------LVLKSGSIAIGTYTMTKV

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------AAFLGKVTCAKDAKGGTL
Q9QAH4_9SECO/9-99--------------------------------------------------------------LLYYESVDVPKDTLAGTL
Q09G89_GFLV/608-698--------------------------------------------------------------LAGRGVIYIPKDCQANRY
Q9JGK5_SDV/160-249--------------------------------------------------------------HLFTKNLEIPSTADFCKE
Q9IV56_9SECO/636-727--------------------------------------------------------------LVGVKWVSVPKDAKQSAF
A1YYW2_BRAV/156-247--------------------------------------------------------------LAFAKMYQCKKDAKAGHV
Q65624_9SECO/45-137--------------------------------------------------------------IAHVVQGWVPKDATKGRV
Q6JX06_9SECO/849-939--------------------------------------------------------------FVFVHTIDLPNAVTVGTV
Q20LA0_9SECO/601-691--------------------------------------------------------------LLYYESVNVPRDTLEGTR
POL2_BRSV/842-932--------------------------------------------------------------YAFGETIELPATVTPGTV
A0A9J8_ARMV/580-670--------------------------------------------------------------LAGRGSVQVPKDCQAGKY
Q6JX05_9SECO/604-694--------------------------------------------------------------LAGRGSVQVPKDCRKDAF
Q9Z0D6_SDV/74-163--------------------------------------------------------------HLFTENLAIPSTADFCKE
Q9QRA5_9SECO/10-101--------------------------------------------------------------AAYVGRVTCAKDAKGGTL
Q86631_9SECO/85-173--------------------------------------------------------------WSAVTPFKCAAEAAENTI
POL2_GCMV/815-905--------------------------------------------------------------FAFIHTIDLPTAVTEGQV
A2ID55_9SECO/270-361--------------------------------------------------------------LMSATSYNVSKDVAAGVV
Q64959_9SECO/4-94--------------------------------------------------------------FAFSQRITYPAARTVGTV
Q8B5P7_TRSV/12-103--------------------------------------------------------------CCGTLSFKVPKDAKKGKH
Q88483_9SECO/838-928--------------------------------------------------------------FACGETIILPATSASGSI
POL2_CNSV/688-778--------------------------------------------------------------FVFTQLITVPAASTKGNV

PF00760

CAPSD_CMVFN/11-215GKRLLLPD------SV-TEY------------------------------------------------------------

PF01318

CAPSD_BMV/2-188AMSITLPH------ELSSEK------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754VSFISFPAFRLNFIALANIN------------------------------------------------------------
CAPSD_NCBVS/1-608LLVMHLPFFRHPLLFITTTS------------------------------------------------------------
CAPSD_HASV/2-647LSIFSFPMFRTAYVAVANVE------------------------------------------------------------

PF01829

CAPSD_NODAM/42-399DTAANVTAFRYASMAAGVYP------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535FNQWQLPRYGGHLANNNHLA------------------------------------------------------------
Q8JMP1_9CALI/305-540FQQWVLPHYAGSLALNTNLA------------------------------------------------------------
Q8B4Z2_9CALI/297-515HSFWRIPDYRADV.LGSDFA------------------------------------------------------------
Q917X1_9CALI/305-538FEQWTLPRYSGALTLNMNLA------------------------------------------------------------
Q9IV43_9CALI/304-537VNFWTIPQYGSSLAEASQLA------------------------------------------------------------
Q8VA02_9CALI/306-539VDPWVIPRYGSTLTEAAQLA------------------------------------------------------------
Q9IV49_9CALI/306-538FRQWTLPRYGGHLTNNIHLA------------------------------------------------------------
Q6EAX3_9CALI/306-538FDQWALPRYSGHLTLNMNLA------------------------------------------------------------
Q8BAC6_9CALI/304-534FRQWSLPNYGGHLALNNHLA------------------------------------------------------------
Q6WQW7_9CALI/296-512..FWVLPDYRTDV.LGSEFA------------------------------------------------------------
Q6B7R3_9CALI/303-535FRQWELPNYSGALTLNTNLA------------------------------------------------------------
Q6EAW7_9CALI/305-538FDQWVLPNYSGALGLNMHLA------------------------------------------------------------
Q66418_9CALI/306-538VDPWVIPRYGSSLTEAAQLA------------------------------------------------------------
Q80FL2_9CALI/317-546FDQWSLPDYSGPITHNMNLA------------------------------------------------------------
Q9IV42_9CALI/305-535..FGTIPKYGSSLPDVTHLA------------------------------------------------------------
Q6XDL5_9CALI/307-546FDQWTLPSYSGALTLNMNLA------------------------------------------------------------
Q6B7R2_9CALI/304-538INLWKIPSYGSTVTESVHLA------------------------------------------------------------
Q917X4_9CALI/305-533FNQWALPNYSGALTLNMNLA------------------------------------------------------------
Q783W9_9CALI/306-535YNQWLLPRYGGHLTNNTHLA------------------------------------------------------------
Q80J94_9CALI/309-538....TIPEYNDGL..LVPLA------------------------------------------------------------
Q913B6_9CALI/305-540FNQWVVPRYAGALNLNTNLA------------------------------------------------------------
Q8JW44_9CALI/304-539INLWEIPDYGSSLSQAANLA------------------------------------------------------------
Q83876_9CALI/301-524VDLWKIPNYGSSITEATHLA------------------------------------------------------------
Q9IV48_9CALI/306-533VDPWKIPSYGSTVTESTHLA------------------------------------------------------------
Q8V713_9CALI/316-545FNQWQLPAYGGALTNNTNLA------------------------------------------------------------
Q91I85_9CALI/304-538TNFWKIPDYGSSLAEASQLA------------------------------------------------------------
Q8JXJ0_9CALI/304-537VDFWSIPDYGSNLAEASQLA------------------------------------------------------------
Q783X1_9CALI/315-545WHQWELPEYSGHLTLNMNLA------------------------------------------------------------
Q783Y0_9CALI/305-533FNQWTLPNYSGALTLNMGLA------------------------------------------------------------

PF02226

POLG_HRV8A/2-69LNYFNINYFKDAASSGAS--------------------------------------------------------------
POLG_POL1M/2-69INYTTINYYRDSASNAAS--------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191TGVINYNFYSNSYTDAVDL.------------------------------------------------------------
Q9DLK1_FMDVP/202-285TGSIINNYYMQQYQNSMDTQ------------------------------------------------------------

PF01766

POLS_IBDVU/9-452LSELTDVSYNGLMSATANIN------------------------------------------------------------
POLS_DXV96/2-442LSEVSDYSYDRILSITSNPL------------------------------------------------------------
POLS_BSNV/7-428LSEIKDLDYNSLLSATANIN------------------------------------------------------------
POLS_IPNVJ/5-453LSEVESLTYNSLMSLTTNPQ------------------------------------------------------------

PF02248

Q66170_CPMVS/720-899GDD.NWNTHIYNPPIMNVLR------------------------------------------------------------
Q9YWJ9_9SECO/828-1009STG.NWNITVYPSPIANLLK------------------------------------------------------------
POL2_CPMVS/837-1016GDD.NWNTHIYNPPIMNVLR------------------------------------------------------------
POL2_BPMV/821-1004KTG.DWITLVQNSPISNLLR------------------------------------------------------------
POL2_CPSMV/808-988GQE.GAVSVLSSSPVANLLR------------------------------------------------------------
POL2_RCMV/786-964SNT.GWNLTALNTPVANLLR------------------------------------------------------------
Q66179_APMV/2-185ASGRNWRFVLIPSPMVYLLQ------------------------------------------------------------
POL2_APMV/802-985ASGRNWRFVLIPSPMVYLLQ------------------------------------------------------------
POL2_SQMVM/622-803STG.NWNITVYPSPIANLLK------------------------------------------------------------
Q9YWK0_9SECO/739-920STG.NWSITAYPSPISNLLK------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422.SS-TCRVAMGENPFAAMIA------------------------------------------------------------
POL2_BRSV/1176-1338.SK-HVKVTNFVNALAILCA------------------------------------------------------------
Q86631_9SECO/418-544.VE-GATLKMEAHPLARLVA------------------------------------------------------------
POL2_ARMV/344-502.ST-TSTVALGDNPFAHMIA------------------------------------------------------------
Q88483_9SECO/1172-1336.SK-EVQVTNFVNALAIMCA------------------------------------------------------------
A2ID55_9SECO/610-780ENR-NFTATINANPFHYILN------------------------------------------------------------
Q80JS8_BRAV/347-511.LT-CGEVTMSTNPLALLIG------------------------------------------------------------
A0A9J6_ARMV/960-1118.ST-TCTVALGTNPFAHMIA------------------------------------------------------------
CAPSD_TRSV/351-511.SK-DATVTLASNPLSWLVA------------------------------------------------------------
POL2_GCMV/1150-1316.YK-EATVTNYVNAFAIMCA------------------------------------------------------------
Q6XPY1_9SECO/164-322.YK-EAEVINHVNAFSIMCA------------------------------------------------------------
Q6XFY6_9SECO/157-316.SS-TSTVALGNNPFAHMIA------------------------------------------------------------
Q9IV56_9SECO/980-1138.AK-DCTLELATNPFSKMIA------------------------------------------------------------
Q65624_9SECO/386-551.LP-GQTVTMRRNALANLIR------------------------------------------------------------
POL2_CNSV/1022-1185.SE-DMKVTGYTNAFLQMCQ------------------------------------------------------------
Q64959_9SECO/338-502.VK-NTKCVNFTNAFAIMCA------------------------------------------------------------
Q20LA0_9SECO/942-1102LAG-SYDTTNYVNPTSLLFS------------------------------------------------------------
A3FEN2_9SECO/348-507.DD-KSEVLLRQHPLSLLIS------------------------------------------------------------
Q9ELS0_9SECO/148-312.LS-NATVALKNNPLSAIFG------------------------------------------------------------
Q9QAH0_9SECO/350-510AAG-EVDVTNYVNPTSLLFS------------------------------------------------------------
Q24M89_9SECO/943-1103LAG-SYDITNYVNPASLLFS------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266ACYWSKYRWRSCRLVYIPYC------------------------------------------------------------
CAPSD_MCMVK/23-222SQMWNTIVFNSVRITWETFT------------------------------------------------------------
CAPSD_PMVK/39-236GSAFAIHRWRALSFEWIPSC------------------------------------------------------------
CAPSD_RCNMV/24-213AANYDMYRLKKLTLRYVPLV------------------------------------------------------------
CAPSD_CARMS/51-245ATNFNKYRITALTVKYSPAC------------------------------------------------------------
CAPSD_SBMVA/46-262AANWSKYSLLSVRYTYLPSC------------------------------------------------------------
CAPSD_TBSVC/76-269ASNFDQYTFNSVVLHYVPLC------------------------------------------------------------
CAPSD_POLVP/66-257AASFDQYKFDRVQLQYVPMC------------------------------------------------------------
CAPSD_OCSVU/111-308AVNYEKYKFRRLSFTLVPLV------------------------------------------------------------
CAPSD_TNVA/61-272ADLYSKYRWLSCEIIYIPKC------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340ARIFQRYAVETLEFEIQPMC------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207LKAYHEYKITSILLQFVSEA------------------------------------------------------------
CAPSD_PEMVW/53-187LAAYQKYRIVWLKVVYQSEA------------------------------------------------------------
CAPSD_BYDVP/62-199LKSYHRYKITSIRVEFKSHA------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659ASNYAQYRVVRATIRYRPLV------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416GAQYSMWKLKYLNVKLTSMV------------------------------------------------------------

PF00983

COAT_TYMV/8-177TTFYRHASLESLWVTIHPTL------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215LDVVKLLY......NEQFAV-------QG---------------------------------------------------
POLG_AEVCA/45-212IDIVKELL......DQSYAV-------DG---------------------------------------------------
POLG_CXA9/93-300..WWKFPEAL....SDMGLF-------GQ---------------------------------------------------
POLG_CXB3N/93-302..WWKLPDAL....SNLGLF-------GQ---------------------------------------------------
POLG_CXB4J/93-300..WWKFPDAL....SEMGLF-------GQ---------------------------------------------------
POLG_CXA21/93-308..WWKLPDCL....KDMGMF-------GQ---------------------------------------------------
POLG_POL1M/93-308..WWKLPDAL....RDMGLF-------GQ---------------------------------------------------
POLG_POL3L/93-307..WWKLPDAL....RDMGLF-------GQ---------------------------------------------------
POLG_HE701/93-288..WWKLPDAL....NQIGMF-------GQ---------------------------------------------------
POLG_BOVEV/93-285..YWKLPDAL....NNTGMF-------GQ---------------------------------------------------
POLG_HRV14/93-299..CWKLPDAL....KDMGVF-------GQ---------------------------------------------------
POLG_HRV2/93-302..WWKLPDAL....KDMGIF-------GE---------------------------------------------------
POLG_HRV8A/93-302..WWKLPDAL....KNMGIF-------GE---------------------------------------------------
POLG_HRV1B/93-301..WWKLPDAL....KEMGIF-------GE---------------------------------------------------
POLG_FMDV1/311-475..LTKLELPT....DHHGVF-------GH---------------------------------------------------
POLG_FMDVT/311-475..MHKVVLPH....EPKGVY-------GG---------------------------------------------------
POLG_FMDVO/311-475..LLELPT......DHKGVY-------GS---------------------------------------------------
POLG_EMCV/161-359LSTSAFPFLTSCP.VKMVVS-------LV---------------------------------------------------
POLG_TMEVB/172-382..HIRIPLPHVLAGEDGGVF-------GA---------------------------------------------------
POLG_ENMGO/162-361..YIRIPLPHVLSGEDGGVF-------GA---------------------------------------------------
POLG_FMDVO/533-691..DMSLAAKQ....MSNTFL-------AG---------------------------------------------------
POLG_FMDV1/533-692..DVSLAAKH....MSNTYL-------SG---------------------------------------------------
POLG_EMCV/420-582..TYQVTLSCSC..LANTFL-------AA---------------------------------------------------
POLG_TMEVB/443-606..DYQVALSCSC..MANSML-------AA---------------------------------------------------
POLG_HE701/347-515..NIPLDIQLEGP.LRNTLL-------GN---------------------------------------------------
POLG_HRV2/358-522..SIRTDV.ASQP.LATTLI-------GE---------------------------------------------------
POLG_HRV8A/364-529..SIPVDI.ASQP.LATTLI-------GE---------------------------------------------------
POLG_HRV1B/360-525..AIKVDI.TSQP.LATTLI-------GE---------------------------------------------------
POLG_BOVEV/345-515..ALRLELGGSGP.LSSSLL-------GT---------------------------------------------------
POLG_CXA21/369-534..CLSLSPASDKR.LSHTML-------GE---------------------------------------------------
POLG_CXA9/358-524..GLRLQPGLDSV.FKHTLL-------GE---------------------------------------------------
POLG_CXB4J/358-524..GFPLQPGASSV.LQRTLL-------GE---------------------------------------------------
POLG_CXB3N/360-526..GFPLQPGYSSV.FSRTLL-------GE---------------------------------------------------
POLG_CXB1J/360-526..GFPLQPGANNV.LNRTLL-------GE---------------------------------------------------
POLG_FMDVO/725-872..LDLMQI......PSHTLV-------GA---------------------------------------------------
POLG_FMDV1/726-878..IDLMQT......HKHGIV-------GA---------------------------------------------------
POLG_BOVEV/610-775..NWRIDF......REFVQL-------RA---------------------------------------------------
POLG_HRV8A/621-792..TWKVSL......QEMAQI-------RR---------------------------------------------------
POLG_HRV2/614-772..VWAINL......QEMAQI-------RR---------------------------------------------------
POLG_HRV1B/627-786..TWKITL......QEMAQI-------RR---------------------------------------------------
POLG_HE701/609-781..IWTLNT......RELVQI-------RR---------------------------------------------------
POLG_HRV14/614-787..DWKINL......SSLVQL-------RK---------------------------------------------------
POLG_CXA9/612-783..AWPINT......KQMVQM-------RR---------------------------------------------------
POLG_CXB4J/612-783..EWVINT......RQVAQL-------RR---------------------------------------------------
POLG_SVDVU/612-782..YWVINT......RQVAQL-------RR---------------------------------------------------
POLG_CXB3N/630-782..EWVLTP......RQAAQL-------RR---------------------------------------------------
POLG_POL1M/636-806..VWKITY......KDTVQL-------RR---------------------------------------------------
POLG_CXA21/642-812..IWNITY......TDTVQL-------RR---------------------------------------------------
POLG_CXA24/646-809..TWAITY......TDTVQL-------RR---------------------------------------------------

PF00915

CAPSD_VESVA/137-421LYSQALNP------SINPYL-------DH---------------------------------------------------
POLG_RHDVF/1768-2065LYTVQHSP------QNNPFT-------AV---------------------------------------------------
CAPSD_FCVUR/112-395LFKQSLGP------LLNPYL-------EH---------------------------------------------------
CAPSD_NVN68/2-294LFDLSLGP------HLNPFL-------LH---------------------------------------------------

PF08762

Q8B107_ALPV/599-804...AAQATM-----VNIDLY.......SY---------------------------------------------------
O56051_9VIRU/590-790LEGVTQEGS-----SDIDGI.......SW---------------------------------------------------
Q56QP7_9VIRU/684-855........W-----HYKDYV.......SI---------------------------------------------------
O36967_9VIRU/668-900.....VAPA-----EPMSLF.......EY---------------------------------------------------
Q5UBY1_9VIRU/79-259........K-----EGRDYM.......SY---------------------------------------------------
Q6ITS9_9VIRU/106-313VDTETKEAK-----YGFSYFWSAPTTLNI---------------------------------------------------
Q4JFT2_9VIRU/834-1009...FGTDNS-----LRQSLV.......NI---------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226----GVGSTAVILDDNFV..-------TK--------ANALT--------------------------------------
Q27W03_PCV1/5-227----GVGSTVVILDANFV..-------TP--------STNLA--------------------------------------
A3FEQ4_9CIRC/3-256----TQGSTIIDKDGQIVR.-------TS--------TTGWA--------------------------------------
Q3HUU1_GOCV/5-247----TQGSTYIDKEGNITTT-------TS--------GSEWN--------------------------------------
Q1L2D2_9CIRC/1-237----GLGHTVPITDARLMNF-------VK--------KKGLA--------------------------------------
CAPSD_CACV/7-243----GFGHNVPIQDNHLEDF-------FK--------KTRLD--------------------------------------
Q0H9S8_9CIRC/4-236----GIGHNVPIQDNHLEDF-------FK--------KPGLE--------------------------------------
Q06J73_9CIRC/8-245----GAGVTVPIQDQHLRDF-------FK--------KTRLT--------------------------------------
Q9DXG3_BFDV/11-242----GFGHTAVIQDSRITRF-------KT--------IADQT--------------------------------------
Q69EZ5_BFDV/7-239----GFGHTAVIQDSRISKF-------KT--------TADQN--------------------------------------
Q9DXG0_BFDV/11-242----GFGHTAVIQDSRIEKF-------KT--------RADQS--------------------------------------
Q9DXF4_BFDV/3-235----GFGHTAVIQDSRISKF-------KT--------TADQT--------------------------------------

PF02956

A7VLZ2_9VIRU/1-506ACDLRYAHLGCCNTNQLASF-------LT.LNTDFYQYAAWG............................NPKNPYIPTE
Q9WT88_9VIRU/1-603AADLRYPFCSPQTNNPCTTF-------QV.LRK.NYNTVIGT...........................SVKDQESTQDF
Q91CY9_9VIRU/1-581ACSFLHPFIPPESDNICITF-------QV.LRD.FYYTQMSV......................TPTTTTSLNQKDEKIF
A7VLY0_9VIRU/1-515AANMQWAYYNPDQQSRCLTL-------YS.LNIKFFANTDWS............................ATHTGTQM..
Q9JGT1_9VIRU/1-585AADMQYPFGSPLTDTIVVSF-------QV.LQS.MYNDCLSV.......................LPSNFVEPSGKGKLL
Q80QT8_9VIRU/1-595AADMRFPFCSPLTDNPCYTF-------QV.LHE.EYYNVIGT........................SALLTPTNATYTNF
CAPSD_TTVB1/1-533SCSLDQMYAPQDQISTNISL-------FS.LNTNVFQINNWH....KQPYTTKAASTLE.TYLYCYHNGHEPTQELKWKD
A7VM00_9VIRU/1-509ACNFRYPWLACCNENLIITL-------YY.LQPSFWSHTEWA............................QYSTSA....
Q9JG61_9VIRU/1-534SCSLDQMYAPNDQISTNITF-------LS.LNTNIFQNPYWE.LDDNQPYFPKVTGTINNIGLYTMGNGGNIKNMKNWKQ
Q91PS3_9VIRU/1-581IGNLRFPFCRPQTENTCVYF-------QV.LSN.AWNNMLSI..........................AHPHTENNWQYI
CAPSD_TTVV4/1-560ACNLRYPFGSPQTKNICIYF-------LV.LAS.IYNDKVSI..........................AKDEVTKNYDTL
Q91C93_9VIRU/1-546ACSLDRPYLNSQSISNTVGF-------KT.LNYEAFLNRGFK.NIPTTGYFPKPNTRYF.....ITQTHSTDPKNVPIGS
Q2F827_9VIRU/1-589AASFIHPFSQPQTNNICTTF-------QV.LKD.MYYDCIGI...........................NSTLTTKYENL
Q91CY5_9VIRU/1-584AASFMHPFCSPLTNNPCITF-------QV.LKD.NYYSCIGV.........................NSLETHKNSYTKL
Q8V7G9_9VIRU/1-572GLELSNPWLRSGTNSPVIGF-------WV.LKNHLYDGNLSN.............................IASGEQLTA
Q99A78_9VIRU/1-584AADMQYPFGSPLTDSVVVGF-------QV.LQS.MYNDCLSI........................LPENFNGNGKGKAL
Q6H9C2_9VIRU/1-573ACDLQYPFGSPLTDNPCVNF-------QI.LGP.QYKKHLSI..........................SSTMDESNKAHY
CAPSD_TTVT1/1-433FLNPFKQIMHTNQTEQSFPF-------AIELGNTDYDKPPNN......................................
Q9JG80_9VIRU/1-589AASFLHPFGSPQTDNPCYTF-------QV.LKE.FYNQAIGF............................SATQDKIDNV
A7VLZ6_9VIRU/1-506ALDLRHSYLGCCNENSQVYF-------FY.LNHGFYKQTNWG............................QYSTTP....
Q6H9D2_9VIRU/1-557PCDLRFPFCSPQTDNPCVNF-------LV.LAG.VYNGKLSI..........................EPTNVESQYNSL
Q6H999_9VIRU/1-471EADLRFPFCSPQTGNTCISF-------QV.LNS.VYNNYLSI.......................NTFNNDNSDSKLKEF
Q77JT5_9VIRU/1-606TADFQYPFGSPLTNSPCCNF-------QV.LNS.NYDNAHSI........................LNLSNEPTNKWHTY
Q91PS7_9VIRU/1-585ACSLRFPFCSPQTDNTCVNF-------QV.LSK.RFNTMLSI..........................SPDYPKKNYDSF
CAPSD_TTVV9/1-555TATLMHPWMAPFVNSPALTI-------YA.VNHKTYSDMSIL..........................PSNNQGSTKNEL
Q9JG47_9VIRU/1-553TCSLDRMYLSSSSVSTTMGF-------VS.LDTNGFMERYMK.DNGTAPYSPLTGQIIF.....AAPNGDNVITNIPLGQ
A7VLW0_9VIRU/1-507ACNLRYPWLACCNENLIITL-------RY.LQPQFYHNSAWA............................QTTKE.....
Q0ZLH9_9VIRU/1-573AASLRFPFGSPQTENYCIYF-------QV.LDP.WYHTRLSI..........................TGGKPAEYWTQL
Q5ENW7_9VIRU/1-501LIDMQKPF............-------...DANGAFRNAWWL............................EQRNDQGEMK
A7VLX2_9VIRU/1-509ACDFNYPRIGCCNVSQVMTI-------FF.LNPQFWGQTDWG............................QYMAHA....
Q80AR5_9VIRU/1-594AADLKHPFCSPQTNNPCTTF-------QV.LRD.KYNDMIGF....................PFNYNPSDTNQTKTLQDF
Q91CZ2_9VIRU/1-601LASFQHPFCRPLTDNPCVTF-------QV.LQN.FYNNVIGY...........................SSSDTLVDNVF
CAPSD_TTVG1/1-514ACSLRYPRIGCCNENRMITL-------YC.LNTKFYQDTEWG............................TTKQAPHY..
Q98Y63_9VIRU/1-581ACSFIHPFCSPESDTICMTF-------QV.LRE.FYYTHLTV......................TPTTTTSTPEKDKKIF
Q9QU36_9VIRU/1-529AASFDRYYTNSKAKSTTIGF-------IS.LNTLTFQYHNWQ.DPPTTGYKPQDNMWFW.....GTLNGSDDPNEEPLTN
A7VM12_9VIRU/1-509AMNLRYSYLSASNENMLVNI-------SS.LNPQWYVNTDWA............................RARQDTQG..
A7VLV6_9VIRU/1-508ACDVPFVRIGCCNPSQVSTI-------YF.LNPQFYYDTDWG............................ATKNHA....
Q9JG50_9VIRU/1-535ICNLNNYWLSNNHLSNNISF-------WS.VNTRLFSNPNFQNTDSTVGYTPKDGVYLY......GTYNGTPTQNLTWMH
A7VLW4_9VIRU/1-507VCNFSHANLSGKNQNMLVSL-------IS.LNLSFYKNPAWA............................QALTASG...
A7VM04_9VIRU/1-513AANLNYVNLGCCNTNQMCTF-------FY.INPGFYQIANWG............................ATTTTG....
A7VLY4_9VIRU/1-498ACDLNYPHIGATSQNQIITL-------FG.LNQSFYSKGNWG............................AVVQTG....
CAPSD_TTVD1/1-324WVDLDRPWMADISKPA....-------QT.IDPSTYDKK.........................................
Q91CZ6_9VIRU/1-596LASFQHPFCRPQTDNPCVTF-------QV.LQN.FYNKCIGT.........................SVNLSDSTFDSIF
A7VM08_9VIRU/1-506ACNFRYPTLGCCNENRILNL-------FA.LDTGFYQNVDWM............................QARQTGVG..
CAPSD_TTVV3/1-573ACDLQYPFGSPQTDNVCVNF-------QI.LGQ.PYYQHLKT........................ALGLTEKTTYENHY
Q91D00_9VIRU/1-593AADFRHPFCSPQTNNPCTTF-------QV.LRE.NYNEVLGL....................PYANTGSNNEVKIKIDNF
Q99AR5_9VIRU/1-604AASLRYPFCSPQTNNPNCTF-------QV.LRK.NYHKVIGT...........................SSTNSEDVTPF
Q9DTD2_9VIRU/1-559AADFTFPFGSPLTNTHCVNF-------QV.LGS.DYNDILSI...........................LPDKLKSKESK
Q91D04_9VIRU/1-591AASFRHPFCPPQTDNICITF-------QV.LKD.FYYTQMSV........................TPDTAGQEKDIEIF
CAPSD_TTVV8/1-571ACDLQYPFGSPLTENYCISF-------QV.LGS.AYNNLISN...........................TLNPNEEQQDI
Q5ENX0_9VIRU/1-603AADLKHPFGSPLTDTPCVSF-------QV.LGD.LYNECLNI..........DLPETEKDSLTKLKNSSTDEYSKNLQKL
O90364_9VIRU/1-590AADIPYPFGSPLTDSVVVNF-------QV.LQS.MYDKYISI...........................LPDQKSQSKSL
Q9IFV0_9VIRU/1-583AASLRFPFCSPQTGNICIYF-------QI.LDPYWYNRRMSI..........................TPDLLKSNYESF
Q9QUE7_9VIRU/1-586AADMQYPFGSPLTDTPVVTF-------QV.LRS.MYNDALST.......................LPSNFENASSPGQKL
A8DMR2_9VIRU/1-531ALSLDRYYTSANSISSTIGF-------AS.INTTIFQYSDFKSPNLTQPYKPNDEYWLRT....WTNQTITNFSAVETQR
Q9DUH8_9VIRU/1-609AADFMHPFGSPLTETPCVTF-------QV.LGD.LYNKCLNIDLPKVDTVKNASSPHTKIQVKLTDNSGNPTNKEAVKTL
A7VLW8_9VIRU/1-511ACSLNYPRLGCCNENRTLTL-------YY.INPYFYQYSDWG............................QVKEHANY..
Q99AQ3_9VIRU/1-582AASFTHPFCSPQTANPCITF-------QV.LKE.FYYQAMGY............................GTPETTMSTI

PF02247

POL2_SQMVM/246-618PLAIGGGA-GTKDAILMNMP-------NA---------------------------------------------------
POL2_CPMVS/460-832PLSIGGGA-GATQAFLANMP-------NS---------------------------------------------------
POL2_BPMV/447-819PLSIGGGA-GAKSAILMNMP-------NA---------------------------------------------------
Q9Z006_9SECO/476-846EVNFGKPQ-TDGKEVTSTFA-------SA---------------------------------------------------
O12663_9SECO/321-691EVNFGKPQ-TDGKEVTSTFA-------SS---------------------------------------------------
Q9YWK0_9SECO/363-735PLAIGGGA-GTKDAILMNMP-------NA---------------------------------------------------
POL2_CPSMV/437-806PLSIGGGA-GAKNSILMNLP-------NA---------------------------------------------------
POL2_RCMV/407-778PLAIGGGA-GAKNSILMNMT-------NA---------------------------------------------------
Q9YWJ9_9SECO/452-824PLAIGGGA-GTKDAILMNMP-------NA---------------------------------------------------
Q66170_CPMVS/343-715PLSIGGGA-GATQAFLANMP-------NS---------------------------------------------------

PF03391

CAPSD_TRSV/179-344ISYNFGGPVKHSKKHAISYS-------RA---------------------------------------------------
POL2_RRVS/768-936FAIMPGTAILHGQQIVRTFP-------RV---------------------------------------------------
POL2_BRAV/1268-1433SLDIGTSTTTVSGWRTVSFP-------AA---------------------------------------------------
Q65029_ARMV/745-916VSLLLGQTLVDGTHKVYNFN-------NT---------------------------------------------------
POL2_ARMVS/792-963VSLLLGQTLVDGTHKVYNFN-------NT---------------------------------------------------
Q67703_GFLV/166-336AGLTLGQVPMVGTTRVYNLN-------ST---------------------------------------------------
POL2_GFLV/771-941AGLTLGQVPMVGTTKVYNLN-------ST---------------------------------------------------
POL2_BRSV/1007-1170PVSLAAKLQSTSGRTAYSYA-------AG---------------------------------------------------
POL2_GCMV/981-1144PLSFAVQQKSSSGRIAYSYA-------AG---------------------------------------------------
POL2_TORVR/1497-1662RLLFGLSTVISGNMSTLNAN-------QA---------------------------------------------------
Q88483_9SECO/1003-1166PVSLAMRVDSAAKRQAYSYA-------AG---------------------------------------------------

PF03689

A3FEM9_9SECO/10-101LHTLDIIK-ECKSQNLLRYK-------EW---------------------------------------------------
Q9QAH4_9SECO/9-99LTRIDVRA-KAATFDSAVWR-------QW---------------------------------------------------
Q09G89_GFLV/608-698LGTLNIRD-MISDFKGVQYE-------KW---------------------------------------------------
Q9JGK5_SDV/160-249LARYQVMA-EAMNYRSASYY-------SR---------------------------------------------------
Q9IV56_9SECO/636-727LGTHNFRE-IAKEYAGEFYN-------RW---------------------------------------------------
A1YYW2_BRAV/156-247LATVDIQT-RVFEDNRRVAL-------DW---------------------------------------------------
Q65624_9SECO/45-137LEAINLRE-DIATSDNLVKY-------EW---------------------------------------------------
Q6JX06_9SECO/849-939LAKIDILE-KIKTTHSAVCA-------EW---------------------------------------------------
Q20LA0_9SECO/601-691LARIDLRA-KAQEMDSAVWR-------QW---------------------------------------------------
POL2_BRSV/842-932LAVFNIFD-KIQETNTKVCS-------KW---------------------------------------------------
A0A9J8_ARMV/580-670LKTLDLRD-MISGFSGIQYE-------KW---------------------------------------------------
Q6JX05_9SECO/604-694LKTLDMRS-MTAGFAGIQYE-------KW---------------------------------------------------
Q9Z0D6_SDV/74-163LARYNVLA-KATSFKSASYY-------SR---------------------------------------------------
Q9QRA5_9SECO/10-101LHTLNVIE-ACKSMSLLRYK-------EW---------------------------------------------------
Q86631_9SECO/85-173LARWSLRS-IISESGTDAWT-------KW---------------------------------------------------
POL2_GCMV/815-905LAKIDIFK-KIQDAKSMVCV-------QW---------------------------------------------------
A2ID55_9SECO/270-361IGRLNLVE-RARVDNTIPYL-------EW---------------------------------------------------
Q64959_9SECO/4-94IGTLDIFA-LITTTNSRVCA-------EW---------------------------------------------------
Q8B5P7_TRSV/12-103LGTYDIRQ-ALMDYGGLHSQ-------EW---------------------------------------------------
Q88483_9SECO/838-928LAKIDLIS-LIKNTNTRVCS-------EW---------------------------------------------------
POL2_CNSV/688-778LAGVDILA-NARTTMSGFYM-------RW---------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754--------------------------------------------------------------------------------
CAPSD_NCBVS/1-608--------------------------------------------------------------------------------
CAPSD_HASV/2-647--------------------------------------------------------------------------------

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------YDPYVNYSSRH-------------------------
Q27W03_PCV1/5-227--------------------------------------------YDPYINYSSRH-------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------IDPYGSTSSRR-------------------------
Q3HUU1_GOCV/5-247--------------------------------------------VDPYAAMSSRK-------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------DDPLANWDGAL-------------------------
CAPSD_CACV/7-243--------------------------------------------ADPLANWDGAR-------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------TDPLANWDGAR-------------------------
Q06J73_9CIRC/8-245--------------------------------------------VDPLANWDGAR-------------------------
Q9DXG3_BFDV/11-242--------------------------------------------QDPLAPFDGAK-------------------------
Q69EZ5_BFDV/7-239--------------------------------------------QDPLAPFDGAR-------------------------
Q9DXG0_BFDV/11-242--------------------------------------------QDPLAPFDGAK-------------------------
Q9DXF4_BFDV/3-235--------------------------------------------QDPLAPFDGAR-------------------------

PF02956

A7VLZ2_9VIRU/1-506QDKWYRP..........................YRIVEPVTEV.EDVKGNKKTIT....T....................
Q9WT88_9VIRU/1-603ENWLYKTD.......................SHYQTFATEAQLGRIPAFNPDGTK....NTKQQSWQDNWSKKNSPWTGN
Q91CY9_9VIRU/1-581SDHLYKNP.......................EYWQSHHTAARL.STSQKPALRNK....EEIPNDHGYLNTTPTDSTFRT
A7VLY0_9VIRU/1-515....YFP..........................YNAWPHTKGL.TFWTIDSKGNK....TPHSI................
Q9JGT1_9VIRU/1-585YDKIRKHL.......................PYYNTTQTQAQL.KRYIDNQST..........TDTWNSYLNTKKFSTNE
Q80QT8_9VIRU/1-595EKWLYGKC.......................THYQTFATDTRL.APQTTSKYKPD....GQPLTSSELTWDQSAFNSFKT
CAPSD_TTVB1/1-533IILLGNM........................TNYTDGKKYNTS.GTTPLDLFKTE....NKPY.................
A7VM00_9VIRU/1-509....YNPQ.........................GHLHPMPETL.TFKGKIDNREYTWNMSPF..................
Q9JG61_9VIRU/1-534LIPLYQT........................QLYKKEHNTNGTDWTTNFSDLSQP....NK...................
Q91PS3_9VIRU/1-581TETLLKT...HWHSNQRKGTMANYDSRDRVGVVFNTFKTQEHI.QNPNFQTDKEQ....VSTPYTYDT............
CAPSD_TTVV4/1-560VDAIKKSPQGL....................TVFNTFKTQEHM.QEPSSETCKET....QKTNPPFKYEN..........
Q91C93_9VIRU/1-546LIFLGNT........................NLLTLGTKIQDA.CPSSTENEWKN....QFEKYLQTEKN..........
Q2F827_9VIRU/1-589FNKLYSKC.......................CYFETFQTIAQL.NPGFKAAKKTT....NGSGSTAATLGDAVTELKNPN
Q91CY5_9VIRU/1-584QEWLYKTN.......................TFFETTQVIAQL.SPSFAPAYKPN....GTNNNTHKPLGGMVPELKYNN
Q8V7G9_9VIRU/1-572RQTLFTT........................KLLPSNNTKDEW.QYAYTPL..............MKTFYTQAANTAAHN
Q99A78_9VIRU/1-584HDNITKYL.......................PNYNTTQTLAQL.KPYIDNTSTGS........TNNWSSYVNTSKFTTAS
Q6H9C2_9VIRU/1-573EQNLFKKT.......................ELYNTFQTIAQL.KETGNISGITPTWTEVQNSTTLNQAGNNATDS....
CAPSD_TTVT1/1-433................................................................................
Q9JG80_9VIRU/1-589FNILYQNN.......................SYWESNITPFYV.INVKKGSNTAD....YLSPQITDSNFRKK.......
A7VLZ6_9VIRU/1-506.................................YRPSNEINTV.YYKDKTGNKKQ....IGP..FNT.............
Q6H9D2_9VIRU/1-557LSAIETNTQG.....................TLFNTFKTPEMI.KCPAAGKAPET....GDISTNCYKK...........
Q6H999_9VIRU/1-471LNKAFPTTGTKGTSL................NALNTFRTEGCI.SHPQLKKPNPQ....INKPLDSQYFAP.........
Q77JT5_9VIRU/1-606RNNCYKFLLEQY...................SYYNTKQVVAQL.KYKWNPNQNPT....MPNTSNASLSKKPDDLTKTKT
Q91PS7_9VIRU/1-585VKTYLKNAQEHWNQN.KKGTLDNYNDPNRLLTVFNTFKTEEHL.YDPSAKETKNT....TNTDAAGNKYNT.........
CAPSD_TTVV9/1-555IETLYTAE.......................HTYNPMAQRIWG.NIKPQNTNF...........................
Q9JG47_9VIRU/1-553CILLGTV........................TDYTPGTQLSSI.TLNTGALSPPS....DWGTFKSASKAIYNAYYQHKY
A7VLW0_9VIRU/1-507....YNPV.........................YGTQPMKKTL.TFNYIIGNQRGTYTMSNS..................
Q0ZLH9_9VIRU/1-573KAYLTQG....WGRS....TNNAGYQHGPLGTYFNTLKTSEHI.RQPPADNYKQA....NKDTTYYGR............
Q5ENW7_9VIRU/1-501YIELWGRV.......................PPQGDSELPKKK.EFSTGTDNPNY....NVQDNEEKNIYPIIIYVDQKD
A7VLX2_9VIRU/1-509.................................YMNIATGVAL.TGTYKDKQDKP....QNITVGDYT............
Q80AR5_9VIRU/1-594EKWLYSSS.......................THYQTFATEANL.RPRQYNADGGA....NPNYAQLQSKWTTTIYAKK..
Q91CZ2_9VIRU/1-601TSLLYSKA.......................SFWQSHLTPSYV.KKINNNPDGSSISQRVGTMPDMTEYNKWVSNTNIGT
CAPSD_TTVG1/1-514....FKP..........................YATINKSMIFVSNYGGKKTEYN....IGQWIETDIPGEG........
Q98Y63_9VIRU/1-581NDQLYSNA.......................NFYQSLHASAFL.NIAQAPAIHGH....NGIPNNSRYLSSTGTETSFRT
Q9QU36_9VIRU/1-529LIYLGGT........................NNHTKGIPVKNQ.SNYASQPNM...........................
A7VM12_9VIRU/1-509....YLP..........................QPNM..NKSL.SYKNKTKGGSE....TTTQMPST.............
A7VLV6_9VIRU/1-508.................................YMYIRTGVSL.TGTYKGKDGKD....HEKIIGEWKKM..........
Q9JG50_9VIRU/1-535MIYLGNT........................HKYQQGLAPIDMSGPTSNQIKALH....EKQN.................
A7VLW4_9VIRU/1-507....YKP..........................YDNIPSDLPF.VVKQANKEVQKYMKPQ....................
A7VM04_9VIRU/1-513....YIP..........................YSGYPTATIY.TWNYKQWQTGQ....GGQ..PFT.............
A7VLY4_9VIRU/1-498.................................YQPYPSVTTF.TYKTAATKQVE....TFN..................
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596RDYLYKIG.......................SFYQQVLVPSYI.KRITHNPDGST....GGTLSTLTAYNEWVTGTGP.N
A7VM08_9VIRU/1-506....YKP..........................YSTIDKRLTF.HYKTATGSSTVQV.......................
CAPSD_TTVV3/1-573KNNLYKKI.......................KFYNTTETIAQL.KPLVDATTNQT....WSHYVNPNKLTTTPTSEITH.
Q91D00_9VIRU/1-593ENWLYNSS.......................VHYQTFQTEQMF.RPKQYNADGST....WKDYKSMLSTWTSQIYNKK..
Q99AR5_9VIRU/1-604ENWLYNTA.......................SHYQTFATEAQVGRIPSFNPDGTK....NTKESEWQNYWSKKGEPWNPN
Q9DTD2_9VIRU/1-559IEKIYKNI.......................AYYNTKQTIAHL.KITDNCKNTQT....DITNTKH..............
Q91D04_9VIRU/1-591EKHLFKNP.......................QFYQTVHTQGII.SKTRRTAKFSTSNNTLGSDTNITPYLEQPTATNHKN
CAPSD_TTVV8/1-571KSAIYNNV.......................NAYLTRITESHM.ANLISKAPPKQ....VLKSSDGSLQTDH........
Q5ENX0_9VIRU/1-603LQQLYTNG.......................QYWQTFITGPFIKDTMQANNYQQK....KTNYTKTNFYTTRDATGDTAF
O90364_9VIRU/1-590LSNIANYI.......................PFYNTTQTIAQL.KPFIDAGNITS.....GTAATTWGSYINTTKFTTTA
Q9IFV0_9VIRU/1-583FSVLNTK....FSSSPLYPNVATTVPSGPIGTVFNTFKTQEHV.VDPRWDTVKKQ....STGSQWSNTF...........
Q9QUE7_9VIRU/1-586YKEISTYL.......................PYYNTTETIAQL.KRYVENTEKNG.....TTPNPWQSKYVNTTAFTTAL
A8DMR2_9VIRU/1-531VILLGNT........................NDYQPGEPMGDE.KAHYEDYFKTK....TK...................
Q9DUH8_9VIRU/1-609YEQLFSYG.......................QYWQTFITDFMT.ANPPKYDNGNN....KKLFNDNDYNTFKTTFLTK..
A7VLW8_9VIRU/1-511....YKP..........................YNSIADLEFW.SGNTKNPTKYK....PKDEIEKATDPP.........
Q99AQ3_9VIRU/1-582WNTLYTTS.......................TYWQSHLTPQFV.RMPKNNPDNTA....NTEANKFNEWVDKTFKTG...

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754--------------------------------------------------------------------------------
CAPSD_NCBVS/1-608--------------------------------------------------------------------------------
CAPSD_HASV/2-647--------------------------------------------------------------------------------

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506...................VFTPYTE......................................................
Q9WT88_9VIRU/1-603SGTYP...QTTSEMYKIP.YDSNFGFPTYR.........AQKDYILER..RQCNFNYEV....NNPVSKKVWPQPSTTTP
Q91CY9_9VIRU/1-581G..................NNTIYGQPSYR.........PNYTKLTKI..REWYFTQEN.........TDNPIHGSYLKP
A7VLY0_9VIRU/1-515...................KPQNYNQ......................................................
Q9JGT1_9VIRU/1-585SPKTD...INSIGGPYTTYSDTWYKGTAYIQ.........KITEVPPK..AAELYYKQT...........EQLIGATFTG
Q80QT8_9VIRU/1-595K..................ADSNYGYCTYNPNGST....QLVEKIKGY..RNQRFRWLT......SYTGTNHINDTFAKG
CAPSD_TTVB1/1-533...................WGNVFTNLNQDQ.................................................
A7VM00_9VIRU/1-509...................ISDKYTN......................................................
Q9JG61_9VIRU/1-534...................WANPFSYSAHEETN...............................................
Q91PS3_9VIRU/1-581...................VTSLWGDYVYKES........IIDSFKTN..ATNYYNSRK..............GTQITAS
CAPSD_TTVV4/1-560...................LSSLWGDKIYKES........TFNSFKTN..AENLWKARS..............KHTLLGS
Q91C93_9VIRU/1-546...................WGNPFTPEYLDED................................................
Q2F827_9VIRU/1-589GTFYT...G..........NNSTFGCCTYK.........PTKEIGSNA..NKWFWHQLT........ATDSDTLGQYGRA
Q91CY5_9VIRU/1-584AGFHT...G..........NNPVFGMCKYK.........PSTLTMQNA..NKWFWENLQ.........VENDLQSKYGKA
Q8V7G9_9VIRU/1-572I..................TDKTYNWKNYK............THYDKV..QQTWTTKAQFNYDLVKEEYKTVYPTTATFP
Q99A78_9VIRU/1-584KTITT.....SAEGPYYTFADTWYRGTAYNN.........SITNVPLQ..AAQLYHDTT...........KKLLGTTFTG
Q6H9C2_9VIRU/1-573...................RDTWYKGNTYNE.........KISELAQI..TRNRFKNAT..........KTALPNYPTIM
CAPSD_TTVT1/1-433................................................................................
Q9JG80_9VIRU/1-589...................VNTNYNWYTYNAK.......SNKDNLHKL..RQAYFKQLT.SEGPQHTSSDNGYASQWTTP
A7VLZ6_9VIRU/1-506...................TATAYDD......................................................
Q6H9D2_9VIRU/1-557...................LDSAWGDTIWNQN........TIANFKKN..TDNLWNAGH..............NQTMTGS
Q6H999_9VIRU/1-471...................LDALWGDPIYY..........NDLNEKKS..LKDIIENILIKNMITYHEKLREFPNSYQGN
Q77JT5_9VIRU/1-606TNEYP...H..........WDTLYGGLAYGHSTVTPGTTSSPTDLKTQMLTGNEFYTTAGKKLIDTFHPIPYYENGSSKA
Q91PS7_9VIRU/1-585...................VTSLWGDYIYKET........VVDNFINN..AKNYFESRK..............GNIVMSN
CAPSD_TTVV9/1-555...................TPENYWNKWNE..........IHTKIKTN..RQSELTQLKQMRKRLELTTENDYQDP....
Q9JG47_9VIRU/1-553...................WGNPFFTNWFHGD................................................
A7VLW0_9VIRU/1-507...................DISDYDS......................................................
Q0ZLH9_9VIRU/1-573...................VDSHWGDHVYQQT........IIQAMEEN..QSNMYTKRA..............LHTFLGS
Q5ENW7_9VIRU/1-501Q..................KPRKKYCVCYNKTLNRWRLGQ........................................
A7VLX2_9VIRU/1-509...................GENPYYS......................................................
Q80AR5_9VIRU/1-594...................TDSNFGYTSYNFSGD.....QGYKYVTEI..RQWYWTQLT.....SWTQTAPHINSTFANA
Q91CZ2_9VIRU/1-601GFVNS...N..........VSVHYNYCQYN.........PNHTHLTTL..RQYYFFWET.HPAAANKTPVTHVPITTTKP
CAPSD_TTVG1/1-514...................NLARYYR......................................................
Q98Y63_9VIRU/1-581G..................NNSIYGQPNYK.........PIPEKLTEI..RKWFFKQAT.........TPNEIHGTYGKP
Q9QU36_9VIRU/1-529...................WGNIFHEDYLFGT................................................
A7VM12_9VIRU/1-509...................SFTSYSA......................................................
A7VLV6_9VIRU/1-508...................GEAQYYE......................................................
Q9JG50_9VIRU/1-535...................WGNPFHYNFANK.................................................
A7VLW4_9VIRU/1-507...................ATTDYST......................................................
A7VM04_9VIRU/1-513...................KPQTYNQ......................................................
A7VLY4_9VIRU/1-498...................KPTTYEA......................................................
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596KFIPG...N..........TSVHYNFCTYN.........PKYDNLKAL..RSYYFHWETVQSVATSNFNAQHVPITSTMP
A7VM08_9VIRU/1-506...................DQSDETK......................................................
CAPSD_TTVV3/1-573...................NNTWYRGNAYND.........KITDLPEI..VKKSYYKAT...........ELAIPEAVKP
Q91D00_9VIRU/1-593...................TDSNYGYASYDFS.......KGKEFATQM..RQHYWVQLT.....QLTATVPHIGPTYSNT
Q99AR5_9VIRU/1-604SSYPH...TTTNQMYKIP.FDSNYGFPTYK.........PIKEYMLQR..RAWSFKYET....DNPVSKKIWPQPTTTKP
Q9DTD2_9VIRU/1-559...................NDTQYKGNTYVD.........EINQVRKD..TGDKFIKAT..........SLALSNSWVKP
Q91D04_9VIRU/1-591TLSTG..............NNSIYGLPSYN.........PIPDKLKKI..QEWFWKQET........DKENLVTGSYQTP
CAPSD_TTVV8/1-571...................NDTQFGGNPYNTNQF......TTTTVNKIIQGAQNYLTTI........KTHLQPNNSAINP
Q5ENX0_9VIRU/1-603VSN................ADSNYLYATYHPE.......NIETKLYKI..RENYFQLSI....GKNDVFGDHTSQYRGAT
O90364_9VIRU/1-590TTTYTYPGTTTNTVTMYSSNDSWYRGTVYNN.........QIKELPKK..AAELYSKAT...........KTLLGNTFTT
Q9IFV0_9VIRU/1-583...................VDSHWGDHIYENTSSKS....ILTAMKDN..ATKMYDRRK..............RDTYLGS
Q9QUE7_9VIRU/1-586NVTTE........KPYTTFSDSWYRGTVYKE.........TITEVPLA..AAKLYQNQT...........KKLLSTTFTG
A8DMR2_9VIRU/1-531...................WGNPFYAPYFEPEPQKIFMIK........................................
Q9DUH8_9VIRU/1-609...................KDSGYLFASYNPA.......QVAENIKNI..RDQNFALTT....GKNDVFGDSKAQYHNAT
A7VLW8_9VIRU/1-511...................STAKYYA......................................................
Q99AQ3_9VIRU/1-582...................KLVKYNYNQYK.........PDIEKLTLL..RQYYFRWET.......QHTGVAVPPTWTTP

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215-------DK--KL-VSRIQIRVNPLPK-------FDSTVWVTVR-------------------KVPASSD----------

PF01318

CAPSD_BMV/2-188-------NK--ELKVGRVLLWLGLLPS-------VAGRIKACVA-------------------EKQAQAE----------

PF03566

Q80IX5_PRVFL/54-754-------NE..ALTLETRNTFIQTLNNITNWRD.LGTGQWAQFA..PGWYYSIYVLPNTYAMAEIGDRTD.....SVTQF
CAPSD_NCBVS/1-608-------NTEVEVTNADLDAFANDWNNRTDWTE.ATYPSWAQVG..NVFY....MVVPTEALTDVPPPTQLGVSGLLESY
CAPSD_HASV/2-647-------NK..EMSLDVVNDLIEWLNNLADWRYVVDSEQWINFTNDTTYYVRIRVLRPTY...DVPDPTE.GLVRTVSDY

PF01829

CAPSD_NODAM/42-399-------TSNLMQFAGSIQVYKIPLKQ-------VLNSYSQTVA-------------------TVPPTNL-------AQN

PF08435

Q91H09_9CALI/305-535-------PAVSPLFPGEQILFFRS---------------------------------------FIPGA.S--------G.
Q8JMP1_9CALI/305-540-------PAVAPTFPGEQLLFFRS---------------------------------------RVPCV.Q--------GL
Q8B4Z2_9CALI/297-515-------PSVSAPGVGETLLFFMC---------------------------------------NVPRL.N--------G.
Q917X1_9CALI/305-538-------PAVAPLFPGERLLFFRS---------------------------------------YVPLK.G--------G.
Q9IV43_9CALI/304-537-------PVVYPPGFGEAIVYFMS---------------------------------------PIPGPNT--------A.
Q8VA02_9CALI/306-539-------PPIYPPGFGEAIVFFMS---------------------------------------DFPIA.H--------G.
Q9IV49_9CALI/306-538-------PAVAPLFPGEQILFFRS---------------------------------------QIPSS.G--------G.
Q6EAX3_9CALI/306-538-------PPIAPNFPGEQLLFFRS---------------------------------------NVPCA.G--------G.
Q8BAC6_9CALI/304-534-------PAVTPLFPGEQILFFRS---------------------------------------HIPSA.G--------G.
Q6WQW7_9CALI/296-512-------PAVSAPGVGETILFFMG---------------------------------------KAPVQ.G--------P.
Q6B7R3_9CALI/303-535-------PAVGPNFPGEQILFFRS---------------------------------------NVPSV.Q--------G.
Q6EAW7_9CALI/305-538-------PAVSPLFPGERLLFFRS---------------------------------------YIPLK.G--------G.
Q66418_9CALI/306-538-------PPIYPPGFGEAIVFFMS---------------------------------------DFPVV.S--------G.
Q80FL2_9CALI/317-546-------PAVAPNFPGEQLLFFRS---------------------------------------QLPXS.G--------G.
Q9IV42_9CALI/305-535-------PAVFPPGFGEVILYFYS---------------------------------------IFPGS.G--------Q.
Q6XDL5_9CALI/307-546-------PSVAPVFPGECLLFFRS---------------------------------------FIPLK.G--------G.
Q6B7R2_9CALI/304-538-------PPIYPPGFGETLVNLMS---------------------------------------NFPIGHT--------N.
Q917X4_9CALI/305-533-------PSVAPLFPGEQLLFFRS---------------------------------------HIPLK.G--------G.
Q783W9_9CALI/306-535-------PSVSPMFPGEQILFFRS---------------------------------------FMPGA.S--------G.
Q80J94_9CALI/309-538-------PPIGPFLPGEVLLRFRT---------------------------------------YMRQIDT--------A.
Q913B6_9CALI/305-540-------PSVAPVFPGERLLFFRS---------------------------------------YLPLK.G--------G.
Q8JW44_9CALI/304-539-------PPVFPPGFGEALVYFVS---------------------------------------AFPGPNN--------R.
Q83876_9CALI/301-524-------PSVYSPGFGEVLVFFMS---------------------------------------KIPGP.G--------G.
Q9IV48_9CALI/306-533-------PLIFPPGFGEAIVYFMS---------------------------------------DFPIV.S--------G.
Q8V713_9CALI/316-545-------PPVMPVYPGEQLLFFRS---------------------------------------QLPSS.G--------G.
Q91I85_9CALI/304-538-------PAVYPPGFNEVIVYFMA---------------------------------------SIPGPNQ--------S.
Q8JXJ0_9CALI/304-537-------PVVYPPGFGEAIVYFMS---------------------------------------RVPGWNR--------T.
Q783X1_9CALI/315-545-------PAVAPAFPGERILFFRS---------------------------------------VVPSA.G--------G.
Q783Y0_9CALI/305-533-------PPVAPTFPGERILFFRS---------------------------------------HIPLK.G--------G.

PF02226

POLG_HRV8A/2-69---------------------------------------------------------------RLDFSQD----------
POLG_POL1M/2-69---------------------------------------------------------------KQDFSQD----------

PF11492

Q7T7T5_HARNA/2003-2059---------------------------------------------------------------FSK....----------
POLS_CRPVC/291-340---------------------------------------------------------------IFS....----------
Q2HWK2_RSET1/357-413---------------------------------------------------------------YAR....----------
POLS_ABPVR/340-396---------------------------------------------------------------MAKPVTS----------

PF08935

Q9WJ28_PTV1F/119-191-------..SGAMSSQ-----------------------------------------------ESNAAEN----------
Q9DLK1_FMDVP/202-285-------LGDNAISGG-----------------------------------------------SNEGSTD----------

PF01766

POLS_IBDVU/9-452-------DKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMV.ATCDSSDRPRVY-TITAADDYQFSSQYQAG
POLS_DXV96/2-442-------DKVGNVLVGDGIEVLSLPQGFNNPYVRLGDKSPSTLSSPTHITNTSQNLATGGAY-MIP.......VTTVPGQ
POLS_BSNV/7-428-------DKVGNVLVGDGVAVLSLPAGSDLPYVRLGDEVPSSAGV.....ARCSPSDRPRHY-NAN.......NKQVQVG
POLS_IPNVJ/5-453-------DKVNNQLVTKGITVLNLPTGFDKPYVRLEDETPQGPQSMNGARMRCTAAIAPRRY-EIDLPSER..LPTVAAT

PF02248

Q66170_CPMVS/720-899-------TAAWKSGT-IHVQLN----------------------------------------VRG.AGVK----------
Q9YWJ9_9SECO/828-1009-------VAAWKKGT-IRFQLI----------------------------------------CRG.AAVK----------
POL2_CPMVS/837-1016-------TAAWKSGT-IHVQLN----------------------------------------VRG.AGVK----------
POL2_BPMV/821-1004-------VAAWKKGC-LMVKVV----------------------------------------MSGNAAVK----------
POL2_CPSMV/808-988-------TAAWKCGT-LHVKVV----------------------------------------MTGRVTTT----------
POL2_RCMV/786-964-------TAAWKRGT-IHVQVA----------------------------------------MFG.STVK----------
Q66179_APMV/2-185-------TSDWKRGK-LHFKLK----------------------------------------ILGKSNVK----------
POL2_APMV/802-985-------TSDWKRGK-LHFKLK----------------------------------------ILGKSNVK----------
POL2_SQMVM/622-803-------VAAWKKGT-IRFQLI----------------------------------------CRG.AAVK----------
Q9YWK0_9SECO/739-920-------VAAWKKGT-IRFQLI----------------------------------------CRG.AAVK----------

PF03688

A5H0K4_GFLV/264-422-------CHGLHSGI.LDLKFQWSL.------------------------------------NTEFGKSS----------
POL2_BRSV/1176-1338-------TTGMHHGN.CTIHFSWLWH------------------------------------PAELGKQL----------
Q86631_9SECO/418-544-------SRGMFQGT.MRFILRWTF.------------------------------------...ASSLT----------
POL2_ARMV/344-502-------CHGLHHGI.LDLKLMWDL.------------------------------------EGEFGKSS----------
Q88483_9SECO/1172-1336-------TTGMHFGK.CTLHFSWGWY------------------------------------RGKLADQS----------
A2ID55_9SECO/610-780-------SCAFFKGS.VELIVRFGVS------------------------------------NVALSNLC----------
Q80JS8_BRAV/347-511-------SCGFFRGN.LTIVLEWAT.------------------------------------FLKAGDKE----------
A0A9J6_ARMV/960-1118-------CHGLHRGV.LELKLEWSL.------------------------------------VEEFGKST----------
CAPSD_TRSV/351-511-------ATGWHYGE.VDLCISWSR.------------------------------------SKQAQAQE----------
POL2_GCMV/1150-1316-------TTGMHAGK.CILHFSWTL.------------------------------------.NKGTSFK----------
Q6XPY1_9SECO/164-322-------TTGMQWGSPFALHLDSHM.------------------------------------........----------
Q6XFY6_9SECO/157-316-------CHGLHCGT.LELKFMWSLG------------------------------------TTTYGGSS----------
Q9IV56_9SECO/980-1138-------ATGFLEGQ.VTLSVSWST.------------------------------------NVEASKIK----------
Q65624_9SECO/386-551-------SCGFFRGR.VTFVFQWTL.------------------------------------NVAHIVPT----------
POL2_CNSV/1022-1185-------TSTMHFGS.VIIHFSWTL.------------------------------------FGGTTNAA----------
Q64959_9SECO/338-502-------TTGMHWGR.CILHFTWSWH------------------------------------RNTEAGKN----------
Q20LA0_9SECO/942-1102-------VTGLHGGV.IRLHITWSP.------------------------------------KTTLGESK----------
A3FEN2_9SECO/348-507-------STGFFTGR.AIFVFQWGL.------------------------------------NTTAGNMK----------
Q9ELS0_9SECO/148-312-------ACGYFRGK.LEMSLTWTA.------------------------------------NGKLSDAG----------
Q9QAH0_9SECO/350-510-------VTGLHGGI.IRLHITWCP.------------------------------------NTNLGESK----------
Q24M89_9SECO/943-1103-------VTGLHGGT.IRLHVTWCP.------------------------------------KTNLGESK----------

PF08462

Q5ZF43_CARMV/250-348------------NGN-----------------------------------------------ELQLRVVA----------
Q999Y9_CARMV/250-348------------NGN-----------------------------------------------ELQLRVVA----------
Q4JGW6_CARMV/250-348------------NGN-----------------------------------------------ELQLRVVA----------
Q8JJU7_CARMV/250-348------------NGN-----------------------------------------------ELQLRVVA----------
CAPSD_CARMS/250-348------------NGN-----------------------------------------------ELQLRVVA----------
Q999Z1_CARMV/250-348------------NGN-----------------------------------------------ELRLRVVA----------
CAPSD_CARMV/250-348------------NGN-----------------------------------------------ELQLRVVA----------
Q7TG55_CARMV/250-348------------NGN-----------------------------------------------ELQLRVVA----------

PF00729

CAPSD_PNLV/47-266--------SSSFTGY-VSMGLSYDYAD-----------------------------------AIPSDETE----------
CAPSD_MCMVK/23-222--------ADTTSGY-ISMAFLSDYML-----------------------------------SIP...TG----------
CAPSD_PMVK/39-236--------PTTTPGN-LVLRFYPNYST-----------------------------------ETPKTLTD----------
CAPSD_RCNMV/24-213--------TVQNSGR-VAMIWDPDSQD-----------------------------------SAPQSRQE----------
CAPSD_CARMS/51-245--------SFETNGR-VALGFNDDASD-----------------------------------TPPTTKVG----------
CAPSD_SBMVA/46-262--------PSTTSGS-IHMGFQYDMAD-----------------------------------TLPVSVNQ----------
CAPSD_TBSVC/76-269--------STTEVGR-VAIYFDKDSED-----------------------------------PEPADRVE----------
CAPSD_POLVP/66-257--------ATTETGR-VAIYFDKDQQD-----------------------------------VEPADRVE----------
CAPSD_OCSVU/111-308--------STNYSGR-IGVGFDYDSSD-----------------------------------LVPGNRQE----------
CAPSD_TNVA/61-272--------PTTTSGS-IAMAFTYDRND-----------------------------------AAPTARAQ----------

PF11729

CAPSD_SJNNV/1-340--------PANTGGG-YVAGFLPDPTDNDHTFDALQATRGAVVAKWWESRTVRPQYTRTLLWTSTGKEQR----------

PF00894

CAPSD_PLRV1/70-207--------SSTSSGS-IAYELDPH.CK-----------------------------------------------------
CAPSD_PEMVW/53-187--------AATDRGC-IAYHVDTSTTK-----------------------------------------------------
CAPSD_BYDVP/62-199--------SANTAGA-IFIELDTA.CK-----------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------PNAVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASEH--------VIPSERLH----------

PF03115

CAPSD_HASV1/1-416-------GASAVNGTVSGVSLNPTTTPTSTSWSGLGARKHLDVTVGKNATF-----------KLKPSDLG----------

PF00983

COAT_TYMV/8-177-------QAPTFPTT-VGVCWVPANSP-----------------------------------VTPAQITK----------

PF00073

Q9WMA0_9PICO/49-215-------LLRYHTYARFGIEIQVQIN.P---------------.........TPFQQGGLICAMVPG--D----------
POLG_AEVCA/45-212-------LLKYHSYARFGLDVIVQIN.P---------------.........TSFQAGGLIAALVPY--D----------
POLG_CXA9/93-300-------NMQYHYLGRAGYTIHLQCN.A---------------.........SKFHQGCLLVVCVPE--A----------
POLG_CXB3N/93-302-------NMQYHYLGRTGYTVHVQCN.A---------------.........SKFHQGCLLVVCVPE--A----------
POLG_CXB4J/93-300-------NMQYHYLGRSGYTIHVQCN.A---------------.........SKFHQGCLLVVCVPE--A----------
POLG_CXA21/93-308-------NMYYHYLGRSGYTIHVQCN.A---------------.........SKFHQGALGVFLIPE--F----------
POLG_POL1M/93-308-------NMYYHYLGRSGYTVHVQCN.A---------------.........SKFHQGALGVFAVPE--M----------
POLG_POL3L/93-307-------NMYYHYLGRSGYTVHVQCN.A---------------.........SKFHQGALGVFAIPE--Y----------
POLG_HE701/93-288-------NVQYHYLYRSGFLCHVQCN.A---------------.........TKFHQGTLLIVAIPE--H----------
POLG_BOVEV/93-285-------NAQFHYIYRGGWAVHVQCN.A---------------.........TKFHQGTLLVLAIPE--H----------
POLG_HRV14/93-299-------NMFFHSLGRSGYTVHVQCN.A---------------.........TKFHSGCLLVVVIPE--H----------
POLG_HRV2/93-302-------NMFYHYLGRSGYTIHVQCN.A---------------.........SKFHQGTLIVALIPE--H----------
POLG_HRV8A/93-302-------NMFYHFLGRSGYTIHVQCN.S---------------.........SKFHQGLLIVAAIPE--H----------
POLG_HRV1B/93-301-------NMYYHFLGRSGYTVHVQCN.A---------------.........SKFHQGTLLVAMIPE--H----------
POLG_FMDV1/311-475-------LVDSYAYMRNGWDVEVSAV.G---------------.........NQFNGGCLLVAMVPE--W----------
POLG_FMDVT/311-475-------LVKSYAYMRNGWDVEVTAV.G---------------.........NQFNGGCLLVALVPE--M----------
POLG_FMDVO/311-475-------LTDSYAYMRNGWDVEVTAV.G---------------.........NQFNGGCLLVAMVPE--L----------
POLG_EMCV/161-359-------ALRRHYLVKTGWRVQVQCN.A---------------.........SQFHAGGLLVFMAPE--Y----------
POLG_TMEVB/172-382-------TLRRHYLCKTGWRVQVQCN.A---------------.........SQFHAGSLLVFMAPE--F----------
POLG_ENMGO/162-361-------TLRRHYLVKTGWRVQVQCN.A---------------.........SQFHAGSLLVFMAPE--Y----------
POLG_FMDVO/533-691-------LAQYYTQYSGTINLHFMFT.G---------------.........PTDAKARYMVAYAPP--G----------
POLG_FMDV1/533-692-------IAQYYTQYSGTINLHFMFT.G---------------.........STDSKARYMVAYIPP--G----------
POLG_EMCV/420-582-------LSRNFAQYRGSLVYTFVFT.G---------------.........TAMMKGKFLIAYTPP--G----------
POLG_TMEVB/443-606-------VARNFNQYRGSLNFLFVFT.G---------------.........AAMVKGKFLIAYTPP--G----------
POLG_HE701/347-515-------ISRYYTHWSGSLEMTFMFC.G---------------.........SFMTTGKLIICYTPP--G----------
POLG_HRV2/358-522-------ISSYFTHWTGSLRFSFMFC.G---------------.........TANTTVKLLLAYTPP--G----------
POLG_HRV8A/364-529-------LASYYTHWTGSLRFSFMFC.G---------------.........SASSTLKLLIAYTPP--G----------
POLG_HRV1B/360-525-------IASYYTHWTGSLRFSFMFC.G---------------.........TANTTLKLLLAYTPP--G----------
POLG_BOVEV/345-515-------LAKHYTQWSGSVEITCMFT.G---------------.........TFMTTGKVLLAYTPP--G----------
POLG_CXA21/369-534-------ILNYYTHWTGSIRFTFLFC.G---------------.........SMMATGKLLLSYSPP--G----------
POLG_CXA9/358-524-------ILNYYAHWSGSMKLTFVFC.G---------------.........SAMATGKFLIAYSPP--G----------
POLG_CXB4J/358-524-------ILNYYTHWSGSLKLTFVFC.G---------------.........SAMATGKFLLAYSPP--G----------
POLG_CXB3N/360-526-------ILNYYTHWSGSIKLTFMFC.G---------------.........SAMATGKFLLAYSPP--G----------
POLG_CXB1J/360-526-------ILNYYTHWSGSIKLTFMFC.G---------------.........SAMATGKFLLAYSPP--G----------
POLG_FMDVO/725-872-------LLRASTYYFSDLEIAVKHE.G---------------.................DLTWVPN--G----------
POLG_FMDV1/726-878-------LLRAATYYFSDLEIVVRHD.G---------------.................NLTWVPN--G----------
POLG_BOVEV/610-775-------KMSWFTYMRFDVEFTIIATSS---------------TGQNV....TTEQHTTYQVMYVPP--G----------
POLG_HRV8A/621-792-------KYELFTYTRFDSEITIVTA.A---------------AAQG.....NDSGHIVLQFMYVPP--G----------
POLG_HRV2/614-772-------KFELFTYTRFDSEITLVPC.I---------------SALS.....QDIGHITMQYMYVPP--G----------
POLG_HRV1B/627-786-------KFELFTYVRFDSEVTLVPC.I---------------AGRG.....DDIGHVVMQYMYVPP--G----------
POLG_HE701/609-781-------KMELFTYLRFDTEITIVPTLR---------------LFSSSNVSFSGLPNLTLQAMYVPT--G----------
POLG_HRV14/614-787-------KLELFTYVRFDSEYTILAT.A---------------SQPDSA...NYSSNLVVQAMYVPP--G----------
POLG_CXA9/612-783-------KLEMFTYLRFDMEVTFVIT.S---------------RQDPGTTLAQDMPVLTRQIMYVPP--G----------
POLG_CXB4J/612-783-------KMEMFTYIRCDMELTFVIT.S---------------HQEMSTATNSDVPVQTHQIMYVPP--G----------
POLG_SVDVU/612-782-------KLEMFTYARFDLELTFVIT.S---------------TQEQPTVRGQDAPVLTHQIMYVPP--G----------
POLG_CXB3N/630-782-------KLEFFTYVRFDLELTFVIT.S---------------TQQPSTTQNQDAQILTHQIMYVPP--G----------
POLG_POL1M/636-806-------KLEFFTYSRFDMELTFVVT.A---------------NFTETNN..GHALNQVYQIMYVPP--G----------
POLG_CXA21/642-812-------KLEFFTYSRFDLEMTFVFT.E---------------NYPSTAS..GEVRNQCDQIMYIPP--G----------
POLG_CXA24/646-809-------KLEFFTYSRFDLEMTFVIT.E---------------RYYTSNT..GYARNQVYQLMYIPP--G----------

PF00915

CAPSD_VESVA/137-421-------ISKLYSTWSGGIDVRFTVS-G------------------------SGVFGGKLAALLVPP..G----------
POLG_RHDVF/1768-2065-------LSQMYAGWAGGMQFRFIVA-G------------------------SGVFGGRLVRAVIPP..G----------
CAPSD_FCVUR/112-395-------LSKLYVAWSGSVEVRFSIS-G------------------------SGVFGGKLAAIVVPP..G----------
CAPSD_NVN68/2-294-------LSQMYNGWVGNMRVRIMLA-G------------------------NAFTAGKIIVSCIPPGFG----------

PF08762

Q8B107_ALPV/599-804-------YSYIFAYYRGSFRFKIAPFENKVYAARIR......LIPENGATEANAGPVQEDNTVIDETRTA----------
O56051_9VIRU/590-790-------FASLYAFYRGSMRYKIAPLSNASPLV.........VALKPNSLYSGVRVIDTNGTWTYPDYKG----------
Q56QP7_9VIRU/684-855-------LSYLYRFSRGGYRYKFFADDN...................EQGQVMSTLVKNYHK.DHATSTG----------
O36967_9VIRU/668-900-------YYFIYGFWRGGMRFKLQAVRTNSAETSVKTDTTWTVNLWNSVQDSFNSLINVFSTTDYPIKST----------
Q5UBY1_9VIRU/79-259-------LSYLYRFYRGGRRYKFFNTTA...............LKQSQTCYIRSFLTPRYYTPDNTNNDG----------
Q6ITS9_9VIRU/106-313-------VAEMYALYRGGVRVKVVTEKG............................VDFVRATVSPQQTY----------
Q4JFT2_9VIRU/834-1009-------ISYMYRFTHGSISYKIIPKNKG............................DLYITTTSPDSIE----------

PF02443

Q5Y4T0_PCV2/5-226-------TIPQPFPYHSRYFTPKPVLDR----------------------------------TIDYFQPN----------
Q27W03_PCV1/5-227-------TIRQPFTYHSRYFTPKPELDQ----------------------------------TIDWFHPN----------
A3FEQ4_9CIRC/3-256-------TWDPSRIH.RRYFVPKP....----------------------------------TIQGAGQG----------
Q3HUU1_GOCV/5-247-------TWSPHRYH.KRVFIPKP....----------------------------------TIQQGGTG----------
Q1L2D2_9CIRC/1-237-------KWDQRKGF.KRLVRPKPQL..----------------------------------VITDLSTA----------
CAPSD_CACV/7-243-------KWDLRKGF.KRLFKPRPQL..----------------------------------SVTDTDAA----------
Q0H9S8_9CIRC/4-236-------QWDLRKGF.KRLFRPRPQI..----------------------------------SITDTDAG----------
Q06J73_9CIRC/8-245-------KWTLRKGF.KRLFRPRPQL..----------------------------------SVTDTDTA----------
Q9DXG3_BFDV/11-242-------KWFVSRGF.KRLLRPKPQI..----------------------------------TIEDLTTA----------
Q69EZ5_BFDV/7-239-------KWYLSRGF.KRLLRPKPQI..----------------------------------TLTDLTTA----------
Q9DXG0_BFDV/11-242-------KWYLSRGF.KRLLRPKPQI..----------------------------------MMNDLSTA----------
Q9DXF4_BFDV/3-235-------KWYLNKGF.KRLLRPKPQI..----------------------------------TINDLTTV----------

PF02956

A7VLZ2_9VIRU/1-506.......TITYNKGWFQPALLQAKQITK------PSQAN.............PPLKGARYN.PTLDTGEN----------
Q9WT88_9VIRU/1-603TVD....YYEYHCGWFSNIFIGPNRY.N------LQ.FQ.............TAYVDTTYN.PLMDKGKG----------
Q91CY9_9VIRU/1-581TLN....SVDYHLGKYSAIFLSPYRT.N------TQ.FD.............TAYQDVTYN.PNTDKGKG----------
A7VLY0_9VIRU/1-515.......SVNYLQGFFSQYVLQAQKITD------ADDNVPAKYEQYSAAMSTLLIAAFRYN.PEEDTGQG----------
Q9JGT1_9VIRU/1-585STR....YLHYTGGLYTSIWLSAGRS.Y------FE.TH.............GPDTDITYN.PFSDRGEG----------
Q80QT8_9VIRU/1-595KHQ....EYEYHLGWYSNIFLGNLRH.N------LA.FS.............PAYIDITYN.PIVDKGQG----------
CAPSD_TTVB1/1-533.......DVIIYYGTKPKQDDNWTSTAP------ILPIT.............SLYVECRYN.PFKDKGTG----------
A7VM00_9VIRU/1-509.......SLNKDSGWFNPKVLNAYTVLK------GDQRQSL...........VPCGVLRYN.PYTDTGRG----------
Q9JG61_9VIRU/1-534.......DVQIFYGTPPTETTYNTQP.Q------LQTIT.............GLYQECRYN.PFKDKGTG----------
Q91PS3_9VIRU/1-581K......FLNHKTGIFSPIFLSRQRL.A------PD.FP.............GFYTEVIYN.PANDKGVG----------
CAPSD_TTVV4/1-560K......ELNFKTGMYSAIFLTNGRL.S------PD.YP.............GIYIEVVYN.PLLGQGEG----------
Q91C93_9VIRU/1-546.......NYNIWITNKTPQELKAKYKSN------TDKLHSSDTDTFWTLKRVPSVLDCRYN.PFRDDNR.----------
Q2F827_9VIRU/1-589SIK....YMEYHTGIYSSIFLSPLRS.N------LE.FP.............TAYQDVTYN.PLTDRGIG----------
Q91CY5_9VIRU/1-584NLT....CMEYHTGIYSSIFLSPQR..N------LQ.FP.............AAYLDVTYN.PNCDRGIG----------
Q8V7G9_9VIRU/1-572PEWSNRQYLEHDYGLFSPYFLTPNRY.S------TE.WH.............MPITYVRYN.PLADKGIG----------
Q99A78_9VIRU/1-584GSP....YLEYHGGLYSSIWLSAGRS.Y------FE.TK.............GTYTDITYN.PFTDRGQG----------
Q6H9C2_9VIRU/1-573STD....LYEYHSGIYSSIYLSAGRS.Y------FE.TT.............GAYSDIIYN.PFTDKGTG----------
CAPSD_TTVT1/1-433.......SYDFKDTNEVKKVWN......------..................TAGKKYYYR.ADWDTGDG----------
Q9JG80_9VIRU/1-589STD....AYEYHLGMFSTIFLAPDR..P------VPRFP.............CAYQDVTYN.PLMDKGVG----------
A7VLZ6_9VIRU/1-506.......SVSYTKGYFQPPFLQTQFVCT------SSMCDVKAGY........LPINVAIYN.PMQDSSQG----------
Q6H9D2_9VIRU/1-557K......YLNYRTGIYSAIFLSAGRL.S------PD.FP.............GLYDDIVYN.PTTDEGIG----------
Q6H999_9VIRU/1-471K......AFCHLTGIYSPPYLNQGRI.S------PEIF..............GLYTEIIYN.PYTDKGTG----------
Q77JT5_9VIRU/1-606NTN....IFDYYTGMYSSIFLSSGRS.N------PE.VK.............GSYTDISYN.PLTDKGVG----------
Q91PS7_9VIRU/1-585E......YLNHKTGLYSPIFLSNSRL.S------PD.FP.............GFYIDVLYN.PANDKGIG----------
CAPSD_TTVV9/1-555.......NFGLSYGLYSPLLLYPEMYFP------EQS...............KVYQKARYN.PLLDQGIG----------
Q9JG47_9VIRU/1-553.......QRMIATGKTLKELCQIYKDDD------ITTAKLKEGFIFKE....QKWVELRYN.PWADKGKG----------
A7VLW0_9VIRU/1-507.......SVSISKGWFQPKILNAYEVKD------NTVTQAL...........TPCGVLRYN.PADDDGQG----------
Q0ZLH9_9VIRU/1-573Q......YLNFKSGLFSSIFLDNARL.S------PD.FK.............GMYQEVVYN.PFNDRGVG----------
Q5ENW7_9VIRU/1-501.......ASTLKIGNLKGLVLRQLMNQE------MT................YIWKEGEYSAPFVQRWKG----------
A7VLX2_9VIRU/1-509.......SINYTGGWFDTRFLNSYEIKK------KNTQQWLGY.........LPVGVARYN.PNEDTGEG----------
Q80AR5_9VIRU/1-594THP....EFEYHAGWYSNIFIGPNRF.N------IQ.FK.............VAYMDVTYN.PINDKGHL----------
Q91CZ2_9VIRU/1-601TKD....WWEYRLGLFSPIFLSPLRSSN------IE.WP.............FAYRDIIYN.PLMDKGVG----------
CAPSD_TTVG1/1-514.......SISKEGGYFSPKILQAYQTKV------KSVDYKP...........LPIVLGRYN.PAIDDGKG----------
Q98Y63_9VIRU/1-581TYD....AVDYHLGKYSPIFLSPYRT.N------TQ.FP.............TAYMDVTYN.PNVDKGKG----------
Q9QU36_9VIRU/1-529.......SQIYVSNKTPQEVVNYIVSHQ------TQKVKEYTGITPRTL...PLTVECRYN.PFNDKSTG----------
A7VM12_9VIRU/1-509.......SVSYDNGWFNKNFLRAIELQS------PTGTKLGQ..........LPLNYGRYN.PTRDKGIG----------
A7VLV6_9VIRU/1-508.......SINYDTGWFNSQFLSSYKIEK------TSTKQPYAH.........LPIGVARYN.PDQDTGQG----------
Q9JG50_9VIRU/1-535.......QVRFFISSKNPTTIQDTDLNN------PISNTTILDE........PVFQECRYN.PYKDKGYG----------
A7VLW4_9VIRU/1-507.......SISYDDGWFGPLFLSAIKIGK------IEQATAT...........HQIIQARYN.PNIDSGVG----------
A7VM04_9VIRU/1-513.......SVNYNTGFFSKQMLEAVQLTT------DQTGQRPLGM........NPVNICRYN.PTLDSGKG----------
A7VLY4_9VIRU/1-498.......SVSYTTGWFNPKLMQLTEYVT------PQQLA.............KPVLAFRYN.AQLDNGKG----------
CAPSD_TTVD1/1-324............................------..........................N.DMINK.VP----------
Q91CZ6_9VIRU/1-596TKD....YWEYRIGMFSPTFLSPYRTSP------IENWP.............MAYRDISYN.PLNDKVVG----------
A7VM08_9VIRU/1-506.......WLTYEGGWFQPKILQAYKVTL------NGADKAL...........LPLVPIRYN.PAADDGTG----------
CAPSD_TTVV3/1-573TTD....LFEYHAGIYSSIFLSPGRA.Y------FE.TP.............GAYQDIIYN.PFTDKGIG----------
Q91D00_9VIRU/1-593TTP....EYEYHAGWYSPVFIGPNRH.N------IQ.FR.............TAYMDVTYN.PLNDKGQF----------
Q99AR5_9VIRU/1-604TID....YYEYHAGWFSNIFIGPNRH.S------LQ.FQ.............TAYVDTTYN.PLNDKGKG----------
Q9DTD2_9VIRU/1-559TTN....DLEYHTGMYSSIFLSSGRS.N------PE.LK.............GPYTDVCYN.PLVDKGIG----------
Q91D04_9VIRU/1-591TNK....SVSYHLGKYSPIFLSSYRT.N------LQ.FI.............TAYTDVTYN.PLNDKGKG----------
CAPSD_TTVV8/1-571NTQW...HLEYHAGIYSAPFLSAGRL.N------PE.IK.............GLYTDITYN.PMMDKGTG----------
Q5ENX0_9VIRU/1-603Q......LLEYHLGIYSPIFLHPGRS.N------IQ.MW.............TAYRDIVYN.PLLDKGEG----------
O90364_9VIRU/1-590EDC....TLEYHGGLYSSIWLSPGRS.Y------FE.TP.............GAYTDIKYN.PFTDRGEG----------
Q9IFV0_9VIRU/1-583K......YLNYRTGLYSSIFLANERT.S------PD.FP.............GLYQEVVYN.PLVDEGEG----------
Q9QUE7_9VIRU/1-586GSE....YLEYHGGLYSSIWLSAGRS.Y------FE.TK.............GAYTDICYN.PYTDRGEG----------
A8DMR2_9VIRU/1-531.......NLNKLQTANPTEKIQNLNCTL------LPPEK.............TVLTICRYN.PQNDRSAH----------
Q9DUH8_9VIRU/1-609H......LLDYKLGIYSPVFLHPGRS.N------IQ.MW.............TAYRDIVYN.PFLDKGEG----------
A7VLW8_9VIRU/1-511.......SINYNTGYFSTKVLNAFKVMV------NSKESKP...........LPLGVARYN.PVEDDGKG----------
Q99AQ3_9VIRU/1-582TTD....RYEYHVGMFSPIFLTPYRSAG------LD.FP.............YAYADVTYN.PLTDKGVG----------

PF02247

POL2_SQMVM/246-618-------VISLHRYFRGDFVFEIT--------------------------------------KMSSPYIK----------
POL2_CPMVS/460-832-------WISMWRYFRGELHFEVT--------------------------------------KMSSPYIK----------
POL2_BPMV/447-819-------VLSMWRYFVGDLVFEVS--------------------------------------KMTSPYIK----------
Q9Z006_9SECO/476-846-------YCGLSQYIQSDVILDFT--------------------------------------LMSSPMIG----------
O12663_9SECO/321-691-------YCGLSQYMQSDVILDFT--------------------------------------LMSSPMIG----------
Q9YWK0_9SECO/363-735-------VISLHRYFRGDFVFEIT--------------------------------------KMSSPYIK----------
POL2_CPSMV/437-806-------ILSMWRYFKADLEFELI--------------------------------------KMSSPYIN----------
POL2_RCMV/407-778-------FLSLWRYFHGDLVFEVQ--------------------------------------KMSSPFIK----------
Q9YWJ9_9SECO/452-824-------VISLHRYFRGDFVFEIT--------------------------------------KMSSPYIK----------
Q66170_CPMVS/343-715-------WISMWRYFRGELHFEVT--------------------------------------KMSSPYIK----------

PF03391

CAPSD_TRSV/179-344-------VMSRNLGWSGTISGSVK--------------------------------------SVSSLFCT----------
POL2_RRVS/768-936-------VAAHFRSWTGKVRMSIQ--------------------------------------EVSSIFLT----------
POL2_BRAV/1268-1433-------YALFLQGHGGSLVGEVV--------------------------------------HTGSAAVS----------
Q65029_ARMV/745-916-------LLSYYLGIGGIVKGKVH--------------------------------------VCSPCTYG----------
POL2_ARMVS/792-963-------LLSYYLGIGGIVKGKVH--------------------------------------VCSPCTYG----------
Q67703_GFLV/166-336-------LVSCVLGMGGTIRGKVH--------------------------------------ICAPIFYS----------
POL2_GFLV/771-941-------LVSCVLGMGGTVRGRVH--------------------------------------ICAPIFYS----------
POL2_BRSV/1007-1170-------LLSHFLGVGGTIHFVVR--------------------------------------TTSSAFVT----------
POL2_GCMV/981-1144-------LLSHFLGIGGTIHFKIQ--------------------------------------CTSSAFVT----------
POL2_TORVR/1497-1662-------LLRFFQGSNGTLHGRIK--------------------------------------KIGTALTT----------
Q88483_9SECO/1003-1166-------VLSHFLGVGGDIIFSVH--------------------------------------STASTFVS----------

PF03689

A3FEM9_9SECO/10-101-------QRQG..FLHGKLRLRCF--------------------------------------IPTNIFCG----------
Q9QAH4_9SECO/9-99-------VRDG..CLKPKIKVRIT--------------------------------------AATSCFSG----------
Q09G89_GFLV/608-698-------ITAG..LVMPTFKIVIR--------------------------------------LPANAFTG----------
Q9JGK5_SDV/160-249-------LLSGVAILRPHFKFVCR--------------------------------------LVTPILES----------
Q9IV56_9SECO/636-727-------VYNR..NISPCILVRCH--------------------------------------LPKMPFLG----------
A1YYW2_BRAV/156-247-------LAHG..LASFKYDLQLT--------------------------------------VGSNPFVG----------
Q65624_9SECO/45-137-------LAKG..LIHPDLKLRMT--------------------------------------VGQNPFVG----------
Q6JX06_9SECO/849-939-------VQMG..YMDRNLKLISH--------------------------------------LAPSQFCG----------
Q20LA0_9SECO/601-691-------VKDG..CMKPRIKVRIS--------------------------------------AASSCFSG----------
POL2_BRSV/842-932-------LEQG..YVSQNLTAISH--------------------------------------LAPNAFSG----------
A0A9J8_ARMV/580-670-------ITAG..LIMPDFKVVIR--------------------------------------YPANAFTG----------
Q6JX05_9SECO/604-694-------ITSG..LCMPKFEVVIR--------------------------------------YPPNAFTG----------
Q9Z0D6_SDV/74-163-------LLSGVAILRPHFKFTFR--------------------------------------LVTPILES----------
Q9QRA5_9SECO/10-101-------QRQG..FVHGELRLRCF--------------------------------------IPTNIFCG----------
Q86631_9SECO/85-173-------QREL..PTTFLVTGTIA--------------------------------------MSVNIMAG----------
POL2_GCMV/815-905-------MQAG..YVNKNLTFISH--------------------------------------LAPSQFCG----------
A2ID55_9SECO/270-361-------LSKG..MVHPKLEVEIL--------------------------------------APTNMFMG----------
Q64959_9SECO/4-94-------LERG..YVDRNILMVSH--------------------------------------LFTSPYLG----------
Q8B5P7_TRSV/12-103-------CAKG..IVNPTFTVRMH--------------------------------------APRNAFAG----------
Q88483_9SECO/838-928-------LMDG..YVSQNLRAVSH--------------------------------------LAPNSFSG----------
POL2_CNSV/688-778-------LQKG..YIDTNLKLICH--------------------------------------LPRAPFAG----------

PF00760

CAPSD_CMVFN/11-215-LSVAAISAMF---------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188-AAF-QVALAV---------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754RKVYKGITFEFNAPTLIDQGWWVGAHIPVKPQSETIPAAERFSAGSMTVSASNAIFQPSNTVARIVWSITPLPVATVALT
CAPSD_NCBVS/1-608RLTSSGVTAYFNAPTLVNQGVAVIAQF..QPDKEHQKENPDIVAGTTQTGGT...................LQLGGSGPN
CAPSD_HASV/2-647RLTYKAITCEANMPTLVDQGFWIGGQYALTPTSLPQYDVS....EAYALHTLTFARPSSAAALAFVWA..GLPQGGTAPA

PF01829

CAPSD_NODAM/42-399TIAIDGLEALDALPNNNYSGSFIEGCYSQSVCNEPEFEFHPI--------------------------------------

PF08435

Q91H09_9CALI/305-535.HTNGEMDCLL---------------------------------------------------------------------
Q8JMP1_9CALI/305-540QGQDAFIDCLL---------------------------------------------------------------------
Q8B4Z2_9CALI/297-515.VNPGPCPCLL---------------------------------------------------------------------
Q917X1_9CALI/305-538.FGNPAIDCLV---------------------------------------------------------------------
Q9IV43_9CALI/304-537.HKPNLVPCLL---------------------------------------------------------------------
Q8VA02_9CALI/306-539.TNGLSVPCTI---------------------------------------------------------------------
Q9IV49_9CALI/306-538.HELGYMDCLV---------------------------------------------------------------------
Q6EAX3_9CALI/306-538.VSDGVIDCLL---------------------------------------------------------------------
Q8BAC6_9CALI/304-534.HTDGAIDCLL---------------------------------------------------------------------
Q6WQW7_9CALI/296-512...SNPLPCLL---------------------------------------------------------------------
Q6B7R3_9CALI/303-535.GQPIEIDCLI---------------------------------------------------------------------
Q6EAW7_9CALI/305-538.HGDPFIDCLV---------------------------------------------------------------------
Q66418_9CALI/306-538.VNGMRIPCTL---------------------------------------------------------------------
Q80FL2_9CALI/317-546.ISKGILDCLV---------------------------------------------------------------------
Q9IV42_9CALI/305-535.PSQLQVPCLL---------------------------------------------------------------------
Q6XDL5_9CALI/307-546.YGNPAIDCLM---------------------------------------------------------------------
Q6B7R2_9CALI/304-538.SNMAQVPCTL---------------------------------------------------------------------
Q917X4_9CALI/305-533.TSNGAIDCLL---------------------------------------------------------------------
Q783W9_9CALI/306-535.HTDGAIDCLL---------------------------------------------------------------------
Q80J94_9CALI/309-538DAAAEAIDCAL---------------------------------------------------------------------
Q913B6_9CALI/305-540.YGNPAIDCLL---------------------------------------------------------------------
Q8JW44_9CALI/304-539.SAPNDVPCLL---------------------------------------------------------------------
Q83876_9CALI/301-524....DSLPCLL---------------------------------------------------------------------
Q9IV48_9CALI/306-533..NTAQIPCTL---------------------------------------------------------------------
Q8V713_9CALI/316-545.VVAGWLDCLL---------------------------------------------------------------------
Q91I85_9CALI/304-538.GSPNLVPCLL---------------------------------------------------------------------
Q8JXJ0_9CALI/304-537.NRLNLVPCLL---------------------------------------------------------------------
Q783X1_9CALI/315-545.YGSGQIDCLI---------------------------------------------------------------------
Q783Y0_9CALI/305-533.VADPVIDCLL---------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191-AASGPTSLLK---------------------------------------------------------------------
Q9DLK1_FMDVP/202-285-TTSTHTNNTQ---------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452GVTITLFSANIDAITSLSI..GGELVFQ...TS-----------------------------------------------
POLS_DXV96/2-442GFHNKEFSINVDSVGPVDILWSGQMTMQ.....-----------------------------------------------
POLS_BSNV/7-428TTDTKTNGFNIDATTPTEV..TVDMQIA...QI-----------------------------------------------
POLS_IPNVJ/5-453GTPTTIYEGNADIVNSTAV..TGDITFQLEAEP-----------------------------------------------

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506--------------------------------------------------------------------------------
Q9WT88_9VIRU/1-603--------------------------------------------------------------------------------
Q91CY9_9VIRU/1-581--------------------------------------------------------------------------------
A7VLY0_9VIRU/1-515--------------------------------------------------------------------------------
Q9JGT1_9VIRU/1-585--------------------------------------------------------------------------------
Q80QT8_9VIRU/1-595--------------------------------------------------------------------------------
CAPSD_TTVB1/1-533--------------------------------------------------------------------------------
A7VM00_9VIRU/1-509--------------------------------------------------------------------------------
Q9JG61_9VIRU/1-534--------------------------------------------------------------------------------
Q91PS3_9VIRU/1-581--------------------------------------------------------------------------------
CAPSD_TTVV4/1-560--------------------------------------------------------------------------------
Q91C93_9VIRU/1-546--------------------------------------------------------------------------------
Q2F827_9VIRU/1-589--------------------------------------------------------------------------------
Q91CY5_9VIRU/1-584--------------------------------------------------------------------------------
Q8V7G9_9VIRU/1-572--------------------------------------------------------------------------------
Q99A78_9VIRU/1-584--------------------------------------------------------------------------------
Q6H9C2_9VIRU/1-573--------------------------------------------------------------------------------
CAPSD_TTVT1/1-433--------------------------------------------------------------------------------
Q9JG80_9VIRU/1-589--------------------------------------------------------------------------------
A7VLZ6_9VIRU/1-506--------------------------------------------------------------------------------
Q6H9D2_9VIRU/1-557--------------------------------------------------------------------------------
Q6H999_9VIRU/1-471--------------------------------------------------------------------------------
Q77JT5_9VIRU/1-606--------------------------------------------------------------------------------
Q91PS7_9VIRU/1-585--------------------------------------------------------------------------------
CAPSD_TTVV9/1-555--------------------------------------------------------------------------------
Q9JG47_9VIRU/1-553--------------------------------------------------------------------------------
A7VLW0_9VIRU/1-507--------------------------------------------------------------------------------
Q0ZLH9_9VIRU/1-573--------------------------------------------------------------------------------
Q5ENW7_9VIRU/1-501--------------------------------------------------------------------------------
A7VLX2_9VIRU/1-509--------------------------------------------------------------------------------
Q80AR5_9VIRU/1-594--------------------------------------------------------------------------------
Q91CZ2_9VIRU/1-601--------------------------------------------------------------------------------
CAPSD_TTVG1/1-514--------------------------------------------------------------------------------
Q98Y63_9VIRU/1-581--------------------------------------------------------------------------------
Q9QU36_9VIRU/1-529--------------------------------------------------------------------------------
A7VM12_9VIRU/1-509--------------------------------------------------------------------------------
A7VLV6_9VIRU/1-508--------------------------------------------------------------------------------
Q9JG50_9VIRU/1-535--------------------------------------------------------------------------------
A7VLW4_9VIRU/1-507--------------------------------------------------------------------------------
A7VM04_9VIRU/1-513--------------------------------------------------------------------------------
A7VLY4_9VIRU/1-498--------------------------------------------------------------------------------
CAPSD_TTVD1/1-324--------------------------------------------------------------------------------
Q91CZ6_9VIRU/1-596--------------------------------------------------------------------------------
A7VM08_9VIRU/1-506--------------------------------------------------------------------------------
CAPSD_TTVV3/1-573--------------------------------------------------------------------------------
Q91D00_9VIRU/1-593--------------------------------------------------------------------------------
Q99AR5_9VIRU/1-604--------------------------------------------------------------------------------
Q9DTD2_9VIRU/1-559--------------------------------------------------------------------------------
Q91D04_9VIRU/1-591--------------------------------------------------------------------------------
CAPSD_TTVV8/1-571--------------------------------------------------------------------------------
Q5ENX0_9VIRU/1-603--------------------------------------------------------------------------------
O90364_9VIRU/1-590--------------------------------------------------------------------------------
Q9IFV0_9VIRU/1-583--------------------------------------------------------------------------------
Q9QUE7_9VIRU/1-586--------------------------------------------------------------------------------
A8DMR2_9VIRU/1-531--------------------------------------------------------------------------------
Q9DUH8_9VIRU/1-609--------------------------------------------------------------------------------
A7VLW8_9VIRU/1-511--------------------------------------------------------------------------------
Q99AQ3_9VIRU/1-582--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215------------------------ADGASPVLVYQYAASG-----------VQANNKLLYDL------------------

PF01318

CAPSD_BMV/2-188------------------------ADSSKEVVAAMYT-------------------------------------------

PF03566

Q80IX5_PRVFL/54-754TGTGGTNNTSGKFFSVEIDGNV..NSVWTFTAPASILAEG........EPFAEEGDTTSFSM.......TTI......TA
CAPSD_NCBVS/1-608YTLTMTIGDQVEFGG.........AAIPLPTVSMGPMPES........GQLVFQTANLTFDV..GNTITITT......TL
CAPSD_HASV/2-647GTPAWEQASSGGYLTWRHNGTTFPAGSVSYVLPEGFALERYDPNDGSWTDFASAGDTVTFRQVAVDEVVVTNNPAGGGSA

PF01829

CAPSD_NODAM/42-399------------------------MEGYASVPPANVTNAQ----------------------------------------

PF08435

Q91H09_9CALI/305-535------------------------PQEFVQHFYQEAATAR----------------------------------------
Q8JMP1_9CALI/305-540------------------------PQEWVNHFYQEAAPSQ----------------------------------------
Q8B4Z2_9CALI/297-515------------------------PQEWITHFVSERAALQ----------------------------------------
Q917X1_9CALI/305-538------------------------PQEWVQHFYQESAPSL----------------------------------------
Q9IV43_9CALI/304-537------------------------PQEFVTHFVSEQAPSM----------------------------------------
Q8VA02_9CALI/306-539------------------------PQEFVTHFVNEQAPTR----------------------------------------
Q9IV49_9CALI/306-538------------------------PQEWVQHFYQEAATAQ----------------------------------------
Q6EAX3_9CALI/306-538------------------------PQEWIQHFYQESAPSQ----------------------------------------
Q8BAC6_9CALI/304-534------------------------PQEWIEHFYQEAAPSQ----------------------------------------
Q6WQW7_9CALI/296-512------------------------PLEWVFHFASERPTKQ----------------------------------------
Q6B7R3_9CALI/303-535------------------------PQEWVSHFYQESAPSQ----------------------------------------
Q6EAW7_9CALI/305-538------------------------PQEWIQHFYQESAPAQ----------------------------------------
Q66418_9CALI/306-538------------------------PQEYVAHFVNEQAPTR----------------------------------------
Q80FL2_9CALI/317-546------------------------PQEWVQHFYQESAPAQ----------------------------------------
Q9IV42_9CALI/305-535------------------------PQEFITHFCNEQAPIA----------------------------------------
Q6XDL5_9CALI/307-546------------------------PQEWVQHLYQESAPSL----------------------------------------
Q6B7R2_9CALI/304-538------------------------PQEFVAHFVNEQAPVR----------------------------------------
Q917X4_9CALI/305-533------------------------PQEWVQHFYQESAPSS----------------------------------------
Q783W9_9CALI/306-535------------------------PQEWVAHFYQEAATAQ----------------------------------------
Q80J94_9CALI/309-538------------------------PQEFVSWFASNAFTVQ----------------------------------------
Q913B6_9CALI/305-540------------------------PQEWVQHFYQEAAPSM----------------------------------------
Q8JW44_9CALI/304-539------------------------PQEYITHFVSEQAPTM----------------------------------------
Q83876_9CALI/301-524------------------------PQGYISHLASEQAPTV----------------------------------------
Q9IV48_9CALI/306-533------------------------PQEFVSHFVEQQAPIR----------------------------------------
Q8V713_9CALI/316-545------------------------PQEWVQHFFQESATSQ----------------------------------------
Q91I85_9CALI/304-538------------------------PQEYITHFISEQAPIQ----------------------------------------
Q8JXJ0_9CALI/304-537------------------------PQEFIGHFVSEQAPAI----------------------------------------
Q783X1_9CALI/315-545------------------------PQEWVQHFYQEAAPSQ----------------------------------------
Q783Y0_9CALI/305-533------------------------HQEWIQHLYQESAPSQ----------------------------------------

PF02226

POLG_HRV8A/2-69------------------------PSKFTDPV------------------------------------------------
POLG_POL1M/2-69------------------------PSKFTEPI------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059------------------------ATEIVARAGASAA-------------------------------------------
POLS_CRPVC/291-340------------------------TPAWISAKAADLA-------------------------------------------
Q2HWK2_RSET1/357-413------------------------ATEIGAGAVGKIA-------------------------------------------
POLS_ABPVR/340-396------------------------TIKWVADKIGSVA-------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191------------------------........AGINAAAR----------------------------------------
Q9DLK1_FMDVP/202-285------------------------NNDWFSKLANTAFSGL----------------------------------------

PF01766

POLS_IBDVU/9-452------------------------VQGLILGATIYLIGFD----------------------------------------
POLS_DXV96/2-442------------------------.DEWTVTANYQPLNIS----------------------------------------
POLS_BSNV/7-428------------------------AAGKTLTVTVKLMGLT----------------------------------------
POLS_IPNVJ/5-453------------------------VNETRFDFILQFLGLD----------------------------------------

PF02248

Q66170_CPMVS/720-899------------------------RADWDGQVFVYLRQSM----------------------------------------
Q9YWJ9_9SECO/828-1009------------------------QSDWAASARIDLINNL----------------------------------------
POL2_CPMVS/837-1016------------------------RADWDGQVFVYLRQSM----------------------------------------
POL2_BPMV/821-1004------------------------RSDWASLVQVFLTNSN----------------------------------------
POL2_CPSMV/808-988------------------------RANWASHTQMSLVNSD----------------------------------------
POL2_RCMV/786-964------------------------RSDWTSTVQLFLRQSM----------------------------------------
Q66179_APMV/2-185------------------------RSEWSSTSRIDVRRAP----------------------------------------
POL2_APMV/802-985------------------------RSEWSSTSRIDVRRAP----------------------------------------
POL2_SQMVM/622-803------------------------QSDWAASARIDLINNL----------------------------------------
Q9YWK0_9SECO/739-920------------------------QSDWAASARIDLVNNL----------------------------------------

PF03688

A5H0K4_GFLV/264-422------------------------GSITITKLVGDKAMGL----------------------------------------
POL2_BRSV/1176-1338------------------------GRLKFVQ.....GMGI----------------------------------------
Q86631_9SECO/418-544------------------------TPTTYVQLVHKFGTTT----------------------------------------
POL2_ARMV/344-502------------------------GGVTITKLCGDKATGM----------------------------------------
Q88483_9SECO/1172-1336------------------------GA...VSLQTGMGRAA----------------------------------------
A2ID55_9SECO/610-780------------------------GRVLFRT...KFGNMR----------------------------------------
Q80JS8_BRAV/347-511------------------------GTVQLTTCRGMIDDVK----------------------------------------
A0A9J6_ARMV/960-1118------------------------GSVILTHLVGDKATGL----------------------------------------
CAPSD_TRSV/351-511------------------------GSVSITTNYRDWGAYW----------------------------------------
POL2_GCMV/1150-1316------------------------DLQGHISFYSGMGDST----------------------------------------
Q6XPY1_9SECO/164-322------------------------TQADDQKICESHSAGI----------------------------------------
Q6XFY6_9SECO/157-316------------------------GSVIFTKLCGDKATGL----------------------------------------
Q9IV56_9SECO/980-1138------------------------GHIIFVVYDADLVNSF----------------------------------------
Q65624_9SECO/386-551------------------------ATMQILTAVGRVGNAE----------------------------------------
POL2_CNSV/1022-1185------------------------TAGGVVTIAEGFGPE.----------------------------------------
Q64959_9SECO/338-502------------------------AR....EISQSRLEWV----------------------------------------
Q20LA0_9SECO/942-1102------------------------GTLKYMQYLYN....T----------------------------------------
A3FEN2_9SECO/348-507------------------------GSFSARLAFGKGVEEI----------------------------------------
Q9ELS0_9SECO/148-312------------------------SRLWIGKCWGDPKRAE----------------------------------------
Q9QAH0_9SECO/350-510------------------------GTLKYMQYLYH....T----------------------------------------
Q24M89_9SECO/943-1103------------------------GTLKYMQYLYH....T----------------------------------------

PF08462

Q5ZF43_CARMV/250-348------------------------AGKWCIIVRGTVEGGF----------------------------------------
Q999Y9_CARMV/250-348------------------------AGKWCIIVRGTVEGGF----------------------------------------
Q4JGW6_CARMV/250-348------------------------AGKWCIIVRGTIEGGF----------------------------------------
Q8JJU7_CARMV/250-348------------------------AGKWCIIVRGTVEGGF----------------------------------------
CAPSD_CARMS/250-348------------------------AGKWCIIVRGTVEGGF----------------------------------------
Q999Z1_CARMV/250-348------------------------AGKWCIIVRGTVEGGF----------------------------------------
CAPSD_CARMV/250-348------------------------AGKWCIIVRGTVEGGF----------------------------------------
Q7TG55_CARMV/250-348------------------------AGRWCIIVRGTVEGGF----------------------------------------

PF00729

CAPSD_PNLV/47-266------------------------MSALK-GYTTTSA-------------------------------------------
CAPSD_MCMVK/23-222------------------------VEDVA-RIVPSAT-------------------------------------------
CAPSD_PMVK/39-236------------------------LMDSE-SLVLVPS-------------------------------------------
CAPSD_RCNMV/24-213------------------------ISAYS-RSVSTAV-------------------------------------------
CAPSD_CARMS/51-245------------------------FYDLG-KHVETAA-------------------------------------------
CAPSD_SBMVA/46-262------------------------LSNLR-GYVSGQV-------------------------------------------
CAPSD_TBSVC/76-269------------------------LANYS-VLKETAP-------------------------------------------
CAPSD_POLVP/66-257------------------------LANMG-HWTESAP-------------------------------------------
CAPSD_OCSVU/111-308------------------------FYALS-NHCENMP-------------------------------------------
CAPSD_TNVA/61-272------------------------LSQSY-KAINFPP-------------------------------------------

PF11729

CAPSD_SJNNV/1-340------------------------LTSPG-RLVLLCVGSN----------------------------------------

PF00894

CAPSD_PLRV1/70-207------------------------VSSLQ-SYVNK---------------------------------------------
CAPSD_PEMVW/53-187------------------------KAADV-VLLDT---------------------------------------------
CAPSD_BYDVP/62-199------------------------QSALG-SYINS---------------------------------------------

PF03014

CAPSD_HEVCH/41-659------------------------YRNQGWRSVETSGVAE----------------------------------------

PF03115

CAPSD_HASV1/1-416------------------------GPRDG-WWLTNTNDNA----------------------------------------

PF00983

COAT_TYMV/8-177------------------------TYGGQ-IFC-----------------------------------------------

PF00073

Q9WMA0_9PICO/49-215------------------------QS..............----------------------------------------
POLG_AEVCA/45-212------------------------QV..............----------------------------------------
POLG_CXA9/93-300------------------------EM...........GGA----------------------------------------
POLG_CXB3N/93-302------------------------EM...........GCA----------------------------------------
POLG_CXB4J/93-300------------------------EM...........GCT----------------------------------------
POLG_CXA21/93-308------------------------VM...........ACN----------------------------------------
POLG_POL1M/93-308------------------------CL...........AGD----------------------------------------
POLG_POL3L/93-307------------------------CL...........AGD----------------------------------------
POLG_HE701/93-288------------------------QI.............G----------------------------------------
POLG_BOVEV/93-285------------------------QI..............----------------------------------------
POLG_HRV14/93-299------------------------QL...........ASH----------------------------------------
POLG_HRV2/93-302------------------------QI...........ASA----------------------------------------
POLG_HRV8A/93-302------------------------QL...........ASA----------------------------------------
POLG_HRV1B/93-301------------------------QL...........ASA----------------------------------------
POLG_FMDV1/311-475------------------------KA..............----------------------------------------
POLG_FMDVT/311-475------------------------GD..............----------------------------------------
POLG_FMDVO/311-475------------------------YS..............----------------------------------------
POLG_EMCV/161-359------------------------PT...........LDA----------------------------------------
POLG_TMEVB/172-382------------------------YTGKGTKTGTMEPSDP----------------------------------------
POLG_ENMGO/162-361------------------------PT...........LDV----------------------------------------
POLG_FMDVO/533-691------------------------ME..............----------------------------------------
POLG_FMDV1/533-692------------------------VE..............----------------------------------------
POLG_EMCV/420-582------------------------AG..............----------------------------------------
POLG_TMEVB/443-606------------------------AG..............----------------------------------------
POLG_HE701/347-515------------------------GS..............----------------------------------------
POLG_HRV2/358-522------------------------IA..............----------------------------------------
POLG_HRV8A/364-529------------------------VG..............----------------------------------------
POLG_HRV1B/360-525------------------------ID..............----------------------------------------
POLG_BOVEV/345-515------------------------GD..............----------------------------------------
POLG_CXA21/369-534------------------------AK..............----------------------------------------
POLG_CXA9/358-524------------------------AN..............----------------------------------------
POLG_CXB4J/358-524------------------------AG..............----------------------------------------
POLG_CXB3N/360-526------------------------AG..............----------------------------------------
POLG_CXB1J/360-526------------------------AG..............----------------------------------------
POLG_FMDVO/725-872------------------------AP..............----------------------------------------
POLG_FMDV1/726-878------------------------AP..............----------------------------------------
POLG_BOVEV/610-775------------------------AP..............----------------------------------------
POLG_HRV8A/621-792------------------------AP..............----------------------------------------
POLG_HRV2/614-772------------------------AP..............----------------------------------------
POLG_HRV1B/627-786------------------------AP..............----------------------------------------
POLG_HE701/609-781------------------------AR..............----------------------------------------
POLG_HRV14/614-787------------------------AP..............----------------------------------------
POLG_CXA9/612-783------------------------GP..............----------------------------------------
POLG_CXB4J/612-783------------------------GP..............----------------------------------------
POLG_SVDVU/612-782------------------------GP..............----------------------------------------
POLG_CXB3N/630-782------------------------GP..............----------------------------------------
POLG_POL1M/636-806------------------------AP..............----------------------------------------
POLG_CXA21/642-812------------------------AP..............----------------------------------------
POLG_CXA24/646-809------------------------AP..............----------------------------------------

PF00915

CAPSD_VESVA/137-421------------------------VE-PIESVSMLQYPHV----------------------------------------
POLG_RHDVF/1768-2065------------------------IE-IGPGLEVRQFPHV----------------------------------------
CAPSD_FCVUR/112-395------------------------VD-PIQSTSMLQYPHV----------------------------------------
CAPSD_NVN68/2-294------------------------SH-NLTIAQATLFPHV----------------------------------------

PF08762

Q8B107_ALPV/599-804------------------------AD------------V.----------------------------------------
O56051_9VIRU/590-790------------------------AE------------V.----------------------------------------
Q56QP7_9VIRU/684-855------------------------PS------------H.----------------------------------------
O36967_9VIRU/668-900------------------------GA------------LP----------------------------------------
Q5UBY1_9VIRU/79-259------------------------PS------------H.----------------------------------------
Q6ITS9_9VIRU/106-313------------------------GS------------EV----------------------------------------
Q4JFT2_9VIRU/834-1009------------------------TS------------TS----------------------------------------

PF02443

Q5Y4T0_PCV2/5-226------------------------.NKRN---------------------------------------------------
Q27W03_PCV1/5-227------------------------.NKRN---------------------------------------------------
A3FEQ4_9CIRC/3-256------------------------.STYS---------------------------------------------------
Q3HUU1_GOCV/5-247------------------------TNIWS---------------------------------------------------
Q1L2D2_9CIRC/1-237------------------------.NETA---------------------------------------------------
CAPSD_CACV/7-243------------------------.NVTA---------------------------------------------------
Q0H9S8_9CIRC/4-236------------------------.NVTA---------------------------------------------------
Q06J73_9CIRC/8-245------------------------.NTTA---------------------------------------------------
Q9DXG3_BFDV/11-242------------------------.NQSA---------------------------------------------------
Q69EZ5_BFDV/7-239------------------------.NQSA---------------------------------------------------
Q9DXG0_BFDV/11-242------------------------.NQSA---------------------------------------------------
Q9DXF4_BFDV/3-235------------------------.NQSA---------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506------------------------TAVWL.TNVVNQSYYP----------------------------------------
Q9WT88_9VIRU/1-603------------------------NKIWF.QYLSKKGTDY----------------------------------------
Q91CY9_9VIRU/1-581------------------------NKIWI.QSCTKESTIL----------------------------------------
A7VLY0_9VIRU/1-515------------------------NVVWLTSTLSNTHWER----------------------------------------
Q9JGT1_9VIRU/1-585------------------------NMLWI.DWLTKEDSQY----------------------------------------
Q80QT8_9VIRU/1-595------------------------NKVWF.QYLTKETTEF----------------------------------------
CAPSD_TTVB1/1-533------------------------NKVYL.VPTDSGLGSF----------------------------------------
A7VM00_9VIRU/1-509------------------------NKMWV.NSVLVGAWQE----------------------------------------
Q9JG61_9VIRU/1-534------------------------NIFYL.KSTKTQQGSF----------------------------------------
Q91PS3_9VIRU/1-581------------------------NKIWM.DWCTKNDSQW----------------------------------------
CAPSD_TTVV4/1-560------------------------NMIWL.EWCPKKTKQY----------------------------------------
Q91C93_9VIRU/1-546------------------------NEVYLLKITEQNSYDY----------------------------------------
Q2F827_9VIRU/1-589------------------------NRIWY.QYSTKENTTF----------------------------------------
Q91CY5_9VIRU/1-584------------------------NKIWF.QYSTKMTTDF----------------------------------------
Q8V7G9_9VIRU/1-572------------------------NRIYM.QWCSESSSSF----------------------------------------
Q99A78_9VIRU/1-584------------------------NMVWI.DWVSKYDSVY----------------------------------------
Q6H9C2_9VIRU/1-573------------------------NIIWI.DYLTKEDTIF----------------------------------------
CAPSD_TTVT1/1-433------------------------NAIMLPNTLSPT....----------------------------------------
Q9JG80_9VIRU/1-589------------------------NHIWF.QYNTKADTQL----------------------------------------
A7VLZ6_9VIRU/1-506------------------------NAIYL.VSTLTNTWDQ----------------------------------------
Q6H9D2_9VIRU/1-557------------------------NIVWI.DWCTKADCNF----------------------------------------
Q6H999_9VIRU/1-471------------------------NKVWM.DPLTKENNIY----------------------------------------
Q77JT5_9VIRU/1-606------------------------NMIWI.DWLTKGDTVY----------------------------------------
Q91PS7_9VIRU/1-585------------------------NKIWM.DWCTKNDSTW----------------------------------------
CAPSD_TTVV9/1-555------------------------NVVWT.EPLTKKTCDY----------------------------------------
Q9JG47_9VIRU/1-553------------------------NMVYL.LPINEHQHSY----------------------------------------
A7VLW0_9VIRU/1-507------------------------NKLWV.VNTLTYNWKI----------------------------------------
Q0ZLH9_9VIRU/1-573------------------------NKVWV.QWCTNEDTIF----------------------------------------
Q5ENW7_9VIRU/1-501------------------------SRFAV.IDARKADQEN----------------------------------------
A7VLX2_9VIRU/1-509------------------------NEVWL.TSIQKGHFDK----------------------------------------
Q80AR5_9VIRU/1-594------------------------NRVWF.QYSTKPTTDF----------------------------------------
Q91CZ2_9VIRU/1-601------------------------NMMWY.QYNTKPDTQF----------------------------------------
CAPSD_TTVG1/1-514------------------------NKIYL.QTIMNGHWGL----------------------------------------
Q98Y63_9VIRU/1-581------------------------NKIWL.QSVTKETSDF----------------------------------------
Q9QU36_9VIRU/1-529------------------------NNTFF.VSNHADQTKW----------------------------------------
A7VM12_9VIRU/1-509------------------------NKIYI.ISTIADSWGP----------------------------------------
A7VLV6_9VIRU/1-508------------------------NEVWL.ATIFKGHYDK----------------------------------------
Q9JG50_9VIRU/1-535------------------------NEAYFLSNVIAKKKAW----------------------------------------
A7VLW4_9VIRU/1-507------------------------NQIYC.ASTHAYSWAP----------------------------------------
A7VM04_9VIRU/1-513------------------------NAIWL.VSSHANTYRE----------------------------------------
A7VLY4_9VIRU/1-498------------------------NSVWF.KSILTEDFSK----------------------------------------
CAPSD_TTVD1/1-324------------------------NMWWK...........----------------------------------------
Q91CZ6_9VIRU/1-596------------------------NKLWL.QSIVKADTQF----------------------------------------
A7VM08_9VIRU/1-506------------------------NLVTI.VDLVAGHWTG----------------------------------------
CAPSD_TTVV3/1-573------------------------NIVWI.DWLSKSDAVY----------------------------------------
Q91D00_9VIRU/1-593------------------------NRVWF.QYSTKPTTDF----------------------------------------
Q99AR5_9VIRU/1-604------------------------NKIWF.QYHSKVNTDL----------------------------------------
Q9DTD2_9VIRU/1-559------------------------NIVWL.DWCSKEDSKF----------------------------------------
Q91D04_9VIRU/1-591------------------------NQIWV.QYVTKPDTIF----------------------------------------
CAPSD_TTVV8/1-571------------------------NKIWC.DSLTKADMKY----------------------------------------
Q5ENX0_9VIRU/1-603------------------------NRIWF.QYHTKKDNRY----------------------------------------
O90364_9VIRU/1-590------------------------NMLWI.DWLSKKNMNY----------------------------------------
Q9IFV0_9VIRU/1-583------------------------NIVWI.DWCSKDDTTF----------------------------------------
Q9QUE7_9VIRU/1-586------------------------NMVWI.DWLSKTDSRY----------------------------------------
A8DMR2_9VIRU/1-531------------------------NALYA.SPVTTARTKW----------------------------------------
Q9DUH8_9VIRU/1-609------------------------NKVWY.QYHTKTDNKY----------------------------------------
A7VLW8_9VIRU/1-511------------------------NEIWV.ASIHSNAYAK----------------------------------------
Q99AQ3_9VIRU/1-582------------------------NRMWY.QYNTKIDTQF----------------------------------------

PF02247

POL2_SQMVM/246-618------------------------ATIAFFIAFGDITEEM----------------------------------------
POL2_CPMVS/460-832------------------------ATVTFLIAFGNLSDAF----------------------------------------
POL2_BPMV/447-819------------------------CTVSFFIAFGNLADDT----------------------------------------
Q9Z006_9SECO/476-846------------------------GTFSIAYVAGAYIEKV----------------------------------------
O12663_9SECO/321-691------------------------GTFSIAYVAGAYIEKV----------------------------------------
Q9YWK0_9SECO/363-735------------------------ATIAFFIAFGDITEEM----------------------------------------
POL2_CPSMV/437-806------------------------ATIAFFVAFGDLSDDT----------------------------------------
POL2_RCMV/407-778------------------------STVTFFIGFGGLPFSE----------------------------------------
Q9YWJ9_9SECO/452-824------------------------ATIAFFIAFGDITEEM----------------------------------------
Q66170_CPMVS/343-715------------------------ATVTFLIAFGNLSDAF----------------------------------------

PF03391

CAPSD_TRSV/179-344------------------------ASFVIFPWECEAPPTL----------------------------------------
POL2_RRVS/768-936------------------------GTYMVGVSW.NATADL----------------------------------------
POL2_BRAV/1268-1433------------------------CALHLCISFGGAPPTL----------------------------------------
Q65029_ARMV/745-916------------------------IVLRVVSEWNGVTNNW----------------------------------------
POL2_ARMVS/792-963------------------------IVLRVVSEWNGVTNNW----------------------------------------
Q67703_GFLV/166-336------------------------IVLWVVSEWNGTTMDW----------------------------------------
POL2_GFLV/771-941------------------------IVLWVVSEWNGTTMDW----------------------------------------
POL2_BRSV/1007-1170------------------------SKLRIA.LW.GTVPET----------------------------------------
POL2_GCMV/981-1144------------------------ARLRVA.LW.GDTITL----------------------------------------
POL2_TORVR/1497-1662------------------------CSLLLSLRHKDASLTL----------------------------------------
Q88483_9SECO/1003-1166------------------------CSLRVA.LW.GTIPTT----------------------------------------

PF03689

A3FEM9_9SECO/10-101------------------------HSMMCS--------------------------------------------------
Q9QAH4_9SECO/9-99------------------------IVLGVC--------------------------------------------------
Q09G89_GFLV/608-698------------------------LTWVMS--------------------------------------------------
Q9JGK5_SDV/160-249------------------------IPLMIV--------------------------------------------------
Q9IV56_9SECO/636-727------------------------LTLGMC--------------------------------------------------
A1YYW2_BRAV/156-247------------------------VTLGIT--------------------------------------------------
Q65624_9SECO/45-137------------------------ISIGIC--------------------------------------------------
Q6JX06_9SECO/849-939------------------------VAIWYV--------------------------------------------------
Q20LA0_9SECO/601-691------------------------VVLGIC--------------------------------------------------
POL2_BRSV/842-932------------------------IAIWYI--------------------------------------------------
A0A9J8_ARMV/580-670------------------------ITWVMS--------------------------------------------------
Q6JX05_9SECO/604-694------------------------LTWVMS--------------------------------------------------
Q9Z0D6_SDV/74-163------------------------IPLLVV--------------------------------------------------
Q9QRA5_9SECO/10-101------------------------HSMMCT--------------------------------------------------
Q86631_9SECO/85-173------------------------TTLGLV--------------------------------------------------
POL2_GCMV/815-905------------------------VAIWYI--------------------------------------------------
A2ID55_9SECO/270-361------------------------TTIGVV--------------------------------------------------
Q64959_9SECO/4-94------------------------MAIWYV--------------------------------------------------
Q8B5P7_TRSV/12-103------------------------LSIACT--------------------------------------------------
Q88483_9SECO/838-928------------------------ISIWYI--------------------------------------------------
POL2_CNSV/688-778------------------------MSFFVL--------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754DTVVYSVSSSLTGSSVIVRGVTKGSGVSITPVTVGIDTEAVNRL...SIEMPALTTEEVTTNVPKYEQFLCKESGGAYIV
CAPSD_NCBVS/1-608PPGSVTGMWQFTASNGTD.TVTVDAGARLYAFGANLDASELNLQDINSIKIPPTNMNQMMQATPKTIQFQLNETKGFY.M
CAPSD_HASV/2-647PTFTVRVPPSNAYTNTVFRNTLLET............RPSSRRL...ELPMPPADFGQTVANNPKIEQSLLKETLGCYLV

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF08435

Q91H09_9CALI/305-535--------------------------------------------------------------------------------
Q8JMP1_9CALI/305-540--------------------------------------------------------------------------------
Q8B4Z2_9CALI/297-515--------------------------------------------------------------------------------
Q917X1_9CALI/305-538--------------------------------------------------------------------------------
Q9IV43_9CALI/304-537--------------------------------------------------------------------------------
Q8VA02_9CALI/306-539--------------------------------------------------------------------------------
Q9IV49_9CALI/306-538--------------------------------------------------------------------------------
Q6EAX3_9CALI/306-538--------------------------------------------------------------------------------
Q8BAC6_9CALI/304-534--------------------------------------------------------------------------------
Q6WQW7_9CALI/296-512--------------------------------------------------------------------------------
Q6B7R3_9CALI/303-535--------------------------------------------------------------------------------
Q6EAW7_9CALI/305-538--------------------------------------------------------------------------------
Q66418_9CALI/306-538--------------------------------------------------------------------------------
Q80FL2_9CALI/317-546--------------------------------------------------------------------------------
Q9IV42_9CALI/305-535--------------------------------------------------------------------------------
Q6XDL5_9CALI/307-546--------------------------------------------------------------------------------
Q6B7R2_9CALI/304-538--------------------------------------------------------------------------------
Q917X4_9CALI/305-533--------------------------------------------------------------------------------
Q783W9_9CALI/306-535--------------------------------------------------------------------------------
Q80J94_9CALI/309-538--------------------------------------------------------------------------------
Q913B6_9CALI/305-540--------------------------------------------------------------------------------
Q8JW44_9CALI/304-539--------------------------------------------------------------------------------
Q83876_9CALI/301-524--------------------------------------------------------------------------------
Q9IV48_9CALI/306-533--------------------------------------------------------------------------------
Q8V713_9CALI/316-545--------------------------------------------------------------------------------
Q91I85_9CALI/304-538--------------------------------------------------------------------------------
Q8JXJ0_9CALI/304-537--------------------------------------------------------------------------------
Q783X1_9CALI/315-545--------------------------------------------------------------------------------
Q783Y0_9CALI/305-533--------------------------------------------------------------------------------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059--------------------------------------------------------------------------------
POLS_CRPVC/291-340--------------------------------------------------------------------------------
Q2HWK2_RSET1/357-413--------------------------------------------------------------------------------
POLS_ABPVR/340-396--------------------------------------------------------------------------------

PF08935

Q9WJ28_PTV1F/119-191--------------------------------------------------------------------------------
Q9DLK1_FMDVP/202-285--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452-----------------------------------G....TAVITRA.VAADN..GLTAGTDNLMPFNI....VIPTSEI
POLS_DXV96/2-442-----------------------------------G....TLIANSQRTLTWSNTGVSNGSHYMNMNNLNVS.LFHENPP
POLS_BSNV/7-428-----------------------------------G....AKVASRSETVSGN..GGT........FHFSTTAVFGETEI
POLS_IPNVJ/5-453-----------------------------------NDVPVVTVTSSTLVTADNYRGASA..........KFTQSIPTEMI

PF02248

Q66170_CPMVS/720-899--------------------------------------------------------------------------------
Q9YWJ9_9SECO/828-1009--------------------------------------------------------------------------------
POL2_CPMVS/837-1016--------------------------------------------------------------------------------
POL2_BPMV/821-1004--------------------------------------------------------------------------------
POL2_CPSMV/808-988--------------------------------------------------------------------------------
POL2_RCMV/786-964--------------------------------------------------------------------------------
Q66179_APMV/2-185--------------------------------------------------------------------------------
POL2_APMV/802-985--------------------------------------------------------------------------------
POL2_SQMVM/622-803--------------------------------------------------------------------------------
Q9YWK0_9SECO/739-920--------------------------------------------------------------------------------

PF03688

A5H0K4_GFLV/264-422--------------------------------------------------------------------------------
POL2_BRSV/1176-1338--------------------------------------------------------------------------------
Q86631_9SECO/418-544--------------------------------------------------------------------------------
POL2_ARMV/344-502--------------------------------------------------------------------------------
Q88483_9SECO/1172-1336--------------------------------------------------------------------------------
A2ID55_9SECO/610-780--------------------------------------------------------------------------------
Q80JS8_BRAV/347-511--------------------------------------------------------------------------------
A0A9J6_ARMV/960-1118--------------------------------------------------------------------------------
CAPSD_TRSV/351-511--------------------------------------------------------------------------------
POL2_GCMV/1150-1316--------------------------------------------------------------------------------
Q6XPY1_9SECO/164-322--------------------------------------------------------------------------------
Q6XFY6_9SECO/157-316--------------------------------------------------------------------------------
Q9IV56_9SECO/980-1138--------------------------------------------------------------------------------
Q65624_9SECO/386-551--------------------------------------------------------------------------------
POL2_CNSV/1022-1185--------------------------------------------------------------------------------
Q64959_9SECO/338-502--------------------------------------------------------------------------------
Q20LA0_9SECO/942-1102--------------------------------------------------------------------------------
A3FEN2_9SECO/348-507--------------------------------------------------------------------------------
Q9ELS0_9SECO/148-312--------------------------------------------------------------------------------
Q9QAH0_9SECO/350-510--------------------------------------------------------------------------------
Q24M89_9SECO/943-1103--------------------------------------------------------------------------------

PF08462

Q5ZF43_CARMV/250-348--------------------------------------------------------------------------------
Q999Y9_CARMV/250-348--------------------------------------------------------------------------------
Q4JGW6_CARMV/250-348--------------------------------------------------------------------------------
Q8JJU7_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMS/250-348--------------------------------------------------------------------------------
Q999Z1_CARMV/250-348--------------------------------------------------------------------------------
CAPSD_CARMV/250-348--------------------------------------------------------------------------------
Q7TG55_CARMV/250-348--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506--------------------------------------------------------------------------------
Q9WT88_9VIRU/1-603--------------------------------------------------------------------------------
Q91CY9_9VIRU/1-581--------------------------------------------------------------------------------
A7VLY0_9VIRU/1-515--------------------------------------------------------------------------------
Q9JGT1_9VIRU/1-585--------------------------------------------------------------------------------
Q80QT8_9VIRU/1-595--------------------------------------------------------------------------------
CAPSD_TTVB1/1-533--------------------------------------------------------------------------------
A7VM00_9VIRU/1-509--------------------------------------------------------------------------------
Q9JG61_9VIRU/1-534--------------------------------------------------------------------------------
Q91PS3_9VIRU/1-581--------------------------------------------------------------------------------
CAPSD_TTVV4/1-560--------------------------------------------------------------------------------
Q91C93_9VIRU/1-546--------------------------------------------------------------------------------
Q2F827_9VIRU/1-589--------------------------------------------------------------------------------
Q91CY5_9VIRU/1-584--------------------------------------------------------------------------------
Q8V7G9_9VIRU/1-572--------------------------------------------------------------------------------
Q99A78_9VIRU/1-584--------------------------------------------------------------------------------
Q6H9C2_9VIRU/1-573--------------------------------------------------------------------------------
CAPSD_TTVT1/1-433--------------------------------------------------------------------------------
Q9JG80_9VIRU/1-589--------------------------------------------------------------------------------
A7VLZ6_9VIRU/1-506--------------------------------------------------------------------------------
Q6H9D2_9VIRU/1-557--------------------------------------------------------------------------------
Q6H999_9VIRU/1-471--------------------------------------------------------------------------------
Q77JT5_9VIRU/1-606--------------------------------------------------------------------------------
Q91PS7_9VIRU/1-585--------------------------------------------------------------------------------
CAPSD_TTVV9/1-555--------------------------------------------------------------------------------
Q9JG47_9VIRU/1-553--------------------------------------------------------------------------------
A7VLW0_9VIRU/1-507--------------------------------------------------------------------------------
Q0ZLH9_9VIRU/1-573--------------------------------------------------------------------------------
Q5ENW7_9VIRU/1-501--------------------------------------------------------------------------------
A7VLX2_9VIRU/1-509--------------------------------------------------------------------------------
Q80AR5_9VIRU/1-594--------------------------------------------------------------------------------
Q91CZ2_9VIRU/1-601--------------------------------------------------------------------------------
CAPSD_TTVG1/1-514--------------------------------------------------------------------------------
Q98Y63_9VIRU/1-581--------------------------------------------------------------------------------
Q9QU36_9VIRU/1-529--------------------------------------------------------------------------------
A7VM12_9VIRU/1-509--------------------------------------------------------------------------------
A7VLV6_9VIRU/1-508--------------------------------------------------------------------------------
Q9JG50_9VIRU/1-535--------------------------------------------------------------------------------
A7VLW4_9VIRU/1-507--------------------------------------------------------------------------------
A7VM04_9VIRU/1-513--------------------------------------------------------------------------------
A7VLY4_9VIRU/1-498--------------------------------------------------------------------------------
CAPSD_TTVD1/1-324--------------------------------------------------------------------------------
Q91CZ6_9VIRU/1-596--------------------------------------------------------------------------------
A7VM08_9VIRU/1-506--------------------------------------------------------------------------------
CAPSD_TTVV3/1-573--------------------------------------------------------------------------------
Q91D00_9VIRU/1-593--------------------------------------------------------------------------------
Q99AR5_9VIRU/1-604--------------------------------------------------------------------------------
Q9DTD2_9VIRU/1-559--------------------------------------------------------------------------------
Q91D04_9VIRU/1-591--------------------------------------------------------------------------------
CAPSD_TTVV8/1-571--------------------------------------------------------------------------------
Q5ENX0_9VIRU/1-603--------------------------------------------------------------------------------
O90364_9VIRU/1-590--------------------------------------------------------------------------------
Q9IFV0_9VIRU/1-583--------------------------------------------------------------------------------
Q9QUE7_9VIRU/1-586--------------------------------------------------------------------------------
A8DMR2_9VIRU/1-531--------------------------------------------------------------------------------
Q9DUH8_9VIRU/1-609--------------------------------------------------------------------------------
A7VLW8_9VIRU/1-511--------------------------------------------------------------------------------
Q99AQ3_9VIRU/1-582--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF03689

A3FEM9_9SECO/10-101--------------------------------------------------------------------------------
Q9QAH4_9SECO/9-99--------------------------------------------------------------------------------
Q09G89_GFLV/608-698--------------------------------------------------------------------------------
Q9JGK5_SDV/160-249--------------------------------------------------------------------------------
Q9IV56_9SECO/636-727--------------------------------------------------------------------------------
A1YYW2_BRAV/156-247--------------------------------------------------------------------------------
Q65624_9SECO/45-137--------------------------------------------------------------------------------
Q6JX06_9SECO/849-939--------------------------------------------------------------------------------
Q20LA0_9SECO/601-691--------------------------------------------------------------------------------
POL2_BRSV/842-932--------------------------------------------------------------------------------
A0A9J8_ARMV/580-670--------------------------------------------------------------------------------
Q6JX05_9SECO/604-694--------------------------------------------------------------------------------
Q9Z0D6_SDV/74-163--------------------------------------------------------------------------------
Q9QRA5_9SECO/10-101--------------------------------------------------------------------------------
Q86631_9SECO/85-173--------------------------------------------------------------------------------
POL2_GCMV/815-905--------------------------------------------------------------------------------
A2ID55_9SECO/270-361--------------------------------------------------------------------------------
Q64959_9SECO/4-94--------------------------------------------------------------------------------
Q8B5P7_TRSV/12-103--------------------------------------------------------------------------------
Q88483_9SECO/838-928--------------------------------------------------------------------------------
POL2_CNSV/688-778--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215---------------------------------------------------SAMR--ADIGDMRKYAVL-----------

PF01318

CAPSD_BMV/2-188---------------------------------------------------DAFRG-ATLGDLLNLQIY-----------

PF03566

Q80IX5_PRVFL/54-754HYKMNNPVFEMTGEENFGGFQFHYPGYDPENNALGLRGIVDTFENNFSSAVVHFWG-ISQSATIVCKTYDGWEGTTNAGS
CAPSD_NCBVS/1-608PLRAFQPVFEMTMATSYGPVRWKTPRTTVVDYHRAIGGLQDTIDSNFAIGVAAMTG-MSTSTVPYFKVFRRFEAIPAEGS
CAPSD_HASV/2-647HSKMRNPVFQLTPASSFGAVSFNNPGYERTRDLPDYTGIRDSFDQNMSTAVAHFRS-LSHSCSIVTKTYQGWEGVTNVNT

PF01829

CAPSD_NODAM/42-399-------------ASMFTNLTFSGARYTGLGDMDAIAILVTTPTGAVNTAVLKVWACVEYRPNPNSTLY-----------

PF08435

Q91H09_9CALI/305-535----------------------------------------------SEVALLRFVNPDTGRALFESKLH-----------
Q8JMP1_9CALI/305-540----------------------------------------------ADVALIRYVNPDTGRTLFEAKLH-----------
Q8B4Z2_9CALI/297-515----------------------------------------------SDVALLNYVNPNTGRVLFEAKLY-----------
Q917X1_9CALI/305-538----------------------------------------------GDVALVRYVNPDTGRVLFEAKLH-----------
Q9IV43_9CALI/304-537----------------------------------------------GEAALVHYVDPDTNRNLGEFKLY-----------
Q8VA02_9CALI/306-539----------------------------------------------GEAALLHYLDPDTHRNLGEFKLY-----------
Q9IV49_9CALI/306-538----------------------------------------------SEVALIRFINPDTGRVLFEAKLH-----------
Q6EAX3_9CALI/306-538----------------------------------------------SDVALIRYVNPDTGRTLFEAKLH-----------
Q8BAC6_9CALI/304-534----------------------------------------------SDIALVRFINPDTGRVLLEAKLH-----------
Q6WQW7_9CALI/296-512----------------------------------------------SDVALLNYINPDTGRVLFEAKLY-----------
Q6B7R3_9CALI/303-535----------------------------------------------SDVALVRYVNPDTGRTIFEAKLH-----------
Q6EAW7_9CALI/305-538----------------------------------------------SSVALLRYVNPDTGRTLFEAKLH-----------
Q66418_9CALI/306-538----------------------------------------------GEAALLHYVDPDTHRNLGEFKMY-----------
Q80FL2_9CALI/317-546----------------------------------------------TQVALVRYVNXDTGRVLFEAKLH-----------
Q9IV42_9CALI/305-535----------------------------------------------GEAALLHYVDPDTGRNLGEFKLY-----------
Q6XDL5_9CALI/307-546----------------------------------------------SDVALVRYVNPETGRTLFEAKLH-----------
Q6B7R2_9CALI/304-538----------------------------------------------GDAALLHYVDPDTHRNLGEFKLY-----------
Q917X4_9CALI/305-533----------------------------------------------TDVALIRYTNPDTGRVLFEAKLH-----------
Q783W9_9CALI/306-535----------------------------------------------TDVALIRFVNPDTGRVLFEGKLH-----------
Q80J94_9CALI/309-538----------------------------------------------SEALLLRYRNTLTGQLLFECKLY-----------
Q913B6_9CALI/305-540----------------------------------------------SEVALVRYINPDTGRALFEAKLH-----------
Q8JW44_9CALI/304-539----------------------------------------------GDAALLHYVDPDTNRNLGEFKLY-----------
Q83876_9CALI/301-524----------------------------------------------GEGPLLHYVDPDTDRNLGEFKAY-----------
Q9IV48_9CALI/306-533----------------------------------------------GEAALLHYVDPDTHRNLGEFKLY-----------
Q8V713_9CALI/316-545----------------------------------------------SDVALVRYVNPTTGRVLFEAKLH-----------
Q91I85_9CALI/304-538----------------------------------------------GEAALLHYVDPDTNRNLGEFKLY-----------
Q8JXJ0_9CALI/304-537----------------------------------------------GEAALLHYVDPDTNRNLGEFKLY-----------
Q783X1_9CALI/315-545----------------------------------------------SAVALIRYVNPDTGRNIFEAKLH-----------
Q783Y0_9CALI/305-533----------------------------------------------SDVALIRFTNPDTGRVLFEAKLH-----------

PF02226

POLG_HRV8A/2-69--------------------------------------------------------------------------------
POLG_POL1M/2-69--------------------------------------------------------------------------------

PF11492

Q7T7T5_HARNA/2003-2059------------------------------------------------------------------KLF-----------
POLS_CRPVC/291-340------------------------------------------------------------------KLF-----------
Q2HWK2_RSET1/357-413------------------------------------------------------------------SLF-----------
POLS_ABPVR/340-396------------------------------------------------------------------AIF-----------

PF08935

Q9WJ28_PTV1F/119-191----------------------------------------------------------------IGPLL-----------
Q9DLK1_FMDVP/202-285----------------------------------------------------------------FGALL-----------

PF01766

POLS_IBDVU/9-452TQPITSIKLEIVT.SKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVS-----------
POLS_DXV96/2-442PEPVAAIKININYGNNTNGDS....SFSVDSSFTINVIGGATIGVNSPTVGVGYQGVAEGTAITISGIN-----------
POLS_BSNV/7-428TQPVVGVQVL....AKTNGD.....PIVVDSYVGVTVHGGNMPGTLRPVTIIAYESVATGSVLTLSGIS-----------
POLS_IPNVJ/5-453TKPITRVKLAYQLNQQTAIANAATLGAKGPASVSFSSGNGNVPGVLRPITLVAYEKMTPQSILTVAGVS-----------

PF02248

Q66170_CPMVS/720-899-------------------------------------NPESYDARTFVISQPGSAMLNFSFDIIG---------------
Q9YWJ9_9SECO/828-1009-------------------------------------SNKALPARSWYITKPRGGDI