Sequence alignment for CL0055

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754ASANQAGKRLEPRKRTRSIRSRQDLDTMHRVVVSVDVDSLTTLMGNIMTLAGSGGRGSLLTAGDVEKNPGPQMTRENKAP
CAPSD_NCBVS/1-608MDANV.........QIRPAR..............................................NNP...........
CAPSD_HASV/2-647GDAGVASQRPHNRRGTRNVR............................................................

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266-----------------------------------------------------------------------------GRV
CAPSD_MCMVK/23-222-----------------------------------------------------------------------------RAI
CAPSD_PMVK/39-236-----------------------------------------------------------------------------YVT
CAPSD_RCNMV/24-213-----------------------------------------------------------------------------VKT
CAPSD_CARMS/51-245-----------------------------------------------------------------------------TPA
CAPSD_SBMVA/46-262-----------------------------------------------------------------------------AGV
CAPSD_TBSVC/76-269-----------------------------------------------------------------------------GGA
CAPSD_POLVP/66-257-----------------------------------------------------------------------------.GA
CAPSD_OCSVU/111-308-----------------------------------------------------------------------------.GT
CAPSD_TNVA/61-272-----------------------------------------------------------------------------GGY

PF11729

CAPSD_SJNNV/1-340-------------------------------------------------------------------------MVRKGDK

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659---------------------------------------------------------------FWGDRADSQPFAIPYIH

PF03115

CAPSD_HASV1/1-416---------------------------------------------------------------MASKSNKQVTVEVSNNG

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINV
POL2_CPMVS/460-832MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNI
POL2_BPMV/447-819METNLFKLSLDDVETPKGSMLDLKISQSKIALPKNTVGGTILRSDLLANFLTEGNFRASVDLQRTHRIKGMIKMVATVGI
Q9Z006_9SECO/476-846Q........TNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLN.ELSKHSAVHTGLLNMLSKIPGSLKVKINCQV
O12663_9SECO/321-691Q........TNNFAIESATETMRLLFSGHASIPLNVIPGTKITVAYLN.ELSKHSAVHTGLLNMLSKIPGSLKVKINCQV
Q9YWK0_9SECO/363-735NELDLAQLSLDDTSSLRGSVLQTKLATSRVILSKTMVGNTILRENLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINV
POL2_CPSMV/437-806D...LFKRNLDDVSTISDTMLGAMIGQTKVVIPKTLVAGTVLKSGPLSDVMQQGSFRSTIALQRTHIITGKIHVVAMLET
POL2_RCMV/407-778TDTDLFKLSLDDTSSPKGSLLDTRFAQKKVLIPKAMAGGADLLSSNLYDVLSGSSFRASLALARTHVVEGKIRCICTINL
Q9YWJ9_9SECO/452-824NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINV
Q66170_CPMVS/343-715MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNI

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226------------------------RR-----------------------------RYRRRRHRPRSHLGQILRR------
Q27W03_PCV1/5-227------------------------RR-----------------------------RYRRRRTRPRSHLGNILRR------
A3FEQ4_9CIRC/3-256------------------------RS-----------------------------TYRRAYRA.......RRRR------
Q3HUU1_GOCV/5-247------------------------RA-----------------------------RPRSLYYR.......RRRA------
Q1L2D2_9CIRC/1-237------------------------ML-----------------------------LSRRRWRRGLRP...RYRR------
CAPSD_CACV/7-243------------------------QV-----------------------------ARRRRPLAPRRR...RWRR------
Q0H9S8_9CIRC/4-236------------------------QV-----------------------------ARRRRQTQAIRR...RWRR------
Q06J73_9CIRC/8-245------------------------HF-----------------------------LIQRRMRHWRRRRHLRMRR------
Q9DXG3_BFDV/11-242------------------------TF-----------------------------QIRRRYARP......Y.RG------
Q69EZ5_BFDV/7-239------------------------IF-----------------------------QIRRRYARP......YVRR------
Q9DXG0_BFDV/11-242------------------------IF-----------------------------QIRR.IARP......RYRR------
Q9DXF4_BFDV/3-235------------------------HF-----------------------------QIRRRYARP......Y.RR------

PF02956

A7VLZ2_9VIRU/1-506-----------MPF.WWARR....KR..WWRGRR.....................RPFYRRRYHYKKRRP..RR......
Q9WT88_9VIRU/1-603-----------MA..YWFRR.........WGWRPRR..RWRRWRRRR..RRLPRRRTRRAVRGLGRRRKPRVRR..RRRT
Q91CY9_9VIRU/1-581-----------MAFRWWWWR....RR.PQRRWTRRR...WRRL.RTR........RPRRTVRRRRRRPRV...R..RRRW
A7VLY0_9VIRU/1-515-----------MPF.WWARR....KK..PWYSN......................WNRYRRRYKRRRWPR..RR..RRRI
Q9JGT1_9VIRU/1-585-----------MAYRWWRRR....SR..RWRRRRWR..RWRRRRRP.........RRRRPARRCRRRRTV..RR..RRR.
Q80QT8_9VIRU/1-595-----------MA..WWGRW....RR...WRWRPRR...WRRRRRRR....VPRRRAQRPVRRRRRRVR.......RRRW
CAPSD_TTVB1/1-533-----------MPPFYYRRR.........WYSNPWR...................RKRLRFRRRRLRRPI..RKRFRR..
A7VM00_9VIRU/1-509-----------MAF.WWYRR....NK..PWFGR......................YKRRRTRRYKRTWRT..RR..RRP.
Q9JG61_9VIRU/1-534-----------MPPFNYYRR....R....YFYRPRR...................YRRRWFTTWRPRQTL..RRRFRR..
Q91PS3_9VIRU/1-581-----------MWWNWW..K....RR..RWR.PRRR.WRT.RR.RRRLPV.....WRRRRTTRYARRRRV..RRLRRRR.
CAPSD_TTVV4/1-560-----------M...WWWRR....RF...WR.PKRR.WRWRRR.RRRPLA.....RRRRRPARLARRPRV...R..RRRF
Q91C93_9VIRU/1-546-----------MPW..........RN...YYYRRRR...................RPRRFWRRRFRTPIY..RRFWRR..
Q2F827_9VIRU/1-589-----------MAWSWWWRR....RK..RWWPRRRR..RWRRF.RTR........RARRAVPRRRRRRRV...R..RRRW
Q91CY5_9VIRU/1-584-----------MAWRWWWQR....RR..RWWPRRRR..RWRRL.RRR........RPRRPVRRRRRRATV...R..RRRW
Q8V7G9_9VIRU/1-572-----------MAW..YRYR....RR..PWRRRRRPRWGLRRR............RFRRSFRGRGRRRYV..SRWSRRRY
Q99A78_9VIRU/1-584-----------MAYGWWARR....RR..RWRRWKRR..PWRRRWRT.........RRRRPRRRYRRRRHV..RR..RRR.
Q6H9C2_9VIRU/1-573-----------MAWGFWGRR....RRWRRWRARRRR...WRPR.RR.........RRRRPTRRFRARRRV..RR..RG..
CAPSD_TTVT1/1-433-----------MRF....RY....RK...WR........................RPRRLFRSRRRRGYA..RRRWRRRA
Q9JG80_9VIRU/1-589-----------MAWGWWRRW....RR...WPARRWRRRRRRRPVRRR........RAGRPARRYRRRRTV...RTRRRRW
A7VLZ6_9VIRU/1-506-----------MPF.WWRRR....RR..FWTNRR.....................FTYKRRKRYPRRYN...RR......
Q6H9D2_9VIRU/1-557-----------M...WWWRR....RR...WRAPWRR.RRW..R.RRRPRT.....RRFRRAARRPRRPRV...R..RPRR
Q6H999_9VIRU/1-471-----------M....................................................................
Q77JT5_9VIRU/1-606-----------MAWRRWRWR....PW...WRRRRRR..RWRRR.RRRP.......RRRRPYRR.RRPRRV..RR..RR..
Q91PS7_9VIRU/1-585-----------MWWNRW..K....RY..RWR.PLRR.WRT.YR.RRRPLR.....WRRRGAARRPRRRRV..RRW.RRR.
CAPSD_TTVV9/1-555-----------MPWWPWRRW....RR...WR...RRRGNWRRRVAPR........RYRRTARRARRRRKAV.RR..RRRR
Q9JG47_9VIRU/1-553-----------MPF.....Y....KRWRRWRWRR.....................RPRRLWRRRFRRPLY..RRFWRR..
A7VLW0_9VIRU/1-507-----------MAF.WWRRR....RK..PWFG...........................RWRRYRRRTNYKPRR..KRRR
Q0ZLH9_9VIRU/1-573-----------MAWRWWWRR....RR..PW.....R.WRW.RR.RRRPARR....RRRRRPARRARRPRV..RRW.RRR.
Q5ENW7_9VIRU/1-501-----------MAP.....T....RR...WRR.......................RFGRRRRRYRKRRYGWRRRYYRYRP
A7VLX2_9VIRU/1-509-----------MPF.WWARR....RK..PWYGRF.....................RRRYRYRPYKKR.....RR..RRR.
Q80AR5_9VIRU/1-594-----------MAWGWWLKR.WRRRKKPAWKKWRTR..RWRRF.RRR........RPKRTYGRRRRRRTV......RRRR
Q91CZ2_9VIRU/1-601-----------MAYSYWWRR....RR...WPW..RG..RWRRW.RRR..RRIPRRRPRRPVRRYRRR.PV..RR..KRRW
CAPSD_TTVG1/1-514-----------MPF.WWGRR....NK..FWYG.............................RNYRRKKRRFPKR..RKRR
Q98Y63_9VIRU/1-581-----------MAWRWWWAR....RR.PNRRWTRRR...WRRL.RTR........RPRRPVRRRRRRPRV...R..RRRW
Q9QU36_9VIRU/1-529-----------MPYFY........RR...WFPRRR....................RFRRSWRRRIRGPFR..RKYWR...
A7VM12_9VIRU/1-509-----------MPF.WWRRR....RK..PWYG.......................RFRYRRRFQTKRRRN..RR......
A7VLV6_9VIRU/1-508-----------MPF.WWARR....RR..PWFGRY......................KRYKTRRYRRRFRP..KR..HRY.
Q9JG50_9VIRU/1-535-----------MPPYNYYRW....NNWRRPTYRRRR...................WRRRQYRRRRPRPFIR.RRFWR...
A7VLW4_9VIRU/1-507-----------MPF.WWNRR....RK..NWWG........................YKYKTRKYRRRRWP..RR..RRQT
A7VM04_9VIRU/1-513-----------MPF.YWRRR....RK..FWWGKA.....................RPRWRFQRYRRKTT...RR..RRRR
A7VLY4_9VIRU/1-498-----------MPF.WWNRR....KR..WWRGAR.....................RPWYKRKRYTRRYR...RR......
CAPSD_TTVD1/1-324-----------MAY....FR....RN..FYGGRRHY...................YRRRNAYTRRRYRRV..RR......
Q91CZ6_9VIRU/1-596-----------MA..YWWRR....RR...WPW..RR..RWRRR.GRR..RRVPRRRYRRPVRRYRKRYTV..RR..RRRR
A7VM08_9VIRU/1-506-----------MPF.WWTRR....RK..PWFGT......................WRQRRYRRRRRRTTY..KR..RKP.
CAPSD_TTVV3/1-573-----------MAWYWWRRR....RRRGWWKPRRRR...WRRR.RA.........RRRGPARRHRARRRV..RR..RR..
Q91D00_9VIRU/1-593-----------MAWRWWWRRRWKPRRRPAWTKYRRR..RWRRL.RPR........RPRRLARGRRRRRTV......RRRR
Q99AR5_9VIRU/1-604-----------MA..WWGRW....RR...WPRRRWR..RWRRRRRRR....LPTRRTRRAVRGLGRRPRKTVRR..RRRR
Q9DTD2_9VIRU/1-559-----------MAFWWWRRR....RR.ARWRRRAAA.RRWRRR.RP.........RRRRAARRAGRRRRV..RR..RR..
Q91D04_9VIRU/1-591-----------MAWTWWWQR....RR.RRWPWRRRR...WRRL.RTR........RPRRLVRRRRKRYRV..RR..RRRW
CAPSD_TTVV8/1-571-----------MAWP.WRRR....RW..RWRRRRPRWRRWRRR.RT.........WRRRP.RRAVRRRRV..RR..R...
Q5ENX0_9VIRU/1-603-----------MAWWGW.......RRRWGWRPRWRRRRRWTRR.RRR....VPARRPRRPVRRHRKRYRV...R..RRRW
O90364_9VIRU/1-590-----------MAYGWWRRR....RR..RWRRWRPR..PWRPRWRT.........RRRRPARRRGHRRNV..RR..RRRG
Q9IFV0_9VIRU/1-583-----------MAWRWWWRR....RR..RWP.RRRR.TTW.RR.RPRP.......RRRRRTARTRRRGRV..RRW.RRR.
Q9QUE7_9VIRU/1-586-----------MAYGWWRRR....RR..RWKRWRRR.PRWRRPWRT.........RRRRPARRRGRRGTV..RR..RRR.
A8DMR2_9VIRU/1-531-----------MPY..............YWRGWRRR...................RRRRFWRRRAGAPFRR.RRYWRY..
Q9DUH8_9VIRU/1-609-----------MPWGWW.......RR...WRRRPRRWRRWRRWGRR.........RTRWGLRTRRARAAV...R..RRRR
A7VLW8_9VIRU/1-511-----------MPF.WWGRR....RK..YWWGRR.....................FTRPKYRRYQ.......RR..RKR.
Q99AQ3_9VIRU/1-582-----------MS..WWGWR....RR...WWWKPRR..RWRRR.RARRPRRLPRRRYRRPTRRYRGR.RV..RR..RRAG

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421------------------------LR------------------------------------------------------
POLG_RHDVF/1768-2065------------------------GK------------------------------------------------------
CAPSD_FCVUR/112-395------------------------..------------------------------------------------------
CAPSD_NVN68/2-294------------------------MM------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------RNRRRRPRRGSR-----SAPSSADANFRVLSQQL--------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------STSGTGKMTRAQRRAA--------------------------------

PF03566

Q80IX5_PRVFL/54-754NMSVRAQNVTVSNSRRRRRKNRKPRK.....QVEQATILKPQLLPGES--------------------------------
CAPSD_NCBVS/1-608.....SQGNQGRNNNNKRRRRRRGLKLPPVVAPITSPGQMAEPANHAN--------------------------------
CAPSD_HASV/2-647...VSANTVTVNGRRNQRR..RTGRQVSPPDNFTAAAQDLAQSLDANT--------------------------------

PF01829

CAPSD_NODAM/42-399----------MAATNNMLKMSAPGLDFLK--CAFASPDFSTDPGKGIP--------------------------------

PF01766

POLS_IBDVU/9-452--------------QQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSET--------------------------------
POLS_DXV96/2-442--------------NTTNEYLKTLLNPAQFISDIPDDIMIRHVNSAQT--------------------------------
POLS_BSNV/7-428--------------NTQIRYLNSLLVPETGSTSIPDDTLDRHCLKTET--------------------------------
POLS_IPNVJ/5-453--------------KATATYLRSIMLPENGPASIPDDITERHILKQET--------------------------------

PF00729

CAPSD_PNLV/47-266VTAPVSSAALI.RYKAPSL------N....GNSMDSVRLASKSLVIE.--------------------------------
CAPSD_MCMVK/23-222RANPPVPRPNPQRNRPPPA------G..........TTCSMSEILLAV--------------------------------
CAPSD_PMVK/39-236TLGP..........SRPRM------G.....QGQGWQKLSHEEIILQV--------------------------------
CAPSD_RCNMV/24-213VAIPFAKTQII.KTVNP..------......PPKPARGILHTQLVMSV--------------------------------
CAPSD_CARMS/51-245ILAFTPRRPRM.TNSPPRT------SRNSPGQAGKSMTMSKTELLCTV--------------------------------
CAPSD_SBMVA/46-262SMAPIAQGTMV.RLREPSL------R.....TAGGVTVLTHSELSTE.--------------------------------
CAPSD_TBSVC/76-269IMAPVAVTRQL.VGSKPKF------T....GRTSGSVTVTHREYLSQV--------------------------------
CAPSD_POLVP/66-257IAAPVANTRII.RASKPKF------T.....RSKGSVTIAHRELLGQF--------------------------------
CAPSD_OCSVU/111-308TAAPVSISRNINRRSKPSI------K.....MMGDAVVISHSEMLGAI--------------------------------
CAPSD_TNVA/61-272IVAPTSGGVVT.RPIVPKF------S.....NRGDSTIVRNTEILNN.--------------------------------

PF11729

CAPSD_SJNNV/1-340KLAKPPTTKAA-NSQPRRR------ATQRRRSGRADAPLAKASTITGF--------------------------------

PF00894

CAPSD_PLRV1/70-207----------------------------------ETFVFTKDNLVGNT--------------------------------
CAPSD_PEMVW/53-187----------------------------------D.FSMVHGPFNGNA--------------------------------
CAPSD_BYDVP/62-199----------------------------------EVFVFSVDNLKANS--------------------------------

PF03014

CAPSD_HEVCH/41-659PTNPFAPDVTAAAGAGPRV------RQPARPLGSAWRDQAQRPAAASR--------------------------------

PF03115

CAPSD_HASV1/1-416RSRSKSRARSQSRGRDKSVKITVNSRNRARRQPGRDKRQSSQRVRNIV--------------------------------

PF00983

COAT_TYMV/8-177--APQDRTVTV-ATVLPAV-------------PGPSPLTIKQPFQSE---------------------------------

PF02247

POL2_SQMVM/246-618PENTGCALAICFNSGITGA.ADTDIYTTSSQNAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAH..FAVQCVTGWT
POL2_CPMVS/460-832SDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR..MTVICVSGWT
POL2_BPMV/447-819PENTGIALACAMNSSIRGR.ASSDIYTICSQDCELWNPACTKAMTMSFNPNPCSDAWSLEFLKRTGFH..CDIICVTGWT
Q9Z006_9SECO/476-846APTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPYVEFCFQAFFLCRLVEHALFRVFQICSCGGHTDIVQVA
O12663_9SECO/321-691APTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPFVEFIFKPFSCADWWNMHYLGSFKCAPVVVIQTLSKWL
Q9YWK0_9SECO/363-735PENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVWNPACEKAVELSFNPNPCSDAWNFVFLQKTKAH..FAVQCVTGWT
POL2_CPSMV/437-806AVNTGLGLAICFNSGIRGK.ASADIYATCSQDAMIWNPSCTKVMQYAFNPNPCSDGWSLAFLERTGYH..CVVTCVTGWT
POL2_RCMV/407-778PENTGCCLAITVNSSNRGQ.FSTDIYTTGSQDRILWNPACSKNCDFSFNPNPCGTAWSLEFLRRTKFH..LSVTCVSGWS
Q9YWJ9_9SECO/452-824PENTGCALAICFNSGITGA.ADTDIYTTSSQDAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAH..FAVQCVTGWT
Q66170_CPMVS/343-715SDNSGCCLMLAINSGVRGK.YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR..MTVICVSGWT

PF03391

CAPSD_TRSV/179-344-------------------------------PTMTWPIQL.GDTFAID--------------------------------
POL2_RRVS/768-936-------------------------------PTFVWPPKP.TDISLLK--------------------------------
POL2_BRAV/1268-1433-------------------------------PTLVLPQAFGGDLPLDL--------------------------------
Q65029_ARMV/745-916-------------------------------PNFIYSADA.FNGSLKF--------------------------------
POL2_ARMVS/792-963-------------------------------PNFIYSADA.FNGSLKF--------------------------------
Q67703_GFLV/166-336-------------------------------PTLVFDPGV.FNGKFQF--------------------------------
POL2_GFLV/771-941-------------------------------PTLVFDPGV.FNGKFQF--------------------------------
POL2_BRSV/1007-1170-------------------------------QPLSYPIEA.RHLTDLN--------------------------------
POL2_GCMV/981-1144-------------------------------SIVTYPISL.EHLKDIE--------------------------------
POL2_TORVR/1497-1662-------------------------------PFITLPHIF.NRLDIGY--------------------------------
Q88483_9SECO/1003-1166-------------------------------NPLTYPIKP.GHLEDLD--------------------------------

PF02443

Q5Y4T0_PCV2/5-226----------RPWLVHPR..HRYRWRRK..-.......NGIFNTRLSR--------------------------------
Q27W03_PCV1/5-227----------RPYLAHPAFGNRYRWRRK..-.......TGIFNSRLST--------------------------------
A3FEQ4_9CIRC/3-256----------RGLRR......RLRRRRLRI-GRPRRRFS.VVTFKVTR--------------------------------
Q3HUU1_GOCV/5-247----------ANRRR......RYRRRRLHI-GRIRSKYT.IFNVKQTQ--------------------------------
Q1L2D2_9CIRC/1-237----------RHYRR......RRRTRRLPR-NRRGHRANRVYYFRLRH--------------------------------
CAPSD_CACV/7-243----------RYWXR......R...RRIPA-NRRGHRTNRVYRFRFVR--------------------------------
Q0H9S8_9CIRC/4-236----------RHWRR..........RRL.T-NRRGHRTNRVYRFKFVR--------------------------------
Q06J73_9CIRC/8-245----------RHWRR......R...RRIPA-NRRGHRTNRIYRIKLVR--------------------------------
Q9DXG3_BFDV/11-242----------RHIR.......RYRRRRRHF-RRRRFSTNRIYTLRLTR--------------------------------
Q69EZ5_BFDV/7-239----------RHIR.......RYRRRRRHF-RRRRFTTNRIYTLRFKR--------------------------------
Q9DXG0_BFDV/11-242----------RHIR.......RYRPRRTYF-RRRRFSTNRIYTLRLKR--------------------------------
Q9DXF4_BFDV/3-235----------RHIRR.....YRYRQRRRHF-CRRRFTTNRLYTIRLKR--------------------------------

PF02956

A7VLZ2_9VIRU/1-506RLYKRKHR..RTYRRRRKSFRKVRRKRRTL.PLKQWQPETIRKCKVKG--------------------------------
Q9WT88_9VIRU/1-603RRRTY.....RRGWRRRRYIR.RGRRKKKL.ILTQWNPAIVKRCNIKG--------------------------------
Q91CY9_9VIRU/1-581GRRRGRRRLYRRTYRKR......RKRRKKM.TLKMWNPSTIRACNIRG--------------------------------
A7VLY0_9VIRU/1-515PYGRRR........RRRRRKRKVRRKRQRI.IVKQWQPESIVKCEIKG--------------------------------
Q9JGT1_9VIRU/1-585GR.WTRTY..RRWRRKG.....RRRSKKKL.IIRQWQPNYRRRCNIVG--------------------------------
Q80QT8_9VIRU/1-595GRRRW.....RRGYRRRLRLRRRRRRRKKI.ILTQWNPAKVRKCTIRG--------------------------------
CAPSD_TTVB1/1-533..........RRWVRRRRFFR.FKRKLRKI.RIDQWQPETIRKCHVKG--------------------------------
A7VM00_9VIRU/1-509.IRRRRNR..RTNRRRRRRRYKVRRKQKKI.TLKQWQPESIKKCKIKG--------------------------------
Q9JG61_9VIRU/1-534..........RRWVRKRRFFKYKKRKLKKI.RLSQWQPDSIRKCTIKG--------------------------------
Q91PS3_9VIRU/1-581RRGWAR....RRYLRARR....RVKRRKKI.KLTQWNPTVVKKCVVKG--------------------------------
CAPSD_TTVV4/1-560QWGRPR....RYRPRRRR....RRRKRQKI.KLKQWNPAVTKFCRIIG--------------------------------
Q91C93_9VIRU/1-546..........RYRVRKRH....FKRKLSKL.TIQEWQPPSIRKLTIKG--------------------------------
Q2F827_9VIRU/1-589GRRRRRRRV.FYKRRRRKTGRLYRKPKKKL.VLTQWHPTTVRNCSIRG--------------------------------
Q91CY5_9VIRU/1-584RGRRGRRTYTRRAVRRR......RRPKKKL.VLTQWSPQTVRNCTIRG--------------------------------
Q8V7G9_9VIRU/1-572RRRRR.....RGRRRRGR....RRRKRQTL.IPRQWQPDVTKKCFITG--------------------------------
Q99A78_9VIRU/1-584GR.WRRRY..RKWRRKG.....RRRGKKKI.IIRQWQPNYRRRCNIIG--------------------------------
Q6H9C2_9VIRU/1-573GR.WRRRY..RKWRRGRR....RRTHRKKI.VIKQWQPNFIRRCYIIG--------------------------------
CAPSD_TTVT1/1-433WGRRRRVR..RYRRRR......GGTKRQYISSIMQWNPQHRHLCYIKG--------------------------------
Q9JG80_9VIRU/1-589GRRRYRRGWRRRTYVRKGR...HRKKKKRL.ILRQWQPATRRRCTITG--------------------------------
A7VLZ6_9VIRU/1-506.YGRRRNYR.RPARRRRRKLRKVRRKKKQI.AVKQWQPESITKCKILG--------------------------------
Q6H9D2_9VIRU/1-557RRGWAR....RYRLRRRR....RRRRRRKL.ILTQWQPAKIRKCLVIG--------------------------------
Q6H999_9VIRU/1-471..................................KG............--------------------------------
Q77JT5_9VIRU/1-606GR.WRRAY..RRWGRRRR....RRRHKKKL.VLTQWQPAVVKRCLIVG--------------------------------
Q91PS7_9VIRU/1-585RRAWGR....RRYIRRRR....LRRRRKKI.PITQWNPSVVRKCVVTG--------------------------------
CAPSD_TTVV9/1-555RVRRRGYY..RRYRRR......RRYKRRLL.ILKQWQPTTNLRLTVKG--------------------------------
Q9JG47_9VIRU/1-553..........KYRVR........KRKLKYL.PLRQWQPHYINKLKVQG--------------------------------
A7VLW0_9VIRU/1-507IYRRRRNY..RTTKGRRRRRYKVRRKQQKI.LVKQWQPECIRKCKIKG--------------------------------
Q0ZLH9_9VIRU/1-573.RVWAP....RPYIRRRR....RSFRRKKI.KITQWNPAVTKKCTVTG--------------------------------
Q5ENW7_9VIRU/1-501RDYRR.....RWLVRRRRRSVYRRGGRRAR.PYRLFNPKVMRRVVIRG--------------------------------
A7VLX2_9VIRU/1-509RFTRRRNF..KASRRRRRRRYEVRRKRQKI.VLKQWQPESIKKCKVKG--------------------------------
Q80AR5_9VIRU/1-594VRRLR.....RRGWTRRRYIR.RRRRKKKL.VLTQWNPQDVRRCTIRG--------------------------------
Q91CZ2_9VIRU/1-601GRRGRRRRYTRRYRRRLT....VRRKRNKL.RLSVWQPQNIRYCAIKG--------------------------------
CAPSD_TTVG1/1-514FYRRTKYR..RPARRRRRRRRKVRRKKKTL.IVRQWQPDSIVLCKIKG--------------------------------
Q98Y63_9VIRU/1-581GRRRGRRRFYRRRFKKR......RRRRRKL.TLKMWNPSTIRACNIKG--------------------------------
Q9QU36_9VIRU/1-529..........RHWVRRYS....RKRKLSKL.NIKEWQPITIRKTKVKG--------------------------------
A7VM12_9VIRU/1-509RFTRRRNRRVTRRRRRRTRHQKVRRKKNKI.PVLQWQPDSIRKCHIKG--------------------------------
A7VLV6_9VIRU/1-508PFRRRR.......RRRRRRRYKVRRKKKKI.VIQQWQPESIKKCKIKG--------------------------------
Q9JG50_9VIRU/1-535..........RHTVRRRR....IKKKLKKI.KIYEWQPTVIKKCHIKG--------------------------------
A7VLW4_9VIRU/1-507LYRRRRPT..RTNRRRRRRHRKVKRKRKTL.TVKQWQPESIRKCKIIG--------------------------------
A7VM04_9VIRU/1-513PARKRAH...RYAGRRRRRRYKVRRKRQKI.PLFQWQPDKIVKCKIKG--------------------------------
A7VLY4_9VIRU/1-498IYKNRRRR..PTRRRRRRRHTKVRRKRQTI.PVRQWQPERIVRCKIKG--------------------------------
CAPSD_TTVD1/1-324..........RHRGRRFPYFKQGKRRRTRL..LHVTDPRYKAHCTITG--------------------------------
Q91CZ6_9VIRU/1-596GRRGRPRR..RLYRRRYT....LRRKRKRL.IIKQWQPNNIRKCRITG--------------------------------
A7VM08_9VIRU/1-506RYNRRRPR..RLTRRRRRRKYKVRRKQKKI.HLTQWQPDRIRKCKIKG--------------------------------
CAPSD_TTVV3/1-573GR.WRRRY..RRWRRRGG....RRRHRKKL.IIKQWQPNFIRHCYIIG--------------------------------
Q91D00_9VIRU/1-593VRRLRR....RRGWTRRRYL..RRRKRRKL.ILTQWNPNIVRRCSIKG--------------------------------
Q99AR5_9VIRU/1-604PRRTY.....RRGWRRRRYIRRRRGRRKKL.TLTMWNPNIVRRCNIEG--------------------------------
Q9DTD2_9VIRU/1-559GR.WRRAH..RRWRRRRG....RRRHKRKL.IIRQWQPPYTRRCYIVG--------------------------------
Q91D04_9VIRU/1-591GRRRGRRTYLRRRLKK.......RKRRKKL.RLTQWNPSTIRGCTIKG--------------------------------
CAPSD_TTVV8/1-571GRGWRRLY..RRYRRRRG....RRTYKKKP.VLTQWQPTVRRRCFIIG--------------------------------
Q5ENX0_9VIRU/1-603GR........RYTRRGRLRLRRRRRRRKKI.VLTQWNPQTVRRCYIRG--------------------------------
O90364_9VIRU/1-590GR.WRRRY..RRWKRKG.....RRRKKAKI.IIRQWQPNYRRRCNIVG--------------------------------
Q9IFV0_9VIRU/1-583GRGWRR....RTYIRRRR....R..RKKKI.NIQQWNPATVKKCVVTG--------------------------------
Q9QUE7_9VIRU/1-586GR.WRRRY..RRWRRKG.....RRRRKKKL.IIRQWQPNYTRKCNIVG--------------------------------
A8DMR2_9VIRU/1-531..........RYRVRR......LRRKPKKL.PIKQWQPTKMRRLTVTG--------------------------------
Q9DUH8_9VIRU/1-609GRVRRRARGGRRYHYRRRFRRRRARRRKKI.VLTQWNPQTVRKCLIRG--------------------------------
A7VLW8_9VIRU/1-511PIRRRKPR..RTYRRRYRRRKKVRRKRKTL.LVRQWNPDSILTCKIKG--------------------------------
Q99AQ3_9VIRU/1-582GWRGR.RRYSRRYSRRLT....VRRKKKKL.TLKIWQPQNIRRCKIRG--------------------------------

PF00073

Q9WMA0_9PICO/49-215-----------------------------------DQSSVHTAEVGSH--------------------------------
POLG_AEVCA/45-212-----------------------------------DQSSVSTATMGSL--------------------------------
POLG_CXA9/93-300-----------------------------------TTQECANVVVGYG--------------------------------
POLG_CXB3N/93-302-----------------------------------TTQECANVVVGYG--------------------------------
POLG_CXB4J/93-300-----------------------------------TTQECANVVVGYG--------------------------------
POLG_CXA21/93-308-----------------------------------TTQEAANAIVAYG--------------------------------
POLG_POL1M/93-308-----------------------------------TTQEAANSVVAYG--------------------------------
POLG_POL3L/93-307-----------------------------------TTQEAANSVVAYG--------------------------------
POLG_HE701/93-288-----------------------------------VTQEAANICCAYG--------------------------------
POLG_BOVEV/93-285-----------------------------------TTQEAANICVAYG--------------------------------
POLG_HRV14/93-299-----------------------------------TTQEAANAVVCYA--------------------------------
POLG_HRV2/93-302-----------------------------------TSQDVANAIVAYG--------------------------------
POLG_HRV8A/93-302-----------------------------------TSQDTANAVVAYG--------------------------------
POLG_HRV1B/93-301-----------------------------------TSQDVANAVVGYG--------------------------------
POLG_FMDV1/311-475-----------------------------------TTQSSVGVTYGYS--------------------------------
POLG_FMDVT/311-475-----------------------------------TTQSSVGVTFGYA--------------------------------
POLG_FMDVO/311-475-----------------------------------TTQSSVGVTYGYA--------------------------------
POLG_EMCV/161-359-----------------------------------........TPSQQ--------------------------------
POLG_TMEVB/172-382-----------------------------------NTQSTVGRLCGYG--------------------------------
POLG_ENMGO/162-361-----------------------------------NTQSTVGRLVGYG--------------------------------
POLG_FMDVO/533-691-----------------------------------VFNPPRNQLPGRF--------------------------------
POLG_FMDV1/533-692-----------------------------------VYNPPKTNYPGRF--------------------------------
POLG_EMCV/420-582-----------------------------------TPVAPSNYMVGEY--------------------------------
POLG_TMEVB/443-606-----------------------------------TISTPSDYMCGEF--------------------------------
POLG_HE701/347-515-----------------------------------FSPTPEMHIPGQV--------------------------------
POLG_HRV2/358-522-----------------------------------YHPTKEISIPGEV--------------------------------
POLG_HRV8A/364-529-----------------------------------FHPTKEIFIPGQV--------------------------------
POLG_HRV1B/360-525-----------------------------------YHPTKEISIPGEV--------------------------------
POLG_BOVEV/345-515-----------------------------------FQPTLEIFIPGKV--------------------------------
POLG_CXA21/369-534-----------------------------------FDVTPPIHIPGEV--------------------------------
POLG_CXA9/358-524-----------------------------------FDVTPSMNIPGEV--------------------------------
POLG_CXB4J/358-524-----------------------------------FDVTPEMNIPGQV--------------------------------
POLG_CXB3N/360-526-----------------------------------YDVTPEMRIPGEV--------------------------------
POLG_CXB1J/360-526-----------------------------------FDVTPEMQIPGRV--------------------------------
POLG_FMDVO/725-872-----------------------------------......TTSAGES--------------------------------
POLG_FMDV1/726-878-----------------------------------......TTTTGES--------------------------------
POLG_BOVEV/610-775-----------------------------------DESMIETRTIVPT--------------------------------
POLG_HRV8A/621-792-----------------------------------PEDMIETRYVITD--------------------------------
POLG_HRV2/614-772-----------------------------------PEDVIETRYVQTS--------------------------------
POLG_HRV1B/627-786-----------------------------------..........MTS--------------------------------
POLG_HE701/609-781-----------------------------------....IQTRTVINM--------------------------------
POLG_HRV14/614-787-----------------------------------PSDSIETRTTYMH--------------------------------
POLG_CXA9/612-783-----------------------------------PSDTMQTRHVKNY--------------------------------
POLG_CXB4J/612-783-----------------------------------PSDTMQTRHVHNY--------------------------------
POLG_SVDVU/612-782-----------------------------------PSDTMQTRHVKNY--------------------------------
POLG_CXB3N/630-782-----------------------------------.............--------------------------------
POLG_POL1M/636-806-----------------------------------PSDTVQTRHVVQH--------------------------------
POLG_CXA21/642-812-----------------------------------.........VINY--------------------------------
POLG_CXA24/646-809-----------------------------------.........VVNY--------------------------------

PF00915

CAPSD_VESVA/137-421----------STAD.VNSNF.TFRAESDGPGSTEIVTEEQGT.IVQQQ--------------------------------
POLG_RHDVF/1768-2065----------ARAAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVIT--------------------------------
CAPSD_FCVUR/112-395----------..KA.WDPNLPLFRLEADD...GSITAPEQGT.VVGGV--------------------------------
CAPSD_NVN68/2-294----------ASKD........ATSSVDGASGAGQLVPEVNA.SDPLA--------------------------------

PF08762

Q8B107_ALPV/599-804-----------------------------------T..SSA.LTVGEK--------------------------------
O56051_9VIRU/590-790-----------------------------------TFNASM.LMMGEK--------------------------------
Q56QP7_9VIRU/684-855-----------------------------------SPNAVMGKIAGER--------------------------------
O36967_9VIRU/668-900-----------------------------------S..PEA.HCIGEK--------------------------------
Q5UBY1_9VIRU/79-259-----------------------------------NMEALL.KGSGEQ--------------------------------
Q6ITS9_9VIRU/106-313-----------------------------------NPNISL.LISGEV--------------------------------
Q4JFT2_9VIRU/834-1009-----------------------------------T...ML.TTMGEQ--------------------------------

PF00760

CAPSD_CMVFN/11-215-------------SRLNKTLAAGRPTINH------PTFVGS------------------------------------E--

PF01318

CAPSD_BMV/2-188-------------ARRNRWTARVQPVIVE------PLAAGQ------------------------------------GKA

PF03566

Q80IX5_PRVFL/54-754-------------VAPSGGRGTMDPPVHEICAQSIDPSEGAVGWFYKYMD-PAGAVESGKALGEFSKVPDGLLRYSVDAE
CAPSD_NCBVS/1-608-------------TRVNRGRTRV.RGLRQ.AMMESPMAATSEAWIHDYLD-PDGEYKTS.L..DDGKIPDGAIPQSTCGQ
CAPSD_HASV/2-647-------------VTFPANISSM.PEFRNWAKGKIDLDSDSIGWYFKYLD-PAGATESARAVGEYSKIPDGLVKFSVDAE

PF01829

CAPSD_NODAM/42-399-------------DKFQGLVLPKKHCLTQ----SITFTPGK-----------------------QTMLLVAPIPGIACLK

PF01766

POLS_IBDVU/9-452-------------STYNLTVGDTGSGLIV----FFPGFPGSIVGAHYTLQ.SNGNYKFDQMLLTAQNLPAS---YNYCRL
POLS_DXV96/2-442-------------ITYNLKSGASGTGLIV----VYPNTPSSISGFHYIWDSATSNWVFDQYIYTAQELKDS---YDYGRL
POLS_BSNV/7-428-------------TTENLVAALGGSGLIV----LFPNSPSGLLGAHYTKT.PQGSLIFDKAITTSQDLKKA---YNYARL
POLS_IPNVJ/5-453-------------SSYNLEVSESGSGLLV----CFPGAPGSRVGAHYRWNLNQTALEFDQWLETSQDLKKA---FNYGRL

PF00729

CAPSD_PNLV/47-266-------------..........AV--------KVGIEYQV------------------------SVVPLVP..CIQHT-
CAPSD_MCMVK/23-222-------------SATTA.DQILEI--------PVCAGIDF------------------------PA.GTSPRYIGAAK-
CAPSD_PMVK/39-236-------------NSSTAADTIQTI--------PIIPRLSV------------------------PA.GDKPIYSGSAP-
CAPSD_RCNMV/24-213-------------VGSVQ......M--------RTNNGKSN------------------------QRFRLNPSNPALFP-
CAPSD_CARMS/51-245-------------KGTTGVIP....--------......SF------------------------EDWVVSPRNVAVFP-
CAPSD_SBMVA/46-262-------------...........L--------SVTNAIVI------------------------TSELVMP..YTMGT-
CAPSD_TBSVC/76-269-------------NNSTG......F--------QVNGGIVG------------------------NLLQLNPLNGTLFS-
CAPSD_POLVP/66-257-------------NNSSG......L--------VVNGGVSG------------------------NLYRINPSNPVVFP-
CAPSD_OCSVU/111-308-------------NSGTPSSNVTAF--------RCTG....------------------------..YRANPGMSTIFP-
CAPSD_TNVA/61-272-------------......QILAAL--------GAFNTTNS------------------------ALIAAAP......S-

PF11729

CAPSD_SJNNV/1-340-------------GRATNDVHISGMSRIAQAVVPAGTGTDG------------------------KIVVDSTIVPELLP-

PF00894

CAPSD_PLRV1/70-207-------------QGS---------------------------------------------------FTFGPSLSDCPA-
CAPSD_PEMVW/53-187-------------TGT---------------------------------------------------VKFGPS.SDCQC-
CAPSD_BYDVP/62-199-------------SGA---------------------------------------------------IKFGPSLSQCPA-

PF03014

CAPSD_HEVCH/41-659-------------RRPTTAGAAPLTAVAPAHDTPPVPDVDSRGAILRRQYNLSTSPLTSSVATGTNLVLYAAPLSPLLP-

PF03115

CAPSD_HASV1/1-416-------------NKQLRKQGVTGPKPAICQRATATLGTVG--------SNTSGTTEIEACILLNPVLVKDATGSTQFG-

PF00983

COAT_TYMV/8-177---------------------------------VLFAGTKD---------------------------AEASLTIANID-

PF02247

POL2_SQMVM/246-618TTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRWMGK--------------LSFPQGPARVLKRMPLAIGGGA-G
POL2_CPMVS/460-832LSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRWMGK--------------LTFPQGVTSEVRRMPLSIGGGA-G
POL2_BPMV/447-819ATPMQDVQVTIDWFISSQECVPRTYCVLNPQNPFVLNRWMGK--------------LTFPQGTSRSVKRMPLSIGGGA-G
Q9Z006_9SECO/476-846ERSEVDARISFAIYYEPTITLPKQIATLEHAPAFMFRKELGT--------------LAFKQG.ELVAYSFEVNFGKPQ-T
O12663_9SECO/321-691NSPKVDARISFAIYYEPSIVLPKQIATLEHAPAFMFRKELGT--------------LAFKQG.ERVAYSFEVNFGKPQ-T
Q9YWK0_9SECO/363-735TTPLTDLALVLTWHIDRNLCVPETLTISSAHASFPINRWMGK--------------LSFPQGPARVLKRMPLAIGGGA-G
POL2_CPSMV/437-806GTPLQDTFMTINWHISREACVPKIYTIFDPEPDMMLNRWMGR--------------AIFPQQSTQVVRRMPLSIGGGA-G
POL2_RCMV/407-778AQPQTDIAMTMDWYVSNKPCVPCIYNVGTPGQNVWVNRWMGK--------------LSFPQGSQNQLKQMPLAIGGGA-G
Q9YWJ9_9SECO/452-824TTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRWMGK--------------LSFPQGPARVLKRMPLAIGGGA-G
Q66170_CPMVS/343-715LSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRWMGK--------------LTFPQGVTSEVRRMPLSIGGGA-G

PF03391

CAPSD_TRSV/179-344--------------------------------------RYYE--------------AKEIKLDGSTSMLSISYNFGGPVK
POL2_RRVS/768-936--------------------------------------EVWG--------------PYRFTLDGTEAKESFAIMPGTAIL
POL2_BRAV/1268-1433--------------------------------------WRGP--------------YTFPLGGGTKRLSTSLDIGTSTTT
Q65029_ARMV/745-916--------------------------------------LTIP--------------PLEYDLSATSAYKSVSLLLGQTLV
POL2_ARMVS/792-963--------------------------------------LTIP--------------PLEYDLSATSAYKSVSLLLGQTLV
Q67703_GFLV/166-336--------------------------------------LTCP--------------PIFFDLTAVTALKSAGLTLGQVPM
POL2_GFLV/771-941--------------------------------------LTCP--------------PIFFDLTAVTALRSAGLTLGQVPM
POL2_BRSV/1007-1170--------------------------------------LMLA--------------PKQIAVGTYAMITFPVSLAAKLQS
POL2_GCMV/981-1144--------------------------------------IMLP--------------PRQMAIGNAGSINFPLSFAVQQKS
POL2_TORVR/1497-1662--------------------------------------WRGP--------------TEIDLTSTPAPNAYRLLFGLSTVI
Q88483_9SECO/1003-1166--------------------------------------LVLK--------------SGSIAIGTYTMTKVPVSLAMRVDS

PF02443

Q5Y4T0_PCV2/5-226-------------TIGYTVK..------------------------------------.ATTVRTPSWNVDMMRFNINDF
Q27W03_PCV1/5-227-------------EFVLTIK..------------------------------------..GGYSQPSWNVNYLKFNIGQF
A3FEQ4_9CIRC/3-256-------------HTVFGFFGS------------------------------------GTGPTATGRWQSLSLEDGAQYT
Q3HUU1_GOCV/5-247-------------NISFTFF..------------------------------------GTGSPEKNKWQAMSLEAVQSSG
Q1L2D2_9CIRC/1-237-------------SVKVTLQ.K------------------------------------DEG..GSFKYGTDVFTFTLEDV
CAPSD_CACV/7-243-------------EFGQVLQ.K------------------------------------GTGG.SQLSFGTDGINIILDDF
Q0H9S8_9CIRC/4-236-------------MYRQECA..------------------------------------GSGD.TTLKWATDGLNIMLDDF
Q06J73_9CIRC/8-245-------------QYQQILG.K------------------------------------AENA.GAFRFGTDGVTIILKDF
Q9DXG3_BFDV/11-242-------------QFQFKIN.K------------------------------------QTTSVGNLIFNADYITFALDDF
Q69EZ5_BFDV/7-239-------------QFKFQIE.K------------------------------------QTTATATMTWKSDYITFALSDF
Q9DXG0_BFDV/11-242-------------QFKFEIR.K------------------------------------QTTQPGNLIWNADYVTFTLENF
Q9DXF4_BFDV/3-235-------------EFKFDIN.K------------------------------------QTTQTGQIIWNSDYVTFALSDF

PF02956

A7VLZ2_9VIRU/1-506-------------IGIHTLGVE...GTQYRCYTANKYEYTIA....K.........QPSGGGFGVERYTLEYLYKEHKAG
Q9WT88_9VIRU/1-603-------------GLPIIICGE...PRAAFNYGYHMEDYTPQ....P.........FPFGGGMSTVTFSLKALYDQYLKH
Q91CY9_9VIRU/1-581-------------FIALVVCGH...TRAGCNYAIHSEDYIPQ....L.........RPYGGSFSTTTWSLKLLFDEYLKF
A7VLY0_9VIRU/1-515-------------LGCLVAGAQ...GRQPFCYTNSKYEYPQP....K.........APGGGGFGAELFTLQYLYDEWVAR
Q9JGT1_9VIRU/1-585-------------YMPLLICGE...NTVARNYATHSDDCYFP....G..........PFGGGMTTDKFTLRILYDEYKRF
Q80QT8_9VIRU/1-595-------------VLPMILAGA...GRFAFNYGLHSDDITVQKPLNQ.........NPHGGGMSTVTFSLQVLYDQHQRF
CAPSD_TTVB1/1-533-------------NLCLLTCGR...GNINHNYILTSESYVPT....S.........EPGGGSWSILQMTTRVLYDEYKAA
A7VM00_9VIRU/1-509-------------TGQIVLGAE...GTQFRCFTVYKNEFTNP....K.........VATGGGFGVELFSLKYLYQEYLAR
Q9JG61_9VIRU/1-534-------------QLCLLTCGI...GRINNNFTLTAESYVPI....S.........EPGGGGWSIMQITLRALYDEYEHY
Q91PS3_9VIRU/1-581-------------YLPLLICGTGTTGTTYRNYGSHMHDYRKY....D..........PFGGGISTMQFNLSILFDEYMKH
CAPSD_TTVV4/1-560-------------YYPLIICGE...GTTVRNYNVHSQDYVQY....E..........SYGGGMTTTMFNLKVPYEQFQLH
Q91C93_9VIRU/1-546-------------YYPLFQSTR...DRLSNNMITYLESIAPH....Y.........VPGGGGFSISCFSLNTLYKEHLKL
Q2F827_9VIRU/1-589-------------LVPLVLCGH...TQGGRNFALRSDDYPKQ....G.........SPYGGSFSTTTWNLRVLFDEHQKH
Q91CY5_9VIRU/1-584-------------IVPMVICGH...TRAGRNFAIHSEDFTSQ....I.........KPHGGSFSTTTWSLKVCWDEHQKF
Q8V7G9_9VIRU/1-572-------------WMPLIICGT...GHTQFNFITHEEDIPGA....G.........ASYGGNLTNITITLGGLYEQYMLH
Q99A78_9VIRU/1-584-------------YMPVLICGN...NTVSRNYATHSDDSYLP....G..........PFGGGMTTDKFTLRILYDEYCRF
Q6H9C2_9VIRU/1-573-------------YLPLIFCGE...NTTAQNFATRSDDMISK....G..........PYGGGMTTTKFTLRILYDEFTRF
CAPSD_TTVT1/1-433-------------ITWLCAARADRMSWPGIKQIAATDSTRYW....S.........TILVGGCGVLTLSMDWFFFENLRW
Q9JG80_9VIRU/1-589-------------YLPIVFCGH...TKGNKNYALHSDDYTPQ....G.........QAFGGALSTTSFSLKVLFDQHQRG
A7VLZ6_9VIRU/1-506-------------HSALVVGAE...GKQMFCYTTNKNIAVPP....K.........SPYGGGFGVEQYSLNYLYEEYTFH
Q6H9D2_9VIRU/1-557-------------YLALVLCGN...GTFSKNYASHSDDYVQK....G..........PFGGGLSSMRFNMRILYDQFKRH
Q6H999_9VIRU/1-471-------------............................................PFGGGHSTMRFSLYILFEERLRH
Q77JT5_9VIRU/1-606-------------FDPLIICGI...NRTIFNYTTHSEDFTFN....N.........DSFGGGLCTAQYTLRILFQEKLAQ
Q91PS7_9VIRU/1-585-------------YIPLLICGTGTTGTTYKNYGSHAADYKKY....D..........PFGGGYSTMQFTLETLFDEWVKH
CAPSD_TTVV9/1-555-------------LIPVVVMGK...GKTQNNFGQWEQTVPLE....G.........ESYGGSFTIRKFTLQTLYEDYLKL
Q9JG47_9VIRU/1-553-------------WYPLAISTK...DRLSNNLNLYLESIAPH....Y.........LHGGGGFTICNFSLMTLYQENLVC
A7VLW0_9VIRU/1-507-------------LGTIVLGAE...GTQYRCYTDYLDEWTNP....K.........VPGGGGFGCELFTLRYLYKMYLAR
Q0ZLH9_9VIRU/1-573-------------YLPVIYCGTGDIGTTFQNFGSHMNEYKQY....N..........AAGGGFSTMLFTMQNLYEEYQKH
Q5ENW7_9VIRU/1-501-------------WWPILQCLK...GQEALRYRPLQWDTERQWRVRSDFEDQYGYLVQYGGGWGSGDVTLEGLYQEHLLW
A7VLX2_9VIRU/1-509-------------FGCLVLGAE...GRQFYCWTNEASNYPQP....K.........APGGGGFGCEVITLEYLYQQYKAH
Q80AR5_9VIRU/1-594-------------IIPLIMCGA...NTASFNYGMHSDDSTPQ....P.........EKFGGGMSTVTFSLFVLYDQYTRH
Q91CZ2_9VIRU/1-601-------------LFPILICGH...GKSAGNYAIHSDDFITS....R.........FSFGGGLSTTSYSLKLLFDQNLRG
CAPSD_TTVG1/1-514-------------YDSIIWGAE...GTQFQCSTHEMYEYTRQ....K.........YPGGGGFGVQLYSLEYLYDQWKLR
Q98Y63_9VIRU/1-581-------------AINLVMCGH...TQAGRNYAIRSEDFYPQ....I.........QSFGGSFSTTTWSLRVLFDEYQKF
Q9QU36_9VIRU/1-529-------------LYPAFLCND...QRIGNNAIQYLDSIAPH....H.........FPGGGGFGIIQFTLQGLYEQFIKA
A7VM12_9VIRU/1-509-------------QGTLVVGAE...GTQMFCYTRDKFKYIPP....K.........TPYGGGFGAEKFTLSYLYEEYTFH
A7VLV6_9VIRU/1-508-------------FGCLVLGSQ...GTQYLCYTNEAANYVPP....K.........SPGGGGFGCEYITLEYLYKQWKAH
Q9JG50_9VIRU/1-535-------------TIPLIQGGK...DRQGFNYAQYQDSYIPS....H.........KGGGGTWSIMVFSLGALYEEWERL
A7VLW4_9VIRU/1-507-------------LEPQLLGAE...GSQIDCFTVVKTDYVPA....K.........LPWGGGFSLQNYTLKYLYSEYTYH
A7VM04_9VIRU/1-513-------------VTTLVLGAE...GKQLVCYTNVKTANTPA....K.........APGGGGFGCEQFSLDSLYADYKLR
A7VLY4_9VIRU/1-498-------------ISVIVLGGE...GKQFQCYTNEATTWTPL....R.........TPGGGGFGVEKYTLSHLYDQYKFG
CAPSD_TTVD1/1-324-------------WVPIAMTRI...QLISQPFTV...DTLSP....F.........HVYPGGYGYGVFTLEAMYKEHLMK
Q91CZ6_9VIRU/1-596-------------MLPMVICGH...GMSANNYAIRSDDTETM....K.........FSFGGGFSTTTFTLKVLYDQHLRG
A7VM08_9VIRU/1-506-------------RGTLIMGAQ...GRQYMCYTNVKDRLTPS....R.........APAGGGFGVERFTLEYLYRQWKAR
CAPSD_TTVV3/1-573-------------YMPLIICGE...NTFSHNYATHSDDMLST....G..........PYGGGMTTTKFTLRILFDEYQRH
Q91D00_9VIRU/1-593-------------IIPLTMCGA...NTASFNYGMHSDDSTPQ....P.........EKFGGGMSTVTFSLYVLYDQFTRH
Q99AR5_9VIRU/1-604-------------GLPLILCGE...NRAAFNYAYHSEDYTEQ....P.........FPFGGGMSTTTFSLRGLYDQYTKH
Q9DTD2_9VIRU/1-559-------------YLPLIMCGE...NCFSKNFATHSDDIDCS....V..........AYGGGMTATQFTLRILYDEFQRH
Q91D04_9VIRU/1-591-------------MAPLIICGH...TMAGNNFAIRMEDYVSQ....I.........RPFGGSFSTTTWSLKVLWDEHTRF
CAPSD_TTVV8/1-571-------------YMPLIICGE...NLTSKNYASHADDFVKD....G..........PFGGGMTTMQFSLRILYDEFLRF
Q5ENX0_9VIRU/1-603-------------LMPVIWAGM...GSGGKNYAVRSDDYTQS...............SFGGSFGTETFSLRVLFDQYQRG
O90364_9VIRU/1-590-------------YIPVLICGE...NTVSRNYATHSDDTNYP....G..........PFGGGMTTDKFTLRILYDEYKRF
Q9IFV0_9VIRU/1-583-------------YVPLLICGTGTTGTTYKNYGSHINDYTKF....D..........PFGGGFSTLMFNLRILFDEYKKQ
Q9QUE7_9VIRU/1-586-------------YMPVIMCGE...NTLIRNYATHADDCYWP....G..........PFGGGMATQKFTPRILYDDYKRF
A8DMR2_9VIRU/1-531-------------KYPLFEGTS...ERIGNNNTQSIDTIAPY....L.........FPSGGLFSITVFTLKGLYELHLKA
Q9DUH8_9VIRU/1-609-------------MFPILWCGS...GAAGKNYALHMDDYTPS..............GGFGGSFSLTTFNLRALYDEHMKG
A7VLW8_9VIRU/1-511-------------FLDILMGAD...GNQYQCYTQNRYSMPPP....K.........HPCGGGFSVDRFTLQWLYDQWRLR
Q99AQ3_9VIRU/1-582-------------LLPLLICGH...TRSAFNYAIHSDDKTPQ....Q.........QSFGGGLSTVSFSLKVLFDPNQRG

PF00073

Q9WMA0_9PICO/49-215-------------QI.......---EPLKTSVDKPGSKK-TQ--------------GEKFFLIHSADWLTTHALFHEVAK
POLG_AEVCA/45-212-------------QDVQYRT..---.....AVDIPGSRV-TQ--------------GERFFLIDQREWNSTQSEWQLLGK
POLG_CXA9/93-300-------------RWPTYLR..---DDEATAEDQPTQPD-VA--------------TCRFYTLDSIKWEKGSVGW.....
POLG_CXB3N/93-302-------------VWPDYLK..---DSEATAEDQPTQPD-VA--------------TCRFYTLDSVQWQKTSPGW.....
POLG_CXB4J/93-300-------------VWPDYLS..---DEEATAEDQPTQPD-VA--------------TCRFYTLNSVKWEMQSAGW.....
POLG_CXA21/93-308-------------EWPTYIN..---DSEANPVDAPTEPD-VS--------------SNRFYTLESVSWKTTSRGW.....
POLG_POL1M/93-308-------------RWPEYLR..---DSEANPVDQPTEPD-VA--------------ACRFYTLDTVSWTKESRGW.....
POLG_POL3L/93-307-------------RWPEFIR..---DDEANPVDQPTEPD-VA--------------TCRFYTLDTVMWGKESKGW.....
POLG_HE701/93-288-------------EWPTYLP..---DNEAVAIDKPTQPE-TS--------------TDRFYTLKSKKWESNSTGW.....
POLG_BOVEV/93-285-------------CWPAKLS..---DTDATSVDKPTEPG-VS--------------ADAFYTLRSKPWQADSKGW.....
POLG_HRV14/93-299-------------EWPEYLP..---DVDASDVNKTSKPD-TS--------------VCRFYTLDSKTWTTGSKGW.....
POLG_HRV2/93-302-------------VWPHYLS..---SKDASAIDKPSQPD-TS--------------SNRFYTLRSVTWSSSSKGW.....
POLG_HRV8A/93-302-------------VWPSYLT..---PDDATAIDKPTQPD-TS--------------SNRFYTLDSRSWTSASSGW.....
POLG_HRV1B/93-301-------------VWPHYLT..---PQDATAIDKPTQPD-TS--------------SNRFYTLESKHWNGDSKGW.....
POLG_FMDV1/311-475-------------TEEDHVA..---GPNTSGLETRV...-VQ--------------AERFFKKFLFDWTTDKPFGY....
POLG_FMDVT/311-475-------------TAEDSTS..---GPNTSGLETRV...-HQ--------------AERFFKMALFDWVPSQNFGH....
POLG_FMDVO/311-475-------------TAEDFVS..---GPNTSGLETRV...-VQ--------------AERFFKTHLFDWVTSDSFGRCH..
POLG_EMCV/161-359-------------WAVLSVM..---VPFMMESIRHHVLT-LL--------------QKRFWRWKGTTPSRLMIGHQHKSP
POLG_TMEVB/172-382-------------KSHHG....---EHPASCADTATDKV-LA--------------AERYYTIDLASWTTSQEAFS....
POLG_ENMGO/162-361-------------TVHDG....---EHPASCADTASEKI-LA--------------VERYYTFKVNDWTSTQKPFE....
POLG_FMDVO/533-691-------------TNLLDVAEA---CPTFLRFEGGV...-..--------------...PYVTTKTDSDRVLAQF.....
POLG_FMDV1/533-692-------------TNLLDVAEA---CPTFLRFDDG.KP.-..--------------....YVVTRADDTRLLAKF.....
POLG_EMCV/420-582-------------KDFLEIAQ.---IPTFIGNKIPN...-..--------------..AVPYIEASNTAVKTQPLA....
POLG_TMEVB/443-606-------------SDLLELCK.---LPTFLG.....NPN-TN--------------NKRYPYFSATNSVPATSMV.....
POLG_HE701/347-515-------------HSMLEIV..---QIESMMEINNVN.D-AS--------------GVERLRVQISAQSDMDQLLF....
POLG_HRV2/358-522-------------KNLVEIC..---QVDSLVPINNTDTY-IN--------------SENMYSVVLQSSINAPDKIF....
POLG_HRV8A/364-529-------------RNLIEMC..---QVDTLIPVNNTQEN-VR--------------SVNMYTVDLRTQVDLAKEVF....
POLG_HRV1B/360-525-------------KNLIEMC..---QVDTLIPVNNVGTN-VG--------------NISMYTVQLGNQMDMAQEVF....
POLG_BOVEV/345-515-------------NNLLEIA..---QVESILEANNRE.G-VE--------------GVERYVIPVSVQDALDAQIY....
POLG_CXA21/369-534-------------KNMMELA..---EIDTLIPMNAVDGK-VN--------------TMEMYQIPLNDNLSKAPIF.....
POLG_CXA9/358-524-------------KNLMEIA..---EVDSVVPVNNVQDT-TD--------------QMEMFRIPVTINAPLQQQVF....
POLG_CXB4J/358-524-------------RNLMEIA..---EVDSVVPINNLKAN-LM--------------TMEAYRVQVRSTDEMGGQIF....
POLG_CXB3N/360-526-------------KNLMEIA..---EVDSVVPVQNVGEK-VN--------------SMEAYQIPVRSNEGSGTQVF....
POLG_CXB1J/360-526-------------NNLMEIA..---EVDSVVPVNNTDNN-VN--------------GLKAYQIPVQSNSDNRRQVF....
POLG_FMDVO/725-872-------------ADPVTTT..---VENYGGETQIQRRQ-HT--------------DVSFIMDRFVKVTPQNQINI....
POLG_FMDV1/726-878-------------ADPVTTT..---VENYGGDTQVQRRH-HT--------------DVGFIMDRFVKINSLSPTHV....
POLG_BOVEV/610-775-------------HGIHETS..---VESFFGRSSLV...-..--------------..GMPLLATGTSIT..........
POLG_HRV8A/621-792-------------QTRDETS..---IESFLGRSGCI...-AM--------------IEFNTSSDKTEHDKIGKGFK....
POLG_HRV2/614-772-------------QTRDEMS..---LESFLGRSGCIHES-KL--------------EVTLANYNKENFT...........
POLG_HRV1B/627-786-------------QTRDEMS..---IESFLGRSGCV...-..--------------HISRIKVDYNDYNGVNKNFT....
POLG_HE701/609-781-------------HGTAECL..---VENFLGRSALV...-CM--------------RSFEYKNHSTSTSSIQKNFF....
POLG_HRV14/614-787-------------FNGSETD..---VECFLGRAACV..H-VT--------------EIQNKDATGIDNHREAKLFN....
POLG_CXA9/612-783-------------HSRSEST..---VENFLGRSACV...-..--------------...YMEEYKTTDKHVNKKFV....
POLG_CXB4J/612-783-------------HSRSESS..---IENFLCRSACV...-..--------------...IYIKYSSAESNNLKRYA....
POLG_SVDVU/612-782-------------HSRSEST..---VENFLCRSACV...-..--------------....FYTTYKNHDSDGDNFA....
POLG_CXB3N/630-782-------------...SEST..---IENFLCRSACV...-..--------------....YFTEYKN..SGAKRYA....
POLG_POL1M/636-806-------------RSRSESS..---IESFFARGACV...-..--------------..TIMTVDNPASTTNKDKLFA...
POLG_CXA21/642-812-------------KTRSESC..---LESFFGRAACV...-..--------------..TILSLTNSSKSGEEKKHFN...
POLG_CXA24/646-809-------------KTRSEST..---LESFFGRSACV...-.T--------------MLEVENFNATTEADKKKQFT....

PF00915

CAPSD_VESVA/137-421-------------PAPAPTALA---TLATASTGKSVEQ..EW--------------MTFFSYHTSINWSTVESQ...GKV
POLG_RHDVF/1768-2065-------------AENSSASIA---TAGIGGPPQQVDQQETW--------------RTNFYYNDVFTWSVADAP...GSI
CAPSD_FCVUR/112-395-------------IAEPSSQMS---TAADMASGKSVDS..EW--------------EAFFSFHTSVNWSTSETQ...GKI
CAPSD_NVN68/2-294-------------MDPVAGSST---AVATAGQVNPID...PW--------------IINNFVQAPQGEFTISPNNTPGDV

PF08762

Q8B107_ALPV/599-804-------------VTSLRQI-----LKRFHLIYSNL----T.--------------TSTKNNNLYRINSFKTPKPI....
O56051_9VIRU/590-790-------------VTSFRQL-----IKRFSAI....----..--------------...TPPTQNRYWEFTQPFWINTNR
Q56QP7_9VIRU/684-855-------------LVNLRPL-----LRCFRSLGG..----..--------------.....ITLDRAGQILSERVY....
O36967_9VIRU/668-900-------------IMSIRQL-----IKRFGMALNSL----NL--------------ISDAPNTLIAPFSVQHPTPV....
Q5UBY1_9VIRU/79-259-------------IMNLRSL-----LRTFRTISENW----NL--------------APNTKTALTDLTDVAD........
Q6ITS9_9VIRU/106-313-------------FTNFRNL-----IKRVNFRKATT----LN--------------GKRISDTFDINSLIEAPRLDIAQY
Q4JFT2_9VIRU/834-1009-------------FVSLRML-----TRR........----..--------------..SSPVDILRGDLVTLPGIS....

PF00760

CAPSD_CMVFN/11-215-RCR-------------------PGYTFT-------SITLKPPKID------RGSYYGKRLLL-----------------

PF01318

CAPSD_BMV/2-188IKAI-------------------AGYSIS-------KWEASSDAIT------AKATNAMSITL-----------------

PF03566

Q80IX5_PRVFL/54-754QRPI-------------------VTIECP-------TVSESDLPLD------GKLWRVSFISF-----------------
CAPSD_NCBVS/1-608FRGT-------------------VGARYP-------GLNSTTLPLD------GGTWPLLVMHL-----------------
CAPSD_HASV/2-647IREI-------------------YNEECP-------VVTDVSVPLD------GRQWSLSIFSF-----------------

PF01829

CAPSD_NODAM/42-399AEAN-------------------VGASFS-------GVPLASVEFPGFDQLFGTSATDTAANV-----------------

PF01766

POLS_IBDVU/9-452VSRS-------------------LTVRSS-------TLPGGVYALNGTIN--AVTFQGSLSEL-----------------
POLS_DXV96/2-442ISGS-------------------LSIKSS-------TLPAGVYALNGTFN--AVWFQGTLSEV-----------------
POLS_BSNV/7-428VSRI-------------------VQVRSS-------TLPAGVYALNGTFN--GVTYIGSLSEI-----------------
POLS_IPNVJ/5-453ISRK-------------------YDIQSS-------TLPAGLYALNGTLN--AATFEGSLSEV-----------------

PF00729

CAPSD_PNLV/47-266-----------------------WLSGV--------ACYWSKYRWR------SCRLVYIPYC------------------
CAPSD_MCMVK/23-222-----------------------WLAAQ--------SQMWNTIVFN------SVRITWETFT------------------
CAPSD_PMVK/39-236-----------------------HLRTI--------GSAFAIHRWR------ALSFEWIPSC------------------
CAPSD_RCNMV/24-213-----------------------TLAYE--------AANYDMYRLK------KLTLRYVPLV------------------
CAPSD_CARMS/51-245-----------------------QLSLL--------ATNFNKYRIT------ALTVKYSPAC------------------
CAPSD_SBMVA/46-262-----------------------WLRGV--------AANWSKYSLL------SVRYTYLPSC------------------
CAPSD_TBSVC/76-269-----------------------WLPAI--------ASNFDQYTFN------SVVLHYVPLC------------------
CAPSD_POLVP/66-257-----------------------WLQGI--------AASFDQYKFD------RVQLQYVPMC------------------
CAPSD_OCSVU/111-308-----------------------WLSAT--------AVNYEKYKFR------RLSFTLVPLV------------------
CAPSD_TNVA/61-272-----------------------WLASI--------ADLYSKYRWL------SCEIIYIPKC------------------

PF11729

CAPSD_SJNNV/1-340-----------------------RLGHA--------ARIFQRYAVE------TLEFEIQPMC------------------

PF00894

CAPSD_PLRV1/70-207-----------------------FKDGI--------LKAYHEYKIT------SILLQFVSEA------------------
CAPSD_PEMVW/53-187-----------------------IK.GN--------LAAYQKYRIV------WLKVVYQSEA------------------
CAPSD_BYDVP/62-199-----------------------LSDGI--------LKSYHRYKIT------SIRVEFKSHA------------------

PF03014

CAPSD_HEVCH/41-659-----------------------LQDGTNTHIMATEASNYAQYRVV------RATIRYRPLV------------------

PF03115

CAPSD_HASV1/1-416-----------------------PVQAL--------GAQYSMWKLK------YLNVKLTSMVG-----------------

PF00983

COAT_TYMV/8-177-----------------------SVSTL--------TTFYRHASLE------SLWVTIHPTLQ-----------------

PF02247

POL2_SQMVM/246-618TKDA-------------------ILMNMP-------NAVISLHRYF------RGDFVFEITKM-----------------
POL2_CPMVS/460-832ATQA-------------------FLANMP-------NSWISMWRYF------RGELHFEVTKM-----------------
POL2_BPMV/447-819AKSA-------------------ILMNMP-------NAVLSMWRYF------VGDLVFEVSKM-----------------
Q9Z006_9SECO/476-846DGKE-------------------VTSTFA-------SAYCGLSQYI------QSDVILDFTLM-----------------
O12663_9SECO/321-691DGKE-------------------VTSTFA-------SSYCGLSQYM------QSDVILDFTLM-----------------
Q9YWK0_9SECO/363-735TKDA-------------------ILMNMP-------NAVISLHRYF------RGDFVFEITKM-----------------
POL2_CPSMV/437-806AKNS-------------------ILMNLP-------NAILSMWRYF------KADLEFELIKM-----------------
POL2_RCMV/407-778AKNS-------------------ILMNMT-------NAFLSLWRYF------HGDLVFEVQKM-----------------
Q9YWJ9_9SECO/452-824TKDA-------------------ILMNMP-------NAVISLHRYF------RGDFVFEITKM-----------------
Q66170_CPMVS/343-715ATQA-------------------FLANMP-------NSWISMWRYF------RGELHFEVTKM-----------------

PF03391

CAPSD_TRSV/179-344HSKK-------------------HAISYS-------RAVMSRNLGW------SGTISGSVKSV-----------------
POL2_RRVS/768-936HGQQ-------------------IVRTFP-------RVVAAHFRSW------TGKVRMSIQEV-----------------
POL2_BRAV/1268-1433VSGW-------------------RTVSFP-------AAYALFLQGH------GGSLVGEVVHT-----------------
Q65029_ARMV/745-916DGTH-------------------KVYNFN-------NTLLSYYLGI------GGIVKGKVHVC-----------------
POL2_ARMVS/792-963DGTH-------------------KVYNFN-------NTLLSYYLGI------GGIVKGKVHVC-----------------
Q67703_GFLV/166-336VGTT-------------------RVYNLN-------STLVSCVLGM------GGTIRGKVHIC-----------------
POL2_GFLV/771-941VGTT-------------------KVYNLN-------STLVSCVLGM------GGTVRGRVHIC-----------------
POL2_BRSV/1007-1170TSGR-------------------TAYSYA-------AGLLSHFLGV------GGTIHFVVRTT-----------------
POL2_GCMV/981-1144SSGR-------------------IAYSYA-------AGLLSHFLGI------GGTIHFKIQCT-----------------
POL2_TORVR/1497-1662SGNM-------------------STLNAN-------QALLRFFQGS------NGTLHGRIKKI-----------------
Q88483_9SECO/1003-1166AAKR-------------------QAYSYA-------AGVLSHFLGV------GGDIIFSVHST-----------------

PF02443

Q5Y4T0_PCV2/5-226LPPG................---......-------.GGSNPLTVP------FEYYRI----------------------
Q27W03_PCV1/5-227LPPS................---......-------.GGTNPLPLP------FQYYRI----------------------
A3FEQ4_9CIRC/3-256DPPAQGNNICGLNMRWAMFG---DTNSYM-------QGNKPQYHYP------YDYYII----------------------
Q3HUU1_GOCV/5-247TSPKP.....GINLRFAVFG---DR...L-------PGTGNQYHYP------FDYYMI----------------------
Q1L2D2_9CIRC/1-237LNPT................---......-------..GGDSLKLP------FEDYKI----------------------
CAPSD_CACV/7-243L.DW................---......-------..GTINWRLP------FEDYRI----------------------
Q0H9S8_9CIRC/4-236L.DW................---......-------..GTINWRLP------FEDYRI----------------------
Q06J73_9CIRC/8-245F.PE................---......-------..GK...ELP------FEDYRI----------------------
Q9DXG3_BFDV/11-242L.QA................---......-------..VPNPHTLN------FEDYRI----------------------
Q69EZ5_BFDV/7-239L.GN................---......-------..TTNPQTLN------FEHYRI----------------------
Q9DXG0_BFDV/11-242L.TN................---......-------..TPNPSALN------FEDYRI----------------------
Q9DXF4_BFDV/3-235L.TA................---......-------...PNPTGWP------FEDYRI----------------------

PF02956

A7VLZ2_9VIRU/1-506NNVW---------TTSNVNL---DLVRYT-------GCRFIFWRHP------HIDFVGVYSRN-----------------
Q9WT88_9VIRU/1-603QNRW---------TFSNDQL---DLARYR-------GCKLRFYRSP------VCDFIVHYNLI-----------------
Q91CY9_9VIRU/1-581RNKW---------SYPNTEL---NLARYR-------GATFTFYRDP------KVDYIVVYNTV-----------------
A7VLY0_9VIRU/1-515RNIW---------TKTNDYK---DLVRFT-------GATFYLYKHP------TTDFIFNYNNQ-----------------
Q9JGT1_9VIRU/1-585MNYW---------TASNEDL---NLCRYL-------GCTLYVFRHP------EVDFIIIINTS-----------------
Q80QT8_9VIRU/1-595LNQW---------SYPNDQL---DLARYR-------GCSFSFYRHP------EVDFIAQFDNV-----------------
CAPSD_TTVB1/1-533RNWW---------TKSNSLL---PLTKYI-------RCKLKFYRSD------QTDYIVTIQRT-----------------
A7VM00_9VIRU/1-509NNIW---------TSTNAYR---DFCRYT-------GSSFTFFRHP------DTDFIIVYDIQ-----------------
Q9JG61_9VIRU/1-534RNWW---------TTSNCGL---PLVKYT-------GCSIKFYNSN------DTDYIVTVQRT-----------------
Q91PS3_9VIRU/1-581RCTW---------SKSNVDL---ELIRYR-------GCSFKLYRHE------KCDFFFTYSRK-----------------
CAPSD_TTVV4/1-560QNFW---------TRSNIDL---DLVRYH-------SVKFTFFRHP------KVDFIVKFNRN-----------------
Q91C93_9VIRU/1-546HNWW---------TKTNDNY---PLIRYN-------GCTLKLFKSE------KVDYIFYYQRH-----------------
Q2F827_9VIRU/1-589HNTW---------SYPNNQL---DLGRYK-------GCTFYFYRDK------KTDYIVKFQRR-----------------
Q91CY5_9VIRU/1-584MNRW---------SYPNTQL---DLARYL-------GVTFYFYRDQ------KTDYIVQWSRN-----------------
Q8V7G9_9VIRU/1-572RNHW---------SRSNYDL---ELARYL-------GFTLKCYRHA------TVDYILTYSRT-----------------
Q99A78_9VIRU/1-584MNYW---------TASNEDL---DLCRYR-------GCTLWFFRHP------DVDFIILINTM-----------------
Q6H9C2_9VIRU/1-573MNFW---------TVSNEDL---DLCRYV-------GCKLIFFKHP------TVDFIVQINTQ-----------------
CAPSD_TTVT1/1-433RNRW---------SHSNVGY---DLARYM-------GTHLYFPPLA------DIWYIVWTDTE-----------------
Q9JG80_9VIRU/1-589LNKW---------SFPNDQL---DLARYR-------GCKFYFYRTK------QTDWIGQYDIS-----------------
A7VLZ6_9VIRU/1-506NNYW---------TKSNILK---DLCRFL-------WLKIIFFRDN------KTDFIVSYDRN-----------------
Q6H9D2_9VIRU/1-557LNFW---------THTNQDL---DLVRYR-------GCTMTFYRHP------EVDFIVKFNRK-----------------
Q6H999_9VIRU/1-471MNFW---------TRSNDNL---ELTRYL-------GASVKIYRHP------DQDFIVIYNRR-----------------
Q77JT5_9VIRU/1-606HNFW---------SASNEDL---DLARYL-------GATIVLYRHP------TVDFLVRIRTS-----------------
Q91PS7_9VIRU/1-585RCTW---------SRSNKDL---ELVRYL-------GGSFTLYRHP------KCDFIFRYNRK-----------------
CAPSD_TTVV9/1-555RNRW---------SRSNTDL---ELIRYT-------GLNLRLYRHE------FSDYIVHYSLE-----------------
Q9JG47_9VIRU/1-553RNWW---------TKGNENM---PLIRYL-------GCEITLYRQA------EVDYMVYVHNS-----------------
A7VLW0_9VIRU/1-507KNIW---------TFSNKYK---DLVRYT-------GTRFTFFRHP------ETDFILAYDIQ-----------------
Q0ZLH9_9VIRU/1-573RCRW---------SKSNQDL---DLCRYL-------DCKLTFYRSP------NTDFIVGYNRK-----------------
Q5ENW7_9VIRU/1-501RNSW---------SKGNDGM---DLVRYF-------GCVVYLYPLK------DQDYWFWWDTD-----------------
A7VLX2_9VIRU/1-509NCIF---------TASNHYK---DPVRYT-------GCEIILYRHP------YVDFVVTYSNQ-----------------
Q80AR5_9VIRU/1-594LNRW---------SYPNDQL---DLARYK-------GCKFKFYRDT------NTDFIVTYDIN-----------------
Q91CZ2_9VIRU/1-601LNRW---------TASNDQL---DLARYL-------GAIFWFYRDQ------KTDYIVQYDIS-----------------
CAPSD_TTVG1/1-514NNIW---------TKTNQLK---DLCRYL-------KCVMTFYRHQ------HIDFVIVYERQ-----------------
Q98Y63_9VIRU/1-581HNFW---------TYPNTQL---DLCRYK-------YAIFTFYRDP------KVDYIVIYNTN-----------------
Q9QU36_9VIRU/1-529TNWW---------TQTNCSL---PLIRYN-------FCKLKFYRTA------NVDYVVKIIRC-----------------
A7VM12_9VIRU/1-509NNVW---------TATNLYK---DLCRYL-------YCKIIFFRHP------DTDFVINYSRQ-----------------
A7VLV6_9VIRU/1-508NCIW---------TASNNYK---DLCRYT-------GCTITLFRHK------YIDFIFCYSVM-----------------
Q9JG50_9VIRU/1-535NNVW---------TKTNNGL---PFARYC-------GCRFKFYRQE------YYDYIVHYSIC-----------------
A7VLW4_9VIRU/1-507NNIW---------TSSNNQK---DLCRYT-------GGYIKLFRHE------TQDFIISYDLQ-----------------
A7VM04_9VIRU/1-513KNVW---------TKSNILL---DLCRYL-------FVKISFYRHP------ETDFIVTWHRQ-----------------
A7VLY4_9VIRU/1-498NNIW---------TKTNILT---DLVQYL-------GCKFVFYRHQ------YVDFIVKYSRN-----------------
CAPSD_TTVD1/1-324RNRW---------SRSNAGF---DLGRYL-------GTWLTLVPHP------YFSYLFYYD..-----------------
Q91CZ6_9VIRU/1-596MNKW---------STSNDIL---DLARYL-------GCDFYFYRDK------HTDYIVQYDTA-----------------
A7VM08_9VIRU/1-506NNIW---------TATNKNT---DLVRYL-------GCRFSFYRHP------DTDFIVNFSRQ-----------------
CAPSD_TTVV3/1-573LNFW---------TVSNQDL---DLARYL-------GTKIIFFRHP------TVDFVVQIHTQ-----------------
Q91D00_9VIRU/1-593MNRW---------SYSNDQL---DLARYR-------GCSFKLYRNP------TTDFIVQYDNN-----------------
Q99AR5_9VIRU/1-604MNRW---------TFSNDQL---DLARYR-------GCKFRFYRHP------TCDFIVHYNLV-----------------
Q9DTD2_9VIRU/1-559LNYW---------TASNNDL---DLARYL-------GATITFFRHP------DVDFIVQIHTS-----------------
Q91D04_9VIRU/1-591HNTW---------SYPNTQL---DLARFK-------GVNFYFYRDK------DTDFIVTYSSV-----------------
CAPSD_TTVV8/1-571LNIW---------THSNQDL---DLARYH-------GFKLTLYRHP------TVDFIVIIRNS-----------------
Q5ENX0_9VIRU/1-603FNKW---------SHTNKDL---DLALYY-------GCRFRFYRHD------RTDFIVSFTNN-----------------
O90364_9VIRU/1-590MNYW---------TASNEDL---DLCRYL-------GVNLYFFRHP------DVDFIIKINTM-----------------
Q9IFV0_9VIRU/1-583RCRW---------SRSNDEL---ELVRYL-------GCSFTLYREQ------NVDFLFKYNRR-----------------
Q9QUE7_9VIRU/1-586MNYW---------TSSNEDL---DLCRYR-------GVTLYFFRHP------DVDFIILINTT-----------------
A8DMR2_9VIRU/1-531RNWW---------SISNCNL---PLIKYR-------GCKITLYRNV------DVDYVTVYTRC-----------------
Q9DUH8_9VIRU/1-609RNRW---------SHTNEDL---ELALYF-------GCRFTFYRHP------TTDFIVTFSNT-----------------
A7VLW8_9VIRU/1-511QNIW---------TKPNTYK---DLCRFI-------VAKITLYRHK------TTDFIVQYSRQ-----------------
Q99AQ3_9VIRU/1-582LNRW---------SASNDQL---DLARYT-------GCTFWFYRHK------KTDFIVQYDVS-----------------

PF00073

Q9WMA0_9PICO/49-215LDVV---------KLLY......NEQFAV-------QGLLRYHTYA------RFGIEIQVQIN.P---------------
POLG_AEVCA/45-212IDIV---------KELL......DQSYAV-------DGLLKYHSYA------RFGLDVIVQIN.P---------------
POLG_CXA9/93-300..WW---------KFPEAL....SDMGLF-------GQNMQYHYLG------RAGYTIHLQCN.A---------------
POLG_CXB3N/93-302..WW---------KLPDAL....SNLGLF-------GQNMQYHYLG------RTGYTVHVQCN.A---------------
POLG_CXB4J/93-300..WW---------KFPDAL....SEMGLF-------GQNMQYHYLG------RSGYTIHVQCN.A---------------
POLG_CXA21/93-308..WW---------KLPDCL....KDMGMF-------GQNMYYHYLG------RSGYTIHVQCN.A---------------
POLG_POL1M/93-308..WW---------KLPDAL....RDMGLF-------GQNMYYHYLG------RSGYTVHVQCN.A---------------
POLG_POL3L/93-307..WW---------KLPDAL....RDMGLF-------GQNMYYHYLG------RSGYTVHVQCN.A---------------
POLG_HE701/93-288..WW---------KLPDAL....NQIGMF-------GQNVQYHYLY------RSGFLCHVQCN.A---------------
POLG_BOVEV/93-285..YW---------KLPDAL....NNTGMF-------GQNAQFHYIY------RGGWAVHVQCN.A---------------
POLG_HRV14/93-299..CW---------KLPDAL....KDMGVF-------GQNMFFHSLG------RSGYTVHVQCN.A---------------
POLG_HRV2/93-302..WW---------KLPDAL....KDMGIF-------GENMFYHYLG------RSGYTIHVQCN.A---------------
POLG_HRV8A/93-302..WW---------KLPDAL....KNMGIF-------GENMFYHFLG------RSGYTIHVQCN.S---------------
POLG_HRV1B/93-301..WW---------KLPDAL....KEMGIF-------GENMYYHFLG------RSGYTVHVQCN.A---------------
POLG_FMDV1/311-475..LT---------KLELPT....DHHGVF-------GHLVDSYAYM------RNGWDVEVSAV.G---------------
POLG_FMDVT/311-475..MH---------KVVLPH....EPKGVY-------GGLVKSYAYM------RNGWDVEVTAV.G---------------
POLG_FMDVO/311-475..LL---------ELPT......DHKGVY-------GSLTDSYAYM------RNGWDVEVTAV.G---------------
POLG_EMCV/161-359LSTS---------AFPFLTSCP.VKMVVS-------LVALRRHYLV------KTGWRVQVQCN.A---------------
POLG_TMEVB/172-382..HI---------RIPLPHVLAGEDGGVF-------GATLRRHYLC------KTGWRVQVQCN.A---------------
POLG_ENMGO/162-361..YI---------RIPLPHVLSGEDGGVF-------GATLRRHYLV------KTGWRVQVQCN.A---------------
POLG_FMDVO/533-691..DM---------SLAAKQ....MSNTFL-------AGLAQYYTQY------SGTINLHFMFT.G---------------
POLG_FMDV1/533-692..DV---------SLAAKH....MSNTYL-------SGIAQYYTQY------SGTINLHFMFT.G---------------
POLG_EMCV/420-582..TY---------QVTLSCSC..LANTFL-------AALSRNFAQY------RGSLVYTFVFT.G---------------
POLG_TMEVB/443-606..DY---------QVALSCSC..MANSML-------AAVARNFNQY------RGSLNFLFVFT.G---------------
POLG_HE701/347-515..NI---------PLDIQLEGP.LRNTLL-------GNISRYYTHW------SGSLEMTFMFC.G---------------
POLG_HRV2/358-522..SI---------RTDV.ASQP.LATTLI-------GEISSYFTHW------TGSLRFSFMFC.G---------------
POLG_HRV8A/364-529..SI---------PVDI.ASQP.LATTLI-------GELASYYTHW------TGSLRFSFMFC.G---------------
POLG_HRV1B/360-525..AI---------KVDI.TSQP.LATTLI-------GEIASYYTHW------TGSLRFSFMFC.G---------------
POLG_BOVEV/345-515..AL---------RLELGGSGP.LSSSLL-------GTLAKHYTQW------SGSVEITCMFT.G---------------
POLG_CXA21/369-534..CL---------SLSPASDKR.LSHTML-------GEILNYYTHW------TGSIRFTFLFC.G---------------
POLG_CXA9/358-524..GL---------RLQPGLDSV.FKHTLL-------GEILNYYAHW------SGSMKLTFVFC.G---------------
POLG_CXB4J/358-524..GF---------PLQPGASSV.LQRTLL-------GEILNYYTHW------SGSLKLTFVFC.G---------------
POLG_CXB3N/360-526..GF---------PLQPGYSSV.FSRTLL-------GEILNYYTHW------SGSIKLTFMFC.G---------------
POLG_CXB1J/360-526..GF---------PLQPGANNV.LNRTLL-------GEILNYYTHW------SGSIKLTFMFC.G---------------
POLG_FMDVO/725-872..LD---------LMQI......PSHTLV-------GALLRASTYY------FSDLEIAVKHE.G---------------
POLG_FMDV1/726-878..ID---------LMQT......HKHGIV-------GALLRAATYY------FSDLEIVVRHD.G---------------
POLG_BOVEV/610-775..NW---------RIDF......REFVQL-------RAKMSWFTYM------RFDVEFTIIATSS---------------
POLG_HRV8A/621-792..TW---------KVSL......QEMAQI-------RRKYELFTYT------RFDSEITIVTA.A---------------
POLG_HRV2/614-772..VW---------AINL......QEMAQI-------RRKFELFTYT------RFDSEITLVPC.I---------------
POLG_HRV1B/627-786..TW---------KITL......QEMAQI-------RRKFELFTYV------RFDSEVTLVPC.I---------------
POLG_HE701/609-781..IW---------TLNT......RELVQI-------RRKMELFTYL------RFDTEITIVPTLR---------------
POLG_HRV14/614-787..DW---------KINL......SSLVQL-------RKKLELFTYV------RFDSEYTILAT.A---------------
POLG_CXA9/612-783..AW---------PINT......KQMVQM-------RRKLEMFTYL------RFDMEVTFVIT.S---------------
POLG_CXB4J/612-783..EW---------VINT......RQVAQL-------RRKMEMFTYI------RCDMELTFVIT.S---------------
POLG_SVDVU/612-782..YW---------VINT......RQVAQL-------RRKLEMFTYA------RFDLELTFVIT.S---------------
POLG_CXB3N/630-782..EW---------VLTP......RQAAQL-------RRKLEFFTYV------RFDLELTFVIT.S---------------
POLG_POL1M/636-806..VW---------KITY......KDTVQL-------RRKLEFFTYS------RFDMELTFVVT.A---------------
POLG_CXA21/642-812..IW---------NITY......TDTVQL-------RRKLEFFTYS------RFDLEMTFVFT.E---------------
POLG_CXA24/646-809..TW---------AITY......TDTVQL-------RRKLEFFTYS------RFDLEMTFVIT.E---------------

PF00915

CAPSD_VESVA/137-421LYSQ---------ALNP------SINPYL-------DHISKLYSTW------SGGIDVRFTVS-G---------------
POLG_RHDVF/1768-2065LYTV---------QHSP------QNNPFT-------AVLSQMYAGW------AGGMQFRFIVA-G---------------
CAPSD_FCVUR/112-395LFKQ---------SLGP------LLNPYL-------EHLSKLYVAW------SGSVEVRFSIS-G---------------
CAPSD_NVN68/2-294LFDL---------SLGP------HLNPFL-------LHLSQMYNGW------VGNMRVRIMLA-G---------------

PF08762

Q8B107_ALPV/599-804...A---------AQATM-----VNIDLY.......SYYSYIFAYY------RGSFRFKIAPFENKVYAARIR......L
O56051_9VIRU/590-790LEGV---------TQEGS-----SDIDGI.......SWFASLYAFY------RGSMRYKIAPLSNASPLV.........V
Q56QP7_9VIRU/684-855....---------....W-----HYKDYV.......SILSYLYRFS------RGGYRYKFFADDN...............
O36967_9VIRU/668-900....---------.VAPA-----EPMSLF.......EYYYFIYGFW------RGGMRFKLQAVRTNSAETSVKTDTTWTV
Q5UBY1_9VIRU/79-259....---------....K-----EGRDYM.......SYLSYLYRFY------RGGRRYKFFNTTA...............
Q6ITS9_9VIRU/106-313VDTE---------TKEAK-----YGFSYFWSAPTTLNIVAEMYALY------RGGVRVKVVTEKG...............
Q4JFT2_9VIRU/834-1009...F---------GTDNS-----LRQSLV.......NIISYMYRFT------HGSISYKIIPKNKG..............

PF00760

CAPSD_CMVFN/11-215---------PD-------SV-TEYDK-------------------------------------KL-VSR---IQIRVNPL

PF01318

CAPSD_BMV/2-188---------PH-------ELSSEKNK-------------------------------------ELKVGR---VLLWLGLL

PF03566

Q80IX5_PRVFL/54-754---------PAFRLN-FIALANINNE..-----------------------------------ALTLET---RNTFIQTL
CAPSD_NCBVS/1-608---------PFFRHP-LLFITTTSNTEV-----------------------------------EVTNAD---LDAFANDW
CAPSD_HASV/2-647---------PMFRTA-YVAVANVENK..-----------------------------------EMSLDV---VNDLIEWL

PF01829

CAPSD_NODAM/42-399---------TAFRYA-SMAAGVYPTSNL-----------------------------------MQFAGS---IQVYKIPL

PF01766

POLS_IBDVU/9-452---------TDVSYNGLMSATANINDKI-----------------------------------GNVLVG---EGVTVLSL
POLS_DXV96/2-442---------SDYSYDRILSITSNPLDKV-----------------------------------GNVLVG---DGIEVLSL
POLS_BSNV/7-428---------KDLDYNSLLSATANINDKV-----------------------------------GNVLVG---DGVAVLSL
POLS_IPNVJ/5-453---------ESLTYNSLMSLTTNPQDKV-----------------------------------NNQLVT---KGITVLNL

PF00729

CAPSD_PNLV/47-266---------SSSFTGY-VSMGLSYDYAD-----------------------------------AIPSDETEMSALK-GYT
CAPSD_MCMVK/23-222---------ADTTSGY-ISMAFLSDYML-----------------------------------SIP...TGVEDVA-RIV
CAPSD_PMVK/39-236---------PTTTPGN-LVLRFYPNYST-----------------------------------ETPKTLTDLMDSE-SLV
CAPSD_RCNMV/24-213---------TVQNSGR-VAMIWDPDSQD-----------------------------------SAPQSRQEISAYS-RSV
CAPSD_CARMS/51-245---------SFETNGR-VALGFNDDASD-----------------------------------TPPTTKVGFYDLG-KHV
CAPSD_SBMVA/46-262---------PSTTSGS-IHMGFQYDMAD-----------------------------------TLPVSVNQLSNLR-GYV
CAPSD_TBSVC/76-269---------STTEVGR-VAIYFDKDSED-----------------------------------PEPADRVELANYS-VLK
CAPSD_POLVP/66-257---------ATTETGR-VAIYFDKDQQD-----------------------------------VEPADRVELANMG-HWT
CAPSD_OCSVU/111-308---------STNYSGR-IGVGFDYDSSD-----------------------------------LVPGNRQEFYALS-NHC
CAPSD_TNVA/61-272---------PTTTSGS-IAMAFTYDRND-----------------------------------AAPTARAQLSQSY-KAI

PF11729

CAPSD_SJNNV/1-340---------PANTGGG-YVAGFLPDPTDNDHTFDALQATRGAVVAKWWESRTVRPQYTRTLLWTSTGKEQRLTSPG-RLV

PF00894

CAPSD_PLRV1/70-207---------SSTSSGS-IAYELDPH.CK-------------------------------------------VSSLQ-SYV
CAPSD_PEMVW/53-187---------AATDRGC-IAYHVDTSTTK-------------------------------------------KAADV-VLL
CAPSD_BYDVP/62-199---------SANTAGA-IFIELDTA.CK-------------------------------------------QSALG-SYI

PF03014

CAPSD_HEVCH/41-659---------PNAVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASEH--------VIPSERLHYRNQGWRSV

PF03115

CAPSD_HASV1/1-416---------ASAVNGTVSGVSLNPTTTPTSTSWSGLGARKHLDVTVGKNATF-----------KLKPSDLGGPRDG-WWL

PF00983

COAT_TYMV/8-177---------APTFPTT-VGVCWVPANSP-----------------------------------VTPAQITKTYGGQ-IFC

PF02247

POL2_SQMVM/246-618--------SSPYIKATIAFFIAFG--DI-----------------------------------TEEMTN...LESFPHKL
POL2_CPMVS/460-832--------SSPYIKATVTFLIAFG--NL-----------------------------------SDAFGF...YESFPHRI
POL2_BPMV/447-819--------TSPYIKCTVSFFIAFG--NL-----------------------------------ADDTIN...FEAFPHKL
Q9Z006_9SECO/476-846--------SSPMIGGTFSIAYVAG--AY-----------------------------------IEKVGNMQILDSLPHID
O12663_9SECO/321-691--------SSPMIGGTFSIAYVAG--AY-----------------------------------IEKVGNMQILDSLPHID
Q9YWK0_9SECO/363-735--------SSPYIKATIAFFIAFG--DI-----------------------------------TEEMTN...LESFPHKL
POL2_CPSMV/437-806--------SSPYINATIAFFVAFG--DL-----------------------------------SDDTVN...FEAFPHKL
POL2_RCMV/407-778--------SSPFIKSTVTFFIGFG--GL-----------------------------------PFSEN....LEDFPNKL
Q9YWJ9_9SECO/452-824--------SSPYIKATIAFFIAFG--DI-----------------------------------TEEMTN...LESFPHKL
Q66170_CPMVS/343-715--------SSPYIKATVTFLIAFG--NL-----------------------------------SDAFGF...YESFPHRI

PF03391

CAPSD_TRSV/179-344--------SSLFCTASFVIFPWEC--EA-----------------------------------PPTLRQ---VLWGPHQI
POL2_RRVS/768-936--------SSIFLTGTYMVGVSW.--NA-----------------------------------TADLAD---IVTRKHWI
POL2_BRAV/1268-1433--------GSAAVSCALHLCISFG--GA-----------------------------------PPTLEE---ALVFPGFR
Q65029_ARMV/745-916--------SPCTYGIVLRVVSEWN--GV-----------------------------------TNNWNQ---LFKYPGCY
POL2_ARMVS/792-963--------SPCTYGIVLRVVSEWN--GV-----------------------------------TNNWNQ---LFKYPGCY
Q67703_GFLV/166-336--------APIFYSIVLWVVSEWN--GT-----------------------------------TMDWNE---LFKYPGVY
POL2_GFLV/771-941--------APIFYSIVLWVVSEWN--GT-----------------------------------TMDWNE---LFKYPGVY
POL2_BRSV/1007-1170--------SSAFVTSKLRIA.LW.--GT-----------------------------------VPETDQ---LAQMPHVD
POL2_GCMV/981-1144--------SSAFVTARLRVA.LW.--GD-----------------------------------TITLEQ---LSQMPHVD
POL2_TORVR/1497-1662--------GTALTTCSLLLSLRHK--DA-----------------------------------SLTLET---AYQRPHYI
Q88483_9SECO/1003-1166--------ASTFVSCSLRVA.LW.--GT-----------------------------------IPTTEE---LAQIPHVD

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506---------YPMQLQKYTYPDTHP--QQ-----------------------------------IMLAKH---KFFIPSLL
Q9WT88_9VIRU/1-603---------PPLKMNQFTSPNTHP--GL-----------------------------------LMLSKH---KIIIPSFQ
Q91CY9_9VIRU/1-581---------PPFKLNKYSCPMLHP--GM-----------------------------------MMQYKK---KVLIPSYQ
A7VLY0_9VIRU/1-515---------PPFLLEKDFYNDLHP--QM-----------------------------------LLLAKH---HRVIPSRQ
Q9JGT1_9VIRU/1-585---------PPFLDTEITGPSIHP--GM-----------------------------------MALNKR---ARWIPSLK
Q80QT8_9VIRU/1-595---------PPMKMDELTAPNTHP--AL-----------------------------------LLQSKK---KVKIYSWK
CAPSD_TTVB1/1-533---------GPFEVTLESYLSTQP--SR-----------------------------------HLMNHK---AFIVPKLG
A7VM00_9VIRU/1-509---------PPFTINKHTYMMTHP--HF-----------------------------------LLQRKH---KKILLSKS
Q9JG61_9VIRU/1-534---------GPFEVDRDSYLNTQP--SR-----------------------------------HMMNKN---SFIVPKLN
Q91PS3_9VIRU/1-581---------PPFKDSQLTGPSLHP--GM-----------------------------------LMNRRK---KIILLSFK
CAPSD_TTVV4/1-560---------PPFTDSVLTGPMLHP--GV-----------------------------------LMNSKR---KILIPSWE
Q91C93_9VIRU/1-546---------YPMKASALMYTSTQP--QI-----------------------------------LLLNNR---KRIVKCKA
Q2F827_9VIRU/1-589---------GPFKINKYSSPMAHP--GM-----------------------------------MMLDKM---KILVPSFD
Q91CY5_9VIRU/1-584---------PPFKLNKYSSPMYHP--GM-----------------------------------MMQARK---KLMVPSFQ
Q8V7G9_9VIRU/1-572---------TPFETNELSHMLTHP--LL-----------------------------------MLLNKH---HRVIPSLK
Q99A78_9VIRU/1-584---------SPFLDTQLTGPSIHP--GL-----------------------------------MALNKR---ARWIPSLK
Q6H9C2_9VIRU/1-573---------PPFLDTHLTAASIHP--GI-----------------------------------MMLSKR---HILIPSLK
CAPSD_TTVT1/1-433---------F.VDQPKKVMSYTHP--WI-----------------------------------LLMTKK---HKVIKPRK
Q9JG80_9VIRU/1-589---------EPYKLDKYSCPNYHP--GN-----------------------------------LIKAKH---KFLIPSYD
A7VLZ6_9VIRU/1-506---------PPFNLTKFTYPGAHP--QQ-----------------------------------MLLQKH---HKLILSQM
Q6H9D2_9VIRU/1-557---------PPFLDTIVSGPAMHP--GM-----------------------------------LMTTKH---KILVKSFK
Q6H999_9VIRU/1-471---------TPLGGNIYTAPSLHP--GN-----------------------------------AILAKH---KILVPSLQ
Q77JT5_9VIRU/1-606---------PPFEDTDMTAMTLHP--GM-----------------------------------MMLAKK---TIKIPSLK
Q91PS7_9VIRU/1-585---------PPFKDTQITGPSLHP--GI-----------------------------------LMTRRK---KKIIKSFL
CAPSD_TTVV9/1-555---------TPMEVGLESHMLAHP--LK-----------------------------------MIMSSK---HVTVPSLL
Q9JG47_9VIRU/1-553---------YPMSANLLTYQSTCP--QV-----------------------------------MLMNNR---TKIMPCKR
A7VLW0_9VIRU/1-507---------PPFHITKWTYMSIHP--QM-----------------------------------LLLRKH---KKLLLSTA
Q0ZLH9_9VIRU/1-573---------PPFIDTQITRCTLHP--GM-----------------------------------LIQERK---KVIIPSFQ
Q5ENW7_9VIRU/1-501---------FKELYAENIKEYSQP--SV-----------------------------------MMMAKR---TRIVIARE
A7VLX2_9VIRU/1-509---------PPFSINQFTYPDIHP--QN-----------------------------------LLLRKH---KKIVLSRA
Q80AR5_9VIRU/1-594---------PPMKNTELSGPNTHP--GM-----------------------------------LMQQKR---KILVPSWD
Q91CZ2_9VIRU/1-601---------EPFKIDKDSSPSFHP--GI-----------------------------------LMKSKH---KVLVPSFQ
CAPSD_TTVG1/1-514---------PPFEIDKLTYMKYHP--YM-----------------------------------LLQRKH---KIILPSQT
Q98Y63_9VIRU/1-581---------PPFKINKYSSPFLHP--GL-----------------------------------MMLQKK---KILIPSFQ
Q9QU36_9VIRU/1-529---------YPLKATHDLYMQTQP--SI-----------------------------------LMRDKH---SILIPCMK
A7VM12_9VIRU/1-509---------PPWELSKYTYPSCHP--HQ-----------------------------------MLLDKH---KVVIFSQA
A7VLV6_9VIRU/1-508---------PPFDINKLTYPDIQP--QN-----------------------------------LLLRQR---HKLILSQA
Q9JG50_9VIRU/1-535---------YPMTDTEDQHLNSQP--HR-----------------------------------LIQGRK---KIVVHRYN
A7VLW4_9VIRU/1-507---------PPHELSKYTFPSCHP--HQ-----------------------------------MLLQKR---HKILLSKQ
A7VM04_9VIRU/1-513---------PPFDISKEIYAACHP--QN-----------------------------------MLLAKH---KMLILSKF
A7VLY4_9VIRU/1-498---------LPMTIEKLTYPHTHP--QA-----------------------------------LLLSRH---KRIIPSRV
CAPSD_TTVD1/1-324---------PEYGNTFEFKKLIHP--AI-----------------------------------MITHPK---TILVLSNK
Q91CZ6_9VIRU/1-596---------APFTIDKDSSANYHP--GV-----------------------------------LIKARK---KVLVPSYD
A7VM08_9VIRU/1-506---------PPFNIDKYTYMSMQP--QE-----------------------------------MLLGKH---KKIILSKL
CAPSD_TTVV3/1-573---------PPFQDTEITAPSIHP--GM-----------------------------------LILSKK---HILIPSLK
Q91D00_9VIRU/1-593---------PPMKNTILSSPNTHP--GM-----------------------------------LMQQKH---RILVPSWQ
Q99AR5_9VIRU/1-604---------PPLKMNQFTSPNTHP--GL-----------------------------------LMLTKH---KIIIPSFL
Q9DTD2_9VIRU/1-559---------PPFRDTEMTGPSIHP--GM-----------------------------------LMLKKH---RLLIPSLK
Q91D04_9VIRU/1-591---------PPFKMDKYSSAMLHP--GT-----------------------------------LMQRKK---KILIPSFT
CAPSD_TTVV8/1-571---------PPFEDTELTGPNTHP--GM-----------------------------------LMLRHK---KILVPSLR
Q5ENX0_9VIRU/1-603---------PPMKTNQYTAPMTHP--GM-----------------------------------LMRAKH---KILIPSRL
O90364_9VIRU/1-590---------PPFLDTELTAPRLHP--GM-----------------------------------LALDKR---ARWIPSLK
Q9IFV0_9VIRU/1-583---------QPFSDSQLTGPSLHP--GI-----------------------------------IMKQKR---KVIVPSYK
Q9QUE7_9VIRU/1-586---------PPFVDTEITGPSIHP--GM-----------------------------------MALNKR---ARFIPSLK
A8DMR2_9VIRU/1-531---------GSLTATEELYRSCQP--SL-----------------------------------LLLNKH---KKVLTCKK
Q9DUH8_9VIRU/1-609---------PPMMSNQYTAPLAHP--GM-----------------------------------LMRSKY---KLLLPSFK
A7VLW8_9VIRU/1-511---------PPFLIDKWTYMQYHP--YM-----------------------------------LLQSKH---TKIIPSEQ
Q99AQ3_9VIRU/1-582---------APFKLDKNSCPSYHP--FM-----------------------------------LMKAKH---KVLIPSFD

PF00073

Q9WMA0_9PICO/49-215.........TPFQQGGLICAMVPG--DQ-----------------------------------S.....---........
POLG_AEVCA/45-212.........TSFQAGGLIAALVPY--DQ-----------------------------------V.....---........
POLG_CXA9/93-300.........SKFHQGCLLVVCVPE--AE-----------------------------------M.....---......GG
POLG_CXB3N/93-302.........SKFHQGCLLVVCVPE--AE-----------------------------------M.....---......GC
POLG_CXB4J/93-300.........SKFHQGCLLVVCVPE--AE-----------------------------------M.....---......GC
POLG_CXA21/93-308.........SKFHQGALGVFLIPE--FV-----------------------------------M.....---......AC
POLG_POL1M/93-308.........SKFHQGALGVFAVPE--MC-----------------------------------L.....---......AG
POLG_POL3L/93-307.........SKFHQGALGVFAIPE--YC-----------------------------------L.....---......AG
POLG_HE701/93-288.........TKFHQGTLLIVAIPE--HQ-----------------------------------I.....---........
POLG_BOVEV/93-285.........TKFHQGTLLVLAIPE--HQ-----------------------------------I.....---........
POLG_HRV14/93-299.........TKFHSGCLLVVVIPE--HQ-----------------------------------L.....---......AS
POLG_HRV2/93-302.........SKFHQGTLIVALIPE--HQ-----------------------------------I.....---......AS
POLG_HRV8A/93-302.........SKFHQGLLIVAAIPE--HQ-----------------------------------L.....---......AS
POLG_HRV1B/93-301.........SKFHQGTLLVAMIPE--HQ-----------------------------------L.....---......AS
POLG_FMDV1/311-475.........NQFNGGCLLVAMVPE--WK-----------------------------------A.....---........
POLG_FMDVT/311-475.........NQFNGGCLLVALVPE--MG-----------------------------------D.....---........
POLG_FMDVO/311-475.........NQFNGGCLLVAMVPE--LY-----------------------------------S.....---........
POLG_EMCV/161-359.........SQFHAGGLLVFMAPE--YP-----------------------------------T.....---......LD
POLG_TMEVB/172-382.........SQFHAGSLLVFMAPE--FY-----------------------------------TGKGTK---TGTMEPSD
POLG_ENMGO/162-361.........SQFHAGSLLVFMAPE--YP-----------------------------------T.....---......LD
POLG_FMDVO/533-691.........PTDAKARYMVAYAPP--GM-----------------------------------E.....---........
POLG_FMDV1/533-692.........STDSKARYMVAYIPP--GV-----------------------------------E.....---........
POLG_EMCV/420-582.........TAMMKGKFLIAYTPP--GA-----------------------------------G.....---........
POLG_TMEVB/443-606.........AAMVKGKFLIAYTPP--GA-----------------------------------G.....---........
POLG_HE701/347-515.........SFMTTGKLIICYTPP--GG-----------------------------------S.....---........
POLG_HRV2/358-522.........TANTTVKLLLAYTPP--GI-----------------------------------A.....---........
POLG_HRV8A/364-529.........SASSTLKLLIAYTPP--GV-----------------------------------G.....---........
POLG_HRV1B/360-525.........TANTTLKLLLAYTPP--GI-----------------------------------D.....---........
POLG_BOVEV/345-515.........TFMTTGKVLLAYTPP--GG-----------------------------------D.....---........
POLG_CXA21/369-534.........SMMATGKLLLSYSPP--GA-----------------------------------K.....---........
POLG_CXA9/358-524.........SAMATGKFLIAYSPP--GA-----------------------------------N.....---........
POLG_CXB4J/358-524.........SAMATGKFLLAYSPP--GA-----------------------------------G.....---........
POLG_CXB3N/360-526.........SAMATGKFLLAYSPP--GA-----------------------------------G.....---........
POLG_CXB1J/360-526.........SAMATGKFLLAYSPP--GA-----------------------------------G.....---........
POLG_FMDVO/725-872.................DLTWVPN--GA-----------------------------------P.....---........
POLG_FMDV1/726-878.................NLTWVPN--GA-----------------------------------P.....---........
POLG_BOVEV/610-775TGQNV....TTEQHTTYQVMYVPP--GA-----------------------------------P.....---........
POLG_HRV8A/621-792AAQG.....NDSGHIVLQFMYVPP--GA-----------------------------------P.....---........
POLG_HRV2/614-772SALS.....QDIGHITMQYMYVPP--GA-----------------------------------P.....---........
POLG_HRV1B/627-786AGRG.....DDIGHVVMQYMYVPP--GA-----------------------------------P.....---........
POLG_HE701/609-781LFSSSNVSFSGLPNLTLQAMYVPT--GA-----------------------------------R.....---........
POLG_HRV14/614-787SQPDSA...NYSSNLVVQAMYVPP--GA-----------------------------------P.....---........
POLG_CXA9/612-783RQDPGTTLAQDMPVLTRQIMYVPP--GG-----------------------------------P.....---........
POLG_CXB4J/612-783HQEMSTATNSDVPVQTHQIMYVPP--GG-----------------------------------P.....---........
POLG_SVDVU/612-782TQEQPTVRGQDAPVLTHQIMYVPP--GG-----------------------------------P.....---........
POLG_CXB3N/630-782TQQPSTTQNQDAQILTHQIMYVPP--GG-----------------------------------P.....---........
POLG_POL1M/636-806NFTETNN..GHALNQVYQIMYVPP--GA-----------------------------------P.....---........
POLG_CXA21/642-812NYPSTAS..GEVRNQCDQIMYIPP--GA-----------------------------------P.....---........
POLG_CXA24/646-809RYYTSNT..GYARNQVYQLMYIPP--GA-----------------------------------P.....---........

PF00915

CAPSD_VESVA/137-421---------SGVFGGKLAALLVPP..GV-----------------------------------E-PIES---VSMLQYPH
POLG_RHDVF/1768-2065---------SGVFGGRLVRAVIPP..GI-----------------------------------E-IGPG---LEVRQFPH
CAPSD_FCVUR/112-395---------SGVFGGKLAAIVVPP..GV-----------------------------------D-PIQS---TSMLQYPH
CAPSD_NVN68/2-294---------NAFTAGKIIVSCIPPGFGS-----------------------------------H-NLTI---AQATLFPH

PF08762

Q8B107_ALPV/599-804IPENGATEANAGPVQEDNTVIDETRTAA-----------------------------------D---------------V
O56051_9VIRU/590-790ALKPNSLYSGVRVIDTNGTWTYPDYKGA-----------------------------------E---------------V
Q56QP7_9VIRU/684-855....EQGQVMSTLVKNYHK.DHATSTGP-----------------------------------S---------------H
O36967_9VIRU/668-900NLWNSVQDSFNSLINVFSTTDYPIKSTG-----------------------------------A---------------L
Q5UBY1_9VIRU/79-259LKQSQTCYIRSFLTPRYYTPDNTNNDGP-----------------------------------S---------------H
Q6ITS9_9VIRU/106-313.............VDFVRATVSPQQTYG-----------------------------------S---------------E
Q4JFT2_9VIRU/834-1009..............DLYITTTSPDSIET-----------------------------------S---------------T

PF00760

CAPSD_CMVFN/11-215PK-------FDSTVWVTVR-------------------KVPASSD-------------LSVAAISAMF------------

PF01318

CAPSD_BMV/2-188PS-------VAGRIKACVA-------------------EKQAQAE-------------AAF-QVALAV------------

PF03566

Q80IX5_PRVFL/54-754NNITNWRD.LGTGQWAQFA..PGWYYSIYVLPNTYAMAEIGDRTD.--....SVTQFRKVYKGITFEFNAPTLIDQ----
CAPSD_NCBVS/1-608NNRTDWTE.ATYPSWAQVG..NVFY....MVVPTEALTDVPPPTQL--GVSGLLESYRLTSSGVTAYFNAPTLVNQ----
CAPSD_HASV/2-647NNLADWRYVVDSEQWINFTNDTTYYVRIRVLRPTY...DVPDPTE.--GLVRTVSDYRLTYKAITCEANMPTLVDQ----

PF01829

CAPSD_NODAM/42-399KQ-------VLNSYSQTVA-------------------TVPPTNL---------AQNTIAIDGLEALDALPNNNYS----

PF01766

POLS_IBDVU/9-452PTSYDLGYVRLGDPIPAIGLDPKMV.ATCDSSDRPRVYTITAADDYQFSSQYQAGGVTITLFSANIDAITSLSI..----
POLS_DXV96/2-442PQGFNNPYVRLGDKSPSTLSSPTHITNTSQNLATGGAYMIP.......VTTVPGQGFHNKEFSINVDSVGPVDILW----
POLS_BSNV/7-428PAGSDLPYVRLGDEVPSSAGV.....ARCSPSDRPRHYNAN.......NKQVQVGTTDTKTNGFNIDATTPTEV..----
POLS_IPNVJ/5-453PTGFDKPYVRLEDETPQGPQSMNGARMRCTAAIAPRRYEIDLPSER..LPTVAATGTPTTIYEGNADIVNSTAV..----

PF00729

CAPSD_PNLV/47-266TTSA--------------WAGSEGIKMLSYP----------------------------------------TGAVP----
CAPSD_MCMVK/23-222PSAT--------------IALKNRGPSIVMP----------------------------------------QN...----
CAPSD_PMVK/39-236LVPS--------------LSGKTYRPKIETR----------------------------------------GN...----
CAPSD_RCNMV/24-213STAV--------------YEKC.........----------------------------------------.....----
CAPSD_CARMS/51-245ETAA--------------QTAK.........----------------------------------------.....----
CAPSD_SBMVA/46-262SGQV--------------WSGSSGLCYINGT----------------------------------------RCLDT----
CAPSD_TBSVC/76-269ETAP--------------WAEA.........----------------------------------------.....----
CAPSD_POLVP/66-257ESAP--------------WCES.........----------------------------------------.....----
CAPSD_OCSVU/111-308ENMP--------------WQES.........----------------------------------------.....----
CAPSD_TNVA/61-272NFPP--------------YAGYDGAAYLNSN----------------------------------------QGAGS----

PF11729

CAPSD_SJNNV/1-340LLCVGSNTDVVNVSVMCRWSVRLSVPSLETP----------------------------------------EDTTA----

PF00894

CAPSD_PLRV1/70-207NK----------------FQITKGGAKTYQA----------------------------------------RMING----
CAPSD_PEMVW/53-187DT----------------WNIRSNGSATFGR----------------------------------------EILGD----
CAPSD_BYDVP/62-199NS----------------FTISKTASKTFRS----------------------------------------EAING----

PF03014

CAPSD_HEVCH/41-659ETSGVAEEEATSGLVMLCIHGSLVNSYTNTPYTGALGLLDFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADG----

PF03115

CAPSD_HASV1/1-416TNTNDNASDTLGPSIEIHTLGRTMSSYKNEQFTGGLFLVELASEWCFTGYAANPNLVNLVKSTDNQVSVTFEGSAG----

PF00983

COAT_TYMV/8-177-------------------------------------------------------------------------IGG----

PF02247

POL2_SQMVM/246-618VQFREIQGRT.TITFTQSEFL----------------------------------------------TAWSTQVLS----
POL2_CPMVS/460-832VQFAEVEEKC.TLVFSQQEFV----------------------------------------------TAWSTQVNP----
POL2_BPMV/447-819VQFGEIQEKV.VLKFSQEEFL----------------------------------------------TAWSTQVRP----
Q9Z006_9SECO/476-846FTFSSGSKSTRSVRFPKEVFG----------------------------------------------VYQALDRWD----
O12663_9SECO/321-691FTFSAGSKSTRSVRFPKEIFG----------------------------------------------VYQALDRWD----
Q9YWK0_9SECO/363-735VQFAEIQGRT.TITFTQGEFL----------------------------------------------TAWSTQVLS----
POL2_CPSMV/437-806IVFSDKQDRT.TISFSKDEFL----------------------------------------------MAWSTQVRP----
POL2_RCMV/407-778IQFGEVQERV.EITFTRKEFL----------------------------------------------TAWSTQVDP----
Q9YWJ9_9SECO/452-824VQFAEIQGRT.TITFTQSEFL----------------------------------------------TAWSTQVLS----
Q66170_CPMVS/343-715VQFAEVEEKC.TLVFSQQEFV----------------------------------------------TAWSTQVNP----

PF03391

CAPSD_TRSV/179-344MHG.DGQFEI-AIKTR-------------------------------------------------------LHSAA----
POL2_RRVS/768-936VKS.NEIFEV-DLYCP-------------------------------------------------------YGENP----
POL2_BRAV/1268-1433LPSGEGKFHI-KVQTP-------------------------------------------------------YGRLS----
Q65029_ARMV/745-916IEE.DGSFAI-EIRSP-------------------------------------------------------YHRTP----
POL2_ARMVS/792-963IEE.DGSFAI-EIRSP-------------------------------------------------------YHRTP----
Q67703_GFLV/166-336VEE.DGSSEV-KIRSP-------------------------------------------------------YHRTP----
POL2_GFLV/771-941VEE.DGSFEV-KIRSP-------------------------------------------------------YHRTP----
POL2_BRSV/1007-1170VEV.NVDASL-QIQSP-------------------------------------------------------FFSTA----
POL2_GCMV/981-1144CDV.DVVSSL-KIQSP-------------------------------------------------------FYATA----
POL2_TORVR/1497-1662LA..DGQGAF-SLPIS-------------------------------------------------------TPHAA----
Q88483_9SECO/1003-1166VTL.DAKATL-QIQSP-------------------------------------------------------FFATA----

PF02443

Q5Y4T0_PCV2/5-226------RKVKVEFWPCSPITQ.GDR--------------------GVGSTAVILDDNFV..TK--------ANALT----
Q27W03_PCV1/5-227------RKAKYEFYPRDPITS.NQR--------------------GVGSTVVILDANFV..TP--------STNLA----
A3FEQ4_9CIRC/3-256------KGVAVTLRPAYNIYQ.KSK--------------------TQGSTIIDKDGQIVR.TS--------TTGWA----
Q3HUU1_GOCV/5-247------RMVKVELRPAYNPFT.RVR--------------------TQGSTYIDKEGNITTTTS--------GSEWN----
Q1L2D2_9CIRC/1-237------VLVKVEMRPLGENST.EWK--------------------GLGHTVPITDARLMNFVK--------KKGLA----
CAPSD_CACV/7-243------RLAKVEMRPLNESWE.EWK--------------------GFGHNVPIQDNHLEDFFK--------KTRLD----
Q0H9S8_9CIRC/4-236------RLAKFEMRPLNENWG.SWH--------------------GIGHNVPIQDNHLEDFFK--------KPGLE----
Q06J73_9CIRC/8-245------RLAKVEGIPRREDWT.HWE--------------------GAGVTVPIQDQHLRDFFK--------KTRLT----
Q9DXG3_BFDV/11-242------KLAKMEMRPTGGHYTVQSD--------------------GFGHTAVIQDSRITRFKT--------IADQT----
Q69EZ5_BFDV/7-239------KLAKMEMRPTYGFGSITQE--------------------GFGHTAVIQDSRISKFKT--------TADQN----
Q9DXG0_BFDV/11-242------KLAKMEMKPTWGHYSIATE--------------------GFGHTAVIQDSRIEKFKT--------RADQS----
Q9DXF4_BFDV/3-235------KLAKMEMKPTWGHSYTNSE--------------------GFGHTAVIQDSRISKFKT--------TADQT----

PF02956

A7VLZ2_9VIRU/1-506TKPHGKRYVKIKIKPPTQMSN-KWFFQEGFSDTGLVQIHTAACDLRYAHLGCCNTNQLASFLT.LNTDFYQYAAWG....
Q9WT88_9VIRU/1-603TRPGGRRFVKIRLNPPKLFED-KWYTQQDLCKVPLVSITATAADLRYPFCSPQTNNPCTTFQV.LRK.NYNTVIGT....
Q91CY9_9VIRU/1-581TKPKGKAKIRLRIKPPVLFED-KWYTQQDLCPVNLLSLAVSACSFLHPFIPPESDNICITFQV.LRD.FYYTQMSV....
A7VLY0_9VIRU/1-515RKPLGKPYIKVKIKPPKQMLT-EWFFQQDFATQGLFSIHAAAANMQWAYYNPDQQSRCLTLYS.LNIKFFANTDWS....
Q9JGT1_9VIRU/1-585NRPGRKHYVKIKVGAPRMFTD-KWYPQTDLCDMTLLTIFASAADMQYPFGSPLTDTIVVSFQV.LQS.MYNDCLSV....
Q80QT8_9VIRU/1-595TRPWGKKKVTVRVGPPKLFED-KWYSQHELCKVPLVSWRLTAADMRFPFCSPLTDNPCYTFQV.LHE.EYYNVIGT....
CAPSD_TTVB1/1-533RGPNKETYVKKIVRPPALFQS-KWYFSQDIYNTPLFILTVSSCSLDQMYAPQDQISTNISLFS.LNTNVFQINNWH....
A7VM00_9VIRU/1-509TNPNGKLTKRIKIKPPKMLQT-KWYFQEELAEFGLVAIHAAACNFRYPWLACCNENLIITLYY.LQPSFWSHTEWA....
Q9JG61_9VIRU/1-534PNKKRKPYIRKKYKPPALLQN-KWYFAQDILNTPLILFTTSSCSLDQMYAPNDQISTNITFLS.LNTNIFQNPYWE.LDD
Q91PS3_9VIRU/1-581TRPKGHSTKTIRIPPPTLFAD-RWYFQKDFAKVPLVNIGASIGNLRFPFCRPQTENTCVYFQV.LSN.AWNNMLSI....
CAPSD_TTVV4/1-560TRPRGKKRIPVRIGPPRLFTD-HWYFQRDFCGVPLLTVNATACNLRYPFGSPQTKNICIYFLV.LAS.IYNDKVSI....
Q91C93_9VIRU/1-546NNKKTKPYIRLRIPPPSQLKT-KWYFQRDIANLPLLLTIATACSLDRPYLNSQSISNTVGFKT.LNYEAFLNRGFK.NIP
Q2F827_9VIRU/1-589TRPGGRRRVKVTIRPPTLLED-KWYTQQDLAPVNLVSLVVSAASFIHPFSQPQTNNICTTFQV.LKD.MYYDCIGI....
Q91CY5_9VIRU/1-584TRPRGRKRYRVRIRPPNMFAD-KWYTQEDLCPVPLVQLVVSAASFMHPFCSPLTNNPCITFQV.LKD.NYYSCIGV....
Q8V7G9_9VIRU/1-572TRPKGKRSVRIHIKPPKLMIN-KWYFAKDLCNIGPCQIYATGLELSNPWLRSGTNSPVIGFWV.LKNHLYDGNLSN....
Q99A78_9VIRU/1-584SRPGRKHVVKIRVGAPRMFTD-KWYPQSDLCDLPLLTIFASAADMQYPFGSPLTDSVVVGFQV.LQS.MYNDCLSI....
Q6H9C2_9VIRU/1-573TRPSRKHRVVVRVGAPRLFQD-KWYPQSDLCDTVLLSIFATACDLQYPFGSPLTDNPCVNFQI.LGP.QYKKHLSI....
CAPSD_TTVT1/1-433WNGKGK...KIFLKPPAVFNS-AWYTSDKWCGAGLGRIYFSFLNPFKQIMHTNQTEQSFPFAIELGNTDYDKPPNN....
Q9JG80_9VIRU/1-589TNPKGRQKIIVKIPPPDLFVD-KWYTQEDLCSVNLVSLAVSAASFLHPFGSPQTDNPCYTFQV.LKE.FYNQAIGF....
A7VLZ6_9VIRU/1-506TKNPNKLTKKFKIKPPRQMIS-KWFFTKPFAKYPLLSLKASALDLRHSYLGCCNENSQVYFFY.LNHGFYKQTNWG....
Q6H9D2_9VIRU/1-557TKPKGKGTVKVRIRPPTLFDD-RWYFQHDICKTTLFTISATPCDLRFPFCSPQTDNPCVNFLV.LAG.VYNGKLSI....
Q6H999_9VIRU/1-471TRPKGRKAIRLRIAPPTLFTD-KWYFQKDIADLTLFNIMAVEADLRFPFCSPQTGNTCISFQV.LNS.VYNNYLSI....
Q77JT5_9VIRU/1-606TRPSRKHVVRIRVGAPKLFED-KWYPQNELCDVTLLTIQATTADFQYPFGSPLTNSPCCNFQV.LNS.NYDNAHSI....
Q91PS7_9VIRU/1-585TRPRGRATKRVRFKPPTLYTD-KWYFQKDICNLPLVNIAASACSLRFPFCSPQTDNTCVNFQV.LSK.RFNTMLSI....
CAPSD_TTVV9/1-555TKKGGRRYLRLKIPPPKLMMT-QWYFQKEFCQVGLVLLSISTATLMHPWMAPFVNSPALTIYA.VNHKTYSDMSIL....
Q9JG47_9VIRU/1-553YNRNKKPYKKFFVKPPSQLQN-KWYFQKELSNVPLMQVMATTCSLDRMYLSSSSVSTTMGFVS.LDTNGFMERYMK.DNG
A7VLW0_9VIRU/1-507TKPNGKLTTRFKIRPPKQLVT-KWFFQKDFAQYGLVAIAAAACNLRYPWLACCNENLIITLRY.LQPQFYHNSAWA....
Q0ZLH9_9VIRU/1-573TRPKGRIKRKIKVRPPTLFTD-KWYFQRDLCKVPLVTVSASAASLRFPFGSPQTENYCIYFQV.LDP.WYHTRLSI....
Q5ENW7_9VIRU/1-501RAPHRRKVRKIFIPPPSRDTT-QWQFQTDFCNRKLFTWAAGLIDMQKPF...............DANGAFRNAWWL....
A7VLX2_9VIRU/1-509TKPHGKLTVKIKIKPPKLLST-RWFFQKEMSSVPLVQLSAAACDFNYPRIGCCNVSQVMTIFF.LNPQFWGQTDWG....
Q80AR5_9VIRU/1-594AYPKGRKYVLAKIPPPKLFED-HWYTQPDLCKVPLVTLRSTAADLKHPFCSPQTNNPCTTFQV.LRD.KYNDMIGF....
Q91CZ2_9VIRU/1-601TWPKGRSKVKLKIKPPKMFVD-KWYTQEDLCTVTLVSLVVSLASFQHPFCRPLTDNPCVTFQV.LQN.FYNNVIGY....
CAPSD_TTVG1/1-514TNPRGKLKKKKTIKPPKQMLS-KWFFQQQFAKYDLLLIAAAACSLRYPRIGCCNENRMITLYC.LNTKFYQDTEWG....
Q98Y63_9VIRU/1-581TKPGGKSRIKVKIKPPALFED-KWYTQQDLCPVNLLSLAVSACSFIHPFCSPESDTICMTFQV.LRE.FYYTHLTV....
Q9QU36_9VIRU/1-529NGRNRKTYKTIKVRPPTQMTN-GWFFQKDLCNFPLLVILATAASFDRYYTNSKAKSTTIGFIS.LNTLTFQYHNWQ.DPP
A7VM12_9VIRU/1-509SKPHGKYKYKLRIKPPKQLIT-KWFFTKPFSNYGLLFLKGSAMNLRYSYLSASNENMLVNISS.LNPQWYVNTDWA....
A7VLV6_9VIRU/1-508SNPKGKLRVKVKIKPPKTMQT-KWYFQKQIAELPLVQLQAAACDVPFVRIGCCNPSQVSTIYF.LNPQFYYDTDWG....
Q9JG50_9VIRU/1-535KQIHKKPYVKKRIRPPAMLQS-HWYFQQEICNTGLLLITTSICNLNNYWLSNNHLSNNISFWS.VNTRLFSNPNFQNTDS
A7VLW4_9VIRU/1-507SNPNGKLYKKIKFKPPKQMIN-KWLFTKNFTPASLIVLKTAVCNFSHANLSGKNQNMLVSLIS.LNLSFYKNPAWA....
A7VM04_9VIRU/1-513TNPKGKLKKTRKVKPPKQMLN-KWFFQEHFSHEPLLMIQATAANLNYVNLGCCNTNQMCTFFY.INPGFYQIANWG....
A7VLY4_9VIRU/1-498TKPHGKNRVIIKIKPTRVVLK-KWFFQETFDTTGLCSIYAAACDLNYPHIGATSQNQIITLFG.LNQSFYSKGNWG....
CAPSD_TTVD1/1-324RGGNRRKWPRMWIPRPAIFAD-GWEFQKDLCQHGLFAFGWAWVDLDRPWMADISKPA....QT.IDPSTYDKK.......
Q91CZ6_9VIRU/1-596THPKGRAKIKIHIEPPKMFVD-KWYAQHDLCDVELVSFVVSLASFQHPFCRPQTDNPCVTFQV.LQN.FYNKCIGT....
A7VM08_9VIRU/1-506TKPTGRIKHTLKIGPPKLLTN-KWMFQEQFATQDLVQIAGTACNFRYPTLGCCNENRILNLFA.LDTGFYQNVDWM....
CAPSD_TTVV3/1-573TRPSKKHYVKVRVGAPRLFQD-KWYPQSELCDVTLLVIYATACDLQYPFGSPQTDNVCVNFQI.LGQ.PYYQHLKT....
Q91D00_9VIRU/1-593TFPRGRKYVKVKIPPPKLFED-HWYTQPDLCKVPLVTLRSTAADFRHPFCSPQTNNPCTTFQV.LRE.NYNEVLGL....
Q99AR5_9VIRU/1-604TRPGGRRFVKIRLPPPKLFED-KWYTQQDLCKQPLVTLTATAASLRYPFCSPQTNNPNCTFQV.LRK.NYHKVIGT....
Q9DTD2_9VIRU/1-559TRPGRKHRITVRIGAPKTFED-KWYPQTDLCDVILVVIYATAADFTFPFGSPLTNTHCVNFQV.LGS.DYNDILSI....
Q91D04_9VIRU/1-591TRPRGRKKVKLHIKPPVLFED-KWYTQQDLCDVNLLSLAVSAASFRHPFCPPQTDNICITFQV.LKD.FYYTQMSV....
CAPSD_TTVV8/1-571TRPSRRHKITVRIGPPKLFED-KWYSQTDICDVILATVYATACDLQYPFGSPLTENYCISFQV.LGS.AYNNLISN....
Q5ENX0_9VIRU/1-603TRPRGKKYISVRIRPPKLFQH-KWYTQSDLCSVSLVQLNLTAADLKHPFGSPLTDTPCVSFQV.LGD.LYNECLNI....
O90364_9VIRU/1-590SIPGKKHYIKIRVGAPKMFTD-KWYPQTDLCDMVLLTVYATAADIPYPFGSPLTDSVVVNFQV.LQS.MYDKYISI....
Q9IFV0_9VIRU/1-583TKPKGRPVKRIRIKPPTLFTD-RWYFQKDFSNFPLVTISASAASLRFPFCSPQTGNICIYFQI.LDPYWYNRRMSI....
Q9QUE7_9VIRU/1-586TRPGRRHIVKIRVGAPKLYED-KWYPQSELCDVPLLTVYATAADMQYPFGSPLTDTPVVTFQV.LRS.MYNDALST....
A8DMR2_9VIRU/1-531NNNKRKISKTIKIPPPTLMQN-KWYFQKDFAKYPLVMILSAALSLDRYYTSANSISSTIGFAS.INTTIFQYSDFKSPNL
Q9DUH8_9VIRU/1-609TRPGGKKTVSVRIRPPKLFNH-KWYAQSDLCDVNLVQFTVTAADFMHPFGSPLTETPCVTFQV.LGD.LYNKCLNIDLPK
A7VLW8_9VIRU/1-511TNPKGRLKKKLIIRPPKQMLS-KWFFQRQFATADLFQLVTAACSLNYPRLGCCNENRTLTLYY.INPYFYQYSDWG....
Q99AQ3_9VIRU/1-582TKPKGREKIKLRIQPPKMFID-KWYTQEDLCPVILVTLVATAASFTHPFCSPQTANPCITFQV.LKE.FYYQAMGY....

PF00073

Q9WMA0_9PICO/49-215...............YGSI...............................----------------...ASLTVYP----
POLG_AEVCA/45-212..............DIESI...............................----------------...AAMTTYC----
POLG_CXA9/93-300AVVGQ..AFSATAMANGDKAYEF.TSATQSDQTK.VQTAIHN....AGMG----------------VGVGNLTIYP----
POLG_CXB3N/93-302ATLDN..TPSSAELLGGDTAKEFADKPVASGSNKLVQRVVYN....AGMG----------------VGVGNLTIFP----
POLG_CXB4J/93-300TNAEN..APAYGDLCGGETAKSF.EQNAATGKTA.VQTAVCN....AGMG----------------VGVGNLTIYP----
POLG_CXA21/93-308NTESKTSYVSYINANPGERGGEFTNTYNPSNTDVSEGRQFAALDYLLGSG----------------VLAGNAFVYP----
POLG_POL1M/93-308DSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNG----------------TLLGNAFVFP----
POLG_POL3L/93-307DSDKQR.YTSYANANPGERGGKFYSQFNKDNAVTSPKREFCPVDYLLGCG----------------VLLGNAFVYP----
POLG_HE701/93-288GKKGTGTSASFAEVMKGAEGGVFEQPYLLDD..................G----------------TSLACALVYP----
POLG_BOVEV/93-285...ATQEQPAFDRTMPGSEGGTFQEPFWLED..................G----------------TSLGNSLIYP----
POLG_HRV14/93-299HEGGNV.SVKYTFTHPGERGIDL...SSANEVGGPVKDVIYN....MN.G----------------TLLGNLLIFP----
POLG_HRV2/93-302ALHGNV.NVGYNYTHPGETGREVKAETRLNPDLQPTEEYWLN....FD.G----------------TLLGNITIFP----
POLG_HRV8A/93-302ATSGNV.SVGYNHTHPGEQGREVVPSRTSSDNKRPSDDSWLN....FD.G----------------TLLGNLPIYP----
POLG_HRV1B/93-301AKNGSV.TAGYNLTHPGEAGR.VVGQQRDANLRQPSDDSWLN....FD.G----------------TLLGNLLIFP----
POLG_FMDV1/311-475.............FDTREK...............................----------------...YQLTLFP----
POLG_FMDVT/311-475.............ISDREK...............................----------------...YQLTLYP----
POLG_FMDVO/311-475..............IQKRE...............................----------------..LYQLTLFP----
POLG_EMCV/161-359AFAMDNRW.SKDNLPNGTRTQTNKKGPFAMD..................H----------------QNFWQWTLYP----
POLG_TMEVB/172-382PFTMDTEWRSPQGAPTGYRYDS.RTGFFATN..................H----------------QNQWQWTVYP----
POLG_ENMGO/162-361VFAMDNRW.SKDNLPNGTRTQTNRKGPFAMD..................H----------------QNFWQWTLYP----
POLG_FMDVO/533-691..............PPKTP...............................----------------...EAAAHCI----
POLG_FMDV1/533-692.............TPPDTP...............................----------------...EEAAHCI----
POLG_EMCV/420-582..............KPTSR...............................----------------...DQAMQAT----
POLG_TMEVB/443-606..............KPTTR...............................----------------...DQAMQST----
POLG_HE701/347-515..............SPTDR...............................----------------...MQAMLAT----
POLG_HRV2/358-522..............EPTTR...............................----------------...KDAMLGT----
POLG_HRV8A/364-529..............KPKSR...............................----------------...REAMLGT----
POLG_HRV1B/360-525..............KPATR...............................----------------...KDAMLGT----
POLG_BOVEV/345-515..............MPRNR...............................----------------...EEAMLGT----
POLG_CXA21/369-534..............PPTNR...............................----------------...KDAMLGT----
POLG_CXA9/358-524..............PPKTR...............................----------------...KDAMLGT----
POLG_CXB4J/358-524..............APDSR...............................----------------...KNAMLGT----
POLG_CXB3N/360-526..............APTKR...............................----------------...VDAMLGT----
POLG_CXB1J/360-526..............VPKNR...............................----------------...RDAMLGT----
POLG_FMDVO/725-872..................................................----------------EKALDNTTNP----
POLG_FMDV1/726-878..................................................----------------EAALSNTSNP----
POLG_BOVEV/610-775..............VPSNQ..............................D----------------SFQWQSGCNP----
POLG_HRV8A/621-792..............VPEKR..............................D----------------DYTWQSGTNA----
POLG_HRV2/614-772..............VPNSR..............................D----------------DYAWQSGTNA----
POLG_HRV1B/627-786..............IPKTR..............................N----------------DFSWQSGTNM----
POLG_HE701/609-781..............KPSSQ..............................D----------------SFEWQSACNP----
POLG_HRV14/614-787..............NPKEW..............................D----------------DYTWQSASNP----
POLG_CXA9/612-783..............IPAKV..............................D----------------DYAWQTSTNP----
POLG_CXB4J/612-783..............VPTSV..............................N----------------DYVWQTSTNP----
POLG_SVDVU/612-782..............VPTKV..............................N----------------SYSWQTSTNP----
POLG_CXB3N/630-782..............VPDKV..............................D----------------SYVWQTSTNP----
POLG_POL1M/636-806..............VPEKW..............................D----------------DYTWQTSSNP----
POLG_CXA21/642-812..............RPSSW..............................D----------------DYTWQSSSNP----
POLG_CXA24/646-809..............RPTAW..............................D----------------DYTWQSSSNP----

PF00915

CAPSD_VESVA/137-421VLFDARQTEPVIFTIPDIRKTLFHSMD.ETDTTKLVIMVY....KNGADT..KTTCSITVETRPSADFTFALLKPP----
POLG_RHDVF/1768-2065VVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGS..TSAIQVTVETRPSEDFEFVMIRAP----
CAPSD_FCVUR/112-395VLFDARQVEPVIFTIPDLRSTLYHLMS.DTDTTSLVIMVYNDLINPYANDSNSSGCIVTVETKPGSDFKFHLLKPP----
CAPSD_NVN68/2-294VIADVRTLDPIEVPLEDVRNVLFHNNDRNQQTMRLVCMLYTPLRTGGGTG.DSFVVAGRVMTCPSPDFNFLFLVPP----

PF08762

Q8B107_ALPV/599-804............YMPRNLEGTFEFQV----------------------------------------PHYSRYPLLP----
O56051_9VIRU/590-790............FMTPN.EGIHELSI----------------------------------------PYYSSY...P----
Q56QP7_9VIRU/684-855............MTYNNLNPVHEIMI----------------------------------------PYYSQYRKIP----
O36967_9VIRU/668-900PAGTSGFGNSMTYIDPEVEGFMEFEI----------------------------------------PYYNISHISP----
Q5UBY1_9VIRU/79-259............ITYPVLNPVHEVEV----------------------------------------PYYCQYRKLP----
Q6ITS9_9VIRU/106-313VAPTTHISTPLAIEQIPIKGVAEFQI----------------------------------------PYYA.....P----
Q4JFT2_9VIRU/834-1009SAYQFDTNRAMHYINTSLNPMAQISL----------------------------------------PYYS.....P----

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754--------------------------------------------------------------------------------
CAPSD_NCBVS/1-608--------------------------------------------------------------------------------
CAPSD_HASV/2-647--------------------------------------------------------------------------------

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226------------------------------------------------------------------------------YD
Q27W03_PCV1/5-227------------------------------------------------------------------------------YD
A3FEQ4_9CIRC/3-256------------------------------------------------------------------------------ID
Q3HUU1_GOCV/5-247------------------------------------------------------------------------------VD
Q1L2D2_9CIRC/1-237------------------------------------------------------------------------------DD
CAPSD_CACV/7-243------------------------------------------------------------------------------AD
Q0H9S8_9CIRC/4-236------------------------------------------------------------------------------TD
Q06J73_9CIRC/8-245------------------------------------------------------------------------------VD
Q9DXG3_BFDV/11-242------------------------------------------------------------------------------QD
Q69EZ5_BFDV/7-239------------------------------------------------------------------------------QD
Q9DXG0_BFDV/11-242------------------------------------------------------------------------------QD
Q9DXF4_BFDV/3-235------------------------------------------------------------------------------QD

PF02956

A7VLZ2_9VIRU/1-506........................NPKNPYIPTEQDKWYRP..........................YRIVEPVTEV.ED
Q9WT88_9VIRU/1-603.......................SVKDQESTQDFENWLYKTD.......................SHYQTFATEAQLGRI
Q91CY9_9VIRU/1-581..................TPTTTTSLNQKDEKIFSDHLYKNP.......................EYWQSHHTAARL.ST
A7VLY0_9VIRU/1-515........................ATHTGTQM......YFP..........................YNAWPHTKGL.TF
Q9JGT1_9VIRU/1-585...................LPSNFVEPSGKGKLLYDKIRKHL.......................PYYNTTQTQAQL.KR
Q80QT8_9VIRU/1-595....................SALLTPTNATYTNFEKWLYGKC.......................THYQTFATDTRL.AP
CAPSD_TTVB1/1-533KQPYTTKAASTLE.TYLYCYHNGHEPTQELKWKDIILLGNM........................TNYTDGKKYNTS.GT
A7VM00_9VIRU/1-509........................QYSTSA........YNPQ.........................GHLHPMPETL.TF
Q9JG61_9VIRU/1-534NQPYFPKVTGTINNIGLYTMGNGGNIKNMKNWKQLIPLYQT........................QLYKKEHNTNGTDWT
Q91PS3_9VIRU/1-581......................AHPHTENNWQYITETLLKT...HWHSNQRKGTMANYDSRDRVGVVFNTFKTQEHI.QN
CAPSD_TTVV4/1-560......................AKDEVTKNYDTLVDAIKKSPQGL....................TVFNTFKTQEHM.QE
Q91C93_9VIRU/1-546TTGYFPKPNTRYF.....ITQTHSTDPKNVPIGSLIFLGNT........................NLLTLGTKIQDA.CP
Q2F827_9VIRU/1-589.......................NSTLTTKYENLFNKLYSKC.......................CYFETFQTIAQL.NP
Q91CY5_9VIRU/1-584.....................NSLETHKNSYTKLQEWLYKTN.......................TFFETTQVIAQL.SP
Q8V7G9_9VIRU/1-572.........................IASGEQLTARQTLFTT........................KLLPSNNTKDEW.QY
Q99A78_9VIRU/1-584....................LPENFNGNGKGKALHDNITKYL.......................PNYNTTQTLAQL.KP
Q6H9C2_9VIRU/1-573......................SSTMDESNKAHYEQNLFKKT.......................ELYNTFQTIAQL.KE
CAPSD_TTVT1/1-433................................................................................
Q9JG80_9VIRU/1-589........................SATQDKIDNVFNILYQNN.......................SYWESNITPFYV.IN
A7VLZ6_9VIRU/1-506........................QYSTTP.....................................YRPSNEINTV.YY
Q6H9D2_9VIRU/1-557......................EPTNVESQYNSLLSAIETNTQG.....................TLFNTFKTPEMI.KC
Q6H999_9VIRU/1-471...................NTFNNDNSDSKLKEFLNKAFPTTGTKGTSL................NALNTFRTEGCI.SH
Q77JT5_9VIRU/1-606....................LNLSNEPTNKWHTYRNNCYKFLLEQY...................SYYNTKQVVAQL.KY
Q91PS7_9VIRU/1-585......................SPDYPKKNYDSFVKTYLKNAQEHWNQN.KKGTLDNYNDPNRLLTVFNTFKTEEHL.YD
CAPSD_TTVV9/1-555......................PSNNQGSTKNELIETLYTAE.......................HTYNPMAQRIWG.NI
Q9JG47_9VIRU/1-553TAPYSPLTGQIIF.....AAPNGDNVITNIPLGQCILLGTV........................TDYTPGTQLSSI.TL
A7VLW0_9VIRU/1-507........................QTTKE.........YNPV.........................YGTQPMKKTL.TF
Q0ZLH9_9VIRU/1-573......................TGGKPAEYWTQLKAYLTQG....WGRS....TNNAGYQHGPLGTYFNTLKTSEHI.RQ
Q5ENW7_9VIRU/1-501........................EQRNDQGEMKYIELWGRV.......................PPQGDSELPKKK.EF
A7VLX2_9VIRU/1-509........................QYMAHA.....................................YMNIATGVAL.TG
Q80AR5_9VIRU/1-594................PFNYNPSDTNQTKTLQDFEKWLYSSS.......................THYQTFATEANL.RP
Q91CZ2_9VIRU/1-601.......................SSSDTLVDNVFTSLLYSKA.......................SFWQSHLTPSYV.KK
CAPSD_TTVG1/1-514........................TTKQAPHY......FKP..........................YATINKSMIFVSN
Q98Y63_9VIRU/1-581..................TPTTTTSTPEKDKKIFNDQLYSNA.......................NFYQSLHASAFL.NI
Q9QU36_9VIRU/1-529TTGYKPQDNMWFW.....GTLNGSDDPNEEPLTNLIYLGGT........................NNHTKGIPVKNQ.SN
A7VM12_9VIRU/1-509........................RARQDTQG......YLP..........................QPNM..NKSL.SY
A7VLV6_9VIRU/1-508........................ATKNHA.....................................YMYIRTGVSL.TG
Q9JG50_9VIRU/1-535TVGYTPKDGVYLY......GTYNGTPTQNLTWMHMIYLGNT........................HKYQQGLAPIDMSGP
A7VLW4_9VIRU/1-507........................QALTASG.......YKP..........................YDNIPSDLPF.VV
A7VM04_9VIRU/1-513........................ATTTTG........YIP..........................YSGYPTATIY.TW
A7VLY4_9VIRU/1-498........................AVVQTG.....................................YQPYPSVTTF.TY
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596.....................SVNLSDSTFDSIFRDYLYKIG.......................SFYQQVLVPSYI.KR
A7VM08_9VIRU/1-506........................QARQTGVG......YKP..........................YSTIDKRLTF.HY
CAPSD_TTVV3/1-573....................ALGLTEKTTYENHYKNNLYKKI.......................KFYNTTETIAQL.KP
Q91D00_9VIRU/1-593................PYANTGSNNEVKIKIDNFENWLYNSS.......................VHYQTFQTEQMF.RP
Q99AR5_9VIRU/1-604.......................SSTNSEDVTPFENWLYNTA.......................SHYQTFATEAQVGRI
Q9DTD2_9VIRU/1-559.......................LPDKLKSKESKIEKIYKNI.......................AYYNTKQTIAHL.KI
Q91D04_9VIRU/1-591....................TPDTAGQEKDIEIFEKHLFKNP.......................QFYQTVHTQGII.SK
CAPSD_TTVV8/1-571.......................TLNPNEEQQDIKSAIYNNV.......................NAYLTRITESHM.AN
Q5ENX0_9VIRU/1-603......DLPETEKDSLTKLKNSSTDEYSKNLQKLLQQLYTNG.......................QYWQTFITGPFIKDT
O90364_9VIRU/1-590.......................LPDQKSQSKSLLSNIANYI.......................PFYNTTQTIAQL.KP
Q9IFV0_9VIRU/1-583......................TPDLLKSNYESFFSVLNTK....FSSSPLYPNVATTVPSGPIGTVFNTFKTQEHV.VD
Q9QUE7_9VIRU/1-586...................LPSNFENASSPGQKLYKEISTYL.......................PYYNTTETIAQL.KR
A8DMR2_9VIRU/1-531TQPYKPNDEYWLRT....WTNQTITNFSAVETQRVILLGNT........................NDYQPGEPMGDE.KA
Q9DUH8_9VIRU/1-609VDTVKNASSPHTKIQVKLTDNSGNPTNKEAVKTLYEQLFSYG.......................QYWQTFITDFMT.AN
A7VLW8_9VIRU/1-511........................QVKEHANY......YKP..........................YNSIADLEFW.SG
Q99AQ3_9VIRU/1-582........................GTPETTMSTIWNTLYTTS.......................TYWQSHLTPQFV.RM

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754--------------------------------------------------------------------------------
CAPSD_NCBVS/1-608--------------------------------------------------------------------------------
CAPSD_HASV/2-647--------------------------------------------------------------------------------

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659--------------------------------------------------------------------------------

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226PYVNYSSRH-----------------------------------------------------------------------
Q27W03_PCV1/5-227PYINYSSRH-----------------------------------------------------------------------
A3FEQ4_9CIRC/3-256PYGSTSSRR-----------------------------------------------------------------------
Q3HUU1_GOCV/5-247PYAAMSSRK-----------------------------------------------------------------------
Q1L2D2_9CIRC/1-237PLANWDGAL-----------------------------------------------------------------------
CAPSD_CACV/7-243PLANWDGAR-----------------------------------------------------------------------
Q0H9S8_9CIRC/4-236PLANWDGAR-----------------------------------------------------------------------
Q06J73_9CIRC/8-245PLANWDGAR-----------------------------------------------------------------------
Q9DXG3_BFDV/11-242PLAPFDGAK-----------------------------------------------------------------------
Q69EZ5_BFDV/7-239PLAPFDGAR-----------------------------------------------------------------------
Q9DXG0_BFDV/11-242PLAPFDGAK-----------------------------------------------------------------------
Q9DXF4_BFDV/3-235PLAPFDGAR-----------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506VKGNKKTIT....T.......................................VFTPYTE....................
Q9WT88_9VIRU/1-603PAFNPDGTK....NTKQQSWQDNWSKKNSPWTGNSGTYP...QTTSEMYKIP.YDSNFGFPTYR.........AQKDYIL
Q91CY9_9VIRU/1-581SQKPALRNK....EEIPNDHGYLNTTPTDSTFRTG..................NNTIYGQPSYR.........PNYTKLT
A7VLY0_9VIRU/1-515WTIDSKGNK....TPHSI...................................KPQNYNQ....................
Q9JGT1_9VIRU/1-585YIDNQST..........TDTWNSYLNTKKFSTNESPKTD...INSIGGPYTTYSDTWYKGTAYIQ.........KITEVP
Q80QT8_9VIRU/1-595QTTSKYKPD....GQPLTSSELTWDQSAFNSFKTK..................ADSNYGYCTYNPNGST....QLVEKIK
CAPSD_TTVB1/1-533TPLDLFKTE....NKPY....................................WGNVFTNLNQDQ...............
A7VM00_9VIRU/1-509KGKIDNREYTWNMSPF.....................................ISDKYTN....................
Q9JG61_9VIRU/1-534TNFSDLSQP....NK......................................WANPFSYSAHEETN.............
Q91PS3_9VIRU/1-581PNFQTDKEQ....VSTPYTYDT...............................VTSLWGDYVYKES........IIDSFK
CAPSD_TTVV4/1-560PSSETCKET....QKTNPPFKYEN.............................LSSLWGDKIYKES........TFNSFK
Q91C93_9VIRU/1-546SSTENEWKN....QFEKYLQTEKN.............................WGNPFTPEYLDED..............
Q2F827_9VIRU/1-589GFKAAKKTT....NGSGSTAATLGDAVTELKNPNGTFYT...G..........NNSTFGCCTYK.........PTKEIGS
Q91CY5_9VIRU/1-584SFAPAYKPN....GTNNNTHKPLGGMVPELKYNNAGFHT...G..........NNPVFGMCKYK.........PSTLTMQ
Q8V7G9_9VIRU/1-572AYTPL..............MKTFYTQAANTAAHNI..................TDKTYNWKNYK............THYD
Q99A78_9VIRU/1-584YIDNTSTGS........TNNWSSYVNTSKFTTASKTITT.....SAEGPYYTFADTWYRGTAYNN.........SITNVP
Q6H9C2_9VIRU/1-573TGNISGITPTWTEVQNSTTLNQAGNNATDS.......................RDTWYKGNTYNE.........KISELA
CAPSD_TTVT1/1-433................................................................................
Q9JG80_9VIRU/1-589VKKGSNTAD....YLSPQITDSNFRKK..........................VNTNYNWYTYNAK.......SNKDNLH
A7VLZ6_9VIRU/1-506KDKTGNKKQ....IGP..FNT................................TATAYDD....................
Q6H9D2_9VIRU/1-557PAAGKAPET....GDISTNCYKK..............................LDSAWGDTIWNQN........TIANFK
Q6H999_9VIRU/1-471PQLKKPNPQ....INKPLDSQYFAP............................LDALWGDPIYY..........NDLNEK
Q77JT5_9VIRU/1-606KWNPNQNPT....MPNTSNASLSKKPDDLTKTKTTNEYP...H..........WDTLYGGLAYGHSTVTPGTTSSPTDLK
Q91PS7_9VIRU/1-585PSAKETKNT....TNTDAAGNKYNT............................VTSLWGDYIYKET........VVDNFI
CAPSD_TTVV9/1-555KPQNTNF..............................................TPENYWNKWNE..........IHTKIK
Q9JG47_9VIRU/1-553NTGALSPPS....DWGTFKSASKAIYNAYYQHKY...................WGNPFFTNWFHGD..............
A7VLW0_9VIRU/1-507NYIIGNQRGTYTMSNS.....................................DISDYDS....................
Q0ZLH9_9VIRU/1-573PPADNYKQA....NKDTTYYGR...............................VDSHWGDHVYQQT........IIQAME
Q5ENW7_9VIRU/1-501STGTDNPNY....NVQDNEEKNIYPIIIYVDQKDQ..................KPRKKYCVCYNKTLNRWRLGQ......
A7VLX2_9VIRU/1-509TYKDKQDKP....QNITVGDYT...............................GENPYYS....................
Q80AR5_9VIRU/1-594RQYNADGGA....NPNYAQLQSKWTTTIYAKK.....................TDSNFGYTSYNFSGD.....QGYKYVT
Q91CZ2_9VIRU/1-601INNNPDGSSISQRVGTMPDMTEYNKWVSNTNIGTGFVNS...N..........VSVHYNYCQYN.........PNHTHLT
CAPSD_TTVG1/1-514YGGKKTEYN....IGQWIETDIPGEG...........................NLARYYR....................
Q98Y63_9VIRU/1-581AQAPAIHGH....NGIPNNSRYLSSTGTETSFRTG..................NNSIYGQPNYK.........PIPEKLT
Q9QU36_9VIRU/1-529YASQPNM..............................................WGNIFHEDYLFGT..............
A7VM12_9VIRU/1-509KNKTKGGSE....TTTQMPST................................SFTSYSA....................
A7VLV6_9VIRU/1-508TYKGKDGKD....HEKIIGEWKKM.............................GEAQYYE....................
Q9JG50_9VIRU/1-535TSNQIKALH....EKQN....................................WGNPFHYNFANK...............
A7VLW4_9VIRU/1-507KQANKEVQKYMKPQ.......................................ATTDYST....................
A7VM04_9VIRU/1-513NYKQWQTGQ....GGQ..PFT................................KPQTYNQ....................
A7VLY4_9VIRU/1-498KTAATKQVE....TFN.....................................KPTTYEA....................
CAPSD_TTVD1/1-324................................................................................
Q91CZ6_9VIRU/1-596ITHNPDGST....GGTLSTLTAYNEWVTGTGP.NKFIPG...N..........TSVHYNFCTYN.........PKYDNLK
A7VM08_9VIRU/1-506KTATGSSTVQV..........................................DQSDETK....................
CAPSD_TTVV3/1-573LVDATTNQT....WSHYVNPNKLTTTPTSEITH....................NNTWYRGNAYND.........KITDLP
Q91D00_9VIRU/1-593KQYNADGST....WKDYKSMLSTWTSQIYNKK.....................TDSNYGYASYDFS.......KGKEFAT
Q99AR5_9VIRU/1-604PSFNPDGTK....NTKESEWQNYWSKKGEPWNPNSSYPH...TTTNQMYKIP.FDSNYGFPTYK.........PIKEYML
Q9DTD2_9VIRU/1-559TDNCKNTQT....DITNTKH.................................NDTQYKGNTYVD.........EINQVR
Q91D04_9VIRU/1-591TRRTAKFSTSNNTLGSDTNITPYLEQPTATNHKNTLSTG..............NNSIYGLPSYN.........PIPDKLK
CAPSD_TTVV8/1-571LISKAPPKQ....VLKSSDGSLQTDH...........................NDTQFGGNPYNTNQF......TTTTVN
Q5ENX0_9VIRU/1-603MQANNYQQK....KTNYTKTNFYTTRDATGDTAFVSN................ADSNYLYATYHPE.......NIETKLY
O90364_9VIRU/1-590FIDAGNITS.....GTAATTWGSYINTTKFTTTATTTYTYPGTTTNTVTMYSSNDSWYRGTVYNN.........QIKELP
Q9IFV0_9VIRU/1-583PRWDTVKKQ....STGSQWSNTF..............................VDSHWGDHIYENTSSKS....ILTAMK
Q9QUE7_9VIRU/1-586YVENTEKNG.....TTPNPWQSKYVNTTAFTTALNVTTE........KPYTTFSDSWYRGTVYKE.........TITEVP
A8DMR2_9VIRU/1-531HYEDYFKTK....TK......................................WGNPFYAPYFEPEPQKIFMIK......
Q9DUH8_9VIRU/1-609PPKYDNGNN....KKLFNDNDYNTFKTTFLTK.....................KDSGYLFASYNPA.......QVAENIK
A7VLW8_9VIRU/1-511NTKNPTKYK....PKDEIEKATDPP............................STAKYYA....................
Q99AQ3_9VIRU/1-582PKNNPDNTA....NTEANKFNEWVDKTFKTG......................KLVKYNYNQYK.........PDIEKLT

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754-----------------------------------------GWWVGAHIPVKPQSETIPAAERFSAGSMTVSASNAIFQP
CAPSD_NCBVS/1-608-----------------------------------------GVAVIAQF..QPDKEHQKENPDIVAGTTQTGGT......
CAPSD_HASV/2-647-----------------------------------------GFWIGGQYALTPTSLPQYDVS....EAYALHTLTFARPS

PF01829

CAPSD_NODAM/42-399-----------------------------------------GSFIEGCYSQSVCNEPEFEFHPI----------------

PF01766

POLS_IBDVU/9-452-----------------------------------------GGELVFQ...TSVQGLILGATIYLIGFDG....TA----
POLS_DXV96/2-442-----------------------------------------SGQMTMQ......DEWTVTANYQPLNISG....TL----
POLS_BSNV/7-428-----------------------------------------TVDMQIA...QIAAGKTLTVTVKLMGLTG....AK----
POLS_IPNVJ/5-453-----------------------------------------TGDITFQLEAEPVNETRFDFILQFLGLDNDVPVVT----

PF00729

CAPSD_PNLV/47-266-----------------------------------------SGAVVLSLDCASMSKPWY---------------------
CAPSD_MCMVK/23-222-----------------------------------------......RTVFRCIQAGQF---------------------
CAPSD_PMVK/39-236-----------------------------------------......PPELRNIDATAF---------------------
CAPSD_RCNMV/24-213-----------------------------------------......SLTIPADNQWRF---------------------
CAPSD_CARMS/51-245-----------------------------------------......DLVIPVDGKTRF---------------------
CAPSD_SBMVA/46-262-----------------------------------------ANAITTTLDVGQLGKKWY---------------------
CAPSD_TBSVC/76-269-----------------------------------------......MLRVPTDKIKRF---------------------
CAPSD_POLVP/66-257-----------------------------------------......TLNVPVDNVKRF---------------------
CAPSD_OCSVU/111-308-----------------------------------------......TVEIKCDNAYRF---------------------
CAPSD_TNVA/61-272-----------------------------------------AIAV..QLDVTKLDKPWY---------------------

PF11729

CAPSD_SJNNV/1-340-----------------------------------------PITTQAPLHNDSINNGYT---------------------

PF00894

CAPSD_PLRV1/70-207-----------------------------------------V-----EWHDSSEDQCRI---------------------
CAPSD_PEMVW/53-187-----------------------------------------Q-----PWYESNKDQFFF---------------------
CAPSD_BYDVP/62-199-----------------------------------------K-----EFQESTIDQFWM---------------------

PF03014

CAPSD_HEVCH/41-659-----------------------------------------TAELTTTAATRFMKDLYFTSTNGVGEIGRGIALTLFNLA

PF03115

CAPSD_HASV1/1-416-----------------------------------------S-----PLIMNVPEGSHF---------------------

PF00983

COAT_TYMV/8-177-----------------------------------------AINTLSPLIVKCPLEM-----------------------

PF02247

POL2_SQMVM/246-618-----------------------------------------TVNPQKDGCPHLYA-------------------------
POL2_CPMVS/460-832-----------------------------------------RTTLEADGCPYLYA-------------------------
POL2_BPMV/447-819-----------------------------------------ATTLLADGCPYLYA-------------------------
Q9Z006_9SECO/476-846-----------------------------------------LDSARGDDVSGNFV-------------------------
O12663_9SECO/321-691-----------------------------------------LDSARGDDVSGNFV-------------------------
Q9YWK0_9SECO/363-735-----------------------------------------TVNPQKDGCPHLYA-------------------------
POL2_CPSMV/437-806-----------------------------------------DTKLSEDGCPYLYA-------------------------
POL2_RCMV/407-778-----------------------------------------AGPVAGDGCPYLCA-------------------------
Q9YWJ9_9SECO/452-824-----------------------------------------TVDPQKDGCPHLYA-------------------------
Q66170_CPMVS/343-715-----------------------------------------RTTLEADGCPYLYA-------------------------

PF03391

CAPSD_TRSV/179-344-----------------------------------------T.TEEGFGRLGILP....---------------------
POL2_RRVS/768-936-----------------------------------------TFTGQANGKPFIIVHK..---------------------
POL2_BRAV/1268-1433-----------------------------------------TLTPDCALYVYLAG....---------------------
Q65029_ARMV/745-916-----------------------------------------LRLIDAQSASSFTSTLNF---------------------
POL2_ARMVS/792-963-----------------------------------------LRLIDAQSASSFTSTLNF---------------------
Q67703_GFLV/166-336-----------------------------------------ARLLAGQSQRDMSS.LNF---------------------
POL2_GFLV/771-941-----------------------------------------ARLLAGQSQRDMSS.LNF---------------------
POL2_BRSV/1007-1170-----------------------------------------N.FGNSGSAFYVST....---------------------
POL2_GCMV/981-1144-----------------------------------------N.FGDSGARFWVTP....---------------------
POL2_TORVR/1497-1662-----------------------------------------TSFLEDMLRLEIFA....---------------------
Q88483_9SECO/1003-1166-----------------------------------------N.FGDDGTAFYIAT....---------------------

PF02443

Q5Y4T0_PCV2/5-226-----------------------------------------TIPQPFPYHSRYFTPKPV---------------------
Q27W03_PCV1/5-227-----------------------------------------TIRQPFTYHSRYFTPKPE---------------------
A3FEQ4_9CIRC/3-256-----------------------------------------TWDPSRIH.RRYFVPKP.---------------------
Q3HUU1_GOCV/5-247-----------------------------------------TWSPHRYH.KRVFIPKP.---------------------
Q1L2D2_9CIRC/1-237-----------------------------------------KWDQRKGF.KRLVRPKPQ---------------------
CAPSD_CACV/7-243-----------------------------------------KWDLRKGF.KRLFKPRPQ---------------------
Q0H9S8_9CIRC/4-236-----------------------------------------QWDLRKGF.KRLFRPRPQ---------------------
Q06J73_9CIRC/8-245-----------------------------------------KWTLRKGF.KRLFRPRPQ---------------------
Q9DXG3_BFDV/11-242-----------------------------------------KWFVSRGF.KRLLRPKPQ---------------------
Q69EZ5_BFDV/7-239-----------------------------------------KWYLSRGF.KRLLRPKPQ---------------------
Q9DXG0_BFDV/11-242-----------------------------------------KWYLSRGF.KRLLRPKPQ---------------------
Q9DXF4_BFDV/3-235-----------------------------------------KWYLNKGF.KRLLRPKPQ---------------------

PF02956

A7VLZ2_9VIRU/1-506.........................................TITYNKGWFQPALLQAKQ---------------------
Q9WT88_9VIRU/1-603ER..RQCNFNYEV....NNPVSKKVWPQPSTTTPTVD....YYEYHCGWFSNIFIGPNR---------------------
Q91CY9_9VIRU/1-581KI..REWYFTQEN.........TDNPIHGSYLKPTLN....SVDYHLGKYSAIFLSPYR---------------------
A7VLY0_9VIRU/1-515.........................................SVNYLQGFFSQYVLQAQK---------------------
Q9JGT1_9VIRU/1-585PK..AAELYYKQT...........EQLIGATFTGSTR....YLHYTGGLYTSIWLSAGR---------------------
Q80QT8_9VIRU/1-595GY..RNQRFRWLT......SYTGTNHINDTFAKGKHQ....EYEYHLGWYSNIFLGNLR---------------------
CAPSD_TTVB1/1-533.........................................DVIIYYGTKPKQDDNWTS---------------------
A7VM00_9VIRU/1-509.........................................SLNKDSGWFNPKVLNAYT---------------------
Q9JG61_9VIRU/1-534.........................................DVQIFYGTPPTETTYNTQ---------------------
Q91PS3_9VIRU/1-581TN..ATNYYNSRK..............GTQITASK......FLNHKTGIFSPIFLSRQR---------------------
CAPSD_TTVV4/1-560TN..AENLWKARS..............KHTLLGSK......ELNFKTGMYSAIFLTNGR---------------------
Q91C93_9VIRU/1-546.........................................NYNIWITNKTPQELKAKY---------------------
Q2F827_9VIRU/1-589NA..NKWFWHQLT........ATDSDTLGQYGRASIK....YMEYHTGIYSSIFLSPLR---------------------
Q91CY5_9VIRU/1-584NA..NKWFWENLQ.........VENDLQSKYGKANLT....CMEYHTGIYSSIFLSPQR---------------------
Q8V7G9_9VIRU/1-572KV..QQTWTTKAQFNYDLVKEEYKTVYPTTATFPPEWSNRQYLEHDYGLFSPYFLTPNR---------------------
Q99A78_9VIRU/1-584LQ..AAQLYHDTT...........KKLLGTTFTGGSP....YLEYHGGLYSSIWLSAGR---------------------
Q6H9C2_9VIRU/1-573QI..TRNRFKNAT..........KTALPNYPTIMSTD....LYEYHSGIYSSIYLSAGR---------------------
CAPSD_TTVT1/1-433.........................................SYDFKDTNEVKKVWN...---------------------
Q9JG80_9VIRU/1-589KL..RQAYFKQLT.SEGPQHTSSDNGYASQWTTPSTD....AYEYHLGMFSTIFLAPDR---------------------
A7VLZ6_9VIRU/1-506.........................................SVSYTKGYFQPPFLQTQF---------------------
Q6H9D2_9VIRU/1-557KN..TDNLWNAGH..............NQTMTGSK......YLNYRTGIYSAIFLSAGR---------------------
Q6H999_9VIRU/1-471KS..LKDIIENILIKNMITYHEKLREFPNSYQGNK......AFCHLTGIYSPPYLNQGR---------------------
Q77JT5_9VIRU/1-606TQMLTGNEFYTTAGKKLIDTFHPIPYYENGSSKANTN....IFDYYTGMYSSIFLSSGR---------------------
Q91PS7_9VIRU/1-585NN..AKNYFESRK..............GNIVMSNE......YLNHKTGLYSPIFLSNSR---------------------
CAPSD_TTVV9/1-555TN..RQSELTQLKQMRKRLELTTENDYQDP...........NFGLSYGLYSPLLLYPEM---------------------
Q9JG47_9VIRU/1-553.........................................QRMIATGKTLKELCQIYK---------------------
A7VLW0_9VIRU/1-507.........................................SVSISKGWFQPKILNAYE---------------------
Q0ZLH9_9VIRU/1-573EN..QSNMYTKRA..............LHTFLGSQ......YLNFKSGLFSSIFLDNAR---------------------
Q5ENW7_9VIRU/1-501.........................................ASTLKIGNLKGLVLRQLM---------------------
A7VLX2_9VIRU/1-509.........................................SINYTGGWFDTRFLNSYE---------------------
Q80AR5_9VIRU/1-594EI..RQWYWTQLT.....SWTQTAPHINSTFANATHP....EFEYHAGWYSNIFIGPNR---------------------
Q91CZ2_9VIRU/1-601TL..RQYYFFWET.HPAAANKTPVTHVPITTTKPTKD....WWEYRLGLFSPIFLSPLR---------------------
CAPSD_TTVG1/1-514.........................................SISKEGGYFSPKILQAYQ---------------------
Q98Y63_9VIRU/1-581EI..RKWFFKQAT.........TPNEIHGTYGKPTYD....AVDYHLGKYSPIFLSPYR---------------------
Q9QU36_9VIRU/1-529.........................................SQIYVSNKTPQEVVNYIV---------------------
A7VM12_9VIRU/1-509.........................................SVSYDNGWFNKNFLRAIE---------------------
A7VLV6_9VIRU/1-508.........................................SINYDTGWFNSQFLSSYK---------------------
Q9JG50_9VIRU/1-535.........................................QVRFFISSKNPTTIQDTD---------------------
A7VLW4_9VIRU/1-507.........................................SISYDDGWFGPLFLSAIK---------------------
A7VM04_9VIRU/1-513.........................................SVNYNTGFFSKQMLEAVQ---------------------
A7VLY4_9VIRU/1-498.........................................SVSYTTGWFNPKLMQLTE---------------------
CAPSD_TTVD1/1-324...........................................................---------------------
Q91CZ6_9VIRU/1-596AL..RSYYFHWETVQSVATSNFNAQHVPITSTMPTKD....YWEYRIGMFSPTFLSPYR---------------------
A7VM08_9VIRU/1-506.........................................WLTYEGGWFQPKILQAYK---------------------
CAPSD_TTVV3/1-573EI..VKKSYYKAT...........ELAIPEAVKPTTD....LFEYHAGIYSSIFLSPGR---------------------
Q91D00_9VIRU/1-593QM..RQHYWVQLT.....QLTATVPHIGPTYSNTTTP....EYEYHAGWYSPVFIGPNR---------------------
Q99AR5_9VIRU/1-604QR..RAWSFKYET....DNPVSKKIWPQPTTTKPTID....YYEYHAGWFSNIFIGPNR---------------------
Q9DTD2_9VIRU/1-559KD..TGDKFIKAT..........SLALSNSWVKPTTN....DLEYHTGMYSSIFLSSGR---------------------
Q91D04_9VIRU/1-591KI..QEWFWKQET........DKENLVTGSYQTPTNK....SVSYHLGKYSPIFLSSYR---------------------
CAPSD_TTVV8/1-571KIIQGAQNYLTTI........KTHLQPNNSAINPNTQW...HLEYHAGIYSAPFLSAGR---------------------
Q5ENX0_9VIRU/1-603KI..RENYFQLSI....GKNDVFGDHTSQYRGATQ......LLEYHLGIYSPIFLHPGR---------------------
O90364_9VIRU/1-590KK..AAELYSKAT...........KTLLGNTFTTEDC....TLEYHGGLYSSIWLSPGR---------------------
Q9IFV0_9VIRU/1-583DN..ATKMYDRRK..............RDTYLGSK......YLNYRTGLYSSIFLANER---------------------
Q9QUE7_9VIRU/1-586LA..AAKLYQNQT...........KKLLSTTFTGGSE....YLEYHGGLYSSIWLSAGR---------------------
A8DMR2_9VIRU/1-531.........................................NLNKLQTANPTEKIQNLN---------------------
Q9DUH8_9VIRU/1-609NI..RDQNFALTT....GKNDVFGDSKAQYHNATH......LLDYKLGIYSPVFLHPGR---------------------
A7VLW8_9VIRU/1-511.........................................SINYNTGYFSTKVLNAFK---------------------
Q99AQ3_9VIRU/1-582LL..RQYYFRWET.......QHTGVAVPPTWTTPTTD....RYEYHVGMFSPIFLTPYR---------------------

PF00073

Q9WMA0_9PICO/49-215-----------------------------------------HGLLNCNINNVVRIKV-----------------------
POLG_AEVCA/45-212-----------------------------------------HGKLNCNINNVVRMKV-----------------------
POLG_CXA9/93-300-----------------------------------------HQWINLRTNNSATIVM-----------------------
POLG_CXB3N/93-302-----------------------------------------HQWINLRTNNSATIVM-----------------------
POLG_CXB4J/93-300-----------------------------------------HQWINLRTNNSATIVM-----------------------
POLG_CXA21/93-308-----------------------------------------HQIINLRTNNSATIVV-----------------------
POLG_POL1M/93-308-----------------------------------------HQIINLRTNNCATLVL-----------------------
POLG_POL3L/93-307-----------------------------------------HQIINLRTNNSATIVL-----------------------
POLG_HE701/93-288-----------------------------------------HQWINLRTNNSATIVL-----------------------
POLG_BOVEV/93-285-----------------------------------------HQWINLRTNNSATLIL-----------------------
POLG_HRV14/93-299-----------------------------------------HQFINLRTNNTATIVI-----------------------
POLG_HRV2/93-302-----------------------------------------HQFINLRSNNSATIIA-----------------------
POLG_HRV8A/93-302-----------------------------------------HQYINLRTNNSATLIL-----------------------
POLG_HRV1B/93-301-----------------------------------------HQFINLRSNNSATLIV-----------------------
POLG_FMDV1/311-475-----------------------------------------HQFISPRTNMTAHITV-----------------------
POLG_FMDVT/311-475-----------------------------------------HQFINPRTNMTAHITV-----------------------
POLG_FMDVO/311-475-----------------------------------------HQFINPRTNMTAHITV-----------------------
POLG_EMCV/161-359-----------------------------------------HQFLNLRTNTTVDLEV-----------------------
POLG_TMEVB/172-382-----------------------------------------HQILNLRTNTTVDLEV-----------------------
POLG_ENMGO/162-361-----------------------------------------HQFLNLRTNTTVDLEV-----------------------
POLG_FMDVO/533-691-----------------------------------------HAEWDTGLNSKFTFSI-----------------------
POLG_FMDV1/533-692-----------------------------------------HAEWDTGLNSKFTFSI-----------------------
POLG_EMCV/420-582-----------------------------------------YAIWDLGLNSSYSFTV-----------------------
POLG_TMEVB/443-606-----------------------------------------YAIWDLGLNSSFNFTA-----------------------
POLG_HE701/347-515-----------------------------------------HVVWDFGLQSSITIII-----------------------
POLG_HRV2/358-522-----------------------------------------HVIWDVGLQSTISMVV-----------------------
POLG_HRV8A/364-529-----------------------------------------HLVWDVGLQSTASLVV-----------------------
POLG_HRV1B/360-525-----------------------------------------HVVWDVGLQSTISLVV-----------------------
POLG_BOVEV/345-515-----------------------------------------HVVWDFGLQSSITLVI-----------------------
POLG_CXA21/369-534-----------------------------------------HIIWDLGLQSSCSMVA-----------------------
POLG_CXA9/358-524-----------------------------------------HIIWDIGLQSSCVLCV-----------------------
POLG_CXB4J/358-524-----------------------------------------HVIWDVGLQSSCVLCV-----------------------
POLG_CXB3N/360-526-----------------------------------------HVIWDVGLQSSCVLCI-----------------------
POLG_CXB1J/360-526-----------------------------------------HVIWDVGLQSSCVLCV-----------------------
POLG_FMDVO/725-872-----------------------------------------TAYHK...APLTRLAL-----------------------
POLG_FMDV1/726-878-----------------------------------------TAYNK...APFTRLAL-----------------------
POLG_BOVEV/610-775-----------------------------------------SVFADTD.GPPAQFSV-----------------------
POLG_HRV8A/621-792-----------------------------------------SVFWQEG.QPYPRFTI-----------------------
POLG_HRV2/614-772-----------------------------------------SVFWQHG.QAYPRFSL-----------------------
POLG_HRV1B/627-786-----------------------------------------SIFWQHG.QPFPRFSL-----------------------
POLG_HE701/609-781-----------------------------------------SVFFKIN.DPPARLTI-----------------------
POLG_HRV14/614-787-----------------------------------------SVFFKVG..DTSRFSV-----------------------
POLG_CXA9/612-783-----------------------------------------SIFWTEG.NAPARMSI-----------------------
POLG_CXB4J/612-783-----------------------------------------SIFWTEG.NAPPRMSI-----------------------
POLG_SVDVU/612-782-----------------------------------------SVFWTEG.SAPPRMSI-----------------------
POLG_CXB3N/630-782-----------------------------------------SVFWTEG.NAPPRMSI-----------------------
POLG_POL1M/636-806-----------------------------------------SIFYTYG.TAPARISV-----------------------
POLG_CXA21/642-812-----------------------------------------SIFYMYG.NAPPRMSI-----------------------
POLG_CXA24/646-809-----------------------------------------SVFYTYG.SAPPRISI-----------------------

PF00915

CAPSD_VESVA/137-421-----------------------------------------GSLIKHGSIPS..DLI-----------------------
POLG_RHDVF/1768-2065-----------------------------------------SSKTVDSISPAGLLTT-----------------------
CAPSD_FCVUR/112-395-----------------------------------------GSMLTHGSVPS..DLI-----------------------
CAPSD_NVN68/2-294-----------------------------------------..TVEQKTRP...FTL-----------------------

PF08762

Q8B107_ALPV/599-804-----------------------------------------NTA...GSIPVIGVQD-----------------------
O56051_9VIRU/590-790-----------------------------------------VTLTTYNSTD....SD-----------------------
Q56QP7_9VIRU/684-855-----------------------------------------IS............GE-----------------------
O36967_9VIRU/668-900-----------------------------------------ATTYVRGTESPITINS-----------------------
Q5UBY1_9VIRU/79-259-----------------------------------------IASTSD..........-----------------------
Q6ITS9_9VIRU/106-313-----------------------------------------CLSSSFRANS....ET-----------------------
Q4JFT2_9VIRU/834-1009-----------------------------------------AENLVIDSKSFPQLSD-----------------------

PF00760

CAPSD_CMVFN/11-215----------------------------------------------ADGASPVLVYQYAASG-----------VQANNKL

PF01318

CAPSD_BMV/2-188----------------------------------------------ADSSKEVVAAMYT---------------------

PF03566

Q80IX5_PRVFL/54-754SNTVARIVWSITPLPVATVALTTGTGGTNNTSGKFFSVEIDGNV..NSVWTFTAPASILAEG........EPFAEEGDTT
CAPSD_NCBVS/1-608.............LQLGGSGPNYTLTMTIGDQVEFGG.........AAIPLPTVSMGPMPES........GQLVFQTANL
CAPSD_HASV/2-647SAAALAFVWA..GLPQGGTAPAGTPAWEQASSGGYLTWRHNGTTFPAGSVSYVLPEGFALERYDPNDGSWTDFASAGDTV

PF01829

CAPSD_NODAM/42-399----------------------------------------------MEGYASVPPANVTNAQ------------------

PF01766

POLS_IBDVU/9-452----------------------------------------------VITRA.VAADN..GLT------------------
POLS_DXV96/2-442----------------------------------------------IANSQRTLTWSNTGVS------------------
POLS_BSNV/7-428----------------------------------------------VASRSETVSGN..GGT------------------
POLS_IPNVJ/5-453----------------------------------------------VTSSTLVTADNYRGAS------------------

PF00729

CAPSD_PNLV/47-266---------------------------------------------------PYISAVAATNL------------------
CAPSD_MCMVK/23-222---------------------------------------------------AALGSAADKQM------------------
CAPSD_PMVK/39-236---------------------------------------------------SAL.SDEDKGD------------------
CAPSD_RCNMV/24-213---------------------------------------------------VADNTTVDRKL------------------
CAPSD_CARMS/51-245---------------------------------------------------IRDSASDDAKL------------------
CAPSD_SBMVA/46-262---------------------------------------------------PFKTSTDFTTA------------------
CAPSD_TBSVC/76-269---------------------------------------------------CDDSSTSDHKL------------------
CAPSD_POLVP/66-257---------------------------------------------------MNDNTTTDRKL------------------
CAPSD_OCSVU/111-308---------------------------------------------------TGTHVAADNKL------------------
CAPSD_TNVA/61-272---------------------------------------------------PTISSAGFGAL------------------

PF11729

CAPSD_SJNNV/1-340---------------------------------------------------GFRSILLGATQ------------------

PF00894

CAPSD_PLRV1/70-207---------------------------------------------------LWKGN------------------------
CAPSD_PEMVW/53-187---------------------------------------------------LYRGT------------------------
CAPSD_BYDVP/62-199---------------------------------------------------LYKAN------------------------

PF03014

CAPSD_HEVCH/41-659DTLLGGLPTELISSAGGQLFYSRPVVSANG----------------EPTVKLYTSVENAQQD------------------

PF03115

CAPSD_HASV1/1-416------------------------ARTVLA----------------RSTTPTTLARAGERTT------------------

PF00983

COAT_TYMV/8-177---------------------------------------------------MNPRVKDSIQY------------------

PF02247

POL2_SQMVM/246-618------LLH.-----------------------------------------DSATSTIEGNF------------------
POL2_CPMVS/460-832------IIH.-----------------------------------------DSTTGTISGDF------------------
POL2_BPMV/447-819------MVH.-----------------------------------------DSSVSTIPGDF------------------
Q9Z006_9SECO/476-846------LYQR-----------------------------------------DAVSSALEGEL------------------
O12663_9SECO/321-691------LYQR-----------------------------------------DAVSSALEGEL------------------
Q9YWK0_9SECO/363-735------LLH.-----------------------------------------DSATSTIEGNF------------------
POL2_CPSMV/437-806------ITH.-----------------------------------------NGVSSSVEGDF------------------
POL2_RCMV/407-778------MVH.-----------------------------------------DSTASTITGDF------------------
Q9YWJ9_9SECO/452-824------LLH.-----------------------------------------DSATSTIEGNF------------------
Q66170_CPMVS/343-715------IIH.-----------------------------------------DSTTGTISGDF------------------

PF03391

CAPSD_TRSV/179-344----..LSG------------------------------------------PIAPDAHVGSY------------------
POL2_RRVS/768-936----..LGG------------------------------------------IVGPKDSVGTF------------------
POL2_BRAV/1268-1433----....G------------------------------------------PIAVAPMSVPY------------------
Q65029_ARMV/745-916----YAISG------------------------------------------PIAPSGETAKM------------------
POL2_ARMVS/792-963----YAISG------------------------------------------PIAPSGETAKM------------------
Q67703_GFLV/166-336----YAIAG------------------------------------------PIAPSGETARL------------------
POL2_GFLV/771-941----YAIAG------------------------------------------PIAPSGETAQL------------------
POL2_BRSV/1007-1170----..LCA------------------------------------------PMAPETVETGS------------------
POL2_GCMV/981-1144----..MSS------------------------------------------PMAPETMESKL------------------
POL2_TORVR/1497-1662----..IAG------------------------------------------PFSPKDNKAKY------------------
Q88483_9SECO/1003-1166----..LCA------------------------------------------PLAPETMETGF------------------

PF02443

Q5Y4T0_PCV2/5-226----LDR--------------------------------------------TIDYFQPN.NK------------------
Q27W03_PCV1/5-227----LDQ--------------------------------------------TIDWFHPN.NK------------------
A3FEQ4_9CIRC/3-256----...--------------------------------------------TIQGAGQG.ST------------------
Q3HUU1_GOCV/5-247----...--------------------------------------------TIQQGGTGTNI------------------
Q1L2D2_9CIRC/1-237----L..--------------------------------------------VITDLSTA.NE------------------
CAPSD_CACV/7-243----L..--------------------------------------------SVTDTDAA.NV------------------
Q0H9S8_9CIRC/4-236----I..--------------------------------------------SITDTDAG.NV------------------
Q06J73_9CIRC/8-245----L..--------------------------------------------SVTDTDTA.NT------------------
Q9DXG3_BFDV/11-242----I..--------------------------------------------TIEDLTTA.NQ------------------
Q69EZ5_BFDV/7-239----I..--------------------------------------------TLTDLTTA.NQ------------------
Q9DXG0_BFDV/11-242----I..--------------------------------------------MMNDLSTA.NQ------------------
Q9DXF4_BFDV/3-235----I..--------------------------------------------TINDLTTV.NQ------------------

PF02956

A7VLZ2_9VIRU/1-506----ITKPSQAN.............PPLKG----------------ARYN.PTLDTGENTAV------------------
Q9WT88_9VIRU/1-603----Y.NLQ.FQ.............TAYVD----------------TTYN.PLMDKGKGNKI------------------
Q91CY9_9VIRU/1-581----T.NTQ.FD.............TAYQD----------------VTYN.PNTDKGKGNKI------------------
A7VLY0_9VIRU/1-515----ITDADDNVPAKYEQYSAAMSTLLIAA----------------FRYN.PEEDTGQGNVV------------------
Q9JGT1_9VIRU/1-585----S.YFE.TH.............GPDTD----------------ITYN.PFSDRGEGNML------------------
Q80QT8_9VIRU/1-595----H.NLA.FS.............PAYID----------------ITYN.PIVDKGQGNKV------------------
CAPSD_TTVB1/1-533----TAPILPIT.............SLYVE----------------CRYN.PFKDKGTGNKV------------------
A7VM00_9VIRU/1-509----VLKGDQRQSL...........VPCGV----------------LRYN.PYTDTGRGNKM------------------
Q9JG61_9VIRU/1-534----P.QLQTIT.............GLYQE----------------CRYN.PFKDKGTGNIF------------------
Q91PS3_9VIRU/1-581----L.APD.FP.............GFYTE----------------VIYN.PANDKGVGNKI------------------
CAPSD_TTVV4/1-560----L.SPD.YP.............GIYIE----------------VVYN.PLLGQGEGNMI------------------
Q91C93_9VIRU/1-546----KSNTDKLHSSDTDTFWTLKRVPSVLD----------------CRYN.PFRDDNR.NEV------------------
Q2F827_9VIRU/1-589----S.NLE.FP.............TAYQD----------------VTYN.PLTDRGIGNRI------------------
Q91CY5_9VIRU/1-584----..NLQ.FP.............AAYLD----------------VTYN.PNCDRGIGNKI------------------
Q8V7G9_9VIRU/1-572----Y.STE.WH.............MPITY----------------VRYN.PLADKGIGNRI------------------
Q99A78_9VIRU/1-584----S.YFE.TK.............GTYTD----------------ITYN.PFTDRGQGNMV------------------
Q6H9C2_9VIRU/1-573----S.YFE.TT.............GAYSD----------------IIYN.PFTDKGTGNII------------------
CAPSD_TTVT1/1-433----.....................TAGKK----------------YYYR.ADWDTGDGNAI------------------
Q9JG80_9VIRU/1-589----..PVPRFP.............CAYQD----------------VTYN.PLMDKGVGNHI------------------
A7VLZ6_9VIRU/1-506----VCTSSMCDVKAGY........LPINV----------------AIYN.PMQDSSQGNAI------------------
Q6H9D2_9VIRU/1-557----L.SPD.FP.............GLYDD----------------IVYN.PTTDEGIGNIV------------------
Q6H999_9VIRU/1-471----I.SPEIF..............GLYTE----------------IIYN.PYTDKGTGNKV------------------
Q77JT5_9VIRU/1-606----S.NPE.VK.............GSYTD----------------ISYN.PLTDKGVGNMI------------------
Q91PS7_9VIRU/1-585----L.SPD.FP.............GFYID----------------VLYN.PANDKGIGNKI------------------
CAPSD_TTVV9/1-555----YFPEQS...............KVYQK----------------ARYN.PLLDQGIGNVV------------------
Q9JG47_9VIRU/1-553----DDDITTAKLKEGFIFKE....QKWVE----------------LRYN.PWADKGKGNMV------------------
A7VLW0_9VIRU/1-507----VKDNTVTQAL...........TPCGV----------------LRYN.PADDDGQGNKL------------------
Q0ZLH9_9VIRU/1-573----L.SPD.FK.............GMYQE----------------VVYN.PFNDRGVGNKV------------------
Q5ENW7_9VIRU/1-501----NQEMT................YIWKE----------------GEYSAPFVQRWKGSRF------------------
A7VLX2_9VIRU/1-509----IKKKNTQQWLGY.........LPVGV----------------ARYN.PNEDTGEGNEV------------------
Q80AR5_9VIRU/1-594----F.NIQ.FK.............VAYMD----------------VTYN.PINDKGHLNRV------------------
Q91CZ2_9VIRU/1-601----SSNIE.WP.............FAYRD----------------IIYN.PLMDKGVGNMM------------------
CAPSD_TTVG1/1-514----TKVKSVDYKP...........LPIVL----------------GRYN.PAIDDGKGNKI------------------
Q98Y63_9VIRU/1-581----T.NTQ.FP.............TAYMD----------------VTYN.PNVDKGKGNKI------------------
Q9QU36_9VIRU/1-529----SHQTQKVKEYTGITPRTL...PLTVE----------------CRYN.PFNDKSTGNNT------------------
A7VM12_9VIRU/1-509----LQSPTGTKLGQ..........LPLNY----------------GRYN.PTRDKGIGNKI------------------
A7VLV6_9VIRU/1-508----IEKTSTKQPYAH.........LPIGV----------------ARYN.PDQDTGQGNEV------------------
Q9JG50_9VIRU/1-535----LNNPISNTTILDE........PVFQE----------------CRYN.PYKDKGYGNEA------------------
A7VLW4_9VIRU/1-507----IGKIEQATAT...........HQIIQ----------------ARYN.PNIDSGVGNQI------------------
A7VM04_9VIRU/1-513----LTTDQTGQRPLGM........NPVNI----------------CRYN.PTLDSGKGNAI------------------
A7VLY4_9VIRU/1-498----YVTPQQLA.............KPVLA----------------FRYN.AQLDNGKGNSV------------------
CAPSD_TTVD1/1-324----..........................----------------...N.DMINK.VPNMW------------------
Q91CZ6_9VIRU/1-596----TSPIENWP.............MAYRD----------------ISYN.PLNDKVVGNKL------------------
A7VM08_9VIRU/1-506----VTLNGADKAL...........LPLVP----------------IRYN.PAADDGTGNLV------------------
CAPSD_TTVV3/1-573----A.YFE.TP.............GAYQD----------------IIYN.PFTDKGIGNIV------------------
Q91D00_9VIRU/1-593----H.NIQ.FR.............TAYMD----------------VTYN.PLNDKGQFNRV------------------
Q99AR5_9VIRU/1-604----H.SLQ.FQ.............TAYVD----------------TTYN.PLNDKGKGNKI------------------
Q9DTD2_9VIRU/1-559----S.NPE.LK.............GPYTD----------------VCYN.PLVDKGIGNIV------------------
Q91D04_9VIRU/1-591----T.NLQ.FI.............TAYTD----------------VTYN.PLNDKGKGNQI------------------
CAPSD_TTVV8/1-571----L.NPE.IK.............GLYTD----------------ITYN.PMMDKGTGNKI------------------
Q5ENX0_9VIRU/1-603----S.NIQ.MW.............TAYRD----------------IVYN.PLLDKGEGNRI------------------
O90364_9VIRU/1-590----S.YFE.TP.............GAYTD----------------IKYN.PFTDRGEGNML------------------
Q9IFV0_9VIRU/1-583----T.SPD.FP.............GLYQE----------------VVYN.PLVDEGEGNIV------------------
Q9QUE7_9VIRU/1-586----S.YFE.TK.............GAYTD----------------ICYN.PYTDRGEGNMV------------------
A8DMR2_9VIRU/1-531----CTLLPPEK.............TVLTI----------------CRYN.PQNDRSAHNAL------------------
Q9DUH8_9VIRU/1-609----S.NIQ.MW.............TAYRD----------------IVYN.PFLDKGEGNKV------------------
A7VLW8_9VIRU/1-511----VMVNSKESKP...........LPLGV----------------ARYN.PVEDDGKGNEI------------------
Q99AQ3_9VIRU/1-582----SAGLD.FP.............YAYAD----------------VTYN.PLTDKGVGNRM------------------

PF00073

Q9WMA0_9PICO/49-215---------------------------------------------------PFIYTRGAYH-------------------
POLG_AEVCA/45-212---------------------------------------------------PYIYSRGCYN-------------------
POLG_CXA9/93-300---------------------------------------------------PYINSVPMDN-------------------
POLG_CXB3N/93-302---------------------------------------------------PYTNSVPMDN-------------------
POLG_CXB4J/93-300---------------------------------------------------PYINSVPMDN-------------------
POLG_CXA21/93-308---------------------------------------------------PYVNSLVIDC-------------------
POLG_POL1M/93-308---------------------------------------------------PYVNSLSIDS-------------------
POLG_POL3L/93-307---------------------------------------------------PYVNALAIDS-------------------
POLG_HE701/93-288---------------------------------------------------PWMNSAPMDF-------------------
POLG_BOVEV/93-285---------------------------------------------------PYVNAIPMDS-------------------
POLG_HRV14/93-299---------------------------------------------------PYINSVPIDS-------------------
POLG_HRV2/93-302---------------------------------------------------PYVNAVPMDS-------------------
POLG_HRV8A/93-302---------------------------------------------------PYVNAVPMDS-------------------
POLG_HRV1B/93-301---------------------------------------------------PYVNAVPMDS-------------------
POLG_FMDV1/311-475---------------------------------------------------PYLGVNRYDQ-------------------
POLG_FMDVT/311-475---------------------------------------------------PYVGVNRYDQ-------------------
POLG_FMDVO/311-475---------------------------------------------------PFVGVNRYDQ-------------------
POLG_EMCV/161-359---------------------------------------------------PYVNIAPTSS-------------------
POLG_TMEVB/172-382---------------------------------------------------PYVNVAPSSS-------------------
POLG_ENMGO/162-361---------------------------------------------------PYVNIAPTSS-------------------
POLG_FMDVO/533-691---------------------------------------------------PYLSAADYAY-------------------
POLG_FMDV1/533-692---------------------------------------------------PYVSAADYAY-------------------
POLG_EMCV/420-582---------------------------------------------------PFISPTHFRM-------------------
POLG_TMEVB/443-606---------------------------------------------------PFISPTHYRQ-------------------
POLG_HE701/347-515---------------------------------------------------PWISGSHYRM-------------------
POLG_HRV2/358-522---------------------------------------------------PWISASHYRN-------------------
POLG_HRV8A/364-529---------------------------------------------------PWVSASHFRF-------------------
POLG_HRV1B/360-525---------------------------------------------------PWVSASHFRL-------------------
POLG_BOVEV/345-515---------------------------------------------------PWISASHFRG-------------------
POLG_CXA21/369-534---------------------------------------------------PWISNTVYRR-------------------
POLG_CXA9/358-524---------------------------------------------------PWISQTHYRL-------------------
POLG_CXB4J/358-524---------------------------------------------------PWISQTHYRY-------------------
POLG_CXB3N/360-526---------------------------------------------------PWISQTHYRF-------------------
POLG_CXB1J/360-526---------------------------------------------------PWISQTHYRY-------------------
POLG_FMDVO/725-872---------------------------------------------------PYTAPHRVLA-------------------
POLG_FMDV1/726-878---------------------------------------------------PYTAPHRVLA-------------------
POLG_BOVEV/610-775---------------------------------------------------PFMSSANAYS-------------------
POLG_HRV8A/621-792---------------------------------------------------PFMSIASAYY-------------------
POLG_HRV2/614-772---------------------------------------------------PFLSVASAYY-------------------
POLG_HRV1B/627-786---------------------------------------------------PFLSIASAYY-------------------
POLG_HE701/609-781---------------------------------------------------PFMSINSAYA-------------------
POLG_HRV14/614-787---------------------------------------------------PYVGLASAYN-------------------
POLG_CXA9/612-783---------------------------------------------------PFISIGNAYS-------------------
POLG_CXB4J/612-783---------------------------------------------------PFMSIGNAYT-------------------
POLG_SVDVU/612-782---------------------------------------------------PFIGIGNAYS-------------------
POLG_CXB3N/630-782---------------------------------------------------PFLSIGNAYS-------------------
POLG_POL1M/636-806---------------------------------------------------PYVGISNAYS-------------------
POLG_CXA21/642-812---------------------------------------------------PYVGIANAYS-------------------
POLG_CXA24/646-809---------------------------------------------------PYVGIANAYS-------------------

PF00915

CAPSD_VESVA/137-421---------------------------------------------------PRNSAHWLGN.------------------
POLG_RHDVF/1768-2065---------------------------------------------------PVLTGVGNDN.------------------
CAPSD_FCVUR/112-395---------------------------------------------------PKTSSLWIGN.------------------
CAPSD_NVN68/2-294---------------------------------------------------PNLPLSSLSNS------------------

PF08762

Q8B107_ALPV/599-804---------------------------------------------------LIQ.RNLVSVN------------------
O56051_9VIRU/590-790---------------------------------------------------VLDARNGFNRV------------------
Q56QP7_9VIRU/684-855---------------------------------------------------VELIKGKIQTP------------------
O36967_9VIRU/668-900---------------------------------------------------VLR.GHLPPQI------------------
Q5UBY1_9VIRU/79-259---------------------------------------------------....KGYDASL------------------
Q6ITS9_9VIRU/106-313---------------------------------------------------FYYSSGRNNLD------------------
Q4JFT2_9VIRU/834-1009---------------------------------------------------L.........S------------------

PF00760

CAPSD_CMVFN/11-215LYDL----------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754SFSM.......TTI......TADTVVYSVSSSLTGSSVIVRGVTKGSGVSITPVTVGIDTEAVNRL...SIEMPALTTEE
CAPSD_NCBVS/1-608TFDV..GNTITITT......TLPPGSVTGMWQFTASNGTD.TVTVDAGARLYAFGANLDASELNLQDINSIKIPPTNMNQ
CAPSD_HASV/2-647TFRQVAVDEVVVTNNPAGGGSAPTFTVRVPPSNAYTNTVFRNTLLET............RPSSRRL...ELPMPPADFGQ

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452---------------------------------------------------------------------------AGTDN
POLS_DXV96/2-442---------------------------------------------------------------------------NGSHY
POLS_BSNV/7-428---------------------------------------------------------------------------.....
POLS_IPNVJ/5-453---------------------------------------------------------------------------A....

PF00729

CAPSD_PNLV/47-266---------------------------------------------------------GE---------------------
CAPSD_MCMVK/23-222---------------------------------------------------------YS---------------------
CAPSD_PMVK/39-236---------------------------------------------------------YS---------------------
CAPSD_RCNMV/24-213---------------------------------------------------------VD---------------------
CAPSD_CARMS/51-245---------------------------------------------------------VD---------------------
CAPSD_SBMVA/46-262---------------------------------------------------------VG---------------------
CAPSD_TBSVC/76-269---------------------------------------------------------ID---------------------
CAPSD_POLVP/66-257---------------------------------------------------------VD---------------------
CAPSD_OCSVU/111-308---------------------------------------------------------ID---------------------
CAPSD_TNVA/61-272---------------------------------------------------------SV---------------------

PF11729

CAPSD_SJNNV/1-340---------------------------------------------------------LD---------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659---------------------------------------------------------KG---------------------

PF03115

CAPSD_HASV1/1-416---------------------------------------------------------SD---------------------

PF00983

COAT_TYMV/8-177---------------------------------------------------------LD---------------------

PF02247

POL2_SQMVM/246-618---------------------------------------------------------VI---------------------
POL2_CPMVS/460-832---------------------------------------------------------NL---------------------
POL2_BPMV/447-819---------------------------------------------------------VI---------------------
Q9Z006_9SECO/476-846---------------------------------------------------------TF---------------------
O12663_9SECO/321-691---------------------------------------------------------TF---------------------
Q9YWK0_9SECO/363-735---------------------------------------------------------II---------------------
POL2_CPSMV/437-806---------------------------------------------------------IL---------------------
POL2_RCMV/407-778---------------------------------------------------------NL---------------------
Q9YWJ9_9SECO/452-824---------------------------------------------------------VI---------------------
Q66170_CPMVS/343-715---------------------------------------------------------NL---------------------

PF03391

CAPSD_TRSV/179-344---------------------------------------------------------EF---------------------
POL2_RRVS/768-936---------------------------------------------------------GF---------------------
POL2_BRAV/1268-1433---------------------------------------------------------QF---------------------
Q65029_ARMV/745-916---------------------------------------------------------PV---------------------
POL2_ARMVS/792-963---------------------------------------------------------PV---------------------
Q67703_GFLV/166-336---------------------------------------------------------PI---------------------
POL2_GFLV/771-941---------------------------------------------------------PI---------------------
POL2_BRSV/1007-1170---------------------------------------------------------EY---------------------
POL2_GCMV/981-1144---------------------------------------------------------EY---------------------
POL2_TORVR/1497-1662---------------------------------------------------------QF---------------------
Q88483_9SECO/1003-1166---------------------------------------------------------QY---------------------

PF02443

Q5Y4T0_PCV2/5-226---------------------------------------------------------RN---------------------
Q27W03_PCV1/5-227---------------------------------------------------------RN---------------------
A3FEQ4_9CIRC/3-256---------------------------------------------------------YS---------------------
Q3HUU1_GOCV/5-247---------------------------------------------------------WS---------------------
Q1L2D2_9CIRC/1-237---------------------------------------------------------TA---------------------
CAPSD_CACV/7-243---------------------------------------------------------TA---------------------
Q0H9S8_9CIRC/4-236---------------------------------------------------------TA---------------------
Q06J73_9CIRC/8-245---------------------------------------------------------TA---------------------
Q9DXG3_BFDV/11-242---------------------------------------------------------SA---------------------
Q69EZ5_BFDV/7-239---------------------------------------------------------SA---------------------
Q9DXG0_BFDV/11-242---------------------------------------------------------SA---------------------
Q9DXF4_BFDV/3-235---------------------------------------------------------SA---------------------

PF02956

A7VLZ2_9VIRU/1-506---------------------------------------------------------WL.TNVVNQSYYP...PKTDLDL
Q9WT88_9VIRU/1-603---------------------------------------------------------WF.QYLSKKGTDY...NEKQCYC
Q91CY9_9VIRU/1-581---------------------------------------------------------WI.QSCTKESTIL....DNACRC
A7VLY0_9VIRU/1-515---------------------------------------------------------WLTSTLSNTHWER...PQL.SDL
Q9JGT1_9VIRU/1-585---------------------------------------------------------WI.DWLTKEDSQY...SKTQSKC
Q80QT8_9VIRU/1-595---------------------------------------------------------WF.QYLTKETTEF...KAEQAKC
CAPSD_TTVB1/1-533---------------------------------------------------------YL.VPTDSGLGSF.LTLPTKSEL
A7VM00_9VIRU/1-509---------------------------------------------------------WV.NSVLVGAWQE...PKD.TDL
Q9JG61_9VIRU/1-534---------------------------------------------------------YL.KSTKTQQGSF.LSLPTDNRI
Q91PS3_9VIRU/1-581---------------------------------------------------------WM.DWCTKNDSQW...TDRQSVV
CAPSD_TTVV4/1-560---------------------------------------------------------WL.EWCPKKTKQY...NERQCYN
Q91C93_9VIRU/1-546---------------------------------------------------------YLLKITEQNSYDY..HEPPKPEL
Q2F827_9VIRU/1-589---------------------------------------------------------WY.QYSTKENTTF...NETQCKC
Q91CY5_9VIRU/1-584---------------------------------------------------------WF.QYSTKMTTDF...EQKQCKC
Q8V7G9_9VIRU/1-572---------------------------------------------------------YM.QWCSESSSSF...EPTKSKC
Q99A78_9VIRU/1-584---------------------------------------------------------WI.DWVSKYDSVY...SKTQSKC
Q6H9C2_9VIRU/1-573---------------------------------------------------------WI.DYLTKEDTIF...VKNKSKC
CAPSD_TTVT1/1-433---------------------------------------------------------MLPNTLSPT.......TPASWLL
Q9JG80_9VIRU/1-589---------------------------------------------------------WF.QYNTKADTQLIVSAPSPCKA
A7VLZ6_9VIRU/1-506---------------------------------------------------------YL.VSTLTNTWDQ...PPKDSSI
Q6H9D2_9VIRU/1-557---------------------------------------------------------WI.DWCTKADCNF...NETQSKG
Q6H999_9VIRU/1-471---------------------------------------------------------WM.DPLTKENNIY...KEGQSKC
Q77JT5_9VIRU/1-606---------------------------------------------------------WI.DWLTKGDTVY...DPKKSKC
Q91PS7_9VIRU/1-585---------------------------------------------------------WM.DWCTKNDSTW...RDTPQKL
CAPSD_TTVV9/1-555---------------------------------------------------------WT.EPLTKKTCDY....ASQAYN
Q9JG47_9VIRU/1-553---------------------------------------------------------YL.LPINEHQHSYGWAPPTNKDI
A7VLW0_9VIRU/1-507---------------------------------------------------------WV.VNTLTYNWKI...PTD.DDL
Q0ZLH9_9VIRU/1-573---------------------------------------------------------WV.QWCTNEDTIF...KDLPGRV
Q5ENW7_9VIRU/1-501---------------------------------------------------------AV.IDARKADQEN..........
A7VLX2_9VIRU/1-509---------------------------------------------------------WL.TSIQKGHFDK...PSKTPDF
Q80AR5_9VIRU/1-594---------------------------------------------------------WF.QYSTKPTTDF...VEKQAKC
Q91CZ2_9VIRU/1-601---------------------------------------------------------WY.QYNTKPDTQF...SPTSCRA
CAPSD_TTVG1/1-514---------------------------------------------------------YL.QTIMNGHWGL...PQKTPDY
Q98Y63_9VIRU/1-581---------------------------------------------------------WL.QSVTKETSDF...DSRSCRC
Q9QU36_9VIRU/1-529---------------------------------------------------------FF.VSNHADQTKW..QPIDNPDT
A7VM12_9VIRU/1-509---------------------------------------------------------YI.ISTIADSWGP...PTTDKNV
A7VLV6_9VIRU/1-508---------------------------------------------------------WL.ATIFKGHYDK...PTVTDDF
Q9JG50_9VIRU/1-535---------------------------------------------------------YFLSNVIAKKKAW..DPPDNKLL
A7VLW4_9VIRU/1-507---------------------------------------------------------YC.ASTHAYSWAP...PSKDKQL
A7VM04_9VIRU/1-513---------------------------------------------------------WL.VSSHANTYRE...PITDKTL
A7VLY4_9VIRU/1-498---------------------------------------------------------WF.KSILTEDFSK...PKVDSDL
CAPSD_TTVD1/1-324---------------------------------------------------------WK.....................
Q91CZ6_9VIRU/1-596---------------------------------------------------------WL.QSIVKADTQF...HIPSCTY
A7VM08_9VIRU/1-506---------------------------------------------------------TI.VDLVAGHWTG...NYT.EAY
CAPSD_TTVV3/1-573---------------------------------------------------------WI.DWLSKSDAVY...SEKQSKC
Q91D00_9VIRU/1-593---------------------------------------------------------WF.QYSTKPTTDF...NNTQCKC
Q99AR5_9VIRU/1-604---------------------------------------------------------WF.QYHSKVNTDL...RDRGIYC
Q9DTD2_9VIRU/1-559---------------------------------------------------------WL.DWCSKEDSKF...DETKSKV
Q91D04_9VIRU/1-591---------------------------------------------------------WV.QYVTKPDTIF...NERQCKC
CAPSD_TTVV8/1-571---------------------------------------------------------WC.DSLTKADMKY...TEGRSKY
Q5ENX0_9VIRU/1-603---------------------------------------------------------WF.QYHTKKDNRY...SVPNCHW
O90364_9VIRU/1-590---------------------------------------------------------WI.DWLSKKNMNY...DKVQSKC
Q9IFV0_9VIRU/1-583---------------------------------------------------------WI.DWCSKDDTTF...RDLPQRY
Q9QUE7_9VIRU/1-586---------------------------------------------------------WI.DWLSKTDSRY...DKTRSKC
A8DMR2_9VIRU/1-531---------------------------------------------------------YA.SPVTTARTKW..GATTKPEL
Q9DUH8_9VIRU/1-609---------------------------------------------------------WY.QYHTKTDNKY...DPTKCRY
A7VLW8_9VIRU/1-511---------------------------------------------------------WV.ASIHSNAYAK...PAE.DNL
Q99AQ3_9VIRU/1-582---------------------------------------------------------WY.QYNTKIDTQF...DAKCCKC

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421---------------------------------------------------------RW---------------------
POLG_RHDVF/1768-2065---------------------------------------------------------RW---------------------
CAPSD_FCVUR/112-395---------------------------------------------------------RF---------------------
CAPSD_NVN68/2-294---------------------------------------------------------RA---------------------

PF08762

Q8B107_ALPV/599-804---------------------------------------------------------IL---------------------
O56051_9VIRU/590-790---------------------------------------------------------IA---------------------
Q56QP7_9VIRU/684-855---------------------------------------------------------VE---------------------
O36967_9VIRU/668-900---------------------------------------------------------VA---------------------
Q5UBY1_9VIRU/79-259---------------------------------------------------------MY---------------------
Q6ITS9_9VIRU/106-313---------------------------------------------------------IS---------------------
Q4JFT2_9VIRU/834-1009---------------------------------------------------------IS---------------------

PF00760

CAPSD_CMVFN/11-215-------------------------------------------------------------------------SAMR--A

PF01318

CAPSD_BMV/2-188-------------------------------------------------------------------------DAFRG-A

PF03566

Q80IX5_PRVFL/54-754VTTNVPKYEQFLCKESGGAYIVHYKMNNPVFEMTGEENFGGFQFHYPGYDPENNALGLRGIVDTFENNFSSAVVHFWG-I
CAPSD_NCBVS/1-608MMQATPKTIQFQLNETKGFY.MPLRAFQPVFEMTMATSYGPVRWKTPRTTVVDYHRAIGGLQDTIDSNFAIGVAAMTG-M
CAPSD_HASV/2-647TVANNPKIEQSLLKETLGCYLVHSKMRNPVFQLTPASSFGAVSFNNPGYERTRDLPDYTGIRDSFDQNMSTAVAHFRS-L

PF01829

CAPSD_NODAM/42-399-----------------------------------ASMFTNLTFSGARYTGLGDMDAIAILVTTPTGAVNTAVLKVWACV

PF01766

POLS_IBDVU/9-452LMPFNI....VIPTSEITQPITSIKLEIVT.SKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVTLVAYERVATGSVV
POLS_DXV96/2-442MNMNNLNVS.LFHENPPPEPVAAIKININYGNNTNGDS....SFSVDSSFTINVIGGATIGVNSPTVGVGYQGVAEGTAI
POLS_BSNV/7-428...FHFSTTAVFGETEITQPVVGVQVL....AKTNGD.....PIVVDSYVGVTVHGGNMPGTLRPVTIIAYESVATGSVL
POLS_IPNVJ/5-453......KFTQSIPTEMITKPITRVKLAYQLNQQTAIANAATLGAKGPASVSFSSGNGNVPGVLRPITLVAYEKMTPQSIL

PF00729

CAPSD_PNLV/47-266------KQPELLNQYTPARAFIG---------------------TGGGMQ--------------GVNGLTAG......RV
CAPSD_MCMVK/23-222------P..........GRFIVA---------------------I...PK--------------ASATQAVG......QI
CAPSD_PMVK/39-236------V..........GRLVVG---------------------S...SK--------------QAVVIQLG......LL
CAPSD_RCNMV/24-213------F..........GQLLFV---------------------T...HS--------------GSDGIETG......DI
CAPSD_CARMS/51-245------F..........GRLVLS---------------------T.YGFD--------------KADTV.VG......EL
CAPSD_SBMVA/46-262------VNVNIATPLVPARLIIA---------------------M.LDGS--------------SSTAVSTG......RL
CAPSD_TBSVC/76-269------L..........GQLGIA---------------------T...YG--------------GAGTNAVG......DI
CAPSD_POLVP/66-257------L..........GQIGLA---------------------T...YG--------------GGSTNPVG......DL
CAPSD_OCSVU/111-308------L..........GQVVVM---------------------S...DS--------------VSNGGTISAALPLFDL
CAPSD_TNVA/61-272------L...DQNQFCPASLVVA---------------------S..DGG--------------PATATPAG......DL

PF11729

CAPSD_SJNNV/1-340------LAPANAVFVTDKPLPID---------------------YNLGVGDVDRAVYWHLRKKAGDTQVPAG--YFDWGL

PF00894

CAPSD_PLRV1/70-207----------------------------------------------------------------GKSSDSAG------SF
CAPSD_PEMVW/53-187----------------------------------------------------------------G.GTDVAG------HY
CAPSD_BYDVP/62-199----------------------------------------------------------------GTTTDTAG------QF

PF03014

CAPSD_HEVCH/41-659------IAIPHDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQSTYGSSTG------PV

PF03115

CAPSD_HASV1/1-416------TVWQVLNTAVSAAELV----------------------TPPPFNWLVKGGWWFVKLIAGRTRTGSR------SF

PF00983

COAT_TYMV/8-177------S----------PKLLIS--------------------------------------ITAQPTAPPAS--------

PF02247

POL2_SQMVM/246-618------------------------------------------------------------------------------GV
POL2_CPMVS/460-832------------------------------------------------------------------------------GV
POL2_BPMV/447-819------------------------------------------------------------------------------GV
Q9Z006_9SECO/476-846------------------------------------------------------------------------------RI
O12663_9SECO/321-691------------------------------------------------------------------------------RI
Q9YWK0_9SECO/363-735------------------------------------------------------------------------------GV
POL2_CPSMV/437-806------------------------------------------------------------------------------GI
POL2_RCMV/407-778------------------------------------------------------------------------------GV
Q9YWJ9_9SECO/452-824------------------------------------------------------------------------------GV
Q66170_CPMVS/343-715------------------------------------------------------------------------------GV

PF03391

CAPSD_TRSV/179-344------------------------------------------------------------------------------IV
POL2_RRVS/768-936------------------------------------------------------------------------------MI
POL2_BRAV/1268-1433------------------------------------------------------------------------------CI
Q65029_ARMV/745-916------------------------------------------------------------------------------VV
POL2_ARMVS/792-963------------------------------------------------------------------------------VV
Q67703_GFLV/166-336------------------------------------------------------------------------------VV
POL2_GFLV/771-941------------------------------------------------------------------------------VV
POL2_BRSV/1007-1170------------------------------------------------------------------------------YI
POL2_GCMV/981-1144------------------------------------------------------------------------------YI
POL2_TORVR/1497-1662------------------------------------------------------------------------------MC
Q88483_9SECO/1003-1166------------------------------------------------------------------------------YI

PF02443

Q5Y4T0_PCV2/5-226-----QLWLRL--------------------------------------------QTT..................GNVD
Q27W03_PCV1/5-227-----QLWLHL--------------------------------------------NTH..................TNVE
A3FEQ4_9CIRC/3-256-----TFFLGG--------------------------------------------KNFTWI...........NCSQDQVV
Q3HUU1_GOCV/5-247-----TWYTPG--------------------------------------------GRQLWL...........NSIQDNVV
Q1L2D2_9CIRC/1-237-----ALWLNS--------------------------------------------QKAFWIPLQLNAAQIKP....KKVK
CAPSD_CACV/7-243-----ALWLNN--------------------------------------------PKSLWIPIMKKSDQNLP.SSGTRVK
Q0H9S8_9CIRC/4-236-----ALWLTN--------------------------------------------PRSAWIPLMKKGDQNLP.SSGSRVK
Q06J73_9CIRC/8-245-----ALWLNN--------------------------------------------PRGAWIPLMKKGETTASTTSGTRVN
Q9DXG3_BFDV/11-242-----ALWLNS--------------------------------------------ARTGWIPL.....QGGPNSAGAKVR
Q69EZ5_BFDV/7-239-----ALWLNS--------------------------------------------ARTGWIPL.....QGGPNAAGAKVR
Q9DXG0_BFDV/11-242-----ALWLNS--------------------------------------------VRTGWIPL.....QGGPNAAGSKVK
Q9DXF4_BFDV/3-235-----ALWLNS--------------------------------------------TRTGWIPL.....QGGPNTAGTKVR

PF02956

A7VLZ2_9VIRU/1-506FVQGLPLWQLLLG..FPDWVRQKK.KDPTFLQSYYLCFHCDAIEP....KPGL..HQV.FIPVDYSFVQGKGPYD.S.LL
Q9WT88_9VIRU/1-603TLEDMPLWAICFG..YTDYVETQLGPNVDHETAGLIIMICPYTQPPM.YDKNR..PNWGYVVYDTNFGNGKMPSG.SGQV
Q91CY9_9VIRU/1-581VIEDMPLWAMVNG..YLEFCDSEL.PGANIYNTYIVVVICPYTKPQL.LNKTN..PKQGYVFYDTLFGDGKMPTG.TGLV
A7VLY0_9VIRU/1-515VIVGKPLWLSFYG..FESFIQKTK.HDKGWLLSGFYVCKCPYLKTL..SATTQ..TTF..AFIDLDFIQGKLPYG.E.TI
Q9JGT1_9VIRU/1-585LIENLPLWAAIYG..FKEYCSKVT.GDTNIEHNCKCVIRSPYTIPQL.LDHNN..PLRGYIPYSFNFGNGKMPGG.SSLV
Q80QT8_9VIRU/1-595VIENLPLYCAFFG..YEDYLQRTLGPYQDVETVGIVCFICPYTEPAC.VNKNDGKSNWGYVFYDVNFGNGKTPEG.LGRV
CAPSD_TTVB1/1-533IITDLPLWLITWG..WIEWLKKSR.PVAHIEEEYQVVIQSKYIHP..........QLPCYVLIDKYFRHPPEGQHYITEL
A7VM00_9VIRU/1-509VMEGYPLWAMLYG..YTSLLKQVK.SKTVPFAGSMIVVKSPALYRV..FGEDT..KDY.YPLIDKSFMDGKGTNN.T.DP
Q9JG61_9VIRU/1-534LLKDFPIWLATWG..WISWLLKSK.PVHYLEEDYHLVIQSPYIYP..........PMPCYVPLDKYFTHND.....GKNL
Q91PS3_9VIRU/1-581PIVDIPLWAAVMG..YSDYCRKYY.QGTNVLKEARLTVICPYTEPPL.TDKNS..TDTGFIPFDYNFGDGKMPDG.QNYI
CAPSD_TTVV4/1-560LIQHVPLWAAIHG..YMDFCKKTF.KDNNLDKNTRVVLICPYTRPQL.YNPQK..PDWGYVPYDYNFAQTKMPDG.NGYI
Q91C93_9VIRU/1-546IAKDLPLWACLWG..YIDYQKKAA.TYTEIDTTCICVILSHSLDPT.........THTTFIPLDEDFLKGQSSFRPEHQT
Q2F827_9VIRU/1-589VLSDLPLWSMFYG..YVDFIESELGISAEIHNFGIVCVQCPYTFPPM.FDKSK..PDKGYVFYDTLFGNGKMPDG.SGHV
Q91CY5_9VIRU/1-584VLENIPLWSAFHG..YPDFIEQELSISAEIHNFGLVCFICPYTFPPC.YNKTK..PEQGYVFYDTTFGNGKMPDG.SGHI
Q8V7G9_9VIRU/1-572MLQDMPLYMLTYG..YLDYVVKCT.GVKSAWTDMRVAIRSPYTFPQL.IGSTD...KVGFIPLGEKFMSGDTDPV.KNFI
Q99A78_9VIRU/1-584LIENLPLWASVYG..YAEYCSKST.GDTNIEQNCRVVIRSPFTNPQL.LDHNN..PLRGYVPYSINFGNGKMPGG.SSQV
Q6H9C2_9VIRU/1-573EIMDMPLWAACTG..YTEFCAKYT.GDSAIIYNARIVIRCPYTEPML.IDHSD..PNKGFVPYSFNFGNGKMPGG.SSNV
CAPSD_TTVT1/1-433LEWDAPYWLWFWGKTYQDFVSSHT.PEGNPYYGQIYVKWWPITNPYD.............................QGPH
Q9JG80_9VIRU/1-589HIEDIPLWAAFYG..YSDFIESELGPFVDAETVGLVCVICPYTKPPL.WSKTN..PSMGYVFYDRNFGDGKWTDG.RGKI
A7VLZ6_9VIRU/1-506LIQGMPIWLGLFG..YLDYVRQVK.KDKTWLESHVLVLKSPAIFTF..PQPGA..DAW.YCPLSKTFIDGVGPYR.T.DL
Q6H9D2_9VIRU/1-557VIKDIPLWAALFG..YVDFLKKTF.KDDQLDKTARLTLISPYTKPQL.IGPTQ..PNKGFVPYDYNFGRAHMPSG.ESYI
Q6H999_9VIRU/1-471LLTDMPLWTLLFG..YTDWCKKDT.NNWDLPLNYRLVLICPYTFPKL.YNEKV..KDYGYIPYSYKFGAGQMPDG.SNYI
Q77JT5_9VIRU/1-606LLSDFPLWSLCYG..YPDYCRKQT.GDSGIYYDYRVLIRCPYTYPQL.IKHND..KYFGFVVYSENFGLGRLPGG.NPNP
Q91PS7_9VIRU/1-585PVVDIPLWAALLG..YSDYCTKYF.NDKGLIKEARLTIICPYTQPPL.TDPEN..VDMGFIPYDFNFGNGVMPDG.TPYI
CAPSD_TTVV9/1-555VIKDAPLYLALFG..YIDICSKLA.KDKSFYLSNRVCVKCPYTVPQL.LSKTN..ATLGHVILSENFMRGLVPSK.DSYV
Q9JG47_9VIRU/1-553ITQDLPLNILLWG..YLDFHRKAK.TYNDIDTTCLLVIKSPYLYPK......G..QITFAVPLDQEFLDGNSPYFTEGHK
A7VLW0_9VIRU/1-507ILEGYPLWLMLYG..YTSFLYQVK.ADKNPFSSSLIVVKSSALQRV..FGTDT..TGW.YPLIDKSFMDGKGPGN.T.DP
Q0ZLH9_9VIRU/1-573PVVDLPLWCALMG..YSDYCKKYF.HDDGFLKEARITIISPYTNPPL.INNKN..TNEGFVPYSFYFGKGRMPDG.NGYI
Q5ENW7_9VIRU/1-501..PKVSTWPIEGTWNTQDTVLKDV........................FGINL..QNQQFRAAD..FGKLTLPKS.PHDL
A7VLX2_9VIRU/1-509LLIGLPLWMAFYG..FWNYLEYTT.KAKDIFKTHMFVVKCPAIKRL..STTIT..TDY.YPFFDQDFLNGNLPYG.E.YL
Q80AR5_9VIRU/1-594LLQNLPLWSMLFG..YSEYVESQLGPFQDHGTVGLVIVQCPYTVPPM.YDKER..PNMGYVFYDTHFGNGKLGNG.LGQV
Q91CZ2_9VIRU/1-601VLEDKPIWSMAYG..YADFLLSILGEHDDVDFHGLVCIICPYTRPPL.FDKDN..PKMGYVFYDAKFGNGKWIDG.TGFI
CAPSD_TTVG1/1-514IIEEVPLWLGFWG..YYNYLKQTR..TEAIFPLHMFVVQSKYIQTQ..QTETP..NNF.WAFIDNSFIQGKNPWD.S.VI
Q98Y63_9VIRU/1-581IIENLPMWAMVNG..YSDFAESEL..GSEVHAVYVCCIICPYTKPML.YNKTN..PAMGYIFYDTLFGDGKLPSG.PGLV
Q9QU36_9VIRU/1-529QTPNLPIWLTTWG..LMDWYKKAG.IISQPELNYMVVFECPYISSNP........KLKYYVPIDDTMQTGQSPY..IEVL
A7VM12_9VIRU/1-509LIENLPLWLGLYG..YISYLETIK.PPD.WLKSSLIVLVSDAIYHS..GTPVP..STK.WAPIDSDYIDGNKPYD.Q.YI
A7VLV6_9VIRU/1-508VIRGLPLWMAFYG..YWSYLKYKT.KDKGVFTNHMFVVKCPAIKPM..QSAIT..TDY.YPVIDLEFIQGKWPYE.E.QV
Q9JG50_9VIRU/1-535YNSGYPCWLLPWG..WLDWQLKLK.QINQIGINYNYIFKTDQILP..........KLPAYIPINPSFVFPE.....EDQL
A7VLW4_9VIRU/1-507LIEGMPLWLGLFG..YYSFVRSVK..SEDFMKAHVICIKSPALYCY..PEIGS..CDT.YVFIDPEFISGKRPYE.Q.LI
A7VM04_9VIRU/1-513IFEGLPLYMLLYG..YLSYVQKVK.NVRDFLNNYTLCMRSPALFPY..SQPGA..ETQVIIPVNENFIHGKAAYD.E.TL
A7VLY4_9VIRU/1-498IISDMPIWQALYG..FTDFIKAVK.PDPNFLASYILLIETRFVEPF..SSHAT..GNY.WIPIDSSFVTGKGPYN.T.PI
CAPSD_TTVD1/1-324..EAANDWLTEWG...................................................................
Q91CZ6_9VIRU/1-596VLEDKPLWAACFG..YRDFIKSVK.EKQDPDFEYIVCVICPYTIPPL.FDDKN..PLMGYVFYDTNFGNGKWLDG.SGLV
A7VM08_9VIRU/1-506TIKNIPLWMALHG..YASYVQAKS.GDKGILTHSMIIVSSNAITRL..PTAST..QTV.FPLLSSNFVNGKAPYY.Q.PL
CAPSD_TTVV3/1-573GIFDLPLWAAFFG..YAEFCSKST.GDTAIAYNSRVCVRCPYTEPQL.LNHNN..PSQGYVFYSYNFGKGKMPGG.SSQV
Q91D00_9VIRU/1-593VLENIPLWSALFG..YSEYVESQLGPFQDHGTVGVVVVQCPYTVPPM.YNKEK..PDMGYVFYDTHFGNGKLGNG.SGQV
Q99AR5_9VIRU/1-604LLEDMPLWSMTFG..YSDYVSTQLGPNVDHETQGLVCIICPYTEPPM.YDKTN..PNSGYVAYDTNFGNGKMPSG.RSQV
Q9DTD2_9VIRU/1-559PIRDMPLWAALFG..YAEYASKET.GDTAINTNARLTLICPYTDPML.FKPQD..PKFGFVPYSLNFGLGRMPGD.STYV
Q91D04_9VIRU/1-591HIVDIPLWAAFHG..YIDFIQSELGIQEEILNIAIIVVICPYTKPKLVHDPPN..QNQGFVFYDTQFGDGKMPEG.SGLV
CAPSD_TTVV8/1-571LIENLPLWAAVWG..YLDYCTKTS.GDAAFHYNYRVTLISPYTSPML.FNPQD..PTKGFVPYSLNFGLGKMPGG.KGYV
Q5ENX0_9VIRU/1-603MLENLPLWSLLHG..YSEYLESQV.KYGDLRKEGKVLITCPYTKPPL.FDPKD..PSKGWVPYNDTFGRGKWIDG.GGYI
O90364_9VIRU/1-590LVSDLPLWASAYG..YVEFCAKST.GDQNIHMNARLLIRSPFTDPQL.LVHTD..PTKGFVPYSLNFGNGKMPGG.SSNV
Q9IFV0_9VIRU/1-583AVKDIPLWAAFMG..YRDYVTKAL.HDPGLSKEVRVTIICPYTKPKL.YNPDS..TDEGYVPYDYNFGKGKMPDG.NGYI
Q9QUE7_9VIRU/1-586LIEKLPLWAAVYG..YPEYCAKST.GDSNIDMNARVVIRCPYTVPQM.IDTSD..ELRGFIVYSFNFGRGKMPGG.SSEV
A8DMR2_9VIRU/1-531NTEGLPLWLLSFG..FHDWLLKSE.KVQRLDLDYVYVILSDYITP..........KMEHYVPVDPNFTQGRSPFEITDHM
Q9DUH8_9VIRU/1-609MVEDLPLWSLLHG..YADYIISQI.KYGDPLVEGKVLIRCPYTRPAL.YNKQS..PDEGYVVYNTYFGMGKWVDG.SGYI
A7VLW8_9VIRU/1-511NFNGYPLWLAFWG..YWSYLQKIK..DKSFFALHYFVVKSPYIYTA..QTEST..KNF.FPIIDWAFIQGKDPYD.G.YL
Q99AQ3_9VIRU/1-582VLEDMPLYAMAFG..HADFLEQEIGEYQDLEANGYVCVISPYTKPPM.FNKHN..PQQGYVFYDSQWGNGKWIDG.TGFV

PF00073

Q9WMA0_9PICO/49-215-------------------------------------------------------------------------------F
POLG_AEVCA/45-212-------------------------------------------------------------------------------L
POLG_CXA9/93-300-------------------------------------------------------------------------------M
POLG_CXB3N/93-302-------------------------------------------------------------------------------M
POLG_CXB4J/93-300-------------------------------------------------------------------------------M
POLG_CXA21/93-308-------------------------------------------------------------------------------M
POLG_POL1M/93-308-------------------------------------------------------------------------------M
POLG_POL3L/93-307-------------------------------------------------------------------------------M
POLG_HE701/93-288-------------------------------------------------------------------------------A
POLG_BOVEV/93-285-------------------------------------------------------------------------------A
POLG_HRV14/93-299-------------------------------------------------------------------------------M
POLG_HRV2/93-302-------------------------------------------------------------------------------M
POLG_HRV8A/93-302-------------------------------------------------------------------------------M
POLG_HRV1B/93-301-------------------------------------------------------------------------------M
POLG_FMDV1/311-475-------------------------------------------------------------------------------Y
POLG_FMDVT/311-475-------------------------------------------------------------------------------Y
POLG_FMDVO/311-475-------------------------------------------------------------------------------Y
POLG_EMCV/161-359-------------------------------------------------------------------------------W
POLG_TMEVB/172-382-------------------------------------------------------------------------------W
POLG_ENMGO/162-361-------------------------------------------------------------------------------W
POLG_FMDVO/533-691-------------------------------------------------------------------------------T
POLG_FMDV1/533-692-------------------------------------------------------------------------------T
POLG_EMCV/420-582-------------------------------------------------------------------------------V
POLG_TMEVB/443-606-------------------------------------------------------------------------------T
POLG_HE701/347-515-------------------------------------------------------------------------------F
POLG_HRV2/358-522-------------------------------------------------------------------------------T
POLG_HRV8A/364-529-------------------------------------------------------------------------------T
POLG_HRV1B/360-525-------------------------------------------------------------------------------T
POLG_BOVEV/345-515-------------------------------------------------------------------------------V
POLG_CXA21/369-534-------------------------------------------------------------------------------C
POLG_CXA9/358-524-------------------------------------------------------------------------------V
POLG_CXB4J/358-524-------------------------------------------------------------------------------V
POLG_CXB3N/360-526-------------------------------------------------------------------------------V
POLG_CXB1J/360-526-------------------------------------------------------------------------------V
POLG_FMDVO/725-872-------------------------------------------------------------------------------T
POLG_FMDV1/726-878-------------------------------------------------------------------------------T
POLG_BOVEV/610-775-------------------------------------------------------------------------------T
POLG_HRV8A/621-792-------------------------------------------------------------------------------M
POLG_HRV2/614-772-------------------------------------------------------------------------------M
POLG_HRV1B/627-786-------------------------------------------------------------------------------M
POLG_HE701/609-781-------------------------------------------------------------------------------N
POLG_HRV14/614-787-------------------------------------------------------------------------------C
POLG_CXA9/612-783-------------------------------------------------------------------------------N
POLG_CXB4J/612-783-------------------------------------------------------------------------------M
POLG_SVDVU/612-782-------------------------------------------------------------------------------M
POLG_CXB3N/630-782-------------------------------------------------------------------------------N
POLG_POL1M/636-806-------------------------------------------------------------------------------H
POLG_CXA21/642-812-------------------------------------------------------------------------------H
POLG_CXA24/646-809-------------------------------------------------------------------------------H

PF00915

CAPSD_VESVA/137-421----------------------------------------------------------------WSMISGFSVQP...RV
POLG_RHDVF/1768-2065----------------------------------------------------------------NGQIVGLQPVP...GG
CAPSD_FCVUR/112-395----------------------------------------------------------------WSDITDFVIRP...FV
CAPSD_NVN68/2-294----------------------------------------------------------------PLPISSMGISPDNVQS

PF08762

Q8B107_ALPV/599-804----------------------------------------------------------------TEAETT.......KAL
O56051_9VIRU/590-790----------------------------------------------------------------RFHSDT.......SAY
Q56QP7_9VIRU/684-855----------------------------------------------------------------KGIKGE..........
O36967_9VIRU/668-900----------------------------------------------------------------VAPQGTIATTDVVNAQ
Q5UBY1_9VIRU/79-259----------------------------------------------------------------YSNVGT.......NQI
Q6ITS9_9VIRU/106-313----------------------------------------------------------------TSPPSI.......NRY
Q4JFT2_9VIRU/834-1009----------------------------------------------------------------NLERTE.......NEY

PF00760

CAPSD_CMVFN/11-215DIGDMRKY----------AVL--------------VYSKDDALETD----------------------------------

PF01318

CAPSD_BMV/2-188TLGDLLNL----------QIY--------------LYA-SEAVPAK----------------------------------

PF03566

Q80IX5_PRVFL/54-754SQSATIVC----------KTYDGWEGTTNAGSTVGQFAHTGAEEED----------------------------------
CAPSD_NCBVS/1-608STSTVPYF----------KVFRRFEAIPAEGSPWGPFASATPPKDD----------------------------------
CAPSD_HASV/2-647SHSCSIVT----------KTYQGWEGVTNVNTPFGQFAHAGLLKNE----------------------------------

PF01829

CAPSD_NODAM/42-399EYRPNPNS----------TLY--------------EFARESPANDE----------------------------------

PF01766

POLS_IBDVU/9-452TVAGVSNF----------ELIPNPELAKNLVTEYGRFDPGAMNYTK----------------------------------
POLS_DXV96/2-442TISGINNY----------ELVPNPDLQKNLPMTYGTCDPHDLTYIK----------------------------------
POLS_BSNV/7-428TLSGISNY----------ELIPNPELAKNIQTSYGKLNPAEMTYTK----------------------------------
POLS_IPNVJ/5-453TVAGVSNY----------ELIPNPDLLKNMVTKYGKYDPEGLNYAK----------------------------------

PF00729

CAPSD_PNLV/47-266FM--VYDI----------------------------------ELIE----------------------------------
CAPSD_MCMVK/23-222KI--SYSV----------------------------------SYRG----------------------------------
CAPSD_PMVK/39-236RM--RYSA----------------------------------EMRG----------------------------------
CAPSD_RCNMV/24-213FL--DCEV----------------------------------EFKG----------------------------------
CAPSD_CARMS/51-245FI--QYTI----------------------------------VLSD----------------------------------
CAPSD_SBMVA/46-262YV--SYTI----------------------------------QLIE----------------------------------
CAPSD_TBSVC/76-269FI--SYSV----------------------------------TLYF----------------------------------
CAPSD_POLVP/66-257FI--HYTI----------------------------------TLFE----------------------------------
CAPSD_OCSVU/111-308IV--NYTV----------------------------------ELIE----------------------------------
CAPSD_TNVA/61-272FI--KYVI----------------------------------EFIE----------------------------------

PF11729

CAPSD_SJNNV/1-340WD--DFNK----------------------------------TFTV----------------------------------

PF00894

CAPSD_PLRV1/70-207RV--TIKV----------------------------------ALQN----------------------------------
CAPSD_PEMVW/53-187RI--SGRI----------------------------------QLMN----------------------------------
CAPSD_BYDVP/62-199II--TMSV----------------------------------SLMT----------------------------------

PF03014

CAPSD_HEVCH/41-659YV--SDSV----------------------------------TLVNVATGAQAVARSLDWTKVTLDGRPLSTTQQYSKTF

PF03115

CAPSD_HASV1/1-416YVYPSYQD----------------------------------ALSN----------------------------------

PF00983

COAT_TYMV/8-177----TCII----------------------------------TVSG----------------------------------

PF02247

POL2_SQMVM/246-618KLLDIRNY----------------------------------RAYG----------------------------------
POL2_CPMVS/460-832KLVGIKDF----------------------------------CGIG----------------------------------
POL2_BPMV/447-819KLTIIENM----------------------------------CAYG----------------------------------
Q9Z006_9SECO/476-846AARLSGDI----------------------------------TFTG----------------------------------
O12663_9SECO/321-691AARLSGDI----------------------------------NFTG----------------------------------
Q9YWK0_9SECO/363-735KLLDIRNY----------------------------------RAYG----------------------------------
POL2_CPSMV/437-806KMVGLKAV----------------------------------ENIG----------------------------------
POL2_RCMV/407-778TLLRIENF----------------------------------VGIG----------------------------------
Q9YWJ9_9SECO/452-824KLLDIRNY----------------------------------RAYG----------------------------------
Q66170_CPMVS/343-715KLVGIKDF----------------------------------CGIG----------------------------------

PF03391

CAPSD_TRSV/179-344HINTWRPD----------------------------------.S------------------------------------
POL2_RRVS/768-936HIHGLTGV----------------------------------YK------------------------------------
POL2_BRAV/1268-1433HLERLVDD----------------------------------..------------------------------------
Q65029_ARMV/745-916QIEEIAL.----------------------------------.P------------------------------------
POL2_ARMVS/792-963QIEEIAL.----------------------------------.P------------------------------------
Q67703_GFLV/166-336QIEEIVR.----------------------------------.P------------------------------------
POL2_GFLV/771-941QIDEIVR.----------------------------------.P------------------------------------
POL2_BRSV/1007-1170QIKGIEAN----------------------------------.P------------------------------------
POL2_GCMV/981-1144QILGIDAD----------------------------------.P------------------------------------
POL2_TORVR/1497-1662YFDHIELV----------------------------------.E------------------------------------
Q88483_9SECO/1003-1166HIHGINAK----------------------------------.A------------------------------------

PF02443

Q5Y4T0_PCV2/5-226HVGLGTAF----------------------------------ENS.----------------------------------
Q27W03_PCV1/5-227HTGLGYAL----------------------------------QNA.----------------------------------
A3FEQ4_9CIRC/3-256HYGMGMSL----------------------------------RKPD----------------------------------
Q3HUU1_GOCV/5-247FYGMGMSL----------------------------------RQAE----------------------------------
Q1L2D2_9CIRC/1-237HYGIAFSY----------------------------------LQPS----------------------------------
CAPSD_CACV/7-243HYGLAFSW----------------------------------PEPT----------------------------------
Q0H9S8_9CIRC/4-236HYGLAISW----------------------------------PQP.----------------------------------
Q06J73_9CIRC/8-245HYGLAFSF----------------------------------PEPW----------------------------------
Q9DXG3_BFDV/11-242HYGIAFSF----------------------------------PQP.----------------------------------
Q69EZ5_BFDV/7-239HYGIAFSF----------------------------------PQP.----------------------------------
Q9DXG0_BFDV/11-242HYGLAFSF----------------------------------AQP.----------------------------------
Q9DXF4_BFDV/3-235HYGLAFSF----------------------------------PQP.----------------------------------

PF02956

A7VLZ2_9VIRU/1-506SKWDNDHW.YPTLKHQLQTIN........SVVETGPFVPKL.DTLK----------------------------------
Q9WT88_9VIRU/1-603PVYWQCRW.RPMLWFQQQVLN........DISKTGPY..AY.RDEY----------------------------------
Q91CY9_9VIRU/1-581PFWLQSRW.YPRAEFQQQVLH........DLYLTGPF..SY.KDDL----------------------------------
A7VLY0_9VIRU/1-515TSQKKALW.YPNVENQVNTVT........NLVQCGPYIPKY.AFRD----------------------------------
Q9JGT1_9VIRU/1-585PIRMRAKW.YPTLFHQKEVLE........AIAQAGPF..AY.HSDI----------------------------------
Q80QT8_9VIRU/1-595HPYWMQRW.RVYSQFQKETMN........RICRTGPF..SY.RDEH----------------------------------
CAPSD_TTVB1/1-533SETDKLHW.HPKYSMQTEQLE........LIAETGPA..AP.KINN----------------------------------
A7VM00_9VIRU/1-509IYPKSKLW.YPALFSQRDSIS........QIVNSGPYIPKY.NETK----------------------------------
Q9JG61_9VIRU/1-534TETDKAHW.HPKIEMQLETLA........KFAETGPA..AP.KINK----------------------------------
Q91PS3_9VIRU/1-581PVEYRFRW.YPCMFHQQNWMN........DIAQCGPF..AY.DGGE----------------------------------
CAPSD_TTVV4/1-560PEFYRFRW.YPSGFHQQNWMN........DLDQCGPF..SH.RGEE----------------------------------
Q91C93_9VIRU/1-546TRPDELNW.HPKVSFQIQSLN........NIACTGPY..TA.KLPA----------------------------------
Q2F827_9VIRU/1-589PTYWQQRW.WPRFSFQRQVMH........DIILTGPF..SY.KDDS----------------------------------
Q91CY5_9VIRU/1-584PIYWQQRW.FIRLAFQTQVMH........DLVMCGPF..SY.KDDL----------------------------------
Q8V7G9_9VIRU/1-572PLKYWYRW.YPFAANQKSVLE........TIVSCGPF..MP.RDQE----------------------------------
Q99A78_9VIRU/1-584PIRMRSKW.YPTLFHQKEVLE........AIAQAGPF..AY.HSDQ----------------------------------
Q6H9C2_9VIRU/1-573PIRMRAKW.YVNIFHQKEVLE........SIVQSGPF..GY.KGDI----------------------------------
CAPSD_TTVT1/1-433TYPEDKEWCLMMLDPQPNFMTCNSIAAALKIAAFGPCVYAP.QDTQ----------------------------------
Q9JG80_9VIRU/1-589EPYWQVRW.RPEMLFQETVXA........DIVQTGPF..SY.KDEL----------------------------------
A7VLZ6_9VIRU/1-506TIKQKERW.FPQIQHQYEILN........SFVEAGPFIPKY.TNQS----------------------------------
Q6H9D2_9VIRU/1-557PMYYRFRW.YICLFHQQKFID........NIVSSGPF..AY.HGSQ----------------------------------
Q6H999_9VIRU/1-471PFQFRAKW.YPTVLHQQQVME........DISRSGPF..AP.KVEK----------------------------------
Q77JT5_9VIRU/1-606PTRMRLHW.YPNMFHQTEVLE........CIAQSGPF..AY.HGDE----------------------------------
Q91PS7_9VIRU/1-585PIECRMKW.YPCMFHQQNFMN........SIVSCGPF..AY.QGDE----------------------------------
CAPSD_TTVV9/1-555PLYMRGKW.YPSIYHQEEVIE........AIVSSGPF..VP.RDQI----------------------------------
Q9JG47_9VIRU/1-553TQSDQQYW.HPKVRFQTRTVN........AIACTGPG..TT.KLPP----------------------------------
A7VLW0_9VIRU/1-507ILLHRKYW.YPSLYGQRDSIS........QLVNCGPYVPKY.NETK----------------------------------
Q0ZLH9_9VIRU/1-573PIDFRFNW.YPCIFHQTNWIN........DMVQCGPF..AY.HGDE----------------------------------
Q5ENW7_9VIRU/1-501DFGHHSRF.GP..................FCVKNEPL..EF.QVYP----------------------------------
A7VLX2_9VIRU/1-509SDNEKKLW.YPTAEKQVVTIN........SLVSCGPYIPRL.NNQK----------------------------------
Q80AR5_9VIRU/1-594PRYWQQRW.YPVLKRQKQVMN........DICKTGPF..AY.RDER----------------------------------
Q91CZ2_9VIRU/1-601PVEFQSRW.KPELAFRKDVLT........DLAMSGPF..SY.SDDL----------------------------------
CAPSD_TTVG1/1-514TYSEQKLW.FPTVAWQLKTIN........AICESGPYVPKL.DNQT----------------------------------
Q98Y63_9VIRU/1-581PFYWQSRW.YPKLAWQQQVLH........DFYLCGPF..SY.KDDL----------------------------------
Q9QU36_9VIRU/1-529SQSDEKHW.YPKGSFQIKTLN........TITSCGPG..TV.KLDN----------------------------------
A7VM12_9VIRU/1-509TPTEKTRW.YPNYKWQLKTLN........AIVECGPYIQQY.AEEK----------------------------------
A7VLV6_9VIRU/1-508TENHKKLW.YPTAEHQTVTIN........NFVESGPYVPRL.ENQK----------------------------------
Q9JG50_9VIRU/1-535TETDKLHW.YPKNDYQLNSIS........TLCSSGPG..TY.QFDK----------------------------------
A7VLW4_9VIRU/1-507TSQQKRLW.YPDMSWQKKTMN........TLVEAGPYVPKL.SDET----------------------------------
A7VM04_9VIRU/1-513TESVKGYW.TPNVYQQIQTLN........TMVESSPYVPKY.SQTK----------------------------------
A7VLY4_9VIRU/1-498GDYTKTKW.FPTVKNQQESIN........AFVKAGPYIPRL.QDEK----------------------------------
CAPSD_TTVD1/1-324.........RPQGSGVTQQFN........QLAMAGPFVLKTNKSEY----------------------------------
Q91CZ6_9VIRU/1-596PVEMQSRW.RPYLAFQTKVMT........DIAMSGPF..SY.PDEL----------------------------------
A7VM08_9VIRU/1-506TDTMKKNW.YPTYEGQQETIN........DIVCCGPLVPKL.YNLT----------------------------------
CAPSD_TTVV3/1-573PIRMRWKW.YVCMFHQLEVME........AICQSGPF..AY.HSDE----------------------------------
Q91D00_9VIRU/1-593PRYWQMRW.YPILKRQKQVMN........DICKTGPF..SY.RDEL----------------------------------
Q99AR5_9VIRU/1-604PVYWQCRW.RPMLWFQQQVLN........DISKSGPY..AY.RDEL----------------------------------
Q9DTD2_9VIRU/1-559PIRQRAKW.YACLYHQQEVIE........AITQSGPF..AY.HCDY----------------------------------
Q91D04_9VIRU/1-591PIYYQNRW.YPRIKFQSQVVH........DFILTGPF..SY.KDDL----------------------------------
CAPSD_TTVV8/1-571PLRMRANW.YPYFFHQQKVLE........AIGMSGPF..TY.RSDE----------------------------------
Q5ENX0_9VIRU/1-603PLPERAFW.YVMLRYQEQVFK........DIVTCGPF..AY.RDDE----------------------------------
O90364_9VIRU/1-590PIRMRAKW.YPTLFHQQEVLE........ALAQSGPF..AY.HSDI----------------------------------
Q9IFV0_9VIRU/1-583PIAYRFQW.YPCMFHQQNFMN........DIVQSGPF..AY.HGEE----------------------------------
Q9QUE7_9VIRU/1-586PIRMRAKW.YPCLFHQKEVLE........ALGQSGPF..AY.HCDQ----------------------------------
A8DMR2_9VIRU/1-531RPPDVGYW.FPKTSYQHTVFS........EIINTGPG..TV.KLPP----------------------------------
Q9DUH8_9VIRU/1-609PIPERARW.MVMLKYQLDVFH........DLVVCGPW..AY.RDDE----------------------------------
A7VLW8_9VIRU/1-511TSTDKSLW.YPTALRQIVTIN........NICKLGPYVPKY.ENDR----------------------------------
Q99AQ3_9VIRU/1-582PVYWLTRW.RVELLFQKQVLS........DLAMSGPF..SY.PDEL----------------------------------

PF00073

Q9WMA0_9PICO/49-215KDPQYPVW----------------------------------ELTI----------------------------------
POLG_AEVCA/45-212RNSAYSIW----------------------------------MLVI----------------------------------
POLG_CXA9/93-300FRHY..NF----------------------------------TLMV----------------------------------
POLG_CXB3N/93-302FRHN..NV----------------------------------TLMV----------------------------------
POLG_CXB4J/93-300FRHN..NF----------------------------------TLMI----------------------------------
POLG_CXA21/93-308AKHN..NW----------------------------------GIVI----------------------------------
POLG_POL1M/93-308VKHN..NW----------------------------------GIAI----------------------------------
POLG_POL3L/93-307VKHN..NW----------------------------------GIAI----------------------------------
POLG_HE701/93-288LRHN..NW----------------------------------TLAV----------------------------------
POLG_BOVEV/93-285IRHS..NW----------------------------------TLAI----------------------------------
POLG_HRV14/93-299TRHN..NV----------------------------------SLMV----------------------------------
POLG_HRV2/93-302RSHN..NW----------------------------------SLVI----------------------------------
POLG_HRV8A/93-302LRHN..NW----------------------------------SLVI----------------------------------
POLG_HRV1B/93-301LRHN..NW----------------------------------SLVI----------------------------------
POLG_FMDV1/311-475KKHK..PW----------------------------------TLVV----------------------------------
POLG_FMDVT/311-475KQHR..PW----------------------------------TLVV----------------------------------
POLG_FMDVO/311-475KVHK..PW----------------------------------TLVV----------------------------------
POLG_EMCV/161-359TQHA..SW----------------------------------TLVI----------------------------------
POLG_TMEVB/172-382TQHA..NW----------------------------------TLVV----------------------------------
POLG_ENMGO/162-361TQHA..SW----------------------------------TLVI----------------------------------
POLG_FMDVO/533-691ASGV..AE----------------------------------TTNV----------------------------------
POLG_FMDV1/533-692ASDT..AE----------------------------------TTNV----------------------------------
POLG_EMCV/420-582GTDQ..VN----------------------------------ITNA----------------------------------
POLG_TMEVB/443-606SYTS..PT----------------------------------ITSV----------------------------------
POLG_HE701/347-515NTDA..KA----------------------------------INAN----------------------------------
POLG_HRV2/358-522SPGR....----------------------------------..ST----------------------------------
POLG_HRV8A/364-529TPDT....----------------------------------.YSS----------------------------------
POLG_HRV1B/360-525ANDK....----------------------------------.YSM----------------------------------
POLG_BOVEV/345-515SNDDVLNY----------------------------------QYYA----------------------------------
POLG_CXA21/369-534ARDD....----------------------------------.FTE----------------------------------
POLG_CXA9/358-524QQDE....----------------------------------.YTS----------------------------------
POLG_CXB4J/358-524VDDK....----------------------------------.YTA----------------------------------
POLG_CXB3N/360-526ASDE....----------------------------------.YTA----------------------------------
POLG_CXB1J/360-526VEDE....----------------------------------.YTA----------------------------------
POLG_FMDVO/725-872VYNGECRY----------------------------------NRNA----------------------------------
POLG_FMDV1/726-878VYDGTNKY----------------------------------SASD----------------------------------
POLG_BOVEV/610-775VYDGYARF----------------------------------MDTD----------------------------------
POLG_HRV8A/621-792FYDGYDGD----------------------------------SAAS----------------------------------
POLG_HRV2/614-772FYDG...Y----------------------------------DEQD----------------------------------
POLG_HRV1B/627-786FYDGYDGD----------------------------------NSSS----------------------------------
POLG_HE701/609-781FYDGFAGF----------------------------------EKKA----------------------------------
POLG_HRV14/614-787FYDGYSHD----------------------------------DAET----------------------------------
POLG_CXA9/612-783FYDGWSNF----------------------------------DQRG----------------------------------
POLG_CXB4J/612-783FYDGWSNF----------------------------------SRDG----------------------------------
POLG_SVDVU/612-782FYDGWARF----------------------------------DKQG----------------------------------
POLG_CXB3N/630-782FYDGWSEF----------------------------------SRNG----------------------------------
POLG_POL1M/636-806FYDGFSKV----------------------------------PLKD----------------------------------
POLG_CXA21/642-812FYDGFARV----------------------------------PLEG----------------------------------
POLG_CXA24/646-809FYDGFARV----------------------------------PLKD----------------------------------

PF00915

CAPSD_VESVA/137-421FQ.SNRHF----------------------------------DFDS----------------------------------
POLG_RHDVF/1768-2065FSTCNRHW----------------------------------NLNG----------------------------------
CAPSD_FCVUR/112-395FQ.ANRHF----------------------------------DFNQ----------------------------------
CAPSD_NVN68/2-294VQFQNGRC----------------------------------TLDG----------------------------------

PF08762

Q8B107_ALPV/599-804FYRA.VGD----------------------------------DFSF----------------------------------
O56051_9VIRU/590-790VYRA.AGD----------------------------------DFSF----------------------------------
Q56QP7_9VIRU/684-855LYRS.GND----------------------------------DLTY----------------------------------
O36967_9VIRU/668-900FARA.PSD----------------------------------DFSF----------------------------------
Q5UBY1_9VIRU/79-259VARA.GND----------------------------------DFTF----------------------------------
Q6ITS9_9VIRU/106-313YAVG.AGD----------------------------------DMDF----------------------------------
Q4JFT2_9VIRU/834-1009FVLASAGD----------------------------------DHTF----------------------------------

PF00760

CAPSD_CMVFN/11-215--------------------------------------------------------------------------------

PF01318

CAPSD_BMV/2-188--------------------------------------------------------------------------------

PF03566

Q80IX5_PRVFL/54-754--------------------------------------------------------------------------------
CAPSD_NCBVS/1-608--------------------------------------------------------------------------------
CAPSD_HASV/2-647--------------------------------------------------------------------------------

PF01829

CAPSD_NODAM/42-399--------------------------------------------------------------------------------

PF01766

POLS_IBDVU/9-452--------------------------------------------------------------------------------
POLS_DXV96/2-442--------------------------------------------------------------------------------
POLS_BSNV/7-428--------------------------------------------------------------------------------
POLS_IPNVJ/5-453--------------------------------------------------------------------------------

PF00729

CAPSD_PNLV/47-266--------------------------------------------------------------------------------
CAPSD_MCMVK/23-222--------------------------------------------------------------------------------
CAPSD_PMVK/39-236--------------------------------------------------------------------------------
CAPSD_RCNMV/24-213--------------------------------------------------------------------------------
CAPSD_CARMS/51-245--------------------------------------------------------------------------------
CAPSD_SBMVA/46-262--------------------------------------------------------------------------------
CAPSD_TBSVC/76-269--------------------------------------------------------------------------------
CAPSD_POLVP/66-257--------------------------------------------------------------------------------
CAPSD_OCSVU/111-308--------------------------------------------------------------------------------
CAPSD_TNVA/61-272--------------------------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340--------------------------------------------------------------------------------

PF00894

CAPSD_PLRV1/70-207--------------------------------------------------------------------------------
CAPSD_PEMVW/53-187--------------------------------------------------------------------------------
CAPSD_BYDVP/62-199--------------------------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659FVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAPHSALALLEDTMDY

PF03115

CAPSD_HASV1/1-416--------------------------------------------------------------------------------

PF00983

COAT_TYMV/8-177--------------------------------------------------------------------------------

PF02247

POL2_SQMVM/246-618--------------------------------------------------------------------------------
POL2_CPMVS/460-832--------------------------------------------------------------------------------
POL2_BPMV/447-819--------------------------------------------------------------------------------
Q9Z006_9SECO/476-846--------------------------------------------------------------------------------
O12663_9SECO/321-691--------------------------------------------------------------------------------
Q9YWK0_9SECO/363-735--------------------------------------------------------------------------------
POL2_CPSMV/437-806--------------------------------------------------------------------------------
POL2_RCMV/407-778--------------------------------------------------------------------------------
Q9YWJ9_9SECO/452-824--------------------------------------------------------------------------------
Q66170_CPMVS/343-715--------------------------------------------------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226--------------------------------------------------------------------------------
Q27W03_PCV1/5-227--------------------------------------------------------------------------------
A3FEQ4_9CIRC/3-256--------------------------------------------------------------------------------
Q3HUU1_GOCV/5-247--------------------------------------------------------------------------------
Q1L2D2_9CIRC/1-237--------------------------------------------------------------------------------
CAPSD_CACV/7-243--------------------------------------------------------------------------------
Q0H9S8_9CIRC/4-236--------------------------------------------------------------------------------
Q06J73_9CIRC/8-245--------------------------------------------------------------------------------
Q9DXG3_BFDV/11-242--------------------------------------------------------------------------------
Q69EZ5_BFDV/7-239--------------------------------------------------------------------------------
Q9DXG0_BFDV/11-242--------------------------------------------------------------------------------
Q9DXF4_BFDV/3-235--------------------------------------------------------------------------------

PF02956

A7VLZ2_9VIRU/1-506--------------------------------------------------------------------------------
Q9WT88_9VIRU/1-603--------------------------------------------------------------------------------
Q91CY9_9VIRU/1-581--------------------------------------------------------------------------------
A7VLY0_9VIRU/1-515--------------------------------------------------------------------------------
Q9JGT1_9VIRU/1-585--------------------------------------------------------------------------------
Q80QT8_9VIRU/1-595--------------------------------------------------------------------------------
CAPSD_TTVB1/1-533--------------------------------------------------------------------------------
A7VM00_9VIRU/1-509--------------------------------------------------------------------------------
Q9JG61_9VIRU/1-534--------------------------------------------------------------------------------
Q91PS3_9VIRU/1-581--------------------------------------------------------------------------------
CAPSD_TTVV4/1-560--------------------------------------------------------------------------------
Q91C93_9VIRU/1-546--------------------------------------------------------------------------------
Q2F827_9VIRU/1-589--------------------------------------------------------------------------------
Q91CY5_9VIRU/1-584--------------------------------------------------------------------------------
Q8V7G9_9VIRU/1-572--------------------------------------------------------------------------------
Q99A78_9VIRU/1-584--------------------------------------------------------------------------------
Q6H9C2_9VIRU/1-573--------------------------------------------------------------------------------
CAPSD_TTVT1/1-433--------------------------------------------------------------------------------
Q9JG80_9VIRU/1-589--------------------------------------------------------------------------------
A7VLZ6_9VIRU/1-506--------------------------------------------------------------------------------
Q6H9D2_9VIRU/1-557--------------------------------------------------------------------------------
Q6H999_9VIRU/1-471--------------------------------------------------------------------------------
Q77JT5_9VIRU/1-606--------------------------------------------------------------------------------
Q91PS7_9VIRU/1-585--------------------------------------------------------------------------------
CAPSD_TTVV9/1-555--------------------------------------------------------------------------------
Q9JG47_9VIRU/1-553--------------------------------------------------------------------------------
A7VLW0_9VIRU/1-507--------------------------------------------------------------------------------
Q0ZLH9_9VIRU/1-573--------------------------------------------------------------------------------
Q5ENW7_9VIRU/1-501--------------------------------------------------------------------------------
A7VLX2_9VIRU/1-509--------------------------------------------------------------------------------
Q80AR5_9VIRU/1-594--------------------------------------------------------------------------------
Q91CZ2_9VIRU/1-601--------------------------------------------------------------------------------
CAPSD_TTVG1/1-514--------------------------------------------------------------------------------
Q98Y63_9VIRU/1-581--------------------------------------------------------------------------------
Q9QU36_9VIRU/1-529--------------------------------------------------------------------------------
A7VM12_9VIRU/1-509--------------------------------------------------------------------------------
A7VLV6_9VIRU/1-508--------------------------------------------------------------------------------
Q9JG50_9VIRU/1-535--------------------------------------------------------------------------------
A7VLW4_9VIRU/1-507--------------------------------------------------------------------------------
A7VM04_9VIRU/1-513--------------------------------------------------------------------------------
A7VLY4_9VIRU/1-498--------------------------------------------------------------------------------
CAPSD_TTVD1/1-324--------------------------------------------------------------------------------
Q91CZ6_9VIRU/1-596--------------------------------------------------------------------------------
A7VM08_9VIRU/1-506--------------------------------------------------------------------------------
CAPSD_TTVV3/1-573--------------------------------------------------------------------------------
Q91D00_9VIRU/1-593--------------------------------------------------------------------------------
Q99AR5_9VIRU/1-604--------------------------------------------------------------------------------
Q9DTD2_9VIRU/1-559--------------------------------------------------------------------------------
Q91D04_9VIRU/1-591--------------------------------------------------------------------------------
CAPSD_TTVV8/1-571--------------------------------------------------------------------------------
Q5ENX0_9VIRU/1-603--------------------------------------------------------------------------------
O90364_9VIRU/1-590--------------------------------------------------------------------------------
Q9IFV0_9VIRU/1-583--------------------------------------------------------------------------------
Q9QUE7_9VIRU/1-586--------------------------------------------------------------------------------
A8DMR2_9VIRU/1-531--------------------------------------------------------------------------------
Q9DUH8_9VIRU/1-609--------------------------------------------------------------------------------
A7VLW8_9VIRU/1-511--------------------------------------------------------------------------------
Q99AQ3_9VIRU/1-582--------------------------------------------------------------------------------

PF00073

Q9WMA0_9PICO/49-215--------------------------------------------------------------------------------
POLG_AEVCA/45-212--------------------------------------------------------------------------------
POLG_CXA9/93-300--------------------------------------------------------------------------------
POLG_CXB3N/93-302--------------------------------------------------------------------------------
POLG_CXB4J/93-300--------------------------------------------------------------------------------
POLG_CXA21/93-308--------------------------------------------------------------------------------
POLG_POL1M/93-308--------------------------------------------------------------------------------
POLG_POL3L/93-307--------------------------------------------------------------------------------
POLG_HE701/93-288--------------------------------------------------------------------------------
POLG_BOVEV/93-285--------------------------------------------------------------------------------
POLG_HRV14/93-299--------------------------------------------------------------------------------
POLG_HRV2/93-302--------------------------------------------------------------------------------
POLG_HRV8A/93-302--------------------------------------------------------------------------------
POLG_HRV1B/93-301--------------------------------------------------------------------------------
POLG_FMDV1/311-475--------------------------------------------------------------------------------
POLG_FMDVT/311-475--------------------------------------------------------------------------------
POLG_FMDVO/311-475--------------------------------------------------------------------------------
POLG_EMCV/161-359--------------------------------------------------------------------------------
POLG_TMEVB/172-382--------------------------------------------------------------------------------
POLG_ENMGO/162-361--------------------------------------------------------------------------------
POLG_FMDVO/533-691--------------------------------------------------------------------------------
POLG_FMDV1/533-692--------------------------------------------------------------------------------
POLG_EMCV/420-582--------------------------------------------------------------------------------
POLG_TMEVB/443-606--------------------------------------------------------------------------------
POLG_HE701/347-515--------------------------------------------------------------------------------
POLG_HRV2/358-522--------------------------------------------------------------------------------
POLG_HRV8A/364-529--------------------------------------------------------------------------------
POLG_HRV1B/360-525--------------------------------------------------------------------------------
POLG_BOVEV/345-515--------------------------------------------------------------------------------
POLG_CXA21/369-534--------------------------------------------------------------------------------
POLG_CXA9/358-524--------------------------------------------------------------------------------
POLG_CXB4J/358-524--------------------------------------------------------------------------------
POLG_CXB3N/360-526--------------------------------------------------------------------------------
POLG_CXB1J/360-526--------------------------------------------------------------------------------
POLG_FMDVO/725-872--------------------------------------------------------------------------------
POLG_FMDV1/726-878--------------------------------------------------------------------------------
POLG_BOVEV/610-775--------------------------------------------------------------------------------
POLG_HRV8A/621-792--------------------------------------------------------------------------------
POLG_HRV2/614-772--------------------------------------------------------------------------------
POLG_HRV1B/627-786--------------------------------------------------------------------------------
POLG_HE701/609-781--------------------------------------------------------------------------------
POLG_HRV14/614-787--------------------------------------------------------------------------------
POLG_CXA9/612-783--------------------------------------------------------------------------------
POLG_CXB4J/612-783--------------------------------------------------------------------------------
POLG_SVDVU/612-782--------------------------------------------------------------------------------
POLG_CXB3N/630-782--------------------------------------------------------------------------------
POLG_POL1M/636-806--------------------------------------------------------------------------------
POLG_CXA21/642-812--------------------------------------------------------------------------------
POLG_CXA24/646-809--------------------------------------------------------------------------------

PF00915

CAPSD_VESVA/137-421--------------------------------------------------------------------------------
POLG_RHDVF/1768-2065--------------------------------------------------------------------------------
CAPSD_FCVUR/112-395--------------------------------------------------------------------------------
CAPSD_NVN68/2-294--------------------------------------------------------------------------------

PF08762

Q8B107_ALPV/599-804--------------------------------------------------------------------------------
O56051_9VIRU/590-790--------------------------------------------------------------------------------
Q56QP7_9VIRU/684-855--------------------------------------------------------------------------------
O36967_9VIRU/668-900--------------------------------------------------------------------------------
Q5UBY1_9VIRU/79-259--------------------------------------------------------------------------------
Q6ITS9_9VIRU/106-313--------------------------------------------------------------------------------
Q4JFT2_9VIRU/834-1009--------------------------------------------------------------------------------

PF00760

CAPSD_CMVFN/11-215---------------ELV-----LHVDIEHQRIPTSGV------------------------------------------

PF01318

CAPSD_BMV/2-188---------------AVV-----VHLEVEHVRPTFDDFFTPVY-------------------------------------

PF03566

Q80IX5_PRVFL/54-754---------------EVVQLANRLQMELTGVYQADDNFAGTVSALASIGLGLLGKSSATPSVIKGIAQQAVGAVQANPGI
CAPSD_NCBVS/1-608---------------VALTVARTWTDLHPFAYPERYNGFGALFAMVAKTIAQIPRYVRSAA...GVANAVTDCIESATES
CAPSD_HASV/2-647---------------EILCLADDLATRLTGVYPATDNFAAAVSAFAANMLSSVLKSEATSSIIKSVGETAVGAAQSGLAK

PF01829

CAPSD_NODAM/42-399---------------YALAAYRKIARDIPIAVACKDN--ATFWERVRSILKSGLNFASTIPGPVGVAATGIKGIIETIGS

PF01766

POLS_IBDVU/9-452---------------LILSERDRLGIKTVWPTREYTDFREYFM---------------------EVADLNSPLKIAGAFG
POLS_DXV96/2-442---------------YILSNREQLGLRSVMTLADYNRMKMYMH---------------------VLTNYHVDEREASSFD
POLS_BSNV/7-428---------------VVLSHRDELGLRSIWSIPQYRDMMSYFR---------------------EVSDRSSPLKIAGAFG
POLS_IPNVJ/5-453---------------MILSHREELDIRTVWRTEEYKERTRAFK---------------------EITDFTSDLPTSKAWG

PF00729

CAPSD_PNLV/47-266---------------PVSP-------------------------------------------------------------
CAPSD_MCMVK/23-222---------------AAI.-------------------------------------------------------------
CAPSD_PMVK/39-236---------------ATS.-------------------------------------------------------------
CAPSD_RCNMV/24-213---------------PQPT-------------------------------------------------------------
CAPSD_CARMS/51-245---------------PTKT-------------------------------------------------------------
CAPSD_SBMVA/46-262---------------PTAL-------------------------------------------------------------
CAPSD_TBSVC/76-269---------------PQPT-------------------------------------------------------------
CAPSD_POLVP/66-257---------------PQPL-------------------------------------------------------------
CAPSD_OCSVU/111-308---------------PQQ.-------------------------------------------------------------
CAPSD_TNVA/61-272---------------PINP-------------------------------------------------------------

PF11729

CAPSD_SJNNV/1-340---------------GAPYYSDQQPRQILLPAGTLFTRVDSEN-------------------------------------

PF00894

CAPSD_PLRV1/70-207---------------P----------------------------------------------------------------
CAPSD_PEMVW/53-187---------------A----------------------------------------------------------------
CAPSD_BYDVP/62-199---------------A----------------------------------------------------------------

PF03014

CAPSD_HEVCH/41-659PARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKVGKTRE-------------------------------------

PF03115

CAPSD_HASV1/1-416------KPALCTGSTPGGMRTRNPVTTTLQFTQMNQPSLGHGE-------------------------------------

PF00983

COAT_TYMV/8-177---------------TL---------------------------------------------------------------

PF02247

POL2_SQMVM/246-618---------------H-------------NPGFEGARLLGISG-------------------------------------
POL2_CPMVS/460-832---------------S-------------NPGIDGSRLLGAIA-------------------------------------
POL2_BPMV/447-819---------------L-------------NPGISGSRLLGTIP-------------------------------------
Q9Z006_9SECO/476-846---------------V-------------SAGYPTTITRIGKG-------------------------------------
O12663_9SECO/321-691---------------V-------------SAGYPTTITRIGKG-------------------------------------
Q9YWK0_9SECO/363-735---------------H-------------NPGFEGARLLGISG-------------------------------------
POL2_CPSMV/437-806---------------V-------------NPGIIGSRLLGAVA-------------------------------------
POL2_RCMV/407-778---------------R-------------NPGIQGARLLGSMQ-------------------------------------
Q9YWJ9_9SECO/452-824---------------H-------------NPGFEGARLLGISG-------------------------------------
Q66170_CPMVS/343-715---------------S-------------NPGIDGSRLLGAIA-------------------------------------

PF03391

CAPSD_TRSV/179-344--------------------------------------------------------------------------------
POL2_RRVS/768-936--------------------------------------------------------------------------------
POL2_BRAV/1268-1433--------------------------------------------------------------------------------
Q65029_ARMV/745-916--------------------------------------------------------------------------------
POL2_ARMVS/792-963--------------------------------------------------------------------------------
Q67703_GFLV/166-336--------------------------------------------------------------------------------
POL2_GFLV/771-941--------------------------------------------------------------------------------
POL2_BRSV/1007-1170--------------------------------------------------------------------------------
POL2_GCMV/981-1144--------------------------------------------------------------------------------
POL2_TORVR/1497-1662--------------------------------------------------------------------------------
Q88483_9SECO/1003-1166--------------------------------------------------------------------------------

PF02443

Q5Y4T0_PCV2/5-226---------------IYD.....QDYN--IRITMYVQFREFNL-------------------------------------
Q27W03_PCV1/5-227---------------ATA.....QNYV--VRLTIYVQFREFIL-------------------------------------
A3FEQ4_9CIRC/3-256---------------NATGDEGKYDIE--AQFTFYIKFGQFTG-------------------------------------
Q3HUU1_GOCV/5-247---------------DTA...SPLTVE--ATITYYIRFGQWTG-------------------------------------
Q1L2D2_9CIRC/1-237---------------PDE.....WAYQ--ANITFYMKFRQFAW-------------------------------------
CAPSD_CACV/7-243---------------PNQ.....MDYQ--VKVTIYCEFRQMNL-------------------------------------
Q0H9S8_9CIRC/4-236---------------HDA.....ILFH--AKVTIYVEFRQMNL-------------------------------------
Q06J73_9CIRC/8-245---------------PAD.....FEMQ--IKATIYVEFRQLNM-------------------------------------
Q9DXG3_BFDV/11-242---------------EQT.....ITYV--TKLTLYVQFRQFAP-------------------------------------
Q69EZ5_BFDV/7-239---------------DKP.....IPYI--CMLTLYVQFRQFAP-------------------------------------
Q9DXG0_BFDV/11-242---------------EIP.....IPYV--CQLTIYVQFRQFAP-------------------------------------
Q9DXF4_BFDV/3-235---------------QTK.....ITYE--CILTIYVQFRQFSP-------------------------------------

PF02956

A7VLZ2_9VIRU/1-506---------------NST-----WELY..STYTFYFKFGGA---------------------------------------
Q9WT88_9VIRU/1-603---------------KNV-----.QLT..LYYNFIFNWGGD---------------------------------------
Q91CY9_9VIRU/1-581---------------KSF-----.SFN..AKYKFSFLWGGN---------------------------------------
A7VLY0_9VIRU/1-515---------------EST-----WELT..YKYIFYFKWGGP---------------------------------------
Q9JGT1_9VIRU/1-585---------------KKV-----.SLG..IKYRFKWVWGGN---------------------------------------
Q80QT8_9VIRU/1-595---------------PGI-----.TLT..ASYKFHFNWGGD---------------------------------------
CAPSD_TTVB1/1-533---------------TKQ-----IEAH..LNYDFLFKWGGS---------------------------------------
A7VM00_9VIRU/1-509---------------EST-----WQCN..YMYTFYFKWGGS---------------------------------------
Q9JG61_9VIRU/1-534---------------QKQ-----IQIH..AFYKFYFKWGGC---------------------------------------
Q91PS3_9VIRU/1-581---------------KSA-----.VLT..AKYKFTFLFGGN---------------------------------------
CAPSD_TTVV4/1-560---------------KMA-----.TLT..SKYNFKFTWGGN---------------------------------------
Q91C93_9VIRU/1-546---------------GTS-----IEGH..MQYKFHFKLGGS---------------------------------------
Q2F827_9VIRU/1-589---------------VMT-----.GIT..AGYKFKFSWGGD---------------------------------------
Q91CY5_9VIRU/1-584---------------ANT-----.TIT..ARYKFRFKWGGN---------------------------------------
Q8V7G9_9VIRU/1-572---------------AGS-----WDIT..VGYKATFKRGGS---------------------------------------
Q99A78_9VIRU/1-584---------------MKV-----.SLG..MKYAFKWVWGGN---------------------------------------
Q6H9C2_9VIRU/1-573---------------KSA-----.VLA..MKYRFHWKWGGN---------------------------------------
CAPSD_TTVT1/1-433---------------TSQ-----IPINIPMYYLSKWQWGGS---------------------------------------
Q9JG80_9VIRU/1-589---------------KNS-----.TLV..CKYKFYFTWGGN---------------------------------------
A7VLZ6_9VIRU/1-506---------------ESN-----WELK..FKYIFHFKWGGP---------------------------------------
Q6H9D2_9VIRU/1-557---------------PSA-----.TLT..TKYKFHFLFGGN---------------------------------------
Q6H999_9VIRU/1-471---------------PGT-----.QLV..MKYCFNFNWGGN---------------------------------------
Q77JT5_9VIRU/1-606---------------RKA-----.VLT..AKYKFRWKWGGN---------------------------------------
Q91PS7_9VIRU/1-585---------------KSV-----.VLT..AKYKFNFLFGGN---------------------------------------
CAPSD_TTVV9/1-555---------------TKS-----LDIT..IGCRFGFRIGGN---------------------------------------
Q9JG47_9VIRU/1-553---------------DVS-----TEFH..MKYKFRFKIGGE---------------------------------------
A7VLW0_9VIRU/1-507---------------NST-----WQCN..YKYTFYFKWGGH---------------------------------------
Q0ZLH9_9VIRU/1-573---------------KNC-----.SLT..MKYKFKFLFGGN---------------------------------------
Q5ENW7_9VIRU/1-501---------------PEP-----TNLW..FQYRFFFQFGGE---------------------------------------
A7VLX2_9VIRU/1-509---------------AST-----WELN..YMFKFYLKWGGP---------------------------------------
Q80AR5_9VIRU/1-594---------------LQA-----.DLT..AGYSFRFNWGGD---------------------------------------
Q91CZ2_9VIRU/1-601---------------KNT-----.TIQ..AKYKFKFKWGGN---------------------------------------
CAPSD_TTVG1/1-514---------------YST-----WELA..THYSFHFKWGGP---------------------------------------
Q98Y63_9VIRU/1-581---------------KSF-----.TIN..TTYKFKFLWGGN---------------------------------------
Q9QU36_9VIRU/1-529---------------DKS-----CEAH..FEYDFRFKIGGC---------------------------------------
A7VM12_9VIRU/1-509---------------NST-----WELK..YHYNFYFKWGGP---------------------------------------
A7VLV6_9VIRU/1-508---------------SST-----WELN..YSYKFYFKWGGP---------------------------------------
Q9JG50_9VIRU/1-535---------------TES-----VQVN..AFYDFFFKWGGC---------------------------------------
A7VLW4_9VIRU/1-507---------------FSN-----WELN..SRYCFYFKWGGP---------------------------------------
A7VM04_9VIRU/1-513---------------NST-----WELD..MFYTFHFKWGWT---------------------------------------
A7VLY4_9VIRU/1-498---------------KST-----WELH..AFYQFYLKWGGT---------------------------------------
CAPSD_TTVD1/1-324---------------VNT-----ELLQIILFYKSHFQWGGE---------------------------------------
Q91CZ6_9VIRU/1-596---------------KNT-----.TIN..AKYKFRFKWGGN---------------------------------------
A7VM08_9VIRU/1-506---------------NST-----WELQ..YFYCFYFKWGGP---------------------------------------
CAPSD_TTVV3/1-573---------------KKA-----.VLG..IKYKFDWKWGGN---------------------------------------
Q91D00_9VIRU/1-593---------------LQV-----.DLA..SPYTFRFNWGGD---------------------------------------
Q99AR5_9VIRU/1-604---------------KNC-----.CLT..AYYNFIFDWGGD---------------------------------------
Q9DTD2_9VIRU/1-559---------------KSA-----.VLG..VKYKFKWIWGGS---------------------------------------
Q91D04_9VIRU/1-591---------------KST-----.VLT..VEYKFKFLWGGN---------------------------------------
CAPSD_TTVV8/1-571---------------KKA-----.VLT..SRYKFKFTWGGN---------------------------------------
Q5ENX0_9VIRU/1-603---------------KNS-----.QLV..AGYTFRFKWGGT---------------------------------------
O90364_9VIRU/1-590---------------KEV-----.SLG..MKYRFKWIWGGN---------------------------------------
Q9IFV0_9VIRU/1-583---------------KSC-----.TLT..AKYRFRFLFGGN---------------------------------------
Q9QUE7_9VIRU/1-586---------------KKA-----.VLG..LKYRFHWIWGGS---------------------------------------
A8DMR2_9VIRU/1-531---------------RIS-----VEAS..MKYKFYFTLGGC---------------------------------------
Q9DUH8_9VIRU/1-609---------------KSV-----.QMP..CKYKFRFKWGGT---------------------------------------
A7VLW8_9VIRU/1-511---------------LST-----WELP..IKYNFTFKWGGP---------------------------------------
Q99AQ3_9VIRU/1-582---------------KNT-----.VLT..AKYRFDFKWGGN---------------------------------------

PF00073

Q9WMA0_9PICO/49-215---------------R.........V---WSELNI---------------------------------------------
POLG_AEVCA/45-212---------------R.........V---WSQLQL---------------------------------------------
POLG_CXA9/93-300---------------I.........P---FVKLDY---------------------------------------------
POLG_CXB3N/93-302---------------I.........P---FVPLDY---------------------------------------------
POLG_CXB4J/93-300---------------I.........P---FAPLDY---------------------------------------------