Sequence alignment for CL0055

PF00073

POLG_ENMGO/159-361--------------------------------------------------------------------------------
POLG_POL1M/92-308--------------------------------------------------------------------------------
POLG_POL1M/630-806--------------------------------------------------------------------------------
POLG_POL3L/92-307--------------------------------------------------------------------------------
POLG_HRV14/91-299--------------------------------------------------------------------------------
POLG_HRV14/610-795--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_EMCV/420-624--------------------------------------------------------------------------------
POLG_FMDVO/308-475--------------------------------------------------------------------------------
POLG_FMDVO/533-693--------------------------------------------------------------------------------
POLG_FMDVO/725-887--------------------------------------------------------------------------------
POLG_FMDV1/308-475--------------------------------------------------------------------------------
POLG_FMDV1/533-694--------------------------------------------------------------------------------
POLG_FMDV1/726-886--------------------------------------------------------------------------------
POLG_FMDVI/11-170--------------------------------------------------------------------------------
POLG_CXB3N/92-302--------------------------------------------------------------------------------
POLG_CXB3N/360-530--------------------------------------------------------------------------------
POLG_CXB3N/630-790--------------------------------------------------------------------------------
POLG_HRV2/92-302--------------------------------------------------------------------------------
POLG_HRV2/358-526--------------------------------------------------------------------------------
POLG_HRV2/610-772--------------------------------------------------------------------------------
POLG_HRV8A/92-302--------------------------------------------------------------------------------
POLG_HRV8A/364-533--------------------------------------------------------------------------------
POLG_HRV8A/617-801--------------------------------------------------------------------------------
POLG_CXB1J/360-528--------------------------------------------------------------------------------
POLG_CXB4J/92-300--------------------------------------------------------------------------------
POLG_CXB4J/358-528--------------------------------------------------------------------------------
POLG_CXB4J/607-796--------------------------------------------------------------------------------
POLG_TMEVB/169-382--------------------------------------------------------------------------------
POLG_TMEVB/443-648--------------------------------------------------------------------------------
POLG_BOVEV/92-285--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_BOVEV/606-778--------------------------------------------------------------------------------
POLG_HRV1B/92-301--------------------------------------------------------------------------------
POLG_HRV1B/360-529--------------------------------------------------------------------------------
POLG_HRV1B/627-794--------------------------------------------------------------------------------
POLG_SVDVU/608-791--------------------------------------------------------------------------------
POLG_FMDVT/308-475--------------------------------------------------------------------------------
POLG_CXA9/90-300--------------------------------------------------------------------------------
POLG_CXA9/358-526--------------------------------------------------------------------------------
POLG_CXA9/608-791--------------------------------------------------------------------------------
POLG_CXA21/90-308--------------------------------------------------------------------------------
POLG_CXA21/369-540--------------------------------------------------------------------------------
POLG_CXA21/642-821--------------------------------------------------------------------------------
POLG_HE701/92-288--------------------------------------------------------------------------------
POLG_HE701/347-517--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------
Q9WMA0_9PICO/45-215--------------------------------------------------------------------------------
POLG_AEVCA/41-212--------------------------------------------------------------------------------

PF00915

CAPSD_FCVC6/107-396--------------------------------------------------------------------------------
Q83876_9CALI/2-295--------------------------------------------------------------------------------
CAPSD_SOUV3/2-296--------------------------------------------------------------------------------
CAPSD_LORDV/2-291--------------------------------------------------------------------------------
O09725_9CALI/267-560--------------------------------------------------------------------------------
Q66418_9CALI/2-296--------------------------------------------------------------------------------
Q66296_9CALI/2-291--------------------------------------------------------------------------------
CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
Q80RD6_9CALI/2-291--------------------------------------------------------------------------------
CAPSD_SMSV1/137-427--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF01829

CAPSD_BBV/50-407--------------------------------------------------------------------------------
CAPSD_NODAM/42-399--------------------------------------------------------------------------------
CAPSD_BOOLV/36-403--------------------------------------------------------------------------------

PF03566

Q80IX5_9VIRU/54-754ASANQAGKRLEPRKRTRSIRSRQDLDTMHRVVVSVDVDSLTTLMGNIMTLAGSGGRGSLLTAGDVEKNPGPQMTRENKAP
Q4TVU2_9VIRU/1-642MDSNSAS....GKRRSRNVR............................................................
Q9YK87_9VIRU/108-757GSSNLKDKSMPFRPRSRRLRGPRPQNLGVR......................AEGRGSLLTCGDVEENPGPTTVAGLVQE
CAPSD_NCBVS/1-608MDANV.........QIRPAR..............................................NNP...........
CAPSD_HASV/2-647GDAGVASQRPHNRRGTRNVR............................................................

PF01766

POLS_BSNV/6-428--------------------------------------------------------------------------------
Q9IP80_IBDV/8-452--------------------------------------------------------------------------------
POLS_DXV96/1-442--------------------------------------------------------------------------------
O55651_9VIRU/4-453--------------------------------------------------------------------------------

PF00760

CAPSD_PSVJ/7-215--------------------------------------------------------------------------------
CAPSD_CMVKI/12-216--------------------------------------------------------------------------------
CAPSD_TAV/7-216--------------------------------------------------------------------------------
CAPSD_CMVC/11-216--------------------------------------------------------------------------------

PF01318

CAPSD_CCMV/2-190--------------------------------------------------------------------------------
CAPSD_BMV/2-188--------------------------------------------------------------------------------
CAPSD_BBMV/2-190--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226----------------------------RR-----------------------------RYRRRRHRPRSHLGQILRR--
Q27W03_PCV1/5-227----------------------------RR-----------------------------RYRRRRTRPRSHLGNILRR--
A3FEQ4_9CIRC/3-256----------------------------RS-----------------------------TYRRAYRA.......RRRR--
Q3HUU1_GOCV/5-247----------------------------RA-----------------------------RPRSLYYR.......RRRA--
Q1L2D2_9CIRC/1-237----------------------------ML-----------------------------LSRRRWRRGLRP...RYRR--
CAPSD_CACV/7-243----------------------------QV-----------------------------ARRRRPLAPRRR...RWRR--
Q0H9S8_9CIRC/4-236----------------------------QV-----------------------------ARRRRQTQAIRR...RWRR--
Q06J73_9CIRC/8-245----------------------------HF-----------------------------LIQRRMRHWRRRRHLRMRR--
Q9DXG3_BFDV/11-242----------------------------TF-----------------------------QIRRRYARP......Y.RG--
Q69EZ5_BFDV/7-239----------------------------IF-----------------------------QIRRRYARP......YVRR--
Q9DXG0_BFDV/11-242----------------------------IF-----------------------------QIRR.IARP......RYRR--
Q9DXF4_BFDV/3-235----------------------------HF-----------------------------QIRRRYARP......Y.RR--

PF02956

A7VLZ2_9VIRU/1-506---------------MPF.WWARR....KR..WWRGRR.....................RPFYRRRYHYKKRRP..RR..
Q9WT88_9VIRU/1-603---------------MA..YWFRR.........WGWRPRR..RWRRWRRRR..RRLPRRRTRRAVRGLGRRRKPRVRR..
Q91CY9_9VIRU/1-581---------------MAFRWWWWR....RR.PQRRWTRRR...WRRL.RTR........RPRRTVRRRRRRPRV...R..
A7VLY0_9VIRU/1-515---------------MPF.WWARR....KK..PWYSN......................WNRYRRRYKRRRWPR..RR..
Q9JGT1_9VIRU/1-585---------------MAYRWWRRR....SR..RWRRRRWR..RWRRRRRP.........RRRRPARRCRRRRTV..RR..
Q80QT8_9VIRU/1-595---------------MA..WWGRW....RR...WRWRPRR...WRRRRRRR....VPRRRAQRPVRRRRRRVR.......
CAPSD_TTVB1/1-533---------------MPPFYYRRR.........WYSNPWR...................RKRLRFRRRRLRRPI..RKRF
A7VM00_9VIRU/1-509---------------MAF.WWYRR....NK..PWFGR......................YKRRRTRRYKRTWRT..RR..
Q9JG61_9VIRU/1-534---------------MPPFNYYRR....R....YFYRPRR...................YRRRWFTTWRPRQTL..RRRF
Q91PS3_9VIRU/1-581---------------MWWNWW..K....RR..RWR.PRRR.WRT.RR.RRRLPV.....WRRRRTTRYARRRRV..RRLR
CAPSD_TTVV4/1-560---------------M...WWWRR....RF...WR.PKRR.WRWRRR.RRRPLA.....RRRRRPARLARRPRV...R..
Q91C93_9VIRU/1-546---------------MPW..........RN...YYYRRRR...................RPRRFWRRRFRTPIY..RRFW
Q2F827_9VIRU/1-589---------------MAWSWWWRR....RK..RWWPRRRR..RWRRF.RTR........RARRAVPRRRRRRRV...R..
Q91CY5_9VIRU/1-584---------------MAWRWWWQR....RR..RWWPRRRR..RWRRL.RRR........RPRRPVRRRRRRATV...R..
Q8V7G9_9VIRU/1-572---------------MAW..YRYR....RR..PWRRRRRPRWGLRRR............RFRRSFRGRGRRRYV..SRWS
Q99A78_9VIRU/1-584---------------MAYGWWARR....RR..RWRRWKRR..PWRRRWRT.........RRRRPRRRYRRRRHV..RR..
Q6H9C2_9VIRU/1-573---------------MAWGFWGRR....RRWRRWRARRRR...WRPR.RR.........RRRRPTRRFRARRRV..RR..
CAPSD_TTVT1/1-433---------------MRF....RY....RK...WR........................RPRRLFRSRRRRGYA..RRRW
Q9JG80_9VIRU/1-589---------------MAWGWWRRW....RR...WPARRWRRRRRRRPVRRR........RAGRPARRYRRRRTV...RTR
A7VLZ6_9VIRU/1-506---------------MPF.WWRRR....RR..FWTNRR.....................FTYKRRKRYPRRYN...RR..
Q6H9D2_9VIRU/1-557---------------M...WWWRR....RR...WRAPWRR.RRW..R.RRRPRT.....RRFRRAARRPRRPRV...R..
Q6H999_9VIRU/1-471---------------M................................................................
Q99AR3_9VIRU/1-606---------------MAWRRWRWR....PW...WRRRRRR..RWRRR.RRRP.......RRRRPYRR.RRPRRV..RR..
Q91PS7_9VIRU/1-585---------------MWWNRW..K....RY..RWR.PLRR.WRT.YR.RRRPLR.....WRRRGAARRPRRRRV..RRW.
CAPSD_TTVV9/1-555---------------MPWWPWRRW....RR...WR...RRRGNWRRRVAPR........RYRRTARRARRRRKAV.RR..
Q9JG47_9VIRU/1-553---------------MPF.....Y....KRWRRWRWRR.....................RPRRLWRRRFRRPLY..RRFW
A7VLW0_9VIRU/1-507---------------MAF.WWRRR....RK..PWFG...........................RWRRYRRRTNYKPRR..
Q0ZLH9_9VIRU/1-573---------------MAWRWWWRR....RR..PW.....R.WRW.RR.RRRPARR....RRRRRPARRARRPRV..RRW.
Q5ENW7_9VIRU/1-501---------------MAP.....T....RR...WRR.......................RFGRRRRRYRKRRYGWRRRYY
A7VLX2_9VIRU/1-509---------------MPF.WWARR....RK..PWYGRF.....................RRRYRYRPYKKR.....RR..
Q80AR5_9VIRU/1-594---------------MAWGWWLKR.WRRRKKPAWKKWRTR..RWRRF.RRR........RPKRTYGRRRRRRTV......
Q91CZ2_9VIRU/1-601---------------MAYSYWWRR....RR...WPW..RG..RWRRW.RRR..RRIPRRRPRRPVRRYRRR.PV..RR..
CAPSD_TTVG1/1-514---------------MPF.WWGRR....NK..FWYG.............................RNYRRKKRRFPKR..
Q98Y63_9VIRU/1-581---------------MAWRWWWAR....RR.PNRRWTRRR...WRRL.RTR........RPRRPVRRRRRRPRV...R..
Q9QU36_9VIRU/1-529---------------MPYFY........RR...WFPRRR....................RFRRSWRRRIRGPFR..RKYW
A7VM12_9VIRU/1-509---------------MPF.WWRRR....RK..PWYG.......................RFRYRRRFQTKRRRN..RR..
A7VLV6_9VIRU/1-508---------------MPF.WWARR....RR..PWFGRY......................KRYKTRRYRRRFRP..KR..
Q9JG50_9VIRU/1-535---------------MPPYNYYRW....NNWRRPTYRRRR...................WRRRQYRRRRPRPFIR.RRFW
A7VLW4_9VIRU/1-507---------------MPF.WWNRR....RK..NWWG........................YKYKTRKYRRRRWP..RR..
A7VM04_9VIRU/1-513---------------MPF.YWRRR....RK..FWWGKA.....................RPRWRFQRYRRKTT...RR..
A7VLY4_9VIRU/1-498---------------MPF.WWNRR....KR..WWRGAR.....................RPWYKRKRYTRRYR...RR..
CAPSD_TTVD1/1-324---------------MAY....FR....RN..FYGGRRHY...................YRRRNAYTRRRYRRV..RR..
Q91CZ6_9VIRU/1-596---------------MA..YWWRR....RR...WPW..RR..RWRRR.GRR..RRVPRRRYRRPVRRYRKRYTV..RR..
A7VM08_9VIRU/1-506---------------MPF.WWTRR....RK..PWFGT......................WRQRRYRRRRRRTTY..KR..
CAPSD_TTVV3/1-573---------------MAWYWWRRR....RRRGWWKPRRRR...WRRR.RA.........RRRGPARRHRARRRV..RR..
Q91D00_9VIRU/1-593---------------MAWRWWWRRRWKPRRRPAWTKYRRR..RWRRL.RPR........RPRRLARGRRRRRTV......
Q99AR5_9VIRU/1-604---------------MA..WWGRW....RR...WPRRRWR..RWRRRRRRR....LPTRRTRRAVRGLGRRPRKTVRR..
Q9DTD2_9VIRU/1-559---------------MAFWWWRRR....RR.ARWRRRAAA.RRWRRR.RP.........RRRRAARRAGRRRRV..RR..
Q91D04_9VIRU/1-591---------------MAWTWWWQR....RR.RRWPWRRRR...WRRL.RTR........RPRRLVRRRRKRYRV..RR..
CAPSD_TTVV8/1-571---------------MAWP.WRRR....RW..RWRRRRPRWRRWRRR.RT.........WRRRP.RRAVRRRRV..RR..
Q5ENX0_9VIRU/1-603---------------MAWWGW.......RRRWGWRPRWRRRRRWTRR.RRR....VPARRPRRPVRRHRKRYRV...R..
O90364_9VIRU/1-590---------------MAYGWWRRR....RR..RWRRWRPR..PWRPRWRT.........RRRRPARRRGHRRNV..RR..
Q9IFV0_9VIRU/1-583---------------MAWRWWWRR....RR..RWP.RRRR.TTW.RR.RPRP.......RRRRRTARTRRRGRV..RRW.
Q9QUE7_9VIRU/1-586---------------MAYGWWRRR....RR..RWKRWRRR.PRWRRPWRT.........RRRRPARRRGRRGTV..RR..
A8DMR2_9VIRU/1-531---------------MPY..............YWRGWRRR...................RRRRFWRRRAGAPFRR.RRYW
Q9DUH8_9VIRU/1-609---------------MPWGWW.......RR...WRRRPRRWRRWRRWGRR.........RTRWGLRTRRARAAV...R..
A7VLW8_9VIRU/1-511---------------MPF.WWGRR....RK..YWWGRR.....................FTRPKYRRYQ.......RR..
Q99AQ3_9VIRU/1-582---------------MS..WWGWR....RR...WWWKPRR..RWRRR.RARRPRRLPRRRYRRPTRRYRGR.RV..RR..

PF00729

CAPSD_TBSVB/75-270--------------------------------------------------------------------------------
CAPSD_MCMVK/21-224--------------------------------------------------------------------------------
CAPSD_TCV/54-245--------------------------------------------------------------------------------
CAPSD_CARMV/50-246--------------------------------------------------------------------------------
CAPSD_RCNMV/23-214--------------------------------------------------------------------------------
CAPSD_TBSVC/75-270--------------------------------------------------------------------------------
CAPSD_SCPMV/58-276--------------------------------------------------------------------------------
CAPSD_TNVD/51-265--------------------------------------------------------------------------------
CAPSD_CNV/66-261--------------------------------------------------------------------------------
CAPSD_MNSV/68-263--------------------------------------------------------------------------------
CAPSD_TNVA/60-273--------------------------------------------------------------------------------
CAPSD_AMCV/75-270--------------------------------------------------------------------------------
CAPSD_CRV/72-266--------------------------------------------------------------------------------

PF11729

Q0QVT6_9VIRU/1-348----------------------------------------------------------------MAKK............
Q68UN9_9VIRU/1-338----------------------------------------------------------------MVRKGDKKLAKPATTK
Q709G0_9VIRU/1-340----------------------------------------------------------------MVRKGEKKLAKAATTK

PF00894

CAPSD_PEMVW/52-188--------------------------------------------------------------------------------
CAPSD_BLRV/59-196--------------------------------------------------------------------------------
CAPSD_BYDV1/61-199--------------------------------------------------------------------------------
Q65845_9LUTE/58-196--------------------------------------------------------------------------------
Q65869_9LUTE/35-172--------------------------------------------------------------------------------
CAPSD_PLRV/70-208--------------------------------------------------------------------------------
CAPSD_BYDVP/62-200--------------------------------------------------------------------------------
CAPSD_BYDVN/67-204--------------------------------------------------------------------------------
Q65868_9LUTE/34-170--------------------------------------------------------------------------------
Q08391_9LUTE/63-200--------------------------------------------------------------------------------
Q65970_9LUTE/62-199--------------------------------------------------------------------------------
Q65880_9LUTE/60-197--------------------------------------------------------------------------------
CAPSD_TYYVF/65-202--------------------------------------------------------------------------------

PF03014

Q8V729_HEV/41-660--------------------------------FWGDRVDSQPFALPYIHPTNPFAADVFSQSGAGARPRQPPRPLGSAWR
CAPSD_AHEV/13-604--------------------------------CCGVSRGSQ..TLP.................AGGRRGQRRRDNSAQWS

PF00983

COAT_CAYMV/7-177--------------------------------------------------------------------------------
Q65665_BMDV/8-179--------------------------------------------------------------------------------
COAT_ELV/19-190--------------------------------------------------------------------------------
COAT_BMDV/8-181--------------------------------------------------------------------------------
O09737_9VIRU/7-178--------------------------------------------------------------------------------
COAT_EPMV/8-179--------------------------------------------------------------------------------
COAT_OYMV/8-179--------------------------------------------------------------------------------
COAT_KYMVJ/7-178--------------------------------------------------------------------------------
COAT_TYMV/7-178--------------------------------------------------------------------------------

PF00073

POLG_ENMGO/159-361---------------------------------------TVTNTQSTVGR.LVGYGTV.......HD.GEHPASCADTA.
POLG_POL1M/92-308---------------------------------------ITTQEAANSVV.AYGRWPE.......YL.RDSEANPVDQP.
POLG_POL1M/630-806---------------------------------------ATNPLVPSDTV.QTRHVVQ........H.RSRSESSIESF.
POLG_POL3L/92-307---------------------------------------ITTQEAANSVV.AYGRWPE.......FI.RDDEANPVDQP.
POLG_HRV14/91-299---------------------------------------TITTQEAANAV.VCYAEWP..........EYLPDVDASDVN
POLG_HRV14/610-795---------------------------------------MPVLPSDSIET.RTTYMHF........N.GSETDVECFLG.
POLG_EMCV/161-359---------------------------------------TPSQQWAVLSV.MVPFMME.......SI.RHHVLTLLQKRF
POLG_EMCV/420-624---------------------------------------TPVAPSNYMVG.EYKDFLEIAQIP.TFI.GNKIPNAVPYI.
POLG_FMDVO/308-475---------------------------------------TTSTTQSSVGV.TYGYATA........E.DFVSGPNTSGL.
POLG_FMDVO/533-693---------------------------------------VFNPPRNQLPG.RFTNLLD....................V.
POLG_FMDVO/725-887---------------------------------------TTSAGESADPV.TTTVENYGGETQ.IQR.RQHTDV......
POLG_FMDV1/308-475---------------------------------------TTSTTQSSVGV.TYGYSTE........E.DHVAGPNTSGL.
POLG_FMDV1/533-694---------------------------------------VYNPPKTNYPG.RFTNLLD....................V.
POLG_FMDV1/726-886---------------------------------------TTTTGESADPV.TTTVENYGGDTQ.VQR.RHHTDV......
POLG_FMDVI/11-170---------------------------------------TTTTGESADPV.TTTVENYGGETQ.IQR.RHHTDV......
POLG_CXB3N/92-302---------------------------------------ITTQECANVVV.GYGVWPD.......YL.KDSEATAEDQP.
POLG_CXB3N/360-530---------------------------------------YDVTPEMRIPG.EVKNLMEIAEV......DSVVPV..QNV.
POLG_CXB3N/630-790---------------------------------------SESTIENFLCRSACVYFTE.............YKNSGAKR.
POLG_HRV2/92-302---------------------------------------ITSQDVANAIV.AYGVWPH.......YL.SSKDASAIDKP.
POLG_HRV2/358-526---------------------------------------YHPTKEISIPG.EVKNLVEICQV....D.SLVPINNTDTY.
POLG_HRV2/610-772---------------------------------------SSVQPEDVIET.RYVQTSQ.......TR.DEMSLESFLGR.
POLG_HRV8A/92-302---------------------------------------ITSQDTANAVV.AYGVWPS.......YL.TPDDATAIDKP.
POLG_HRV8A/364-533---------------------------------------FHPTKEIFIPG.QVRNLIEMCQVD.TLIPVNNTQENVRSV.
POLG_HRV8A/617-801---------------------------------------SSVQPEDMIET.RYVITDQ.......TR.DETSIESFLGR.
POLG_CXB1J/360-528---------------------------------------FDVTPEMQIPG.RVNNLMEIAEVDSVVP.VNNTDNNVNGL.
POLG_CXB4J/92-300---------------------------------------ITTQECANVVV.GYGVWPD.......YL.SDEEATAEDQP.
POLG_CXB4J/358-528---------------------------------------FDVTPEMNIPG.QVRNLMEIAEVDSVVP.INNLKANLMTM.
POLG_CXB4J/607-796---------------------------------------TSQVDPSDTMQ.TRHVHNY.......HS.RSESSIENFLC.
POLG_TMEVB/169-382---------------------------------------SATNTQSTVGR.LCGYGKS.......HH.GEHPASCADTA.
POLG_TMEVB/443-648---------------------------------------TISTPSDYMCG.EFSDLLELCKLP.TFL.GNPNTNNKRYP.
POLG_BOVEV/92-285---------------------------------------ITTQEAANICV.AYGCWPA.......KL.SDTDATSVDKP.
POLG_BOVEV/345-515---------------------------------------FQPTLEIFIPG.KVNNLLEIAQVE.SIL.EANNREGVEGV.
POLG_BOVEV/606-778---------------------------------------STARDESMIET.RTIVPTH........G.IHETSV......
POLG_HRV1B/92-301---------------------------------------ITSQDVANAVV.GYGVWPH.......YL.TPQDATAIDKP.
POLG_HRV1B/360-529---------------------------------------YHPTKEISIPG.EVKNLIEMCQVD.TLIPVNNVGTNVGNI.
POLG_HRV1B/627-794---------------------------------------MTSQTRDEMSI.ESFLGRSGC.....VH.ISRIKV......
POLG_SVDVU/608-791---------------------------------------SQVVPSDTMQT.R.HVKNY.......HS.RSESTVENFLC.
POLG_FMDVT/308-475---------------------------------------TTSTTQSSVGV.TFGYATA........E.DSTSGPNTSGL.
POLG_CXA9/90-300---------------------------------------STITTQECANV.VVGYGRW....P.TYL.RDDEATAEDQP.
POLG_CXA9/358-526---------------------------------------FDVTPSMNIPG.EVKNLMEIAEV......DSVVPV..NNV.
POLG_CXA9/608-791---------------------------------------SQVTPSDTMQT.RHVKNYH.......SR.SESTVENFLGR.
POLG_CXA21/90-308---------------------------------------STITTQEAANA.IVAYGEW....P.TYI.NDSEANPVDAP.
POLG_CXA21/369-540---------------------------------------FDVTPPIHIPG.EVKNMMELAEID.TLI....PMNAVDGK.
POLG_CXA21/642-821---------------------------------------VINYKTRSESC.LESFFGR..............AACVTIL.
POLG_HE701/92-288---------------------------------------IVTQEAANICC.AYGEWPT.......YL.PDNEAVAIDKP.
POLG_HE701/347-517---------------------------------------FSPTPEMHIPG.QVHSMLEIVQIE.SMM.EINNVNDASGV.
POLG_HE701/609-781---------------------------------------IQTRTVINMHG.TAECLVE......NFL.GRSALVCMRSF.
POLG_CXA24/646-809---------------------------------------VVNYKTRSEST.LESFFGR..............SACVTML.
Q9WMA0_9PICO/45-215---------------------------------------FTSVDQSSVHT.AEVGSHQ..........IEPLKTSVDKP.
POLG_AEVCA/41-212---------------------------------------LTTVDQSSVST.ATMGSLQ..........DVQYRTAVDIP.

PF00915

CAPSD_FCVC6/107-396-----------------------ICKVAEGWDPNLPLFRLEAD...DGSITTPEQGT.MVGGVIAEPNAQMSTAADMATG
Q83876_9CALI/2-295-----------------------MMASKD........ATSSVDGASASVQLVPEVNA.SDPLAMDPVAGSSTAVATAGQV
CAPSD_SOUV3/2-296-----------------------MMASKD........APQSADGASGAGQLVPEVNT.ADPLPMEPVAGPTTAVATAGQV
CAPSD_LORDV/2-291-----------------------KMASND........ANPSDGSAAN...LVPEVN..NEVMALEPVVGAAIAAPVAGQQ
O09725_9CALI/267-560-----------------------GNGSKLPTNQNGGHVGQDVDPPGATGPTTSHVVVSNPEQPNGPAQRLEMAVATGSIQ
Q66418_9CALI/2-296-----------------------MMASKD........APTNMDGTSGAGQLVPEANT.AEPISMEPVAGAATAAATAGQV
Q66296_9CALI/2-291-----------------------KMASND........AAPSNDGAAC...LVPEIN..NEAMALEPVAGSAIAAPLTGQQ
CAPSD_VESVA/137-421-----------------------LRSTAD.VNSNF.TFRAESDGPGSTEIVTEEQGT.IVQQQPAPAPTALATLATASTG
POLG_RHDVF/1768-2065-----------------------GKARAAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVITAENSSASIATAGIGGPP
Q80RD6_9CALI/2-291-----------------------KMASND........AAPSTDGAAG...LVPESN..NEVMALEPVAGAALAAPVTGQT
CAPSD_SMSV1/137-427-----------------------LQSTVD.TKPDF.VFRAESDGPGGADIVTEEQGT.VVQQQPVPAQSALTTLAAASTG

PF08762

Q8B107_ALPV/599-804---------------------------------------T..SSA.LTVGEKVTSLRQI---------LKRFHLIYSNLT
O56051_9VIRU/590-790---------------------------------------TFNASM.LMMGEKVTSFRQL---------IKRFSAI.....
Q56QP7_9VIRU/684-855---------------------------------------SPNAVMGKIAGERLVNLRPL---------LRCFRSLGG...
O36967_9VIRU/668-900---------------------------------------S..PEA.HCIGEKIMSIRQL---------IKRFGMALNSLN
Q5UBY1_9VIRU/79-259---------------------------------------NMEALL.KGSGEQIMNLRSL---------LRTFRTISENWN
Q6ITS9_9VIRU/106-313---------------------------------------NPNISL.LISGEVFTNFRNL---------IKRVNFRKATTL
Q4JFT2_9VIRU/834-1009---------------------------------------T...ML.TTMGEQFVSLRML---------TRR.........

PF01829

CAPSD_BBV/50-407---------------------------------------------------AMNMGAL-----------TRLSQPGLAFL
CAPSD_NODAM/42-399---------------------------------------------------MAATNNM-----------LKMSAPGLDFL
CAPSD_BOOLV/36-403---------------------------------------------------AITQNNL-----------MMLSEPGLSFL

PF03566

Q80IX5_9VIRU/54-754NMSVRAQNVTVSNSRRRRRKNRKPRK.....QVEQATILKPQLLPGESVAPSGGRGTMDPPVHEICAQSIDPSEGAVGWF
Q4TVU2_9VIRU/1-642...IAANTVNVAPKQRQARGRRARSRANNIDNVTAAAQELGQSLDANVITFPTNVATM.PEFRSWARGKLDIDQDSIGWY
Q9YK87_9VIRU/108-757AVGGLNKATKTAPGKRTRRRRRNGK............GRIGNPNQPFSISAGAPMSKI.PALRGTLAMTEPISPSSVGWL
CAPSD_NCBVS/1-608.....SQGNQGRNNNNKRRRRRRGLKLPPVVAPITSPGQMAEPANHANTRVNRGRTRV.RGLRQ.AMMESPMAATSEAWI
CAPSD_HASV/2-647...VSANTVTVNGRRNQRR..RTGRQVSPPDNFTAAAQDLAQSLDANTVTFPANISSM.PEFRNWAKGKIDLDSDSIGWY

PF01766

POLS_BSNV/6-428-------------------ENTQIRYLNSLLVPETGSTSIPDDTLDRHCLKTETTTEN-----------LVAALGGSGLI
Q9IP80_IBDV/8-452-------------------TQQIVPFIRSLLMPTTGPASIPDDTLGKHTLRSETSTYN-----------LTVGDTGSGLI
POLS_DXV96/1-442-------------------MNTTNEYLKTLLNPAQFISDIPDDIMIRHVNSAQTITYN-----------LKSGASGTGLI
O55651_9VIRU/4-453-------------------TKATATYLRSIMLPENGPASIPDDITERHILKQETSSYN-----------LEVSDSGSGLL

PF00760

CAPSD_PSVJ/7-215-----------------GNGSRRPRRGRRS.FPIKEDAHARELRAVTAQLNRLV-ALTAARM------------------
CAPSD_CMVKI/12-216-----------------TSRRRRPRRGSRS....ASG.ADAGLRALTQQMLKLN-KTLAIGR------------------
CAPSD_TAV/7-216-----------------GGGSRRPRRGRRNNNNNNSTARDKALLALTQQVNRLA-NIASSSA------------------
CAPSD_CMVC/11-216-----------------RNHRRRPRRGSRS....APSSADANFRVLSQQLSRLN-KTLAAGR------------------

PF01318

CAPSD_CCMV/2-190--------------STVGTGK.LTRAQRRA-------------------AARKNKRNTRVVQ------------------
CAPSD_BMV/2-188--------------STSGTGK.MTRAQRRA-------------------AARRN.RWTARVQ------------------
CAPSD_BBMV/2-190--------------TTSATGKALNRKQRRA-------------------LNRSN.RLRKEFQ------------------

PF02247

POL2_SQMVM/246-618----NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATF-LQDSNER---AAIDLIRTHVIRGKI
POL2_CPMVS/460-832----MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDV-VNGQDFR---ATVAFLRTHVITGKI
POL2_BPMV/447-819----METNLFKLSLDDVETPKGSMLDLKISQSKIALPKNTVGGTILRSDLLANF-LTEGNFR---ASVDLQRTHRIKGMI
Q9Z006_9SECO/476-846----Q........TNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLN.E-LSKHSAV---HTGLLNMLSKIPGSL
O12663_9SECO/321-691----Q........TNNFAIESATETMRLLFSGHASIPLNVIPGTKITVAYLN.E-LSKHSAV---HTGLLNMLSKIPGSL
Q9YWK0_9SECO/363-735----NELDLAQLSLDDTSSLRGSVLQTKLATSRVILSKTMVGNTILRENLLATF-LQDSNER---AAIDLIRTHVIRGKI
POL2_CPSMV/437-806----D...LFKRNLDDVSTISDTMLGAMIGQTKVVIPKTLVAGTVLKSGPLSDV-MQQGSFR---STIALQRTHIITGKI
POL2_RCMV/407-778----TDTDLFKLSLDDTSSPKGSLLDTRFAQKKVLIPKAMAGGADLLSSNLYDV-LSGSSFR---ASLALARTHVVEGKI
Q9YWJ9_9SECO/452-824----NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATF-LQDSNER---AAIDLIRTHVIRGKI
Q66170_CPMVS/343-715----MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDV-VNGQDFR---ATVAFLRTHVITGKI

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------RPWLVHPR..HRYRWRRK..-.......NGIFNTRLSRTI-GYTVK..------------------
Q27W03_PCV1/5-227--------------RPYLAHPAFGNRYRWRRK..-.......TGIFNSRLSTEF-VLTIK..------------------
A3FEQ4_9CIRC/3-256--------------RGLRR......RLRRRRLRI-GRPRRRFS.VVTFKVTRHT-VFGFFGS------------------
Q3HUU1_GOCV/5-247--------------ANRRR......RYRRRRLHI-GRIRSKYT.IFNVKQTQNI-SFTFF..------------------
Q1L2D2_9CIRC/1-237--------------RHYRR......RRRTRRLPR-NRRGHRANRVYYFRLRHSV-KVTLQ.K------------------
CAPSD_CACV/7-243--------------RYWXR......R...RRIPA-NRRGHRTNRVYRFRFVREF-GQVLQ.K------------------
Q0H9S8_9CIRC/4-236--------------RHWRR..........RRL.T-NRRGHRTNRVYRFKFVRMY-RQECA..------------------
Q06J73_9CIRC/8-245--------------RHWRR......R...RRIPA-NRRGHRTNRIYRIKLVRQY-QQILG.K------------------
Q9DXG3_BFDV/11-242--------------RHIR.......RYRRRRRHF-RRRRFSTNRIYTLRLTRQF-QFKIN.K------------------
Q69EZ5_BFDV/7-239--------------RHIR.......RYRRRRRHF-RRRRFTTNRIYTLRFKRQF-KFQIE.K------------------
Q9DXG0_BFDV/11-242--------------RHIR.......RYRPRRTYF-RRRRFSTNRIYTLRLKRQF-KFEIR.K------------------
Q9DXF4_BFDV/3-235--------------RHIRR.....YRYRQRRRHF-CRRRFTTNRLYTIRLKREF-KFDIN.K------------------

PF02956

A7VLZ2_9VIRU/1-506....RLYKRKHR..RTYRRRRKSFRKVRRKRRTL.PLKQWQPETIRKCKVKGIG-IHTLGVE...GTQYRCYTANKYEYT
Q9WT88_9VIRU/1-603RRRTRRRTY.....RRGWRRRRYIR.RGRRKKKL.ILTQWNPAIVKRCNIKGGL-PIIICGE...PRAAFNYGYHMEDYT
Q91CY9_9VIRU/1-581RRRWGRRRGRRRLYRRTYRKR......RKRRKKM.TLKMWNPSTIRACNIRGFI-ALVVCGH...TRAGCNYAIHSEDYI
A7VLY0_9VIRU/1-515RRRIPYGRRR........RRRRRKRKVRRKRQRI.IVKQWQPESIVKCEIKGLG-CLVAGAQ...GRQPFCYTNSKYEYP
Q9JGT1_9VIRU/1-585RRR.GR.WTRTY..RRWRRKG.....RRRSKKKL.IIRQWQPNYRRRCNIVGYM-PLLICGE...NTVARNYATHSDDCY
Q80QT8_9VIRU/1-595RRRWGRRRW.....RRGYRRRLRLRRRRRRRKKI.ILTQWNPAKVRKCTIRGVL-PMILAGA...GRFAFNYGLHSDDIT
CAPSD_TTVB1/1-533RR............RRWVRRRRFFR.FKRKLRKI.RIDQWQPETIRKCHVKGNL-CLLTCGR...GNINHNYILTSESYV
A7VM00_9VIRU/1-509RRP..IRRRRNR..RTNRRRRRRRYKVRRKQKKI.TLKQWQPESIKKCKIKGTG-QIVLGAE...GTQFRCFTVYKNEFT
Q9JG61_9VIRU/1-534RR............RRWVRKRRFFKYKKRKLKKI.RLSQWQPDSIRKCTIKGQL-CLLTCGI...GRINNNFTLTAESYV
Q91PS3_9VIRU/1-581RRR.RRGWAR....RRYLRARR....RVKRRKKI.KLTQWNPTVVKKCVVKGYL-PLLICGTGTTGTTYRNYGSHMHDYR
CAPSD_TTVV4/1-560RRRFQWGRPR....RYRPRRRR....RRRKRQKI.KLKQWNPAVTKFCRIIGYY-PLIICGE...GTTVRNYNVHSQDYV
Q91C93_9VIRU/1-546RR............RYRVRKRH....FKRKLSKL.TIQEWQPPSIRKLTIKGYY-PLFQSTR...DRLSNNMITYLESIA
Q2F827_9VIRU/1-589RRRWGRRRRRRRV.FYKRRRRKTGRLYRKPKKKL.VLTQWHPTTVRNCSIRGLV-PLVLCGH...TQGGRNFALRSDDYP
Q91CY5_9VIRU/1-584RRRWRGRRGRRTYTRRAVRRR......RRPKKKL.VLTQWSPQTVRNCTIRGIV-PMVICGH...TRAGRNFAIHSEDFT
Q8V7G9_9VIRU/1-572RRRYRRRRR.....RGRRRRGR....RRRKRQTL.IPRQWQPDVTKKCFITGWM-PLIICGT...GHTQFNFITHEEDIP
Q99A78_9VIRU/1-584RRR.GR.WRRRY..RKWRRKG.....RRRGKKKI.IIRQWQPNYRRRCNIIGYM-PVLICGN...NTVSRNYATHSDDSY
Q6H9C2_9VIRU/1-573RG..GR.WRRRY..RKWRRGRR....RRTHRKKI.VIKQWQPNFIRRCYIIGYL-PLIFCGE...NTTAQNFATRSDDMI
CAPSD_TTVT1/1-433RRRAWGRRRRVR..RYRRRR......GGTKRQYISSIMQWNPQHRHLCYIKGIT-WLCAARADRMSWPGIKQIAATDSTR
Q9JG80_9VIRU/1-589RRRWGRRRYRRGWRRRTYVRKGR...HRKKKKRL.ILRQWQPATRRRCTITGYL-PIVFCGH...TKGNKNYALHSDDYT
A7VLZ6_9VIRU/1-506.....YGRRRNYR.RPARRRRRKLRKVRRKKKQI.AVKQWQPESITKCKILGHS-ALVVGAE...GKQMFCYTTNKNIAV
Q6H9D2_9VIRU/1-557RPRRRRGWAR....RYRLRRRR....RRRRRRKL.ILTQWQPAKIRKCLVIGYL-ALVLCGN...GTFSKNYASHSDDYV
Q6H999_9VIRU/1-471......................................KG..............-.........................
Q99AR3_9VIRU/1-606RR..GR.WRRAY..RRWGRRRR....RRRHKKKL.VLTQWQPAVVKRCLIVGFD-PLIICGI...NRTIFNYTTHSEDFT
Q91PS7_9VIRU/1-585RRR.RRAWGR....RRYIRRRR....LRRRRKKI.PITQWNPSVVRKCVVTGYI-PLLICGTGTTGTTYKNYGSHAADYK
CAPSD_TTVV9/1-555RRRRRVRRRGYY..RRYRRR......RRYKRRLL.ILKQWQPTTNLRLTVKGLI-PVVVMGK...GKTQNNFGQWEQTVP
Q9JG47_9VIRU/1-553RR............KYRVR........KRKLKYL.PLRQWQPHYINKLKVQGWY-PLAISTK...DRLSNNLNLYLESIA
A7VLW0_9VIRU/1-507KRRRIYRRRRNY..RTTKGRRRRRYKVRRKQQKI.LVKQWQPECIRKCKIKGLG-TIVLGAE...GTQYRCYTDYLDEWT
Q0ZLH9_9VIRU/1-573RRR..RVWAP....RPYIRRRR....RSFRRKKI.KITQWNPAVTKKCTVTGYL-PVIYCGTGDIGTTFQNFGSHMNEYK
Q5ENW7_9VIRU/1-501RYRPRDYRR.....RWLVRRRRRSVYRRGGRRAR.PYRLFNPKVMRRVVIRGWW-PILQCLK...GQEALRYRPLQWDTE
A7VLX2_9VIRU/1-509RRR.RFTRRRNF..KASRRRRRRRYEVRRKRQKI.VLKQWQPESIKKCKVKGFG-CLVLGAE...GRQFYCWTNEASNYP
Q80AR5_9VIRU/1-594RRRRVRRLR.....RRGWTRRRYIR.RRRRKKKL.VLTQWNPQDVRRCTIRGII-PLIMCGA...NTASFNYGMHSDDST
Q91CZ2_9VIRU/1-601KRRWGRRGRRRRYTRRYRRRLT....VRRKRNKL.RLSVWQPQNIRYCAIKGLF-PILICGH...GKSAGNYAIHSDDFI
CAPSD_TTVG1/1-514RKRRFYRRTKYR..RPARRRRRRRRKVRRKKKTL.IVRQWQPDSIVLCKIKGYD-SIIWGAE...GTQFQCSTHEMYEYT
Q98Y63_9VIRU/1-581RRRWGRRRGRRRFYRRRFKKR......RRRRRKL.TLKMWNPSTIRACNIKGAI-NLVMCGH...TQAGRNYAIRSEDFY
Q9QU36_9VIRU/1-529R.............RHWVRRYS....RKRKLSKL.NIKEWQPITIRKTKVKGLY-PAFLCND...QRIGNNAIQYLDSIA
A7VM12_9VIRU/1-509....RFTRRRNRRVTRRRRRRTRHQKVRRKKNKI.PVLQWQPDSIRKCHIKGQG-TLVVGAE...GTQMFCYTRDKFKYI
A7VLV6_9VIRU/1-508HRY.PFRRRR.......RRRRRRRYKVRRKKKKI.VIQQWQPESIKKCKIKGFG-CLVLGSQ...GTQYLCYTNEAANYV
Q9JG50_9VIRU/1-535R.............RHTVRRRR....IKKKLKKI.KIYEWQPTVIKKCHIKGTI-PLIQGGK...DRQGFNYAQYQDSYI
A7VLW4_9VIRU/1-507RRQTLYRRRRPT..RTNRRRRRRHRKVKRKRKTL.TVKQWQPESIRKCKIIGLE-PQLLGAE...GSQIDCFTVVKTDYV
A7VM04_9VIRU/1-513RRRRPARKRAH...RYAGRRRRRRYKVRRKRQKI.PLFQWQPDKIVKCKIKGVT-TLVLGAE...GKQLVCYTNVKTANT
A7VLY4_9VIRU/1-498....IYKNRRRR..PTRRRRRRRHTKVRRKRQTI.PVRQWQPERIVRCKIKGIS-VIVLGGE...GKQFQCYTNEATTWT
CAPSD_TTVD1/1-324..............RHRGRRFPYFKQGKRRRTRL..LHVTDPRYKAHCTITGWV-PIAMTRI...QLISQPFTV...DTL
Q91CZ6_9VIRU/1-596RRRRGRRGRPRR..RLYRRRYT....LRRKRKRL.IIKQWQPNNIRKCRITGML-PMVICGH...GMSANNYAIRSDDTE
A7VM08_9VIRU/1-506RKP.RYNRRRPR..RLTRRRRRRKYKVRRKQKKI.HLTQWQPDRIRKCKIKGRG-TLIMGAQ...GRQYMCYTNVKDRLT
CAPSD_TTVV3/1-573RR..GR.WRRRY..RRWRRRGG....RRRHRKKL.IIKQWQPNFIRHCYIIGYM-PLIICGE...NTFSHNYATHSDDML
Q91D00_9VIRU/1-593RRRRVRRLRR....RRGWTRRRYL..RRRKRRKL.ILTQWNPNIVRRCSIKGII-PLTMCGA...NTASFNYGMHSDDST
Q99AR5_9VIRU/1-604RRRRPRRTY.....RRGWRRRRYIRRRRGRRKKL.TLTMWNPNIVRRCNIEGGL-PLILCGE...NRAAFNYAYHSEDYT
Q9DTD2_9VIRU/1-559RR..GR.WRRAH..RRWRRRRG....RRRHKRKL.IIRQWQPPYTRRCYIVGYL-PLIMCGE...NCFSKNFATHSDDID
Q91D04_9VIRU/1-591RRRWGRRRGRRTYLRRRLKK.......RKRRKKL.RLTQWNPSTIRGCTIKGMA-PLIICGH...TMAGNNFAIRMEDYV
CAPSD_TTVV8/1-571R...GRGWRRLY..RRYRRRRG....RRTYKKKP.VLTQWQPTVRRRCFIIGYM-PLIICGE...NLTSKNYASHADDFV
Q5ENX0_9VIRU/1-603RRRWGR........RYTRRGRLRLRRRRRRRKKI.VLTQWNPQTVRRCYIRGLM-PVIWAGM...GSGGKNYAVRSDDYT
O90364_9VIRU/1-590RRRGGR.WRRRY..RRWKRKG.....RRRKKAKI.IIRQWQPNYRRRCNIVGYI-PVLICGE...NTVSRNYATHSDDTN
Q9IFV0_9VIRU/1-583RRR.GRGWRR....RTYIRRRR....R..RKKKI.NIQQWNPATVKKCVVTGYV-PLLICGTGTTGTTYKNYGSHINDYT
Q9QUE7_9VIRU/1-586RRR.GR.WRRRY..RRWRRKG.....RRRRKKKL.IIRQWQPNYTRKCNIVGYM-PVIMCGE...NTLIRNYATHADDCY
A8DMR2_9VIRU/1-531RY............RYRVRR......LRRKPKKL.PIKQWQPTKMRRLTVTGKY-PLFEGTS...ERIGNNNTQSIDTIA
Q9DUH8_9VIRU/1-609RRRRGRVRRRARGGRRYHYRRRFRRRRARRRKKI.VLTQWNPQTVRKCLIRGMF-PILWCGS...GAAGKNYALHMDDYT
A7VLW8_9VIRU/1-511RKR.PIRRRKPR..RTYRRRYRRRKKVRRKRKTL.LVRQWNPDSILTCKIKGFL-DILMGAD...GNQYQCYTQNRYSMP
Q99AQ3_9VIRU/1-582RRAGGWRGR.RRYSRRYSRRLT....VRRKKKKL.TLKIWQPQNIRRCKIRGLL-PLLICGH...TRSAFNYAIHSDDKT

PF00729

CAPSD_TBSVB/75-270----VGGSI-------MA..PVAVSRQ.LVGSKP-KFTGRTSG....SVTVTHR-EYLTQVN---NSSG..FV-------
CAPSD_MCMVK/21-224----KSRAI-------RANPPVPRPNP.QRNRPP-PA..........GTTCSMS-EILLAVS---ATTADQIL-------
CAPSD_TCV/54-245----KVTRL-------SA..PVALAYR.EVSTQP-RVS.TARD....GITRSGS-ELITTLK---KNTDTEPK-------
CAPSD_CARMV/50-246----YTPAI-------LA..FTPRRPR.MTNPPP-RTSRNSPGQAGKSMTMSKT-ELLSTVK---GTTGVIPS-------
CAPSD_RCNMV/23-214----SVKTV-------AI..PFAKTQI.IKTVNP-PPK.PARG.......ILHT-QLVMSVV---GSVQ..MR-------
CAPSD_TBSVC/75-270----TGGAI-------MA..PVAVTRQ.LVGSKP-KFTGRTSG....SVTVTHR-EYLSQVN---NSTG..FQ-------
CAPSD_SCPMV/58-276----QAGVS-------MA..PIAQGTM.VKLRPP-MLR.SSMD....VTILSHC-ELSTELA---VTVTIVVT-------
CAPSD_TNVD/51-265----TFRPL-------TV..PVAGSVIYSRPRVP-QVR.TNQM....STFVVNT-ELVANIT---LAAAGAF.-------
CAPSD_CNV/66-261----FPGAI-------AA..PISYAYA.VKGRKP-RFQ.TAKG....SVRITHR-EYVSVLS---GTNGEFLR-------
CAPSD_MNSV/68-263----KPGAI-------SA..PVAISRR.VAGMKP-RFV.RSEG....SVKIVHR-EFIASVL---PSSD..LT-------
CAPSD_TNVA/60-273----RGGYI-------VA..PTSGGVV.TRPIVP-KFS.NRGD....STIVRNT-EILNNQI---LAALGAF.-------
CAPSD_AMCV/75-270----TGGAI-------MA..PVAVTRQ.LTGSKP-KFTGKTSG....SVTVTHR-EYLSQVN---MSTG..FQ-------
CAPSD_CRV/72-266----LSGSM-------AA..PVAISRI.VRGSKP-RFI.RSKG....SVTITHR-ELVGQFN---SSSA..LV-------

PF11729

Q0QVT6_9VIRU/1-348....QPRKS-------VR--IAPRMRV-STIPAS-VNTASRLR----SV..QTK-QLNLYSN---TDRLYHVT-------
Q68UN9_9VIRU/1-338AANPQPRR.-------.R--ANNRRRS-NRTDAP-VSKASTVT----GFGRGTN-DVHL.SG---MSRISQAV-------
Q709G0_9VIRU/1-340AANPQPRR.-------.R--TNNRRRN-TRPDAP-LAKASTVT----GFGRPTN-DVHL.SG---MSRIAQAV-------

PF00894

CAPSD_PEMVW/52-188----------------------------V------------------DFSMVHG-PFNGNAT---G--------------
CAPSD_BLRV/59-196----------------------------H------------------EFVFSKD-NLNGNSK---G--------------
CAPSD_BYDV1/61-199----------------------------E------------------VFVFSVN-DLKANSS---G--------------
Q65845_9LUTE/58-196----------------------------E------------------VFTFSVN-DIKGNSN---G--------------
Q65869_9LUTE/35-172----------------------------E------------------TFVFSKD-SLTGNAP---G--------------
CAPSD_PLRV/70-208----------------------------E------------------TFVFTKD-NLMGNSQ---G--------------
CAPSD_BYDVP/62-200----------------------------E------------------VFVFSVD-NLKANSS---G--------------
CAPSD_BYDVN/67-204----------------------------E------------------TFVFSKD-SLAGNSS---G--------------
Q65868_9LUTE/34-170----------------------------E------------------TFVFSKD-SIAGSAP---E--------------
Q08391_9LUTE/63-200----------------------------H------------------TFVFSKD-GINGSSK---G--------------
Q65970_9LUTE/62-199----------------------------E------------------TFVFSKD-NLTGSST---G--------------
Q65880_9LUTE/60-197----------------------------E------------------TFVFSKD-SIAGNAS---G--------------
CAPSD_TYYVF/65-202----------------------------E------------------TFVFSKD-NLAGSSS---G--------------

PF03014

Q8V729_HEV/41-660DQSQRPSAAPRRRSTPAGAAPLTATSPAPDTAPV-PDVDSRGAILRRQYNLSTS-PLTSSVA---SGTNLVLY-------
CAPSD_AHEV/13-604TQ.QRPEGA.......VGPAPLTDVVTAAGTRTV-PDVDQAGAVLVRQYNLVTS-PLGLATL---GSTNALLY-------

PF00983

COAT_CAYMV/7-177--------------------LAPQPLINTKASEL-PSQSGSPP----PEIVYPF-QFTIASL---GV-------------
Q65665_BMDV/8-179--------------------TVKQPSISAPGFTL-SAPDGEQA----GSIRQIF-QFEATSV---GV-------------
COAT_ELV/19-190--------------------KLSQKTPVSNFSAL-PLPNGPQA----PTQLQPF-QFEFPLP---AG-------------
COAT_BMDV/8-181--------------------KVKQASIPAPGSIL-SQPNTEQS----PAIVLPF-QFEATTF---GT-------------
O09737_9VIRU/7-178--------------------TSIQPAINTKSSDL-PLQSGQHP----PSVLQPF-QITVASL---GT-------------
COAT_EPMV/8-179--------------------RSPQPSINAPGFHL-PPTDSQQS----SAIELPF-QFQATTF---GA-------------
COAT_OYMV/8-179--------------------KVRQPSISAPGTHL-SPNPGQQS----PSMVVPF-QVSVSDL---GV-------------
COAT_KYMVJ/7-178--------------------LASQLPVNTKSSEI-PLQSGTPP----PTIIYPF-QIEMASL---GT-------------
COAT_TYMV/7-178--------------------LAPQDRTVTVATVL-PAVPGPSP----LTIKQPF-QSEVLFA---GT-------------

PF00073

POLG_ENMGO/159-361..SEKILAVERYYT.FKVNDWTSTQKP----FEYIRIPL.PHVLSG....E...DGGVF-------GATLRRHYLVKTGW
POLG_POL1M/92-308..TEPDVAACRFYT.LDTVSWT...KE----SRGWWWKL.PDALRD....M.....GLF-------GQNMYYHYLGRSGY
POLG_POL1M/630-806..FARGACVTIMTV.DNPASTTNKDKL----FAVWKITY.KDTVQ.............L-------RRKLEFFTYSRFDM
POLG_POL3L/92-307..TEPDVATCRFYT.LDTVMWG...KE----SKGWWWKL.PDALRD....M.....GLF-------GQNMYYHYLGRSGY
POLG_HRV14/91-299KTSKPDTSVCRFYT.LDSKTWT.TGSK----GWCWKLPD.ALKDMG....V.......F-------GQNMFFHSLGRSGY
POLG_HRV14/610-795..RAACVHVTEIQN.KDATGIDNHREA----KLFNDWKI.NLSSLV....Q.......L-------RKKLELFTYVRFDS
POLG_EMCV/161-359.WRWKGTTPSRLMI.GHQHKSPLSTSA----FPFLTSCP.VKMVV.............S-------LVALRRHYLVKTGW
POLG_EMCV/420-624.................EASNT.AVKT----QPLATYQV.TLSCSC....L...ANTFL-------AALSRNFAQYRGSL
POLG_FMDVO/308-475..ETRVVQAERFFK.THLFDWVTSDSF----GRCHLLEL.PTDHKG....V.......Y-------GSLTDSYAYMRNGW
POLG_FMDVO/533-693..AEACPTFLRFEG.GVPYVTTKTDSD----RVLAQFDM.SLAAKQ....M...SNTFL-------AGLAQYYTQYSGTI
POLG_FMDVO/725-887.................SFIMDRFVKV----TPQNQINI.LDLMQI....P...SHTLV-------GALLRASTYYFSDL
POLG_FMDV1/308-475..ETRVVQAERFFK.KFLFDWTTDKPF----GYLTKLEL.PTDHHG....V.......F-------GHLVDSYAYMRNGW
POLG_FMDV1/533-694..AEACPTFLRFDD.GKPYVVTRADDT----RLLAKFDV.SLAAKH....M...SNTYL-------SGIAQYYTQYSGTI
POLG_FMDV1/726-886.................GFIMDRFVKI----NSLSPTHV.IDLMQT....H...KHGIV-------GALLRAATYYFSDL
POLG_FMDVI/11-170.................AFVLDRFVKV----HVSGNQHT.LDVMQV....H...KDSIV-------GALLRAATYYFSDL
POLG_CXB3N/92-302..TQPDVATCRFYT.LDSVQWQ.KTSP----GWWWKLPD.ALSNLG....L.......F-------GQNMQYHYLGRTGY
POLG_CXB3N/360-530..GEKVNSMEAYQI.PVRSNEGSGTQV----FGFPLQPG.YSSVF.........SRTLL-------GEILNYYTHWSGSI
POLG_CXB3N/630-790.................YAEWV....L----TPRQAAQL.RRKLE..............-------.....FFTYVRFDL
POLG_HRV2/92-302..SQPDTSSNRFYT.LRSVTWSSSSKG----WW...WKL.PDALKD....M.....GIF-------GENMFYHYLGRSGY
POLG_HRV2/358-526......INSENMYS.VVLQSSINAPDK----IFSIRTDV.ASQPL.........ATTLI-------GEISSYFTHWTGSL
POLG_HRV2/610-772...SGCIHESKLEV.TLANYNK...EN----FTVWAINL.QEMAQI....R...RKFEL-------......FTYTRFDS
POLG_HRV8A/92-302..TQPDTSSNRFYT.LDSRSWT...SA----SSGWWWKL.PDALKN....M.....GIF-------GENMFYHFLGRSGY
POLG_HRV8A/364-533.............N.MYTVDLRTQVDL----AKEVFSIP.VDIASQ...PL...ATTLI-------GELASYYTHWTGSL
POLG_HRV8A/617-801...SGCIAMIEFNTSSDKTEHDKIGKG----FKTWKVSL.QEMAQI....R...RKYEL-------......FTYTRFDS
POLG_CXB1J/360-528............KA.YQIPVQSNSDNR----RQVFGFPLQPGANNV....L...NRTLL-------GEILNYYTHWSGSI
POLG_CXB4J/92-300..TQPDVATCRFYT.LNSVKWE.MQSA----GWWWKFPD.ALSEMG....L.......F-------GQNMQYHYLGRSGY
POLG_CXB4J/358-528............EA.YRVQVRSTDEMG----GQIFGFPLQPGASSV....L...QRTLL-------GEILNYYTHWSGSL
POLG_CXB4J/607-796..RSACVIYIKYSS.AESNNLK.RYAE----WVINTRQV.AQLRRK....M........-------....EMFTYIRCDM
POLG_TMEVB/169-382..TDKVLAAERYYT.IDLASWTTSQEA----FSHIRIPL.PHVLAG....E...DGGVF-------GATLRRHYLCKTGW
POLG_TMEVB/443-648.................YFSATNSVPA----TSMVDYQV.ALSCSC....M...ANSML-------AAVARNFNQYRGSL
POLG_BOVEV/92-285..TEPGVSADAFYT.LRSKPWQ.ADSK----GWYWKLPD.ALNNTG....M.......F-------GQNAQFHYIYRGGW
POLG_BOVEV/345-515................ERYVIPVSVQD----ALDAQIYA.LRLELGGSGPL...SSSLL-------GTLAKHYTQWSGSV
POLG_BOVEV/606-778.........ESFFG.RSSLVGMPLLAT----GTSITNWR.IDFREF....V......QL-------RAKMSWFTYMRFDV
POLG_HRV1B/92-301..TQPDTSSNRFYT.LESKHWN.GDSK----GWWWKLPD.ALKEMG....I.......F-------GENMYYHFLGRSGY
POLG_HRV1B/360-529.........SMYTV.QLGNQMDMAQEV----FA.IKVDI.TSQPL.........ATTLI-------GEIASYYTHWTGSL
POLG_HRV1B/627-794................DYNDYNGVNKN----FTTWKITL.QEMAQI....R...RKFEL-------......FTYVRFDS
POLG_SVDVU/608-791..RSACV.....FY.TTYKNHDSDGDN----FAYWVINT.RQVAQ.............L-------RRKLEMFTYARFDL
POLG_FMDVT/308-475..ETRVHQAERFFK.MALFDWVPSQNF----GHMHKVVL.PHEPKG....V.......Y-------GGLVKSYAYMRNGW
POLG_CXA9/90-300..TQPDVATCRFYT.LDSIKWE.KGSV----GWWWKFPE.ALSDMG....L.......F-------GQNMQYHYLGRAGY
POLG_CXA9/358-526..QDTTDQMEMFRI.PVTINAPLQQQV----FGLRLQPG.LDSVF.........KHTLL-------GEILNYYAHWSGSM
POLG_CXA9/608-791...SACVYMEEYKT.TDKHVNKKFV.A----WPINTKQM.VQMRR..............-------..KLEMFTYLRFDM
POLG_CXA21/90-308..TEPDVSSNRFYT.LESVSWK.TTSR----GWWWKLPD.CLKDMG....M.......F-------GQNMYYHYLGRSGY
POLG_CXA21/369-540......VNTMEMYQ.IPLNDNLSKAPI----FCLSLSPA.SDKRL.........SHTML-------GEILNYYTHWTGSI
POLG_CXA21/642-821............SL.TNSSKSGEEKKH----FNIWNITY.TDTVQ.............L-------RRKLEFFTYSRFDL
POLG_HE701/92-288..TQPETSTDRFYT.LKSKKWE.SNST----GWWWKLPD.ALNQIG....M.......F-------GQNVQYHYLYRSGF
POLG_HE701/347-517.........ER......LRVQISAQSD----MDQLLFNI.PLDIQL....EGPLRNTLL-------GNISRYYTHWSGSL
POLG_HE701/609-781...........EYK.NHSTSTSSIQKN----FFIWTLNT.RELVQ.............I-------RRKMELFTYLRFDT
POLG_CXA24/646-809.......EVENFNA.TTEADKK.KQFT----TWAITYTD.TVQLRR....K........-------...LEFFTYSRFDL
Q9WMA0_9PICO/45-215..GSKKTQGEKFFL.IHSADWLTTHAL----FHEVAKLD.VVKLLY....N...EQFAV-------QGLLRYHTYARFGI
POLG_AEVCA/41-212..GSRVTQGERFFL.IDQREWNSTQSE----WQLLGKID.IVKELL....D...QSYAV-------DGLLKYHSYARFGL

PF00915

CAPSD_FCVC6/107-396KSVDS..EWEAFFSFHTSVNWSTSETQ...GKILFKQSLGPLLNPY------------L-------THLAKLYVAWSGSV
Q83876_9CALI/2-295NPID...PWIINNFVQAPQGEFTISPNNTPGDVLFDLSLGPHLNPF------------L-------LHLSQMYNGWVGNM
CAPSD_SOUV3/2-296NMID...PWIVNNFVQSPQGEFTISPNNTPGDILFDLQLGPHLNPF------------L-------SHLSQMYNGWVGNM
CAPSD_LORDV/2-291NVID...PWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPY------------L-------SHLSRMYNGYAGGF
O09725_9CALI/267-560SNVPE..AVRNCFAVCRTFAWNDRMPT...GTFLGSLSLHPNINPY------------T-------SHLSGMWAGWGGSF
Q66418_9CALI/2-296NMID...PWIMSNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPF------------L-------SHLAQMYNGWVGNM
Q66296_9CALI/2-291NIID...PWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPY------------L-------AHLARMYNGYAGGF
CAPSD_VESVA/137-421KSVEQ..EWMTFFSYHTSINWSTVESQ...GKVLYSQALNPSINPY------------L-------DHISKLYSTWSGGI
POLG_RHDVF/1768-2065QQVDQQETWRTNFYYNDVFTWSVADAP...GSILYTVQHSPQNNPF------------T-------AVLSQMYAGWAGGM
Q80RD6_9CALI/2-291NIID...PWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPY------------L-------AHLARMYNGYAGGM
CAPSD_SMSV1/137-427KTVDC..EWTTFFSYHTAVNWSTTEAQ...GKILFSRALSPELNPY------------L-------RHISSLYSTWSGGI

PF08762

Q8B107_ALPV/599-804.TSTKNNNLYRINSFKTPKPI.......AAQATMVNIDL-------------------Y.......SYYSYIFAYYRGSF
O56051_9VIRU/590-790....TPPTQNRYWEFTQPFWINTNRLEGVTQEGSSDIDG-------------------I.......SWFASLYAFYRGSM
Q56QP7_9VIRU/684-855......ITLDRAGQILSERVY............WHYKDY-------------------V.......SILSYLYRFSRGGY
O36967_9VIRU/668-900LISDAPNTLIAPFSVQHPTPV.........VAPAEPMSL-------------------F.......EYYYFIYGFWRGGM
Q5UBY1_9VIRU/79-259LAPNTKTALTDLTDVAD................KEGRDY-------------------M.......SYLSYLYRFYRGGR
Q6ITS9_9VIRU/106-313NGKRISDTFDINSLIEAPRLDIAQYVDTETKEAKYGFSY-------------------FWSAPTTLNIVAEMYALYRGGV
Q4JFT2_9VIRU/834-1009...SSPVDILRGDLVTLPGIS.......FGTDNSLRQSL-------------------V.......NIISYMYRFTHGSI

PF01829

CAPSD_BBV/50-407KCAFAPP----------DFNTDPGK---GIP----DRFEGKVVT-------------------RKDVLNQS.INFT....
CAPSD_NODAM/42-399KCAFASP----------DFSTDPGK---GIP----DKFQGLVLP-------------------KKHCLTQS.ITFT....
CAPSD_BOOLV/36-403KCAFASP----------DSNTDPGK---GIP----DNFEGKVLS-------------------QKNVYTETGVNFSGATT

PF03566

Q80IX5_9VIRU/54-754YKYMDPAGAVESGKALGEFSKVPDG---LLRYSVDAEQRPIVTI-------------------ECPTVSESDLPLDGKLW
Q4TVU2_9VIRU/1-642FKYLDPAGATESARAVGEYSKIPDG---LVKFSVDAEIREIYNE-------------------ECPTVSDASIPLDGAQW
Q9YK87_9VIRU/108-757ETNLDPCGEYKST.L..DYGKVPDG---AIPMSVCGQFRETFTI-------------------RHPGANPMLAPLDGSMW
CAPSD_NCBVS/1-608HDYLDPDGEYKTS.L..DDGKIPDG---AIPQSTCGQFRGTVGA-------------------RYPGLNSTTLPLDGGTW
CAPSD_HASV/2-647FKYLDPAGATESARAVGEYSKIPDG---LVKFSVDAEIREIYNE-------------------ECPVVTDVSVPLDGRQW

PF01766

POLS_BSNV/6-428VLFPNSPSGLLGA----HYTKTPQG.SLIFDKAITTSQDLKKAY-------------------NYARLVSRIVQVRSSTL
Q9IP80_IBDV/8-452VFFPGFPGSIVGA----HYTLQSNG.NYKFDQMLLTAQNLPASY-------------------NYCRLVSRSLTVRSSTL
POLS_DXV96/1-442VVYPNTPSSISGF----HYIWDSATSNWVFDQYIYTAQELKDSY-------------------DYGRLISGSLSIKSSTL
O55651_9VIRU/4-453VCFPGAPGSRVGA----HYKWNANQTRQEFDQWLKTSQDLKKAF-------------------NYGRLISRKYDVQSSTL

PF00760

CAPSD_PSVJ/7-215--------------------------PTLDHPTFVS---SRKCA---------------------KGYTYTSLDVRPTKT
CAPSD_CMVKI/12-216--------------------------PTLNHPTFVG---SESCK---------------------PGYTFTSITLKPPEI
CAPSD_TAV/7-216--------------------------PSLQHPTFIA---SKKCR---------------------AGYTYTSLDVRPTRT
CAPSD_CMVC/11-216--------------------------PTINHPTFVG---SERCR---------------------PGYTFTSITLKPPKI

PF01318

CAPSD_CCMV/2-190--------------------------PVIVEPIASGQGKAIKAW---------------------TGYSVSKWTASCAAA
CAPSD_BMV/2-188--------------------------PVIVEPLAAGQGKAIKAI---------------------AGYSISKWEASSDAI
CAPSD_BBMV/2-190--------------------------PVIVEPLASGQAVSLKTR---------------------TGYCVTQFVSNNPEV

PF02247

POL2_SQMVM/246-618RCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQNAIVW----------------NPACEKAVELTFNPNPCGDA
POL2_CPMVS/460-832KVTATTNISDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTW----------------NPGCKKNFSFTFNPNPCGDS
POL2_BPMV/447-819KMVATVGIPENTGIALACAMNSSIRGR.ASSDIYTICSQDCELW----------------NPACTKAMTMSFNPNPCSDA
Q9Z006_9SECO/476-846KVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKW----------------NPAIEPYVEFCFQAFFLCRL
O12663_9SECO/321-691KVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKW----------------NPAIEPFVEFIFKPFSCADW
Q9YWK0_9SECO/363-735RCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVW----------------NPACEKAVELSFNPNPCSDA
POL2_CPSMV/437-806HVVAMLETAVNTGLGLAICFNSGIRGK.ASADIYATCSQDAMIW----------------NPSCTKVMQYAFNPNPCSDG
POL2_RCMV/407-778RCICTINLPENTGCCLAITVNSSNRGQ.FSTDIYTTGSQDRILW----------------NPACSKNCDFSFNPNPCGTA
Q9YWJ9_9SECO/452-824RCVASINVPENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVW----------------NPACEKAVELTFNPNPCGDA
Q66170_CPMVS/343-715KVTATTNISDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTW----------------NPGCKKNFSFTFNPNPCGDS

PF03391

CAPSD_TRSV/179-344---------------------------------------PTMTW----------------PIQL.GDTFAID--------
POL2_RRVS/768-936---------------------------------------PTFVW----------------PPKP.TDISLLK--------
POL2_BRAV/1268-1433---------------------------------------PTLVL----------------PQAFGGDLPLDL--------
Q65029_ARMV/745-916---------------------------------------PNFIY----------------SADA.FNGSLKF--------
POL2_ARMVS/792-963---------------------------------------PNFIY----------------SADA.FNGSLKF--------
Q67703_GFLV/166-336---------------------------------------PTLVF----------------DPGV.FNGKFQF--------
POL2_GFLV/771-941---------------------------------------PTLVF----------------DPGV.FNGKFQF--------
POL2_BRSV/1007-1170---------------------------------------QPLSY----------------PIEA.RHLTDLN--------
POL2_GCMV/981-1144---------------------------------------SIVTY----------------PISL.EHLKDIE--------
POL2_TORVR/1497-1662---------------------------------------PFITL----------------PHIF.NRLDIGY--------
Q88483_9SECO/1003-1166---------------------------------------NPLTY----------------PIKP.GHLEDLD--------

PF02443

Q5Y4T0_PCV2/5-226------------------.ATTVRTPSWNVDMMRFNINDFLPPG.......................GGSNPLTVPFEYY
Q27W03_PCV1/5-227------------------..GGYSQPSWNVNYLKFNIGQFLPPS.......................GGTNPLPLPFQYY
A3FEQ4_9CIRC/3-256------------------GTGPTATGRWQSLSLEDGAQYTDPPAQGNNICGLNMRWAMFGDTNSYMQGNKPQYHYPYDYY
Q3HUU1_GOCV/5-247------------------GTGSPEKNKWQAMSLEAVQSSGTSPKP.....GINLRFAVFGDR...LPGTGNQYHYPFDYY
Q1L2D2_9CIRC/1-237------------------DEG..GSFKYGTDVFTFTLEDVLNPT........................GGDSLKLPFEDY
CAPSD_CACV/7-243------------------GTGG.SQLSFGTDGINIILDDFL.DW........................GTINWRLPFEDY
Q0H9S8_9CIRC/4-236------------------GSGD.TTLKWATDGLNIMLDDFL.DW........................GTINWRLPFEDY
Q06J73_9CIRC/8-245------------------AENA.GAFRFGTDGVTIILKDFF.PE........................GK...ELPFEDY
Q9DXG3_BFDV/11-242------------------QTTSVGNLIFNADYITFALDDFL.QA........................VPNPHTLNFEDY
Q69EZ5_BFDV/7-239------------------QTTATATMTWKSDYITFALSDFL.GN........................TTNPQTLNFEHY
Q9DXG0_BFDV/11-242------------------QTTQPGNLIWNADYVTFTLENFL.TN........................TPNPSALNFEDY
Q9DXF4_BFDV/3-235------------------QTTQTGQIIWNSDYVTFALSDFL.TA.........................PNPTGWPFEDY

PF02956

A7VLZ2_9VIRU/1-506IA....K.........QPSGGGFGVERYTLEYLYKEHKAGNNVW---------TTSNVNLDLVRYTGCRFIFWRHPHIDF
Q9WT88_9VIRU/1-603PQ....P.........FPFGGGMSTVTFSLKALYDQYLKHQNRW---------TFSNDQLDLARYRGCKLRFYRSPVCDF
Q91CY9_9VIRU/1-581PQ....L.........RPYGGSFSTTTWSLKLLFDEYLKFRNKW---------SYPNTELNLARYRGATFTFYRDPKVDY
A7VLY0_9VIRU/1-515QP....K.........APGGGGFGAELFTLQYLYDEWVARRNIW---------TKTNDYKDLVRFTGATFYLYKHPTTDF
Q9JGT1_9VIRU/1-585FP....G..........PFGGGMTTDKFTLRILYDEYKRFMNYW---------TASNEDLNLCRYLGCTLYVFRHPEVDF
Q80QT8_9VIRU/1-595VQKPLNQ.........NPHGGGMSTVTFSLQVLYDQHQRFLNQW---------SYPNDQLDLARYRGCSFSFYRHPEVDF
CAPSD_TTVB1/1-533PT....S.........EPGGGSWSILQMTTRVLYDEYKAARNWW---------TKSNSLLPLTKYIRCKLKFYRSDQTDY
A7VM00_9VIRU/1-509NP....K.........VATGGGFGVELFSLKYLYQEYLARNNIW---------TSTNAYRDFCRYTGSSFTFFRHPDTDF
Q9JG61_9VIRU/1-534PI....S.........EPGGGGWSIMQITLRALYDEYEHYRNWW---------TTSNCGLPLVKYTGCSIKFYNSNDTDY
Q91PS3_9VIRU/1-581KY....D..........PFGGGISTMQFNLSILFDEYMKHRCTW---------SKSNVDLELIRYRGCSFKLYRHEKCDF
CAPSD_TTVV4/1-560QY....E..........SYGGGMTTTMFNLKVPYEQFQLHQNFW---------TRSNIDLDLVRYHSVKFTFFRHPKVDF
Q91C93_9VIRU/1-546PH....Y.........VPGGGGFSISCFSLNTLYKEHLKLHNWW---------TKTNDNYPLIRYNGCTLKLFKSEKVDY
Q2F827_9VIRU/1-589KQ....G.........SPYGGSFSTTTWNLRVLFDEHQKHHNTW---------SYPNNQLDLGRYKGCTFYFYRDKKTDY
Q91CY5_9VIRU/1-584SQ....I.........KPHGGSFSTTTWSLKVCWDEHQKFMNRW---------SYPNTQLDLARYLGVTFYFYRDQKTDY
Q8V7G9_9VIRU/1-572GA....G.........ASYGGNLTNITITLGGLYEQYMLHRNHW---------SRSNYDLELARYLGFTLKCYRHATVDY
Q99A78_9VIRU/1-584LP....G..........PFGGGMTTDKFTLRILYDEYCRFMNYW---------TASNEDLDLCRYRGCTLWFFRHPDVDF
Q6H9C2_9VIRU/1-573SK....G..........PYGGGMTTTKFTLRILYDEFTRFMNFW---------TVSNEDLDLCRYVGCKLIFFKHPTVDF
CAPSD_TTVT1/1-433YW....S.........TILVGGCGVLTLSMDWFFFENLRWRNRW---------SHSNVGYDLARYMGTHLYFPPLADIWY
Q9JG80_9VIRU/1-589PQ....G.........QAFGGALSTTSFSLKVLFDQHQRGLNKW---------SFPNDQLDLARYRGCKFYFYRTKQTDW
A7VLZ6_9VIRU/1-506PP....K.........SPYGGGFGVEQYSLNYLYEEYTFHNNYW---------TKSNILKDLCRFLWLKIIFFRDNKTDF
Q6H9D2_9VIRU/1-557QK....G..........PFGGGLSSMRFNMRILYDQFKRHLNFW---------THTNQDLDLVRYRGCTMTFYRHPEVDF
Q6H999_9VIRU/1-471.................PFGGGHSTMRFSLYILFEERLRHMNFW---------TRSNDNLELTRYLGASVKIYRHPDQDF
Q99AR3_9VIRU/1-606FN....N.........DSFGGGLCTAQYTLRILFQEKLAQHNFW---------SASNEDLDLARYLGATIVLYRHPTVDF
Q91PS7_9VIRU/1-585KY....D..........PFGGGYSTMQFTLETLFDEWVKHRCTW---------SRSNKDLELVRYLGGSFTLYRHPKCDF
CAPSD_TTVV9/1-555LE....G.........ESYGGSFTIRKFTLQTLYEDYLKLRNRW---------SRSNTDLELIRYTGLNLRLYRHEFSDY
Q9JG47_9VIRU/1-553PH....Y.........LHGGGGFTICNFSLMTLYQENLVCRNWW---------TKGNENMPLIRYLGCEITLYRQAEVDY
A7VLW0_9VIRU/1-507NP....K.........VPGGGGFGCELFTLRYLYKMYLARKNIW---------TFSNKYKDLVRYTGTRFTFFRHPETDF
Q0ZLH9_9VIRU/1-573QY....N..........AAGGGFSTMLFTMQNLYEEYQKHRCRW---------SKSNQDLDLCRYLDCKLTFYRSPNTDF
Q5ENW7_9VIRU/1-501RQWRVRSDFEDQYGYLVQYGGGWGSGDVTLEGLYQEHLLWRNSW---------SKGNDGMDLVRYFGCVVYLYPLKDQDY
A7VLX2_9VIRU/1-509QP....K.........APGGGGFGCEVITLEYLYQQYKAHNCIF---------TASNHYKDPVRYTGCEIILYRHPYVDF
Q80AR5_9VIRU/1-594PQ....P.........EKFGGGMSTVTFSLFVLYDQYTRHLNRW---------SYPNDQLDLARYKGCKFKFYRDTNTDF
Q91CZ2_9VIRU/1-601TS....R.........FSFGGGLSTTSYSLKLLFDQNLRGLNRW---------TASNDQLDLARYLGAIFWFYRDQKTDY
CAPSD_TTVG1/1-514RQ....K.........YPGGGGFGVQLYSLEYLYDQWKLRNNIW---------TKTNQLKDLCRYLKCVMTFYRHQHIDF
Q98Y63_9VIRU/1-581PQ....I.........QSFGGSFSTTTWSLRVLFDEYQKFHNFW---------TYPNTQLDLCRYKYAIFTFYRDPKVDY
Q9QU36_9VIRU/1-529PH....H.........FPGGGGFGIIQFTLQGLYEQFIKATNWW---------TQTNCSLPLIRYNFCKLKFYRTANVDY
A7VM12_9VIRU/1-509PP....K.........TPYGGGFGAEKFTLSYLYEEYTFHNNVW---------TATNLYKDLCRYLYCKIIFFRHPDTDF
A7VLV6_9VIRU/1-508PP....K.........SPGGGGFGCEYITLEYLYKQWKAHNCIW---------TASNNYKDLCRYTGCTITLFRHKYIDF
Q9JG50_9VIRU/1-535PS....H.........KGGGGTWSIMVFSLGALYEEWERLNNVW---------TKTNNGLPFARYCGCRFKFYRQEYYDY
A7VLW4_9VIRU/1-507PA....K.........LPWGGGFSLQNYTLKYLYSEYTYHNNIW---------TSSNNQKDLCRYTGGYIKLFRHETQDF
A7VM04_9VIRU/1-513PA....K.........APGGGGFGCEQFSLDSLYADYKLRKNVW---------TKSNILLDLCRYLFVKISFYRHPETDF
A7VLY4_9VIRU/1-498PL....R.........TPGGGGFGVEKYTLSHLYDQYKFGNNIW---------TKTNILTDLVQYLGCKFVFYRHQYVDF
CAPSD_TTVD1/1-324SP....F.........HVYPGGYGYGVFTLEAMYKEHLMKRNRW---------SRSNAGFDLGRYLGTWLTLVPHPYFSY
Q91CZ6_9VIRU/1-596TM....K.........FSFGGGFSTTTFTLKVLYDQHLRGMNKW---------STSNDILDLARYLGCDFYFYRDKHTDY
A7VM08_9VIRU/1-506PS....R.........APAGGGFGVERFTLEYLYRQWKARNNIW---------TATNKNTDLVRYLGCRFSFYRHPDTDF
CAPSD_TTVV3/1-573ST....G..........PYGGGMTTTKFTLRILFDEYQRHLNFW---------TVSNQDLDLARYLGTKIIFFRHPTVDF
Q91D00_9VIRU/1-593PQ....P.........EKFGGGMSTVTFSLYVLYDQFTRHMNRW---------SYSNDQLDLARYRGCSFKLYRNPTTDF
Q99AR5_9VIRU/1-604EQ....P.........FPFGGGMSTTTFSLRGLYDQYTKHMNRW---------TFSNDQLDLARYRGCKFRFYRHPTCDF
Q9DTD2_9VIRU/1-559CS....V..........AYGGGMTATQFTLRILYDEFQRHLNYW---------TASNNDLDLARYLGATITFFRHPDVDF
Q91D04_9VIRU/1-591SQ....I.........RPFGGSFSTTTWSLKVLWDEHTRFHNTW---------SYPNTQLDLARFKGVNFYFYRDKDTDF
CAPSD_TTVV8/1-571KD....G..........PFGGGMTTMQFSLRILYDEFLRFLNIW---------THSNQDLDLARYHGFKLTLYRHPTVDF
Q5ENX0_9VIRU/1-603QS...............SFGGSFGTETFSLRVLFDQYQRGFNKW---------SHTNKDLDLALYYGCRFRFYRHDRTDF
O90364_9VIRU/1-590YP....G..........PFGGGMTTDKFTLRILYDEYKRFMNYW---------TASNEDLDLCRYLGVNLYFFRHPDVDF
Q9IFV0_9VIRU/1-583KF....D..........PFGGGFSTLMFNLRILFDEYKKQRCRW---------SRSNDELELVRYLGCSFTLYREQNVDF
Q9QUE7_9VIRU/1-586WP....G..........PFGGGMATQKFTPRILYDDYKRFMNYW---------TSSNEDLDLCRYRGVTLYFFRHPDVDF
A8DMR2_9VIRU/1-531PY....L.........FPSGGLFSITVFTLKGLYELHLKARNWW---------SISNCNLPLIKYRGCKITLYRNVDVDY
Q9DUH8_9VIRU/1-609PS..............GGFGGSFSLTTFNLRALYDEHMKGRNRW---------SHTNEDLELALYFGCRFTFYRHPTTDF
A7VLW8_9VIRU/1-511PP....K.........HPCGGGFSVDRFTLQWLYDQWRLRQNIW---------TKPNTYKDLCRFIVAKITLYRHKTTDF
Q99AQ3_9VIRU/1-582PQ....Q.........QSFGGGLSTVSFSLKVLFDPNQRGLNRW---------SASNDQLDLARYTGCTFWFYRHKKTDF

PF00729

CAPSD_TBSVB/75-270----------------VNGGIVG.N.LLQLNPSNG----TLFSW--------------------LPAIASNFDQYSFNSV
CAPSD_MCMVK/21-224----------------EIPVCAGIDFPAGTSPRYI----GAAKW--------------------LAAQSQMWNTIVFNSV
CAPSD_TCV/54-245----------------YT........TAVLNPSEP----GTFNQ--------------------LIKEAAQYEKYRFTSL
CAPSD_CARMV/50-246----------------FE........DWVVSPRNV----AVFPQ--------------------LSLLATNFNKYRITAL
CAPSD_RCNMV/23-214----------------TNNGKSN.Q.RFRLNPSNP----ALFPT--------------------LAYEAANYDMYRLKKL
CAPSD_TBSVC/75-270----------------VNGGIVG.N.LLQLNPLNG----TLFSW--------------------LPAIASNFDQYTFNSV
CAPSD_SCPMV/58-276----------------..........SELVMPFTV----G..TW--------------------LRGVAQNWSKYAWVAI
CAPSD_TNVD/51-265----------------..........SFTTQPLIP----SFGSW--------------------LANIADLYSKWRWISC
CAPSD_CNV/66-261----------------NNGTGPN.N.DFSINPLNP----FLFPW--------------------LVNIAANFDQYKFNSL
CAPSD_MNSV/68-263----------------VNNGDVNIG.KYRVNPSNN----ALFTW--------------------LQGQAQLYDMYRFTRL
CAPSD_TNVA/60-273----------------..........NTTNSALIA----AAPSW--------------------LASIADLYSKYRWLSC
CAPSD_AMCV/75-270----------------VNGGIVG.N.LLQLNPLNG----TLFSW--------------------LPAIASNFDQYSFNSV
CAPSD_CRV/72-266----------------VNGGITG.N.LYKINPANA----VLFPW--------------------LQTLASNFDQYMFNTL

PF11729

Q0QVT6_9VIRU/1-348----------------LPANT.AKGTVIYDQIITP----AIGRR--------------------LRQQAALFQKIKNNSL
Q68UN9_9VIRU/1-338----------------LPAGTGTDGYVVVDATIVP----DLLPR--------------------LGHAARIFQRYAVETL
Q709G0_9VIRU/1-340----------------IPAGTGTDGHVVLDEIIVP----ELLPR--------------------LGHASRIFQRYIVDTL

PF00894

CAPSD_PEMVW/52-188--------------------------TVKFGPS.S----DCQCI--------------------K.GNLAAYQKYRIVWL
CAPSD_BLRV/59-196--------------------------SITFGPSLS----ECKPL--------------------ADGILKAYHEYNITNV
CAPSD_BYDV1/61-199--------------------------TIKFGPDLS----QCPAL--------------------SGGILKSYHLYKITNV
Q65845_9LUTE/58-196--------------------------VIKFGPSLS----QCPAL--------------------SDGILKSYHDYAITNV
Q65869_9LUTE/35-172--------------------------SSPSGRLYQ----SAHAF--------------------SSGILKAYHEYKISKV
CAPSD_PLRV/70-208--------------------------SFTFGPSLS----DCPAF--------------------KDGILKAYHEYKITSI
CAPSD_BYDVP/62-200--------------------------AIKFGPSLS----QCPAL--------------------SDGILKSYHRYKITSI
CAPSD_BYDVN/67-204--------------------------SITFGPSLS----EYPAF--------------------QNGVLKAYHEYKITNC
Q65868_9LUTE/34-170--------------------------SSPSGRLFL----SAPAF--------------------SGGILKAYHEYKITKI
Q08391_9LUTE/63-200--------------------------SITFGPSLS----ECKPF--------------------SDGILKAYHEYKITSV
Q65970_9LUTE/62-199--------------------------SITFGPSLS----ESPAF--------------------SSGILKAYHEYKIIMV
Q65880_9LUTE/60-197--------------------------KITFGPSLS----ECAAF--------------------SGGILKAYHEYKISKI
CAPSD_TYYVF/65-202--------------------------AITFGPSLS----DCPAF--------------------SNGMLKAYHEYKISMV

PF03014

Q8V729_HEV/41-660--------------------------AAPLNPLLPLQDGTNTHI--------------------MATEASNYAQYRVVRA
CAPSD_AHEV/13-604--------------------------AAPVSPLMPLQDGTTSNI--------------------MSTESSNYAQYRVQGL

PF00983

COAT_CAYMV/7-177--------------------------EPTADFVSI----AAQAA--------------------ITAYTSLYRHAILTDL
Q65665_BMDV/8-179--------------------------YETLAQVNL----SSSDS--------------------LAKLTSGYRRAKVVEL
COAT_ELV/19-190--------------------------QEGSVTLPL----ATFPK--------------------MATFLSRHRRAQLTQL
COAT_BMDV/8-181--------------------------AETAAQVSL----QTADP--------------------ITKLTAPYRHAQIVEC
O09737_9VIRU/7-178--------------------------KDLSDSISV----AALSS--------------------IASYTTLYRHAKLTSL
COAT_EPMV/8-179--------------------------TETAAQISL----ASANA--------------------ITKLASLYRHVRLTQC
COAT_OYMV/8-179--------------------------SEVSAQITL----SSDPT--------------------LAQLTSIYRMASIVEC
COAT_KYMVJ/7-178--------------------------ADASDSISI----ASNSL--------------------LASVTTLYRHAKLTSL
COAT_TYMV/7-178--------------------------KDAEASLTI----ANIDS--------------------VSTLTTFYRHASLESL

PF00073

POLG_ENMGO/159-361RV.QVQ..C........NA......SQF......HAG.........S..........L.........L...V...FM...
POLG_POL1M/92-308TV.HVQ..C........NA......SKF......HQG.........A..........L.........G...V...FA...
POLG_POL1M/630-806EL.TFV..V........TAN....FTET......NNG.........HAL.....NQVY.........Q...I...MY...
POLG_POL3L/92-307TV.HVQ..C........NA......SKF......HQG.........A..........L.........G...V...FA...
POLG_HRV14/91-299TV.HVQ..C........NA......TKF......HSG.........C..........L.........L...V...VV...
POLG_HRV14/610-795EY.TIL..A........TA......SQP......DSA.........N..........YSSN...LVVQ...A...MY...
POLG_EMCV/161-359RV.QVQ..C........NA......SQF......HAG.........G..........L.........L...V...FM...
POLG_EMCV/420-624VY.TFV..F........TG......TAM......MKG.........K..........F.........L...I...AY...
POLG_FMDVO/308-475DV.EVT..A........VG......NQF......NGG.........C..........L.........L...V...AM...
POLG_FMDVO/533-693NL.HFM..F........TG......PTD......AKA.........R..........Y.........M...V...AY...
POLG_FMDVO/725-887EI.AVK..H........EG................................................D...L...TW...
POLG_FMDV1/308-475DV.EVS..A........VG......NQF......NGG.........C..........L.........L...V...AM...
POLG_FMDV1/533-694NL.HFM..F........TG......STD......SKA.........R..........Y.........M...V...AY...
POLG_FMDV1/726-886EI.VVR..H........DG................................................N...L...TW...
POLG_FMDVI/11-170EI.AVT..H........TG................................................K...L...TW...
POLG_CXB3N/92-302TV.HVQ..C........NA......SKF......HQG.........C..........L.........L...V...VC...
POLG_CXB3N/360-530KL.TFM..F........CG......SAM......ATG.........K..........F.........L...L...AY...
POLG_CXB3N/630-790EL.TFV..I........TS......TQQPSTTQNQDA.........Q..........I.........LTHQI...MY...
POLG_HRV2/92-302TI.HVQ..C........NA......SKF......HQG.........T..........L.........I...V...AL...
POLG_HRV2/358-526RF.SFM..F........CG......TAN......TTV.........K..........L.........L...L...AY...
POLG_HRV2/610-772EI.TLV..P........CI......SAL......SQD.........I..........G.........H...I...TMQYM
POLG_HRV8A/92-302TI.HVQ..C........NS......SKF......HQG.........L..........L.........I...V...AA...
POLG_HRV8A/364-533RF.SFM..F........CG......SAS......STL.........K..........L.........L...I...AY...
POLG_HRV8A/617-801EITIVT..A........AA......AQG......NDS.........G..........H.........I...VLQFMY...
POLG_CXB1J/360-528KL.TFM..F........CG......SAM......ATG.........K..........F.........L...L...AY...
POLG_CXB4J/92-300TI.HVQ..C........NA......SKF......HQG.........C..........L.........L...V...VC...
POLG_CXB4J/358-528KL.TFV..F........CG......SAM......ATG.........K..........F.........L...L...AY...
POLG_CXB4J/607-796EL.TFV..I........TS......HQE......MST.........ATNSD.VPVQTH.........Q...I...MY...
POLG_TMEVB/169-382RV.QVQ..C........NA......SQF......HAG.........S..........L.........L...V...FM...
POLG_TMEVB/443-648NF.LFV..F........TG......AAM......VKG.........K..........F.........L...I...AY...
POLG_BOVEV/92-285AV.HVQ..C........NA......TKF......HQG.........T..........L.........L...V...LA...
POLG_BOVEV/345-515EI.TCM..F........TG......TFM......TTG.........K..........V.........L...L...AY...
POLG_BOVEV/606-778EF.TII..A........TSSTGQNVTTE......QHT.........T..........Y.........Q...V...MY...
POLG_HRV1B/92-301TV.HVQ..C........NA......SKF......HQG.........T..........L.........L...V...AM...
POLG_HRV1B/360-529RF.SFM..F........CG......TAN......TTL.........K..........L.........L...L...AY...
POLG_HRV1B/627-794EV.TLVPCI........AG......RGD......DIG.........HV........VM.........Q...Y...MY...
POLG_SVDVU/608-791EL.TFV..I........TS......TQE......QPTVRGQDAPVLT..........H.........Q...I...MY...
POLG_FMDVT/308-475DV.EVT..A........VG......NQF......NGG.........C..........L.........Q...A...AL...
POLG_CXA9/90-300TI.HLQ..C........NA......SKF......HQG.........C..........L.........L...V...VC...
POLG_CXA9/358-526KL.TFV..F........CG......SAM......ATG.........K..........F.........L...I...AY...
POLG_CXA9/608-791EV.TFV..I........TS......RQD......PGT.........T..........LAQDMPVLTRQ...I...MY...
POLG_CXA21/90-308TI.HVQ..C........NA......SKF......HQG.........A..........L.........G...V...FL...
POLG_CXA21/369-540RF.TFL..F........CG......SMM......ATG.........K..........L.........L...L...SY...
POLG_CXA21/642-821EM.TFV..F........TE......NYP......STASGE..VRNQC..........D.........Q...I...MY...
POLG_HE701/92-288LC.HVQ..C........NA......TKF......HQG.........T..........L.........L...I...VA...
POLG_HE701/347-517EM.TFM..F........CG......SFM......TTG.........K..........L.........I...I...CY...
POLG_HE701/609-781EI.TIV..P........TL......RLF......SSS.........NVSFSGLPNLTL.........Q...A...MY...
POLG_CXA24/646-809EM.TFV..ITERYYTSNTG......YAR......NQ..........V..........Y.........Q...L...MY...
Q9WMA0_9PICO/45-215EI.QVQ..I........NP......TPF......QQG.........G..........L.........I...C...AM...
POLG_AEVCA/41-212DV.IVQ..I........NP......TSF......QAG.........G..........L.........I...A...AL...

PF00915

CAPSD_FCVC6/107-396DV-RFS--I--------SG------SGV------FGG---------K----------L---------A---A---IV---
Q83876_9CALI/2-295RV-RIM--L--------AG------NAF------TAG---------K----------I---------I---V---SC---
CAPSD_SOUV3/2-296RV-RIL--L--------AG------NAF------SAG---------K----------I---------I---V---CC---
CAPSD_LORDV/2-291EV-QVI--L--------AG------NAF------TAG---------K----------V---------I---F---AA---
O09725_9CALI/267-560EA-RIS--I--------SG------SGM------FAG---------R----------I---------I---A---SV---
Q66418_9CALI/2-296RV-KVL--L--------AG------NAF------TAG---------K----------I---------I---I---SC---
Q66296_9CALI/2-291EV-QVV--L--------AG------NAF------TAG---------K----------I---------I---F---AA---
CAPSD_VESVA/137-421DV-RFT--V--------SG------SGV------FGG---------K----------L---------A---A---LL---
POLG_RHDVF/1768-2065QF-RFI--V--------AG------SGV------FGG---------R----------L---------V---R---AV---
Q80RD6_9CALI/2-291EV-QVM--L--------AG------NAF------TAG---------K----------L---------V---F---AA---
CAPSD_SMSV1/137-427DV-RFT--V--------SG------SGV------FGG---------K----------L---------A---A---LI---

PF08762

Q8B107_ALPV/599-804RF-KIA--P--------FE------NKVYAARIR......LIPENGATEANAGPVQED-------------N---TV---
O56051_9VIRU/590-790RY-KIA--P--------LS------NASPLV.........VALKPNSLYSGVRVIDTN-------------G---TW---
Q56QP7_9VIRU/684-855RY-KFF--A--------DD------N...................EQGQVMSTLVKNY-------------H---K.---
O36967_9VIRU/668-900RF-KLQ--A--------VR------TNSAETSVKTDTTWTVNLWNSVQDSFNSLINVF-------------S---TT---
Q5UBY1_9VIRU/79-259RY-KFF--N--------TT------A...............LKQSQTCYIRSFLTPRY-------------Y---TP---
Q6ITS9_9VIRU/106-313RV-KVV--T--------EK------G............................VDFV-------------R---AT---
Q4JFT2_9VIRU/834-1009SY-KII--P--------KN------KG............................DLY-------------I---TT---

PF01829

CAPSD_BBV/50-407AN-------------------------R------DTFILIAPTPG--------------------VAYW...---.V---
CAPSD_NODAM/42-399PG-------------------------K------QTMLLVAPIPG--------------------IACL...---..---
CAPSD_BOOLV/36-403QN-------------------------V------DTYIIVLPTPG--------------------VAFWRCI---KT---

PF03566

Q80IX5_9VIRU/54-754RV-SFI--S--------FP------AFR------LNFIALANINNE..ALTLETRNTFIQTLNN.ITNWRD.---LG---
Q4TVU2_9VIRU/1-642SL-SII--S--------YP------MFR------TAYFAVANVDNK..EISLDVTNDLIVWLNN.LASWRDV---VD---
Q9YK87_9VIRU/108-757TL-GII--R--------TN------LWR------TPFLLIADMNNA..EISDESLDEVARSFNNYVGDLAD.---AS---
CAPSD_NCBVS/1-608PL-LVM--H--------LP------FFR------HPLLFITTTSNTEVEVTNADLDAFANDWNN.RTDWTE.---AT---
CAPSD_HASV/2-647SL-SIF--S--------FP------MFR------TAYVAVANVENK..EMSLDVVNDLIEWLNN.LADWRYV---VD---

PF01766

POLS_BSNV/6-428PA-GVY--A--------LN------GTF------NGVTYIGSLSE--------------------IKDLDYN---SL---
Q9IP80_IBDV/8-452PG-GVY--A--------LN------GTV------NAVTFQGSLSE--------------------LTDVSYN---GL---
POLS_DXV96/1-442PA-GVY--A--------LN------GTF------NAVWFQGTLSE--------------------VSDYSYD---RI---
O55651_9VIRU/4-453PA-GLY--A--------LN------GTL------NAATFEGSLSE--------------------VESFSYN---SL---

PF00760

CAPSD_PSVJ/7-215EK-GHS--F--------GQ------RLN------LPV-------------------PVSEFPKK--KVSCVQ---LR---
CAPSD_CMVKI/12-216EK-GSY--F--------GR------RLS------LPD-------------------SVTDYDKK--LVSRIQ---IR---
CAPSD_TAV/7-216EK-DKS--F--------GQ------RLI------IPV-------------------PVSEYPKK--KVSCVQ---VR---
CAPSD_CMVC/11-216DR-ESY--Y--------GK------RLL------LPD-------------------SVTEYDKK--LVSRIQ---IR---

PF01318

CAPSD_CCMV/2-190EA-KVT--S--------AI------TIS------LPN-------------------ELSSERNKQLKVGRVL---LW---
CAPSD_BMV/2-188TA-KAT--N--------AM------SIT------LPH-------------------ELSSEKNKELKVGRVL---LW---
CAPSD_BBMV/2-190KA-KEV--V--------SV------SVK------LPD-------------------HLAVEANRALKVGRIS---IL---

PF02247

POL2_SQMVM/246-618WN-FVF--L--------QQ------TKA------H..FAVQCVTGWTTTPLTDLALVLTWHIDRSLCVPKTL---TI---
POL2_CPMVS/460-832WS-AEM--I--------SR------SRV------R..MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIY---HL---
POL2_BPMV/447-819WS-LEF--L--------KR------TGF------H..CDIICVTGWTATPMQDVQVTIDWFISSQECVPRTY---CV---
Q9Z006_9SECO/476-846VE-HAL--F--------RV------FQI------CSCGGHTDIVQVAERSEVDARISFAIYYEPTITLPKQI---AT---
O12663_9SECO/321-691WN-MHY--L--------GS------FKC------APVVVIQTLSKWLNSPKVDARISFAIYYEPSIVLPKQI---AT---
Q9YWK0_9SECO/363-735WN-FVF--L--------QK------TKA------H..FAVQCVTGWTTTPLTDLALVLTWHIDRNLCVPETL---TI---
POL2_CPSMV/437-806WS-LAF--L--------ER------TGY------H..CVVTCVTGWTGTPLQDTFMTINWHISREACVPKIY---TI---
POL2_RCMV/407-778WS-LEF--L--------RR------TKF------H..LSVTCVSGWSAQPQTDIAMTMDWYVSNKPCVPCIY---NV---
Q9YWJ9_9SECO/452-824WN-FVF--L--------QQ------TKA------H..FAVQCVTGWTTTPLTDLALVLTWHIDRSLCVPKTL---TI---
Q66170_CPMVS/343-715WS-AEM--I--------SR------SRV------R..MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIY---HL---

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226RI------------------------------------------------------------------RKVK---VE---
Q27W03_PCV1/5-227RI------------------------------------------------------------------RKAK---YE---
A3FEQ4_9CIRC/3-256II------------------------------------------------------------------KGVA---VT---
Q3HUU1_GOCV/5-247MI------------------------------------------------------------------RMVK---VE---
Q1L2D2_9CIRC/1-237KI------------------------------------------------------------------VLVK---VE---
CAPSD_CACV/7-243RI------------------------------------------------------------------RLAK---VE---
Q0H9S8_9CIRC/4-236RI------------------------------------------------------------------RLAK---FE---
Q06J73_9CIRC/8-245RI------------------------------------------------------------------RLAK---VE---
Q9DXG3_BFDV/11-242RI------------------------------------------------------------------KLAK---ME---
Q69EZ5_BFDV/7-239RI------------------------------------------------------------------KLAK---ME---
Q9DXG0_BFDV/11-242RI------------------------------------------------------------------KLAK---ME---
Q9DXF4_BFDV/3-235RI------------------------------------------------------------------KLAK---ME---

PF02956

A7VLZ2_9VIRU/1-506VG-VYS--R--------NY------PMQ------LQK-YTYPDTHPQQIMLAKHKFFIPSLLTKPHGKRYVK---IK---
Q9WT88_9VIRU/1-603IV-HYN--L--------IP------PLK------MNQ-FTSPNTHPGLLMLSKHKIIIPSFQTRPGGRRFVK---IR---
Q91CY9_9VIRU/1-581IV-VYN--T--------VP------PFK------LNK-YSCPMLHPGMMMQYKKKVLIPSYQTKPKGKAKIR---LR---
A7VLY0_9VIRU/1-515IF-NYN--N--------QP------PFL------LEK-DFYNDLHPQMLLLAKHHRVIPSRQRKPLGKPYIK---VK---
Q9JGT1_9VIRU/1-585II-IIN--T--------SP------PFL------DTE-ITGPSIHPGMMALNKRARWIPSLKNRPGRKHYVK---IK---
Q80QT8_9VIRU/1-595IA-QFD--N--------VP------PMK------MDE-LTAPNTHPALLLQSKKKVKIYSWKTRPWGKKKVT---VR---
CAPSD_TTVB1/1-533IV-TIQ--R--------TG------PFE------VTL-ESYLSTQPSRHLMNHKAFIVPKLGRGPNKETYVK---KI---
A7VM00_9VIRU/1-509II-VYD--I--------QP------PFT------INK-HTYMMTHPHFLLQRKHKKILLSKSTNPNGKLTKR---IK---
Q9JG61_9VIRU/1-534IV-TVQ--R--------TG------PFE------VDR-DSYLNTQPSRHMMNKNSFIVPKLNPNKKRKPYIR---KK---
Q91PS3_9VIRU/1-581FF-TYS--R--------KP------PFK------DSQ-LTGPSLHPGMLMNRRKKIILLSFKTRPKGHSTKT---IR---
CAPSD_TTVV4/1-560IV-KFN--R--------NP------PFT------DSV-LTGPMLHPGVLMNSKRKILIPSWETRPRGKKRIP---VR---
Q91C93_9VIRU/1-546IF-YYQ--R--------HY------PMK------ASA-LMYTSTQPQILLLNNRKRIVKCKANNKKTKPYIR---LR---
Q2F827_9VIRU/1-589IV-KFQ--R--------RG------PFK------INK-YSSPMAHPGMMMLDKMKILVPSFDTRPGGRRRVK---VT---
Q91CY5_9VIRU/1-584IV-QWS--R--------NP------PFK------LNK-YSSPMYHPGMMMQARKKLMVPSFQTRPRGRKRYR---VR---
Q8V7G9_9VIRU/1-572IL-TYS--R--------TT------PFE------TNE-LSHMLTHPLLMLLNKHHRVIPSLKTRPKGKRSVR---IH---
Q99A78_9VIRU/1-584II-LIN--T--------MS------PFL------DTQ-LTGPSIHPGLMALNKRARWIPSLKSRPGRKHVVK---IR---
Q6H9C2_9VIRU/1-573IV-QIN--T--------QP------PFL------DTH-LTAASIHPGIMMLSKRHILIPSLKTRPSRKHRVV---VR---
CAPSD_TTVT1/1-433IV-WTD--T--------EF------.VD------QPK-KVMSYTHPWILLMTKKHKVIKPRKWNGKGK...K---IF---
Q9JG80_9VIRU/1-589IG-QYD--I--------SE------PYK------LDK-YSCPNYHPGNLIKAKHKFLIPSYDTNPKGRQKII---VK---
A7VLZ6_9VIRU/1-506IV-SYD--R--------NP------PFN------LTK-FTYPGAHPQQMLLQKHHKLILSQMTKNPNKLTKK---FK---
Q6H9D2_9VIRU/1-557IV-KFN--R--------KP------PFL------DTI-VSGPAMHPGMLMTTKHKILVKSFKTKPKGKGTVK---VR---
Q6H999_9VIRU/1-471IV-IYN--R--------RT------PLG------GNI-YTAPSLHPGNAILAKHKILVPSLQTRPKGRKAIR---LR---
Q99AR3_9VIRU/1-606LV-RIR--T--------SP------PFE------DTD-MTAMTLHPGMMMLAKKTIKIPSLKTRPSRKHVVR---IR---
Q91PS7_9VIRU/1-585IF-RYN--R--------KP------PFK------DTQ-ITGPSLHPGILMTRRKKKIIKSFLTRPRGRATKR---VR---
CAPSD_TTVV9/1-555IV-HYS--L--------ET------PME------VGL-ESHMLAHPLKMIMSSKHVTVPSLLTKKGGRRYLR---LK---
Q9JG47_9VIRU/1-553MV-YVH--N--------SY------PMS------ANL-LTYQSTCPQVMLMNNRTKIMPCKRYNRNKKPYKK---FF---
A7VLW0_9VIRU/1-507IL-AYD--I--------QP------PFH------ITK-WTYMSIHPQMLLLRKHKKLLLSTATKPNGKLTTR---FK---
Q0ZLH9_9VIRU/1-573IV-GYN--R--------KP------PFI------DTQ-ITRCTLHPGMLIQERKKVIIPSFQTRPKGRIKRK---IK---
Q5ENW7_9VIRU/1-501WF-WWD--T--------DF------KEL------YAE-NIKEYSQPSVMMMAKRTRIVIARERAPHRRKVRK---IF---
A7VLX2_9VIRU/1-509VV-TYS--N--------QP------PFS------INQ-FTYPDIHPQNLLLRKHKKIVLSRATKPHGKLTVK---IK---
Q80AR5_9VIRU/1-594IV-TYD--I--------NP------PMK------NTE-LSGPNTHPGMLMQQKRKILVPSWDAYPKGRKYVL---AK---
Q91CZ2_9VIRU/1-601IV-QYD--I--------SE------PFK------IDK-DSSPSFHPGILMKSKHKVLVPSFQTWPKGRSKVK---LK---
CAPSD_TTVG1/1-514VI-VYE--R--------QP------PFE------IDK-LTYMKYHPYMLLQRKHKIILPSQTTNPRGKLKKK---KT---
Q98Y63_9VIRU/1-581IV-IYN--T--------NP------PFK------INK-YSSPFLHPGLMMLQKKKILIPSFQTKPGGKSRIK---VK---
Q9QU36_9VIRU/1-529VV-KII--R--------CY------PLK------ATH-DLYMQTQPSILMRDKHSILIPCMKNGRNRKTYKT---IK---
A7VM12_9VIRU/1-509VI-NYS--R--------QP------PWE------LSK-YTYPSCHPHQMLLDKHKVVIFSQASKPHGKYKYK---LR---
A7VLV6_9VIRU/1-508IF-CYS--V--------MP------PFD------INK-LTYPDIQPQNLLLRQRHKLILSQASNPKGKLRVK---VK---
Q9JG50_9VIRU/1-535IV-HYS--I--------CY------PMT------DTE-DQHLNSQPHRLIQGRKKIVVHRYNKQIHKKPYVK---KR---
A7VLW4_9VIRU/1-507II-SYD--L--------QP------PHE------LSK-YTFPSCHPHQMLLQKRHKILLSKQSNPNGKLYKK---IK---
A7VM04_9VIRU/1-513IV-TWH--R--------QP------PFD------ISK-EIYAACHPQNMLLAKHKMLILSKFTNPKGKLKKT---RK---
A7VLY4_9VIRU/1-498IV-KYS--R--------NL------PMT------IEK-LTYPHTHPQALLLSRHKRIIPSRVTKPHGKNRVI---IK---
CAPSD_TTVD1/1-324LF-YYD--.--------.P------EYG------NTF-EFKKLIHPAIMITHPKTILVLSNKRGGNRRKWPR---MW---
Q91CZ6_9VIRU/1-596IV-QYD--T--------AA------PFT------IDK-DSSANYHPGVLIKARKKVLVPSYDTHPKGRAKIK---IH---
A7VM08_9VIRU/1-506IV-NFS--R--------QP------PFN------IDK-YTYMSMQPQEMLLGKHKKIILSKLTKPTGRIKHT---LK---
CAPSD_TTVV3/1-573VV-QIH--T--------QP------PFQ------DTE-ITAPSIHPGMLILSKKHILIPSLKTRPSKKHYVK---VR---
Q91D00_9VIRU/1-593IV-QYD--N--------NP------PMK------NTI-LSSPNTHPGMLMQQKHRILVPSWQTFPRGRKYVK---VK---
Q99AR5_9VIRU/1-604IV-HYN--L--------VP------PLK------MNQ-FTSPNTHPGLLMLTKHKIIIPSFLTRPGGRRFVK---IR---
Q9DTD2_9VIRU/1-559IV-QIH--T--------SP------PFR------DTE-MTGPSIHPGMLMLKKHRLLIPSLKTRPGRKHRIT---VR---
Q91D04_9VIRU/1-591IV-TYS--S--------VP------PFK------MDK-YSSAMLHPGTLMQRKKKILIPSFTTRPRGRKKVK---LH---
CAPSD_TTVV8/1-571IV-IIR--N--------SP------PFE------DTE-LTGPNTHPGMLMLRHKKILVPSLRTRPSRRHKIT---VR---
Q5ENX0_9VIRU/1-603IV-SFT--N--------NP------PMK------TNQ-YTAPMTHPGMLMRAKHKILIPSRLTRPRGKKYIS---VR---
O90364_9VIRU/1-590II-KIN--T--------MP------PFL------DTE-LTAPRLHPGMLALDKRARWIPSLKSIPGKKHYIK---IR---
Q9IFV0_9VIRU/1-583LF-KYN--R--------RQ------PFS------DSQ-LTGPSLHPGIIMKQKRKVIVPSYKTKPKGRPVKR---IR---
Q9QUE7_9VIRU/1-586II-LIN--T--------TP------PFV------DTE-ITGPSIHPGMMALNKRARFIPSLKTRPGRRHIVK---IR---
A8DMR2_9VIRU/1-531VT-VYT--R--------CG------SLT------ATE-ELYRSCQPSLLLLNKHKKVLTCKKNNNKRKISKT---IK---
Q9DUH8_9VIRU/1-609IV-TFS--N--------TP------PMM------SNQ-YTAPLAHPGMLMRSKYKLLLPSFKTRPGGKKTVS---VR---
A7VLW8_9VIRU/1-511IV-QYS--R--------QP------PFL------IDK-WTYMQYHPYMLLQSKHTKIIPSEQTNPKGRLKKK---LI---
Q99AQ3_9VIRU/1-582IV-QYD--V--------SA------PFK------LDK-NSCPSYHPFMLMKAKHKVLIPSFDTKPKGREKIK---LR---

PF00729

CAPSD_TBSVB/75-270VL-HYV--P--------LC------GTT------EVG-RVALYFDKD----------------------SQ---------
CAPSD_MCMVK/21-224RI-TWE--T--------FT------ADT------TSG-YISMAFLSD----------------------YM---------
CAPSD_TCV/54-245RF-RYS--P--------MS------PST------TGG-KVALAFDRD----------------------AA---------
CAPSD_CARMV/50-246TV-KYS--P--------AC------SFE------TNG-RVALGFNDD----------------------AS---------
CAPSD_RCNMV/23-214TL-RYV--P--------LV------TVQ------NSG-RVAMIWDPD----------------------SQ---------
CAPSD_TBSVC/75-270VL-HYV--P--------LC------STT------EVG-RVAIYFDKD----------------------SE---------
CAPSD_SCPMV/58-276RY-TYL--P--------SC------PTT------TSG-AIHMGFQYD----------------------MA---------
CAPSD_TNVD/51-265SV-VYI--P--------KC------PTS------TQG-SVVMAIVYD----------------------AQ---------
CAPSD_CNV/66-261RF-EYV--P--------LV------NTT------TNG-RVALYFDKD----------------------SE---------
CAPSD_MNSV/68-263RI-TYI--P--------TT------GST------STG-RVSLLWDRD----------------------SQ---------
CAPSD_TNVA/60-273EI-IYI--P--------KC------PTT------TSG-SIAMAFTYD----------------------RN---------
CAPSD_AMCV/75-270LL-HYV--P--------LC------ATT------EVG-RVAMYFDKD----------------------SE---------
CAPSD_CRV/72-266RL-QYV--P--------MC------AST------ETG-RVAIYFDKD----------------------SQ---------

PF11729

Q0QVT6_9VIRU/1-348RF-EVQ--T--------QT------PTT------NGG-GYVVAFLHD----------------------PSM---DV---
Q68UN9_9VIRU/1-338EF-EIQ--P--------MC------PAN------TGG-GYVAGFLPD----------------------PT.---..---
Q709G0_9VIRU/1-340EF-EIQ--P--------MC------PAN------TGG-GYVAGFLPD----------------------PT.---..---

PF00894

CAPSD_PEMVW/52-188KV-VYQ--S--------EA------AAT------DRG-CIAYHVDTS---------------------TTK---------
CAPSD_BLRV/59-196EL-AYI--T--------EA------SST------SSG-SIAYELDPH---------------------.LK---------
CAPSD_BYDV1/61-199KV-EFK--S--------HA------SAS------TVG-AMFIELDTW---------------------.CS---------
Q65845_9LUTE/58-196QI-FYR--S--------HA------SSE------TEG-ALFIELDNS---------------------.CT---------
Q65869_9LUTE/35-172TL-EFI--S--------EA------SSQ------SEG-SIAYELDPH---------------------.NK---------
CAPSD_PLRV/70-208LL-QFV--S--------EA------SST------SSG-SIAYELDPH---------------------.CK---------
CAPSD_BYDVP/62-200RV-EFK--S--------HA------SAN------TAG-AIFIELDTA---------------------.CK---------
CAPSD_BYDVN/67-204VL-QFV--S--------EA------SST------AAG-SISYELDPH---------------------.CK---------
Q65868_9LUTE/34-170IL-EFI--S--------EA------SST------QSG-SIAYELDPH---------------------.NK---------
Q08391_9LUTE/63-200LL-QFI--T--------EA------SST------SSG-SIAYELDPH---------------------.CK---------
Q65970_9LUTE/62-199QL-EFI--S--------EA------SST------SSG-SISYELDPH---------------------.CK---------
Q65880_9LUTE/60-197IL-EFI--S--------EA------AST------AEG-SIAYELDSH---------------------.NK---------
CAPSD_TYYVF/65-202IL-EFV--S--------EA------SSQ------NSG-SIAYELDPH---------------------.CK---------

PF03014

Q8V729_HEV/41-660TI-RYR--P--------LV------PNA------VGGYAISISFWPQ---------------------TTT---------
CAPSD_AHEV/13-604TV-RWR--P--------VV------PNA------VGGFSISMAYWPQ---------------------TTS---------

PF00983

COAT_CAYMV/7-177QA-IIH--P--------NG------YAP------AFPTSVALAWVPY----------------------NS---------
Q65665_BMDV/8-179FL-TIT--P--------TQ------RAI------DCPVTVDVAWVPA----------------------NS---------
COAT_ELV/19-190HA-VVS--P--------SA------VSI------GHPLTVQLIWVPA----------------------SS---------
COAT_BMDV/8-181KA-ILT--P--------TD------LAV------SNPLTVYLAWVPA----------------------NS---------
O09737_9VIRU/7-178TA-TIH--P--------NA------LSV------SNPTTVSLVWVPY----------------------NS---------
COAT_EPMV/8-179AA-TIT--P--------TA------AAI------ANPLTVNIVWVSD----------------------NS---------
COAT_OYMV/8-179EA-VLF--P--------NS------TSS------KNPVHCDLIWVPS----------------------NS---------
COAT_KYMVJ/7-178KA-TIH--P--------TG------QAP------AFPTTVALAWVPY----------------------NS---------
COAT_TYMV/7-178WV-TIH--P--------TL------QAP------TFPTTVGVCWVPA----------------------NS---------

PF00073

POLG_ENMGO/159-361.APEYPT...........................................LDVFAMDNRWSKD.NLPNGTRTQTNRKGPF
POLG_POL1M/92-308.VPEMCLAGDSNTTTMHTSYQNANPGE....KGGTFTGTFTPDNNQTSPARRFCPVDYLL......GNGTLL........
POLG_POL1M/630-806.VPPGAP...............................................VPEKW.....................
POLG_POL3L/92-307.IPEYCLAGDSDKQRYTSYA...................NANPGERGGKFYSQFNKDNA............VTSPKREFC
POLG_HRV14/91-299.IPEHQLASHEGGNVSVKYTFTHPG.........ERGIDLSSANEVGGPVKDVIYNMNG.....................
POLG_HRV14/610-795.VPPGAP...............................................NPKEW.....................
POLG_EMCV/161-359.APEYPT...........................................LDAFAMDNRWSKD.NLPNGTRTQTNKKGPF
POLG_EMCV/420-624.TPPGAG...............................................KPTSR.....................
POLG_FMDVO/308-475.VPELYS..............................................IQKREL.....................
POLG_FMDVO/533-693.APPGME...............................................PPKTP.....................
POLG_FMDVO/725-887.VPNGAP.........................................................................
POLG_FMDV1/308-475.VPEWKA..............................................FDTREK.....................
POLG_FMDV1/533-694.IPPGVE..............................................TPPDTP.....................
POLG_FMDV1/726-886.VPNGAP.........................................................................
POLG_FMDVI/11-170.VPNGAP.........................................................................
POLG_CXB3N/92-302.VPEAEMGCATLDNTPSSAELLGGDTA....KEFADKPVASGSNKLVQRVVYNAGMGVG.....................
POLG_CXB3N/360-530.SPPGAG...............................................APTKR.....................
POLG_CXB3N/630-790.VPPGGP............................................VPDKVDSY.....................
POLG_HRV2/92-302.IPEHQIASALHGNVNVGYNYTHPGETGREVKAETRLNPDLQPTEEYWLNFDGTLLGNI.....................
POLG_HRV2/358-526.TPPGIA...............................................EPTTR.....................
POLG_HRV2/610-772YVPPGAP...............................................VPNSR.....................
POLG_HRV8A/92-302.IPEHQLASATSGNVSVGYNHTHPGEQG...REVVPSRTSSDNKRPSDDSWLNFDGTLL.....................
POLG_HRV8A/364-533.TPPGVG...............................................KPKSR.....................
POLG_HRV8A/617-801.VPPGAP...............................................VPEKR.....................
POLG_CXB1J/360-528.SPPGAG...............................................VPKNR.....................
POLG_CXB4J/92-300.VPEAEMGCTNAENAPAYGDLC...............GGETAKSFEQNAATGKTAVQTAVCNA.GMGVGV..........
POLG_CXB4J/358-528.SPPGAG...............................................APDSR.....................
POLG_CXB4J/607-796.VPPGGP...............................................VPTSV.....................
POLG_TMEVB/169-382.APEFYTGKGTKT................................GTMEPSDPFTMDTEWRSPQGAPTGYRYDS.RTGFF
POLG_TMEVB/443-648.TPPGAG...............................................KPTTR.....................
POLG_BOVEV/92-285.IPEHQIATQE....................................QPAFDRTMPGSE............GGTFQEPFW
POLG_BOVEV/345-515.TPPGGD...............................................MPRNR.....................
POLG_BOVEV/606-778.VPPGAP...............................................VPSNQ.....................
POLG_HRV1B/92-301.IPEHQLASAKNGSVTAGYNLTHPGEA....GRVVGQQRDANLRQPSDDSWLNFDGTLL.....................
POLG_HRV1B/360-529.TPPGID...............................................KPATR.....................
POLG_HRV1B/627-794.VPPGAP...............................................IPKTR.....................
POLG_SVDVU/608-791.VPPGGP............................................VPTKVNSY.....................
POLG_FMDVT/308-475.VPEMGD..............................................ISDREK.....................
POLG_CXA9/90-300.VPEAEMGGAVVGQAFSATAMA...............NGDKAYEFTSATQSDQTKVQTAIHN...AGMGVGV........
POLG_CXA9/358-526.SPPGAN...............................................PPKTR.....................
POLG_CXA9/608-791.VPPGGP...........................................IPAKVDDYA.....................
POLG_CXA21/90-308.IPEFVMACNTESKTSYVSYINANPGER..GGEFTNTYNPSNTDVSEGRQFAALDYLLG.................SGVL
POLG_CXA21/369-540.SPPGAK...............................................PPTNR.....................
POLG_CXA21/642-821.IPPGAP...............................................RPSSW.....................
POLG_HE701/92-288.IPEHQIGKKGTGTSASFAEVM...............KGAEGGVFEQPYLLD..DGTSL.....................
POLG_HE701/347-517.TPPGGS...............................................SPTDR.....................
POLG_HE701/609-781.VPTGAR...............................................KPSSQ.....................
POLG_CXA24/646-809.IPPGAP............................................RPTAWDDY.....................
Q9WMA0_9PICO/45-215.VPGDQ................................................SYGSI.....................
POLG_AEVCA/41-212.VPYDQV...............................................DIESI.....................

PF00915

CAPSD_FCVC6/107-396-VPP..G----------------------------------------------IDPVQS---------------------
Q83876_9CALI/2-295-IPPGFG----------------------------------------------SQQLTI---------------------
CAPSD_SOUV3/2-296-VPPGFT----------------------------------------------SSSLTI---------------------
CAPSD_LORDV/2-291-VPPNFP----------------------------------------------TEGLSP---------------------
O09725_9CALI/267-560-IPP..G----------------------------------------------VDPTSI---------------------
Q66418_9CALI/2-296-IPPGFA----------------------------------------------AQNISI---------------------
Q66296_9CALI/2-291-IPPNFP----------------------------------------------IDNLSA---------------------
CAPSD_VESVA/137-421-VPP..G----------------------------------------------VEPIES---------------------
POLG_RHDVF/1768-2065-IPP..G----------------------------------------------IEIGPG---------------------
Q80RD6_9CALI/2-291-VPPHFP----------------------------------------------VENLSP---------------------
CAPSD_SMSV1/137-427-VPP..G----------------------------------------------IEPVES---------------------

PF08762

Q8B107_ALPV/599-804-IDETRT-----------------------------------------------AADV.---------------------
O56051_9VIRU/590-790-TYPDYK-----------------------------------------------GAEV.---------------------
Q56QP7_9VIRU/684-855-DHATST-----------------------------------------------GPSH.---------------------
O36967_9VIRU/668-900-DYPIKS-----------------------------------------------TGALP---------------------
Q5UBY1_9VIRU/79-259-DNTNND-----------------------------------------------GPSH.---------------------
Q6ITS9_9VIRU/106-313-VSPQQT-----------------------------------------------YGSEV---------------------
Q4JFT2_9VIRU/834-1009-TSPDSI-----------------------------------------------ETSTS---------------------

PF01829

CAPSD_BBV/50-407-ADVPAG-----------------------------------------------TF----------PISTT.TFNAVNFP
CAPSD_NODAM/42-399-.KAEAN-----------------------------------------------VG----------ASFSGVPLASVEFP
CAPSD_BOOLV/36-403-ATAPAQ-----------------------------------------------PA----------ALTTTDVFTAVPFP

PF03566

Q80IX5_9VIRU/54-754-TGQWAQ-----------------------------------------------FA..PGWYYSIYVLPNTYAMAEIGDR
Q4TVU2_9VIRU/1-642-SGQWFV-----------------------------------------------FSDDPTWFVRIRVLHPTY...DLPDP
Q9YK87_9VIRU/108-757-HPNWVE-----------------------------------------------TSQAGLYW....SIQRWTALIGVPPP
CAPSD_NCBVS/1-608-YPSWAQ-----------------------------------------------VG..NVFY....MVVPTEALTDVPPP
CAPSD_HASV/2-647-SEQWIN-----------------------------------------------FTNDTTYYVRIRVLRPTY...DVPDP

PF01766

POLS_BSNV/6-428-LSATAN-----------------------------------------------INDKVGNV----LVGDGVAVLSLPAG
Q9IP80_IBDV/8-452-MSATAN-----------------------------------------------INDKIGNV----LVGEGVTVLSLPTS
POLS_DXV96/1-442-LSITSN-----------------------------------------------PLDKVGNV----LVGDGIEVLSLPQG
O55651_9VIRU/4-453-MSLTTN-----------------------------------------------PQDKVNNQ----PVTKGVTVLNLPTG

PF00760

CAPSD_PSVJ/7-215-LNPSPT-----------------------------------------------FDSTVWVTLRKLPLGYSLASESVFKL
CAPSD_CMVKI/12-216-INPLPK-----------------------------------------------FDSTVWVTVRKVPSSSDLSVAAISAM
CAPSD_TAV/7-216-LNPSPK-----------------------------------------------FNSTIWVSLRRLDETTLLTSENVFKL
CAPSD_CMVC/11-216-VNPLPK-----------------------------------------------FDSTVWVTVRKVPASSDLSVAAISAM

PF01318

CAPSD_CCMV/2-190-LGLLPS-----------------------------------------------VSGTVKSCVTETQTTAAASFQVALAV
CAPSD_BMV/2-188-LGLLPS-----------------------------------------------VAGRIKACVAEKQAQAEAAFQVALAV
CAPSD_BBMV/2-190-LGLLPT-----------------------------------------------VAGTVKVCLTEKQDSPAESFKRALAV

PF02247

POL2_SQMVM/246-618-SSAHAS-----------------------------------------------FPINRWMGKLSFPQGPARVLKRMPLA
POL2_CPMVS/460-832-ADCQNW-----------------------------------------------LPLNRWMGKLTFPQGVTSEVRRMPLS
POL2_BPMV/447-819-LNPQNP-----------------------------------------------FVLNRWMGKLTFPQGTSRSVKRMPLS
Q9Z006_9SECO/476-846-LEHAPA-----------------------------------------------FMFRKELGTLAFKQG.ELVAYSFEVN
O12663_9SECO/321-691-LEHAPA-----------------------------------------------FMFRKELGTLAFKQG.ERVAYSFEVN
Q9YWK0_9SECO/363-735-SSAHAS-----------------------------------------------FPINRWMGKLSFPQGPARVLKRMPLA
POL2_CPSMV/437-806-FDPEPD-----------------------------------------------MMLNRWMGRAIFPQQSTQVVRRMPLS
POL2_RCMV/407-778-GTPGQN-----------------------------------------------VWVNRWMGKLSFPQGSQNQLKQMPLA
Q9YWJ9_9SECO/452-824-SSAHAS-----------------------------------------------FPINRWMGKLSFPQGPARVLKRMPLA
Q66170_CPMVS/343-715-ADCQNW-----------------------------------------------LPLNRWMGKLTFPQGVTSEVRRMPLS

PF03391

CAPSD_TRSV/179-344-----------------------------------------------------------RYYEAKEIKLDGSTSMLSISY
POL2_RRVS/768-936-----------------------------------------------------------EVWGPYRFTLDGTEAKESFAI
POL2_BRAV/1268-1433-----------------------------------------------------------WRGPYTFPLGGGTKRLSTSLD
Q65029_ARMV/745-916-----------------------------------------------------------LTIPPLEYDLSATSAYKSVSL
POL2_ARMVS/792-963-----------------------------------------------------------LTIPPLEYDLSATSAYKSVSL
Q67703_GFLV/166-336-----------------------------------------------------------LTCPPIFFDLTAVTALKSAGL
POL2_GFLV/771-941-----------------------------------------------------------LTCPPIFFDLTAVTALRSAGL
POL2_BRSV/1007-1170-----------------------------------------------------------LMLAPKQIAVGTYAMITFPVS
POL2_GCMV/981-1144-----------------------------------------------------------IMLPPRQMAIGNAGSINFPLS
POL2_TORVR/1497-1662-----------------------------------------------------------WRGPTEIDLTSTPAPNAYRLL
Q88483_9SECO/1003-1166-----------------------------------------------------------LVLKSGSIAIGTYTMTKVPVS

PF02443

Q5Y4T0_PCV2/5-226-FWPCSP-----------------------------------------------ITQ.GDR-------------------
Q27W03_PCV1/5-227-FYPRDP-----------------------------------------------ITS.NQR-------------------
A3FEQ4_9CIRC/3-256-LRPAYN-----------------------------------------------IYQ.KSK-------------------
Q3HUU1_GOCV/5-247-LRPAYN-----------------------------------------------PFT.RVR-------------------
Q1L2D2_9CIRC/1-237-MRPLGE-----------------------------------------------NST.EWK-------------------
CAPSD_CACV/7-243-MRPLNE-----------------------------------------------SWE.EWK-------------------
Q0H9S8_9CIRC/4-236-MRPLNE-----------------------------------------------NWG.SWH-------------------
Q06J73_9CIRC/8-245-GIPRRE-----------------------------------------------DWT.HWE-------------------
Q9DXG3_BFDV/11-242-MRPTGG-----------------------------------------------HYTVQSD-------------------
Q69EZ5_BFDV/7-239-MRPTYG-----------------------------------------------FGSITQE-------------------
Q9DXG0_BFDV/11-242-MKPTWG-----------------------------------------------HYSIATE-------------------
Q9DXF4_BFDV/3-235-MKPTWG-----------------------------------------------HSYTNSE-------------------

PF02956

A7VLZ2_9VIRU/1-506-IKPPTQ-----------------------------------------------MSN-KWFFQEGFSDTGLVQIHTAACD
Q9WT88_9VIRU/1-603-LNPPKL-----------------------------------------------FED-KWYTQQDLCKVPLVSITATAAD
Q91CY9_9VIRU/1-581-IKPPVL-----------------------------------------------FED-KWYTQQDLCPVNLLSLAVSACS
A7VLY0_9VIRU/1-515-IKPPKQ-----------------------------------------------MLT-EWFFQQDFATQGLFSIHAAAAN
Q9JGT1_9VIRU/1-585-VGAPRM-----------------------------------------------FTD-KWYPQTDLCDMTLLTIFASAAD
Q80QT8_9VIRU/1-595-VGPPKL-----------------------------------------------FED-KWYSQHELCKVPLVSWRLTAAD
CAPSD_TTVB1/1-533-VRPPAL-----------------------------------------------FQS-KWYFSQDIYNTPLFILTVSSCS
A7VM00_9VIRU/1-509-IKPPKM-----------------------------------------------LQT-KWYFQEELAEFGLVAIHAAACN
Q9JG61_9VIRU/1-534-YKPPAL-----------------------------------------------LQN-KWYFAQDILNTPLILFTTSSCS
Q91PS3_9VIRU/1-581-IPPPTL-----------------------------------------------FAD-RWYFQKDFAKVPLVNIGASIGN
CAPSD_TTVV4/1-560-IGPPRL-----------------------------------------------FTD-HWYFQRDFCGVPLLTVNATACN
Q91C93_9VIRU/1-546-IPPPSQ-----------------------------------------------LKT-KWYFQRDIANLPLLLTIATACS
Q2F827_9VIRU/1-589-IRPPTL-----------------------------------------------LED-KWYTQQDLAPVNLVSLVVSAAS
Q91CY5_9VIRU/1-584-IRPPNM-----------------------------------------------FAD-KWYTQEDLCPVPLVQLVVSAAS
Q8V7G9_9VIRU/1-572-IKPPKL-----------------------------------------------MIN-KWYFAKDLCNIGPCQIYATGLE
Q99A78_9VIRU/1-584-VGAPRM-----------------------------------------------FTD-KWYPQSDLCDLPLLTIFASAAD
Q6H9C2_9VIRU/1-573-VGAPRL-----------------------------------------------FQD-KWYPQSDLCDTVLLSIFATACD
CAPSD_TTVT1/1-433-LKPPAV-----------------------------------------------FNS-AWYTSDKWCGAGLGRIYFSFLN
Q9JG80_9VIRU/1-589-IPPPDL-----------------------------------------------FVD-KWYTQEDLCSVNLVSLAVSAAS
A7VLZ6_9VIRU/1-506-IKPPRQ-----------------------------------------------MIS-KWFFTKPFAKYPLLSLKASALD
Q6H9D2_9VIRU/1-557-IRPPTL-----------------------------------------------FDD-RWYFQHDICKTTLFTISATPCD
Q6H999_9VIRU/1-471-IAPPTL-----------------------------------------------FTD-KWYFQKDIADLTLFNIMAVEAD
Q99AR3_9VIRU/1-606-VGAPKL-----------------------------------------------FED-KWYPQNELCDVTLLTIQATTAD
Q91PS7_9VIRU/1-585-FKPPTL-----------------------------------------------YTD-KWYFQKDICNLPLVNIAASACS
CAPSD_TTVV9/1-555-IPPPKL-----------------------------------------------MMT-QWYFQKEFCQVGLVLLSISTAT
Q9JG47_9VIRU/1-553-VKPPSQ-----------------------------------------------LQN-KWYFQKELSNVPLMQVMATTCS
A7VLW0_9VIRU/1-507-IRPPKQ-----------------------------------------------LVT-KWFFQKDFAQYGLVAIAAAACN
Q0ZLH9_9VIRU/1-573-VRPPTL-----------------------------------------------FTD-KWYFQRDLCKVPLVTVSASAAS
Q5ENW7_9VIRU/1-501-IPPPSR-----------------------------------------------DTT-QWQFQTDFCNRKLFTWAAGLID
A7VLX2_9VIRU/1-509-IKPPKL-----------------------------------------------LST-RWFFQKEMSSVPLVQLSAAACD
Q80AR5_9VIRU/1-594-IPPPKL-----------------------------------------------FED-HWYTQPDLCKVPLVTLRSTAAD
Q91CZ2_9VIRU/1-601-IKPPKM-----------------------------------------------FVD-KWYTQEDLCTVTLVSLVVSLAS
CAPSD_TTVG1/1-514-IKPPKQ-----------------------------------------------MLS-KWFFQQQFAKYDLLLIAAAACS
Q98Y63_9VIRU/1-581-IKPPAL-----------------------------------------------FED-KWYTQQDLCPVNLLSLAVSACS
Q9QU36_9VIRU/1-529-VRPPTQ-----------------------------------------------MTN-GWFFQKDLCNFPLLVILATAAS
A7VM12_9VIRU/1-509-IKPPKQ-----------------------------------------------LIT-KWFFTKPFSNYGLLFLKGSAMN
A7VLV6_9VIRU/1-508-IKPPKT-----------------------------------------------MQT-KWYFQKQIAELPLVQLQAAACD
Q9JG50_9VIRU/1-535-IRPPAM-----------------------------------------------LQS-HWYFQQEICNTGLLLITTSICN
A7VLW4_9VIRU/1-507-FKPPKQ-----------------------------------------------MIN-KWLFTKNFTPASLIVLKTAVCN
A7VM04_9VIRU/1-513-VKPPKQ-----------------------------------------------MLN-KWFFQEHFSHEPLLMIQATAAN
A7VLY4_9VIRU/1-498-IKPTRV-----------------------------------------------VLK-KWFFQETFDTTGLCSIYAAACD
CAPSD_TTVD1/1-324-IPRPAI-----------------------------------------------FAD-GWEFQKDLCQHGLFAFGWAWVD
Q91CZ6_9VIRU/1-596-IEPPKM-----------------------------------------------FVD-KWYAQHDLCDVELVSFVVSLAS
A7VM08_9VIRU/1-506-IGPPKL-----------------------------------------------LTN-KWMFQEQFATQDLVQIAGTACN
CAPSD_TTVV3/1-573-VGAPRL-----------------------------------------------FQD-KWYPQSELCDVTLLVIYATACD
Q91D00_9VIRU/1-593-IPPPKL-----------------------------------------------FED-HWYTQPDLCKVPLVTLRSTAAD
Q99AR5_9VIRU/1-604-LPPPKL-----------------------------------------------FED-KWYTQQDLCKQPLVTLTATAAS
Q9DTD2_9VIRU/1-559-IGAPKT-----------------------------------------------FED-KWYPQTDLCDVILVVIYATAAD
Q91D04_9VIRU/1-591-IKPPVL-----------------------------------------------FED-KWYTQQDLCDVNLLSLAVSAAS
CAPSD_TTVV8/1-571-IGPPKL-----------------------------------------------FED-KWYSQTDICDVILATVYATACD
Q5ENX0_9VIRU/1-603-IRPPKL-----------------------------------------------FQH-KWYTQSDLCSVSLVQLNLTAAD
O90364_9VIRU/1-590-VGAPKM-----------------------------------------------FTD-KWYPQTDLCDMVLLTVYATAAD
Q9IFV0_9VIRU/1-583-IKPPTL-----------------------------------------------FTD-RWYFQKDFSNFPLVTISASAAS
Q9QUE7_9VIRU/1-586-VGAPKL-----------------------------------------------YED-KWYPQSELCDVPLLTVYATAAD
A8DMR2_9VIRU/1-531-IPPPTL-----------------------------------------------MQN-KWYFQKDFAKYPLVMILSAALS
Q9DUH8_9VIRU/1-609-IRPPKL-----------------------------------------------FNH-KWYAQSDLCDVNLVQFTVTAAD
A7VLW8_9VIRU/1-511-IRPPKQ-----------------------------------------------MLS-KWFFQRQFATADLFQLVTAACS
Q99AQ3_9VIRU/1-582-IQPPKM-----------------------------------------------FID-KWYTQEDLCPVILVTLVATAAS

PF00729

CAPSD_TBSVB/75-270-DPEPAD-----------------------------------------------RVE--LANFGVLKETAPWA.......
CAPSD_MCMVK/21-224-LSIPTG-----------------------------------------------VED--VARIVPSATIALKNR......
CAPSD_TCV/54-245-KPPPND-----------------------------------------------LAS--LYNIEGCVSSVPWT.......
CAPSD_CARMV/50-246-DTPPTT-----------------------------------------------KVG--FYDLGKHVETAAQT.......
CAPSD_RCNMV/23-214-DSAPQS-----------------------------------------------RQE--ISAYSRSVSTAVYE.......
CAPSD_TBSVC/75-270-DPEPAD-----------------------------------------------RVE--LANYSVLKETAPWA.......
CAPSD_SCPMV/58-276-DTLPVS-----------------------------------------------VNQ--LSNLKGYVTGPVWEGQSGLCF
CAPSD_TNVD/51-265-DTVPTT-----------------------------------------------RTQ--VSQCYQSITFPPYAGYGGASA
CAPSD_CNV/66-261-DPGPDD-----------------------------------------------RAA--LANYAHLSEISPWA.......
CAPSD_MNSV/68-263-DPLPID-----------------------------------------------RAA--ISSYAHSADSAPWA.......
CAPSD_TNVA/60-273-DAAPTA-----------------------------------------------RAQ--LSQSYKAINFPPYAGYDGAAY
CAPSD_AMCV/75-270-DPEPAD-----------------------------------------------RVE--LANYSVLAETAPWA.......
CAPSD_CRV/72-266-DLEPVD-----------------------------------------------RIE--LANMRHLTETAPWC.......

PF11729

Q0QVT6_9VIRU/1-348-GQGENA-----------------------------------------------LKA--LTAVQGTQTSKFWQ-------
Q68UN9_9VIRU/1-338-.DNDHT-----------------------------------------------FDA--LQATRGAVVAKWWE-------
Q709G0_9VIRU/1-340-.DSDHT-----------------------------------------------FDA--LQATRGAVVAKWWE-------

PF00894

CAPSD_PEMVW/52-188--------------------------------------------------------------------------------
CAPSD_BLRV/59-196--------------------------------------------------------------------------------
CAPSD_BYDV1/61-199--------------------------------------------------------------------------------
Q65845_9LUTE/58-196--------------------------------------------------------------------------------
Q65869_9LUTE/35-172--------------------------------------------------------------------------------
CAPSD_PLRV/70-208--------------------------------------------------------------------------------
CAPSD_BYDVP/62-200--------------------------------------------------------------------------------
CAPSD_BYDVN/67-204--------------------------------------------------------------------------------
Q65868_9LUTE/34-170--------------------------------------------------------------------------------
Q08391_9LUTE/63-200--------------------------------------------------------------------------------
Q65970_9LUTE/62-199--------------------------------------------------------------------------------
Q65880_9LUTE/60-197--------------------------------------------------------------------------------
CAPSD_TYYVF/65-202--------------------------------------------------------------------------------

PF03014

Q8V729_HEV/41-660-TPTSVD-----------------------------------------------MNS--ITSTDVRILVQPGI-------
CAPSD_AHEV/13-604-TPTSID-----------------------------------------------MNS--ITSTDVRVVLQPGS-------

PF00983

COAT_CAYMV/7-177-TATAAK-----------------------------------------------ILD..VFGGQEFCVGGSINS------
Q65665_BMDV/8-179-TAPPSK-----------------------------------------------ILS..IYGGQRFLIGGPITT------
COAT_ELV/19-190-TTTSSQ-----------------------------------------------ILG..TYGGQQISVGGQVTN------
COAT_BMDV/8-181-PATPTQ-----------------------------------------------ILKLRVYGGQSFVLGGAISA------
O09737_9VIRU/7-178-SATSAQ-----------------------------------------------ILD..VYGAKRFCIGGAINT------
COAT_EPMV/8-179-TAKPTE-----------------------------------------------ILN..VFGGSSYTFGGALNA------
COAT_OYMV/8-179-SASPKT-----------------------------------------------ILQ..TYGGNRFTVGGPITS------
COAT_KYMVJ/7-178-TATSAQ-----------------------------------------------ILS..VYGGQMFCIGGSINS------
COAT_TYMV/7-178-PVTPAQ-----------------------------------------------ITK..TYGGQIFCIGGAINT------

PF00073

POLG_ENMGO/159-361AMDH.....QNFWQWTLYP-------------------------------------------------------------
POLG_POL1M/92-308............GNAFVFP-------------------------------------------------------------
POLG_POL1M/630-806...D.....DYTWQTSSNP-------------------------------------------------------------
POLG_POL3L/92-307PVDYLLGCGVLLGNAFVYP-------------------------------------------------------------
POLG_HRV14/91-299.........TLLGNLLIFP-------------------------------------------------------------
POLG_HRV14/610-795...D.....DYTWQSASNP-------------------------------------------------------------
POLG_EMCV/161-359AMDH.....QNFWQWTLYP-------------------------------------------------------------
POLG_EMCV/420-624............DQAMQAT-------------------------------------------------------------
POLG_FMDVO/308-475............YQLTLFP-------------------------------------------------------------
POLG_FMDVO/533-693............EAAAHCI-------------------------------------------------------------
POLG_FMDVO/725-887............EKALDNT-------------------------------------------------------------
POLG_FMDV1/308-475............YQLTLFP-------------------------------------------------------------
POLG_FMDV1/533-694............EEAAHCI-------------------------------------------------------------
POLG_FMDV1/726-886............EAALSNT-------------------------------------------------------------
POLG_FMDVI/11-170............VSALDNT-------------------------------------------------------------
POLG_CXB3N/92-302...........VGNLTIFP-------------------------------------------------------------
POLG_CXB3N/360-530............VDAMLGT-------------------------------------------------------------
POLG_CXB3N/630-790...........VWQTSTNP-------------------------------------------------------------
POLG_HRV2/92-302...............TIFP-------------------------------------------------------------
POLG_HRV2/358-526............KDAMLGT-------------------------------------------------------------
POLG_HRV2/610-772...D.....DYAWQSGTNA-------------------------------------------------------------
POLG_HRV8A/92-302............GNLPIYP-------------------------------------------------------------
POLG_HRV8A/364-533............REAMLGT-------------------------------------------------------------
POLG_HRV8A/617-801...D.....DYTWQSGTNA-------------------------------------------------------------
POLG_CXB1J/360-528............RDAMLGT-------------------------------------------------------------
POLG_CXB4J/92-300............GNLTIYP-------------------------------------------------------------
POLG_CXB4J/358-528............KNAMLGT-------------------------------------------------------------
POLG_CXB4J/607-796...N.....DYVWQTSTNP-------------------------------------------------------------
POLG_TMEVB/169-382ATNH.....QNQWQWTVYP-------------------------------------------------------------
POLG_TMEVB/443-648............DQAMQST-------------------------------------------------------------
POLG_BOVEV/92-285LEDG.....TSLGNSLIYP-------------------------------------------------------------
POLG_BOVEV/345-515............EEAMLGT-------------------------------------------------------------
POLG_BOVEV/606-778...D.....SFQWQSGCNP-------------------------------------------------------------
POLG_HRV1B/92-301............GNLLIFP-------------------------------------------------------------
POLG_HRV1B/360-529............KDAMLGT-------------------------------------------------------------
POLG_HRV1B/627-794...N.....DFSWQSGTNM-------------------------------------------------------------
POLG_SVDVU/608-791...........SWQTSTNP-------------------------------------------------------------
POLG_FMDVT/308-475............YQLTLYP-------------------------------------------------------------
POLG_CXA9/90-300............GNLTIYP-------------------------------------------------------------
POLG_CXA9/358-526............KDAMLGT-------------------------------------------------------------
POLG_CXA9/608-791............WQTSTNP-------------------------------------------------------------
POLG_CXA21/90-308A...........GNAFVYP-------------------------------------------------------------
POLG_CXA21/369-540............KDAMLGT-------------------------------------------------------------
POLG_CXA21/642-821...D.....DYTWQSSSNP-------------------------------------------------------------
POLG_HE701/92-288............ACALVYP-------------------------------------------------------------
POLG_HE701/347-517............MQAMLAT-------------------------------------------------------------
POLG_HE701/609-781...D.....SFEWQSACNP-------------------------------------------------------------
POLG_CXA24/646-809...........TWQSSSNP-------------------------------------------------------------
Q9WMA0_9PICO/45-215............ASLTVYP-------------------------------------------------------------
POLG_AEVCA/41-212............AAMTTYC-------------------------------------------------------------

PF00915

CAPSD_FCVC6/107-396------------TSMLQYP-------------------------------------------------------------
Q83876_9CALI/2-295------------AQATLFP-------------------------------------------------------------
CAPSD_SOUV3/2-296------------AQATLFP-------------------------------------------------------------
CAPSD_LORDV/2-291------------SQVTMFP-------------------------------------------------------------
O09725_9CALI/267-560------------RDPGVLP-------------------------------------------------------------
Q66418_9CALI/2-296------------AQATMFP-------------------------------------------------------------
Q66296_9CALI/2-291------------AQITMCP-------------------------------------------------------------
CAPSD_VESVA/137-421------------VSMLQYP-------------------------------------------------------------
POLG_RHDVF/1768-2065------------LEVRQFP-------------------------------------------------------------
Q80RD6_9CALI/2-291------------QQITMFP-------------------------------------------------------------
CAPSD_SMSV1/137-427------------PTMLQYP-------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804----------.........-------------------------------------------------------------
O56051_9VIRU/590-790----------.........-------------------------------------------------------------
Q56QP7_9VIRU/684-855----------.........-------------------------------------------------------------
O36967_9VIRU/668-900----------AGTSGFGNS-------------------------------------------------------------
Q5UBY1_9VIRU/79-259----------.........-------------------------------------------------------------
Q6ITS9_9VIRU/106-313----------APTTHISTP-------------------------------------------------------------
Q4JFT2_9VIRU/834-1009----------AYQFDTNRA-------------------------------------------------------------

PF01829

CAPSD_BBV/50-407-----------------GFNSMFG------------------------------------NAAASRSDQVSSFRYASMNV
CAPSD_NODAM/42-399-----------------GFDQLFG------------------------------------TSATDTAANVTAFRYASMAA
CAPSD_BOOLV/36-403-----------------DFTSLFG------------------------------------TTATNRADQVAAFRYASMNF

PF03566

Q80IX5_9VIRU/54-754TD.....SVTQFRKVYKGITFEFNAPTLIDQG-------------------WWVGAHIPVKPQSETIPAAERFSAGSMTV
Q4TVU2_9VIRU/1-642TE.GLLRTVSDYRLTYKSITCEANMPTLVDQG-------------------FWIGGHYALTPIATTQNAVE....GSGFV
Q9YK87_9VIRU/108-757SDTGVSPYITDFRITGSGFTVSSNTPSLINQG-------------------MVVVAQF..NPNTENKEVIPHSESGETPL
CAPSD_NCBVS/1-608TQLGVSGLLESYRLTSSGVTAYFNAPTLVNQG-------------------VAVIAQF..QPDKEHQKENPDIVAGTTQT
CAPSD_HASV/2-647TE.GLVRTVSDYRLTYKAITCEANMPTLVDQG-------------------FWIGGQYALTPTSLPQYDVS....EAYAL

PF01766

POLS_BSNV/6-428SDLPYVRLGDEVP...SSA..GVARCS---------------------------------PSDRPRHYNANNKQ......
Q9IP80_IBDV/8-452YDLGYVRLGDPISAIGLDP.KMVATCD---------------------------------SSDRPRVYTITAADDYQFLS
POLS_DXV96/1-442FNNPYVRLGDKSPSTLSSPTHITNTSQ---------------------------------NLATGGAYMIPVTT......
O55651_9VIRU/4-453FDKPYVRLEDETPQGPQSMNGARMRCT---------------------------------AAIAPRRYEIDLPS..ARLP

PF00760

CAPSD_PSVJ/7-215FTDG-----LSAVLMYQHV-------------------------------------------------------------
CAPSD_CMVKI/12-216FGDG-----NSPVLVYQYA-------------------------------------------------------------
CAPSD_TAV/7-216FTDG-----LAAVLIYQHV-------------------------------------------------------------
CAPSD_CMVC/11-216FADG-----ASPVLVYQYA-------------------------------------------------------------

PF01318

CAPSD_CCMV/2-190-ADN-----SKDVVAAMY--------------------------------------------------------------
CAPSD_BMV/2-188-ADS-----SKEVVAAMY--------------------------------------------------------------
CAPSD_BBMV/2-190-ADS-----SKEVASAFY--------------------------------------------------------------

PF02247

POL2_SQMVM/246-618IGGGA-GTKDAILMNMPNA-------------------------------------------------------------
POL2_CPMVS/460-832IGGGA-GATQAFLANMPNS-------------------------------------------------------------
POL2_BPMV/447-819IGGGA-GAKSAILMNMPNA-------------------------------------------------------------
Q9Z006_9SECO/476-846FGKPQ-TDGKEVTSTFASA-------------------------------------------------------------
O12663_9SECO/321-691FGKPQ-TDGKEVTSTFASS-------------------------------------------------------------
Q9YWK0_9SECO/363-735IGGGA-GTKDAILMNMPNA-------------------------------------------------------------
POL2_CPSMV/437-806IGGGA-GAKNSILMNLPNA-------------------------------------------------------------
POL2_RCMV/407-778IGGGA-GAKNSILMNMTNA-------------------------------------------------------------
Q9YWJ9_9SECO/452-824IGGGA-GTKDAILMNMPNA-------------------------------------------------------------
Q66170_CPMVS/343-715IGGGA-GATQAFLANMPNS-------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344NFGGPVKHSKKHAISYSRA-------------------------------------------------------------
POL2_RRVS/768-936MPGTAILHGQQIVRTFPRV-------------------------------------------------------------
POL2_BRAV/1268-1433IGTSTTTVSGWRTVSFPAA-------------------------------------------------------------
Q65029_ARMV/745-916LLGQTLVDGTHKVYNFNNT-------------------------------------------------------------
POL2_ARMVS/792-963LLGQTLVDGTHKVYNFNNT-------------------------------------------------------------
Q67703_GFLV/166-336TLGQVPMVGTTRVYNLNST-------------------------------------------------------------
POL2_GFLV/771-941TLGQVPMVGTTKVYNLNST-------------------------------------------------------------
POL2_BRSV/1007-1170LAAKLQSTSGRTAYSYAAG-------------------------------------------------------------
POL2_GCMV/981-1144FAVQQKSSSGRIAYSYAAG-------------------------------------------------------------
POL2_TORVR/1497-1662FGLSTVISGNMSTLNANQA-------------------------------------------------------------
Q88483_9SECO/1003-1166LAMRVDSAAKRQAYSYAAG-------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226-GVGSTAVILDDNFV..TK--------ANALT------------------------------------------------
Q27W03_PCV1/5-227-GVGSTVVILDANFV..TP--------STNLA------------------------------------------------
A3FEQ4_9CIRC/3-256-TQGSTIIDKDGQIVR.TS--------TTGWA------------------------------------------------
Q3HUU1_GOCV/5-247-TQGSTYIDKEGNITTTTS--------GSEWN------------------------------------------------
Q1L2D2_9CIRC/1-237-GLGHTVPITDARLMNFVK--------KKGLA------------------------------------------------
CAPSD_CACV/7-243-GFGHNVPIQDNHLEDFFK--------KTRLD------------------------------------------------
Q0H9S8_9CIRC/4-236-GIGHNVPIQDNHLEDFFK--------KPGLE------------------------------------------------
Q06J73_9CIRC/8-245-GAGVTVPIQDQHLRDFFK--------KTRLT------------------------------------------------
Q9DXG3_BFDV/11-242-GFGHTAVIQDSRITRFKT--------IADQT------------------------------------------------
Q69EZ5_BFDV/7-239-GFGHTAVIQDSRISKFKT--------TADQN------------------------------------------------
Q9DXG0_BFDV/11-242-GFGHTAVIQDSRIEKFKT--------RADQS------------------------------------------------
Q9DXF4_BFDV/3-235-GFGHTAVIQDSRISKFKT--------TADQT------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506LRYAHLGCCNTNQLASFLT.LNTDFYQYAAWG............................NPKNPYIPTEQDKWYRP...
Q9WT88_9VIRU/1-603LRYPFCSPQTNNPCTTFQV.LRK.NYNTVIGT...........................SVKDQESTQDFENWLYKTD..
Q91CY9_9VIRU/1-581FLHPFIPPESDNICITFQV.LRD.FYYTQMSV......................TPTTTTSLNQKDEKIFSDHLYKNP..
A7VLY0_9VIRU/1-515MQWAYYNPDQQSRCLTLYS.LNIKFFANTDWS............................ATHTGTQM......YFP...
Q9JGT1_9VIRU/1-585MQYPFGSPLTDTIVVSFQV.LQS.MYNDCLSV.......................LPSNFVEPSGKGKLLYDKIRKHL..
Q80QT8_9VIRU/1-595MRFPFCSPLTDNPCYTFQV.LHE.EYYNVIGT........................SALLTPTNATYTNFEKWLYGKC..
CAPSD_TTVB1/1-533LDQMYAPQDQISTNISLFS.LNTNVFQINNWH....KQPYTTKAASTLE.TYLYCYHNGHEPTQELKWKDIILLGNM...
A7VM00_9VIRU/1-509FRYPWLACCNENLIITLYY.LQPSFWSHTEWA............................QYSTSA........YNPQ..
Q9JG61_9VIRU/1-534LDQMYAPNDQISTNITFLS.LNTNIFQNPYWE.LDDNQPYFPKVTGTINNIGLYTMGNGGNIKNMKNWKQLIPLYQT...
Q91PS3_9VIRU/1-581LRFPFCRPQTENTCVYFQV.LSN.AWNNMLSI..........................AHPHTENNWQYITETLLKT...
CAPSD_TTVV4/1-560LRYPFGSPQTKNICIYFLV.LAS.IYNDKVSI..........................AKDEVTKNYDTLVDAIKKSPQG
Q91C93_9VIRU/1-546LDRPYLNSQSISNTVGFKT.LNYEAFLNRGFK.NIPTTGYFPKPNTRYF.....ITQTHSTDPKNVPIGSLIFLGNT...
Q2F827_9VIRU/1-589FIHPFSQPQTNNICTTFQV.LKD.MYYDCIGI...........................NSTLTTKYENLFNKLYSKC..
Q91CY5_9VIRU/1-584FMHPFCSPLTNNPCITFQV.LKD.NYYSCIGV.........................NSLETHKNSYTKLQEWLYKTN..
Q8V7G9_9VIRU/1-572LSNPWLRSGTNSPVIGFWV.LKNHLYDGNLSN.............................IASGEQLTARQTLFTT...
Q99A78_9VIRU/1-584MQYPFGSPLTDSVVVGFQV.LQS.MYNDCLSI........................LPENFNGNGKGKALHDNITKYL..
Q6H9C2_9VIRU/1-573LQYPFGSPLTDNPCVNFQI.LGP.QYKKHLSI..........................SSTMDESNKAHYEQNLFKKT..
CAPSD_TTVT1/1-433PFKQIMHTNQTEQSFPFAIELGNTDYDKPPNN................................................
Q9JG80_9VIRU/1-589FLHPFGSPQTDNPCYTFQV.LKE.FYNQAIGF............................SATQDKIDNVFNILYQNN..
A7VLZ6_9VIRU/1-506LRHSYLGCCNENSQVYFFY.LNHGFYKQTNWG............................QYSTTP..............
Q6H9D2_9VIRU/1-557LRFPFCSPQTDNPCVNFLV.LAG.VYNGKLSI..........................EPTNVESQYNSLLSAIETNTQG
Q6H999_9VIRU/1-471LRFPFCSPQTGNTCISFQV.LNS.VYNNYLSI.......................NTFNNDNSDSKLKEFLNKAFPTTGT
Q99AR3_9VIRU/1-606FQYPFGSPLTNSPCCNFQV.LNS.NYDNAHSI........................LNLSNEPTNKWHTYRNNCYKFLLE
Q91PS7_9VIRU/1-585LRFPFCSPQTDNTCVNFQV.LSK.RFNTMLSI..........................SPDYPKKNYDSFVKTYLKNAQE
CAPSD_TTVV9/1-555LMHPWMAPFVNSPALTIYA.VNHKTYSDMSIL..........................PSNNQGSTKNELIETLYTAE..
Q9JG47_9VIRU/1-553LDRMYLSSSSVSTTMGFVS.LDTNGFMERYMK.DNGTAPYSPLTGQIIF.....AAPNGDNVITNIPLGQCILLGTV...
A7VLW0_9VIRU/1-507LRYPWLACCNENLIITLRY.LQPQFYHNSAWA............................QTTKE.........YNPV..
Q0ZLH9_9VIRU/1-573LRFPFGSPQTENYCIYFQV.LDP.WYHTRLSI..........................TGGKPAEYWTQLKAYLTQG...
Q5ENW7_9VIRU/1-501MQKPF...............DANGAFRNAWWL............................EQRNDQGEMKYIELWGRV..
A7VLX2_9VIRU/1-509FNYPRIGCCNVSQVMTIFF.LNPQFWGQTDWG............................QYMAHA..............
Q80AR5_9VIRU/1-594LKHPFCSPQTNNPCTTFQV.LRD.KYNDMIGF....................PFNYNPSDTNQTKTLQDFEKWLYSSS..
Q91CZ2_9VIRU/1-601FQHPFCRPLTDNPCVTFQV.LQN.FYNNVIGY...........................SSSDTLVDNVFTSLLYSKA..
CAPSD_TTVG1/1-514LRYPRIGCCNENRMITLYC.LNTKFYQDTEWG............................TTKQAPHY......FKP...
Q98Y63_9VIRU/1-581FIHPFCSPESDTICMTFQV.LRE.FYYTHLTV......................TPTTTTSTPEKDKKIFNDQLYSNA..
Q9QU36_9VIRU/1-529FDRYYTNSKAKSTTIGFIS.LNTLTFQYHNWQ.DPPTTGYKPQDNMWFW.....GTLNGSDDPNEEPLTNLIYLGGT...
A7VM12_9VIRU/1-509LRYSYLSASNENMLVNISS.LNPQWYVNTDWA............................RARQDTQG......YLP...
A7VLV6_9VIRU/1-508VPFVRIGCCNPSQVSTIYF.LNPQFYYDTDWG............................ATKNHA..............
Q9JG50_9VIRU/1-535LNNYWLSNNHLSNNISFWS.VNTRLFSNPNFQNTDSTVGYTPKDGVYLY......GTYNGTPTQNLTWMHMIYLGNT...
A7VLW4_9VIRU/1-507FSHANLSGKNQNMLVSLIS.LNLSFYKNPAWA............................QALTASG.......YKP...
A7VM04_9VIRU/1-513LNYVNLGCCNTNQMCTFFY.INPGFYQIANWG............................ATTTTG........YIP...
A7VLY4_9VIRU/1-498LNYPHIGATSQNQIITLFG.LNQSFYSKGNWG............................AVVQTG..............
CAPSD_TTVD1/1-324LDRPWMADISKPA....QT.IDPSTYDKK...................................................
Q91CZ6_9VIRU/1-596FQHPFCRPQTDNPCVTFQV.LQN.FYNKCIGT.........................SVNLSDSTFDSIFRDYLYKIG..
A7VM08_9VIRU/1-506FRYPTLGCCNENRILNLFA.LDTGFYQNVDWM............................QARQTGVG......YKP...
CAPSD_TTVV3/1-573LQYPFGSPQTDNVCVNFQI.LGQ.PYYQHLKT........................ALGLTEKTTYENHYKNNLYKKI..
Q91D00_9VIRU/1-593FRHPFCSPQTNNPCTTFQV.LRE.NYNEVLGL....................PYANTGSNNEVKIKIDNFENWLYNSS..
Q99AR5_9VIRU/1-604LRYPFCSPQTNNPNCTFQV.LRK.NYHKVIGT...........................SSTNSEDVTPFENWLYNTA..
Q9DTD2_9VIRU/1-559FTFPFGSPLTNTHCVNFQV.LGS.DYNDILSI...........................LPDKLKSKESKIEKIYKNI..
Q91D04_9VIRU/1-591FRHPFCPPQTDNICITFQV.LKD.FYYTQMSV........................TPDTAGQEKDIEIFEKHLFKNP..
CAPSD_TTVV8/1-571LQYPFGSPLTENYCISFQV.LGS.AYNNLISN...........................TLNPNEEQQDIKSAIYNNV..
Q5ENX0_9VIRU/1-603LKHPFGSPLTDTPCVSFQV.LGD.LYNECLNI..........DLPETEKDSLTKLKNSSTDEYSKNLQKLLQQLYTNG..
O90364_9VIRU/1-590IPYPFGSPLTDSVVVNFQV.LQS.MYDKYISI...........................LPDQKSQSKSLLSNIANYI..
Q9IFV0_9VIRU/1-583LRFPFCSPQTGNICIYFQI.LDPYWYNRRMSI..........................TPDLLKSNYESFFSVLNTK...
Q9QUE7_9VIRU/1-586MQYPFGSPLTDTPVVTFQV.LRS.MYNDALST.......................LPSNFENASSPGQKLYKEISTYL..
A8DMR2_9VIRU/1-531LDRYYTSANSISSTIGFAS.INTTIFQYSDFKSPNLTQPYKPNDEYWLRT....WTNQTITNFSAVETQRVILLGNT...
Q9DUH8_9VIRU/1-609FMHPFGSPLTETPCVTFQV.LGD.LYNKCLNIDLPKVDTVKNASSPHTKIQVKLTDNSGNPTNKEAVKTLYEQLFSYG..
A7VLW8_9VIRU/1-511LNYPRLGCCNENRTLTLYY.INPYFYQYSDWG............................QVKEHANY......YKP...
Q99AQ3_9VIRU/1-582FTHPFCSPQTANPCITFQV.LKE.FYYQAMGY............................GTPETTMSTIWNTLYTTS..

PF00729

CAPSD_TBSVB/75-270.........EAMLRIPTD.-------------------------------------------------------------
CAPSD_MCMVK/21-224.........GPSIVMPQNR-------------------------------------------------------------
CAPSD_TCV/54-245.........GFILTVPTD.-------------------------------------------------------------
CAPSD_CARMV/50-246.........AKDLVIPVD.-------------------------------------------------------------
CAPSD_RCNMV/23-214.........KCSLTIPAD.-------------------------------------------------------------
CAPSD_TBSVC/75-270.........EAMLRVPTD.-------------------------------------------------------------
CAPSD_SCPMV/58-276VNNTKCPDTSRAITIALDT-------------------------------------------------------------
CAPSD_TNVD/51-265LNHKGSG..GESLVSTLDT-------------------------------------------------------------
CAPSD_CNV/66-261.........ITKLTVPTD.-------------------------------------------------------------
CAPSD_MNSV/68-263.........ENVLVVPCD.-------------------------------------------------------------
CAPSD_TNVA/60-273LNSNQGA..GSAIAVQLDV-------------------------------------------------------------
CAPSD_AMCV/75-270.........ERALWVPTD.-------------------------------------------------------------
CAPSD_CRV/72-266.........EGSLRVPVD.-------------------------------------------------------------

PF11729

Q0QVT6_9VIRU/1-348-SVNMNVQTTKQQDFTLNG-------------------------------------------------------------
Q68UN9_9VIRU/1-338-SRTVRPQYTRTLLWTSSG-------------------------------------------------------------
Q709G0_9VIRU/1-340-SRTVRPQYARTLLWTSTG-------------------------------------------------------------

PF00894

CAPSD_PEMVW/52-188---------KAADVVLLDT-------------------------------------------------------------
CAPSD_BLRV/59-196---------NTTIQSKINK-------------------------------------------------------------
CAPSD_BYDV1/61-199---------QSTLGSYINS-------------------------------------------------------------
Q65845_9LUTE/58-196---------QSALASYINS-------------------------------------------------------------
Q65869_9LUTE/35-172---------LSALSSTINE-------------------------------------------------------------
CAPSD_PLRV/70-208---------VSSLQSYVNK-------------------------------------------------------------
CAPSD_BYDVP/62-200---------QSALGSYINS-------------------------------------------------------------
CAPSD_BYDVN/67-204---------ASSLASTINK-------------------------------------------------------------
Q65868_9LUTE/34-170---------LSTLASTINQ-------------------------------------------------------------
Q08391_9LUTE/63-200---------YSEIQSLLNK-------------------------------------------------------------
Q65970_9LUTE/62-199---------LSSLQSTINK-------------------------------------------------------------
Q65880_9LUTE/60-197---------LSTLGSTINK-------------------------------------------------------------
CAPSD_TYYVF/65-202---------LNSLSSTINK-------------------------------------------------------------

PF03014

Q8V729_HEV/41-660---------ASELVIPSER-------------------------------------------------------------
CAPSD_AHEV/13-604---------AGLLTIPHER-------------------------------------------------------------

PF00983

COAT_CAYMV/7-177---------TSPIIVPC---------------------------------------------------------------
Q65665_BMDV/8-179---------SQIIRVPC---------------------------------------------------------------
COAT_ELV/19-190---------SSPAKVSA---------------------------------------------------------------
COAT_BMDV/8-181---------AKTIEVPL---------------------------------------------------------------
O09737_9VIRU/7-178---------LSSIHVPC---------------------------------------------------------------
COAT_EPMV/8-179---------TKPLTIPL---------------------------------------------------------------
COAT_OYMV/8-179---------NQIISFPL---------------------------------------------------------------
COAT_KYMVJ/7-178---------LSPIDVPC---------------------------------------------------------------
COAT_TYMV/7-178---------LSPLIVKC---------------------------------------------------------------

PF00073

POLG_ENMGO/159-361--------------------------------------------------------------------------------
POLG_POL1M/92-308--------------------------------------------------------------------------------
POLG_POL1M/630-806--------------------------------------------------------------------------------
POLG_POL3L/92-307--------------------------------------------------------------------------------
POLG_HRV14/91-299--------------------------------------------------------------------------------
POLG_HRV14/610-795--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_EMCV/420-624--------------------------------------------------------------------------------
POLG_FMDVO/308-475--------------------------------------------------------------------------------
POLG_FMDVO/533-693--------------------------------------------------------------------------------
POLG_FMDVO/725-887--------------------------------------------------------------------------------
POLG_FMDV1/308-475--------------------------------------------------------------------------------
POLG_FMDV1/533-694--------------------------------------------------------------------------------
POLG_FMDV1/726-886--------------------------------------------------------------------------------
POLG_FMDVI/11-170--------------------------------------------------------------------------------
POLG_CXB3N/92-302--------------------------------------------------------------------------------
POLG_CXB3N/360-530--------------------------------------------------------------------------------
POLG_CXB3N/630-790--------------------------------------------------------------------------------
POLG_HRV2/92-302--------------------------------------------------------------------------------
POLG_HRV2/358-526--------------------------------------------------------------------------------
POLG_HRV2/610-772--------------------------------------------------------------------------------
POLG_HRV8A/92-302--------------------------------------------------------------------------------
POLG_HRV8A/364-533--------------------------------------------------------------------------------
POLG_HRV8A/617-801--------------------------------------------------------------------------------
POLG_CXB1J/360-528--------------------------------------------------------------------------------
POLG_CXB4J/92-300--------------------------------------------------------------------------------
POLG_CXB4J/358-528--------------------------------------------------------------------------------
POLG_CXB4J/607-796--------------------------------------------------------------------------------
POLG_TMEVB/169-382--------------------------------------------------------------------------------
POLG_TMEVB/443-648--------------------------------------------------------------------------------
POLG_BOVEV/92-285--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_BOVEV/606-778--------------------------------------------------------------------------------
POLG_HRV1B/92-301--------------------------------------------------------------------------------
POLG_HRV1B/360-529--------------------------------------------------------------------------------
POLG_HRV1B/627-794--------------------------------------------------------------------------------
POLG_SVDVU/608-791--------------------------------------------------------------------------------
POLG_FMDVT/308-475--------------------------------------------------------------------------------
POLG_CXA9/90-300--------------------------------------------------------------------------------
POLG_CXA9/358-526--------------------------------------------------------------------------------
POLG_CXA9/608-791--------------------------------------------------------------------------------
POLG_CXA21/90-308--------------------------------------------------------------------------------
POLG_CXA21/369-540--------------------------------------------------------------------------------
POLG_CXA21/642-821--------------------------------------------------------------------------------
POLG_HE701/92-288--------------------------------------------------------------------------------
POLG_HE701/347-517--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------
Q9WMA0_9PICO/45-215--------------------------------------------------------------------------------
POLG_AEVCA/41-212--------------------------------------------------------------------------------

PF00915

CAPSD_FCVC6/107-396--------------------------------------------------------------------------------
Q83876_9CALI/2-295--------------------------------------------------------------------------------
CAPSD_SOUV3/2-296--------------------------------------------------------------------------------
CAPSD_LORDV/2-291--------------------------------------------------------------------------------
O09725_9CALI/267-560--------------------------------------------------------------------------------
Q66418_9CALI/2-296--------------------------------------------------------------------------------
Q66296_9CALI/2-291--------------------------------------------------------------------------------
CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
Q80RD6_9CALI/2-291--------------------------------------------------------------------------------
CAPSD_SMSV1/137-427--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF01829

CAPSD_BBV/50-407G---------------------IYPTSNLMQFA----------------------GSITVWKCPVK..LSN---------
CAPSD_NODAM/42-399G---------------------VYPTSNLMQFA----------------------GSIQVYKIPLKQVLNS---------
CAPSD_BOOLV/36-403G---------------------LYPTCNSTQYN----------------------GGISVWKGAVQ..MST---------

PF03566

Q80IX5_9VIRU/54-754SASNAIFQPSNTVARIVWSITPLPVATVALTTGTGGTNNTSGKFFSVEIDGNV..NSVWTFTAPASILAEG........E
Q4TVU2_9VIRU/1-642HPFNVTRPGIAAGVTLTWA..SMPPGGSAPSGDPAWIPDSTTQF.QWRHGGFDAPTGVITYTIPRGYTMQYFDTTTNEWN
Q9YK87_9VIRU/108-757GWSRLYSVTASTV.....AITYIQPGVGGAQNQRTVTLNRSGSVIN.........SSV.LPQVTQGYRFNN........G
CAPSD_NCBVS/1-608GGT...................LQLGGSGPNYTLTMTIGDQVEFGG.........AAIPLPTVSMGPMPES........G
CAPSD_HASV/2-647HTLTFARPSSAAALAFVWA..GLPQGGTAPAGTPAWEQASSGGYLTWRHNGTTFPAGSVSYVLPEGFALERYDPNDGSWT

PF01766

POLS_BSNV/6-428----------------------.VQVGTTDTKTNGFNIDATT-------------PTEVTVDMQIAQIAAG---------
Q9IP80_IBDV/8-452----------------------QYQTGGVTITLFSANIDAIT-------------SLSIGGELVFQTSVQD---------
POLS_DXV96/1-442----------------------.VPGQGFHNKEFSINVDSVG-------------PVDILWSGQMTMQDEW---------
O55651_9VIRU/4-453----------------------TVPATGTLTTMYEGNADIVN-------------STTVTGDISFRLDQDP---------

PF00760

CAPSD_PSVJ/7-215--------------------------------------------------------------------------------
CAPSD_CMVKI/12-216--------------------------------------------------------------------------------
CAPSD_TAV/7-216--------------------------------------------------------------------------------
CAPSD_CMVC/11-216--------------------------------------------------------------------------------

PF01318

CAPSD_CCMV/2-190--------------------------------------------------------------------------------
CAPSD_BMV/2-188--------------------------------------------------------------------------------
CAPSD_BBMV/2-190--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226----------------------------------YDPYVNYSSRH-----------------------------------
Q27W03_PCV1/5-227----------------------------------YDPYINYSSRH-----------------------------------
A3FEQ4_9CIRC/3-256----------------------------------IDPYGSTSSRR-----------------------------------
Q3HUU1_GOCV/5-247----------------------------------VDPYAAMSSRK-----------------------------------
Q1L2D2_9CIRC/1-237----------------------------------DDPLANWDGAL-----------------------------------
CAPSD_CACV/7-243----------------------------------ADPLANWDGAR-----------------------------------
Q0H9S8_9CIRC/4-236----------------------------------TDPLANWDGAR-----------------------------------
Q06J73_9CIRC/8-245----------------------------------VDPLANWDGAR-----------------------------------
Q9DXG3_BFDV/11-242----------------------------------QDPLAPFDGAK-----------------------------------
Q69EZ5_BFDV/7-239----------------------------------QDPLAPFDGAR-----------------------------------
Q9DXG0_BFDV/11-242----------------------------------QDPLAPFDGAK-----------------------------------
Q9DXF4_BFDV/3-235----------------------------------QDPLAPFDGAR-----------------------------------

PF02956

A7VLZ2_9VIRU/1-506.......................YRIVEPVTEV.EDVKGNKKTIT....T..............................
Q9WT88_9VIRU/1-603.....................SHYQTFATEAQLGRIPAFNPDGTK....NTKQQSWQDNWSKKNSPWTGNSGTYP...QT
Q91CY9_9VIRU/1-581.....................EYWQSHHTAARL.STSQKPALRNK....EEIPNDHGYLNTTPTDSTFRTG.........
A7VLY0_9VIRU/1-515.......................YNAWPHTKGL.TFWTIDSKGNK....TPHSI..........................
Q9JGT1_9VIRU/1-585.....................PYYNTTQTQAQL.KRYIDNQST..........TDTWNSYLNTKKFSTNESPKTD...IN
Q80QT8_9VIRU/1-595.....................THYQTFATDTRL.APQTTSKYKPD....GQPLTSSELTWDQSAFNSFKTK.........
CAPSD_TTVB1/1-533.....................TNYTDGKKYNTS.GTTPLDLFKTE....NKPY...........................
A7VM00_9VIRU/1-509.......................GHLHPMPETL.TFKGKIDNREYTWNMSPF............................
Q9JG61_9VIRU/1-534.....................QLYKKEHNTNGTDWTTNFSDLSQP....NK.............................
Q91PS3_9VIRU/1-581HWHSNQRKGTMANYDSRDRVGVVFNTFKTQEHI.QNPNFQTDKEQ....VSTPYTYDT......................
CAPSD_TTVV4/1-560L....................TVFNTFKTQEHM.QEPSSETCKET....QKTNPPFKYEN....................
Q91C93_9VIRU/1-546.....................NLLTLGTKIQDA.CPSSTENEWKN....QFEKYLQTEKN....................
Q2F827_9VIRU/1-589.....................CYFETFQTIAQL.NPGFKAAKKTT....NGSGSTAATLGDAVTELKNPNGTFYT...G.
Q91CY5_9VIRU/1-584.....................TFFETTQVIAQL.SPSFAPAYKPN....GTNNNTHKPLGGMVPELKYNNAGFHT...G.
Q8V7G9_9VIRU/1-572.....................KLLPSNNTKDEW.QYAYTPL..............MKTFYTQAANTAAHNI.........
Q99A78_9VIRU/1-584.....................PNYNTTQTLAQL.KPYIDNTSTGS........TNNWSSYVNTSKFTTASKTITT.....
Q6H9C2_9VIRU/1-573.....................ELYNTFQTIAQL.KETGNISGITPTWTEVQNSTTLNQAGNNATDS..............
CAPSD_TTVT1/1-433................................................................................
Q9JG80_9VIRU/1-589.....................SYWESNITPFYV.INVKKGSNTAD....YLSPQITDSNFRKK.................
A7VLZ6_9VIRU/1-506.......................YRPSNEINTV.YYKDKTGNKKQ....IGP..FNT.......................
Q6H9D2_9VIRU/1-557.....................TLFNTFKTPEMI.KCPAAGKAPET....GDISTNCYKK.....................
Q6H999_9VIRU/1-471KGTSL................NALNTFRTEGCI.SHPQLKKPNPQ....INKPLDSQYFAP...................
Q99AR3_9VIRU/1-606QY...................SYYNTKQVVAQL.KYKWNPNQNPT....MPNTSNASLSKKPDDLTKTKTTNEYP...H.
Q91PS7_9VIRU/1-585HWNQN.KKGTLDNYNDPNRLLTVFNTFKTEEHL.YDPSAKETKNT....TNTDAAGNKYNT...................
CAPSD_TTVV9/1-555.....................HTYNPMAQRIWG.NIKPQNTNF.....................................
Q9JG47_9VIRU/1-553.....................TDYTPGTQLSSI.TLNTGALSPPS....DWGTFKSASKAIYNAYYQHKY..........
A7VLW0_9VIRU/1-507.......................YGTQPMKKTL.TFNYIIGNQRGTYTMSNS............................
Q0ZLH9_9VIRU/1-573.WGRS....TNNAGYQHGPLGTYFNTLKTSEHI.RQPPADNYKQA....NKDTTYYGR......................
Q5ENW7_9VIRU/1-501.....................PPQGDSELPKKK.EFSTGTDNPNY....NVQDNEEKNIYPIIIYVDQKDQ.........
A7VLX2_9VIRU/1-509.......................YMNIATGVAL.TGTYKDKQDKP....QNITVGDYT......................
Q80AR5_9VIRU/1-594.....................THYQTFATEANL.RPRQYNADGGA....NPNYAQLQSKWTTTIYAKK............
Q91CZ2_9VIRU/1-601.....................SFWQSHLTPSYV.KKINNNPDGSSISQRVGTMPDMTEYNKWVSNTNIGTGFVNS...N.
CAPSD_TTVG1/1-514.......................YATINKSMIFVSNYGGKKTEYN....IGQWIETDIPGEG..................
Q98Y63_9VIRU/1-581.....................NFYQSLHASAFL.NIAQAPAIHGH....NGIPNNSRYLSSTGTETSFRTG.........
Q9QU36_9VIRU/1-529.....................NNHTKGIPVKNQ.SNYASQPNM.....................................
A7VM12_9VIRU/1-509.......................QPNM..NKSL.SYKNKTKGGSE....TTTQMPST.......................
A7VLV6_9VIRU/1-508.......................YMYIRTGVSL.TGTYKGKDGKD....HEKIIGEWKKM....................
Q9JG50_9VIRU/1-535.....................HKYQQGLAPIDMSGPTSNQIKALH....EKQN...........................
A7VLW4_9VIRU/1-507.......................YDNIPSDLPF.VVKQANKEVQKYMKPQ..............................
A7VM04_9VIRU/1-513.......................YSGYPTATIY.TWNYKQWQTGQ....GGQ..PFT.......................
A7VLY4_9VIRU/1-498.......................YQPYPSVTTF.TYKTAATKQVE....TFN............................
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596.....................SFYQQVLVPSYI.KRITHNPDGST....GGTLSTLTAYNEWVTGTGP.NKFIPG...N.
A7VM08_9VIRU/1-506.......................YSTIDKRLTF.HYKTATGSSTVQV.................................
CAPSD_TTVV3/1-573.....................KFYNTTETIAQL.KPLVDATTNQT....WSHYVNPNKLTTTPTSEITH...........
Q91D00_9VIRU/1-593.....................VHYQTFQTEQMF.RPKQYNADGST....WKDYKSMLSTWTSQIYNKK............
Q99AR5_9VIRU/1-604.....................SHYQTFATEAQVGRIPSFNPDGTK....NTKESEWQNYWSKKGEPWNPNSSYPH...TT
Q9DTD2_9VIRU/1-559.....................AYYNTKQTIAHL.KITDNCKNTQT....DITNTKH........................
Q91D04_9VIRU/1-591.....................QFYQTVHTQGII.SKTRRTAKFSTSNNTLGSDTNITPYLEQPTATNHKNTLSTG.....
CAPSD_TTVV8/1-571.....................NAYLTRITESHM.ANLISKAPPKQ....VLKSSDGSLQTDH..................
Q5ENX0_9VIRU/1-603.....................QYWQTFITGPFIKDTMQANNYQQK....KTNYTKTNFYTTRDATGDTAFVSN.......
O90364_9VIRU/1-590.....................PFYNTTQTIAQL.KPFIDAGNITS.....GTAATTWGSYINTTKFTTTATTTYTYPGTT
Q9IFV0_9VIRU/1-583.FSSSPLYPNVATTVPSGPIGTVFNTFKTQEHV.VDPRWDTVKKQ....STGSQWSNTF.....................
Q9QUE7_9VIRU/1-586.....................PYYNTTETIAQL.KRYVENTEKNG.....TTPNPWQSKYVNTTAFTTALNVTTE.....
A8DMR2_9VIRU/1-531.....................NDYQPGEPMGDE.KAHYEDYFKTK....TK.............................
Q9DUH8_9VIRU/1-609.....................QYWQTFITDFMT.ANPPKYDNGNN....KKLFNDNDYNTFKTTFLTK............
A7VLW8_9VIRU/1-511.......................YNSIADLEFW.SGNTKNPTKYK....PKDEIEKATDPP...................
Q99AQ3_9VIRU/1-582.....................TYWQSHLTPQFV.RMPKNNPDNTA....NTEANKFNEWVDKTFKTG.............

PF00729

CAPSD_TBSVB/75-270--------------------------------------------------------------------------------
CAPSD_MCMVK/21-224--------------------------------------------------------------------------------
CAPSD_TCV/54-245--------------------------------------------------------------------------------
CAPSD_CARMV/50-246--------------------------------------------------------------------------------
CAPSD_RCNMV/23-214--------------------------------------------------------------------------------
CAPSD_TBSVC/75-270--------------------------------------------------------------------------------
CAPSD_SCPMV/58-276--------------------------------------------------------------------------------
CAPSD_TNVD/51-265--------------------------------------------------------------------------------
CAPSD_CNV/66-261--------------------------------------------------------------------------------
CAPSD_MNSV/68-263--------------------------------------------------------------------------------
CAPSD_TNVA/60-273--------------------------------------------------------------------------------
CAPSD_AMCV/75-270--------------------------------------------------------------------------------
CAPSD_CRV/72-266--------------------------------------------------------------------------------

PF11729

Q0QVT6_9VIRU/1-348--------------------------------------------------------------------------------
Q68UN9_9VIRU/1-338--------------------------------------------------------------------------------
Q709G0_9VIRU/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PEMVW/52-188--------------------------------------------------------------------------------
CAPSD_BLRV/59-196--------------------------------------------------------------------------------
CAPSD_BYDV1/61-199--------------------------------------------------------------------------------
Q65845_9LUTE/58-196--------------------------------------------------------------------------------
Q65869_9LUTE/35-172--------------------------------------------------------------------------------
CAPSD_PLRV/70-208--------------------------------------------------------------------------------
CAPSD_BYDVP/62-200--------------------------------------------------------------------------------
CAPSD_BYDVN/67-204--------------------------------------------------------------------------------
Q65868_9LUTE/34-170--------------------------------------------------------------------------------
Q08391_9LUTE/63-200--------------------------------------------------------------------------------
Q65970_9LUTE/62-199--------------------------------------------------------------------------------
Q65880_9LUTE/60-197--------------------------------------------------------------------------------
CAPSD_TYYVF/65-202--------------------------------------------------------------------------------

PF03014

Q8V729_HEV/41-660--------------------------------------------------------------------------------
CAPSD_AHEV/13-604--------------------------------------------------------------------------------

PF00983

COAT_CAYMV/7-177--------------------------------------------------------------------------------
Q65665_BMDV/8-179--------------------------------------------------------------------------------
COAT_ELV/19-190--------------------------------------------------------------------------------
COAT_BMDV/8-181--------------------------------------------------------------------------------
O09737_9VIRU/7-178--------------------------------------------------------------------------------
COAT_EPMV/8-179--------------------------------------------------------------------------------
COAT_OYMV/8-179--------------------------------------------------------------------------------
COAT_KYMVJ/7-178--------------------------------------------------------------------------------
COAT_TYMV/7-178--------------------------------------------------------------------------------

PF00073

POLG_ENMGO/159-361-----------------------------------------------------------------------------HQF
POLG_POL1M/92-308-----------------------------------------------------------------------------HQI
POLG_POL1M/630-806-----------------------------------------------------------------------------SIF
POLG_POL3L/92-307-----------------------------------------------------------------------------HQI
POLG_HRV14/91-299-----------------------------------------------------------------------------HQF
POLG_HRV14/610-795-----------------------------------------------------------------------------SVF
POLG_EMCV/161-359-----------------------------------------------------------------------------HQF
POLG_EMCV/420-624-----------------------------------------------------------------------------YAI
POLG_FMDVO/308-475-----------------------------------------------------------------------------HQF
POLG_FMDVO/533-693-----------------------------------------------------------------------------HAE
POLG_FMDVO/725-887-----------------------------------------------------------------------------TNP
POLG_FMDV1/308-475-----------------------------------------------------------------------------HQF
POLG_FMDV1/533-694-----------------------------------------------------------------------------HAE
POLG_FMDV1/726-886-----------------------------------------------------------------------------SNP
POLG_FMDVI/11-170-----------------------------------------------------------------------------ANP
POLG_CXB3N/92-302-----------------------------------------------------------------------------HQW
POLG_CXB3N/360-530-----------------------------------------------------------------------------HVI
POLG_CXB3N/630-790-----------------------------------------------------------------------------SVF
POLG_HRV2/92-302-----------------------------------------------------------------------------HQF
POLG_HRV2/358-526-----------------------------------------------------------------------------HVI
POLG_HRV2/610-772-----------------------------------------------------------------------------SVF
POLG_HRV8A/92-302-----------------------------------------------------------------------------HQY
POLG_HRV8A/364-533-----------------------------------------------------------------------------HLV
POLG_HRV8A/617-801-----------------------------------------------------------------------------SVF
POLG_CXB1J/360-528-----------------------------------------------------------------------------HVI
POLG_CXB4J/92-300-----------------------------------------------------------------------------HQW
POLG_CXB4J/358-528-----------------------------------------------------------------------------HVI
POLG_CXB4J/607-796-----------------------------------------------------------------------------SIF
POLG_TMEVB/169-382-----------------------------------------------------------------------------HQI
POLG_TMEVB/443-648-----------------------------------------------------------------------------YAI
POLG_BOVEV/92-285-----------------------------------------------------------------------------HQW
POLG_BOVEV/345-515-----------------------------------------------------------------------------HVV
POLG_BOVEV/606-778-----------------------------------------------------------------------------SVF
POLG_HRV1B/92-301-----------------------------------------------------------------------------HQF
POLG_HRV1B/360-529-----------------------------------------------------------------------------HVV
POLG_HRV1B/627-794-----------------------------------------------------------------------------SIF
POLG_SVDVU/608-791-----------------------------------------------------------------------------SVF
POLG_FMDVT/308-475-----------------------------------------------------------------------------HQF
POLG_CXA9/90-300-----------------------------------------------------------------------------HQW
POLG_CXA9/358-526-----------------------------------------------------------------------------HII
POLG_CXA9/608-791-----------------------------------------------------------------------------SIF
POLG_CXA21/90-308-----------------------------------------------------------------------------HQI
POLG_CXA21/369-540-----------------------------------------------------------------------------HII
POLG_CXA21/642-821-----------------------------------------------------------------------------SIF
POLG_HE701/92-288-----------------------------------------------------------------------------HQW
POLG_HE701/347-517-----------------------------------------------------------------------------HVV
POLG_HE701/609-781-----------------------------------------------------------------------------SVF
POLG_CXA24/646-809-----------------------------------------------------------------------------SVF
Q9WMA0_9PICO/45-215-----------------------------------------------------------------------------HGL
POLG_AEVCA/41-212-----------------------------------------------------------------------------HGK

PF00915

CAPSD_FCVC6/107-396-----------------------------------------------------------------------------HVL
Q83876_9CALI/2-295-----------------------------------------------------------------------------HVI
CAPSD_SOUV3/2-296-----------------------------------------------------------------------------HVI
CAPSD_LORDV/2-291-----------------------------------------------------------------------------HII
O09725_9CALI/267-560-----------------------------------------------------------------------------HAF
Q66418_9CALI/2-296-----------------------------------------------------------------------------HVI
Q66296_9CALI/2-291-----------------------------------------------------------------------------HVI
CAPSD_VESVA/137-421-----------------------------------------------------------------------------HVL
POLG_RHDVF/1768-2065-----------------------------------------------------------------------------HVV
Q80RD6_9CALI/2-291-----------------------------------------------------------------------------HVI
CAPSD_SMSV1/137-427-----------------------------------------------------------------------------HVL

PF08762

Q8B107_ALPV/599-804-----------------------------------------------------------------------------..Y
O56051_9VIRU/590-790-----------------------------------------------------------------------------..F
Q56QP7_9VIRU/684-855-----------------------------------------------------------------------------..M
O36967_9VIRU/668-900-----------------------------------------------------------------------------MTY
Q5UBY1_9VIRU/79-259-----------------------------------------------------------------------------..I
Q6ITS9_9VIRU/106-313-----------------------------------------------------------------------------LAI
Q4JFT2_9VIRU/834-1009-----------------------------------------------------------------------------MHY

PF01829

CAPSD_BBV/50-407--------------------VQFPVAT------TP------------------------------------------AT.
CAPSD_NODAM/42-399--------------------YSQTVAT------VP------------------------------------------PTN
CAPSD_BOOLV/36-403--------------------TQYPLDT------TP------------------------------------------ES.

PF03566

Q80IX5_9VIRU/54-754PFAEEGDTTSFSM...........TTI......TA------------------------------------------DTV
Q4TVU2_9VIRU/1-642GFANPDDVVTFGQ.TGGAAGTNATITI......TA------------------------------------------PTV
Q9YK87_9VIRU/108-757DTYAVGDTLRFQLTERDSGGYTVRLQR......SA------------------------------------------DGT
CAPSD_NCBVS/1-608QLVFQTANLTFDV......GNTITITT......TL------------------------------------------PPG
CAPSD_HASV/2-647DFASAGDTVTFRQ....VAVDEVVVTNNPAGGGSA------------------------------------------PTF

PF01766

POLS_BSNV/6-428---------------------------------.K------------------------------------------TLT
Q9IP80_IBDV/8-452---------------------------------.L------------------------------------------VLG
POLS_DXV96/1-442---------------------------------TV------------------------------------------TAN
O55651_9VIRU/4-453---------------------------------.P------------------------------------------NDT

PF00760

CAPSD_PSVJ/7-215-----------------------------------------------------------------------------PNG
CAPSD_CMVKI/12-216-----------------------------------------------------------------------------ASG
CAPSD_TAV/7-216-----------------------------------------------------------------------------PTG
CAPSD_CMVC/11-216-----------------------------------------------------------------------------ASG

PF01318

CAPSD_CCMV/2-190-----------------------------------------------------------------------------PEA
CAPSD_BMV/2-188-----------------------------------------------------------------------------TDA
CAPSD_BBMV/2-190-----------------------------------------------------------------------------VDG

PF02247

POL2_SQMVM/246-618-----------------------------------------------------------------------------VIS
POL2_CPMVS/460-832-----------------------------------------------------------------------------WIS
POL2_BPMV/447-819-----------------------------------------------------------------------------VLS
Q9Z006_9SECO/476-846-----------------------------------------------------------------------------YCG
O12663_9SECO/321-691-----------------------------------------------------------------------------YCG
Q9YWK0_9SECO/363-735-----------------------------------------------------------------------------VIS
POL2_CPSMV/437-806-----------------------------------------------------------------------------ILS
POL2_RCMV/407-778-----------------------------------------------------------------------------FLS
Q9YWJ9_9SECO/452-824-----------------------------------------------------------------------------VIS
Q66170_CPMVS/343-715-----------------------------------------------------------------------------WIS

PF03391

CAPSD_TRSV/179-344-----------------------------------------------------------------------------VMS
POL2_RRVS/768-936-----------------------------------------------------------------------------VAA
POL2_BRAV/1268-1433-----------------------------------------------------------------------------YAL
Q65029_ARMV/745-916-----------------------------------------------------------------------------LLS
POL2_ARMVS/792-963-----------------------------------------------------------------------------LLS
Q67703_GFLV/166-336-----------------------------------------------------------------------------LVS
POL2_GFLV/771-941-----------------------------------------------------------------------------LVS
POL2_BRSV/1007-1170-----------------------------------------------------------------------------LLS
POL2_GCMV/981-1144-----------------------------------------------------------------------------LLS
POL2_TORVR/1497-1662-----------------------------------------------------------------------------LLR
Q88483_9SECO/1003-1166-----------------------------------------------------------------------------VLS

PF02443

Q5Y4T0_PCV2/5-226-----------------------------------------------------------------------------TIP
Q27W03_PCV1/5-227-----------------------------------------------------------------------------TIR
A3FEQ4_9CIRC/3-256-----------------------------------------------------------------------------TWD
Q3HUU1_GOCV/5-247-----------------------------------------------------------------------------TWS
Q1L2D2_9CIRC/1-237-----------------------------------------------------------------------------KWD
CAPSD_CACV/7-243-----------------------------------------------------------------------------KWD
Q0H9S8_9CIRC/4-236-----------------------------------------------------------------------------QWD
Q06J73_9CIRC/8-245-----------------------------------------------------------------------------KWT
Q9DXG3_BFDV/11-242-----------------------------------------------------------------------------KWF
Q69EZ5_BFDV/7-239-----------------------------------------------------------------------------KWY
Q9DXG0_BFDV/11-242-----------------------------------------------------------------------------KWY
Q9DXF4_BFDV/3-235-----------------------------------------------------------------------------KWY

PF02956

A7VLZ2_9VIRU/1-506.........VFTPYTE.............................................................TIT
Q9WT88_9VIRU/1-603TSEMYKIP.YDSNFGFPTYR.........AQKDYILER..RQCNFNYEV....NNPVSKKVWPQPSTTTPTVD....YYE
Q91CY9_9VIRU/1-581.........NNTIYGQPSYR.........PNYTKLTKI..REWYFTQEN.........TDNPIHGSYLKPTLN....SVD
A7VLY0_9VIRU/1-515.........KPQNYNQ.............................................................SVN
Q9JGT1_9VIRU/1-585SIGGPYTTYSDTWYKGTAYIQ.........KITEVPPK..AAELYYKQT...........EQLIGATFTGSTR....YLH
Q80QT8_9VIRU/1-595.........ADSNYGYCTYNPNGST....QLVEKIKGY..RNQRFRWLT......SYTGTNHINDTFAKGKHQ....EYE
CAPSD_TTVB1/1-533.........WGNVFTNLNQDQ........................................................DVI
A7VM00_9VIRU/1-509.........ISDKYTN.............................................................SLN
Q9JG61_9VIRU/1-534.........WANPFSYSAHEETN......................................................DVQ
Q91PS3_9VIRU/1-581.........VTSLWGDYVYKES........IIDSFKTN..ATNYYNSRK..............GTQITASK......FLN
CAPSD_TTVV4/1-560.........LSSLWGDKIYKES........TFNSFKTN..AENLWKARS..............KHTLLGSK......ELN
Q91C93_9VIRU/1-546.........WGNPFTPEYLDED.......................................................NYN
Q2F827_9VIRU/1-589.........NNSTFGCCTYK.........PTKEIGSNA..NKWFWHQLT........ATDSDTLGQYGRASIK....YME
Q91CY5_9VIRU/1-584.........NNPVFGMCKYK.........PSTLTMQNA..NKWFWENLQ.........VENDLQSKYGKANLT....CME
Q8V7G9_9VIRU/1-572.........TDKTYNWKNYK............THYDKV..QQTWTTKAQFNYDLVKEEYKTVYPTTATFPPEWSNRQYLE
Q99A78_9VIRU/1-584SAEGPYYTFADTWYRGTAYNN.........SITNVPLQ..AAQLYHDTT...........KKLLGTTFTGGSP....YLE
Q6H9C2_9VIRU/1-573.........RDTWYKGNTYNE.........KISELAQI..TRNRFKNAT..........KTALPNYPTIMSTD....LYE
CAPSD_TTVT1/1-433.............................................................................SYD
Q9JG80_9VIRU/1-589.........VNTNYNWYTYNAK.......SNKDNLHKL..RQAYFKQLT.SEGPQHTSSDNGYASQWTTPSTD....AYE
A7VLZ6_9VIRU/1-506.........TATAYDD.............................................................SVS
Q6H9D2_9VIRU/1-557.........LDSAWGDTIWNQN........TIANFKKN..TDNLWNAGH..............NQTMTGSK......YLN
Q6H999_9VIRU/1-471.........LDALWGDPIYY..........NDLNEKKS..LKDIIENILIKNMITYHEKLREFPNSYQGNK......AFC
Q99AR3_9VIRU/1-606.........WDTLYGGLAYGHSTVTPGTTSSPTDLKTQMLTGNEFYTTAGKKLIDTFHPIPYYENGSSKANTN....IFD
Q91PS7_9VIRU/1-585.........VTSLWGDYIYKET........VVDNFINN..AKNYFESRK..............GNIVMSNE......YLN
CAPSD_TTVV9/1-555.........TPENYWNKWNE..........IHTKIKTN..RQSELTQLKQMRKRLELTTENDYQDP...........NFG
Q9JG47_9VIRU/1-553.........WGNPFFTNWFHGD.......................................................QRM
A7VLW0_9VIRU/1-507.........DISDYDS.............................................................SVS
Q0ZLH9_9VIRU/1-573.........VDSHWGDHVYQQT........IIQAMEEN..QSNMYTKRA..............LHTFLGSQ......YLN
Q5ENW7_9VIRU/1-501.........KPRKKYCVCYNKTLNRWRLGQ...............................................AST
A7VLX2_9VIRU/1-509.........GENPYYS.............................................................SIN
Q80AR5_9VIRU/1-594.........TDSNFGYTSYNFSGD.....QGYKYVTEI..RQWYWTQLT.....SWTQTAPHINSTFANATHP....EFE
Q91CZ2_9VIRU/1-601.........VSVHYNYCQYN.........PNHTHLTTL..RQYYFFWET.HPAAANKTPVTHVPITTTKPTKD....WWE
CAPSD_TTVG1/1-514.........NLARYYR.............................................................SIS
Q98Y63_9VIRU/1-581.........NNSIYGQPNYK.........PIPEKLTEI..RKWFFKQAT.........TPNEIHGTYGKPTYD....AVD
Q9QU36_9VIRU/1-529.........WGNIFHEDYLFGT.......................................................SQI
A7VM12_9VIRU/1-509.........SFTSYSA.............................................................SVS
A7VLV6_9VIRU/1-508.........GEAQYYE.............................................................SIN
Q9JG50_9VIRU/1-535.........WGNPFHYNFANK........................................................QVR
A7VLW4_9VIRU/1-507.........ATTDYST.............................................................SIS
A7VM04_9VIRU/1-513.........KPQTYNQ.............................................................SVN
A7VLY4_9VIRU/1-498.........KPTTYEA.............................................................SVS
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596.........TSVHYNFCTYN.........PKYDNLKAL..RSYYFHWETVQSVATSNFNAQHVPITSTMPTKD....YWE
A7VM08_9VIRU/1-506.........DQSDETK.............................................................WLT
CAPSD_TTVV3/1-573.........NNTWYRGNAYND.........KITDLPEI..VKKSYYKAT...........ELAIPEAVKPTTD....LFE
Q91D00_9VIRU/1-593.........TDSNYGYASYDFS.......KGKEFATQM..RQHYWVQLT.....QLTATVPHIGPTYSNTTTP....EYE
Q99AR5_9VIRU/1-604TNQMYKIP.FDSNYGFPTYK.........PIKEYMLQR..RAWSFKYET....DNPVSKKIWPQPTTTKPTID....YYE
Q9DTD2_9VIRU/1-559.........NDTQYKGNTYVD.........EINQVRKD..TGDKFIKAT..........SLALSNSWVKPTTN....DLE
Q91D04_9VIRU/1-591.........NNSIYGLPSYN.........PIPDKLKKI..QEWFWKQET........DKENLVTGSYQTPTNK....SVS
CAPSD_TTVV8/1-571.........NDTQFGGNPYNTNQF......TTTTVNKIIQGAQNYLTTI........KTHLQPNNSAINPNTQW...HLE
Q5ENX0_9VIRU/1-603.........ADSNYLYATYHPE.......NIETKLYKI..RENYFQLSI....GKNDVFGDHTSQYRGATQ......LLE
O90364_9VIRU/1-590TNTVTMYSSNDSWYRGTVYNN.........QIKELPKK..AAELYSKAT...........KTLLGNTFTTEDC....TLE
Q9IFV0_9VIRU/1-583.........VDSHWGDHIYENTSSKS....ILTAMKDN..ATKMYDRRK..............RDTYLGSK......YLN
Q9QUE7_9VIRU/1-586...KPYTTFSDSWYRGTVYKE.........TITEVPLA..AAKLYQNQT...........KKLLSTTFTGGSE....YLE
A8DMR2_9VIRU/1-531.........WGNPFYAPYFEPEPQKIFMIK...............................................NLN
Q9DUH8_9VIRU/1-609.........KDSGYLFASYNPA.......QVAENIKNI..RDQNFALTT....GKNDVFGDSKAQYHNATH......LLD
A7VLW8_9VIRU/1-511.........STAKYYA.............................................................SIN
Q99AQ3_9VIRU/1-582.........KLVKYNYNQYK.........PDIEKLTLL..RQYYFRWET.......QHTGVAVPPTWTTPTTD....RYE

PF00729

CAPSD_TBSVB/75-270-----------------------------------------------------------------------------...
CAPSD_MCMVK/21-224-----------------------------------------------------------------------------TVF
CAPSD_TCV/54-245-----------------------------------------------------------------------------...
CAPSD_CARMV/50-246-----------------------------------------------------------------------------...
CAPSD_RCNMV/23-214-----------------------------------------------------------------------------...
CAPSD_TBSVC/75-270-----------------------------------------------------------------------------...
CAPSD_SCPMV/58-276-----------------------------------------------------------------------------NEV
CAPSD_TNVD/51-265-----------------------------------------------------------------------------NRV
CAPSD_CNV/66-261-----------------------------------------------------------------------------...
CAPSD_MNSV/68-263-----------------------------------------------------------------------------...
CAPSD_TNVA/60-273-----------------------------------------------------------------------------TKL
CAPSD_AMCV/75-270-----------------------------------------------------------------------------...
CAPSD_CRV/72-266-----------------------------------------------------------------------------...

PF11729

Q0QVT6_9VIRU/1-348-----------------------------------------------------------------------------SDV
Q68UN9_9VIRU/1-338-----------------------------------------------------------------------------KEQ
Q709G0_9VIRU/1-340-----------------------------------------------------------------------------KEQ

PF00894

CAPSD_PEMVW/52-188-----------------------------------------------------------------------------WNI
CAPSD_BLRV/59-196-----------------------------------------------------------------------------FSI
CAPSD_BYDV1/61-199-----------------------------------------------------------------------------FTI
Q65845_9LUTE/58-196-----------------------------------------------------------------------------FTI
Q65869_9LUTE/35-172-----------------------------------------------------------------------------FSI
CAPSD_PLRV/70-208-----------------------------------------------------------------------------FQI
CAPSD_BYDVP/62-200-----------------------------------------------------------------------------FTI
CAPSD_BYDVN/67-204-----------------------------------------------------------------------------FTI
Q65868_9LUTE/34-170-----------------------------------------------------------------------------ISI
Q08391_9LUTE/63-200-----------------------------------------------------------------------------FSI
Q65970_9LUTE/62-199-----------------------------------------------------------------------------FGI
Q65880_9LUTE/60-197-----------------------------------------------------------------------------FSI
CAPSD_TYYVF/65-202-----------------------------------------------------------------------------FGI

PF03014

Q8V729_HEV/41-660-----------------------------------------------------------------------------LHY
CAPSD_AHEV/13-604-----------------------------------------------------------------------------LAY

PF00983

COAT_CAYMV/7-177--------------------------------------------------------------------------------
Q65665_BMDV/8-179--------------------------------------------------------------------------------
COAT_ELV/19-190--------------------------------------------------------------------------------
COAT_BMDV/8-181--------------------------------------------------------------------------------
O09737_9VIRU/7-178--------------------------------------------------------------------------------
COAT_EPMV/8-179--------------------------------------------------------------------------------
COAT_OYMV/8-179--------------------------------------------------------------------------------
COAT_KYMVJ/7-178--------------------------------------------------------------------------------
COAT_TYMV/7-178--------------------------------------------------------------------------------

PF00073

POLG_ENMGO/159-361LNLRTNTTVDLEV--------------------------------------------PYVNIAPTSSWT.----------
POLG_POL1M/92-308INLRTNNCATLVL--------------------------------------------PYVNSLSIDSMV.----------
POLG_POL1M/630-806YTYGTAP.ARISV--------------------------------------------PYVGISNAYSHFY----------
POLG_POL3L/92-307INLRTNNSATIVL--------------------------------------------PYVNALAIDSMV.----------
POLG_HRV14/91-299INLRTNNTATIVI--------------------------------------------PYINSVPIDSMT.----------
POLG_HRV14/610-795FKVG..DTSRFSV--------------------------------------------PYVGLASAYNCFY----------
POLG_EMCV/161-359LNLRTNTTVDLEV--------------------------------------------PYVNIAPTSSWT.----------
POLG_EMCV/420-624WDLGLNSSYSFTV--------------------------------------------PFISPTHFRMVGT----------
POLG_FMDVO/308-475INPRTNMTAHITV--------------------------------------------PFVGVNRYDQYK.----------
POLG_FMDVO/533-693WDTGLNSKFTFSI--------------------------------------------PYLSAADYAYTAS----------
POLG_FMDVO/725-887TAYHKAPLTRLAL--------------------------------------------PYTAPHRVLATVY----------
POLG_FMDV1/308-475ISPRTNMTAHITV--------------------------------------------PYLGVNRYDQYK.----------
POLG_FMDV1/533-694WDTGLNSKFTFSI--------------------------------------------PYVSAADYAYTAS----------
POLG_FMDV1/726-886TAYNKAPFTRLAL--------------------------------------------PYTAPHRVLATVY----------
POLG_FMDVI/11-170TAYHKGPLTRLAL--------------------------------------------PYTAPHRVLATTY----------
POLG_CXB3N/92-302INLRTNNSATIVM--------------------------------------------PYTNSVPMDNMF.----------
POLG_CXB3N/360-530WDVGLQSSCVLCI--------------------------------------------PWISQTHYRFVAS----------
POLG_CXB3N/630-790W.TEGNAPPRMSI--------------------------------------------PFLSIGNAYSNFY----------
POLG_HRV2/92-302INLRSNNSATIIA--------------------------------------------PYVNAVPMDSMR.----------
POLG_HRV2/358-526WDVGLQSTISMVV--------------------------------------------PWISASHYRNTS.----------
POLG_HRV2/610-772WQHGQA.YPRFSL--------------------------------------------PFLSVASAYYMFY----------
POLG_HRV8A/92-302INLRTNNSATLIL--------------------------------------------PYVNAVPMDSML.----------
POLG_HRV8A/364-533WDVGLQSTASLVV--------------------------------------------PWVSASHFRFTT.----------
POLG_HRV8A/617-801WQEGQ.PYPRFTI--------------------------------------------PFMSIASAYYMFY----------
POLG_CXB1J/360-528WDVGLQSSCVLCV--------------------------------------------PWISQTHYRYVVE----------
POLG_CXB4J/92-300INLRTNNSATIVM--------------------------------------------PYINSVPMDNMF.----------
POLG_CXB4J/358-528WDVGLQSSCVLCV--------------------------------------------PWISQTHYRYVVD----------
POLG_CXB4J/607-796W.TEGNAPPRMSI--------------------------------------------PFMSIGNAYTMFY----------
POLG_TMEVB/169-382LNLRTNTTVDLEV--------------------------------------------PYVNVAPSSSWT.----------
POLG_TMEVB/443-648WDLGLNSSFNFTA--------------------------------------------PFISPTHYRQTSY----------
POLG_BOVEV/92-285INLRTNNSATLIL--------------------------------------------PYVNAIPMDSAI.----------
POLG_BOVEV/345-515WDFGLQSSITLVI--------------------------------------------PWISASHFRGVSN----------
POLG_BOVEV/606-778ADTD.GPPAQFSV--------------------------------------------PFMSSANAYSTVY----------
POLG_HRV1B/92-301INLRSNNSATLIV--------------------------------------------PYVNAVPMDSML.----------
POLG_HRV1B/360-529WDVGLQSTISLVV--------------------------------------------PWVSASHFRLTAN----------
POLG_HRV1B/627-794WQHGQ.PFPRFSL--------------------------------------------PFLSIASAYYMFY----------
POLG_SVDVU/608-791WTEGSAPP.RMSI--------------------------------------------PFIGIGNAYSMFY----------
POLG_FMDVT/308-475INPRTNMTAHITV--------------------------------------------PYVGVNRYDQYK.----------
POLG_CXA9/90-300INLRTNNSATIVM--------------------------------------------PYINSVPMDNMF.----------
POLG_CXA9/358-526WDIGLQSSCVLCV--------------------------------------------PWISQTHYRLVQQ----------
POLG_CXA9/608-791W.TEGNAPARMSI--------------------------------------------PFISIGNAYSNFY----------
POLG_CXA21/90-308INLRTNNSATIVV--------------------------------------------PYVNSLVIDCMA.----------
POLG_CXA21/369-540WDLGLQSSCSMVA--------------------------------------------PWISNTVYRRCAR----------
POLG_CXA21/642-821YMYG.NAPPRMSI--------------------------------------------PYVGIANAYSHFY----------
POLG_HE701/92-288INLRTNNSATIVL--------------------------------------------PWMNSAPMDFAL.----------
POLG_HE701/347-517WDFGLQSSITIII--------------------------------------------PWISGSHYRMFNT----------
POLG_HE701/609-781FKIN.DPPARLTI--------------------------------------------PFMSINSAYANFY----------
POLG_CXA24/646-809YTYGSAPP.RISI--------------------------------------------PYVGIANAYSHFY----------
Q9WMA0_9PICO/45-215LNCNINNVVRIKV--------------------------------------------PFIYTRGAYHFKD----------
POLG_AEVCA/41-212LNCNINNVVRMKV--------------------------------------------PYIYSRGCYNLRN----------

PF00915

CAPSD_FCVC6/107-396FDARQVEPVIFSI--------------------------------------------PDLRSTLYHLMS.----------
Q83876_9CALI/2-295ADVRTLDPIEVPL--------------------------------------------EDVRNVLFHNNDR----------
CAPSD_SOUV3/2-296ADVRTLEPIEMPL--------------------------------------------EDVRNVLYHTND.----------
CAPSD_LORDV/2-291VDVRQLEPVLIPL--------------------------------------------PDVRNNFYHYNQA----------
O09725_9CALI/267-560VDARVTDPVSFMI--------------------------------------------PDVRNIDYHRMDI----------
Q66418_9CALI/2-296ADVRVLEPIEVPL--------------------------------------------EDVRNVLFHNND.----------
Q66296_9CALI/2-291VDVRQLEPINLPM--------------------------------------------PDVRNNFFHYNQG----------
CAPSD_VESVA/137-421FDARQTEPVIFTI--------------------------------------------PDIRKTLFHSMD.----------
POLG_RHDVF/1768-2065IDARSLEPVTITM--------------------------------------------PDLRPNMYHPTGD----------
Q80RD6_9CALI/2-291IDVRTLEPVLLPL--------------------------------------------PDVRNNFFHYNQK----------
CAPSD_SMSV1/137-427FDARQTEPVIFTI--------------------------------------------PDIRKTLYHSMD.----------

PF08762

Q8B107_ALPV/599-804MPRNLEGTFEFQV--------------------------------------------PHYSRYPLLPNTA----------
O56051_9VIRU/590-790MTPN.EGIHELSI--------------------------------------------PYYSSY...PVTL----------
Q56QP7_9VIRU/684-855TYNNLNPVHEIMI--------------------------------------------PYYSQYRKIPIS.----------
O36967_9VIRU/668-900IDPEVEGFMEFEI--------------------------------------------PYYNISHISPATT----------
Q5UBY1_9VIRU/79-259TYPVLNPVHEVEV--------------------------------------------PYYCQYRKLPIAS----------
Q6ITS9_9VIRU/106-313EQIPIKGVAEFQI--------------------------------------------PYYA.....PCLS----------
Q4JFT2_9VIRU/834-1009INTSLNPMAQISL--------------------------------------------PYYS.....PAEN----------

PF01829

CAPSD_BBV/50-407.SALVHTLVGLDGVLAVGPDNFS-------------ESFIKGV-----------FSQSVCNEPDFEFSDILEGIQTL---
CAPSD_NODAM/42-399LAQNTIAIDGLEALDALPNNNYS-------------GSFIEGC-----------YSQSVCNEPEFEFHPIMEGYASV---
CAPSD_BOOLV/36-403.SQLVHAITGLESALKVGDENYS-------------ESFIDGV-----------FTQSINGNAEFPFYPILEGVQTL---

PF03566

Q80IX5_9VIRU/54-754VYSVSSSLTGSSVI..VRGVTKGSGVSITPVTVGIDTEAVNRL...SIEMPALTTEEVTTNVPKYEQFLCKESGGAYIVH
Q4TVU2_9VIRU/1-642TLTILATTTSAANVINFRNLDAET............TAASNRS...EVPLPPLTFGQTAPNNPKIEQTLVKDTLGSYLVH
Q9YK87_9VIRU/108-757TFTNIGPLSTTTGQ..NGGFNTDSG.....LGVLLEGDVLAGR.VNMLTLPPFTQSDLMQQTPKTCVFQIKE.GGFY.VR
CAPSD_NCBVS/1-608SVTGMWQFTASNGT..D.TVTVDAGARLYAFGANLDASELNLQDINSIKIPPTNMNQMMQATPKTIQFQLNETKGFY.MP
CAPSD_HASV/2-647TVRVPPSNAYTNTV..FRNTLLET............RPSSRRL...ELPMPPADFGQTVANNPKIEQSLLKETLGCYLVH

PF01766

POLS_BSNV/6-428VTVKLMGLTGAKVA--SRSETVS-------------GNG..GT-----------FHF.....STTAVFGETEITQPV-VG
Q9IP80_IBDV/8-452ATIYLIGFDGTTVI--TRAVASD-------------NGLTAGT-----------DNL....MPFNLVIPTNEITQPI-TS
POLS_DXV96/1-442YQPLNISGTLIANS--QRTLTWS-------------NTGVSNG-----------SHYMNMNNLNVSLFHENPPPEPV-AA
O55651_9VIRU/4-453KYDFQLDFLGLDNN--VPVVSIT-------------SYTLATT-----------DNYRGVSVKFTQSIPTETITKPI-TR

PF00760

CAPSD_PSVJ/7-215IQRDNKIIYDLSPVGT-----------------------------------------EIGDMSE-YAIIV----------
CAPSD_CMVKI/12-216VQANNKLLYDLSEMRA-----------------------------------------DIGDMRK-YAVLV----------
CAPSD_TAV/7-216IQPNNKITFDMSNVGA-----------------------------------------EIGDMGK-YALIV----------
CAPSD_CMVC/11-216VQANNKLLFDLSAMRA-----------------------------------------DIGDMRK-YAVLV----------

PF01318

CAPSD_CCMV/2-190FK------------GI-----------------------------------------TLEQLTADLTIYL----------
CAPSD_BMV/2-188FR------------GA-----------------------------------------TLGDLLN.LQIYL----------
CAPSD_BBMV/2-190FK------------DV-----------------------------------------SLGDLEKDLSIYL----------

PF02247

POL2_SQMVM/246-618LHRYFRGDFVFEITKMSS---------------------------------------PYIKATIAFFIAFGDIT------
POL2_CPMVS/460-832MWRYFRGELHFEVTKMSS---------------------------------------PYIKATVTFLIAFGNLS------
POL2_BPMV/447-819MWRYFVGDLVFEVSKMTS---------------------------------------PYIKCTVSFFIAFGNLA------
Q9Z006_9SECO/476-846LSQYIQSDVILDFTLMSS---------------------------------------PMIGGTFSIAYVAGAYI------
O12663_9SECO/321-691LSQYMQSDVILDFTLMSS---------------------------------------PMIGGTFSIAYVAGAYI------
Q9YWK0_9SECO/363-735LHRYFRGDFVFEITKMSS---------------------------------------PYIKATIAFFIAFGDIT------
POL2_CPSMV/437-806MWRYFKADLEFELIKMSS---------------------------------------PYINATIAFFVAFGDLS------
POL2_RCMV/407-778LWRYFHGDLVFEVQKMSS---------------------------------------PFIKSTVTFFIGFGGLP------
Q9YWJ9_9SECO/452-824LHRYFRGDFVFEITKMSS---------------------------------------PYIKATIAFFIAFGDIT------
Q66170_CPMVS/343-715MWRYFRGELHFEVTKMSS---------------------------------------PYIKATVTFLIAFGNLS------

PF03391

CAPSD_TRSV/179-344RNLGWSGTISGSVKSVSS---------------------------------------LFCTASFVIFPWECEAP------
POL2_RRVS/768-936HFRSWTGKVRMSIQEVSS---------------------------------------IFLTGTYMVGVSW.NAT------
POL2_BRAV/1268-1433FLQGHGGSLVGEVVHTGS---------------------------------------AAVSCALHLCISFGGAP------
Q65029_ARMV/745-916YYLGIGGIVKGKVHVCSP---------------------------------------CTYGIVLRVVSEWNGVT------
POL2_ARMVS/792-963YYLGIGGIVKGKVHVCSP---------------------------------------CTYGIVLRVVSEWNGVT------
Q67703_GFLV/166-336CVLGMGGTIRGKVHICAP---------------------------------------IFYSIVLWVVSEWNGTT------
POL2_GFLV/771-941CVLGMGGTVRGRVHICAP---------------------------------------IFYSIVLWVVSEWNGTT------
POL2_BRSV/1007-1170HFLGVGGTIHFVVRTTSS---------------------------------------AFVTSKLRIA.LW.GTV------
POL2_GCMV/981-1144HFLGIGGTIHFKIQCTSS---------------------------------------AFVTARLRVA.LW.GDT------
POL2_TORVR/1497-1662FFQGSNGTLHGRIKKIGT---------------------------------------ALTTCSLLLSLRHKDAS------
Q88483_9SECO/1003-1166HFLGVGGDIIFSVHSTAS---------------------------------------TFVSCSLRVA.LW.GTI------

PF02443

Q5Y4T0_PCV2/5-226QPFPYHSRYFTPKPVLDR---------------------------------------TIDYFQPN.NKRN----------
Q27W03_PCV1/5-227QPFTYHSRYFTPKPELDQ---------------------------------------TIDWFHPN.NKRN----------
A3FEQ4_9CIRC/3-256PSRIH.RRYFVPKP....---------------------------------------TIQGAGQG.STYS----------
Q3HUU1_GOCV/5-247PHRYH.KRVFIPKP....---------------------------------------TIQQGGTGTNIWS----------
Q1L2D2_9CIRC/1-237QRKGF.KRLVRPKPQL..---------------------------------------VITDLSTA.NETA----------
CAPSD_CACV/7-243LRKGF.KRLFKPRPQL..---------------------------------------SVTDTDAA.NVTA----------
Q0H9S8_9CIRC/4-236LRKGF.KRLFRPRPQI..---------------------------------------SITDTDAG.NVTA----------
Q06J73_9CIRC/8-245LRKGF.KRLFRPRPQL..---------------------------------------SVTDTDTA.NTTA----------
Q9DXG3_BFDV/11-242VSRGF.KRLLRPKPQI..---------------------------------------TIEDLTTA.NQSA----------
Q69EZ5_BFDV/7-239LSRGF.KRLLRPKPQI..---------------------------------------TLTDLTTA.NQSA----------
Q9DXG0_BFDV/11-242LSRGF.KRLLRPKPQI..---------------------------------------MMNDLSTA.NQSA----------
Q9DXF4_BFDV/3-235LNKGF.KRLLRPKPQI..---------------------------------------TINDLTTV.NQSA----------

PF02956

A7VLZ2_9VIRU/1-506YNKGWFQPALLQAKQITKPSQAN.............PPLKGAR-----------YN.PTLDTGENTAVWL.TNVVNQSYY
Q9WT88_9VIRU/1-603YHCGWFSNIFIGPNRY.NLQ.FQ.............TAYVDTT-----------YN.PLMDKGKGNKIWF.QYLSKKGTD
Q91CY9_9VIRU/1-581YHLGKYSAIFLSPYRT.NTQ.FD.............TAYQDVT-----------YN.PNTDKGKGNKIWI.QSCTKESTI
A7VLY0_9VIRU/1-515YLQGFFSQYVLQAQKITDADDNVPAKYEQYSAAMSTLLIAAFR-----------YN.PEEDTGQGNVVWLTSTLSNTHWE
Q9JGT1_9VIRU/1-585YTGGLYTSIWLSAGRS.YFE.TH.............GPDTDIT-----------YN.PFSDRGEGNMLWI.DWLTKEDSQ
Q80QT8_9VIRU/1-595YHLGWYSNIFLGNLRH.NLA.FS.............PAYIDIT-----------YN.PIVDKGQGNKVWF.QYLTKETTE
CAPSD_TTVB1/1-533IYYGTKPKQDDNWTSTAPILPIT.............SLYVECR-----------YN.PFKDKGTGNKVYL.VPTDSGLGS
A7VM00_9VIRU/1-509KDSGWFNPKVLNAYTVLKGDQRQSL...........VPCGVLR-----------YN.PYTDTGRGNKMWV.NSVLVGAWQ
Q9JG61_9VIRU/1-534IFYGTPPTETTYNTQP.QLQTIT.............GLYQECR-----------YN.PFKDKGTGNIFYL.KSTKTQQGS
Q91PS3_9VIRU/1-581HKTGIFSPIFLSRQRL.APD.FP.............GFYTEVI-----------YN.PANDKGVGNKIWM.DWCTKNDSQ
CAPSD_TTVV4/1-560FKTGMYSAIFLTNGRL.SPD.YP.............GIYIEVV-----------YN.PLLGQGEGNMIWL.EWCPKKTKQ
Q91C93_9VIRU/1-546IWITNKTPQELKAKYKSNTDKLHSSDTDTFWTLKRVPSVLDCR-----------YN.PFRDDNR.NEVYLLKITEQNSYD
Q2F827_9VIRU/1-589YHTGIYSSIFLSPLRS.NLE.FP.............TAYQDVT-----------YN.PLTDRGIGNRIWY.QYSTKENTT
Q91CY5_9VIRU/1-584YHTGIYSSIFLSPQR..NLQ.FP.............AAYLDVT-----------YN.PNCDRGIGNKIWF.QYSTKMTTD
Q8V7G9_9VIRU/1-572HDYGLFSPYFLTPNRY.STE.WH.............MPITYVR-----------YN.PLADKGIGNRIYM.QWCSESSSS
Q99A78_9VIRU/1-584YHGGLYSSIWLSAGRS.YFE.TK.............GTYTDIT-----------YN.PFTDRGQGNMVWI.DWVSKYDSV
Q6H9C2_9VIRU/1-573YHSGIYSSIYLSAGRS.YFE.TT.............GAYSDII-----------YN.PFTDKGTGNIIWI.DYLTKEDTI
CAPSD_TTVT1/1-433FKDTNEVKKVWN........................TAGKKYY-----------YR.ADWDTGDGNAIMLPNTLSPT...
Q9JG80_9VIRU/1-589YHLGMFSTIFLAPDR..PVPRFP.............CAYQDVT-----------YN.PLMDKGVGNHIWF.QYNTKADTQ
A7VLZ6_9VIRU/1-506YTKGYFQPPFLQTQFVCTSSMCDVKAGY........LPINVAI-----------YN.PMQDSSQGNAIYL.VSTLTNTWD
Q6H9D2_9VIRU/1-557YRTGIYSAIFLSAGRL.SPD.FP.............GLYDDIV-----------YN.PTTDEGIGNIVWI.DWCTKADCN
Q6H999_9VIRU/1-471HLTGIYSPPYLNQGRI.SPEIF..............GLYTEII-----------YN.PYTDKGTGNKVWM.DPLTKENNI
Q99AR3_9VIRU/1-606YYTGMYSSIFLSSGRS.NPE.VK.............GSYTDIS-----------YN.PLTDKGVGNMIWI.DWLTKGDTV
Q91PS7_9VIRU/1-585HKTGLYSPIFLSNSRL.SPD.FP.............GFYIDVL-----------YN.PANDKGIGNKIWM.DWCTKNDST
CAPSD_TTVV9/1-555LSYGLYSPLLLYPEMYFPEQS...............KVYQKAR-----------YN.PLLDQGIGNVVWT.EPLTKKTCD
Q9JG47_9VIRU/1-553IATGKTLKELCQIYKDDDITTAKLKEGFIFKE....QKWVELR-----------YN.PWADKGKGNMVYL.LPINEHQHS
A7VLW0_9VIRU/1-507ISKGWFQPKILNAYEVKDNTVTQAL...........TPCGVLR-----------YN.PADDDGQGNKLWV.VNTLTYNWK
Q0ZLH9_9VIRU/1-573FKSGLFSSIFLDNARL.SPD.FK.............GMYQEVV-----------YN.PFNDRGVGNKVWV.QWCTNEDTI
Q5ENW7_9VIRU/1-501LKIGNLKGLVLRQLMNQEMT................YIWKEGE-----------YSAPFVQRWKGSRFAV.IDARKADQE
A7VLX2_9VIRU/1-509YTGGWFDTRFLNSYEIKKKNTQQWLGY.........LPVGVAR-----------YN.PNEDTGEGNEVWL.TSIQKGHFD
Q80AR5_9VIRU/1-594YHAGWYSNIFIGPNRF.NIQ.FK.............VAYMDVT-----------YN.PINDKGHLNRVWF.QYSTKPTTD
Q91CZ2_9VIRU/1-601YRLGLFSPIFLSPLRSSNIE.WP.............FAYRDII-----------YN.PLMDKGVGNMMWY.QYNTKPDTQ
CAPSD_TTVG1/1-514KEGGYFSPKILQAYQTKVKSVDYKP...........LPIVLGR-----------YN.PAIDDGKGNKIYL.QTIMNGHWG
Q98Y63_9VIRU/1-581YHLGKYSPIFLSPYRT.NTQ.FP.............TAYMDVT-----------YN.PNVDKGKGNKIWL.QSVTKETSD
Q9QU36_9VIRU/1-529YVSNKTPQEVVNYIVSHQTQKVKEYTGITPRTL...PLTVECR-----------YN.PFNDKSTGNNTFF.VSNHADQTK
A7VM12_9VIRU/1-509YDNGWFNKNFLRAIELQSPTGTKLGQ..........LPLNYGR-----------YN.PTRDKGIGNKIYI.ISTIADSWG
A7VLV6_9VIRU/1-508YDTGWFNSQFLSSYKIEKTSTKQPYAH.........LPIGVAR-----------YN.PDQDTGQGNEVWL.ATIFKGHYD
Q9JG50_9VIRU/1-535FFISSKNPTTIQDTDLNNPISNTTILDE........PVFQECR-----------YN.PYKDKGYGNEAYFLSNVIAKKKA
A7VLW4_9VIRU/1-507YDDGWFGPLFLSAIKIGKIEQATAT...........HQIIQAR-----------YN.PNIDSGVGNQIYC.ASTHAYSWA
A7VM04_9VIRU/1-513YNTGFFSKQMLEAVQLTTDQTGQRPLGM........NPVNICR-----------YN.PTLDSGKGNAIWL.VSSHANTYR
A7VLY4_9VIRU/1-498YTTGWFNPKLMQLTEYVTPQQLA.............KPVLAFR-----------YN.AQLDNGKGNSVWF.KSILTEDFS
CAPSD_TTVD1/1-324...........................................-----------.N.DMINK.VPNMWWK..........
Q91CZ6_9VIRU/1-596YRIGMFSPTFLSPYRTSPIENWP.............MAYRDIS-----------YN.PLNDKVVGNKLWL.QSIVKADTQ
A7VM08_9VIRU/1-506YEGGWFQPKILQAYKVTLNGADKAL...........LPLVPIR-----------YN.PAADDGTGNLVTI.VDLVAGHWT
CAPSD_TTVV3/1-573YHAGIYSSIFLSPGRA.YFE.TP.............GAYQDII-----------YN.PFTDKGIGNIVWI.DWLSKSDAV
Q91D00_9VIRU/1-593YHAGWYSPVFIGPNRH.NIQ.FR.............TAYMDVT-----------YN.PLNDKGQFNRVWF.QYSTKPTTD
Q99AR5_9VIRU/1-604YHAGWFSNIFIGPNRH.SLQ.FQ.............TAYVDTT-----------YN.PLNDKGKGNKIWF.QYHSKVNTD
Q9DTD2_9VIRU/1-559YHTGMYSSIFLSSGRS.NPE.LK.............GPYTDVC-----------YN.PLVDKGIGNIVWL.DWCSKEDSK
Q91D04_9VIRU/1-591YHLGKYSPIFLSSYRT.NLQ.FI.............TAYTDVT-----------YN.PLNDKGKGNQIWV.QYVTKPDTI
CAPSD_TTVV8/1-571YHAGIYSAPFLSAGRL.NPE.IK.............GLYTDIT-----------YN.PMMDKGTGNKIWC.DSLTKADMK
Q5ENX0_9VIRU/1-603YHLGIYSPIFLHPGRS.NIQ.MW.............TAYRDIV-----------YN.PLLDKGEGNRIWF.QYHTKKDNR
O90364_9VIRU/1-590YHGGLYSSIWLSPGRS.YFE.TP.............GAYTDIK-----------YN.PFTDRGEGNMLWI.DWLSKKNMN
Q9IFV0_9VIRU/1-583YRTGLYSSIFLANERT.SPD.FP.............GLYQEVV-----------YN.PLVDEGEGNIVWI.DWCSKDDTT
Q9QUE7_9VIRU/1-586YHGGLYSSIWLSAGRS.YFE.TK.............GAYTDIC-----------YN.PYTDRGEGNMVWI.DWLSKTDSR
A8DMR2_9VIRU/1-531KLQTANPTEKIQNLNCTLLPPEK.............TVLTICR-----------YN.PQNDRSAHNALYA.SPVTTARTK
Q9DUH8_9VIRU/1-609YKLGIYSPVFLHPGRS.NIQ.MW.............TAYRDIV-----------YN.PFLDKGEGNKVWY.QYHTKTDNK
A7VLW8_9VIRU/1-511YNTGYFSTKVLNAFKVMVNSKESKP...........LPLGVAR-----------YN.PVEDDGKGNEIWV.ASIHSNAYA
Q99AQ3_9VIRU/1-582YHVGMFSPIFLTPYRSAGLD.FP.............YAYADVT-----------YN.PLTDKGVGNRMWY.QYNTKIDTQ

PF00729

CAPSD_TBSVB/75-270...K--------------VK-------------------------------------RYCNDSATVDQKL----------
CAPSD_MCMVK/21-224RCIQ--------------AG-------------------------------------QFAALGSAADKQM----------
CAPSD_TCV/54-245...S--------------TD-------------------------------------RFVADGIS.DPKL----------
CAPSD_CARMV/50-246...G--------------KT-------------------------------------RFIRDSASDDAKL----------
CAPSD_RCNMV/23-214...N--------------QW-------------------------------------RFVADNTTVDRKL----------
CAPSD_TBSVC/75-270...K--------------IK-------------------------------------RFCDDSSTSDHKL----------
CAPSD_SCPMV/58-276...S--------------EK-------------------------------------RYPFKTATDYATA----------
CAPSD_TNVD/51-265...D--------------KR-------------------------------------WYSTIGNAAFTAL----------
CAPSD_CNV/66-261...N--------------VK-------------------------------------RFISDTSSGDPKL----------
CAPSD_MNSV/68-263...N--------------TW-------------------------------------RYMNDTNAVDRKL----------
CAPSD_TNVA/60-273...D--------------KP-------------------------------------WYPTISSAGFGAL----------
CAPSD_AMCV/75-270...R--------------IK-------------------------------------RFCDDSSTLDHKL----------
CAPSD_CRV/72-266...S--------------VK-------------------------------------RFMNDNSTVDPKL----------

PF11729

Q0QVT6_9VIRU/1-348RLFS--------------PG-------------------------------------RFVVLTDGAPTEP----------
Q68UN9_9VIRU/1-338RLTS--------------PG-------------------------------------RLILLCVGNNTDV----------
Q709G0_9VIRU/1-340RLTS--------------PG-------------------------------------RIILLCVGNNTDV----------

PF00894

CAPSD_PEMVW/52-188RSNG--------------SA-------------------------------------TFGREILGDQPWY----------
CAPSD_BLRV/59-196TKSE--------------KK-------------------------------------KFSRKAINGQAWH----------
CAPSD_BYDV1/61-199SKSA--------------TK-------------------------------------TFTAQQIDGKEFR----------
Q65845_9LUTE/58-196TSSG--------------SK-------------------------------------TFTAGSINGTTMK----------
Q65869_9LUTE/35-172VKGG--------------KK-------------------------------------TLSSNQIGGGVWR----------
CAPSD_PLRV/70-208TKGG--------------AK-------------------------------------TYQARMINGVEWH----------
CAPSD_BYDVP/62-200SKTA--------------SK-------------------------------------TFRSEAINGKEFQ----------
CAPSD_BYDVN/67-204TKTG--------------AR-------------------------------------SFPAKMINGLEWH----------
Q65868_9LUTE/34-170VKGG--------------KR-------------------------------------SISSKQIGGGVWR----------
Q08391_9LUTE/63-200TKSG--------------SK-------------------------------------RFPTRAINGLEWH----------
Q65970_9LUTE/62-199TKSG--------------LR-------------------------------------RWTAKQINGMEWH----------
Q65880_9LUTE/60-197VKGG--------------RK-------------------------------------AFTSNQIGGGVWR----------
CAPSD_TYYVF/65-202TKPG--------------KR-------------------------------------AFTASYINGTEWH----------

PF03014

Q8V729_HEV/41-660RNQGWRSVETTGVAEEEATS-------------------------------------GLVMLCIHGSPVN----------
CAPSD_AHEV/13-604KNNGWRSVETVSVPQEDATS-------------------------------------GMLMVCVHGTPWN----------

PF00983

COAT_CAYMV/7-177------------------PL-------------------------------------TNINPIIKDSVTY----------
Q65665_BMDV/8-179------------------NL-------------------------------------QSVNAMIKDSTIY----------
COAT_ELV/19-190------------------NL-------------------------------------LMMNPHIKDSTSY----------
COAT_BMDV/8-181------------------NL-------------------------------------DSVNRMLKDSVTY----------
O09737_9VIRU/7-178------------------NL-------------------------------------TNVNPIIKDSVTY----------
COAT_EPMV/8-179------------------PM-------------------------------------NSVNCMLKDSVLY----------
COAT_OYMV/8-179------------------RL-------------------------------------DSVNPIIKDSVLY----------
COAT_KYMVJ/7-178------------------NL-------------------------------------TNVNPIIKDSVTY----------
COAT_TYMV/7-178------------------PL-------------------------------------EMMNPRVKDSIQY----------

PF00073

POLG_ENMGO/159-361----....................-------------------------..................-------------
POLG_POL1M/92-308----....................-------------------------..................-------------
POLG_POL1M/630-806----D...................-------------------------..................-------------
POLG_POL3L/92-307----....................-------------------------..................-------------
POLG_HRV14/91-299----....................-------------------------..................-------------
POLG_HRV14/610-795----D...GYSHDDAET.......-------------------------..................-------------
POLG_EMCV/161-359----....................-------------------------..................-------------
POLG_EMCV/420-624----DQVNITNADGWVTVW.QLTP-------------------------LTYPPGCPTSAKILTMVS-------------
POLG_FMDVO/308-475----....................-------------------------..................-------------
POLG_FMDVO/533-693----....................-------------------------..................-------------
POLG_FMDVO/725-887----NGECRYNRNAVPNLR..G..-------------------------..................-------------
POLG_FMDV1/308-475----....................-------------------------..................-------------
POLG_FMDV1/533-694----....................-------------------------..................-------------
POLG_FMDV1/726-886----DGTNKYSASDSR..S..G..-------------------------..................-------------
POLG_FMDVI/11-170----TGTTAYTASA...RR..G..-------------------------..................-------------
POLG_CXB3N/92-302----....................-------------------------..................-------------
POLG_CXB3N/360-530----D...EYTAGG..........-------------------------..................-------------
POLG_CXB3N/630-790----DGWSEFSRNG..........-------------------------..................-------------
POLG_HRV2/92-302----....................-------------------------..................-------------
POLG_HRV2/358-526----....................-------------------------..................-------------
POLG_HRV2/610-772----D...................-------------------------..................-------------
POLG_HRV8A/92-302----....................-------------------------..................-------------
POLG_HRV8A/364-533----P...................-------------------------..................-------------
POLG_HRV8A/617-801----D...GYDGDSAASKY..G..-------------------------..................-------------
POLG_CXB1J/360-528----D...................-------------------------..................-------------
POLG_CXB4J/92-300----....................-------------------------..................-------------
POLG_CXB4J/358-528----D...KYTASG..........-------------------------..................-------------
POLG_CXB4J/607-796----DGWSNFSRDGIY........-------------------------..................-------------
POLG_TMEVB/169-382----....................-------------------------..................-------------
POLG_TMEVB/443-648----TSPTITSVDGWVTVW.KLTP-------------------------LTYPSGTPTNSDILTLVS-------------
POLG_BOVEV/92-285----....................-------------------------..................-------------
POLG_BOVEV/345-515----D...................-------------------------..................-------------
POLG_BOVEV/606-778----DGYARFM.............-------------------------..................-------------
POLG_HRV1B/92-301----....................-------------------------..................-------------
POLG_HRV1B/360-529----....................-------------------------..................-------------
POLG_HRV1B/627-794----DGYDGDNSSS..........-------------------------..................-------------
POLG_SVDVU/608-791----DGWARFDKQG..........-------------------------..................-------------
POLG_FMDVT/308-475----....................-------------------------..................-------------
POLG_CXA9/90-300----....................-------------------------..................-------------
POLG_CXA9/358-526----D...................-------------------------..................-------------
POLG_CXA9/608-791----........DGWSNFDQRG..-------------------------..................-------------
POLG_CXA21/90-308----....................-------------------------..................-------------
POLG_CXA21/369-540----D...................-------------------------..................-------------
POLG_CXA21/642-821----DGFARVPLEGEN........-------------------------................TD-------------
POLG_HE701/92-288----....................-------------------------..................-------------
POLG_HE701/347-517----D...................-------------------------..................-------------
POLG_HE701/609-781----D...................-------------------------..................-------------
POLG_CXA24/646-809----D...................-------------------------..................-------------
Q9WMA0_9PICO/45-215----P...................-------------------------..................-------------
POLG_AEVCA/41-212----S...................-------------------------..................-------------

PF00915

CAPSD_FCVC6/107-396----DTDTTSLVIMVYNDLINP.Y-------------------------ANDSNSSGCIVTVETKPGPDFKFHLLKPPGS
Q83876_9CALI/2-295----NQQTMRLVCMLYTPLSTGGG-------------------------TG..DSFVVAGRVMTCPSPDFNFLFLVPP..
CAPSD_SOUV3/2-296----NQPTMRLVCMLYTPLRTGGG-------------------------SGNSDSFVVAGRVLTAPSSDFSFLFLVPP..
CAPSD_LORDV/2-291----NDSTLKLIAMLYTPLRANNA-------------------------GD..DVFTVSCRVLTRPSPDFDFIFLVPP..
O09725_9CALI/267-560----TEPTCSLGFWVYQPLLNPFS-------------------------TT..AVTTCWVSIETKPGGDFDFCLLRPPGQ
Q66418_9CALI/2-296----SSPTMRLVCMLYTPLRASGS-------------------------SSGTDPFVIAGRVLTCPSPDFSFLFLVPP..
Q66296_9CALI/2-291----SDSRLRLIAMLYTPLRANNS-------------------------GD..DVFTVSCRVLTRPSPDFSFNFLVPP..
CAPSD_VESVA/137-421----ETDTTKLVIMVY....KNGA-------------------------DT...KTTCSITVETRPSADFTFALLKPPGS
POLG_RHDVF/1768-2065----PGLVPTLVLSVYNNLINPFG-------------------------GS...TSAIQVTVETRPSEDFEFVMIRAPSS
Q80RD6_9CALI/2-291----DDPKMRIVAMLYTPLRSNGS-------------------------GD..DVFTVSCRVLTRPSPDFDFTYLVPP..
CAPSD_SMSV1/137-427----DTDTTRLVIMVYNELINP.Y-------------------------EQSEPKSSCSITVETRPSSDFTFSLLKPPGS

PF08762

Q8B107_ALPV/599-804----...GSIPVIGVQDLIQ.RNL-------------------------VSVNILTEAETT.......KALFYRA.VGD-
O56051_9VIRU/590-790----TTYNSTD....SDVLDARNG-------------------------FNRVIARFHSDT.......SAYVYRA.AGD-
Q56QP7_9VIRU/684-855----...........GEVELIKGK-------------------------IQTPVEKGIKGE..........LYRS.GND-
O36967_9VIRU/668-900----YVRGTESPITINSVLR.GHL-------------------------PPQIVAVAPQGTIATTDVVNAQFARA.PSD-
Q5UBY1_9VIRU/79-259----TSD..............KGY-------------------------DASLMYYSNVGT.......NQIVARA.GND-
Q6ITS9_9VIRU/106-313----SSFRANS....ETFYYSSGR-------------------------NNLDISTSPPSI.......NRYYAVG.AGD-
Q4JFT2_9VIRU/834-1009----LVIDSKSFPQLSDL......-------------------------...SISNLERTE.......NEYFVLASAGD-

PF01829

CAPSD_BBV/50-407-----PPANVTVATSGQPFNLAAGAEAVSGIV-G--WGNMD-------TIVIRVSAPTGAVNSAILKTWACLEYRPNPN-
CAPSD_NODAM/42-399-----PPANVTNAQASMFTNLTFSG...ARYT-G--LGDMD-------AIAILVTTPTGAVNTAVLKVWACVEYRPNPN-
CAPSD_BOOLV/36-403-----PGQNVTVAQAGMPFSLDAGAATVAGFT-G--IGGMD-------AIFIKVTAAAGSVNTATIKTWACIEYRPNTN-

PF03566

Q80IX5_9VIRU/54-754YKMNNPVFEMTGEENFGGFQFHYPGYDPENNALG--LRGIVDTFENNFSSAVVHFWGISQSATIVCKTYDGWEGTTNAG-
Q4TVU2_9VIRU/1-642SKMRNPVFQLTPASSFGAISFTNPGFDRNLDLPG--FGGIRDSLDVNMSTAVCHFRSLSKSCSIVTKTYQGWEGVTNVN-
Q9YK87_9VIRU/108-757QDIWQPVYNMTPASRYAPVRFVSNAITLDALNSA--VGTIRDTADSNYGFALCHMTSLPLACAPFIKAEMRFEAVPGRN-
CAPSD_NCBVS/1-608LRAFQPVFEMTMATSYGPVRWKTPRTTVVDYHRA--IGGLQDTIDSNFAIGVAAMTGMSTSTVPYFKVFRRFEAIPAEG-
CAPSD_HASV/2-647SKMRNPVFQLTPASSFGAVSFNNPGYERTRDLPD--YTGIRDSFDQNMSTAVAHFRSLSHSCSIVTKTYQGWEGVTNVN-

PF01766

POLS_BSNV/6-428VQVLAKT.......NGDPI..VVDSYVGVTVHGGNMPGTLR-------PVTIIAYESVATGSVLTLSGISNYELIPNPEL
Q9IP80_IBDV/8-452IKLEIVT.SKSGGQAGDQMSWSASGSLAVTIHGGNYPGALR-------PVTLVAYERVATGSVVTVAGVSNFELIPNPEL
POLS_DXV96/1-442IKININY....GNNTNGDSSFSVDSSFTINVIGGATIGVNS-------PTVGVGYQGVAEGTAITISGINNYELVPNPDL
O55651_9VIRU/4-453VKLSYKINQQTAIGNAATLGPLGPSSVSFSSGNGNVPGVLR-------PITLVAYEKMTPQSILTVAGVSNYELIPNPEL

PF00760

CAPSD_PSVJ/7-215----YSKDD-----------------------------------------------------------------------
CAPSD_CMVKI/12-216----YSKDD-----------------------------------------------------------------------
CAPSD_TAV/7-216----YSKDD-----------------------------------------------------------------------
CAPSD_CMVC/11-216----YSKDD-----------------------------------------------------------------------

PF01318

CAPSD_CCMV/2-190----YS-SA-----------------------------------------------------------------------
CAPSD_BMV/2-188----YA-SE-----------------------------------------------------------------------
CAPSD_BBMV/2-190----YS-EA-----------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618----EEMTN...LESFPHKLVQFR--------EI--------------QGRT.TITFTQSEFLTAWSTQVLSTVNPQKDG
POL2_CPMVS/460-832----DAFGF...YESFPHRIVQFA--------EV--------------EEKC.TLVFSQQEFVTAWSTQVNPRTTLEADG
POL2_BPMV/447-819----DDTIN...FEAFPHKLVQFG--------EI--------------QEKV.VLKFSQEEFLTAWSTQVRPATTLLADG
Q9Z006_9SECO/476-846----EKVGNMQILDSLPHIDFTFS--------SG--------------SKSTRSVRFPKEVFGVYQALDRWDLDSARGDD
O12663_9SECO/321-691----EKVGNMQILDSLPHIDFTFS--------AG--------------SKSTRSVRFPKEIFGVYQALDRWDLDSARGDD
Q9YWK0_9SECO/363-735----EEMTN...LESFPHKLVQFA--------EI--------------QGRT.TITFTQGEFLTAWSTQVLSTVNPQKDG
POL2_CPSMV/437-806----DDTVN...FEAFPHKLIVFS--------DK--------------QDRT.TISFSKDEFLMAWSTQVRPDTKLSEDG
POL2_RCMV/407-778----FSEN....LEDFPNKLIQFG--------EV--------------QERV.EITFTRKEFLTAWSTQVDPAGPVAGDG
Q9YWJ9_9SECO/452-824----EEMTN...LESFPHKLVQFA--------EI--------------QGRT.TITFTQSEFLTAWSTQVLSTVDPQKDG
Q66170_CPMVS/343-715----DAFGF...YESFPHRIVQFA--------EV--------------EEKC.TLVFSQQEFVTAWSTQVNPRTTLEADG

PF03391

CAPSD_TRSV/179-344----PTLRQ---VLWGPHQIMHG.--------DG--------------QFEI-AIKTR---------LHSAAT.TEEGFG
POL2_RRVS/768-936----ADLAD---IVTRKHWIVKS.--------NE--------------IFEV-DLYCP---------YGENPTFTGQANG
POL2_BRAV/1268-1433----PTLEE---ALVFPGFRLPSG--------EG--------------KFHI-KVQTP---------YGRLSTLTPDCAL
Q65029_ARMV/745-916----NNWNQ---LFKYPGCYIEE.--------DG--------------SFAI-EIRSP---------YHRTPLRLIDAQS
POL2_ARMVS/792-963----NNWNQ---LFKYPGCYIEE.--------DG--------------SFAI-EIRSP---------YHRTPLRLIDAQS
Q67703_GFLV/166-336----MDWNE---LFKYPGVYVEE.--------DG--------------SSEV-KIRSP---------YHRTPARLLAGQS
POL2_GFLV/771-941----MDWNE---LFKYPGVYVEE.--------DG--------------SFEV-KIRSP---------YHRTPARLLAGQS
POL2_BRSV/1007-1170----PETDQ---LAQMPHVDVEV.--------NV--------------DASL-QIQSP---------FFSTAN.FGNSGS
POL2_GCMV/981-1144----ITLEQ---LSQMPHVDCDV.--------DV--------------VSSL-KIQSP---------FYATAN.FGDSGA
POL2_TORVR/1497-1662----LTLET---AYQRPHYILA..--------DG--------------QGAF-SLPIS---------TPHAATSFLEDML
Q88483_9SECO/1003-1166----PTTEE---LAQIPHVDVTL.--------DA--------------KATL-QIQSP---------FFATAN.FGDDGT

PF02443

Q5Y4T0_PCV2/5-226----------------QLWLRL----------------------------------------------------------
Q27W03_PCV1/5-227----------------QLWLHL----------------------------------------------------------
A3FEQ4_9CIRC/3-256----------------TFFLGG----------------------------------------------------------
Q3HUU1_GOCV/5-247----------------TWYTPG----------------------------------------------------------
Q1L2D2_9CIRC/1-237----------------ALWLNS----------------------------------------------------------
CAPSD_CACV/7-243----------------ALWLNN----------------------------------------------------------
Q0H9S8_9CIRC/4-236----------------ALWLTN----------------------------------------------------------
Q06J73_9CIRC/8-245----------------ALWLNN----------------------------------------------------------
Q9DXG3_BFDV/11-242----------------ALWLNS----------------------------------------------------------
Q69EZ5_BFDV/7-239----------------ALWLNS----------------------------------------------------------
Q9DXG0_BFDV/11-242----------------ALWLNS----------------------------------------------------------
Q9DXF4_BFDV/3-235----------------ALWLNS----------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506P...PKTDLDLFVQGLPLWQLLLG..FPDWVRQK--------------K.KDPTFLQSYYLCFHCDAIEP....KPGL..
Q9WT88_9VIRU/1-603Y...NEKQCYCTLEDMPLWAICFG..YTDYVETQ--------------LGPNVDHETAGLIIMICPYTQPPM.YDKNR..
Q91CY9_9VIRU/1-581L....DNACRCVIEDMPLWAMVNG..YLEFCDSE--------------L.PGANIYNTYIVVVICPYTKPQL.LNKTN..
A7VLY0_9VIRU/1-515R...PQL.SDLVIVGKPLWLSFYG..FESFIQKT--------------K.HDKGWLLSGFYVCKCPYLKTL..SATTQ..
Q9JGT1_9VIRU/1-585Y...SKTQSKCLIENLPLWAAIYG..FKEYCSKV--------------T.GDTNIEHNCKCVIRSPYTIPQL.LDHNN..
Q80QT8_9VIRU/1-595F...KAEQAKCVIENLPLYCAFFG..YEDYLQRT--------------LGPYQDVETVGIVCFICPYTEPAC.VNKNDGK
CAPSD_TTVB1/1-533F.LTLPTKSELIITDLPLWLITWG..WIEWLKKS--------------R.PVAHIEEEYQVVIQSKYIHP..........
A7VM00_9VIRU/1-509E...PKD.TDLVMEGYPLWAMLYG..YTSLLKQV--------------K.SKTVPFAGSMIVVKSPALYRV..FGEDT..
Q9JG61_9VIRU/1-534F.LSLPTDNRILLKDFPIWLATWG..WISWLLKS--------------K.PVHYLEEDYHLVIQSPYIYP..........
Q91PS3_9VIRU/1-581W...TDRQSVVPIVDIPLWAAVMG..YSDYCRKY--------------Y.QGTNVLKEARLTVICPYTEPPL.TDKNS..
CAPSD_TTVV4/1-560Y...NERQCYNLIQHVPLWAAIHG..YMDFCKKT--------------F.KDNNLDKNTRVVLICPYTRPQL.YNPQK..
Q91C93_9VIRU/1-546Y..HEPPKPELIAKDLPLWACLWG..YIDYQKKA--------------A.TYTEIDTTCICVILSHSLDPT.........
Q2F827_9VIRU/1-589F...NETQCKCVLSDLPLWSMFYG..YVDFIESE--------------LGISAEIHNFGIVCVQCPYTFPPM.FDKSK..
Q91CY5_9VIRU/1-584F...EQKQCKCVLENIPLWSAFHG..YPDFIEQE--------------LSISAEIHNFGLVCFICPYTFPPC.YNKTK..
Q8V7G9_9VIRU/1-572F...EPTKSKCMLQDMPLYMLTYG..YLDYVVKC--------------T.GVKSAWTDMRVAIRSPYTFPQL.IGSTD..
Q99A78_9VIRU/1-584Y...SKTQSKCLIENLPLWASVYG..YAEYCSKS--------------T.GDTNIEQNCRVVIRSPFTNPQL.LDHNN..
Q6H9C2_9VIRU/1-573F...VKNKSKCEIMDMPLWAACTG..YTEFCAKY--------------T.GDSAIIYNARIVIRCPYTEPML.IDHSD..
CAPSD_TTVT1/1-433....TPASWLLLEWDAPYWLWFWGKTYQDFVSSH--------------T.PEGNPYYGQIYVKWWPITNPYD........
Q9JG80_9VIRU/1-589LIVSAPSPCKAHIEDIPLWAAFYG..YSDFIESE--------------LGPFVDAETVGLVCVICPYTKPPL.WSKTN..
A7VLZ6_9VIRU/1-506Q...PPKDSSILIQGMPIWLGLFG..YLDYVRQV--------------K.KDKTWLESHVLVLKSPAIFTF..PQPGA..
Q6H9D2_9VIRU/1-557F...NETQSKGVIKDIPLWAALFG..YVDFLKKT--------------F.KDDQLDKTARLTLISPYTKPQL.IGPTQ..
Q6H999_9VIRU/1-471Y...KEGQSKCLLTDMPLWTLLFG..YTDWCKKD--------------T.NNWDLPLNYRLVLICPYTFPKL.YNEKV..
Q99AR3_9VIRU/1-606Y...DPKKSKCLLSDFPLWSLCYG..YPDYCRKQ--------------T.GDSGIYYDYRVLIRCPYTYPQL.IKHND..
Q91PS7_9VIRU/1-585W...RDTPQKLPVVDIPLWAALLG..YSDYCTKY--------------F.NDKGLIKEARLTIICPYTQPPL.TDPEN..
CAPSD_TTVV9/1-555Y....ASQAYNVIKDAPLYLALFG..YIDICSKL--------------A.KDKSFYLSNRVCVKCPYTVPQL.LSKTN..
Q9JG47_9VIRU/1-553YGWAPPTNKDIITQDLPLNILLWG..YLDFHRKA--------------K.TYNDIDTTCLLVIKSPYLYPK......G..
A7VLW0_9VIRU/1-507I...PTD.DDLILEGYPLWLMLYG..YTSFLYQV--------------K.ADKNPFSSSLIVVKSSALQRV..FGTDT..
Q0ZLH9_9VIRU/1-573F...KDLPGRVPVVDLPLWCALMG..YSDYCKKY--------------F.HDDGFLKEARITIISPYTNPPL.INNKN..
Q5ENW7_9VIRU/1-501N............PKVSTWPIEGTWNTQDTVLKD--------------V........................FGINL..
A7VLX2_9VIRU/1-509K...PSKTPDFLLIGLPLWMAFYG..FWNYLEYT--------------T.KAKDIFKTHMFVVKCPAIKRL..STTIT..
Q80AR5_9VIRU/1-594F...VEKQAKCLLQNLPLWSMLFG..YSEYVESQ--------------LGPFQDHGTVGLVIVQCPYTVPPM.YDKER..
Q91CZ2_9VIRU/1-601F...SPTSCRAVLEDKPIWSMAYG..YADFLLSI--------------LGEHDDVDFHGLVCIICPYTRPPL.FDKDN..
CAPSD_TTVG1/1-514L...PQKTPDYIIEEVPLWLGFWG..YYNYLKQT--------------R..TEAIFPLHMFVVQSKYIQTQ..QTETP..
Q98Y63_9VIRU/1-581F...DSRSCRCIIENLPMWAMVNG..YSDFAESE--------------L..GSEVHAVYVCCIICPYTKPML.YNKTN..
Q9QU36_9VIRU/1-529W..QPIDNPDTQTPNLPIWLTTWG..LMDWYKKA--------------G.IISQPELNYMVVFECPYISSNP........
A7VM12_9VIRU/1-509P...PTTDKNVLIENLPLWLGLYG..YISYLETI--------------K.PPD.WLKSSLIVLVSDAIYHS..GTPVP..
A7VLV6_9VIRU/1-508K...PTVTDDFVIRGLPLWMAFYG..YWSYLKYK--------------T.KDKGVFTNHMFVVKCPAIKPM..QSAIT..
Q9JG50_9VIRU/1-535W..DPPDNKLLYNSGYPCWLLPWG..WLDWQLKL--------------K.QINQIGINYNYIFKTDQILP..........
A7VLW4_9VIRU/1-507P...PSKDKQLLIEGMPLWLGLFG..YYSFVRSV--------------K..SEDFMKAHVICIKSPALYCY..PEIGS..
A7VM04_9VIRU/1-513E...PITDKTLIFEGLPLYMLLYG..YLSYVQKV--------------K.NVRDFLNNYTLCMRSPALFPY..SQPGA..
A7VLY4_9VIRU/1-498K...PKVDSDLIISDMPIWQALYG..FTDFIKAV--------------K.PDPNFLASYILLIETRFVEPF..SSHAT..
CAPSD_TTVD1/1-324.............EAANDWLTEWG..........--------------................................
Q91CZ6_9VIRU/1-596F...HIPSCTYVLEDKPLWAACFG..YRDFIKSV--------------K.EKQDPDFEYIVCVICPYTIPPL.FDDKN..
A7VM08_9VIRU/1-506G...NYT.EAYTIKNIPLWMALHG..YASYVQAK--------------S.GDKGILTHSMIIVSSNAITRL..PTAST..
CAPSD_TTVV3/1-573Y...SEKQSKCGIFDLPLWAAFFG..YAEFCSKS--------------T.GDTAIAYNSRVCVRCPYTEPQL.LNHNN..
Q91D00_9VIRU/1-593F...NNTQCKCVLENIPLWSALFG..YSEYVESQ--------------LGPFQDHGTVGVVVVQCPYTVPPM.YNKEK..
Q99AR5_9VIRU/1-604L...RDRGIYCLLEDMPLWSMTFG..YSDYVSTQ--------------LGPNVDHETQGLVCIICPYTEPPM.YDKTN..
Q9DTD2_9VIRU/1-559F...DETKSKVPIRDMPLWAALFG..YAEYASKE--------------T.GDTAINTNARLTLICPYTDPML.FKPQD..
Q91D04_9VIRU/1-591F...NERQCKCHIVDIPLWAAFHG..YIDFIQSE--------------LGIQEEILNIAIIVVICPYTKPKLVHDPPN..
CAPSD_TTVV8/1-571Y...TEGRSKYLIENLPLWAAVWG..YLDYCTKT--------------S.GDAAFHYNYRVTLISPYTSPML.FNPQD..
Q5ENX0_9VIRU/1-603Y...SVPNCHWMLENLPLWSLLHG..YSEYLESQ--------------V.KYGDLRKEGKVLITCPYTKPPL.FDPKD..
O90364_9VIRU/1-590Y...DKVQSKCLVSDLPLWASAYG..YVEFCAKS--------------T.GDQNIHMNARLLIRSPFTDPQL.LVHTD..
Q9IFV0_9VIRU/1-583F...RDLPQRYAVKDIPLWAAFMG..YRDYVTKA--------------L.HDPGLSKEVRVTIICPYTKPKL.YNPDS..
Q9QUE7_9VIRU/1-586Y...DKTRSKCLIEKLPLWAAVYG..YPEYCAKS--------------T.GDSNIDMNARVVIRCPYTVPQM.IDTSD..
A8DMR2_9VIRU/1-531W..GATTKPELNTEGLPLWLLSFG..FHDWLLKS--------------E.KVQRLDLDYVYVILSDYITP..........
Q9DUH8_9VIRU/1-609Y...DPTKCRYMVEDLPLWSLLHG..YADYIISQ--------------I.KYGDPLVEGKVLIRCPYTRPAL.YNKQS..
A7VLW8_9VIRU/1-511K...PAE.DNLNFNGYPLWLAFWG..YWSYLQKI--------------K..DKSFFALHYFVVKSPYIYTA..QTEST..
Q99AQ3_9VIRU/1-582F...DAKCCKCVLEDMPLYAMAFG..HADFLEQE--------------IGEYQDLEANGYVCVISPYTKPPM.FNKHN..

PF00729

CAPSD_TBSVB/75-270----IDLGQ..........LGIAT--Y-----------------------------------------------------
CAPSD_MCMVK/21-224----YSPGR..........FIVAI--P-----------------------------------------------------
CAPSD_TCV/54-245----VDFGK..........LIMAT--Y-----------------------------------------------------
CAPSD_CARMV/50-246----VDFGR..........IVLST--Y-----------------------------------------------------
CAPSD_RCNMV/23-214----VDFGQ..........LLFVT--H-----------------------------------------------------
CAPSD_TBSVC/75-270----IDLGQ..........LGIAT--Y-----------------------------------------------------
CAPSD_SCPMV/58-276----VGVNANIGNILVPARLVTAM--E-----------------------------------------------------
CAPSD_TNVD/51-265----TSIDK...NQFCPATAIIAG--D-----------------------------------------------------
CAPSD_CNV/66-261----INLGQ..........FGWVA--Y-----------------------------------------------------
CAPSD_MNSV/68-263----VDFGQ..........FLFAT--Y-----------------------------------------------------
CAPSD_TNVA/60-273----SVLDQ...NQFCPASLVVAS--D-----------------------------------------------------
CAPSD_AMCV/75-270----IDLGQ..........LGVAT--Y-----------------------------------------------------
CAPSD_CRV/72-266----IDLGQ..........VGLAT--Y-----------------------------------------------------

PF11729

Q0QVT6_9VIRU/1-348----VSITILFHWTVELSRPALQR--PLNQLAQA--------------VLVATELYQEGLYLRYSNWDGTNFSPPKGQNN
Q68UN9_9VIRU/1-338----VNVSVLCRWSVRLSVPSLET--P.EETTAP--------------IMTQGSLYNDSLST..N...............
Q709G0_9VIRU/1-340----VNVSVLCRWSVRLSVPSLEL--P.EAVAVP--------------ILTQGPLYNDSLTNGYN...............

PF00894

CAPSD_PEMVW/52-188----ESNKD----------QFFFL--Y-----------------------------------------------------
CAPSD_BLRV/59-196----DTSED----------QFRIL--Y-----------------------------------------------------
CAPSD_BYDV1/61-199----ESTVN----------QFYML--Y-----------------------------------------------------
Q65845_9LUTE/58-196----NYLSD----------QFYLL--Y-----------------------------------------------------
Q65869_9LUTE/35-172----DSTED----------QFAIL--Y-----------------------------------------------------
CAPSD_PLRV/70-208----DSSED----------QCRIL--W-----------------------------------------------------
CAPSD_BYDVP/62-200----ESTID----------QFWML--Y-----------------------------------------------------
CAPSD_BYDVN/67-204----PSDED----------QFRIL--Y-----------------------------------------------------
Q65868_9LUTE/34-170----DSSED----------QFAIL--Y-----------------------------------------------------
Q08391_9LUTE/63-200----DTSED----------QFKIH--Y-----------------------------------------------------
Q65970_9LUTE/62-199----DATED----------QFKIL--Y-----------------------------------------------------
Q65880_9LUTE/60-197----DSTED----------QCAIL--Y-----------------------------------------------------
CAPSD_TYYVF/65-202----DVAED----------QFRIL--Y-----------------------------------------------------

PF03014

Q8V729_HEV/41-660----SYTNTPYTGALGLLDFALEL--EFRNLTPG--------------NTNTRVSRYTSTARHRLRRGADGTAELTTTAA
CAPSD_AHEV/13-604----SYTNSVYTGPLGMVDFAIKL--QLRNLSPG--------------NTNARVTRVKVTAPHTIKADPSG.ATITTAAA

PF00983

COAT_CAYMV/7-177----TDTPK----------LLIYS--T-----------------------------------------------------
Q65665_BMDV/8-179----TDSPK----------LLVYA--P-----------------------------------------------------
COAT_ELV/19-190----TDTPK----------LLVYS--T-----------------------------------------------------
COAT_BMDV/8-181----TDTPK----------LLAYS--R-----------------------------------------------------
O09737_9VIRU/7-178----TDTPK----------LLLSS--T-----------------------------------------------------
COAT_EPMV/8-179----TDCPK----------LLAYS--A-----------------------------------------------------
COAT_OYMV/8-179----LDSPR----------LLAFS--P-----------------------------------------------------
COAT_KYMVJ/7-178----SDTPK----------LLLYS--I-----------------------------------------------------
COAT_TYMV/7-178----LDSPK----------LLISI--T-----------------------------------------------------

PF00073

POLG_ENMGO/159-361-----------....QH.ASWTLVIAVV--APL.T------------------Y--------------------------
POLG_POL1M/92-308-----------....KH.NNWGIAILPL--APL.N------------------F--------------------------
POLG_POL1M/630-806-----------....GF.SKVPLKDQSA--ALG.D------------------S--------------------------
POLG_POL3L/92-307-----------....KH.NNWGIAILPL--SPL.D------------------F--------------------------
POLG_HRV14/91-299-----------....RH.NNVSLMVIPI--APL.T------------------V--------------------------
POLG_HRV14/610-795-----------....QY.GITVLNHMGS--MAF.R------------------I--------------------------
POLG_EMCV/161-359-----------....QH.ASWTLVIAVV--APL.T------------------Y--------------------------
POLG_EMCV/420-624-----------AGKDFS.LKMPISPAPW--SPQ.G------------------V--------------------------
POLG_FMDVO/308-475-----------....VH.KPWTLVVMVV--APL.T------------------V--------------------------
POLG_FMDVO/533-693-----------....GV.AETTNVQGWV--CLF.Q------------------I--------------------------
POLG_FMDVO/725-887-----------....DL.QVLAQKVART--LPT.S------------------F--------------------------
POLG_FMDV1/308-475-----------....KH.KPWTLVVMVL--SPL.T------------------V--------------------------
POLG_FMDV1/533-694-----------....DT.AETTNVQGWV--CVY.Q------------------I--------------------------
POLG_FMDV1/726-886-----------....DL.GSIAARVATQ--LPA.S------------------F--------------------------
POLG_FMDVI/11-170-----------....DL.AHLAAAHARH--LPT.S------------------F--------------------------
POLG_CXB3N/92-302-----------....RH.NNVTLMVIPF--VPL.D------------------Y--------------------------
POLG_CXB3N/360-530-----------............FITCW--YQT.N------------------I--------------------------
POLG_CXB3N/630-790-----------....VY.GINTLNNMGT--LYA.R------------------H--------------------------
POLG_HRV2/92-302-----------....SH.NNWSLVIIPI--CPL.E------------------T--------------------------
POLG_HRV2/358-526-----------....PG.RSTSGYITCW--YQT.R------------------L--------------------------
POLG_HRV2/610-772-----------....GY.DE........--QDQ.N------------------Y--------------------------
POLG_HRV8A/92-302-----------....RH.NNWSLVIIPI--CPL.Q------------------V--------------------------
POLG_HRV8A/364-533-----------....DT.YSSAGYITCW--YQT.N------------------F--------------------------
POLG_HRV8A/617-801-----------.......SVVTNDMGTI--CVR.I------------------V--------------------------
POLG_CXB1J/360-528-----------........EYTAAGYVT--CWY.Q------------------T--------------------------
POLG_CXB4J/92-300-----------....RH.NNFTLMIIPF--APL.D------------------Y--------------------------
POLG_CXB4J/358-528-----------............FISCW--YQT.N------------------V--------------------------
POLG_CXB4J/607-796-----------.GYNSL.NNMGTIYARH--VND.S------------------S--------------------------
POLG_TMEVB/169-382-----------....QH.ANWTLVVAVL--SPL.Q------------------Y--------------------------
POLG_TMEVB/443-648-----------AGDDFT.LRMPISPTKW--VPQ.G------------------V--------------------------
POLG_BOVEV/92-285-----------....RH.SNWTLAIIPV--APL.K------------------Y--------------------------
POLG_BOVEV/345-515-----------....DV.LNYQYYAAGH--VTI.W------------------Y--------------------------
POLG_BOVEV/606-778-----------....DT.DPDRYGILPS--NFL.G------------------F--------------------------
POLG_HRV1B/92-301-----------....RH.NNWSLVIIPI--SPL.R------------------S--------------------------
POLG_HRV1B/360-529-----------....DK.YSMAGYITCW--YQT.N------------------L--------------------------
POLG_HRV1B/627-794-----------....KY.GSIVTNDMGT--ICS.R------------------I--------------------------
POLG_SVDVU/608-791-----------....TY.GISTLNNMGT--LYMRH------------------V--------------------------
POLG_FMDVT/308-475-----------....QH.RPWTLVVMVV--APL.T------------------T--------------------------
POLG_CXA9/90-300-----------....RH.YNFTLMVIPF--VKL.D------------------Y--------------------------
POLG_CXA9/358-526-----------........EYTSAGYVT--CWY.Q------------------T--------------------------
POLG_CXA9/608-791-----------....SY.GYNTLNNLGH--IYV.R------------------H--------------------------
POLG_CXA21/90-308-----------....KH.NNWGIVILPL--APL.A------------------F--------------------------
POLG_CXA21/369-540-----------...DFT.EGGFITCFYQ--TRI.V------------------V--------------------------
POLG_CXA21/642-821-----------AGDTFYGLVSINDFGVL--AVR.A------------------V--------------------------
POLG_HE701/92-288-----------....RH.NNWTLAVIPV--CPL.A------------------G--------------------------
POLG_HE701/347-517-----------....AK.AINANVGYVT--CFM.Q------------------T--------------------------
POLG_HE701/609-781-----------....GF.AGFEKKATVL--YGI.N------------------P--------------------------
POLG_CXA24/646-809-----------....GF.ARVPLKDETV--DSG.D------------------T--------------------------
Q9WMA0_9PICO/45-215-----------....QY.PVWELTIRVW--SEL.N------------------I--------------------------
POLG_AEVCA/41-212-----------....AY.SIWMLVIRVW--SQL.Q------------------L--------------------------

PF00915

CAPSD_FCVC6/107-396MLTHGSIPS..DLIPKSSSLWIGN.RFW--SDITD------------------FVIRP...FVFQ.ANRHFDFNQETAG.
Q83876_9CALI/2-295TVEQKTRP...FTLPNLPLSSLSNSRAP--LPISG------------------MGISPDNVQSVQFQNGRCTLDGRLVGT
CAPSD_SOUV3/2-296TIEQKTRA...FTVPNIPLQTLSNSRFP--SLIQG------------------MILSPDASQVVQFQNGRCLIDGQLLGT
CAPSD_LORDV/2-291TVESRTKP...FTVPVLTVEEMSNSRFP--IPLEK------------------LYTGPSSAFVVQPQNGRCTTDGVLLGT
O09725_9CALI/267-560QMENGVSPE..GLLPRRLGYTRGN.RVG--GLIVG------------------MVLVAD...HRQ.VNRHFNARSITYG.
Q66418_9CALI/2-296NVEQKTKP...FSVPNLPLNTLSNSRVP--SLINA------------------MMISRDHGQMVQFQNGRVTLDGQLQGT
Q66296_9CALI/2-291TVESKTKP...FTLPILTISEMSNSRFP--VPIDS------------------LHTSPTENIVVQCQNGRVTLDGELMGT
CAPSD_VESVA/137-421LIKHGSIPS..DLIPRNSAHWLGN.RWW--SMISG------------------FSVQP...RVFQ.SNRHFDFDSTTTG.
POLG_RHDVF/1768-2065KTVDSISPAGLLTTPVLTGVGNDN.RWN--GQIVG------------------LQPVP...GGFSTCNRHWNLNGSTYG.
Q80RD6_9CALI/2-291TVESKTKP...FTLPILTLGELSNSRFP--VSIDQ------------------MYTSPNEVISVQCQNGRCTLDGELQGT
CAPSD_SMSV1/137-427LLKHGSIPS..DLIPRNSRHWMGN.RWW--STIDG------------------FVVQP...RVFQ.SNRHFDFDSTTTG.

PF08762

Q8B107_ALPV/599-804---------------DFSFCGLLGPPFV--.TRCT------------------N--------------------------
O56051_9VIRU/590-790---------------DFSFGFLLGAPIV--IIGLS------------------S--------------------------
Q56QP7_9VIRU/684-855---------------DLTYGWIVGSPQL--YVGAA------------------Q--------------------------
O36967_9VIRU/668-900---------------DFSFMYLVGVPPL--.TNVA------------------R--------------------------
Q5UBY1_9VIRU/79-259---------------DFTFGWLIGTPQT--.QGIT------------------R--------------------------
Q6ITS9_9VIRU/106-313---------------DMDFSIFIGTPPC--.IHAS------------------Q--------------------------
Q4JFT2_9VIRU/834-1009---------------DHTFSQLAGCPAF--TFGPA------------------E--------------------------

PF01829

CAPSD_BBV/50-407-----AMLYQFGHDSPPCDEVALQEYRT--VARSL------------------PVAVIAAQNASMWER--------VKSI
CAPSD_NODAM/42-399-----STLYEFARESPANDEYALAAYRK--IARDI------------------PIAVACKDNATFWER--------VRSI
CAPSD_BOOLV/36-403-----TALYKYAHDSPAEDIIALQQYRK--VYKSL------------------PVAVRAKLNANMWER--------VKRL

PF03566

Q80IX5_9VIRU/54-754-----STVGQFAHTGAEEEDEVVQLANR--LQMEL------------------TGVYQADDN--FAGT--------VSAL
Q4TVU2_9VIRU/1-642-----TPFGQFAHSGLLKNDEIPCLADD--LATRL------------------TGVYGATDN--FAAA--------VSAF
Q9YK87_9VIRU/108-757-----SPWGPFATSTPPKDEVALTISRT--VMDLE------------------PFAMPLAYN--GWGL--------MFSK
CAPSD_NCBVS/1-608-----SPWGPFASATPPKDDVALTVART--WTDLH------------------PFAYPERYN--GFGA--------LFAM
CAPSD_HASV/2-647-----TPFGQFAHAGLLKNEEILCLADD--LATRL------------------TGVYPATDN--FAAA--------VSAF

PF01766

POLS_BSNV/6-428AKNIQTSYGKLNPAEMTYTKVVLSHRDE--LGLRS------------------IWSIPQ-----YRDM--------MSYF
Q9IP80_IBDV/8-452AKNLVTEYGRFDPGAMNYTKLILSERDR--LGIKT------------------VWPTRE-----YTDF--------REYF
POLS_DXV96/1-442QKNLPMTYGTCDPHDLTYIKYILSNREQ--LGLRS------------------VMTLAD-----YNRM--------KMYM
O55651_9VIRU/4-453LKNMVTKYGKYDPEGLNYAKMILSHREE--LDIRT------------------VWRTEE-----YKER--------TRAF

PF00760

CAPSD_PSVJ/7-215-------------------TLE-DDEIL--IHVDV------------------EH-------------------------
CAPSD_CMVKI/12-216-------------------NLE-KDEIV--LHVDV------------------EH-------------------------
CAPSD_TAV/7-216-------------------VLE-ADEMV--IHIDI------------------EH-------------------------
CAPSD_CMVC/11-216-------------------ALE-TDELV--LHVDI------------------EH-------------------------

PF01318

CAPSD_CCMV/2-190-------------------ALT-EGDVI--VHLEV------------------EH-------------------------
CAPSD_BMV/2-188-------------------AVP-AKAVV--VHLEV------------------EH-------------------------
CAPSD_BBMV/2-190-------------------ALA-ANSIR--IRMEV------------------EH-------------------------

PF02247

POL2_SQMVM/246-618CPHLYA------LLH.DSATSTIEGNFV--IGVKL---------------------------------------------
POL2_CPMVS/460-832CPYLYA------IIH.DSTTGTISGDFN--LGVKL---------------------------------------------
POL2_BPMV/447-819CPYLYA------MVH.DSSVSTIPGDFV--IGVKL---------------------------------------------
Q9Z006_9SECO/476-846VSGNFV------LYQRDAVSSALEGELT--FRIAA---------------------------------------------
O12663_9SECO/321-691VSGNFV------LYQRDAVSSALEGELT--FRIAA---------------------------------------------
Q9YWK0_9SECO/363-735CPHLYA------LLH.DSATSTIEGNFI--IGVKL---------------------------------------------
POL2_CPSMV/437-806CPYLYA------ITH.NGVSSSVEGDFI--LGIKM---------------------------------------------
POL2_RCMV/407-778CPYLCA------MVH.DSTASTITGDFN--LGVTL---------------------------------------------
Q9YWJ9_9SECO/452-824CPHLYA------LLH.DSATSTIEGNFV--IGVKL---------------------------------------------
Q66170_CPMVS/343-715CPYLYA------IIH.DSTTGTISGDFN--LGVKL---------------------------------------------

PF03391

CAPSD_TRSV/179-344RLGILP......LSG-PIAPDAHVGSYE--FIVHI---------------------------------------------
POL2_RRVS/768-936KPFIIVHK....LGG-IVGPKDSVGTFG--FMIHI---------------------------------------------
POL2_BRAV/1268-1433YVYLAG........G-PIAVAPMSVPYQ--FCIHL---------------------------------------------
Q65029_ARMV/745-916ASSFTSTLNFYAISG-PIAPSGETAKMP--VVVQI---------------------------------------------
POL2_ARMVS/792-963ASSFTSTLNFYAISG-PIAPSGETAKMP--VVVQI---------------------------------------------
Q67703_GFLV/166-336QRDMSS.LNFYAIAG-PIAPSGETARLP--IVVQI---------------------------------------------
POL2_GFLV/771-941QRDMSS.LNFYAIAG-PIAPSGETAQLP--IVVQI---------------------------------------------
POL2_BRSV/1007-1170AFYVST......LCA-PMAPETVETGSE--YYIQI---------------------------------------------
POL2_GCMV/981-1144RFWVTP......MSS-PMAPETMESKLE--YYIQI---------------------------------------------
POL2_TORVR/1497-1662RLEIFA......IAG-PFSPKDNKAKYQ--FMCYF---------------------------------------------
Q88483_9SECO/1003-1166AFYIAT......LCA-PLAPETMETGFQ--YYIHI---------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226QTT..............--....GNVDH--VGLGT------------------AF-------------------------
Q27W03_PCV1/5-227NTH..............--....TNVEH--TGLGY------------------AL-------------------------
A3FEQ4_9CIRC/3-256KNFTWI...........--NCSQDQVVH--YGMGM------------------SL-------------------------
Q3HUU1_GOCV/5-247GRQLWL...........--NSIQDNVVF--YGMGM------------------SL-------------------------
Q1L2D2_9CIRC/1-237QKAFWIPLQLNAAQIKP--....KKVKH--YGIAF------------------SY-------------------------
CAPSD_CACV/7-243PKSLWIPIMKKSDQNLP--.SSGTRVKH--YGLAF------------------SW-------------------------
Q0H9S8_9CIRC/4-236PRSAWIPLMKKGDQNLP--.SSGSRVKH--YGLAI------------------SW-------------------------
Q06J73_9CIRC/8-245PRGAWIPLMKKGETTAS--TTSGTRVNH--YGLAF------------------SF-------------------------
Q9DXG3_BFDV/11-242ARTGWIPL.....QGGP--NSAGAKVRH--YGIAF------------------SF-------------------------
Q69EZ5_BFDV/7-239ARTGWIPL.....QGGP--NAAGAKVRH--YGIAF------------------SF-------------------------
Q9DXG0_BFDV/11-242VRTGWIPL.....QGGP--NAAGSKVKH--YGLAF------------------SF-------------------------
Q9DXF4_BFDV/3-235TRTGWIPL.....QGGP--NTAGTKVRH--YGLAF------------------SF-------------------------

PF02956

A7VLZ2_9VIRU/1-506HQV.FIPVDYSFVQGKG--PYD.S.LLS--KWDND------------------HW.YPTLKHQLQTIN........SVVE
Q9WT88_9VIRU/1-603PNWGYVVYDTNFGNGKM--PSG.SGQVP--VYWQC------------------RW.RPMLWFQQQVLN........DISK
Q91CY9_9VIRU/1-581PKQGYVFYDTLFGDGKM--PTG.TGLVP--FWLQS------------------RW.YPRAEFQQQVLH........DLYL
A7VLY0_9VIRU/1-515TTF..AFIDLDFIQGKL--PYG.E.TIT--SQKKA------------------LW.YPNVENQVNTVT........NLVQ
Q9JGT1_9VIRU/1-585PLRGYIPYSFNFGNGKM--PGG.SSLVP--IRMRA------------------KW.YPTLFHQKEVLE........AIAQ
Q80QT8_9VIRU/1-595SNWGYVFYDVNFGNGKT--PEG.LGRVH--PYWMQ------------------RW.RVYSQFQKETMN........RICR
CAPSD_TTVB1/1-533QLPCYVLIDKYFRHPPE--GQHYITELS--ETDKL------------------HW.HPKYSMQTEQLE........LIAE
A7VM00_9VIRU/1-509KDY.YPLIDKSFMDGKG--TNN.T.DPI--YPKSK------------------LW.YPALFSQRDSIS........QIVN
Q9JG61_9VIRU/1-534PMPCYVPLDKYFTHND.--....GKNLT--ETDKA------------------HW.HPKIEMQLETLA........KFAE
Q91PS3_9VIRU/1-581TDTGFIPFDYNFGDGKM--PDG.QNYIP--VEYRF------------------RW.YPCMFHQQNWMN........DIAQ
CAPSD_TTVV4/1-560PDWGYVPYDYNFAQTKM--PDG.NGYIP--EFYRF------------------RW.YPSGFHQQNWMN........DLDQ
Q91C93_9VIRU/1-546THTTFIPLDEDFLKGQS--SFRPEHQTT--RPDEL------------------NW.HPKVSFQIQSLN........NIAC
Q2F827_9VIRU/1-589PDKGYVFYDTLFGNGKM--PDG.SGHVP--TYWQQ------------------RW.WPRFSFQRQVMH........DIIL
Q91CY5_9VIRU/1-584PEQGYVFYDTTFGNGKM--PDG.SGHIP--IYWQQ------------------RW.FIRLAFQTQVMH........DLVM
Q8V7G9_9VIRU/1-572.KVGFIPLGEKFMSGDT--DPV.KNFIP--LKYWY------------------RW.YPFAANQKSVLE........TIVS
Q99A78_9VIRU/1-584PLRGYVPYSINFGNGKM--PGG.SSQVP--IRMRS------------------KW.YPTLFHQKEVLE........AIAQ
Q6H9C2_9VIRU/1-573PNKGFVPYSFNFGNGKM--PGG.SSNVP--IRMRA------------------KW.YVNIFHQKEVLE........SIVQ
CAPSD_TTVT1/1-433.................--....QGPHT--YPEDK------------------EWCLMMLDPQPNFMTCNSIAAALKIAA
Q9JG80_9VIRU/1-589PSMGYVFYDRNFGDGKW--TDG.RGKIE--PYWQV------------------RW.RPEMLFQETVXA........DIVQ
A7VLZ6_9VIRU/1-506DAW.YCPLSKTFIDGVG--PYR.T.DLT--IKQKE------------------RW.FPQIQHQYEILN........SFVE
Q6H9D2_9VIRU/1-557PNKGFVPYDYNFGRAHM--PSG.ESYIP--MYYRF------------------RW.YICLFHQQKFID........NIVS
Q6H999_9VIRU/1-471KDYGYIPYSYKFGAGQM--PDG.SNYIP--FQFRA------------------KW.YPTVLHQQQVME........DISR
Q99AR3_9VIRU/1-606KYFGFVVYSENFGLGRL--PGG.NPNPP--TRMRL------------------HW.YPNMFHQTEVLE........CIAQ
Q91PS7_9VIRU/1-585VDMGFIPYDFNFGNGVM--PDG.TPYIP--IECRM------------------KW.YPCMFHQQNFMN........SIVS
CAPSD_TTVV9/1-555ATLGHVILSENFMRGLV--PSK.DSYVP--LYMRG------------------KW.YPSIYHQEEVIE........AIVS
Q9JG47_9VIRU/1-553QITFAVPLDQEFLDGNS--PYFTEGHKT--QSDQQ------------------YW.HPKVRFQTRTVN........AIAC
A7VLW0_9VIRU/1-507TGW.YPLIDKSFMDGKG--PGN.T.DPI--LLHRK------------------YW.YPSLYGQRDSIS........QLVN
Q0ZLH9_9VIRU/1-573TNEGFVPYSFYFGKGRM--PDG.NGYIP--IDFRF------------------NW.YPCIFHQTNWIN........DMVQ
Q5ENW7_9VIRU/1-501QNQQFRAAD..FGKLTL--PKS.PHDLD--FGHHS------------------RF.GP..................FCVK
A7VLX2_9VIRU/1-509TDY.YPFFDQDFLNGNL--PYG.E.YLS--DNEKK------------------LW.YPTAEKQVVTIN........SLVS
Q80AR5_9VIRU/1-594PNMGYVFYDTHFGNGKL--GNG.LGQVP--RYWQQ------------------RW.YPVLKRQKQVMN........DICK
Q91CZ2_9VIRU/1-601PKMGYVFYDAKFGNGKW--IDG.TGFIP--VEFQS------------------RW.KPELAFRKDVLT........DLAM
CAPSD_TTVG1/1-514NNF.WAFIDNSFIQGKN--PWD.S.VIT--YSEQK------------------LW.FPTVAWQLKTIN........AICE
Q98Y63_9VIRU/1-581PAMGYIFYDTLFGDGKL--PSG.PGLVP--FYWQS------------------RW.YPKLAWQQQVLH........DFYL
Q9QU36_9VIRU/1-529KLKYYVPIDDTMQTGQS--PY..IEVLS--QSDEK------------------HW.YPKGSFQIKTLN........TITS
A7VM12_9VIRU/1-509STK.WAPIDSDYIDGNK--PYD.Q.YIT--PTEKT------------------RW.YPNYKWQLKTLN........AIVE
A7VLV6_9VIRU/1-508TDY.YPVIDLEFIQGKW--PYE.E.QVT--ENHKK------------------LW.YPTAEHQTVTIN........NFVE
Q9JG50_9VIRU/1-535KLPAYIPINPSFVFPE.--....EDQLT--ETDKL------------------HW.YPKNDYQLNSIS........TLCS
A7VLW4_9VIRU/1-507CDT.YVFIDPEFISGKR--PYE.Q.LIT--SQQKR------------------LW.YPDMSWQKKTMN........TLVE
A7VM04_9VIRU/1-513ETQVIIPVNENFIHGKA--AYD.E.TLT--ESVKG------------------YW.TPNVYQQIQTLN........TMVE
A7VLY4_9VIRU/1-498GNY.WIPIDSSFVTGKG--PYN.T.PIG--DYTKT------------------KW.FPTVKNQQESIN........AFVK
CAPSD_TTVD1/1-324.................--.........--.....------------------...RPQGSGVTQQFN........QLAM
Q91CZ6_9VIRU/1-596PLMGYVFYDTNFGNGKW--LDG.SGLVP--VEMQS------------------RW.RPYLAFQTKVMT........DIAM
A7VM08_9VIRU/1-506QTV.FPLLSSNFVNGKA--PYY.Q.PLT--DTMKK------------------NW.YPTYEGQQETIN........DIVC
CAPSD_TTVV3/1-573PSQGYVFYSYNFGKGKM--PGG.SSQVP--IRMRW------------------KW.YVCMFHQLEVME........AICQ
Q91D00_9VIRU/1-593PDMGYVFYDTHFGNGKL--GNG.SGQVP--RYWQM------------------RW.YPILKRQKQVMN........DICK
Q99AR5_9VIRU/1-604PNSGYVAYDTNFGNGKM--PSG.RSQVP--VYWQC------------------RW.RPMLWFQQQVLN........DISK
Q9DTD2_9VIRU/1-559PKFGFVPYSLNFGLGRM--PGD.STYVP--IRQRA------------------KW.YACLYHQQEVIE........AITQ
Q91D04_9VIRU/1-591QNQGFVFYDTQFGDGKM--PEG.SGLVP--IYYQN------------------RW.YPRIKFQSQVVH........DFIL
CAPSD_TTVV8/1-571PTKGFVPYSLNFGLGKM--PGG.KGYVP--LRMRA------------------NW.YPYFFHQQKVLE........AIGM
Q5ENX0_9VIRU/1-603PSKGWVPYNDTFGRGKW--IDG.GGYIP--LPERA------------------FW.YVMLRYQEQVFK........DIVT
O90364_9VIRU/1-590PTKGFVPYSLNFGNGKM--PGG.SSNVP--IRMRA------------------KW.YPTLFHQQEVLE........ALAQ
Q9IFV0_9VIRU/1-583TDEGYVPYDYNFGKGKM--PDG.NGYIP--IAYRF------------------QW.YPCMFHQQNFMN........DIVQ
Q9QUE7_9VIRU/1-586ELRGFIVYSFNFGRGKM--PGG.SSEVP--IRMRA------------------KW.YPCLFHQKEVLE........ALGQ
A8DMR2_9VIRU/1-531KMEHYVPVDPNFTQGRS--PFEITDHMR--PPDVG------------------YW.FPKTSYQHTVFS........EIIN
Q9DUH8_9VIRU/1-609PDEGYVVYNTYFGMGKW--VDG.SGYIP--IPERA------------------RW.MVMLKYQLDVFH........DLVV
A7VLW8_9VIRU/1-511KNF.FPIIDWAFIQGKD--PYD.G.YLT--STDKS------------------LW.YPTALRQIVTIN........NICK
Q99AQ3_9VIRU/1-582PQQGYVFYDSQWGNGKW--IDG.TGFVP--VYWLT------------------RW.RVELLFQKQVLS........DLAM

PF00729

CAPSD_TBSVB/75-270-----------G..GAG--TNA-VGDVF--ISYSV------------------TL-------------------------
CAPSD_MCMVK/21-224-----------K..ASA--TQA-VGQIK--ISYSV------------------SY-------------------------
CAPSD_TCV/54-245-----------GQGAND--AAQ-LGEVR--VEYTV------------------QL-------------------------
CAPSD_CARMV/50-246-----------GF.DKA--DTV-VGELF--IQYTI------------------VL-------------------------
CAPSD_RCNMV/23-214-----------S..GSD--GIE-TGDIF--LDCEV------------------EF-------------------------
CAPSD_TBSVC/75-270-----------G..GAG--TNA-VGDIF--ISYSV------------------TL-------------------------
CAPSD_SCPMV/58-276-----------GGSSKT--AVN-TGRLY--ASYTI------------------RL-------------------------
CAPSD_TNVD/51-265-----------GG.PAA--ATA-VGDIF--MRYDI------------------EF-------------------------
CAPSD_CNV/66-261-----------S..GP.--TAE-LGDIF--VEYTV------------------DL-------------------------
CAPSD_MNSV/68-263-----------S..GAG--STA-HGDLY--VEYAV------------------EF-------------------------
CAPSD_TNVA/60-273-----------GG.PAT--ATP-AGDLF--IKYVI------------------EF-------------------------
CAPSD_AMCV/75-270-----------G..GAG--TNA-VGDIF--ISYSV------------------TL-------------------------
CAPSD_CRV/72-266-----------G..GPG--TNA-VGDLF--IHYTV------------------TF-------------------------

PF11729

Q0QVT6_9VIRU/1-348ETALHMENAFAGLPPIS--SFG-TNTLFYQLPYPL------------------RV.....TGNEVLAQFIGFSVSGGNL.
Q68UN9_9VIRU/1-338....DFKSILLGSTPLD--IAP-DGAIF.QLDRPL------------------SIDYSLGTGDVDRAVYWHLKKFAGNAG
Q709G0_9VIRU/1-340....HFQSVLLGSTQID--VAP-TGTIX.QIDRPL------------------LIDYSLGVGDVDRATYWHFRKLIGDVT

PF00894

CAPSD_PEMVW/52-188-----------RGTGGT--D.V-AGHYR--ISGRI------------------QL-------------------------
CAPSD_BLRV/59-196-----------EGNGDA--K.I-AGSFR--VTIKV------------------LT-------------------------
CAPSD_BYDV1/61-199-----------KANGST--SDT-AGQFI--ITIRV------------------AN-------------------------
Q65845_9LUTE/58-196-----------KGNSSK--ATV-AGQFI--ITIRV------------------KM-------------------------
Q65869_9LUTE/35-172-----------KGNGKS--S.I-AGSFR--VTMDV------------------LT-------------------------
CAPSD_PLRV/70-208-----------KGNGKS--SDT-AGSFR--VTIRV------------------AL-------------------------
CAPSD_BYDVP/62-200-----------KANGTT--TDT-AGQFI--ITMSV------------------SL-------------------------
CAPSD_BYDVN/67-204-----------KGNGAS--S.V-AGSFK--ITLRV------------------QL-------------------------
Q65868_9LUTE/34-170-----------KGSGNS--S.V-AGSFR--ITM.V------------------HT-------------------------
Q08391_9LUTE/63-200-----------KGNGES--K.I-AGSFK--ITINV------------------LT-------------------------
Q65970_9LUTE/62-199-----------KGNGSS--S.V-AGSFR--ITIKC------------------QV-------------------------
Q65880_9LUTE/60-197-----------KGNGKS--S.V-AGSFR--ITIEV------------------IV-------------------------
CAPSD_TYYVF/65-202-----------KGNGSS--S.I-AGSFR--ITIKC------------------QF-------------------------

PF03014

Q8V729_HEV/41-660TRFMKDLHF.TGTNGVG--EVG-RGIAL--TLFNLADTLLGGLPTELISSAGGQLFYSRPVVSANGEPTVKLYTSVENAQ
CAPSD_AHEV/13-604ARFMADVRWGLGTAEDG--EIG-HGILG--VLFNLADTVLGGLPSTLLRAASGQYMYGRPVGNANGEPEVKLYMSVEDAV

PF00983

COAT_CAYMV/7-177-----------APSYS...TSA-TCTLT--IRGKV------------------R--------------------------
Q65665_BMDV/8-179-----------IAKGSP..KTP-SATVQ--IGGQI------------------L--------------------------
COAT_ELV/19-190-----------PAVPDDKLTTS-SASII--VFGE.------------------.--------------------------
COAT_BMDV/8-181-----------APTNPS..KIP-TASIQ--ISGRI------------------R--------------------------
O09737_9VIRU/7-178-----------TIASPP..TSP-TCTVT--ISGTI------------------T--------------------------
COAT_EPMV/8-179-----------APSSPS..KTP-TATIQ--IHGKL------------------R--------------------------
COAT_OYMV/8-179-----------APPETQ..SIP-SASLL--IRGKL------------------R--------------------------
COAT_KYMVJ/7-178-----------AQETAP..TLA-TCSVT--ITGTL------------------T--------------------------
COAT_TYMV/7-178-----------AQPTAP..PAS-TCIIT--VSGTL------------------S--------------------------

PF00073

POLG_ENMGO/159-361--------------------------------------------------------------------------------
POLG_POL1M/92-308--------------------------------------------------------------------------------
POLG_POL1M/630-806--------------------------------------------------------------------------------
POLG_POL3L/92-307--------------------------------------------------------------------------------
POLG_HRV14/91-299--------------------------------------------------------------------------------
POLG_HRV14/610-795--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_EMCV/420-624--------------------------------------------------------------------------------
POLG_FMDVO/308-475--------------------------------------------------------------------------------
POLG_FMDVO/533-693--------------------------------------------------------------------------------
POLG_FMDVO/725-887--------------------------------------------------------------------------------
POLG_FMDV1/308-475--------------------------------------------------------------------------------
POLG_FMDV1/533-694--------------------------------------------------------------------------------
POLG_FMDV1/726-886--------------------------------------------------------------------------------
POLG_FMDVI/11-170--------------------------------------------------------------------------------
POLG_CXB3N/92-302--------------------------------------------------------------------------------
POLG_CXB3N/360-530--------------------------------------------------------------------------------
POLG_CXB3N/630-790--------------------------------------------------------------------------------
POLG_HRV2/92-302--------------------------------------------------------------------------------
POLG_HRV2/358-526--------------------------------------------------------------------------------
POLG_HRV2/610-772--------------------------------------------------------------------------------
POLG_HRV8A/92-302--------------------------------------------------------------------------------
POLG_HRV8A/364-533--------------------------------------------------------------------------------
POLG_HRV8A/617-801--------------------------------------------------------------------------------
POLG_CXB1J/360-528--------------------------------------------------------------------------------
POLG_CXB4J/92-300--------------------------------------------------------------------------------
POLG_CXB4J/358-528--------------------------------------------------------------------------------
POLG_CXB4J/607-796--------------------------------------------------------------------------------
POLG_TMEVB/169-382--------------------------------------------------------------------------------
POLG_TMEVB/443-648--------------------------------------------------------------------------------
POLG_BOVEV/92-285--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_BOVEV/606-778--------------------------------------------------------------------------------