Sequence alignment for CL0056

PF05966

Q9Q8V7_RFVKA/1-172-----MSLQEN.DVEDSKDE--GAAFI-GSTIY-G--NKLKKKHL----IKKVKCVSILLRVSIVTSIVSLMAITAILA-
Q8V3H7_SWPV1/1-185-----MSVEVNMENVKSEDN--ATSFS-GSTIY-G--NKLKKKTN----KSKSRCLAIGLRIAIITSLLSLIGIATTLA-
Q08FM0_DPV83/7-191-----.TMEEGNDKKDVTET--ANSFV-GSTIY-G--PKLK.KTK----SKKSKWLSICLRVLVISSILSLMAVATTLA-

PF00059

F1M5M2_RAT/203-312------------SRESYDSA--KLYCY.N...L-S--GNLASLTT....SKEVGFVLDEIQK........NTQQRVSPW-
F1RK81_PIG/131-264------------SGENYWDA--AQTCQ.R...V-N--GSLAIFST....DQELRFVLAQEWDQPE..RSFAWQDQHKLW-
F1P2W2_CHICK/678-795------------AKENYDHA--KLSCR.S...S-G--ASLASLTT....QKKVEFVLKELQKMQSSESTVSNSKALTPW-
LYAM3_MOUSE/49-160------------KAYSWNNS--RVFCR.R...H-F--TDLVAIQN....KNEIAHLNDVIP...........FFNSYYW-
ASGR2_HUMAN/194-302------------SGKAWAEA--EKYCQ.L...E-N--AHLVVINS....WEEQKFIVQHT.............NPFNTW-
ASGR1_HUMAN/171-279------------SGKAWADA--DNYCR.L...E-D--AHLVVVTS....WEEQKFVQHHI.............GPVNTW-
SFTPD_RAT/269-374------------SEEPFEDA--KEMCR.Q...A-G--GQLASPRS....ATENAAVQQLVT...........AHSKAAF-
FCER2_HUMAN/180-284------------GTKQWVHA--RYACD.D...M-E--GQLVSIHS....PEEQDFLTKHA.............SHTGSW-
Q9N3W1_CAEEL/37-145------------YQLTYNAS--RNYCHHNNPVG-F--SNLAYVPD....KETSNYLAVYAHSA.......FGSAAENFW-
E4Y143_OIKDI/82-193------------EPKDFQSA--LLFCE.K...Q-K--GTLANFHE....YFNLRIIS................ENDEFY-
E5RY41_TRISP/53-163------------QKRTFQHA--EQECA.K...L-N--AELFFPPS....GKIVLTIP................HSKEFW-
E3LCH6_CAERE/1231-1343------------NVLPVPQA--MKFCA.S...A-G--GYLVDDMD....AGQNEFLNGAA.............AYTQFW-
E3LJN0_CAERE/2714-2811------------SAVTYTKA--VEYCK.E...L-G--AFVPY.......LRIDDILQTQLA...........QRIEKFS-
VGA7_ALHV1/126-224------------KTYSFQNC--FFACKNI...S-K--CFYLYTPQ....NITDPFFDHTL.............RDQDIW-
LYAM1_HUMAN/46-157------------KPMNWQRA--RRFCR.D...N-Y--TDLVAIQN....KAEIEYLEKTLP...........FSRSYYW-
LYAM3_HUMAN/49-160------------KAYSWNIS--RKYCQ.N...R-Y--TDLVAIQN....KNEIDYLNKVLP...........YYSSYYW-
Q9Q8H9_MYXVL/64-168------------IQLSVYGG--AVLCA.N...H-K--ARIPKAN.....FRHLKVISLT..............YGRDFW-
Q6TUP6_YMTV5/64-166------------IQLTDDGA--LSVCD.G...Y-R--AVLPKTN.....SKHLKVISIT..............YGKYFW-
MRC1_HUMAN/1252-1357------------YTRNWGQA--SLECL.R...M-G--SSLVSIES....AAESSFLSYRVEP.........LKSKTNFW-
CLC4F_RAT/429-538------------DKKSWHEA--ENFCV.S...Q-G--AHLASVTS....QEEQAFLVQIT.............NAVDHW-
LECH_CHICK/98-203------------SRMSWHKA--KAECE.E...M-H--SHLIIIDS....YAKQNFVMFRT.............RNERFW-
LYAM2_CANFA/30-141------------EAMTFDEA--STYCQ.Q...R-Y--THLVAIQN....QEEIKYLNSMFT...........YTPTYYW-
MBL2_RAT/140-242------------RRMPLNRA--KALCS.E...L-Q--GTVATPRN....AEENRAIQNV..............AKDVAF-
SFTPA_MOUSE/144-248------------QSVNFDTI--REMCT.R...A-G--GHIAAPRN....PEENEAIASITK...........KYNTYPY-
NKG2D_HUMAN/116-213------------ESKNWYES--QASCM.S...Q-N--ASLLKVYS....KEDQDLLKL...............VKSYHW-
Q8V3H6_SWPV1/63-165------------VKLTIYGA--LSLCN.T...Y-N--AKIPKTN.....FRHLKVMSLT..............YGKQFW-
REG3B_MOUSE/57-173------------IPQTWFDA--ELACQ.K..RP-G--GHLVSVLN....SAEASFLSSMVKR........TGNSYQYTW-
MRC1_HUMAN/966-1081------------ERKNWQEA--RKACI.G...F-G--GNLVSIQN....EKEQAFLTYHMK...........DSTFSAW-
CD72_HUMAN/250-352------------TSKNWQES--QKQCE.T...L-S--SKLATFSEIYPQSHSYYFLNSLLPN.........GGSGNSYW-
C3XRG9_BRAFL/43-156------------ASTDYAGA--EGLCL.K...H-D--GRLIRVMN....IETHEFLLNHILT........CINQSVSFW-
E9GSY7_DAPPU/251-368------------VQHSWERA--ADLCK.R...Y-G--SDLVVVESYQQNNISEKLAQEQLNP........VTHPDAAFW-
MBL1_RAT/134-236------------ERMPFSKV--KALCS.E...L-R--GTVAIPRN....AEENKAIQEV..............AKTSAF-
ASGR2_MOUSE/187-295------------DGLTWAEA--DQYCQ.L...E-N--AHLLVINS....REEQDFVVKHR.............SQFHIW-
SFTPD_BOVIN/264-369------------SEKTFQDA--QQICT.Q...A-G--GQLPSPRS....AAENEALTQLAT...........AQNKAAF-
SFTPD_HUMAN/270-375------------FVKPFTEA--QLLCT.Q...A-G--GQLASPRS....AAENAALQQLVV...........AKNEAAF-
LYAM2_MOUSE/29-140------------ELMTYDEA--SAYCQ.R...D-Y--THLVAIQN....KEEINYLNSNLK...........HSPSYYW-
REG3A_HUMAN/57-173------------SPKSWTDA--DLACQ.K..RP-S--GNLVSVLS....GAEGSFVSSLVKS........IGNSYSYVW-
KLRBA_RAT/111-212------------TSITWKES--LADCG.G...K-G--ATLLLVQD....QEELRFLRNLTK...........RISSSFW-
SFTPA_RABIT/143-247------------QSVNFDAI--REVCA.R...A-G--GRIAVPRS....LEENEAIASIVK...........ERNTYAY-
SFPA2_HUMAN/144-248------------QSITFDAI--QEACA.R...A-G--GRIAVPRN....PEENEAIASFVK...........KYNTYAY-
Q9N3W8_CAEEL/37-145------------QKMTYDDA--HNWCHFKNPVG-F--SYLAYVPD....QVTSNYLAVFARTE.......FGPDAEKFW-
Q06ZZ3_CPRVZ/55-157------------VKMSALNA--QTKCR.S...M-G--GALPG.......TPETDWVSNVLT..........DLSNAPYW-
Q5BK59_RAT/247-352------------TPRSLEES--RKYCT.S...L-S--SKLAVLNEPPRYSLQDSLPDGLKKL.........LDRSKSYW-
MRC1_HUMAN/521-627------------TLSTFAEA--NQTCN.N...E-N--AYLTTIED....RYEQAFLTSFVG..........LRPEKYFW-
CLC87_CAEEL/103-224------------ELLGFAKA--ERNCF.E...K-Q--STLFVANS....IEEWDAIRVQAK............EAFFSW-
MBL2_HUMAN/144-246------------EIMTFEKV--KALCV.K...F-Q--ASVATPRN....AAENGAIQNL..............IKEEAF-
C3XXU7_BRAFL/313-420------------SALTHQDA--TQACS.A...I-G--GRMVDVRD....HQQHQFLADTIA..........ASTGASCW-
MRC1_HUMAN/380-488------------EKKIQRDA--LTTCR.K...E-G--GDLTSIHT....IEELDFIISQLG..........YEPNDELW-
KLRBA_MOUSE/111-212------------VSNTWEEG--LVDCD.G...K-G--ATLMLIQD....QEELRFLLDSIK...........EKYNSFW-
REG3A_RAT/56-172------------TLKSWFQA--DLACQ.K..RP-S--GHLVSILS....GGEASFVSSLVTG........RVNNNQDIW-
O17575_CAEEL/2720-2817------------SAVTFSRA--VEYCE.E...L-D--AFVPY.......LRINDILQSQLA...........QRIEKFS-
B4KGI3_DROMO/50-166------------IKHSWEKS--AELCR.R...Y-G--AELVAIDSYAENNETLAIARASDPN.........QRASDKYW-
SFTPA_CANFA/144-248------------QSINFNDI--QELCA.G...A-G--GQIAAPMS....PEENEAVASIVK...........KYNTYAY-
O62171_CAEEL/239-356------------LPASWSIA--QASCHHK..GN-N--GHLVNEYS....REKHDFVMAILKTY......KEFQPTYKYH-
F6XBY4_XENTR/135-267------------.GENYWDA--VQTCQ.K...V-N--GSLATFTT....DQELKFILAQEWDMEE..RPYGRKDQRRLW-
H2TF65_TAKRU/131-265------------.SENYWQA--VETCQ.K...V-N--GSLATFVT....NEELQFILKIEVDFDD..KVCDRRDQCKFW-
H3CYY2_TETNG/729-839------------..DSYDNA--KLACR.S...H-N--AVLASLTT....QKKVDFVLKELQTVS.....RMYKTAVTPW-
Q8MJ16_BOVIN/792-906------------.RETYDNA--KLSCR.N...H-N--AFLASLTT....QKKVEFVLKQLRIMQS..SQSMSKFTLTPW-

PF01413

T1ID05_RHOPR/1486-1593------------FLFAFHSQ..SEMI.-----P.E--CP.....R----------------------------GTNKLW-
U6HG85_ECHMU/1508-1613------------.LFARHFQS.DEGS.-----F.D--CP.....A----------------------------GTRFLY-
C3YKJ6_BRAFL/595-702------------.LLARHSQ..NTTV.-----P.N--CP.....P----------------------------GMRQLW-
G7Y6J4_CLOSI/1487-1601------------HVFAFHSQ..ADTLE-----P..--CP.....N----------------------------TWKELW-
CO4A1_BOVIN/116-227------------MVMAVHSQ..TIQI.-----P.Q--CP.....T----------------------------GWSSLW-
V8P2H6_OPHHA/592-698------------FIFSRHSQ..STNI.-----P.T--CP.....S----------------------------GTTHIY-
B7Q188_IXOSC/1169-1276------------YFFTRHSQ..TSRV.-----P.Q--CP.....R----------------------------GTYNLW-
G3NKN3_GASAC/350-461------------NVIAVHSQ..TSLV.-----P.D--CP.....S----------------------------GWDALW-
B4KGC9_DROMO/1668-1780------------NVIAVHSQ..SLAI.-----P.N--CP.....N----------------------------GWEGLW-
G3PLA6_GASAC/1558-1669------------NVIAVHSQ..TTLT.-----P.E--CP.....Q----------------------------NWESLW-
M4AMB5_XIPMA/1525-1634------------...PFHSQ..DQAI.-----P.P--CP.....D----------------------------GWKSLW-
E5SK06_TRISP/1694-1805------------QVVALHSQ..TNDI.-----P.R--CP.....R----------------------------GWTGLW-
B3MP84_DROAN/1557-1662------------ILVTRHSQ..SEQI.-----P.T--CS.....P----------------------------GHTPLW-
D6WLB9_TRICA/1645-1756------------RVIAVHSQ..STTI.-----P.Q--CP.....N----------------------------GWDELW-
H1A1E6_TAEGU/68-181------------.PVALHSQ..DQSI.-----P.P--CP.....P----------------------------SWRSLW-
J9JR68_ACYPI/1664-1776------------NVIAVHSQ..ASTI.-----P.D--CP.....N----------------------------GWEGLW-
H2TV78_TAKRU/1005-1117------------.AVVFHSQ..EHTA.-----P.A--CP.....Q----------------------------GWRSLW-
G4V697_SCHMA/1361-1468------------FLFTVHSQ..DSQP.-----P.S--CP.....I----------------------------YTTPIY-
F6XEM0_MACMU/252-366------------QAVAVHSQ..DQSI.-----P.P--CP.....Q----------------------------TWRSLW-
H9JWX6_BOMMO/1602-1711------------RTIAIHSQ..SSEV.-----P.T--CP.....D----------------------------KWKELW-
C3YYN7_BRAFL/329-436------------.LITRHSQ..TIQV.-----P.E--CP.....L----------------------------GTKKMW-
G1KCR9_ANOCA/1458-1564------------FMFSRHSQ..TTKI.-----P.S--CP.....S----------------------------GTVQIY-
E0VEK8_PEDHC/1629-1740------------RVIAVHSQ..SNDI.-----P.N--CP.....N----------------------------GWENLW-
B0WDA5_CULQU/1510-1617------------YIFTKHSQ..TVHI.-----P.D--CP.....L----------------------------NTIKLW-
H2LZX2_ORYLA/1532-1645------------QAVAVHSQ..DMTI.-----P.M--CP.....P----------------------------GWRSLW-
K1R004_CRAGI/72-175------------....RHSQ..TTVV.-----P.Q--CP.....A----------------------------GTAKLW-
U6HLY4_ECHMU/1554-1662------------YLFAVHSQ..KDTP.-----P.S--CP.....E----------------------------FTHELY-
B3S7P7_TRIAD/67-172------------FLLTVHSQ..TDQI.-----P.D--CP.....G----------------------------NRTRLW-
T1GCH0_MEGSC/798-904------------RVIAFHSQ..SMDV.-----P.N--CP.....G----------------------------GWEELW-
C3YYY5_BRAFL/58-187------------TVMAFHSQ..GPDI.-----P.D--CPLPTRDH----------------------------RWESIW-
W5KGN1_ASTMX/1375-1482------------FLFTRHSQ..RQNV.-----P.Q--CP.....S----------------------------GSQLIH-
G4V697_SCHMA/1472-1585------------.LVAFHSQ..RDDIG-----Q.M--CP.....P----------------------------GWENAW-
H0ZD00_TAEGU/698-809------------MVIAVHSQ..TTVV.-----P.A--CP.....D----------------------------GWMSLW-
T1ID48_RHOPR/1487-1592------------NILVKHSQ..TTSV.-----P.D--CG.....S----------------------------GYTKLW-
G1KC91_ANOCA/1562-1676------------QAVAVHSQ..DQSI.-----P.P--CP.....S----------------------------NWRSLW-
M3ZRX3_XIPMA/134-239------------FLFSRHSQ..DSAA.-----P.A--CP.....A----------------------------QSTLIF-
H3AGX1_LATCH/1534-1644------------MVIAVHSQ..TIQV.-----P.L--CP.....L----------------------------GWDSLW-
H3AVQ2_LATCH/1396-1501------------FIMVLHSQ..SEET.-----P.Q--CL.....P----------------------------GMATLW-
I3JUM0_ORENI/1491-1603------------.VVTFHSQ..SHTF.-----P.S--CP.....P----------------------------GWRSLW-
J9EZI1_WUCBA/240-345------------FLLVKHSQ..TTEV.-----P.Q--CP.....Q----------------------------GQQKLW-
F6XFD7_CIOIN/1621-1732------------IAMAVHSQ..DMVI.-----P.P--CP.....D----------------------------GWKGIW-
B0WDA4_CULQU/1453-1558------------ILLVKHSQ..SEEI.-----P.Q--CE.....P----------------------------GHTKLW-
H2TDN6_TAKRU/1497-1608------------NVIAVHSQ..TTQI.-----P.D--CP.....Q----------------------------DWVSLW-
H2TDN6_TAKRU/1387-1494------------FMIARHSQ..SIHI.-----P.V--CP.....C----------------------------GTSLLF-
I3IXK0_ORENI/1447-1554------------FLFTRHSQ..TTDI.-----P.K--CP.....Q----------------------------ETKLIY-
D6WLB9_TRICA/1535-1642------------FFFTRHSQ..SELI.-----P.V--CP.....R----------------------------DTVKLW-
W5KH26_ASTMX/1396-1500------------FLVAFHSQ..SQVV.-----P.S--CP.....L----------------------------NMTEVW-
Q7PVR6_ANOGA/670-777------------YLFARHSQ..KVTI.-----P.E--CP.....I----------------------------NTYKLW-
Q9VMV5_DROME/1516-1623------------FIFARHSQ..SVHV.-----P.Q--CP.....A----------------------------NTNLLW-
G3WDY8_SARHA/1171-1282------------MVIAVHSQ..TTQL.-----P.Y--CP.....Q----------------------------DWDSLW-
C3ZDE0_BRAFL/114-225------------.AMAVHSQ..ELVI.-----P.E--CP.....R----------------------------GWRGLW-
D6WLB7_TRICA/1694-1806------------NVIAVHSQ..SLSL.-----P.D--CP.....H----------------------------GWSSLW-
T1IZ15_STRMM/1635-1746------------HVITVHSQ..TIDI.-----P.E--CP.....N----------------------------DWESLW-
I3LDI9_PIG/153-260------------FVFTRHSQ..TTTI.-----P.S--CP.....E----------------------------GTEPLY-
B7Q188_IXOSC/1279-1390------------QVIAIHSQ..TLEV.-----P.E--CP.....Q----------------------------GWDGIW-
CO4A2_BOVIN/5-110------------YLLVKHSQ..TDQE.-----P.M--CP.....V----------------------------GMNKLW-
M3ZRX3_XIPMA/242-353------------NVIAIHSQ..TSAV.-----P.P--CP.....V----------------------------DWQSLW-
C3ZDE0_BRAFL/5-110------------HLLTRHSQ..TTQI.-----P.Q--CP.....E----------------------------GMPKLW-
E9IRC9_SOLIN/82-187------------ILLVKHSQ..SQSL.-----P.V--CE.....P----------------------------GHIKLW-
F1R5V4_DANRE/1438-1545------------FLFTRHSQ..TTVI.-----P.E--CP.....A----------------------------GSKRLY-
G7Y6J4_CLOSI/1377-1484------------VLFARHYQAPDVMD.-----P.A--CP.....D----------------------------GTNKVF-
F1QW09_DANRE/1446-1550------------FLLVMHSQ..SRYV.-----P.T--CP.....A----------------------------GLTQLW-
M4AJS4_XIPMA/1454-1558------------FLLVKHSQ..SKNE.-----P.T--CP.....P----------------------------NMHPLW-
G4V8A7_SCHMA/2868-2983------------...AFHAQ..ANQLQ-----EVN--CP.....E----------------------------GWARLW-
T1FRZ7_HELRO/1555-1658------------NTIVRHSQ..TEGD.-----P.S--CP.....F----------------------------GLTTLW-
T1FST9_HELRO/1255-1360------------LTIVRHSQ..TMES.-----P.H--CP.....S----------------------------QGRVLW-
E4X7Q9_OIKDI/981-1083------------FVVTRHSQ..STFV.-----P.K--CP.....A----------------------------GSMKLW-
W4YIV2_STRPU/235-345------------QSLAIHSQ..SQEI.-----P.Q--CP.....G----------------------------GWRSLW-
E5SK06_TRISP/1584-1690------------FYFARHSQ..TTAV.-----P.N--CP.....A----------------------------GTTPMW-
K1RH30_CRAGI/1513-1626------------NVIAVHSQ..EMSI.-----P.E--CP.....I----------------------------GWKGLW-
J9EZI1_WUCBA/348-460------------NVIAVHSQ..TIQI.-----P.N--CP.....N----------------------------GWNSLW-
C3YKJ4_BRAFL/2-108------------..LTRHSQ..TDQI.-----P.N--CP.....E----------------------------NMTKVW-
K1RH30_CRAGI/1405-1510------------FLVVRHSQ..TESE.-----P.E--CP.....D----------------------------STSRLW-
H2M087_ORYLA/509-614------------FLITRHSQ..AQEV.-----P.Y--CP.....D----------------------------GTNLIY-
C3YKJ4_BRAFL/112-221------------.VMAVHSQ..RSAVI-----P.D--CP.....V----------------------------GWRSLW-
W4WSD7_ATTCE/1399-1506------------FYFARHSQ..SEMI.-----P.I--CP.....R----------------------------NTVKIW-
T1L4B8_TETUR/1360-1471------------NVMAVHSQ..TEIY.-----P.E--CP.....N----------------------------GWSSLW-
T1EG21_HELRO/620-730------------QPIAIHSQ..ATSV.-----P.D--CP.....R----------------------------GWSNIW-
G4V8A7_SCHMA/1398-1505------------ILFARHYQTPFVDD.-----L.T--CP.....T----------------------------GTNKLF-
T1INC3_STRMM/426-538------------NVIAVHSQ..SLAI.-----P.E--CP.....S----------------------------GWSGLW-
W5MT75_LEPOC/1535-1646------------NLIAVHSQ..TFEI.-----P.K--CP.....N----------------------------GWESVW-
I3IXK0_ORENI/1558-1669------------TVIAIHSQ..TSMI.-----P.T--CP.....T----------------------------NWVSLW-
W5KH26_ASTMX/1504-1616------------.AFAIHSQ..SKEL.-----P.R--CP.....L----------------------------SWKPLW-
U6IF53_HYMMI/1667-1784------------.AYAFHSQ..SNSLD-----DVH--CP.....E----------------------------NWIELW-
F6VJG0_CIOIN/1571-1682------------LTIAVHSQ..SDLI.-----P.D--CP.....E----------------------------NWISLW-
C3Y8Z7_BRAFL/28-134------------.LITIHSQ..TDSL.-----P.A--CL.....D----------------------------HQTTLF-
F1QYN1_DANRE/1552-1664------------.PIAVHSQ..DLTI.-----P.T--CP.....Q----------------------------GWRSLW-
T1IZ15_STRMM/1525-1632------------YFFTRHSQ..TSSG.-----A.I--CP.....S----------------------------GTTLMW-
W4WSD7_ATTCE/1509-1619------------RVIAVHSQ..SMAI.-----P.E--CP.....G----------------------------GWEEIW-
W5L7X5_ASTMX/1573-1684------------MVIAIHSQ..TIQV.-----P.N--CP.....E----------------------------NWEDLW-
A7SQ52_NEMVE/112-223------------HVMAVHSQ..SITV.-----P.S--CP.....S----------------------------GWSPLW-
K1QZZ6_CRAGI/238-349------------EVVAVHSQ..ETRV.-----P.D--CP.....S----------------------------GFRSMW-
T1EG21_HELRO/510-617------------FYFTRHSQ..TTQV.-----P.T--CP.....Q----------------------------GTLKLW-
B0WDA5_CULQU/1620-1730------------RVIAVHSQ..TMAI.-----P.D--CP.....G----------------------------GWEELW-
G4V8A8_SCHMA/1656-1769------------.LYAFHSQ..TLKI.-----P.K--CP.....D----------------------------GWSTLW-
H9KBV4_APIME/1508-1615------------FSFARHSQ..SEMI.-----P.L--CP.....P----------------------------NTIKLW-
W5LJS4_ASTMX/114-218------------FLLVIHSQ..SEVI.-----P.E--CP.....V----------------------------GMPLLW-
Q9VMV5_DROME/1626-1736------------RIIALHSQ..SMSI.-----P.D--CP.....G----------------------------GWEEMW-
B4NRX0_DROSI/205-317------------NVIAVHSQ..TIAV.-----P.D--CP.....N----------------------------GWESLW-
E9IRC9_SOLIN/190-302------------NVIAIHSQ..SISI.-----P.E--CP.....A----------------------------GWTGLW-
E9GYE4_DAPPU/267-374------------FFYTRHSQ..SSRI.-----P.G--CP.....A----------------------------GSQELW-
F1R5V4_DANRE/1548-1656------------NVIAIHSQ..TINI.-----P.Q--CP.....V----------------------------GWLSLW-
E0VEK7_PEDHC/2309-2414------------ILLVRHSQ..STQI.-----P.R--CE.....P----------------------------DHIQLW-
F6VJG0_CIOIN/1461-1568------------YFVTRHSQ..TTYV.-----P.D--CP.....L----------------------------NMRKLW-
K7I6X3_CAEJA/317-428------------QIIAVHSQ..DTSV.-----P.Q--CP.....Q----------------------------GWSGMW-
U6HLY4_ECHMU/1665-1777------------NLVAFHSQ..RPYLE-----E.S--CP.....P----------------------------GWEHAW-
X1WQB7_ACYPI/360-471------------KVIAVHSQ..SMAI.-----P.E--CP.....N----------------------------GWSELW-
A7SQ52_NEMVE/4-109------------FFLTRHSQ..TVRV.-----P.R--CP.....E----------------------------DRPPLW-
F1QW09_DANRE/1554-1665------------.TIAIHSQ..DRLD.-----P.V--CP.....P----------------------------KWRSLW-
C3XSD7_BRAFL/244-353------------.LITIHSQ..TQDY.-----P.Q--CL.....P----------------------------GLNPLL-
G6DMY2_DANPL/1689-1794------------ILLVRHSQ..TNIV.-----P.Q--CE.....P----------------------------GHIKLW-
H9KBV4_APIME/1618-1728------------RAIAVHSQ..TMAI.-----P.Q--CP.....G----------------------------GWEELW-
F1QYN1_DANRE/1443-1548------------YTLVKHSQ..STRV.-----P.M--CP.....E----------------------------GMTRLW-
CO4A1_BOVIN/6-113------------FLVTRHSQ..TTDD.-----P.Q--CP.....P----------------------------GTKILY-
H3AVQ2_LATCH/1504-1618------------QVIAIHSQ..SEND.-----P.N--CP.....E----------------------------DWLSLW-
W4YIV2_STRPU/127-232------------HFITRHSQ..SRNV.-----P.S--CP.....A----------------------------GTVELW-
W5MT75_LEPOC/1425-1532------------FIFTRHSQ..SKLI.-----P.P--CP.....E----------------------------RSERLY-
E0VEK8_PEDHC/1519-1626------------FFFTVHSQ..TDEV.-----P.P--CP.....Q----------------------------DTTVLW-
F6XFD7_CIOIN/1513-1618------------HLIVRHSQ..TVYI.-----P.E--CP.....A----------------------------GMTKLW-
C3YYX1_BRAFL/102-217------------TVMAFHSQ..GSNI.-----P.D--CPLPTREH----------------------------SWQSIW-
B4NRX0_DROSI/97-202------------ILITRHSQ..SETV.-----P.A--CS.....A----------------------------GHTELW-
I3IXM4_ORENI/1411-1514------------.LLVVHSQ..SANT.-----P.R--CP.....G----------------------------NMNTLW-
T1L4B8_TETUR/1252-1357------------ILLVRHSQ..DIKP.-----P.T--CP.....K----------------------------NMEKLW-
T1FST9_HELRO/1364-1474------------.AMAIHSQ..TRNV.-----P.D--CP.....P----------------------------GWSSLW-
B3S7P5_TRIAD/1401-1510------------..AAFHSQ..TSTA.-----P.S--CP.....N----------------------------GWQQLW-
T1FRZ7_HELRO/1662-1772------------NVLTVHSQ..DITE.-----P.R--CP.....L----------------------------GWKALW-
U6HG85_ECHMU/1616-1731------------HVFAFHSQ..IRSLT-----P..--CP.....S----------------------------TWTELW-
F6XEM0_MACMU/144-249------------FLLVLHSQ..TDQE.-----P.T--CP.....L----------------------------GMPRLW-
H2RQC6_TAKRU/392-502------------..IAVHSQ..MSNQ.-----P.E--CP.....P----------------------------SWRSLW-
C3YYN7_BRAFL/439-564------------MVMAVHSQ..APTI.-----P.D--CP.....M----------------------------GWMNVW-
T1INC3_STRMM/318-423------------ILLVKHSQ..TSEI.-----P.M--CP.....N----------------------------NHVKMW-
Q7PVR6_ANOGA/780-890------------RVMALHSQ..SMSI.-----P.D--CP.....E----------------------------GWEELW-
G7Y6J5_CLOSI/1648-1763------------...AFHAQ..ANQLQ-----EVY--CP.....N----------------------------GWTELW-
W5KGN1_ASTMX/1485-1596------------NVIAVHSQ..TISV.-----P.D--CP.....S----------------------------GWEPLW-
E9GYE4_DAPPU/377-488------------HVIAVHSQ..SMEI.-----P.D--CP.....A----------------------------GWQELW-
G4V8A7_SCHMA/2756-2862------------YLFTRHFQ..NPDTE-----P.V--CP.....P----------------------------GSQKIS-
G3PLB8_GASAC/1546-1658------------.AVAFHSQ..DFKV.-----P.A--CP.....P----------------------------GWRSLW-
F6TRQ1_ORNAN/140-245------------STLVKHSQ..SEQV.-----P.P--CP.....T----------------------------GMALLW-
K7I6X3_CAEJA/207-314------------FTFAKHSQ..TTAV.-----P.Q--CP.....P----------------------------GASQLW-
M4AMB5_XIPMA/1415-1519------------FLLVIHSQ..SVQV.-----P.E--CP.....A----------------------------GSSQLW-
C3YKJ6_BRAFL/706-819------------.VLALHSL..DADFY-----P.D--CP.....P----------------------------GYISLW-
G3PLA6_GASAC/1448-1555------------FLIARHSQ..STKV.-----P.D--CP.....R----------------------------GTTLIF-
I3JUK2_ORENI/1430-1537------------FLIVRHSQ..SIHP.-----P.K--CP.....H----------------------------GTCFIY-
C3ZDD7_BRAFL/4-111------------FIFARHSQ..TTQL.-----P.E--CP.....R----------------------------YTSKMM-
H9JWX6_BOMMO/1492-1599------------FYFTVHSQ..TRLI.-----P.K--CP.....S----------------------------GTSPLW-
B3S7P5_TRIAD/1291-1396------------DVMAIHSQ..STTV.-----P.Q--CP.....S----------------------------PFTTLW-
G6DMY2_DANPL/1797-1909------------NVIAVHSQ..TLDI.-----P.S--CP.....V----------------------------GWNSLW-
K7IPX3_NASVI/1375-1482------------FYFARHSQ..SAMI.-----P.V--CP.....R----------------------------NTVKMW-
H0VSI7_CAVPO/1423-1530------------FLITRHSQ..TVDA.-----P.Q--CP.....Q----------------------------GTVQIS-
G3NH33_GASAC/256-367------------VAIAVHSQ..DITI.-----P.Q--CP.....A----------------------------GWRSMW-
B3S7P7_TRIAD/175-288------------NSIALHSQ..SQTP.-----P.S--CP.....S----------------------------GYELLW-
X1WQB7_ACYPI/250-357------------NFFTYHSQ..TDII.-----P.A--CP.....K----------------------------NTVQLW-
T1ID48_RHOPR/1595-1706------------SVIAVHSQ..SNNI.-----P.D--CP.....N----------------------------GWQSLW-
T1ID05_RHOPR/1596-1706------------RLLAMHSQ..AMSF.-----P.E--CP.....E----------------------------GWEELW-
W5MTA0_LEPOC/1446-1550------------FLIVVHSQ..TEKI.-----P.E--CP.....M----------------------------GMNQMW-
G3NKK3_GASAC/1416-1520------------FLLVLHSQ..SNAI.-----P.S--CP.....V----------------------------DMRVLW-
G3NKN3_GASAC/240-347------------FMFTRHSQ..NLLV.-----P.E--CP.....A----------------------------GSAELY-
C3ZDD7_BRAFL/114-224------------QVLAIHSQ..ALTI.-----P.P--CP.....N----------------------------GWSSLW-
C3Y818_BRAFL/251-355------------ILTVIHSQ..TKDI.-----P.E--CP.....C----------------------------GLTEVY-
CO4A2_BOVIN/113-225------------VAIAVHSQ..DVSI.-----P.H--CP.....A----------------------------GWRSLW-
F1PHG6_CANFA/1571-1684------------QAIAVHSQ..DITI.-----P.Q--CP.....L----------------------------GWHSLW-
G3NKK3_GASAC/1525-1637------------..VTLHSQ..TANQ.-----P.D--CP.....P----------------------------DWRSLW-
I3LDI9_PIG/263-374------------IAIAIHSQ..TTEI.-----P.S--CP.....Q----------------------------GWISLW-
G4V8A8_SCHMA/1546-1652------------HLFTVHSQ..TARI.-----P.S--CP.....S----------------------------STRKLW-
T1GCH0_MEGSC/688-795------------FVFTVHSQ..TVEV.-----P.E--CP.....R----------------------------NSVKMW-
C3ZSP6_BRAFL/193-300------------.LLVRHSQ..TINI.-----P.Q--CP.....L----------------------------GTTVMW-

PF00193

F7EKW5_ORNAN/2173-2265GVFHLQSSA.GKYNLTYSEA--ASRCA.A---Q-G..AQLASLSQ-----------------------------LSAAQQ
H2V249_TAKRU/245-334KVFFLQQSE....GMNLTEA--QQACQ.E---N-S..AEVARVGQ-----------------------------LYAAWK
H3C6Z8_TETNG/32-122RVFLVEGER..RHFLNFDMA--QKMCE.Q---L-N..TTLASPEQ-----------------------------AREAYY
M4AF12_XIPMA/277-366IVYHLNYPR....RLNFTEA--AHACA.R---D-G..GRVAKVGQ-----------------------------LYAAWK
H2UTV0_TAKRU/465-559VLFHYRPIT.GRYTLSFVEA--QQACR.D---I-G..AVIASPPQ-----------------------------LQAAFE
H9H0Q3_MELGA/103-198EIFLETAPD....KFTLEEA--VARCR.A---Q-G..AVLASTGQ-----------------------------LYAAWS
E7EYE0_DANRE/2154-2245.VFHYRSTN.GTYKLNYTMA--QEACK.E---A-G..STIATYMQ-----------------------------LSYAQQ
H3BAD0_LATCH/584-679EVFLAVTEE....KLTLAGA--HEYCQ.K---Q-N..AVLASTGQ-----------------------------LHSAWN
H2L317_ORYLA/231-326RVFFTTSVE....KFTVSEA--ALACS.R---H-G..AQLATTGQ-----------------------------LYIAWQ
H9H1H3_MELGA/121-215VVFPYQPIN.GRYRFNYHEA--KRACE.Q---Q-D..ARLATYQQ-----------------------------LYKAWM
F6YUQ6_XENTR/161-255VIFPYHTRL.GRYSMNFHQA--LQACK.E---Q-D..GILASYDQ-----------------------------LHEAWL
M4AP18_XIPMA/155-249VVFHYRANS.SRYSLDFRKA--KEACM.S---V-N..ASMATADQ-----------------------------LTAAFQ
H3D6N5_TETNG/90-184VIFHYRAPH.DRYGLTFADA--KRVCL.E---N-S..AVMATPGQ-----------------------------LQATFA
R4GBT0_ANOCA/33-126KLFAVGPRN.GTQSLDLAMA--QQSCA.A---F-G..AYLASAEE-----------------------------LKKAIR
F6TXD5_ORNAN/240-323ELFLGAPPQ....KLTLAEA--RRYCR.A---R-G..AAIATTGQ-----------------------------LFAAWS
C3Y1K4_BRAFL/989-1073........Q.GQYNLTFRAA--EAECN.K---F-D..ARVAQWED-----------------------------LLHAWD
W5K9E6_ASTMX/11-100GVFHASLSA..GYAFNASSA--RELCE.H---L-G..VAIADKAQ-----------------------------VIRAST
M3ZEZ9_XIPMA/32-120GVFLVEGES..RYYLTFEMA--MKVCE.Q---L-E..STMASPAQ-----------------------------VQEAYN
F6RUD0_XENTR/42-130..LAESSDH..KYKFNFTRA--ESVCH.V---L-G..LQLASKNQ-----------------------------VEKANK
G3PSB5_GASAC/251-347EVFYPSSVN...AKLTLQEA--RDKCE.R---H-G..AVLASPGQ-----------------------------LFAAWR
A7SD47_NEMVE/72-164NVFNAAASV..KYVIKFNEA--NRLCQ.V---F-G..ARLATIAQ-----------------------------VDKAWK
W5L2D8_ASTMX/166-260VVFPYYSPR.GRYQLTFQEA--KEVCE.Q---Q-G..ACLATFEQ-----------------------------LFAAWE
Q6PID9_HUMAN/153-247IVFHYRAIS.TRYTLDFDRA--QRACL.Q---N-S..AIIATPEQ-----------------------------LQAAYE
H2S086_TAKRU/390-483VVFPYFPPS.GRYNLNFTKA--TQACL.E---Q-D..AVIASHNQ-----------------------------LLKAWR
C3Y1K4_BRAFL/449-534..FLYPARG..SPAVTFDQA--ESVCS.A---V-G..ARVASWED-----------------------------LRDTWL
M3Y9K7_MUSPF/34-128VVFPYFPRL.GRYNLNFHEA--QQACL.D---Q-D..AVIASFDQ-----------------------------LYDAWR
H3CYG5_TETNG/270-358RVFFLKHPA....KLNFSEA--VRACA.S---Q-Q..SQVAKVGQ-----------------------------VYAAWK
G3P7B0_GASAC/113-206VVFPYSPSV.GRYNLNYVEA--TKACL.H---Q-N..ASVANLDQ-----------------------------LRQAWK
W5PN42_SHEEP/45-129.....TKKT..QPLLNFTEA--QQACR.L---V-G..LTLASQDQ-----------------------------VEEARK
I3KB63_ORENI/6-96GVFRAEGND..RHSLDFGMA--EKVCE.Q---Q-K..STIATREQ-----------------------------VEEAYN
F6PXC5_XENTR/501-595VVFHYRAAS.SRYSLNFTEA--KQACL.D---N-N..AIIASPAQ-----------------------------LQAAYE
I3KEY5_ORENI/519-614VVFFTTDYG....RFSYEEA--VHHCE.K---L-N..ATLATPGE-----------------------------LYAAWN
U3IUX8_ANAPL/519-613VVFHYRAAT.SRYALSFVQA--QQACL.Q---N-N..AVIATPEQ-----------------------------LQAAYE
F1QR32_DANRE/150-244VVFHYSGPA.EHYSLSFWEA--SRACE.Q---N-S..AVMASAEQ-----------------------------LWAAFH
H2S086_TAKRU/182-272TFYWLVQPD....SLTFAEA--VQACL.D---D-G..AQIAKVGH-----------------------------IFSAWK
W5M456_LEPOC/19-112RVFIVESKS.GSEGLDAEAA--QRACD.S---E-G..GRLASVED-----------------------------LRQAVA
H3A5H2_LATCH/51-143GVYHRESRA.GRYQLTFKEA--KAVCE.F---E-G..GHLATRSQ-----------------------------LAAAQK
E7FBG3_DANRE/75-163GVFHVQGKE..RYSLTFDDA--QRLCE.R---L-S..TTLANLTQ-----------------------------VKTAFN
C3ZUC3_BRAFL/5-93NIFHLRSPK.GKYMYDLDEA--RQACA.E---T-G..AVLASSAQ-----------------------------LHRAWQ
H3A6L9_LATCH/10-102GVFHYDRHT..RYGLTFPEA--KAACEWD---F-G..AVISSRDQ-----------------------------LYAAYK
I3JV73_ORENI/216-308EVFHSSVPG....RLSLSSA--SDRCV.S---L-G..GQLATVGQ-----------------------------LYLAWR
Q86W61_HUMAN/251-346DVFHLTVPS....KFTFEEA--AKECE.N---Q-D..ARLATVGE-----------------------------LQAAWR
E1BUN0_CHICK/268-356EVFYLEHPT....RMTLEEA--KQACQ.D---A-G..AEIAKVGH-----------------------------LYSAWK
F1Q4Q0_DANRE/249-344NVFFAPTLQ....KMTFDEA--KAVCE.S---N-N..AELASPGQ-----------------------------LHAAWR
W5KSF4_ASTMX/2192-2284GVFHYRSPL.GVYKLNYTQA--QESCQ.Q---E-G..GTIATYVQ-----------------------------LSYAQQ
Q6PID9_HUMAN/478-572VVFHYRPGP.TRYSLTFEEA--QQACL.R---T-G..AVIASPEQ-----------------------------LQAAYE
H3AUC6_LATCH/32-120GVFHVERNG..RYNLTSQEA--AELCQ.S---L-N..TSLATMQQ-----------------------------LEKSLT
H3CE81_TETNG/233-328SVFHTTSAE....KFTFSEA--VVACS.K---R-G..AQLANTGQ-----------------------------LYLAWQ
F1N2Y8_BOVIN/163-257VVFHYRAAL.DRYSLTFAEA--QEACL.L---N-S..ATIAAPRH-----------------------------LQAAFE
H2MXA1_ORYLA/38-130GVYHRESRK.GRYQLTFIEA--KAVCD.Y---E-G..GKLATYEQ-----------------------------LEAARQ
F6QGU9_XENTR/2171-2263GVFHLRSSK.GVYKYNYSEA--MKACN.D---E-T..ATIATYNQ-----------------------------LSYAQQ
H2M1W8_ORYLA/238-327EFYWLSNHN....NLTFNEA--VQACL.R---K-D..AEIAKVGH-----------------------------MFAAWK
H2L7V4_ORYLA/456-550VVFHYRPIT.GRYTLTFMEA--QQACR.N---I-G..AVIASPQQ-----------------------------LQEAYE
H2V249_TAKRU/143-237VVFPYQHPR.GRYRLNFLGA--QQACE.E---Q-G..AALATLTQ-----------------------------LFQSWK
V8P6B4_OPHHA/1137-1229GVFHIRSAK.GQYKLTFADA--NKTCE.D---E-S..ATVATYTQ-----------------------------LLYAQK
F1R511_DANRE/142-233RVFYSMSVE....KFTFADA--EDQCA.K---L-G..AQLATTGQ-----------------------------LYLAWK
H2S2Y1_TAKRU/183-278KVYYSPVRH....KMTFEEA--SKECL.K---E-N..AVLANPGQ-----------------------------LHAAWR
H0ZUW2_TAEGU/54-148VIFPYHPRL.GRYTLNFREA--QQACL.Q---Q-D..GILASHEQ-----------------------------LHQAWL
G3NJP2_GASAC/150-244VVFHYRDAL.GRYAFSFHRA--QSACE.A---I-G..AQIATPDQ-----------------------------LLAAYY
W5NA53_LEPOC/559-654EVFHVSSPG....GLTYDEA--MSSCV.E---Q-N..ATLASTAE-----------------------------LYAAWK
M4A2R4_XIPMA/143-237VVFPYSPHR.GRYNLNFDEA--VRSCE.S---Q-D..AIIASFDQ-----------------------------LLKAWK
R0LX51_ANAPL/4-97KVFALESKN.NSQGLDLAEA--DKACV.A---V-N..AHLATAEE-----------------------------LKRAVV
I3K6I5_ORENI/169-263VVFPYQHPR.GRYHLSFLGA--QQACK.E---Q-D..STVATVTQ-----------------------------LFQSWK
G3PXC4_GASAC/265-353KVYYLQSS.....KMNLTDA--QQACQ.E---D-G..AQVAKVGQ-----------------------------LYAAWK
F1MKY3_BOVIN/32-125KLFVLESQN.GSQGLALEAA--RLSCR.S---R-G..AHLVSADE-----------------------------LRRVVQ
H3CYG5_TETNG/171-263VVFPYHSRK.GRYRLSFFGA--RQACE.D---Q-D..AGLATPEQ-----------------------------LQAAWQ
A7RGE0_NEMVE/165-256KVFYLSGEK..SRLLNFTEA--ERMCQ.F---R-H..GHMASREQ-----------------------------LTEAWK
W5NA53_LEPOC/458-552VVFHYRPIS.SRYSLTFIEA--QLACQ.K---I-G..AIIASPEQ-----------------------------LQAAYE
G3NVP1_GASAC/175-269VVFPYYSPR.GRYRFNFFEA--QQACQ.D---Q-E..ATLATFEQ-----------------------------LFSAWE
U3IX07_ANAPL/2191-2283GVFHLRSPQ.GQYKMTYEKA--KEACA.N---E-S..ATIATYNQ-----------------------------LLYAQK
U3JRF4_FICAL/33-126KVFALESKN.NSQGLYLAEA--EKACV.D---L-S..ARLATAEE-----------------------------LKTAVL
W5M859_LEPOC/38-125..VYLYSVG..QYSFNVTEA--RSACE.S---L-G..VTIATKSQ-----------------------------VSKARQ
C3Y1K4_BRAFL/25-116QVFLAESSD.GQYGIDFWTA--DNFCTQN---Y-GNLVKTATFDN-----------------------------LKLTWE
H2M1W8_ORYLA/137-231VVFPYSPHG.GRYSLNFEHA--EKACA.D---Q-G..AVVASFEQ-----------------------------LYEAWE
I3IZ94_ORENI/167-260VVFPYQSKD.GRYRFNYQEA--KEACA.T---Q-D..GTLATYSQ-----------------------------LYRAWT
E1BUN0_CHICK/167-261IVFPYQPPR.GQYSLNFHEA--ERVCQ.E---Q-G..SLIATFHQ-----------------------------LFQAWS
I3JZL7_ORENI/18-112VVFHYRANS.SRYSLNYSEA--MEACH.S---V-D..ASIATPEQ-----------------------------LTAAFE
G3U8V2_LOXAF/163-264VVFPYHPRG.GRYKLTFAEA--QRACA.E---Q-D..GILASAEQ-----------------------------LHAAWR
Q1LXE1_DANRE/141-235VVFPYSPRL.GRYNLNFQNA--VAACQ.E---Q-D..AVVASFEQ-----------------------------LYGEWK
F6PXV1_XENTR/200-294VVYPYQPPH.GRYQLNFHDA--KKACE.D---Q-D..AMMASFEQ-----------------------------LFKAWE
C3ZUI3_BRAFL/586-672GIFPQRSPA.GTYKYNFDEA--RQACA.E---K-G..ATLASYKQ-----------------------------LEDAWK
W5M1S0_LEPOC/221-316EVFFTPALS....KVTLKEA--EEECA.T---K-G..AVLASTGH-----------------------------LHSAWR
H3CE81_TETNG/549-644EVFHLGSAE....GFTYDRA--AASCH.E---Q-G..AVLASTGE-----------------------------LYAAWK
H2UTV0_TAKRU/255-350RVFYSMSVE....KFSFYEA--KDQCA.K---L-G..ARLATTGE-----------------------------LYLAWK
V8P5V5_OPHHA/237-332EVFYATSAE....KFTFSEA--AEKCH.S---L-G..ARLATTGE-----------------------------LYLAWK
I3ML99_SPETR/46-129......KKV..HRQMNFTEA--KEACR.L---L-G..LTLASKDQ-----------------------------VEAAWK
E7F6T0_DANRE/33-122GVFHIEGIS..RYSLTFQKA--GELCQ.S---L-G..YRLATQEQ-----------------------------VTEAYK
TSG6_RABIT/36-128GVYHREARS.GKYKLTYAEA--KAVCE.F---E-G..GRLATYKQ-----------------------------LEAARK
W5NA53_LEPOC/255-350RVFYSTSLE....KFSFAEA--EEQCM.K---L-G..ATLATTGQ-----------------------------LYLAWQ
Q6PID9_HUMAN/254-349EVFYATSPE....KFTFQEA--ANECR.R---L-G..ARLATTGQ-----------------------------LYLAWQ
W5LHH4_ASTMX/148-241VVFPYQSSR.GRYKLNYNDA--KEACE.K---Q-D..GTLATYMQ-----------------------------LYKAWT
H3A9N1_LATCH/268-362EVFSNSTPE....KFTLEEA--KRFCE.E---Q-G..AEIATTGQ-----------------------------LYAAWN
V8P5V5_OPHHA/497-591VVFHYRPST.NRYSLTFVEA--QQACL.N---N-H..AVIATPEQ-----------------------------LQAAYE
M3YNU2_MUSPF/32-125KLFVLESQN.GSQGLELEVA--QLSCK.S---R-G..AHLVSAEE-----------------------------LRTVVQ
I3JJ27_ORENI/627-722EVFHIGSAE....GFTYSEA--VRSCQ.E---Q-N..ATAASTGH-----------------------------LYAAWK
F6QHJ0_ORNAN/2-95KLFTLEPGN.GSQGLDLPAA--RASCG.S---V-G..ARLATAEE-----------------------------LRRAVL
H2UTP0_TAKRU/161-255VVFPYHSKK.GRYHFNYFGA--GQACQ.D---Q-D..ASLATPEQ-----------------------------LLTAWE
I3KG10_ORENI/253-348EVFYAPVTH....KMTFEEA--SEECK.K---R-K..AVLASPGQ-----------------------------LHAAWR
W5LE59_ASTMX/41-129GVFYVQGDK..RHSLNFTEA--EELCK.V---L-G..ATLASAEQ-----------------------------LNASHA
U3J8X0_ANAPL/250-345EVVHVSVPE....KLTFEEA--KELCR.K---R-D..GVLASVGN-----------------------------LYVAWR
H2L7U2_ORYLA/280-369NVYFLKDQK....KLNFTQA--VQACV.R---D-G..SQIAKVGH-----------------------------LYAAWK
H0V051_CAVPO/262-357EVFYVGPPR....RLTLAGA--RAQCR.R---Q-G..AKLASVGQ-----------------------------LHLAWH
F6PXN1_XENTR/157-251VVFHYRAST.DKYTLDFEAA--QKACI.D---N-G..AQIATPGQ-----------------------------LRAAYE
H0ZII5_TAEGU/32-120GVFHVEKNG..RYSLTRSEA--VELCR.A---L-N..STLATLEQ-----------------------------LKKAHE
W5NCW4_LEPOC/2171-2263GVFHLRSPR.GPYKLNYAES--QESCR.K---Q-E..ATVATYTQ-----------------------------LSYAQQ
I3KG10_ORENI/152-246VVFHYRSSI.SRYTLDYQKA--VQTCE.N---V-G..ANIATYEQ-----------------------------LKAAYE
F6TIG3_CIOIN/20-106EVFPVGGRG..QYALNYWQA--RAKCA.S---L-G..ASLASIQE-----------------------------LDQARL
W5MB73_LEPOC/260-350KVYFLKRHK....KLSYAEA--VKACQ.R---D-G..STIAKAGQ-----------------------------LYAAWK
W5KJN6_ASTMX/458-552VVFHYKVSA.SRYSLTFAEA--QLACQ.N---I-G..AVIASPQQ-----------------------------LHSAYE
H2L317_ORYLA/130-224VVFHYRSFM.GRYALTFEEA--KTTCS.Q---N-S..AAIASPEQ-----------------------------LQAAYD
G3PBZ4_GASAC/32-121GVFLVQGAT..RHSLNFEAA--RNVCV.Q---L-E..SVLASEAQ-----------------------------VKKAYD
H3B5H7_LATCH/153-247VVFHYRAST.NRYNMNFSRA--RHACL.E---N-G..ATLATSAQ-----------------------------LRAAYE
F8W252_DANRE/560-655EIFHVSSLA....GFTYYEA--VAHCR.K---L-S..STLASTGE-----------------------------LYAAWN
Q6PID9_HUMAN/579-674EVFFATRLE....QFTFQEA--LEFCE.S---H-N..ATLATTGQ-----------------------------LYAAWS
H0V0Q4_CAVPO/2172-2264GVFHVRSPL.GQYKLTFDTA--RATCA.S---E-A..ATVATYNQ-----------------------------LSYAQK
F6QZI7_MONDO/42-134.LFVLESWN.GSQGLDLAVA--QASCA.A---S-G..AHLATAVE-----------------------------LRRAVL
F7A729_XENTR/115-208VVFPYQSSG.GRYKFNYVEA--RQACE.E---Q-D..GRLATYSQ-----------------------------LYQSWT
HPLN3_MOUSE/267-356RVYYLENPK....KLTLLEA--REACQ.E---D-G..AQISTVGQ-----------------------------LFAAWK
H2YC92_CIOSA/35-121EVFPLSGRG..LYTLNYWQA--RAKCA.A---V-G..ASLATVQD-----------------------------LDDARL
K7EA70_ORNAN/119-214EVFYVSHPR....RLTLSGA--RAHCQ.S---Q-G..ATLATVGQ-----------------------------LYLAWQ
M3Y9K7_MUSPF/135-225RFYYLIHPT....KLTYEEA--VQACL.N---D-G..AQIAKVGQ-----------------------------IFAAWK
L9KBI4_TUPCH/149-242VVFPYQPSR.GRYQFNYYEA--KQACE.E---Q-D..GRLATYGQ-----------------------------LYQAWT
Q86W61_HUMAN/150-244VVFHYRAAT.SRYTLNFEAA--QKACL.D---V-G..AVIATPEQ-----------------------------LFAAYE
F7ATS6_XENTR/4-99EVFLSSTPD....KFTLHEA--KDYCK.R---L-G..TSIATTGQ-----------------------------LYAAWS
F6UCQ1_XENTR/163-257LVFHYRAAS.NRYALTFPEA--VRSCQ.E---N-S..GVIASPEQ-----------------------------LQAAFE
G1KI55_ANOCA/52-134.......KN..QANFNFTEA--QQVCR.Q---L-D..LMLAHNSE-----------------------------VEKAWK
F8W252_DANRE/459-553VVFHYRAES.GRYAYTYEEA--QDACQ.K---L-G..AVIATPEL-----------------------------LQAAYE
H3BB99_LATCH/271-361KVYYLRHPD....KLQYQEA--EQACR.E---D-G..AEIAKVGQ-----------------------------LFAAWK
H9GJW7_ANOCA/562-657EVFFATQLE....QFTLLEA--QEYCE.S---Q-N..ATLASAGQ-----------------------------LYAAWK
I3KG12_ORENI/112-205AVFPYSPPS.GRYNLNFQDA--VQACE.D---Q-E..AVIASHEQ-----------------------------LLAAWK
H3D620_TETNG/265-360EVFHGSAPQ....GLTFREA--TAFCR.S---H-G..AEVATAAQ-----------------------------LYAAWS
H3D7T0_TETNG/183-278EVFYPPLST....KLTLQQA--KDECH.K---H-D..SVIASTGQ-----------------------------LFAAWR
H2VEJ2_TAKRU/83-177IVFPYFPRL.GRYNLNFHDA--ERACR.D---Q-D..ATVASFDQ-----------------------------LYEAWQ
W5KBY4_ASTMX/2208-2300GVFHLRSPA.GKYKMNYTTA--EAACR.A---E-E..ATLATLSQ-----------------------------LSDAQQ
F6PXV1_XENTR/301-390KVYYLEYPE....RMTFAEA--KAACQ.D---D-G..AQIAKVGQ-----------------------------LFAAWK
W5LZK3_LEPOC/33-122GVFHIEQRG..RYFLTYPEA--EKLCL.S---M-G..TVLASRED-----------------------------VNRAYS
H3BGU3_LATCH/2206-2298GVFHLQSPK.GKYQFTYEDA--QRACE.A---E-G..ASLATFKQ-----------------------------LSDAQQ
F6UCQ1_XENTR/264-357DVYYVPEKS......TLLEA--SNSCL.R---D-G..GMLAKVGQ-----------------------------LYSAWR
G3PXC4_GASAC/164-258VVFPYQHPG.GHYHLSFPAA--QQACE.E---Q-D..STLATFPQ-----------------------------LLRSWK
G5AR83_HETGA/94-188VVFLYREGS.ARYAFSFAGA--REACA.R---I-G..ARIATPEQ-----------------------------LYAAYL
F6RL05_MONDO/2173-2265GVFHLQAPE.GKYRLTFGEA--EKQCL.A---Q-G..AELASLDQ-----------------------------LSAAQQ
V8NUK1_OPHHA/265-360DVFHVTSPD....KVTFKEA--QTLCE.E---Q-E..AVLASVGD-----------------------------LHAAWR
H2MZH4_ORYLA/2159-2251GVFHLSSPE.GKYKMNFSQA--NTACQ.A---E-G..ATLATYKQ-----------------------------LADAQQ
H2UTV0_TAKRU/154-248IVFHYRAIT.SRYTLTFEKA--KAACI.Q---N-S..ATIATPAQ-----------------------------LQAAYD
F1QVB2_DANRE/169-263VVFPYYSSK.GRYLMNYHEA--KEACE.K---Q-D..AHLATFEQ-----------------------------LFAAWE
G3UW60_MOUSE/36-128.LFMLGSQN.GSQGLDLEAA--RLSCR.S---R-G..AHLVSAAE-----------------------------LKRVVR
W5L2C8_ASTMX/556-651EVFHVSTLA....GFTYYEA--AAHCH.R---Q-N..ATMASPGE-----------------------------LYAAWS
G3PSB5_GASAC/150-244VVFHYRANA.SRYTMNLHAA--MDACR.S---A-G..ADIATPDH-----------------------------LAAAFE
F7GLT0_MONDO/2208-2299.VFHLRSPR.GQYKLSFDEA--KEMCT.K---E-E..ATVATYIQ-----------------------------LSYAQK
K7EA70_ORNAN/18-112VVFHYRAAS.NRYTLSFPAA--QDACR.R---S-S..AVIATPGH-----------------------------LQAAFE
W5MB73_LEPOC/159-253VVFPYHPRL.GRYKMNFHEA--QEVCG.Q---Q-D..AILASYGQ-----------------------------LHAAWL
M3WN53_FELCA/2207-2299GVFHLQAPS.GPYGLNFSEA--KAACG.A---Q-G..AVLASLPQ-----------------------------LSAAQK
H3CE81_TETNG/132-226LVFHYRAIM.GRYSLTFEKA--TAACA.Q---N-S..AVVASAEQ-----------------------------LQAAFD
W5KJN9_ASTMX/170-264VVFPYQPHR.GRYHMSFAAA--RRACE.E---Q-D..AAVATFQQ-----------------------------LYAAWR
C3Y1K4_BRAFL/161-249GVFLYPAMS.ADSAVNFWSA--AKTCE.A---V-G..ARLARWQD-----------------------------LTEQWA
F1R6C2_DANRE/4-93.VFLIQTKT.STYSFDAITA--KEACE.A---I-K..MRIAKKTE-----------------------------VETANK
G3HQN1_CRIGR/1449-1541GVFHLRSPL.GQYKLTFDKA--KEACA.N---E-A..ASMATYNQ-----------------------------LSYAQK
W5KJN9_ASTMX/271-360RVYFLLHPQ....RLNFSEA--VQACI.T---D-G..GEIATVGQ-----------------------------MFAAWR
D3ZWH1_RAT/2209-2301GVFHIQATS.GPYGLTFSEA--KEACE.D---Q-G..ADLASLPQ-----------------------------LSAAQQ
H3D6N5_TETNG/191-286EVFHSAVPE....KLSLATA--STHCR.S---L-G..AQLATVGQ-----------------------------LYLAWQ
M4AV85_XIPMA/521-615VVFHYRSPT.GRYALTFVEA--QLACQ.G---V-R..GSMATPQQ-----------------------------LQRAYE
W5KNW0_ASTMX/239-323......IDQ....KMTFTEA--EQACQ.N---D-G..AELAKTGH-----------------------------MYAAWK
H2UTV0_TAKRU/566-661QVFFTSDYD....SFSYDEA--VQHCL.N---L-N..TTLATTAQ-----------------------------IYAAWS
H2UD03_TAKRU/255-349VVFHDSVPR....KLSFDDA--QAYCR.T---A-G..AELASTAQ-----------------------------LYLAWR
H9G9P6_ANOCA/239-335ELFVVSSPQ....RFSWPEG--QEACQ.A---L-G..ASVATTGQ-----------------------------LYAAWS
H2L7V4_ORYLA/557-652EVFFASDYD....SFSYEEA--VQHCQ.S---L-N..STLATPGQ-----------------------------LYAAWK
H3D620_TETNG/164-258VVFHHRDAA.QRYAFTFQRA--RAACQ.A---I-G..AQMASPQQ-----------------------------LLAAYH
H0YCV9_HUMAN/11-98GVFHVEKNG..RYSISRTEA--ADLCK.A---F-N..STLPTMAQ-----------------------------MEKALS
H3A9N1_LATCH/167-261VVFLYRDAL.TRYAFTFEKA--QWACA.G---I-G..ASIATPEQ-----------------------------LLAAYH
U3IUX8_ANAPL/620-715EVFFATQPE....QFTFQEA--QQYCE.S---Q-N..ATLASVGQ-----------------------------LHAAWK
M3XGZ3_LATCH/42-127....VSSGK..NYNLSYLAA--SSACQ.A---M-G..ISLATKRQ-----------------------------IEIAHS
H2TWG7_TAKRU/1997-2088.VFHHRSDN.GQYKLNYTAA--QQACS.A---H-G..GTMATYNQ-----------------------------LYYAQQ
H3AR94_LATCH/2141-2232GVFHLQSPK.GRYKFTYSEA--QEACK.K---E-G..AIVATYNQ-----------------------------LSSAQM
G1KG37_ANOCA/2217-2309GVFHLQSPK.GKYSFTYQDA--EASCG.A---E-G..ATVATLQQ-----------------------------LSAAQQ
F6PXC5_XENTR/602-697EVFFATQPD....QFTFQEA--KEFCD.G---Q-N..ASLASTGQ-----------------------------LYMAWR
W5KML6_ASTMX/146-240VVFHYRTNT.SRYNLDFEGA--GRACR.D---V-G..ATIATADQ-----------------------------LTAAFE
H2L317_ORYLA/587-681EVFHLESAD....GLTYDQA--VLSCQ.E---H-G..GILASTGE-----------------------------LYAAWK
H3D7T0_TETNG/82-176VVFHYRDKA.SRYSLDFLGA--VLACQ.A---A-G..AAIATPEQ-----------------------------LRTAFE
W5K8P3_ASTMX/43-127.....KKKK..SNSFNATTA--SEVCR.S---L-S..VRIATKTE-----------------------------VESALA
W5LMV1_ASTMX/2-91RVFLLELRN.GSNG.GYEEA--SQACE.A---Q-D..ARLASGME-----------------------------LRHAVV
M3VUP6_FELCA/45-129.....NKKT..TQQLNFTEA--QEACR.L---M-G..LTLASKDQ-----------------------------IEAAWR
W5MZE9_LEPOC/36-128GVFHYDRNI..RYNLTFQEA--KEACEKD---F-A..ASLADRMQ-----------------------------LFTAYQ
I3IZ90_ORENI/163-257VVFHYRDAS.SRYAFTFEQA--KEACE.D---I-G..ADIATPEQ-----------------------------LLAAYN
W5M1S0_LEPOC/120-214VVFHYRASS.SRYTLTFEQA--KQTCK.D---V-G..ATIASVEQ-----------------------------LNAAYE
F6PXN1_XENTR/258-352DLFHTTANK....KFTFEEA--KQECE.K---K-N..AALATVGD-----------------------------LYAAWR
G3NVP1_GASAC/277-366TVYYLKQQT....KLNFTDA--SKACV.G---D-G..GRIATVGH-----------------------------LYAAWR
F6PZ03_XENTR/37-125GVFHVEKYD..RYALNREDA--IKLCH.E---L-N..TTIANLTL-----------------------------MEIAQD
A2CF10_DANRE/147-240VVFPYQSQK.GRYRFTFFDA--KEACA.E---Q-D..ATLATYKQ-----------------------------LYRAWT
G1KL45_ANOCA/151-245VVFHYRAST.SRYTLNFQQA--EEACL.E---N-G..AVIASPEQ-----------------------------LTAAYE
F1QVB2_DANRE/270-359EVYFLQHPI....KLNFSEA--VEACQ.T---D-G..GHIAKVGQ-----------------------------LYAAWR
V8P471_OPHHA/222-316VVFPYQSPH.GRYKLNFHEA--KKICE.D---Q-D..AVIASFDQ-----------------------------LFEAWL
G1KCR2_ANOCA/32-120GVFHVEKNH..RYSLTREDA--IALCK.A---L-N..STIPTLEQ-----------------------------MRKAYN
W5MN99_LEPOC/159-253LVFPYQSQE.GRYRFVLREA--REACE.R---Q-D..ARLATYPQ-----------------------------LYRAWT
I3JZL7_ORENI/119-215EVFYPTSIS...SKFTWQQA--REECE.K---H-D..AVLASPGH-----------------------------LFAAWR
I3IZ90_ORENI/264-359EVFHGSTPQ....RFTFGEA--KAYCL.S---H-G..AELATTAQ-----------------------------LYAAWN
H3B5H7_LATCH/254-349EVFHVTSSG....KLTFEEA--KRACE.D---K-G..SVLANTGQ-----------------------------LHAAWR
H9GPN6_ANOCA/261-356RVFYASSPG....RMTFPMA--QKYCL.S---R-G..AQLATTGQ-----------------------------LYLAWK
G3UPK3_MELGA/183-278KVFYATAPG....RFTLLGA--QRHCR.G---R-G..AALATTGQ-----------------------------LYLAWR
I3JV73_ORENI/115-209VVFHYRSPS.ARYALSLSDA--QRACQ.E---N-S..AQIATPAQ-----------------------------LWAAYH
W5L2C8_ASTMX/455-549VVFHYHSGS.RRYAYTFEEA--QRTCQ.Q---M-G..AEIATPEQ-----------------------------LQAAYE
H2S2Y1_TAKRU/82-176VVFHYRTNA.SRYNLDYQGA--VQTCQ.D---I-G..ATIATFEQ-----------------------------LKAAYE
H2S086_TAKRU/82-175VVFPYHLRM.GRYNMNFTNA--VRACL.E---Q-D..AVVASSDQ-----------------------------LLDAWR
W5NA55_LEPOC/169-263VVFPYQPVM.GRYQLNFVGA--ERACE.G---Q-D..ASLATFEQ-----------------------------LFSAWE
G3NIT0_GASAC/1023-1115GVFHLRSPD.GKYKMNFSQA--DAACR.A---E-G..AALATFKQ-----------------------------LGDAQQ
G3UPK3_MELGA/82-176VVFHYRPAG.ARYALTFAAA--RRACM.D---N-S..AIIASPQH-----------------------------LQAAFE
W5KML6_ASTMX/247-341EVFYGSRAG.....LTLQEA--VGVCE.R---L-G..AVLASPGQ-----------------------------LFAAWR
H3D621_TETNG/129-221VVFPYQSKN.GRYKLSYEEA--RRACV.E---Q-D..GTLASQEQ-----------------------------LYRAWT
U3K2S4_FICAL/2229-2321GVFHLQSPQ.RKYDFTYEQA--QAACA.A---E-G..ASLATFQQ-----------------------------LGAAQQ
W5KJN6_ASTMX/559-654KVFIVNSFE....GFTYDEA--VASCQ.G---Q-N..ASLASTAD-----------------------------LHAAWK
I3KUU2_ORENI/263-358EVFHDFIPQ....HLTFNEA--QSYCR.A---A-G..AELATTAQ-----------------------------LYLAWS
G1KSH3_ANOCA/2201-2293GVFHVRSRK.GQYKLTFSQA--NKTCA.D---E-G..ATIATYAQ-----------------------------LVYAQK
H2MVR1_ORYLA/2188-2279.VFHVRSKA.GQYKLTYAAA--QQVCI.I---E-G..GSLATLSQ-----------------------------LHHAQQ
F1QR32_DANRE/251-342EVFSSSVPD....KLTHAEA--AAHCE.S---L-D..ARLASVGQ-----------------------------LFLAWR
H3CE81_TETNG/448-542VVFHYRSGS.SRYAFTYVEA--QQACQ.S---A-G..ASIATPEQ-----------------------------LQAAYE
H0UZZ3_CAVPO/256-351ELFLGAPPD....KLTLEEA--QEYCR.E---R-G..AEIATTGQ-----------------------------LYAAWD
C3ZYF8_BRAFL/3-96NIFHLRSPK.GKYMYDLDEA--RQACA.E---T-G..AALASSAQ-----------------------------LHRAWQ
H3BAD0_LATCH/483-577VVFHYRAAS.SRYSLTFAEA--VQACL.E---N-N..AAIATPQQ-----------------------------LQAAYE
G3T4I8_LOXAF/263-353RVYYLEHPE....KLTLTEA--KAACQ.E---D-G..AQIAKVGQ-----------------------------LFAAWK
E9QHN0_DANRE/150-244VVFHYRANT.SRYSLNFTRA--QQACA.D---V-D..SSIATPEQ-----------------------------LYSAYE
G3U8V2_LOXAF/271-361RVFFLKPLR....PVPFAGA--ARACA.A---R-G..AAVAKVGQ-----------------------------LFAAWK
L5LVH7_MYODS/44-129....LTKKT..NVQLNFTEA--KEACE.L---M-G..LTFASKDQ-----------------------------VEAAWK
G7PQQ7_MACFA/47-129.......KA..NPQLNFTEA--KEACR.L---L-G..LTLASKDQ-----------------------------VETAWK
E7F537_DANRE/496-591VVFHYRGGNCSRYPFGFVEA--QLACK.S---I-G..AVIASAQQ-----------------------------LQAAYE
W5MX80_LEPOC/2209-2300GVFHLRSTA.GKYKLNYTEA--KAACQ.A---E-G..ATLATFSQ-----------------------------MSAAQQ
H0ZUW2_TAEGU/155-245KVYFLKTFR....KLSYPEA--VQACE.K---N-G..AAVAKVGQ-----------------------------LYAAWK
G3P4E1_GASAC/27-116GVFLLIEGG..EYTFDSGAA--EAACR.I---L-N..VAIATRAQ-----------------------------VERAQR
M4AV85_XIPMA/622-716EVFHVGSAE....GFTYDEA--ASACE.N---H-S..AVLASTGE-----------------------------LYAAWK
I3KEY0_ORENI/273-362TVYFLENTT....NLNFTDA--IQACA.S---D-G..SQIAKVGQ-----------------------------LYAAWK
G3Q0U6_GASAC/146-239VVFPYQSGS.GRYRLTFHEA--EEACA.Q---Q-D..ATLASFGQ-----------------------------LYRAWT
H2UD03_TAKRU/154-248VVFHYRDDS.GRYELSFSQA--QEACE.A---V-G..AQIASPEQ-----------------------------LLAAFH
G3T4I8_LOXAF/162-256VVFPYQPPQ.GRYQLNFHEA--QQACE.E---Q-D..AVLASFEQ-----------------------------LFRAWE

PF03440

TOX3_BORPE/31-117PGI--VIPPK----------------------------------------------------------------------
TOX2_BORPE/30-116PGI--VIPPQ----------------------------------------------------------------------
A0KFE5_AERHH/24-105AEP--VYPDQ----------------------------------------------------------------------

PF07979

EAE_ECO27/839-939PNSL.IVPNM----------------------------------------------------------------------
Q846P2_ECOLX/838-938PSSM.I.VSI----------------------------------------------------------------------
Q9S6R2_ECOLX/838-939PGSIVIAVDK----------------------------------------------------------------------
Q8KRL2_ECOLX/838-937PQEI.VSLDK----------------------------------------------------------------------
O06896_ECOLX/839-940PDKIVIAVDK----------------------------------------------------------------------
Q8KRK8_ECOLX/838-938PKKI.VSVNS----------------------------------------------------------------------
A0A024Z842_ECOLX/840-935PNYM.IRVGN----------------------------------------------------------------------
Q9LBG6_ECOLX/835-936PDNIIIAVDK----------------------------------------------------------------------
E7UB01_ECOLX/838-937PQEI.VSLDN----------------------------------------------------------------------
Q9R8B4_ECOLX/839-934PSYM.IKVDK----------------------------------------------------------------------
INVA_YEREN/735-833PNLW.VFSGT----------------------------------------------------------------------
Q8RSS9_ECOLX/842-948PEKI.ITVET----------------------------------------------------------------------
Q8KRL0_ECOLX/839-939PNSL.IVPNM----------------------------------------------------------------------
Q8KRL1_ECOLX/842-948PENI.ITVET----------------------------------------------------------------------

PF05473

A5A7J2_9ALPH/19-219TATVDAQAPPLPTKTVPVFAPPLSTPPQPNELV-Y--TKRRRTKRKAKCRC.....................LFFTMGMF
G9I267_HHV2/4-171RASGPAYQPLAP.....................-A--ASPARARV..PAVA...........................WI
O89243_9ALPH/3-191SPTPEDDPRLGPVRGLLRM...........MDE-T--TS.ERHKR.SRSGC......................PRLLCGC
O56871_ILTV/33-274TPSEDQRSHLEKMMAELPFEVRAILEDEPSVCS-S--TSSSTTSTYSPHPSGELHSMRPENTGGQYWKACKVILLILLGI
EV45_GAHVM/3-192SPTPEDDRDLVVVRGRLRM...........MDN-G--AEHDRERR.SYTAW......................PHLCCGC
Q5Y0Q7_9ALPH/5-173APERLGYRPLAP....................G-G--RLAAPGRL..PAAA...........................WL
D3YPA9_HHV1/4-171RASEHAYRPLGP.....................-G--TPPMRARL..PAAA...........................WV
EV45_EHV4/19-218TAAGNDQAPQLPTKTVLGFTPPLPTLPQPTELV-Y--TKRRRPKRRSRCRC.....................LCFTMGMF
EV45_MEHVH/3-193SPTPEDDRDLVVVRGRLRM...........MDS-G--TETDREQRHPRTTW......................RSICCGC
Q66077_9ALPH/2-174AQLVLTDIPLEDVEN............KNTSSD-E--ETTNLNQKKSTCQC.....................LCVTLGFF
Q69365_FHV1/7-189TSQPLVEIPLVDMEPQPSIHSNEPNPPNKMLTT-A--ISSRRSGI...........................FLFSLGMF

PF05966

Q9Q8V7_RFVKA/1-172-LQ-----------------CSTCDVVKTSAHISSSINQYE..............SECKGIVFDSACYTLHKEPKTFYEA
Q8V3H7_SWPV1/1-185-LQ-----------------YNKCKSVIE..HNEQSYNNQDNITPDANYNIVKLYTGCQGIVYEYYCLRLVYEPLSFDDA
Q08FM0_DPV83/7-191-LQ-----------------YSKCKAEYDSITNKQSLDSYSLVTPDKLDPRFEC.KECQGIMFDGDCYQFNTEHKTFSEA

PF00059

F1M5M2_RAT/203-312-VG-----------------L......RKINISYWGWEDMSPFTNTSL-------........QWL........PGEPND
F1RK81_PIG/131-264-VG-----------------YQY.VFTGRNSSLEGHWEVAFKGSPEVL-------LPPDPGLAAA..........ASDNN
F1P2W2_CHICK/678-795-VG-----------------L......RKINVSYWCWEDMSPFTNTLL-------........QWL........PDEPSD
LYAM3_MOUSE/49-160-IG-----------------I.......RKINNKWTWVGTNKTLTEE.-------......AENWAD.....NEPNNKKN
ASGR2_HUMAN/194-302-IG-----------------L.......TDSDGSWKWVDGTDYRHN..-------......YKNWAVTQPDNWHGHELGG
ASGR1_HUMAN/171-279-MG-----------------L.......HDQNGPWKWVDGTDYETG..-------......FKNWRPEQPDDWYGHGLGG
SFTPD_RAT/269-374-LS-----------------M.....TDVGTEGKFTYPTGEALV....-------......YSNWAP.....GEPNNNGG
FCER2_HUMAN/180-284-IG-----------------L.....RNLDLKGEFIWVDGSHVD....-------......YSNWAP.....GEPTSRSQ
Q9N3W1_CAEEL/37-145-IG-----------------L.....SRDPVSKSLSWDNGFPVTYTNF-------.....G..............SHVGK
E4Y143_OIKDI/82-193-LD-----------------V......LSDSTGQLITSDGTFLDLPIL-------....................HNSTE
E5RY41_TRISP/53-163-ID-----------------T........TLRKNPVWINNPRLDPVQR-------LYLWPKRLALK.......EDGKNSS
E3LCH6_CAERE/1231-1343-IG-----------------L......YRNNDGQFVWDRGTGVTPAPL-------SQTETYWADN.........EPSNDP
E3LJN0_CAERE/2714-2811-ID-----------------MI....TDQERLKAYGVEDDIHLWIS..-------....................SVNIP
VGA7_ALHV1/126-224-IG-----------------T.....FFKKLNAALSTIDNNFDYT...-------....................AWDEL
LYAM1_HUMAN/46-157-IG-----------------I.......RKIGGIWTWVGTNKSLTEE.-------......AENWGD.....GEPNNKKN
LYAM3_HUMAN/49-160-IG-----------------I.......RKNNKTWTWVGTKKALTNE.-------......AENWAD.....NEPNNKRN
Q9Q8H9_MYXVL/64-168-VS-----------------L........TKQKDGRWIDINTNKTVNM-------DSSRELAEIKK........KNTGAT
Q6TUP6_YMTV5/64-166-VG-----------------L.........KKKNNRWFDSSTNETVDM-------NSNVYLTKIK.........GKYDNE
MRC1_HUMAN/1252-1357-IG-----------------L......FRNVEGTWLWINNSPVSFVNW-------N...TG..............DPSGE
CLC4F_RAT/429-538-IG-----------------L.....TDQGTEGNWRWVDGTPFDYVQS-------......RRFWRKGQ.PDNWRHGNGE
LECH_CHICK/98-203-IG-----------------L.....TDENQEGEWQWVDGTDTRSS..-------......FTFWKE.....GEPNNRGF
LYAM2_CANFA/30-141-IG-----------------I.......RKVNKKWTWIGTQKLLTEE.-------......AKNWAP.....GEPNNKQN
MBL2_RAT/140-242-LG-----------------I.....TDQRTENVFEDLTGNRVR....-------......YTNWNE.....GEPNNVGS
SFTPA_MOUSE/144-248-LG-----------------V.....IEGQTPGDFHYLDGASVN....-------......YTNWYP.....GEP.RGRG
NKG2D_HUMAN/116-213-MG-----------------L.....VHIPTNGSWQWEDGSILSPNLL-------.....T..............IIEMQ
Q8V3H6_SWPV1/63-165-VS-----------------L.........SKQGNSWIDININKTVDM-------SNSIELTKIR.........NSNNNK
REG3B_MOUSE/57-173-IG-----------------LHDPTLGAEPNGGGWEWSNNDVMN....-------......YFNWER......NPSTALD
MRC1_HUMAN/966-1081-TG-----------------L.....NDVNSEHTFLWTDGRGVH....-------......YTNWGKGYPGGRRSSLSYE
CD72_HUMAN/250-352-TG-----------------L........SSNKDWKLTDDTQRT....-------....................RTYAQ
C3XRG9_BRAFL/43-156-IG-----------------L.....EDRLNEAVFVYSDGSTLGSFNR-------FYGGVD..............VANED
E9GSY7_DAPPU/251-368-LG-----------------L.....MSLDDLSTNTLEAASGSLVQQY-------......AGFWQ.......VDQPDAR
MBL1_RAT/134-236-LG-----------------I.....TDEVTEGQFMYVTGGRLT....-------......YSNWKK.....DEPNDHGS
ASGR2_MOUSE/187-295-IG-----------------L.......TDRDGSWKWVDGTDYRSN..-------......YRNWAFTQPDNWQGHEQGG
SFTPD_BOVIN/264-369-LS-----------------M.....SDTRKEGTFIYPTGEPLV....-------......YSNWAP.....QEPNNDGG
SFTPD_HUMAN/270-375-LS-----------------M.....TDSKTEGKFTYPTGESLV....-------......YSNWAP.....GEPNDDGG
LYAM2_MOUSE/29-140-IG-----------------I.......RKVNNVWIWVGTGKPLTEE.-------......AQNWAP.....GEPNNKQR
REG3A_HUMAN/57-173-IG-----------------LHDPTQGTEPNGEGWEWSSSDVMN....-------......YFAWER......NPSTISS
KLRBA_RAT/111-212-IG-----------------L.....SYTLSDENWKWINGSTLNSDVL-------S....I..............TGDTE
SFTPA_RABIT/143-247-LG-----------------L.....AEGPTAGDFYYLDGDPVN....-------......YTNWYP.....GEP.RGQG
SFPA2_HUMAN/144-248-VG-----------------L.....TEGPSPGDFRYSDGTPVN....-------......YTNWYR.....GEP.AGRG
Q9N3W8_CAEEL/37-145-IG-----------------L.....HRNGSSGLLEWDNMRPVVHTNF-------.....G..............NNVTK
Q06ZZ3_CPRVZ/55-157-IK-----------------Y.......SYKFDGLIWRDIYTNVTVRS-------LSMTVRSR............GDIHK
Q5BK59_RAT/247-352-IE-----------------Q.........MSHTVYYPQNMKNMKGRR-------....................SDSHS
MRC1_HUMAN/521-627-TG-----------------L.....SDIQTKGTFQWTIEEEVR....-------......FTHWN........SDMPGR
CLC87_CAEEL/103-224-IG-----------------LVR.FTHYEKLEQLPRWQTEGALNPTKI-------NWLIKPYKPL.........FNGWSS
MBL2_HUMAN/144-246-LG-----------------I.....TDEKTEGQFVDLTGNRLT....-------......YTNWNE.....GEPNNAGS
C3XXU7_BRAFL/313-420-LA-----------------M.......KTAPVSIVYSDGTPVLGGAL-------EWSAGE..............PWYPV
MRC1_HUMAN/380-488-IG-----------------L.....NDIKIQMYFEWSDGTPVT....-------......FTKWLRG....EPSHENNR
KLRBA_MOUSE/111-212-IG-----------------L.....RYTLPDMNWKWINGSTLNSDVL-------K....I..............TDDTE
REG3A_RAT/56-172-IW-----------------LHDPTMGQQPNGGGWEWSNSDVLN....-------......YLNWDG......DPSSTVN
O17575_CAEEL/2720-2817-ID-----------------LR....TDQERLKPYGMDDDIPVWIS..-------....................AVNIP
B4KGI3_DROMO/50-166-LG-----------------L.....ASLDDLRTNTLESASGALISQY-------......SGFWS.......LQQPNAE
SFTPA_CANFA/144-248-LG-----------------L.....VESPDSGDFQYMDGAPVN....-------......YTNWYP.....GEP.RGRG
O62171_CAEEL/239-356-IG-----------------L.......NGNCSLWKWDQASGEEQVQL-------QG..WQ..............IWAPD
F6XBY4_XENTR/135-267-VG-----------------YQF.VITSRNHSMEGHWEVAYKGSAEVF-------LPPVPIFGTA..........MSDNE
H2TF65_TAKRU/131-265-VG-----------------YQY.VITNQNHSLEGRWEVAYQGSMQVF-------LPPEGLT.NFG.......EASPTQD
H3CYY2_TETNG/729-839-VG-----------------L......RKINVSYWCWEDMSPFTNTSL-------........QWL........PGEPSD
Q8MJ16_BOVIN/792-906-VG-----------------L......RKINVSYWCWEDMSPFTNSSL-------........QWM........PSEPSD

PF01413

T1ID05_RHOPR/1486-1593-NG-----------------YSLLSVVGDQ.QAFTMDLGTPGSCLRYF----------------------------STMP
U6HG85_ECHMU/1508-1613-DG-----------------YSYLMGGGVD.YLYSMDLGSASSCMRRF----------------------------NTHP
C3YKJ6_BRAFL/595-702-SG-----------------FSLLHVEGNE.RAHKQDLGRAGSCLPRF----------------------------STIP
G7Y6J4_CLOSI/1487-1601-NG-----------------VSLILHT.SGKHGGGQQLSSPGSCMEQF----------------------------RYSP
CO4A1_BOVIN/116-227-IG-----------------YSFVMHTSAGAEGSGQALASPGSCLEEF----------------------------RSAP
V8P2H6_OPHHA/592-698-SG-----------------YSLLFVQGNE.QAHGQDLGTTGSCLSRF----------------------------TTMP
B7Q188_IXOSC/1169-1276-EG-----------------YSLLYILGDE.KAHGQDLGTAGSCLRRF----------------------------STMP
G3NKN3_GASAC/350-461-FG-----------------YSFVMETGVGAEGSGQPLASPGSCLENF----------------------------RKIP
B4KGC9_DROMO/1668-1780-IG-----------------YSFLMHTAVGNGGGGQALQSPGSCLEDF----------------------------RATP
G3PLA6_GASAC/1558-1669-TG-----------------YSFVMQTGAGAEGSSQPLVSPGSCLESF----------------------------RQVP
M4AMB5_XIPMA/1525-1634-TG-----------------YSFLLHTGAGDEGGGQSLASSGSCLRDF----------------------------RTHP
E5SK06_TRISP/1694-1805-TG-----------------YSFIMHTAAGAEGTGQNLQSPGSCLESF----------------------------RTLP
B3MP84_DROAN/1557-1662-TG-----------------YSLLYIDGND.FGHNQDLGSPGSCVPRF----------------------------STLP
D6WLB9_TRICA/1645-1756-AG-----------------YSFLMHVDAGAEGSGQSLVSPGSCLEEF----------------------------RPKP
H1A1E6_TAEGU/68-181-IG-----------------YSFLMHTGSGDQGGGQSLMSPGSCLEDF----------------------------RSAP
J9JR68_ACYPI/1664-1776-IG-----------------YSFVMHTAAGAEGGGQSLASPGSCLEDF----------------------------RATP
H2TV78_TAKRU/1005-1117-TG-----------------YSFLMHTGAGDEGSGQALTSSGSCLKNF----------------------------QTHP
G4V697_SCHMA/1361-1468-TG-----------------YSLVTLQGND.DSTTMDLGTPGSCLRKF----------------------------SIMP
F6XEM0_MACMU/252-366-IG-----------------YSFLMHTGAGDQGGGQALMSPGSCLEDF----------------------------RAAP
H9JWX6_BOMMO/1602-1711-VG-----------------YSFLMHT.AGADASGQSLISPGSCLREF----------------------------RTRP
C3YYN7_BRAFL/329-436-EG-----------------YSLLHMEGNE.RAHGQDLGMSGSCLPKF----------------------------SPMP
G1KCR9_ANOCA/1458-1564-SG-----------------YSLLFVQGNE.QSHGQDLGTVGSCLQRF----------------------------TTMP
E0VEK8_PEDHC/1629-1740-IG-----------------YSFLMHTASGADGSGQSLISPGSCLLEF----------------------------RPTP
B0WDA5_CULQU/1510-1617-DG-----------------YSLVSVIGSS.RSVGQDLGSAGSCMRKF----------------------------STMP
H2LZX2_ORYLA/1532-1645-IG-----------------YSFLMHTAAGAEGGGQSLMSPGSCLEDF----------------------------RATP
K1R004_CRAGI/72-175-DG-----------------FSLVHVIGNG.RSHGQDLGTSGSCLRRF----------------------------STMP
U6HLY4_ECHMU/1554-1662-TG-----------------YSLVTLQGDD.DSISMDLGSPSSCTRVF----------------------------SIMP
B3S7P7_TRIAD/67-172-IG-----------------YSFLSMTGKS.KHSGQDLSSAGSCLRAF----------------------------STDP
T1GCH0_MEGSC/798-904-LG-----------------YSYYMTTMES.GGFGQDLVSPGSCLSEF----------------------------RPSP
C3YYY5_BRAFL/58-187-EG-----------------FSFFMHTAAG.EGSGQIFSSPGSCLERF----------------------------RPAP
W5KGN1_ASTMX/1375-1482-SG-----------------YSLLFINGNN.QGHGQDLGTLGSCLQRF----------------------------STMP
G4V697_SCHMA/1472-1585-NG-----------------FSFPMAIGSSSNGGVQPLESPGSCLQHF----------------------------RALP
H0ZD00_TAEGU/698-809-KG-----------------FSFVMYTSAGSEASGQALASPGSCLEEF----------------------------RAVP
T1ID48_RHOPR/1487-1592-EG-----------------YSLLHVDGNH.MSQIQDLGEAGSCVRKF----------------------------STIP
G1KC91_ANOCA/1562-1676-IG-----------------YSFLMHTGSGDQGGGQSLMSTGSCLEDF----------------------------RSAP
M3ZRX3_XIPMA/134-239-RG-----------------YSLLFINGYS.RAHGQDLGTVGSCLQRF----------------------------STAP
H3AGX1_LATCH/1534-1644-IG-----------------YSFMMVRKLA.ENYSEAIAALRSCVHKF----------------------------KMAY
H3AVQ2_LATCH/1396-1501-TG-----------------FSLLNLEGQE.KAHIQDLGLAGSCLPVF----------------------------STMP
I3JUM0_ORENI/1491-1603-VG-----------------YSFLLHTGAGNNGGGQSLASTGSCLKDF----------------------------RTHP
J9EZI1_WUCBA/240-345-DG-----------------YSLLYIEGNE.KSHNQDLGHAGSCLTRF----------------------------STMP
F6XFD7_CIOIN/1621-1732-LG-----------------YSFAMHTAAGAEGGGQSLSSPGSCLQDF----------------------------RATP
B0WDA4_CULQU/1453-1558-DG-----------------YSLLYVDGND.YPHNQDLGSAGSCVRKF----------------------------STLP
H2TDN6_TAKRU/1497-1608-SG-----------------YSFVMQTGIGADGSSQPLISPGSCLETF----------------------------RKVP
H2TDN6_TAKRU/1387-1494-SG-----------------YSFLFMHAND.RVHGQDLGTPGSCLPHF----------------------------STMP
I3IXK0_ORENI/1447-1554-EG-----------------YSLLFINGNS.RAHGQDLGTLGSCLRRF----------------------------TTMP
D6WLB9_TRICA/1535-1642-DG-----------------YSLLHIMGND.KAMGQDLGTPASCLRRF----------------------------NTMP
W5KH26_ASTMX/1396-1500-QG-----------------YSLLYLEGQE.KAHTQDLGQAGSCMRIF----------------------------STMP
Q7PVR6_ANOGA/670-777-DG-----------------YSLVNVIASS.RSVGQDLGAAGSCLRRF----------------------------STMP
Q9VMV5_DROME/1516-1623-EG-----------------YSLSGNVAAS.RAVGQDLGQSGSCMMRF----------------------------TTMP
G3WDY8_SARHA/1171-1282-TG-----------------YSFMMHTSAGAEGAGQTLASPGSCLEEF----------------------------RPAP
C3ZDE0_BRAFL/114-225-IG-----------------YSFLMHTAAGAEGGGQSLSSPGSCLEDF----------------------------RATP
D6WLB7_TRICA/1694-1806-IG-----------------YSFIMHTSDGAEGGGQSLVSPGSCLEDF----------------------------RASP
T1IZ15_STRMM/1635-1746-IG-----------------YSFVMHTDAGAEGGGQPLVSPGSCLEEF----------------------------RTSP
I3LDI9_PIG/153-260-SG-----------------FSLLFVQGNE.RSHGQDLGTLGSCLQRF----------------------------TTMP
B7Q188_IXOSC/1279-1390-TG-----------------YSFFMNTDSGAEGSGQPLVSPGSCLEDF----------------------------RPNP
CO4A2_BOVIN/5-110-SG-----------------YSLLYFEGQE.KAHNQDLGLAGSCLARF----------------------------STMP
M3ZRX3_XIPMA/242-353-TG-----------------FSFVMETGVGAEGSGQPLVSPGSCLENF----------------------------QGMP
C3ZDE0_BRAFL/5-110-DG-----------------YSLLYLEGNE.RSHGQDLGLPGSCLPRF----------------------------STMP
E9IRC9_SOLIN/82-187-EG-----------------YSLLYTDGDE.RAHSQDLGYAGSCVRKF----------------------------STIP
F1R5V4_DANRE/1438-1545-TG-----------------YSLLFINGNN.RGHGQDLGTLGSCLPMF----------------------------NTMP
G7Y6J4_CLOSI/1377-1484-TG-----------------YSYVMGGGVD.DLVSMDLGTPSSCLVRF----------------------------SSLP
F1QW09_DANRE/1446-1550-NG-----------------YSLLYLEGQE.RAHTQDLGQAGSCLPVF----------------------------STMP
M4AJS4_XIPMA/1454-1558-TG-----------------YSLLYLEGQE.KAYSQDLGQAGSCIPVF----------------------------STLP
G4V8A7_SCHMA/2868-2983-DG-----------------YSFVMHS.VGSTGGGQQLSSPGSCLEYF----------------------------SYSP
T1FRZ7_HELRO/1555-1658-KG-----------------YSLLHLEGHE.DASFQDLGKPGSCMRQF----------------------------NVMP
T1FST9_HELRO/1255-1360-TG-----------------YSLLQFRNNE.KSLNQDLGGPGSCLQVF----------------------------STAP
E4X7Q9_OIKDI/981-1083-DG-----------------YSLAGIRTPA.GDIAQDMGGSGSCLPNV----------------------------SLEP
W4YIV2_STRPU/235-345-TG-----------------YSFTMYT.AASEGGGQGLESVGSCLENF----------------------------RATP
E5SK06_TRISP/1584-1690-TG-----------------YSLLYIQGDG.KSSGQDLGLPGSCLRKF----------------------------STMP
K1RH30_CRAGI/1513-1626-IG-----------------YSFAMHTGAGPSGGGQSLSSPGSCLEDF----------------------------RATP
J9EZI1_WUCBA/348-460-IG-----------------YSFAMHTGAGAEGGGQSLSSPGSCLEDF----------------------------RATP
C3YKJ4_BRAFL/2-108-DG-----------------YSLLHVEGNE.RAHDQDLGLPDSCIPRF----------------------------GILP
K1RH30_CRAGI/1405-1510-TG-----------------YSLLYIEGNE.RSHHQDLGWAGSCMQRF----------------------------STMP
H2M087_ORYLA/509-614-DG-----------------YSLLYVQGNE.RAHGQDLGTAGSCLRRF----------------------------STMP
C3YKJ4_BRAFL/112-221-AG-----------------YSFVMHTASG.EGGGQQFSSPGSCMEYF----------------------------RSAP
W4WSD7_ATTCE/1399-1506-EG-----------------FSLLHIMGNG.RAYAQDLGAAGSCVRKF----------------------------STMP
T1L4B8_TETUR/1360-1471-VG-----------------FSFAMHTAAGAEGGGQSLSSPGSCLEDF----------------------------RAAP
T1EG21_HELRO/620-730-SG-----------------FSLALMTGEGGLGVGQTLHSPGSCLTTF----------------------------RSSP
G4V8A7_SCHMA/1398-1505-TG-----------------YSYVMGGGVD.DLVSMDLGTPSSCLSKF----------------------------SSLP
T1INC3_STRMM/426-538-MG-----------------YSFAMHTAAGAEGGGQSLSSPGSCLEDF----------------------------RATP
W5MT75_LEPOC/1535-1646-MG-----------------YSFVMHTGAGAEGSGQALSSPGSCLEEF----------------------------RTVP
I3IXK0_ORENI/1558-1669-TG-----------------YSFVMETGAGAEGSGQPLASPGSCLEHF----------------------------RKLP
W5KH26_ASTMX/1504-1616-IG-----------------YSFLMHTGSGDEGGGQSLTSPGSCLPNF----------------------------RTHP
U6IF53_HYMMI/1667-1784-NG-----------------FSFFMHT.AGHGGGGQQLSSPGSCLEHF----------------------------RYAP
F6VJG0_CIOIN/1571-1682-IG-----------------YSFVMHTGAGAEGSGQSLQSPGSCLEDF----------------------------RAGP
C3Y8Z7_BRAFL/28-134-QG-----------------FSLVQLGGNG.VSGNQDLGSLGSCLIRF----------------------------STSP
F1QYN1_DANRE/1552-1664-IG-----------------YSFLMHTGAGGEGGGQSLMSPGSCLEDF----------------------------RATP
T1IZ15_STRMM/1525-1632-SG-----------------YSLLHFMGSS.KAHGQDLGTPGSCLRRF----------------------------STMP
W4WSD7_ATTCE/1509-1619-VG-----------------YSFLMHRDAGADGGGQSLVSPGSCLEEF----------------------------RVRP
W5L7X5_ASTMX/1573-1684-IG-----------------YSFMMHTSAGAEGSGQALASPGSCLEDF----------------------------RSAP
A7SQ52_NEMVE/112-223-QG-----------------YSFLMHTSAGNDGSGQLLSSPGSCLEDF----------------------------RAHP
K1QZZ6_CRAGI/238-349-TG-----------------FSFIMTSGAGGRGAGQALESPGSCLEDF----------------------------WVTP
T1EG21_HELRO/510-617-EG-----------------YSLLYVKANH.KAHGQDLGSPSSCLQKF----------------------------STMP
B0WDA5_CULQU/1620-1730-IG-----------------YSYVMHTTDNSGGFGMDLTSPGSCLEEF----------------------------RAQP
G4V8A8_SCHMA/1656-1769-PG-----------------SSFFMNTGYGAQGGGQQLASPGSCLPQF----------------------------RSHM
H9KBV4_APIME/1508-1615-DG-----------------FSLLHVRANG.KSHGQDLGTAGSCVVKF----------------------------NTMP
W5LJS4_ASTMX/114-218-SG-----------------YSLLYLEGQE.RAYTQDLGQAGSCLKIF----------------------------STMP
Q9VMV5_DROME/1626-1736-TG-----------------YSYFMSTLDNVGGVGQNLVSPGSCLEEF----------------------------RAQP
B4NRX0_DROSI/205-317-IG-----------------YSFLMHTAVGNGGGGQALQSPGSCLEDF----------------------------RATP
E9IRC9_SOLIN/190-302-IG-----------------YSFVMHTGAGAQGGGQSLSSPGSCLEDF----------------------------RATP
E9GYE4_DAPPU/267-374-TG-----------------YSLLHLTGDS.KAHGQDLGAPGSCMPRF----------------------------STMP
F1R5V4_DANRE/1548-1656-EG-----------------YSFVMQTGVGAEGSGQPLVSPGSCLEQF----------------------------RKIP
E0VEK7_PEDHC/2309-2414-QG-----------------YSLLYIEGNE.KAHHQDLGFAGSCVQKF----------------------------STMP
F6VJG0_CIOIN/1461-1568-DG-----------------YSLLYIQGNE.RSHGQDLGSAGSCLRRF----------------------------NTMP
K7I6X3_CAEJA/317-428-SG-----------------YSFVMHTAAGAEGTGQSLQSPGSCLEEF----------------------------RAVP
U6HLY4_ECHMU/1665-1777-NG-----------------FSMPMVVSAAVSGGVQPLHSPGSCLMNF----------------------------RALP
X1WQB7_ACYPI/360-471-IG-----------------YSFIMHTDSGADGGGQSLVSPGSCLEEY----------------------------RPRP
A7SQ52_NEMVE/4-109-EG-----------------YSLLYVQGNE.RAHGQDLGSPGSCIQRF----------------------------STMP
F1QW09_DANRE/1554-1665-TG-----------------FSFMMYTGSGDEGGGQSLTSTGSCLQDF----------------------------RSQP
C3XSD7_BRAFL/244-353-QG-----------------FSLVQLGGTG.ITGGQDLGSLGSCLTRF----------------------------STHP
G6DMY2_DANPL/1689-1794-DG-----------------YSLLYIDGNE.KAHNQDLGYAGSCVRKF----------------------------STMP
H9KBV4_APIME/1618-1728-IG-----------------YSFLMHRDVGNGGGGQSLVSPGSCLEEF----------------------------RIRL
F1QYN1_DANRE/1443-1548-EG-----------------YSLLYVEGQE.KAHNQDLGLPGSCLPHF----------------------------STIP
CO4A1_BOVIN/6-113-HG-----------------YSLLYVQGNE.RAHGQDLGTAGSCLRKF----------------------------STMP
H3AVQ2_LATCH/1504-1618-TG-----------------YSFLMHTGAGDQGGGQQLMSSGSCLKDF----------------------------RSTP
W4YIV2_STRPU/127-232-RG-----------------FSVLFSMGNG.HAHHQDLGDAGSCLQRF----------------------------STMP
W5MT75_LEPOC/1425-1532-EG-----------------YSLLFVNGNS.RAHGQDLGTLGSCLQRF----------------------------STMP
E0VEK8_PEDHC/1519-1626-DG-----------------YSLLHFMGNA.KSHGQDLGAPGSCLRKF----------------------------STMP
F6XFD7_CIOIN/1513-1618-EG-----------------YSLLYLEGSE.KAHGQDLGQAGSCMPRF----------------------------NTMP
C3YYX1_BRAFL/102-217-EG-----------------FSFFMHTAAG.EGSGQIFSSPGSCLERF----------------------------RPAP
B4NRX0_DROSI/97-202-TG-----------------YSLLFVDGND.YSHNQDLGSPGSCVQRF----------------------------STLP
I3IXM4_ORENI/1411-1514-EG-----------------FSLLYLEGQE.RAHTQDLGQPGSCMRVF----------------------------STLP
T1L4B8_TETUR/1252-1357-DG-----------------YSLLYIEGNE.RAHGQDLGFAGSCLKRF----------------------------STMP
T1FST9_HELRO/1364-1474-IG-----------------YSFFMQA.AGRSGTGQQLSSTGSCLEDF----------------------------RTTP
B3S7P5_TRIAD/1401-1510-EG-----------------YSYIMQTGTGNQGSGQQLQSPGSCLRNF----------------------------RSQP
T1FRZ7_HELRO/1662-1772-VG-----------------YSFFMHIVHGVSGGGQQLVSSGSCLEDF----------------------------RVLP
U6HG85_ECHMU/1616-1731-TG-----------------VSLLLHT.SGSFGGGQPLSSPGSCLEHF----------------------------RYSP
F6XEM0_MACMU/144-249-TG-----------------YSLLYLEGQE.KAHNQDLGLAGSCLPVF----------------------------STLP
H2RQC6_TAKRU/392-502-TG-----------------YSFLMHTGAGDEGGGQSLTSSGSCLTHF----------------------------RAQP
C3YYN7_BRAFL/439-564-TG-----------------YSFLMHTAAG.EGSGQALHSPGSCLEKF----------------------------RPAP
T1INC3_STRMM/318-423-EG-----------------YSLLYIEGNE.KAHNQDLGFAGSCVRRF----------------------------STMP
Q7PVR6_ANOGA/780-890-LG-----------------YSYAMHTSDNSGGFGQDFVSPGSCMEEF----------------------------RPQP
G7Y6J5_CLOSI/1648-1763-NG-----------------YSFVMHS.AGSTGGGQQLSSPGSCLEYF----------------------------RYSP
W5KGN1_ASTMX/1485-1596-QG-----------------YSFVMQTGVGAEGSGQPLSSPGSCLENF----------------------------QKVP
E9GYE4_DAPPU/377-488-IG-----------------YSFLMHTDSGAEGSGQSLVSPGSCLEDF----------------------------RPTP
G4V8A7_SCHMA/2756-2862-DG-----------------YSFVMANGNG.ELVTMDLGSHSSCLSMF----------------------------SIMP
G3PLB8_GASAC/1546-1658-TG-----------------YSFLLHTGAGDEGGGQSLASSGSCLKDF----------------------------RTHP
F6TRQ1_ORNAN/140-245-EG-----------------YSLLYVEGQD.KAHNQDLGLAGSCLPRF----------------------------STMP
K7I6X3_CAEJA/207-314-EG-----------------YSLLYVQGNG.RASGQDLGQPGSCLSKF----------------------------NTMP
M4AMB5_XIPMA/1415-1519-VG-----------------YSLIYLEGQE.KAHTQDLGQPGSCLPVF----------------------------STMP
C3YKJ6_BRAFL/706-819-TG-----------------YSFLMHTAAG.EGGGQELTSPGSCLQYF----------------------------RPVP
G3PLA6_GASAC/1448-1555-SG-----------------YSFLFINGNE.RAHGQDLGTMGSCLPRF----------------------------STMP
I3JUK2_ORENI/1430-1537-SG-----------------YSFLFINGYK.RAHGQDLGTTGSCLPHF----------------------------STMP
C3ZDD7_BRAFL/4-111-DG-----------------YSLLYTQGNE.RTHGQDLGTAGSCLRRF----------------------------SVMP
H9JWX6_BOMMO/1492-1599-EG-----------------FSLIHIIANG.KAHGQDLGAPGSCLRKF----------------------------STMP
B3S7P5_TRIAD/1291-1396-SG-----------------YSLLFVEGNG.QTIGQDLGRSSSCLERF----------------------------TTLP
G6DMY2_DANPL/1797-1909-IG-----------------YSFVMHTGAGGQGGGQALASPGSCLEDF----------------------------RATP
K7IPX3_NASVI/1375-1482-DG-----------------FSLLHVMGNS.YAHAQDLGTPGSCLKKF----------------------------SVMP
H0VSI7_CAVPO/1423-1530-EG-----------------FSLLYVQGNK.RAHGQDLGTSGSCLRRF----------------------------STMP
G3NH33_GASAC/256-367-IG-----------------YSFLMHTAAGNEGGGQSLSSPGSCLEDF----------------------------RTTP
B3S7P7_TRIAD/175-288-QG-----------------YSYWMHTGQGKSVAGQDLSSPGSCLRRF----------------------------QSMP
X1WQB7_ACYPI/250-357-SG-----------------YSLLHFMGNA.KAHGQDLGAPGSCLRKF----------------------------NTMP
T1ID48_RHOPR/1595-1706-IG-----------------YSFMLHTAGGGDGGGQSLSSSGSCLEDF----------------------------RVTP
T1ID05_RHOPR/1596-1706-IG-----------------YSFLMHS.AGTEGGGQRLMSPGSCLIDF----------------------------RASP
W5MTA0_LEPOC/1446-1550-TG-----------------YSLVYLEGQE.QAHNQDLGLAGSCLQIF----------------------------NTMP
G3NKK3_GASAC/1416-1520-VG-----------------YSLLYLEGQE.KAHTQDLGQAGSCMRVF----------------------------STMP
G3NKN3_GASAC/240-347-SG-----------------YSLLFINGNN.RAHGQDLGSLGSCLPRF----------------------------TTMP
C3ZDD7_BRAFL/114-224-MG-----------------YSFVMHTGAGAEGTGQALASPGSCLEDF----------------------------RSSP
C3Y818_BRAFL/251-355-NG-----------------YSLVELTGSN.FDPDQDLGSTRSCLPYF----------------------------SVSP
CO4A2_BOVIN/113-225-IG-----------------YSFLMHTAAGDEGGGQSLVSPGSCLEDF----------------------------RATP
F1PHG6_CANFA/1571-1684-IG-----------------YSFLMHTAAGAEGGGQSLVSPGSCLEDF----------------------------RATP
G3NKK3_GASAC/1525-1637-TG-----------------YSFLMHTGAGDEGGGQSLTSSGSCLTDF----------------------------RAQP
I3LDI9_PIG/263-374-KG-----------------FSFIMFTSAGSEGAGQALASPGSCLEKF----------------------------RASP
G4V8A8_SCHMA/1546-1652-DG-----------------YSFLSMTGSD.RAHVNDLASPGSCLQLF----------------------------NPIP
T1GCH0_MEGSC/688-795-DG-----------------YSLAGTIGGG.RVVGQDLGLAGSCMRKF----------------------------TTMP
C3ZSP6_BRAFL/193-300-QG-----------------YSLLHGEGNE.RAHGQDMGTAGSCLQRF----------------------------APMP

PF00193

F7EKW5_ORNAN/2173-2265.LG-----------------F---------HLCLVGWLVNGSAGYATS----------------------------YPSP
H2V249_TAKRU/245-334FTG-----------------L---------DHCEAGWLADGSVRYPIT----------------------------TPRP
H3C6Z8_TETNG/32-122.AN-----------------M---------ETCRYGWTNNGSTAILRH----------------------------ILHE
M4AF12_XIPMA/277-366LKG-----------------L---------DRCDAGWLGDGSVRYPIT----------------------------NARA
H2UTV0_TAKRU/465-559.KG-----------------F---------HQCDAGWLSDQTVRYPIV----------------------------SPRE
H9H0Q3_MELGA/103-198.AG-----------------L---------DACNPGWLADGSVRYPIV----------------------------TPRE
E7EYE0_DANRE/2154-2245.AG-----------------Y---------SLCTAGWLDKARVAYPMS----------------------------FSSP
H3BAD0_LATCH/584-679.QG-----------------L---------DRCHAGWLSDGSVRYPVT----------------------------KPRT
H2L317_ORYLA/231-326.GG-----------------M---------DVCNTGWLADLSVRYPIN----------------------------VRRP
H9H1H3_MELGA/121-215.EG-----------------L---------DWCNAGWVLDGTVHYPII----------------------------NSRE
F6YUQ6_XENTR/161-255.SG-----------------L---------DWCNAGWLQDGSVQYPIS----------------------------KPRD
M4AP18_XIPMA/155-249.DG-----------------F---------DQCDAGWLSDYTVRYPIT----------------------------QPRP
H3D6N5_TETNG/90-184.DG-----------------Y---------DNCDAGWLSDQTVRYPIQ----------------------------SPRP
R4GBT0_ANOCA/33-126DCS-----------------F---------AVCTTGWLADGTIGT...----------------------------...T
F6TXD5_ORNAN/240-323.GG-----------------L---------DRCRPGWLADGSVRYPIV----------------------------....
C3Y1K4_BRAFL/989-1073.QG-----------------M---------DICRLGWLQDGTVGFPIH----------------------------SPRA
W5K9E6_ASTMX/11-100.QG-----------------F---------QTCRFGWIDEQIAVIPRI----------------------------QANP
M3ZEZ9_XIPMA/32-120.NS-----------------M---------ETCRYGWINNGSSVILRH----------------------------TQHE
F6RUD0_XENTR/42-130.YG-----------------F---------ETCSFGWVSEQFVVISRI----------------------------QPNE
G3PSB5_GASAC/251-347.EG-----------------L---------NRCDYGWLSDGSARYPVT----------------------------QPRP
A7SD47_NEMVE/72-164.VG-----------------L---------FECSYGWVAEGFAALPIR----------------------------LPLR
W5L2D8_ASTMX/166-260.DG-----------------L---------DWCNAGWLADGTAQYPVS----------------------------VPRE
Q6PID9_HUMAN/153-247.DG-----------------F---------HQCDAGWLADQTVRYPIH----------------------------TPRE
H2S086_TAKRU/390-483.DG-----------------L---------DWCNAGWLSDGSVRYPIT----------------------------NARE
C3Y1K4_BRAFL/449-534.KG-----------------L---------DICMMGWLADGTVAHPVH----------------------------TSRS
M3Y9K7_MUSPF/34-128.GG-----------------L---------DWCNAGWLSDGSVQYPIT----------------------------KPRE
H3CYG5_TETNG/270-358LQG-----------------L---------DRCDAGWLADGSVRYPVA----------------------------TPRA
G3P7B0_GASAC/113-206.GG-----------------L---------DWCNAGWLSDGTVHYPVV----------------------------RARG
W5PN42_SHEEP/45-129.FG-----------------F---------ETCSYGWVKNQFVVIPRI----------------------------ISNP
I3KB63_ORENI/6-96.AS-----------------M---------ETCRNGWISNTSIAILRH----------------------------KSHE
F6PXC5_XENTR/501-595.AG-----------------F---------DQCDAGWISDQTVRYPIV----------------------------TPRE
I3KEY5_ORENI/519-614.QG-----------------L---------DQCSPGWLMDRSVRFPIT----------------------------TPRS
U3IUX8_ANAPL/519-613.AG-----------------F---------DQCDAGWLRDQTVRYPIV----------------------------NPRS
F1QR32_DANRE/150-244.SS-----------------M---------SNCAAGWISDQSVRYPVQ----------------------------TPEL
H2S086_TAKRU/182-272LEG-----------------Y---------DRCDAGWLADGSVRYPIS----------------------------RPRK
W5M456_LEPOC/19-112ECS-----------------F---------TACTRGWLAGPTIGT...----------------------------...T
H3A5H2_LATCH/51-143.IG-----------------L---------HVCTAGWLAGGRVGYPIV----------------------------KAGS
E7FBG3_DANRE/75-163.SG-----------------M---------ETCRYGWINSSQLVILRK----------------------------TPNL
C3ZUC3_BRAFL/5-93.DG-----------------Y---------ERCECGWLSDGTARYPMQ----------------------------EARP
H3A6L9_LATCH/10-102.AG-----------------L---------EECRAGWILLAEVAYPRI----------------------------HQTW
I3JV73_ORENI/216-308.AG-----------------L---------DSCAPGWLSDGSVRYPVT----------------------------WPRA
Q86W61_HUMAN/251-346.NG-----------------F---------DQCDYGWLSDASVRHPVT----------------------------VARA
E1BUN0_CHICK/268-356FHG-----------------L---------DRCDAGWLADGSVRYPIA----------------------------KPRP
F1Q4Q0_DANRE/249-344.QG-----------------L---------DRCDYGWLSDGSARHPVS----------------------------VPRS
W5KSF4_ASTMX/2192-2284.AG-----------------Y---------SMCSAGWLAEKRVGYPMS----------------------------YSRP
Q6PID9_HUMAN/478-572.AG-----------------Y---------EQCDAGWLRDQTVRYPIV----------------------------SPRT
H3AUC6_LATCH/32-120.VG-----------------F---------ETCRYGWTQT.DIAILRI----------------------------HPHE
H3CE81_TETNG/233-328.RG-----------------M---------DVCNAGWLGDRSVRYPIN----------------------------IRRP
F1N2Y8_BOVIN/163-257.DG-----------------F---------DNCDAGWLSDRTVRYPIT----------------------------QSRP
H2MXA1_ORYLA/38-130.IG-----------------F---------HVCAAGWFDKGRVGYPIV----------------------------KAGI
F6QGU9_XENTR/2171-2263.AG-----------------F---------HLCAAGWLDGVRVAYPTT----------------------------YSNQ
H2M1W8_ORYLA/238-327LEG-----------------Y---------NHCNAGWLADGSVRYPVS----------------------------KPRK
H2L7V4_ORYLA/456-550.NG-----------------L---------DQCDAGWVKDQTVRYPVV----------------------------TPRK
H2V249_TAKRU/143-237.EG-----------------L---------NWCNAGWLADGTVHYPIT----------------------------KPRV
V8P6B4_OPHHA/1137-1229.AK-----------------Y---------HLCAAGWLANGRVAYPTA----------------------------FSAP
F1R511_DANRE/142-233.TG-----------------M---------DVCNAGWLADRSVRYPIV----------------------------HPRK
H2S2Y1_TAKRU/183-278.LG-----------------L---------DRCDYGWLSDGSARHPVA----------------------------VPKM
H0ZUW2_TAEGU/54-148.EG-----------------L---------DWCNAGWLQDGSVQYPIA----------------------------RPRE
G3NJP2_GASAC/150-244.DG-----------------Y---------EQCDAGWLADQSVRYPIQ----------------------------VPRE
W5NA53_LEPOC/559-654.QG-----------------F---------DKCRAGWLADGSVRYPIT----------------------------NPRP
M4A2R4_XIPMA/143-237.GG-----------------L---------DWCNAGWLNDGTVQYPIT----------------------------KPRQ
R0LX51_ANAPL/4-97DCS-----------------F---------TGCTTGWLADGSAGT...----------------------------...I
I3K6I5_ORENI/169-263.EG-----------------M---------NWCNAGWLADGTVQYPIT----------------------------QPRE
G3PXC4_GASAC/265-353LTG-----------------L---------DHCDAGWLADGSVRYPIS----------------------------SPRR
F1MKY3_BOVIN/32-125DCA-----------------L---------AVCTTGWLADGTLGT...----------------------------...T
H3CYG5_TETNG/171-263.DG-----------------L---------DWCNAGWLADGSVRYPIT----------------------------EPRA
A7RGE0_NEMVE/165-256.TG-----------------Y---------HLCRWGWLTDVSGGYPIQ----------------------------TPTS
W5NA53_LEPOC/458-552.SG-----------------Y---------HQCDAGWLLDQSVRYPIV----------------------------SPRD
G3NVP1_GASAC/175-269.DG-----------------L---------DWCNAGWLADGTVQYPIT----------------------------APRA
U3IX07_ANAPL/2191-2283.AK-----------------Y---------HLCAAGWLDNERVGYPTA----------------------------FSSP
U3JRF4_FICAL/33-126DCS-----------------F---------AGCTTGWLASGSAGT...----------------------------...I
W5M859_LEPOC/38-125.NG-----------------L---------ETCRYGWVDEQIAVIPRI----------------------------KSLD
C3Y1K4_BRAFL/25-116.RG-----------------L---------DLCRNGWLNDGTVAQPTH----------------------------FSRR
H2M1W8_ORYLA/137-231.DG-----------------L---------DWCNAGWLNDGTVQYPIT----------------------------KPRE
I3IZ94_ORENI/167-260.EG-----------------L---------DWCNAGWLHDGTVHYPII----------------------------HPRP
E1BUN0_CHICK/167-261.EG-----------------L---------DWCNAGWLADGTVHYPIR----------------------------LPRK
I3JZL7_ORENI/18-112.DG-----------------L---------DQCDAGWLADQSVRYPVT----------------------------VSRP
G3U8V2_LOXAF/163-264.EG-----------------L---------DWCNAGWLRDGSVQYPVS----------------------------QPRE
Q1LXE1_DANRE/141-235.SG-----------------L---------DWCNAGWLSDGTVQYPIT----------------------------KPRE
F6PXV1_XENTR/200-294.EG-----------------L---------DWCNAGWLMDGTVQYPVT----------------------------LPRE
C3ZUI3_BRAFL/586-672.NG-----------------L---------DYCACGWLSNRNAGYPTQ----------------------------IARE
W5M1S0_LEPOC/221-316.NG-----------------L---------DRCDYGWLSDGSVRYPIA----------------------------VART
H3CE81_TETNG/549-644.LG-----------------L---------NKCRPGWLMDRSVRYPIN----------------------------NPRS
H2UTV0_TAKRU/255-350.AG-----------------M---------DVCNAGWLEDRSVRYPIN----------------------------IARP
V8P5V5_OPHHA/237-332.DG-----------------M---------DVCSAGWLADRSVRYPIN----------------------------KPSP
I3ML99_SPETR/46-129.SG-----------------F---------ETCSYGWVGEGYTVIPRI----------------------------LPNP
E7F6T0_DANRE/33-122.KG-----------------L---------RTCRYGWIDGQNVTFLPH----------------------------INGP
TSG6_RABIT/36-128.IG-----------------F---------HVCAAGWMAKGRVGYPIV----------------------------KPGS
W5NA53_LEPOC/255-350.KG-----------------M---------DVCSAGWLADLSVRYPIS----------------------------IARP
Q6PID9_HUMAN/254-349.AG-----------------M---------DMCSAGWLADRSVRYPIS----------------------------KARP
W5LHH4_ASTMX/148-241.EG-----------------L---------DWCNAGWLNDGTVHYPII----------------------------HPRP
H3A9N1_LATCH/268-362.EG-----------------L---------DQCDPGWLADGSVRYPIV----------------------------TPRE
V8P5V5_OPHHA/497-591.EG-----------------Y---------EQCDAGWLNDQTVRYPIV----------------------------FPRS
M3YNU2_MUSPF/32-125DCA-----------------F---------AVCTTGWLADGTLGT...----------------------------...T
I3JJ27_ORENI/627-722.MG-----------------F---------DKCRAGWLLDRSVRYPIN----------------------------NPHA
F6QHJ0_ORNAN/2-95HCA-----------------F---------TSCSGGWLADGTIGS...----------------------------...T
H2UTP0_TAKRU/161-255.EG-----------------L---------DWCNAGWLADGTVQYPIT----------------------------EPRD
I3KG10_ORENI/253-348.QG-----------------L---------DRCDYGWLSDGSVRHPVA----------------------------VPRT
W5LE59_ASTMX/41-129.TG-----------------L---------EMCRYAWISNGDIAIVRQ----------------------------KSNP
U3J8X0_ANAPL/250-345.NG-----------------F---------DQCDYGWLADGSVRYPAS----------------------------VARP
H2L7U2_ORYLA/280-369LAG-----------------F---------DRCDAGWLADGSVRYPIT----------------------------KARL
H0V051_CAVPO/262-357.EG-----------------L---------DQCDPGWLADGSVRYPIQ----------------------------TPRR
F6PXN1_XENTR/157-251.DG-----------------F---------EQCDAGWLSDQTVRYPIR----------------------------SPRA
H0ZII5_TAEGU/32-120.LG-----------------F---------ETCRYGFVVG.HIVIPRI----------------------------NPYH
W5NCW4_LEPOC/2171-2263.AG-----------------F---------HICAAGWLAGKRVAYPTV----------------------------YANP
I3KG10_ORENI/152-246.DG-----------------F---------DQCDAGWIADQTVRYPIT----------------------------KPRE
F6TIG3_CIOIN/20-106.NG-----------------L---------SHCSCGWLLEKKAGYPMN----------------------------ETKA
W5MB73_LEPOC/260-350IQL-----------------L---------DRCEAGWLEDGSIRYPIV----------------------------NPRR
W5KJN6_ASTMX/458-552.AG-----------------Y---------HHCDAGWLIDQTVRYPIV----------------------------SPRD
H2L317_ORYLA/130-224.DG-----------------F---------HQCDAGWISDQTVRYPIH----------------------------DVRV
G3PBZ4_GASAC/32-121.KK-----------------M---------ETCRNGWTNNMTIAILRH----------------------------SHHA
H3B5H7_LATCH/153-247.DG-----------------F---------DQCDAGWLVDQTVRYPIT----------------------------KPRN
F8W252_DANRE/560-655.QG-----------------F---------HKCSPGWLADRSVRYPVR----------------------------SPDF
Q6PID9_HUMAN/579-674.RG-----------------L---------DKCYAGWLADGSLRYPIV----------------------------TPRP
H0V0Q4_CAVPO/2172-2264.AG-----------------Y---------HLCSAGWLDSGHVAYPTA----------------------------YSSR
F6QZI7_MONDO/42-134ECS-----------------F---------ATCTTGWLADGTVGT...----------------------------...T
F7A729_XENTR/115-208.DG-----------------L---------DWCNAGWLIDGTIHYPII----------------------------IPRE
HPLN3_MOUSE/267-356FRG-----------------L---------DRCDAGWLADGSARYPIV----------------------------HPRL
H2YC92_CIOSA/35-121.NG-----------------Y---------SHCGCGWLANKKAGYPMN----------------------------TTKA
K7EA70_ORNAN/119-214.EG-----------------L---------DQCDPGWLADGSVRYPIQ----------------------------TPRK
M3Y9K7_MUSPF/135-225LLG-----------------Y---------DRCDAGWLADGSVRYPIS----------------------------RPRR
L9KBI4_TUPCH/149-242.EG-----------------L---------DWCNAGWLLEGSVRYPVL----------------------------TARA
Q86W61_HUMAN/150-244.DG-----------------F---------EQCDAGWLADQTVRYPIR----------------------------APRV
F7ATS6_XENTR/4-99.QG-----------------Y---------DQCNPGWLSDGSVRYPIV----------------------------TPRE
F6UCQ1_XENTR/163-257.DG-----------------L---------DNCDAGWLSDHSVRYPIK----------------------------TPRP
G1KI55_ANOCA/52-134.HG-----------------F---------ETCSFGWVAERYAVISRI----------------------------IPNE
F8W252_DANRE/459-553.AG-----------------L---------HQCSAGWLQDQTVRYPIV----------------------------HPRK
H3BB99_LATCH/271-361FLD-----------------L---------DQCDAGWLADGSVRYPIA----------------------------FPRL
H9GJW7_ANOCA/562-657.LG-----------------L---------DNCRAGWLADGSLRYPIT----------------------------NPRP
I3KG12_ORENI/112-205.GG-----------------L---------DWCNAGWLSDGTVQYPVT----------------------------KPRH
H3D620_TETNG/265-360.DG-----------------L---------HRCSPGWLADGSLRYPAV----------------------------TPGG
H3D7T0_TETNG/183-278.EG-----------------L---------NGCDYSWLSDGSVRYPVT----------------------------IPRP
H2VEJ2_TAKRU/83-177.GK-----------------L---------DWCNAGWLSDGSVQYPIN----------------------------IPRE
W5KBY4_ASTMX/2208-2300.LG-----------------M---------HLCTAGWMDGKKVGYPIR----------------------------FPSV
F6PXV1_XENTR/301-390FID-----------------L---------DRCDAGWLDDGSVRYPIA----------------------------SPRP
W5LZK3_LEPOC/33-122.KG-----------------F---------ETCRYGWIQNISVAIIRQ----------------------------QAHD
H3BGU3_LATCH/2206-2298.MG-----------------L---------HLCSISWMDNKTAGYPTT----------------------------YANP
F6UCQ1_XENTR/264-357.KG-----------------M---------DQCDPGWLADNSVRYPIR----------------------------NPRR
G3PXC4_GASAC/164-258.EG-----------------L---------NWCNAGWLADGTVQYPIT----------------------------RPRA
G5AR83_HETGA/94-188.GG-----------------Y---------EQCDAGWLSDQTVRYPIQ----------------------------TPRE
F6RL05_MONDO/2173-2265.LG-----------------F---------HLCLTGWLSNGTAAYPAV----------------------------YPST
V8NUK1_OPHHA/265-360.NG-----------------F---------DQCDYGWLADGSVRYPAS----------------------------VARI
H2MZH4_ORYLA/2159-2251.LG-----------------M---------HLCVAGWIKGQRVGYVTQ----------------------------YPSP
H2UTV0_TAKRU/154-248.DG-----------------Y---------HQCDAGWLSDETVRYPIQ----------------------------EPRE
F1QVB2_DANRE/169-263.EG-----------------L---------DWCNAGWLTDGTAQYPVS----------------------------VPRV
G3UW60_MOUSE/36-128DCA-----------------S---------AVCTTGWLADGTLGT...----------------------------...T
W5L2C8_ASTMX/556-651.QG-----------------F---------HSCSPGWLSDLSVRYPVQ----------------------------ASQH
G3PSB5_GASAC/150-244.DG-----------------L---------DQCDAGWLADRSVRYPIR----------------------------TPRP
F7GLT0_MONDO/2208-2299.AK-----------------Y---------HLCSAGWLNDGRVAYPTA----------------------------YSSQ
K7EA70_ORNAN/18-112.DG-----------------Y---------DNCDAGWLSDHTVRYPIT----------------------------LSRP
W5MB73_LEPOC/159-253.EG-----------------L---------DWCNAGWLEDGSVQYPIS----------------------------QPRD
M3WN53_FELCA/2207-2299.LG-----------------F---------HLCRVGWLANGSAAHPVV----------------------------FPAA
H3CE81_TETNG/132-226.DG-----------------F---------HQCDAGWLSDHTVRYPIH----------------------------DPRV
W5KJN9_ASTMX/170-264.EG-----------------L---------DWCNAGWLADGTVQYPIT----------------------------QPRS
C3Y1K4_BRAFL/161-249.KG-----------------L---------DICRSGWLQDGATARPIH----------------------------KERE
F1R6C2_DANRE/4-93.NG-----------------L---------QTCRFGWVEEQIAVIPRV----------------------------EKNE
G3HQN1_CRIGR/1449-1541.AS-----------------Y---------HLCSAGWLENGRVGYPTT----------------------------YASP
W5KJN9_ASTMX/271-360FLG-----------------L---------DRCDAGWLADGSLRYPIA----------------------------KPRP
D3ZWH1_RAT/2209-2301.LG-----------------F---------HVCFLGWLANGSAAHPVV----------------------------TPAA
H3D6N5_TETNG/191-286.AG-----------------L---------DQCDPGWLADGSVRYPIN----------------------------VPRK
M4AV85_XIPMA/521-615.DG-----------------Y---------HQCDAGWLLDQTVRYPIV----------------------------FPRK
W5KNW0_ASTMX/239-323LQG-----------------Y---------DRCDAGWLSDGSVRYPIS----------------------------RPRM
H2UTV0_TAKRU/566-661.QG-----------------L---------DKCRPGWLMDRSVRYPIT----------------------------TPRP
H2UD03_TAKRU/255-349.EG-----------------L---------DHCSPGWLSDGSVRYPIT----------------------------IPRD
H9G9P6_ANOCA/239-335.QG-----------------L---------DHCNPGWLADRSARYPIV----------------------------APRE
H2L7V4_ORYLA/557-652.QG-----------------F---------DKCNPGWLMDRSVRFPIT----------------------------IPKS
H3D620_TETNG/164-258.SG-----------------Y---------QPCDAGWLSDGSVSDPIQ----------------------------TPGE
H0YCV9_HUMAN/11-98.IG-----------------F---------ETCRYGFIEG.HVVIPRI----------------------------HPNS
H3A9N1_LATCH/167-261.SG-----------------Y---------EQCDAGWIADQTVRYPIQ----------------------------APRA
U3IUX8_ANAPL/620-715.QG-----------------L---------DRCYPGWLADGSLRYPIV----------------------------SPRP
M3XGZ3_LATCH/42-127.FG-----------------L---------ETCRYGWVSEATAVIARI----------------------------TPNE
H2TWG7_TAKRU/1997-2088.GG-----------------M---------NMCAAGWLDQARVAYPTT----------------------------YSNP
H3AR94_LATCH/2141-2232.AG-----------------F---------HLCVAGWLDGYRVAYPTA----------------------------YSSP
G1KG37_ANOCA/2217-2309.MG-----------------F---------HLCIVGWLHNRTAGYPTV----------------------------YPSK
F6PXC5_XENTR/602-697.LG-----------------L---------DKCRAGWLSDGSVRYPVV----------------------------TPRR
W5KML6_ASTMX/146-240.DG-----------------F---------DQCDAGWLADQTVRYPIT----------------------------RPRD
H2L317_ORYLA/587-681.TG-----------------F---------DKCRAGWLQDGSVRYPIN----------------------------IPRA
H3D7T0_TETNG/82-176.DG-----------------L---------NQCDAGWLSDRSVRYPIT----------------------------VPRP
W5K8P3_ASTMX/43-127.AG-----------------L---------ETCRFGWVEENIAVVPRI----------------------------NPHE
W5LMV1_ASTMX/2-91ECS-----------------F---------SACTQGWLTGPSIGT...----------------------------...T
M3VUP6_FELCA/45-129.SG-----------------F---------ETCSYGWVADKFLVIPRI----------------------------LPNP
W5MZE9_LEPOC/36-128.QG-----------------L---------EECRAGWISSAEVAYPRV----------------------------HKNW
I3IZ90_ORENI/163-257.SG-----------------Y---------EQCDAGWLSDHSVRYPIQ----------------------------MPRE
W5M1S0_LEPOC/120-214.DG-----------------F---------DQCDAGWMEDQTVRYPIT----------------------------KPRA
F6PXN1_XENTR/258-352.KG-----------------F---------DQCDYGWLADGSVRYPVS----------------------------VARP
G3NVP1_GASAC/277-366LAG-----------------L---------DRCDAGWLADGSVRYPIT----------------------------KARA
F6PZ03_XENTR/37-125.IG-----------------F---------ETCRYGWIED.RVVIPRI----------------------------KPNP
A2CF10_DANRE/147-240.EG-----------------L---------DWCNAGWLIDGTVSYPVL----------------------------HPRP
G1KL45_ANOCA/151-245.DG-----------------F---------EQCDAGWLSDQSVRYPII----------------------------YPRP
F1QVB2_DANRE/270-359FVG-----------------L---------DQCDAGWLADGSVRYPIV----------------------------HPRM
V8P471_OPHHA/222-316.DG-----------------L---------DWCNAGWLIDGTAQYPIT----------------------------VPRE
G1KCR2_ANOCA/32-120.LG-----------------F---------ETCRYGYIED.KVVVPRH----------------------------TPYH
W5MN99_LEPOC/159-253.EG-----------------L---------DWCNAGWLDDGTVHYPII----------------------------HSRE
I3JZL7_ORENI/119-215.AG-----------------L---------NRCDFGWLSDGSVRYPIT----------------------------IPRP
I3IZ90_ORENI/264-359.DG-----------------L---------NHCSPGWLADGSVRYPIV----------------------------TPRE
H3B5H7_LATCH/254-349.QG-----------------L---------DRCDYGWLADGSVRYPIA----------------------------VAKT
H9GPN6_ANOCA/261-356.EG-----------------L---------DQCDPGWLADGSARYPIR----------------------------VPRK
G3UPK3_MELGA/183-278.EG-----------------L---------DQCDPGWLADGSVRYPIL----------------------------APRR
I3JV73_ORENI/115-209.DG-----------------F---------ASCAAGWLDDQTVRYAVQ----------------------------VPEL
W5L2C8_ASTMX/455-549.AG-----------------L---------HQCSAGWLKDQSVRYPIV----------------------------HPRN
H2S2Y1_TAKRU/82-176.DG-----------------F---------DQCDAGWLAEQIVGYPIT----------------------------RPRK
H2S086_TAKRU/82-175.GG-----------------L---------DWCNAGWLSDGSVRYPIT----------------------------KPRE
W5NA55_LEPOC/169-263.EG-----------------L---------DWCNAGWLADGTVQYPIT----------------------------LSRE
G3NIT0_GASAC/1023-1115.LG-----------------M---------HLCVAGWMEAGKVGYPIR----------------------------FPSV
G3UPK3_MELGA/82-176.DG-----------------Y---------DNCDAGWLADQSVRYPIT----------------------------LSRP
W5KML6_ASTMX/247-341.AG-----------------L---------DGCDFGWLSDGSARYPVS----------------------------VPRV
H3D621_TETNG/129-221.EG-----------------L---------DWCNAGWLSDGTVQYPII----------------------------QPRP
U3K2S4_FICAL/2229-2321.MG-----------------F---------HLCLVGWLDNGTAGYPTA----------------------------YPNP
W5KJN6_ASTMX/559-654.QG-----------------F---------DKCRAGWLLDHSVRYPIN----------------------------NPRP
I3KUU2_ORENI/263-358.EG-----------------L---------DRCSPGWLSDGSVRYPII----------------------------TPRE
G1KSH3_ANOCA/2201-2293.AN-----------------Y---------HMCAAGWLADGRAAYPIA----------------------------YPSP
H2MVR1_ORYLA/2188-2279.GG-----------------L---------NMCAAGWLDQARVAYPTT----------------------------YSNP
F1QR32_DANRE/251-342.SG-----------------L---------EHCGPAWVSDGTLRVSVG----------------------------PRGS
H3CE81_TETNG/448-542.AG-----------------Y---------HQCDAGWLMDQTVRYPII----------------------------SPRD
H0UZZ3_CAVPO/256-351.GG-----------------L---------DRCSPGWLADGSVRYPIV----------------------------TPSQ
C3ZYF8_BRAFL/3-96.DG-----------------Y---------ERCACGWLTDGAAHYPMQ----------------------------EARY
H3BAD0_LATCH/483-577.AG-----------------Y---------EQCDAGWLSDQTVRYPIV----------------------------NVRQ
G3T4I8_LOXAF/263-353FRG-----------------L---------DRCDAGWLADGSVRYPVA----------------------------HPRP
E9QHN0_DANRE/150-244.DG-----------------F---------EQCDAGWMADQTVRYPII----------------------------RPRD
G3U8V2_LOXAF/271-361LQL-----------------L---------DRCTAGWLADGSARYPIV----------------------------NPRA
L5LVH7_MYODS/44-129.SG-----------------F---------ETCSYGWVADQVVVIPRI----------------------------RPNP
G7PQQ7_MACFA/47-129.AS-----------------F---------ETCSYGWIGDGFVVISRI----------------------------SPNP
E7F537_DANRE/496-591.AG-----------------Y---------HQCDAGWLSDQTVRYPIV----------------------------SPRH
W5MX80_LEPOC/2209-2300.LG-----------------F---------HLCTAGWIDGTRVGYPIT----------------------------FPSV
H0ZUW2_TAEGU/155-245IQL-----------------L---------DRCEAGWLADGSIRYPIV----------------------------NPRA
G3P4E1_GASAC/27-116.RG-----------------L---------EMCKFGWIAEQIAVVPRL----------------------------TADK
M4AV85_XIPMA/622-716.LG-----------------L---------DKCRAGWLLDRSVRYSVN----------------------------SPRP
I3KEY0_ORENI/273-362LMG-----------------L---------DHCDAGWLADGSVRYPIT----------------------------KARA
G3Q0U6_GASAC/146-239.EG-----------------L---------DWCNAGWLHDGTVHYPII----------------------------RPRP
H2UD03_TAKRU/154-248.DG-----------------Y---------EQCDAGWLADQSVRYPIQ----------------------------VPRH
G3T4I8_LOXAF/162-256.EG-----------------L---------DWCNAGWLQDASVQYPIM----------------------------LPRQ

PF03440

TOX3_BORPE/31-117--------------------ALFTQQGGAYGRCP----NGTRALTVAE-------LRG-------------NAELQTYL-
TOX2_BORPE/30-116--------------------EQITQHGGPYGRCA----NKTRALTVAE-------LRG-------------SGDLQEYL-
A0KFE5_AERHH/24-105--------------------LRLFSLG..QEVCG----DKYRPITREE-------AQS-------------...VKSNI-

PF07979

EAE_ECO27/839-939--------------------SKRVTYNDAVNTCK..NFGGKLPSSQNE-------LEN......VFKAWGAANKYEYYKS
Q846P2_ECOLX/838-938--------------------NERMTYNNAMSSCQ..SLSGRLPSSQKE-------LAD......VFDTWGAANKYEHYKT
Q9S6R2_ECOLX/838-939--------------------NTRVTYFDAENKCK..TNSANLAQSKEL-------LAN......IYSTWGAANKYPYYSG
Q8KRL2_ECOLX/838-937--------------------NGKVTYDEANSICL..GNSAHLSASVDT-------LKK......VYSQWGPASKYEHYT.
O06896_ECOLX/839-940--------------------INRMTYSAAENKCR..TISANLAPSKSI-------FGD......TYSKWGAANKYSYYSG
Q8KRK8_ECOLX/838-938--------------------DSRVNYNSASSICG..KINGSLPSSIAE-------LET......LYNKWGAANNYQHYT.
A0A024Z842_ECOLX/840-935--------------------..KASYANAMSFCG..NL...LPSSQTV-------LSN......VYNSWGPANGYDHYRS
Q9LBG6_ECOLX/835-936--------------------INRMAYSEAESRCQ..AISSNLAQSKSV-------LEN......IYSKWGAANKYPYYSS
E7UB01_ECOLX/838-937--------------------SVKVKYDEASGICS..NNAAYLSVSVDS-------LKK......LYSQWGPANKYSHYT.
Q9R8B4_ECOLX/839-934--------------------..QAYYADAMSICK..NL...LPSTQTV-------LSD......IYDSWGAANKYSHYSS
INVA_YEREN/735-833--------------------MSLQSSVEASRNCQRTDFTALIESARAS-------NGSRSPDGTLWGEWGSLATYDSAE.
Q8RSS9_ECOLX/842-948--------------------QNKVIYSVAEATCS..TNSGRLPSSTSE-------LKD......VYNKWGAANSYEGYKG
Q8KRL0_ECOLX/839-939--------------------SKRVTYNDAVNTCK..ILGGRLPSSQDE-------LKN......VFNTWGAANKYEYYKS
Q8KRL1_ECOLX/842-948--------------------QDKVLYNVAKTKCE..MNSGRLPSSTSE-------LKD......VYNQWGPANSYDGYKG

PF05473

A5A7J2_9ALPH/19-219ALGVLMTTAILVSTFI....LTVPIGALRTAPCPAETFGLGDECVRPV-------LLNASSNTRNISGVGAVCEEYSEMA
G9I267_HHV2/4-171GVGAIVGAFALVAALV....LVPPRSSWGLSPCDSGWQEFNAGCVAWD-------PTPV.....EHEQAVGGCSA.PATL
O89243_9ALPH/3-191TIGIALTVFVITATVVLASLFAFSYMSLESGTCPHEWIGLGYSCMRAM-------GSNA.....TELEALDTCSRHNSKL
O56871_ILTV/33-274FLGLLIFMFVISTVMA....FALPNSTWEGGLCPPDWIQHLDSCYRAG-------GGPP...QDTYENAKLSCRALGGKI
EV45_GAHVM/3-192TIGIILTMFVIATTLLLASLFAFSYMSLESGTCPKEWIGLGYSCMRVA-------GNNA.....TELEALDMCAQHNSKL
Q5Y0Q7_9ALPH/5-173LAGVVLGVVLVLAGLV....LAVPRAAWGLAPCGAGWLEFNAGCLAWD-------PTPT.....DYEGAAGGCRA.PATL
D3YPA9_HHV1/4-171GVGTIIGGVVIIAALV....LVPSRASWALSPCDSGWHEFNLGCISWD-------PTPM.....EHEQAVGGCSA.PATL
EV45_EHV4/19-218AMGVLMTTTLLVSTFV....LTVPMVALRTAPCPAQTFGLGDECVRPV-------SLDA.YNSSNSSEIGAVCGAYSEMP
EV45_MEHVH/3-193TIGMVFTIFVLVAAVLLGSLFTVSYMAMESGTCPDEWIGLGYSCMRVA-------GKNA.....TDLEALDTCARHNSKL
Q66077_9ALPH/2-174AAGILLTIAAIIFTFI....FTVPLEMLGSINCPPSTFGIDNVCIEPI-------KKSI....NSYSELSKICYDRLSNP
Q69365_FHV1/7-189FFGVILTATIIVCTFI....FTIPVDMLQMPRCPEETVGIKNCCIRPI-------RRHV....KSHQDLVATCAEYMEQP

PF05966

Q9Q8V7_RFVKA/1-172SEDCANQ--SAVLPFKTLKDHW-------MWDYLEGTWGVDGYGIVELV..DLNTYDVSVE-------------------
Q8V3H7_SWPV1/1-185VKSCMKN--KGNLPSSDLMKTW-------LSDYLDGTWGEEGRGLSKEK..TILEVDISTE-------------------
Q08FM0_DPV83/7-191SMDCAGK--GYSLPATNLMSKW-------IGDYLESTWGEEGYGLSKERGGNIESPDASTE-------------------

PF00059

F1M5M2_RAT/203-312SGFCAYL.........ERAAVA-------GLKA..----------------....NPCTSM-------------------
F1RK81_PIG/131-264VVLCAQLQRFH.FPTLRHRDLH-------SWRA..----------------....ESCQD.-------------------
F1P2W2_CHICK/678-795AGFCGYL.........AEPSSQ-------GLKA..----------------....ATCINE-------------------
LYAM3_MOUSE/49-160NQDCVEIY......IKSNSAPG-------KWND..----------------....EPCFK.-------------------
ASGR2_HUMAN/194-302SEDCVEV...........QPDG-------RWND..----------------....DFCLQ.-------------------
ASGR1_HUMAN/171-279GEDCAHF...........TDDG-------RWND..----------------....DVCQR.-------------------
SFTPD_RAT/269-374AENCVEI...........FTNG-------QWND..----------------....KACGE.-------------------
FCER2_HUMAN/180-284GEDCVMM...........RGSG-------RWND..----------------....AFCDRK-------------------
Q9N3W1_CAEEL/37-145NYFSEKI............SNA-------KWDT..----------------....LGDND.-------------------
E4Y143_OIKDI/82-193ANKCGIYTFDIVDADNGTISQD-------KPVTQA----------------GISLIDCIE.-------------------
E5RY41_TRISP/53-163DIECAAFR......RVDNIIGG-------YVCL..----------------....HSCRS.-------------------
E3LCH6_CAERE/1231-1343MNQCVYYD.......GRADPKK-------AWVT..----------------....DSCST.-------------------
E3LJN0_CAERE/2714-2811NTQCGWL..........SARTR-------RIGD..----------------....VNCNI.-------------------
VGA7_ALHV1/126-224SVYCAYL.........TRRSRS-------TVYF..----------------....TDCTT.-------------------
LYAM1_HUMAN/46-157KEDCVEIY......IKRNKDAG-------KWND..----------------....DACHK.-------------------
LYAM3_HUMAN/49-160NEDCVEIY......IKSPSAPG-------KWND..----------------....EHCLK.-------------------
Q9Q8H9_MYXVL/64-168DASCYVY............KLN-------GIQE..----------------....ILCNV.-------------------
Q6TUP6_YMTV5/64-166NSICFIY............KMG-------ELKG..----------------....VICNV.-------------------
MRC1_HUMAN/1252-1357RNDCVAL..........HASSG-------FWSN..----------------....IHCSS.-------------------
CLC4F_RAT/429-538REDCVHL.............QR-------MWND..----------------....MACGT.-------------------
LECH_CHICK/98-203NEDCAHV...........WTSG-------QWND..----------------....VYCTY.-------------------
LYAM2_CANFA/30-141DEDCVEIY......IKRDKDSG-------KWND..----------------....ERCDK.-------------------
MBL2_RAT/140-242GENCVVL...........LTNG-------KWND..----------------....VPCSD.-------------------
SFTPA_MOUSE/144-248KEKCVEM...........YTDG-------KWND..----------------....KGCLQ.-------------------
NKG2D_HUMAN/116-213KGDCALY...........ASSF-------KGYI..----------------....ENCST.-------------------
Q8V3H6_SWPV1/63-165NECCYTY............KMG-------ELKE..----------------....TVCNI.-------------------
REG3B_MOUSE/57-173RAFCGSL........SRASGFL-------KWRD..----------------....MTCEV.-------------------
MRC1_HUMAN/966-1081DADCVVII......GGASNEAG-------KWMD..----------------....DTCDS.-------------------
CD72_HUMAN/250-352SSKCNKV........HKTWSWW-------TLES..----------------....ESCRS.-------------------
C3XRG9_BRAFL/43-156DSDCVLMA.......TGLIPRW-------DWWT..----------------....EDCSK.-------------------
E9GSY7_DAPPU/251-368KGQCVRA........STANADQ-------SWAL..----------------....SSCES.-------------------
MBL1_RAT/134-236GEDCVTI...........VDNG-------LWND..----------------....ISCQA.-------------------
ASGR2_MOUSE/187-295GEDCAEI...........LSDG-------HWND..----------------....NFCQQ.-------------------
SFTPD_BOVIN/264-369SENCVEI...........FPNG-------KWND..----------------....KVCGE.-------------------
SFTPD_HUMAN/270-375SEDCVEI...........FTNG-------KWND..----------------....RACGE.-------------------
LYAM2_MOUSE/29-140NEDCVEIY......IQRTKDSG-------MWND..----------------....ERCNK.-------------------
REG3A_HUMAN/57-173PGHCASL........SRSTAFL-------RWKD..----------------....YNCNV.-------------------
KLRBA_RAT/111-212KDSCASV............SQD-------KVLS..----------------....ESCDS.-------------------
SFTPA_RABIT/143-247REKCVEM...........YTDG-------KWND..----------------....KNCLQ.-------------------
SFPA2_HUMAN/144-248KEQCVEM...........YTDG-------QWND..----------------....RNCLY.-------------------
Q9N3W8_CAEEL/37-145NYFTENI............SDA-------KWET..----------------....LDDNG.-------------------
Q06ZZ3_CPRVZ/55-157HPFCAVW.............AP-------KPLA..----------------....EPCSN.-------------------
Q5BK59_RAT/247-352QSSCYLI........KCYHSWW-------YESS..----------------....YTCTD.-------------------
MRC1_HUMAN/521-627KPGCVAM........RTGIAGG-------LWDV..----------------....LKCDE.-------------------
CLC87_CAEEL/103-224LANCAAS..........YKSPS-------SLESAS----------------YTYFYPCTY.-------------------
MBL2_HUMAN/144-246DEDCVLL...........LKNG-------QWND..----------------....VPCST.-------------------
C3XXU7_BRAFL/313-420LDLCVLL.........DSSDNY-------KAKT..----------------....AFCTE.-------------------
MRC1_HUMAN/380-488QEDCVVM..........KGKDG-------YWAD..----------------....RGCEW.-------------------
KLRBA_MOUSE/111-212NDSCAAI............SGD-------KVTF..----------------....ESCNS.-------------------
REG3A_RAT/56-172RGNCGSL........TATSEFL-------KWGD..----------------....HHCDV.-------------------
O17575_CAEEL/2720-2817NTQCGWL..........RSRSK-------KIEQ..----------------....ANCNL.-------------------
B4KGI3_DROMO/50-166SGECVAA........SFGGKSQ-------SWDL..----------------....GTCES.-------------------
SFTPA_CANFA/144-248KEQCVEM...........YTDG-------QWNN..----------------....KNCLQ.-------------------
O62171_CAEEL/239-356FPRCSPMLEM...LEGVTYVTD-------GWIN..----------------....VPSNF.-------------------
F6XBY4_XENTR/135-267NILCAQLQCFH.LPSLRHLGLH-------SWYA..----------------....ENCYE.-------------------
H2TF65_TAKRU/131-265SVFCAQLQRFQ.IKSMNERGLH-------SWHA..----------------....ENCYK.-------------------
H3CYY2_TETNG/729-839AGFCGYL.........AEPASS-------SLKA..----------------....QSCINP-------------------
Q8MJ16_BOVIN/792-906AGFCGIL.........SEPSTR-------GLKA..----------------....ATCINP-------------------

PF01413

T1ID05_RHOPR/1486-1593FIFCSPN...QVCDYASRSDYS-------YWLST..............LEPMPFMMTPIAA............ANMGKYI
U6HG85_ECHMU/1508-1613MTVCESG...SVCHTNMRHERS-------YWLAT................LKPRSEEPLPI............EELDGRI
C3YKJ6_BRAFL/595-702FMSCEPD...DTCNYASRDDKT-------YWLSTV..........E.TSAEKPLI..PVRG............LEIKKFV
G7Y6J4_CLOSI/1487-1601VIECNNNA..GTCHYWS.DAKV-------YYLRAL.....DHS..KTQFEK.PQGFTMKAAE...........GPVISNV
CO4A1_BOVIN/116-227FIECHG.R..GTCNYYA.NAYS-------FWLATI.....ERS..E.MFKK.PTPSTLKAG............E.LRTHV
V8P2H6_OPHHA/592-698FLLCNTQ...AVCRFASRNDYS-------YWLST..............ETPMPEDMAPISG............RDLESYI
B7Q188_IXOSC/1169-1276FLFCSLN...NVCNFASRNDYS-------YWLST..............PEPMPMAMTPIVG............RDIQKFI
G3NKN3_GASAC/350-461FIECHG.R..GTCNYYT.DSYS-------YWLAAL.....NPA..D.MFSK.PTPQTDSGD............F.PARLI
B4KGC9_DROMO/1668-1780FIECNGAK..GHCHFYE.TMTS-------FWMVTL.....EDN..D.QFNK.PEQQTLKAG............N.LLSRV
G3PLA6_GASAC/1558-1669FIECHG.R..GTCNYYP.DSYS-------YWLASL.....DPR..S.MFSN.PVPQTVKGP............S.LQSVI
M4AMB5_XIPMA/1525-1634FIECQGAQ..GSCHYFS.NLYS-------FWLTTV.....RDR..E.EFVP.VKPGTIKAA............DQQRHKA
E5SK06_TRISP/1694-1805FIECHG.R..GTCNHYA.TNHA-------FWLAVI.....DRD..M.MFKK.PYSETLKAG............G.LKQRV
B3MP84_DROAN/1557-1662MLSCGQN...NICNYASRNDKT-------FWLST..............SAPLPMM..PVEN............YEINKYI
D6WLB9_TRICA/1645-1756FIECHG.H..GRCNYYT.TILS-------YWLATI.....EDS..A.MFQK.PRSETLKAG............Y.LTSRV
H1A1E6_TAEGU/68-181FIECQGQR..GTCQYFA.NEYS-------FWLTTV.....MPE..L.QFASAPLSGTLKEG............QEQRKKI
J9JR68_ACYPI/1664-1776FIECNGAR..GTCHYFA.NTMS-------FWMATI.....DPD..E.QFTS.PKRQTLKKD............D.SRTRI
H2TV78_TAKRU/1005-1117IIECQGPQ..GSCHYFS.NLYS-------FWLTTI.....SPT..E.QFKA.PRPGTIKAP............DRQRSKT
G4V697_SCHMA/1361-1468FANCFAKVN.GHCQVNMRNGRS-------YWLST................LEQYMLSPARV............ENIKPYI
F6XEM0_MACMU/252-366FLECQGRQ..GTCHFFA.NEYS-------FWLTTV.....KAD..L.QFSSAPAPDTLKES............QAQRQKI
H9JWX6_BOMMO/1602-1711FIECNG.L..GRCNYFA.TAVS-------YWLSTI.....NDN..W.MFQK.PIQETLKTD............K..DSRV
C3YYN7_BRAFL/329-436FLFCDIN...FVCNFASRDDKS-------YWLSTV..........A.TQRDLPDK..PLKG............RRILDLV
G1KCR9_ANOCA/1458-1564FLVCNPN...NICRFASRNDYS-------YWLST..............AEPMPSDMKPISG............KALEPYI
E0VEK8_PEDHC/1629-1740FIECHG.V..GRCNYFS.NSYS-------YWLSTL.....NER..D.MFSK.PRQQTLKAG............L.LETRI
B0WDA5_CULQU/1510-1617YLFCDIN...NVCNYATNNDDS-------IWLAS..............PEPMPMSMAPMKS............REVAQYI
H2LZX2_ORYLA/1532-1645FIECNGAK..GTCHYFA.NKYS-------FWLTTV.....DPK..R.EFVSSPNQETLKAG............Q.ERSRV
K1R004_CRAGI/72-175IMFCNIN...TVCNVAWRNDYS-------YWLST..............REPMLPMMNPVEG............PALQRYI
U6HLY4_ECHMU/1554-1662FASCFSSPPSGACHFNMRNGRS-------FWLST................LEHYMTEPLPV............ERIQRYI
B3S7P7_TRIAD/67-172FAYCNGN...NLCHRGGNSMVT-------YWLST................SLTPAMMTLTG............LNIRPYI
T1GCH0_MEGSC/798-904VIECHG.H..GKCNYYD.PVQS-------FWLAVI.....GED..R.QFSK.PIPQTLKSD.................QS
C3YYY5_BRAFL/58-187FIECHGAR..GTCGFFA.NKFS-------FWLASVPRNYNPDQ..N......RDPYEPQDGPCEEMIRTQQARTEMERMV
W5KGN1_ASTMX/1375-1482FLFCNSD...STCHYASRNDYS-------YWLST..............EVPMSKDAPPISE............GFIQQYI
G4V697_SCHMA/1472-1585FIECNNHD..GNCFHWQ.DGRS-------YWMSSI.....RQN..E.QFIK.PIGTTYNTE............TGILQHV
H0ZD00_TAEGU/698-809FIECHG.R..GTCNYYT.NSYS-------FWLASL.....NPR..R.MFRR.PVPQTLKAG............Q.LENII
T1ID48_RHOPR/1487-1592FLFCDVH...NVCNYASRNDRA-------YWLST..............AEPMSMM..PVEE............SAIQKYI
G1KC91_ANOCA/1562-1676FIECQGQR..GTCHFFA.TAHS-------FWLTTI.....KPE..L.QFTSSPVSETLKDE............RQQRQKT
M3ZRX3_XIPMA/134-239FLICETG...EECRYAERNDFS-------YWLSN..............IRSSTNQTDPEAA..............LESKI
H3AGX1_LATCH/1534-1644FLFCQQKS..NNINEYT.KFVD-------LFISFV..........FLLLNRKPQSETLKAG.............ELQMRV
H3AVQ2_LATCH/1396-1501FAYCNIK...EICYYAERNDKS-------YWLST..............TAAFPMA..PVSE............EEIEPYI
I3JUM0_ORENI/1491-1603FIECQGAR..GSCHYFA.NLYS-------YWLTTV.....SPA..E.QFIT.ASPGTIKAT............DQQRHRT
J9EZI1_WUCBA/240-345FLFCDFN...NVCNYASRNDKS-------YWLST..............TAPIPMM..PVNE............QGIEPYI
F6XFD7_CIOIN/1621-1732FIECNGAR..GHCFFYN.NQYS-------FWLTTI.....SEE..N.QFGT.PEMETLKAG............N.LRTRV
B0WDA4_CULQU/1453-1558ILACGQN...NVCNYASRNDRT-------FWLST..............SAPIPMM..PVSE............HEMRPYI
H2TDN6_TAKRU/1497-1608FIECHG.R..GTCNYYP.DSYS-------FWMASL.....DPK..N.MFGK.PIPQTVKEP............S.LQSIL
H2TDN6_TAKRU/1387-1494FLVCDTE...SNCRYASRNDYS-------YWLST..............GKALPENMVSITG............DMLASYI
I3IXK0_ORENI/1447-1554FLICSPG...QNCLYAAHNDLS-------YWLST..............NKLVAEGLPFVSN............GSLSNYI
D6WLB9_TRICA/1535-1642FLFCNLN...DVCDYAQNNGYS-------YWLST..............TEPMPAMMTPIPA............PEVRRYI
W5KH26_ASTMX/1396-1500FAYSN.P...GICNYASRNDKS-------YWLST..............SVALPMM..PVSG............LSIQPYI
Q7PVR6_ANOGA/670-777FMFCDIN...NVCNYASNNDDT-------IWLAT..............PEPMPMSMAPIPA............DQVERYI
Q9VMV5_DROME/1516-1623YMLCDIT...NVCHFAQNNDDS-------LWLST..............AEPMPMTMTPIQG............RDLMKYI
G3WDY8_SARHA/1171-1282FIECHG.R..GTCNYYA.NSYS-------FWLATV.....EAS..D.MFSK.PQPETLKAG............D.LRTRI
C3ZDE0_BRAFL/114-225FIECNGAR..GTCHYFA.NKFS-------FWLSTI.....SQN..E.QFAD.PVPETLKAG............Q.LRTRV
D6WLB7_TRICA/1694-1806FIECNGAQ..GTCHYFA.NTLS-------FWLATI.....EPY..Q.EFQK.PQKQTLKAG............N.VRDRI
T1IZ15_STRMM/1635-1746FVECQG.N..GRCNYFT.TQYS-------YWLATI.....EQH..D.QFRT.PQSQTLKAG............D.LRNRI
I3LDI9_PIG/153-260FLFCNIN...DVCNFASRNDYS-------YWLST..............PALMPMDMAPITG............RALEPYI
B7Q188_IXOSC/1279-1390FIECHG.H..GRCNYYT.TAYS-------YWLATI.....ERN..D.MFRP.PDPQTLKAG............D.LRTRV
CO4A2_BOVIN/5-110FLYCNPG...DVCYYASRNDKS-------YWLST..............TAPLPMM..PVAE............EDIRPYI
M3ZRX3_XIPMA/242-353FMECSGSS..GTCKYDN.SLYS-------YWLAAL.....DPD..N.MFRR.PSSWILPGN............N..PDNI
C3ZDE0_BRAFL/5-110FIFCNIN...NVCNFAGRNDKS-------YWLST..............SAPIPMM..PVRD............DAIRPYI
E9IRC9_SOLIN/82-187FLFCDVN...NVCHYASRNDRS-------YWLST..............NSPIPMM..PVEE............TAIEEYI
F1R5V4_DANRE/1438-1545FMVCNRD...ETCRYASRNDYS-------YWLST..............DTPMLPDQQMMSG............EILKWYI
G7Y6J4_CLOSI/1377-1484LTQCERD...SMCQINMRHERS-------YWLAT................SVPRSEKPLPV............NETADRI
F1QW09_DANRE/1446-1550FSCCN.M...DTCDYASRNDKS-------YWLST..............NAPIPNK..PLKG............QDIEEHI
M4AJS4_XIPMA/1454-1558FSVCE.T...KKCKYANRNDKS-------YWLST..............MKPQPDH..PFRG............DAIKEYI
G4V8A7_SCHMA/2868-2983LLECNNGM..SLCNYWS.DAKA-------YYLRHV.....SNN..T.EFQK.PVSQYITDHLPDE........TKVLREI
T1FRZ7_HELRO/1555-1658FLHCDA....TSCEYTGKGEKS-------FWLTT................ATNYTIHPVER............NEIQRLI
T1FST9_HELRO/1255-1360FLFCDSM...KTCNYASRNDRS-------FWLST..............AEALPMM..PVTG............SEISKYL
E4X7Q9_OIKDI/981-1083AKSCRK....GSCKSMT..KLT-------SWLGI..............GDSPPTGPNPVCD..............VKAFI
W4YIV2_STRPU/235-345FIECNG.R..GNCHFFS.NEYS-------FWLTVI.....DEE..D.QFAI.PRKRTIKSG............Q.LQSVV
E5SK06_TRISP/1584-1690FMPCNLN...NECHIASRSDYS-------YWLAT..............EEPMTASMAPVSG............FGIRPYI
K1RH30_CRAGI/1513-1626FIECNGSG..GTCHFYA.NKYS-------FWLTTI.....DQS..QNQFAT.PVQETLKAG............N.QRTRV
J9EZI1_WUCBA/348-460FIECNGAR..GSCHYFA.NKFS-------FWLTTI.....EDD..Q.QFRI.PESETLKSG............S.LRTRV
C3YKJ4_BRAFL/2-108FFSCEPD...DVCKYGYRDDKT-------YWLSTI..........D.NAGQQPAV..PISG............TDIRPFI
K1RH30_CRAGI/1405-1510FLFCNSN...NVCNYASRNDKS-------YWLST..............NEPMPMM..PVRD............PELRRFI
H2M087_ORYLA/509-614FMFCNIN...NVCNFASRNDYS-------YWLST..............PNEMPMS..PVTG............ETIKPHI
C3YKJ4_BRAFL/112-221FIECVSDI....CDVSA.NQLS-------FWLIGIPG...GED..D.QFTQ.PKRVVGNIN............V.LRQRI
W4WSD7_ATTCE/1399-1506FLFCNLN...NVCDYANRNDYS-------YWLST..............TEPMPMMMTPIPA............PEIGRYI
T1L4B8_TETUR/1360-1471FIECSGAR..GTCQYFG.NKLS-------FWLATI.....NEK..T.QFEK.PEGGTFKKE............H.LRSKI
T1EG21_HELRO/620-730VFECHG.D..GKCNHYA.NHIS-------YFLSVL.....DRF..N.QYSK.PMSDTYKAA............N.LMNKI
G4V8A7_SCHMA/1398-1505MTQCERD...TTCQSSMRHERS-------YWLAT................LVPRSEQPIPV............DQTADQI
T1INC3_STRMM/426-538FIECNGGR..GTCHYYA.NKYS-------FWLTTI.....DPD..K.MFDK.PSSDTLKAG............S.QRSRV
W5MT75_LEPOC/1535-1646FIECHG.R..GTCNYYT.DSYS-------YWLATL.....NRY..E.MFRK.PKPSTLKAD............R.FKSII
I3IXK0_ORENI/1558-1669FIECHE.R..GTCNFYT.NSYS-------YWLAAL.....NPS..N.MFRY.DTPLAGEPG............E.SSNRI
W5KH26_ASTMX/1504-1616FVECQGEH..GTCNFFP.SIYS-------YWLTNV......EQ..Q.AIKPVPEKTVLKEE............LEQRDNT
U6IF53_HYMMI/1667-1784LLECNNGM..SLCNYWS.DAKA-------YYMRHV.....QNS..T.SFQK.PQGQYMRESTYGD........AGVLREI
F6VJG0_CIOIN/1571-1682FIECHG.R..GTCNQYA.NGYS-------FWLATI.....MPQ..N.QFRQ.PISETLKAG............T.LRQRV
C3Y8Z7_BRAFL/28-134VMSCTAR...NVCENSTVKVST-------SWLSS..............GIHPPAVGEDQSD............DARARAV
F1QYN1_DANRE/1552-1664FIECNGAR..GTCHYFA.NKYS-------FWLTTV.....DVN..E.QFVQGPTQETLKGD............Q.FRSRL
T1IZ15_STRMM/1525-1632FMFCNLN...NVCYFANRNDYS-------YWLST..............PEPMPMMMTPIEG............RDIEKFI
W4WSD7_ATTCE/1509-1619FIECRG.L..GSCNYFA.TATS-------YWLATI.....HDD..E.MFRK.PLQQTLKAD..............HTSRV
W5L7X5_ASTMX/1573-1684FIECHG.H..GTCNYYG.NSYS-------FWLATV.....DTN..E.MFSK.PQSETLKAG............N.LQTRV
A7SQ52_NEMVE/112-223FIECHG.R..GTCHYYG.STYS-------FWLATV.....DQN..K.QFRI.PRPETLKAG............N.LRERV
K1QZZ6_CRAGI/238-349FIECHG.N..GRCNHYA.TPYS-------FWLATL.....RAY..E.EFRT.PISETLKSG............S.QKQRI
T1EG21_HELRO/510-617YLFCGSN...QVCSMATRSDST-------YWLAT..............EQDMTATMATVSN............EQIRPYI
B0WDA5_CULQU/1620-1730VIECHG.H..GTCNFYD.GITS-------FWLTII.....EDG..E.EFNQ.PKQQTLKAD..............QTSKI
G4V8A8_SCHMA/1656-1769FIECTA.K..GLCGFFE.EHKN-------FWLRVM.....PSSMDEHMFGM.VMGTVIKVR............N.SQDSV
H9KBV4_APIME/1508-1615FTFCNLN...NQCNYADREEFS-------YWLST..............TEPMPMSMAPIPA............PQVGRYI
W5LJS4_ASTMX/114-218FSYCN.S...ASCKYASRNDKS-------YWLTT..............NRPVPMM..PVAG............GEIHQYI
Q9VMV5_DROME/1626-1736VIECHG.H..GRCNYYD.ALAS-------FWLTVI.....EEQ..D.QFVQ.PRQQTLKAD..............FTSKI
B4NRX0_DROSI/205-317FIECNGAK..GTCHFYE.TLTS-------FWMYNL.....DSS..E.PFDM.PQQQTIKSG............K.QQSYV
E9IRC9_SOLIN/190-302FIECNGAK..GHCHYYS.NQYS-------FWMVTI.....EES..Q.QFRS.PEKQTLKAG............N.LRSRI
E9GYE4_DAPPU/267-374FLFCNLD...NVCNYASRNDYS-------YWLST..............PEPMPMMMTPITG............NELTRYV
F1R5V4_DANRE/1548-1656FIECHG.R..GTCNFYP.DSYS-------YWLASL.....DHT..N.MFSM.PNRQTAK................QKEII
E0VEK7_PEDHC/2309-2414FLFCDFN...NVCNYASRNDKS-------YWLST..............NSPLPMM..PVEE............TAIRQYI
F6VJG0_CIOIN/1461-1568FMFCAVD...NSCRVASRNDYS-------FWLST..............PEPFPMSMEAVTG............SAIEPYI
K7I6X3_CAEJA/317-428FIECHG.R..GTCNYYA.TNHG-------FWLSIV.....DQD..K.QFRK.PMSQTLKAG............G.LKDRV
U6HLY4_ECHMU/1665-1777FIECNNHH..GNCFHWQ.DGRS-------YWLRAM.....TFN..E.QFTK.PAGATYKTD..............LLRQV
X1WQB7_ACYPI/360-471FIECHG.I..GRCNFYT.TAYS-------YWLSTI.....EDR..D.MFRK.PRPQTLKQN............T.LQTRI
A7SQ52_NEMVE/4-109FLFCNIN...NVCNLASRNDYS-------FWLST..............PEPIPMM..PVQE............TNVQPYI
F1QW09_DANRE/1554-1665FVECQGPR..GTCSYFA.SIYS-------FWMT.IDMEHNDSS.........PHGPVITEE............RQQRDST
C3XSD7_BRAFL/244-353FMQCQDG...NLCNDESAQETT-------LWLAAE..........N.GLPPLVAGQSAPSE............EAVMSAL
G6DMY2_DANPL/1689-1794FLFCDLN...DVCNYASRNDRS-------YWLST..............NLPIPMM..PVNN............NEISRYI
H9KBV4_APIME/1618-1728FIECRS.K..GTCNYFS.TATT-------FWLTTI.....KDY..E.MFRK.PIPQTLKTD..............HTSRV
F1QYN1_DANRE/1443-1548FLYCTAN...EICYYASRNDKS-------YWLST..............TAAIPMM..PVAN............QEISPYI
CO4A1_BOVIN/6-113FLFCNIN...NVCNFASRNDYS-------YWLST..............PEPMPMSMAPITG............ENIRPFI
H3AVQ2_LATCH/1504-1618FIECQGAR..GTCHYYA.SKYS-------FWLTTV.....QHD..Q.QFAPAPKSETVNEE............GLVRQRV
W4YIV2_STRPU/127-232FLFCNFN...NVCNYASRNDRS-------YWLTT..............NEPLPMM..PLMN............QQIDPYI
W5MT75_LEPOC/1425-1532FLFCSTN...NTCNYASRNDYS-------YWLST..............DEQMSKDNAPIMA............EGAEKFI
E0VEK8_PEDHC/1519-1626FMPCNLN...NVCEYSSRNDYS-------YWLST..............SEPMPMMMTPIQP............PDLKKYI
F6XFD7_CIOIN/1513-1618FMYCNTQ...SVCKYGSRNDKS-------YWLST..............TAAIPMM..PVSV............DMVPEYI
C3YYX1_BRAFL/102-217FIECHGAR..GTCGFFA.NKFS-------FWLASV......................PADGRVREMVRNQQPVTEMEKMV
B4NRX0_DROSI/97-202VMSCGQN...SVCNYASRNDKT-------FWLTT..............NAAIPMM..PVQN............NEIRQYI
I3IXM4_ORENI/1411-1514FAPCN.K...HTCSYASRNDKS-------YWLTT..............MEPVPRE..HVSG............VNIKKYI
T1L4B8_TETUR/1252-1357FLFCGLN...QACSYASRNDKS-------FWLST..............NKPIPLR..PVKE............DAIQDFI
T1FST9_HELRO/1364-1474FIECSTER..GSCHYYP.DKVS-------FWLSAF.....EPY..E.QFEK.PQHNKYQGG............N.LRDYV
B3S7P5_TRIAD/1401-1510FIECNS.R..GTCINTV.GGLS-------FWMKAI.....NAS..Q.QFDP.PTQQVLSAS............A.TSSEI
T1FRZ7_HELRO/1662-1772FIECV..E..GKCQFPM.NDMS-------YWMTTV.....DVN..S.QFLT.PNSRTLKAG............S.LRSVI
U6HG85_ECHMU/1616-1731VIECNNNA..GTCHYWS.DAKV-------YYLRSI.....PESLEE.QFSK.PFGLTLKAGD...........GPTVDSV
F6XEM0_MACMU/144-249FAYCNIH...QVCHYAQRNDRS-------YWLAS..............AAPLPMM..PLSE............EAIRPYV
H2RQC6_TAKRU/392-502FVECQGPR..GTCHYFA.NIYS-------FWLTSVELHGAENN.........SAAFTLTDA............WQQRDSV
C3YYN7_BRAFL/439-564FVECHGAQ..GTCHFFA.NKFS-------FWLASIPDFYTPNQ..N......PDAYEATSGYVTEMPKVGLQLNDIEMRI
T1INC3_STRMM/318-423FVFCDFN...NVCNYASRNDKS-------FWLST..............NAPIPMM..PVSE............NAIRSYI
Q7PVR6_ANOGA/780-890VIECHG.H..GTCNFYD.GISS-------FWLTII.....DDA..M.QFNR.PQPQTLKAH..............QTSKV
G7Y6J5_CLOSI/1648-1763LLECNNGM..SLCHYWS.DAKA-------YYLRHV.....SNG..T.EFQQ.PTGKYISERQPDD........TTVLREI
W5KGN1_ASTMX/1485-1596FIECHG.R..GTCSFYT.DSYS-------YWLAAL.....DPT..L.MFSK.PNPKTLKDD............C.QQRII
E9GYE4_DAPPU/377-488FIECQG.H..GRCNYYA.TATS-------YWLSTI.....EED..R.QFAK.PLPQTLKAG............D.LTSRI
G4V8A7_SCHMA/2756-2862FFQCLRD...GSCQLGVRADRS-------YWLAT................TEPLPMMPLNV............SEVHRRV
G3PLB8_GASAC/1546-1658VIECQGAR..GSCHYFA.NIYS-------FWLTTV.....SET..E.QFVT.QRSGTIKAA............ERQRRKA
F6TRQ1_ORNAN/140-245FVYCNID...EVCHYASRNDKS-------YWLST..............TAPIPMM..PVGR............AQIPQYI
K7I6X3_CAEJA/207-314FMFCNMN...SVCHVSSRNDYS-------FWLST..............DEPMTPMMNPVTG............TAIRPYI
M4AMB5_XIPMA/1415-1519FSYCD.K...DACYYSSRNDKS-------YWLST..............TAPISMM..PLFD............QEISLHI
C3YKJ6_BRAFL/706-819FIECQGSL..GTCDIIG.NSLS-------FWLTDVPE...DEV..Q.QFQR.PQAQSGTIF............T.MRNLL
G3PLA6_GASAC/1448-1555FLFCDTE...SNCRYASRNDYS-------YWLST..............DTPMPTNMASITG............DTLATYI
I3JUK2_ORENI/1430-1537FLFCDTE...NTCRYASRNDYS-------YWLST..............DTPMPMNMVSISG............EMLKSYI
C3ZDD7_BRAFL/4-111FLFCNIN...NQCQVASRNDYS-------YWLST..............PEPMTMSMAPIRG............RAIEPYI
H9JWX6_BOMMO/1492-1599YLFCNLN...NVCDFAQREDYS-------FWLST..............PEPMPMAMTPIQA............RDVGTYI
B3S7P5_TRIAD/1291-1396YMFCSLN...QRCDIATRLGVS-------YWLSA................SLAPSYVPISG............SNIAPYI
G6DMY2_DANPL/1797-1909FIECNGEG..GTCHHFA.NKLS-------FWLTTI.....DDK..K.QFAK.PERETLKSG............R.LLQRV
K7IPX3_NASVI/1375-1482FNVCNLN...NVCDYANRNDYS-------YWLSS..............NEQMPMSMTPIPS............REVGAYI
H0VSI7_CAVPO/1423-1530FMFCNIN...NVCNFASRNDYS-------YWLST..............PEPMPMNMEPLKG............QSIKPFI
G3NH33_GASAC/256-367FIECNGAK..GACHYFA.NEHS-------FWLTSI......DR..S..FHTEPASETLKAG............Q.LLSRI
B3S7P7_TRIAD/175-288FIECDGPS..GSCFFYS.NSKS-------FWVTAV.....NVT..D.QFEP.PTATVLNFN............DNPQSYI
X1WQB7_ACYPI/250-357FLFCDVN...EVCNYGSRNDYS-------YWLST..............PEPMPLMMTPILG............LDISKFI
T1ID48_RHOPR/1595-1706FIECNGDR..GTCHHFA.NALS-------FWLVTI.....SPN..E.QFRS.PAKETLKAG............N.LLSRI
T1ID05_RHOPR/1596-1706FIECHG.D..GKCNYYN.FALS-------FWLAIV.....EDR..E.MFRK.PLSQVLKGY............H.YKKRT
W5MTA0_LEPOC/1446-1550FVYCG.D...KVCHYSSRNDKS-------YWLST..............TAPIPAK..PVSD............LEIQQYI
G3NKK3_GASAC/1416-1520FSSCN.M...GTCSYASRNDKS-------YWLST..............TAAIPSL..PVGG............ASIKEHI
G3NKN3_GASAC/240-347FLFCNTD...STCRYASRNDYS-------YWLST..............DQPLPSSVPLISG............DSLRNYI
C3ZDD7_BRAFL/114-224FIECHG.R..GTCNYYA.TTYS-------FWLTTV.....EQG..A.EFRT.PNPETLKAG............N.LRQRI
C3Y818_BRAFL/251-355VTVCGG....KVCTEQP.TQKT-------LWLTS..............GEALPTSQHVTDD.............VLASAV
CO4A2_BOVIN/113-225FIECNGAR..GTCHYYA.NKYS-------FWLTTI.....PEQ..S..FQGTPSADTLKAG............L.IRTHI
F1PHG6_CANFA/1571-1684FIECSGAR..GTCHYFA.NKYS-------FWLTTV.....EER..Q.QFREEPVSETLKAG............Q.LHTRV
G3NKK3_GASAC/1525-1637FVECQGPR..GTCHYFA.NIYS-------FWLTRVEATAPAHE..Q......GSSTTLTNS............WQQRESI
I3LDI9_PIG/263-374FIECHG.R..GTCNYYS.NSYS-------FWLASL.....DPE..R.MFRK.PIPSTVKAG............E.LEKII
G4V8A8_SCHMA/1546-1652FMFCEKQ...ENCYYAQRNDRS-------YWLST...............EEEPMMWNPVPA............NETQRYI
T1GCH0_MEGSC/688-795FMLCELS...NVCNYAQNNDDS-------MWLST..............DEPMNSMMTPIWE............KNILKYI
C3ZSP6_BRAFL/193-300FMFCDIN...FHCHYATRDDKT-------YWLSTV..........T.TEQEIPES..TVDG............PSILPFI

PF00193

F7EKW5_ORNAN/2173-2265..NCGNNH.........VGIVN.......YGVR----------------------ANLLE--------------------
H2V249_TAKRU/245-334..NCGPSE.........PGVRS.......FGFP----------------------PPQ.L--------------------
H3C6Z8_TETNG/32-122..NCARNS.........TGFI........VTST----------------------VTPED--------------------
M4AF12_XIPMA/277-366..NCGPSQ.........PGVRS.......FGFP----------------------APH.M--------------------
H2UTV0_TAKRU/465-559..NCAGNLSQL......PGVRS.......YGLR----------------------PPN.E--------------------
H9H0Q3_MELGA/103-198..RCGGAL.........PGVKTIFQFRNQTGFP----------------------DAQ.S--------------------
E7EYE0_DANRE/2154-2245..RCGSGH.........VGIVD.......YGVR----------------------NNLSE--------------------
H3BAD0_LATCH/584-679..ACGGDK.........PGVRTIYQFPNQTGYP----------------------DPE.S--------------------
H2L317_ORYLA/231-326..QCGGGL.........LGVRTVYLHPNQTGFP----------------------LPE.S--------------------
H9H1H3_MELGA/121-215..PCGGRLLL.......PGIRS.......YGAK----------------------DKQRD--------------------
F6YUQ6_XENTR/161-255..ECGKKDTP.......TGVRN.......YGYR----------------------HKDNE--------------------
M4AP18_XIPMA/155-249..GCEGDLLRR......PGVRT.......YGRR----------------------DPT.E--------------------
H3D6N5_TETNG/90-184..GCYGDREDS......PGVRN.......YGVR----------------------SPD.E--------------------
R4GBT0_ANOCA/33-126..VCNRTG.........SKPQSVKVVDVQIEMD----------------------PSPRG--------------------
F6TXD5_ORNAN/240-323...................VQTVFLFPNQTGFP----------------------DAR.S--------------------
C3Y1K4_BRAFL/989-1073..QCKGGESA.......KGIQ........HFGS----------------------QMHDS--------------------
W5K9E6_ASTMX/11-100..ACGQGR.........VGVI........VW.R----------------------VQLTG--------------------
M3ZEZ9_XIPMA/32-120..NCAKNK.........TGFI..........VN----------------------SYTGD--------------------
F6RUD0_XENTR/42-130..KCGQSK.........TGLV........PWMT----------------------VNAAK--------------------
G3PSB5_GASAC/251-347..QCGGGL.........LGVRTLYKYPNQTGYP----------------------DAS.D--------------------
A7SD47_NEMVE/72-164..DCNTSRDQHSVHRVYYSTTT...........----------------------....K--------------------
W5L2D8_ASTMX/166-260..ACGGTELA.......AGVRS.......YGLR----------------------HKTLD--------------------
Q6PID9_HUMAN/153-247..GCYGDKDEF......PGVRT.......YGIR----------------------DTN.E--------------------
H2S086_TAKRU/390-483..PCGGADNP.......AGLRS.......YGLQ----------------------DRR.S--------------------
C3Y1K4_BRAFL/449-534..SCGDSQIT...................HEGS----------------------REHSE--------------------
M3Y9K7_MUSPF/34-128..PCGGQNTV.......PGVRN.......YGFW----------------------DKDKS--------------------
H3CYG5_TETNG/270-358..NCGPPQ.........PGVRS.......FGFP----------------------PKS.L--------------------
G3P7B0_GASAC/113-206..PCGGNKG........PGLIS.......YGTR----------------------NKQNS--------------------
W5PN42_SHEEP/45-129..KCGKSG.........VGVV........IW.R----------------------SSLGS--------------------
I3KB63_ORENI/6-96..NCSKSM.........IGLI........INTK----------------------VQPDE--------------------
F6PXC5_XENTR/501-595..NCHGDKNGF......PGVRN.......YGVV----------------------NPN.A--------------------
I3KEY5_ORENI/519-614..HCGGSQ.........VGVHTIYAYPNQTGFP----------------------SED.L--------------------
U3IUX8_ANAPL/519-613..NCVGDKESS......PGVRS.......YGMR----------------------PAS.E--------------------
F1QR32_DANRE/150-244..GCFGHTEFS......RGVRN.......YGKR----------------------DPS.E--------------------
H2S086_TAKRU/182-272..NCSPTE.........AAVRF.......VGFP----------------------DKTQK--------------------
W5M456_LEPOC/19-112..VCNSLG.........SGQQSMTAVVVKTENA----------------------STASA--------------------
H3A5H2_LATCH/51-143..NCGFGK.........TGIID.......YGRR----------------------LNKSE--------------------
E7FBG3_DANRE/75-163..NCARNQ.........TDVI..........IK----------------------TSDGK--------------------
C3ZUC3_BRAFL/5-93..SCGSL..........IGVNH..........C----------------------DWQQE--------------------
H3A6L9_LATCH/10-102..KCGQNR.........TGIVS.......YGVR----------------------KSLME--------------------
I3JV73_ORENI/216-308..DCGGTE.........PGVRTVT..PNDTA.D----------------------NTT.A--------------------
Q86W61_HUMAN/251-346..QCGGGL.........LGVRTLYRFENQTGFP----------------------PPD.S--------------------
E1BUN0_CHICK/268-356..NCGPAE.........PGVRS.......FGFP----------------------SKG..--------------------
F1Q4Q0_DANRE/249-344..QCGGGL.........LGVRTMYRYRNQTGFP----------------------DPS.M--------------------
W5KSF4_ASTMX/2192-2284..ACGFGH.........VGIVD.......YGTQ----------------------TDLSK--------------------
Q6PID9_HUMAN/478-572..PCVGDKDSS......PGVRT.......YGVR----------------------PST.E--------------------
H3AUC6_LATCH/32-120..HCASNR.........TGL.........TTVI----------------------GNMST--------------------
H3CE81_TETNG/233-328..QCGGGL.........LGVRTVYLYTNQTGYP----------------------LPE.S--------------------
F1N2Y8_BOVIN/163-257..GCYGDRSSL......PGVRN.......YGRR----------------------DPR.E--------------------
H2MXA1_ORYLA/38-130..NCGFGK.........VGIID.......YGFR----------------------LNKSE--------------------
F6QGU9_XENTR/2171-2263..NCGSGF.........VGIVD.......YGPR----------------------VNLSE--------------------
H2M1W8_ORYLA/238-327..NCSPTE.........AAVRL.......VGFP----------------------DKK.K--------------------
H2L7V4_ORYLA/456-550..HCYGNLYTR......PGVRS.......YGFR----------------------SAT.E--------------------
H2V249_TAKRU/143-237..PCGGLRLP.......PGVRS.......YGRR----------------------HLHLH--------------------
V8P6B4_OPHHA/1137-1229..KCGGGV.........VGIID.......YGIR----------------------VNMTE--------------------
F1R511_DANRE/142-233..KCSGDSEDV......PGVRS.......YNVR----------------------PAH.E--------------------
H2S2Y1_TAKRU/183-278..QCGGGL.........LGVRTMYRFKNQTGFP----------------------EPA.T--------------------
H0ZUW2_TAEGU/54-148..RCGRKDTP.......VGVRS.......YGYR----------------------HKESE--------------------
G3NJP2_GASAC/150-244..GCYGDMDGQ......PGVRN.......YGTM----------------------DQE.D--------------------
W5NA53_LEPOC/559-654..QCGGGK.........AAVHTVYLSPNQTGYP----------------------NLS.S--------------------
M4A2R4_XIPMA/143-237..PCGGVNSR.......PGLRN.......YGLR----------------------NKQMS--------------------
R0LX51_ANAPL/4-97..ICRKTG.........SKQQSVKAIDVKIETD----------------------PFVND--------------------
I3K6I5_ORENI/169-263..RCGGARLA.......PGVRR.......YDRL----------------------HLYPN--------------------
G3PXC4_GASAC/265-353..NCGPPE.........PGVHS.......FGFP----------------------PPQ.H--------------------
F1MKY3_BOVIN/32-125..VCNERR.........GEQQTMRAVDVRVKSS----------------------PVPGG--------------------
H3CYG5_TETNG/171-263..GCGGSA.........PGLRT.......YGEP----------------------HRLLA--------------------
A7RGE0_NEMVE/165-256..NCGGA..........DGVPRV......ESWS----------------------VNGDI--------------------
W5NA53_LEPOC/458-552..NCYGDMNGL......PGVRN.......YGVR----------------------PAD.E--------------------
G3NVP1_GASAC/175-269..SCGGLDLA.......PGLRS.......YGQR----------------------HRHFY--------------------
U3IX07_ANAPL/2191-2283..NCGAGY.........VGIVD.......YGRR----------------------VNLSE--------------------
U3JRF4_FICAL/33-126..ICRKTG.........SKLQSVKAIDVKIETD----------------------PFVND--------------------
W5M859_LEPOC/38-125..KCGKNS.........TGLV........VW.R----------------------AEHSS--------------------
C3Y1K4_BRAFL/25-116..GCTD...........RGVS........RLSS----------------------HQWSE--------------------
H2M1W8_ORYLA/137-231..PCGGSRKG.......PGLRS.......YGQR----------------------NKKLS--------------------
I3IZ94_ORENI/167-260..VCGGELP........SGIRS.......YGPK----------------------DKNND--------------------
E1BUN0_CHICK/167-261..PCGGVHLA.......PGIRS.......YGPR----------------------HRHLH--------------------
I3JZL7_ORENI/18-112..GCEGNLKNR......PGVRT.......YGIR----------------------DPM.E--------------------
G3U8V2_LOXAF/163-264..PCGGAVSPGAGGSTSGGVRN.......YGYR----------------------HNAEE--------------------
Q1LXE1_DANRE/141-235..PCGGARAT.......AGLRN.......YGQR----------------------DKSNS--------------------
F6PXV1_XENTR/200-294..PCGGKDTA.......PGVRS.......YGER----------------------HKHLH--------------------
C3ZUI3_BRAFL/586-672..GCGEAK.........INMCA...........----------------------..WRS--------------------
W5M1S0_LEPOC/221-316..QCGGGL.........LGVRTLYRYRNQTGFP----------------------SPT.E--------------------
H3CE81_TETNG/549-644..ECGGGR.........PGVHTVYAHPNQTSFP----------------------SLD.S--------------------
H2UTV0_TAKRU/255-350..QCGGGL.........LGVRTVYLFHNQTGYP----------------------YPD.S--------------------
V8P5V5_OPHHA/237-332..ICGGNL.........VGVRTVYLYVNQTGYP----------------------YPH.S--------------------
I3ML99_SPETR/46-129..KCGKNG.........IGVL........SW.K----------------------VPVSQ--------------------
E7F6T0_DANRE/33-122..NCDSSS.........AEIT........FHAK----------------------AG.EF--------------------
TSG6_RABIT/36-128..NCGFGK.........TGIID.......YGIR----------------------LNRSE--------------------
W5NA53_LEPOC/255-350..NCGGNL.........VGVRTVYLYVNQTGYP----------------------YPD.S--------------------
Q6PID9_HUMAN/254-349..NCGGNL.........LGVRTVYVHANQTGYP----------------------DPS.S--------------------
W5LHH4_ASTMX/148-241..ACGGELL........AGIRS.......YGPQ----------------------HRTKE--------------------
H3A9N1_LATCH/268-362..RCGGSL.........PGVKTIYLFKNQTGFP----------------------DPS.S--------------------
V8P5V5_OPHHA/497-591..KCSGDKQNF......PGVRS.......YGMR----------------------PAS.E--------------------
M3YNU2_MUSPF/32-125..VCSKGS.........DEQQIMRAIDVRIESN----------------------PAPGA--------------------
I3JJ27_ORENI/627-722..ECGAGK.........IGVHTVYNHPNQTGYP----------------------ELD.A--------------------
F6QHJ0_ORNAN/2-95..VCRPEG.........SEKHNPARGSVQIERN----------------------PIPSR--------------------
H2UTP0_TAKRU/161-255..GCGGMGSA.......PGLRS.......YGER----------------------HRLLS--------------------
I3KG10_ORENI/253-348..KCGGGR.........LGVRTMYRYRNQTGFP----------------------EPT.R--------------------
W5LE59_ASTMX/41-129..LCRAGL.........TGVI..........VF----------------------KPTDP--------------------
U3J8X0_ANAPL/250-345..QCGGGL.........LGVRTLYRYENQTGFP----------------------YPD.S--------------------
H2L7U2_ORYLA/280-369..NCGPPQ.........PGVRS.......FGFP----------------------PLH.R--------------------
H0V051_CAVPO/262-357..RCGGPA.........PGVRTVYRFANRTGFP----------------------APG.G--------------------
F6PXN1_XENTR/157-251..ACYGDKMGK......EGIRT.......YGKR----------------------PVS.E--------------------
H0ZII5_TAEGU/32-120..LCAANN.........TGI.........YKLS----------------------ANTTA--------------------
W5NCW4_LEPOC/2171-2263..KCGFGH.........VGIVD.......YGIR----------------------VNLSE--------------------
I3KG10_ORENI/152-246..GCHGNLPNK......PGVRS.......YGTR----------------------KPT.E--------------------
F6TIG3_CIOIN/20-106..GCGNR..........PGVHL...........----------------------CNWRE--------------------
W5MB73_LEPOC/260-350..RCGGSA.........PGVRT.......LGFP----------------------DKKYR--------------------
W5KJN6_ASTMX/458-552..QCSGDLETV......PGVRN.......YGVR----------------------PAS.E--------------------
H2L317_ORYLA/130-224..NCFGDKEDL......PGVRN.......YGVR----------------------DPR.E--------------------
G3PBZ4_GASAC/32-121..NCAQNA.........TGF.........FIQQ----------------------QQQQD--------------------
H3B5H7_LATCH/153-247..RCYGDKMGR......PGIRT.......YGIR----------------------DPN.E--------------------
F8W252_DANRE/560-655..DCGGNK.........TGVQTIYAQPNQTGSP----------------------HPY.S--------------------
Q6PID9_HUMAN/579-674..ACGGDK.........PGVRTVYLYPNQTGLP----------------------DPL.S--------------------
H0V0Q4_CAVPO/2172-2264..KCGGGA.........VGIVD.......YGVR----------------------TNKSE--------------------
F6QZI7_MONDO/42-134..VCGKMS.........GEQQSIKAVDVKIESD----------------------LVPGS--------------------
F7A729_XENTR/115-208..PCGGNLP........PGIRS.......YGPK----------------------DKLKD--------------------
HPLN3_MOUSE/267-356..NCGPPE.........PGVRT.......FGFP----------------------DPH.T--------------------
H2YC92_CIOSA/35-121..GCGEW..........PGVHM...........----------------------CNWRE--------------------
K7EA70_ORNAN/119-214..KCGGEE.........PGVRTLYQFPNRTGFP----------------------EPS.L--------------------
M3Y9K7_MUSPF/135-225..RCSPTE.........AAVRF.......VGFP----------------------DKKHK--------------------
L9KBI4_TUPCH/149-242..PCGGRGR........PGIRS.......YGPR----------------------DRKRD--------------------
Q86W61_HUMAN/150-244..GCYGDKMGK......AGVRT.......YGFR----------------------SPQ.E--------------------
F7ATS6_XENTR/4-99..RCGGNS.........PGVKTLFLFRNQTGFP----------------------DSM.A--------------------
F6UCQ1_XENTR/163-257..GCYGDRNNL......PGVRT.......YGER----------------------DLQ.E--------------------
G1KI55_ANOCA/52-134..KCGQNK.........TGVA........IW.R----------------------LPVNR--------------------
F8W252_DANRE/459-553..KCSGDSEDV......PGVRS.......YNVR----------------------PAH.E--------------------
H3BB99_LATCH/271-361..NCGPPE.........PGVRS.......FGFP----------------------DKNLQ--------------------
H9GJW7_ANOCA/562-657..GCGGDK.........PGVRTIYLYHNQTGFP----------------------DPQ.S--------------------
I3KG12_ORENI/112-205..PCGGSNNG.......PGLRT.......YGRQ----------------------EKI.R--------------------
H3D620_TETNG/265-360..RCGGAG.........PGVRSVYRHSNQTGFP----------------------EAH.T--------------------
H3D7T0_TETNG/183-278..QCGGGL.........LGVRTLYKYENQTGFP----------------------DPA.E--------------------
H2VEJ2_TAKRU/83-177..PCGGKDMP.......PGIRS.......YGLR----------------------DKEKN--------------------
W5KBY4_ASTMX/2208-2300..KCGDNH.........VGIVL.......YKDP----------------------VDLSS--------------------
F6PXV1_XENTR/301-390..NCGPPE.........PGVRS.......FGFP----------------------ARY.M--------------------
W5LZK3_LEPOC/33-122..RCAANS.........TGV.........LVLP----------------------ANLTV--------------------
H3BGU3_LATCH/2206-2298..NCGLNH.........VGIID.......YGVR----------------------LNLSE--------------------
F6UCQ1_XENTR/264-357..NCGGEE.........PGVRTLYQYPNRTGFP----------------------NPT.R--------------------
G3PXC4_GASAC/164-258..PCGGSGHA.......PGVRS.......YGRR----------------------HLHLH--------------------
G5AR83_HETGA/94-188..ACYGDMDGF......PGVRN.......YGVV----------------------DPG.D--------------------
F6RL05_MONDO/2173-2265..SCNTSH.........AGIIL.......RGTQ----------------------GSLTE--------------------
V8NUK1_OPHHA/265-360..QCGGGL.........LGVRTLYRFENQTGFP----------------------YPD.S--------------------
H2MZH4_ORYLA/2159-2251..KCGDNH.........VGVVL.......YKDP----------------------VDVSN--------------------
H2UTV0_TAKRU/154-248..PCYGDKDNF......PGVRT.......YGVR----------------------DVN.E--------------------
F1QVB2_DANRE/169-263..ACGGTNMA.......AGVRS.......YGIR----------------------DKDLD--------------------
G3UW60_MOUSE/36-128..VCSKGS.........GEQPVSRAVDVRIDSH----------------------PVPGA--------------------
W5L2C8_ASTMX/556-651..DCAMNK.........SGVRTIYVNPNQTAFP----------------------SPD.S--------------------
G3PSB5_GASAC/150-244..GCYGNLGNR......PGVRT.......YGVR----------------------DAS.E--------------------
F7GLT0_MONDO/2208-2299..NCGSGF.........VGIVD.......YGPR----------------------PNKSE--------------------
K7EA70_ORNAN/18-112..GCYGDRNSL......PGVRS.......YGLR----------------------DPQ.E--------------------
W5MB73_LEPOC/159-253..QCGRKETP.......AGVRN.......YGYR----------------------HKEDE--------------------
M3WN53_FELCA/2207-2299..DCGGGQ.........LGVIS.......LGLR----------------------KNHSE--------------------
H3CE81_TETNG/132-226..NCYGDKEEL......PGVRT.......YGVR----------------------DLN.E--------------------
W5KJN9_ASTMX/170-264..PCGGLDLG.......PGVRS.......YGAR----------------------HKLSH--------------------
C3Y1K4_BRAFL/161-249..DCGV...........VGVS........HDAN----------------------VMWNN--------------------
F1R6C2_DANRE/4-93..NCGKNN.........VGVI........TW.R----------------------AEISR--------------------
G3HQN1_CRIGR/1449-1541..KCGSNI.........VGIVD.......YGIR----------------------PNKSE--------------------
W5KJN9_ASTMX/271-360..NCGPQE.........PGVRS.......FGFP----------------------SPH.H--------------------
D3ZWH1_RAT/2209-2301..DCGNNR.........VGVIS.......LGVR----------------------KNLSE--------------------
H3D6N5_TETNG/191-286..NCGGDE.........PGVRTVYNNPNRTGFP----------------------DTT.A--------------------
M4AV85_XIPMA/521-615..KCAGDLGDQ......PGVRT.......YGLR----------------------PAE.E--------------------
W5KNW0_ASTMX/239-323..KCSPTE.........AAVRF.......VGFP----------------------DKKNK--------------------
H2UTV0_TAKRU/566-661..NCGGGQ.........AGVHTIYAFSNQTGFP----------------------DEH.S--------------------
H2UD03_TAKRU/255-349..RCGGPR.........AGVRTLYRFRNQT.FP----------------------DQN.S--------------------
H9G9P6_ANOCA/239-335..KCGGSV.........PGVKTLFRFRNQTGFP----------------------DPQTS--------------------
H2L7V4_ORYLA/557-652..QCGGGL.........VGVHTIHAFPNQTGFP----------------------DEH.S--------------------
H3D620_TETNG/164-258..ACSPGMGGF......PGARN.......YGPV----------------------EPD.E--------------------
H0YCV9_HUMAN/11-98..ICAANN.........TGV.........YILT----------------------SNT.S--------------------
H3A9N1_LATCH/167-261..ACYGDMDGY......PGVRN.......YGVV----------------------DPE.D--------------------
U3IUX8_ANAPL/620-715..ACGGDA.........PGVRTIYQHYNQTGFP----------------------NPL.S--------------------
M3XGZ3_LATCH/42-127..KCGRNQ.........TGVI........TW.R----------------------VDTQK--------------------
H2TWG7_TAKRU/1997-2088..LCGFGH.........VGIVD.......YGIR----------------------KNLSE--------------------
H3AR94_LATCH/2141-2232..KCGSGQ.........VGIID.......YGTK----------------------.NGTD--------------------
G1KG37_ANOCA/2217-2309..KCGGHR.........VGIVS.......YGYR----------------------NNISE--------------------
F6PXC5_XENTR/602-697..ACGGDV.........PGVRTVYIHPNQTGFP----------------------DPL.S--------------------
W5KML6_ASTMX/146-240..GCHGDKMGK......PGVRT.......YGLR----------------------NPT.E--------------------
H2L317_ORYLA/587-681..RCGGGK.........HGVHTVYAHPNQTGFP----------------------PRE.D--------------------
H3D7T0_TETNG/82-176..GCTGDLLGK......PGVRT.......YGIR----------------------DPT.E--------------------
W5K8P3_ASTMX/43-127..KCGKSK.........VGIV........TW.S----------------------TPLSR--------------------
W5LMV1_ASTMX/2-91..VCRSMA............GSLRAVNMRVENV----------------------TETSE--------------------
M3VUP6_FELCA/45-129..KCGKNG.........MGVL........VW.R----------------------NSLSK--------------------
W5MZE9_LEPOC/36-128..NCGQNH.........TGIIT.......YGIR----------------------ENLLE--------------------
I3IZ90_ORENI/163-257..GCFGDMDAL......PGVRN.......YGLL----------------------EPD.E--------------------
W5M1S0_LEPOC/120-214..GCYGDKMGK......PGVRT.......YGVR----------------------HPT.E--------------------
F6PXN1_XENTR/258-352..QCGNGL.........LGVRTKYRFSNQTNFP----------------------NSL.E--------------------
G3NVP1_GASAC/277-366..NCGPPE.........PGVRS.......FGFP----------------------PPN.M--------------------
F6PZ03_XENTR/37-125..ICAANY.........TGI.........FTLG----------------------NNDSL--------------------
A2CF10_DANRE/147-240..ACGGDLL........SGIRS.......YGPR----------------------HKTRE--------------------
G1KL45_ANOCA/151-245..GCYGDMMGK......EGVRS.......YGYR----------------------LAN.E--------------------
F1QVB2_DANRE/270-359..NCGTSE.........PGVRS.......FGFP----------------------PKH.L--------------------
V8P471_OPHHA/222-316..PCGGNHLQ.......PGIRS.......YGER----------------------HKNLH--------------------
G1KCR2_ANOCA/32-120..LCAANT.........TGI.........YILS----------------------TNGSE--------------------
W5MN99_LEPOC/159-253..PCGGRALL.......PGIRS.......YGPK----------------------EPTRD--------------------
I3JZL7_ORENI/119-215..QCGGGQ.........LGVRTLYKYENQTGFP----------------------DPT.D--------------------
I3IZ90_ORENI/264-359..RCGGGE.........PGVRTVYRYSNQTGFP----------------------ETH.S--------------------
H3B5H7_LATCH/254-349..QCGGGQ.........LGVRTLYKYTNRTGFP----------------------DSS.S--------------------
H9GPN6_ANOCA/261-356..KCGGDE.........PGVRTAYQFPNRTGFP----------------------NPS.S--------------------
G3UPK3_MELGA/183-278..KCGGEA.........PGVRTLYRFPNRTGFP----------------------PPT.S--------------------
I3JV73_ORENI/115-209..GCYGHKEYS......AGVRN.......YGKR----------------------DPK.E--------------------
W5L2C8_ASTMX/455-549..NCSGDQGDA......PGVRT.......YGIK----------------------PAF.E--------------------
H2S2Y1_TAKRU/82-176..GCYGNLQSK......PGIRT.......YGKR----------------------KLT.D--------------------
H2S086_TAKRU/82-175..PCGGAKNG.......PGLRS.......YGLQ----------------------NRR.S--------------------
W5NA55_LEPOC/169-263..PCGGLDMA.......PGVRS.......YGAR----------------------HRHLH--------------------
G3NIT0_GASAC/1023-1115..RCGDNH.........VGLVI.......YKEP----------------------VDQSS--------------------
G3UPK3_MELGA/82-176..GCYGDRNSL......PGVRS.......YGQR----------------------EPG.E--------------------
W5KML6_ASTMX/247-341..QCGRGQ.........LGVRTRYLFINQTGFP----------------------VPS.E--------------------
H3D621_TETNG/129-221..SCGGETS........SGLRS.......YGSR----------------------DQE.Q--------------------
U3K2S4_FICAL/2229-2321..SCGSSH.........VGIVD.......YGFR----------------------SNLSE--------------------
W5KJN6_ASTMX/559-654..QCGGGK.........PGVHTVYAFPNQTGYP----------------------DLH.S--------------------
I3KUU2_ORENI/263-358..RCGGPQ.........PGVKTLYRFSNQTGFP----------------------EPS.G--------------------
G1KSH3_ANOCA/2201-2293..KCGGGV.........IGIID.......YGPR----------------------INKSE--------------------
H2MVR1_ORYLA/2188-2279..KCGFGH.........VGIVD.......YGFR----------------------KNLSE--------------------
F1QR32_DANRE/251-342..QCPNEE.........PGVRRVSPAELSNGT.----------------------....K--------------------
H3CE81_TETNG/448-542..KCAGDLGEQ......PGVRS.......YGLR----------------------PAD.E--------------------
H0UZZ3_CAVPO/256-351..RCGGGL.........PGVKTLFLFPNQTGFP----------------------NKH.S--------------------
C3ZYF8_BRAFL/3-96LLVCSN...........IGSKKMT.....HTCY----------------------PNMQT--------------------
H3BAD0_LATCH/483-577..KCYGDKNGF......PGVRN.......YGVR----------------------QPN.E--------------------
G3T4I8_LOXAF/263-353..NCGSAE.........PGVRS.......FGFP----------------------DPQSH--------------------
E9QHN0_DANRE/150-244..GCHGDKWMK......PGVKS.......YDVR----------------------NAY.E--------------------
G3U8V2_LOXAF/271-361..RCGGSR.........PGVRS.......LGFP----------------------DAARR--------------------
L5LVH7_MYODS/44-129..KCGKNG.........MGVV........VW.K----------------------NLPSQ--------------------
G7PQQ7_MACFA/47-129..KCGKNG.........VGVL........IW.K----------------------VAVNR--------------------
E7F537_DANRE/496-591..QCSGDMEQV......PGVRS.......YGLR----------------------PAD.E--------------------
W5MX80_LEPOC/2209-2300..KCGNNH.........VGIVE.......YKDP----------------------VE.SN--------------------
H0ZUW2_TAEGU/155-245..RCGGRE.........PGVRN.......LGFP----------------------DKKYK--------------------
G3P4E1_GASAC/27-116..NCGQGA.........TGVV........KW.R----------------------AKLDQ--------------------
M4AV85_XIPMA/622-716..GCGGEK.........SGVHTLYSPPNQTHYP----------------------EPD.A--------------------
I3KEY0_ORENI/273-362..NCGPSQ.........PGVRS.......FGFP----------------------PQY.L--------------------
G3Q0U6_GASAC/146-239..ACGGDLL........PGIRS.......YGPK----------------------DKTQD--------------------
H2UD03_TAKRU/154-248..GCYGDMHGH......PGVRN.......YGTM----------------------NPD.E--------------------
G3T4I8_LOXAF/162-256..PCGGLGLA.......PGVRS.......YGPR----------------------HRRLH--------------------

PF03440

TOX3_BORPE/31-117RQITPGWSIYGLYD.GTYLGQA-------YGG--------------------IIKDAPPG------AGF------IYR--
TOX2_BORPE/30-116RHVTRGWSIFALYD.GTYLGGE-------YGG--------------------VIKDGTPG------GAF------DLK--
A0KFE5_AERHH/24-105VNMMGQWQISGLANGWVIMGPG-------YNG--------------------EIKPGTAS------NTW------CYP--

PF07979

EAE_ECO27/839-939SQTIISWVQQTAQDAKSGVAST-------YDL--------------------VKQNPLNN......IKA------SES--
Q846P2_ECOLX/838-938RNAMISWIKQTDQDMRQGVAST-------YDL--------------------VKKNPLTN.....KVDI------NKP--
Q9S6R2_ECOLX/838-939SKSLTAWIKQSSSEQSSGVSST-------YDL--------------------VTKNQLIN......VGV------NNK--
Q8KRL2_ECOLX/838-937QRTINAWIQQTDKDKREGVATT-------YDI--------------------VTNNMVQN......VSS------KTP--
O06896_ECOLX/839-940SNSLTAWITQSSSELPSGVSST-------YDL--------------------ITTNSLTN......VKT------TDN--
Q8KRK8_ECOLX/838-938QASITAWTLQTSDDVKKGVTST-------YDL--------------------VRKNPQLN.....KVNI------NDN--
A0A024Z842_ECOLX/840-935MQSITAWITQTEADKISGVSTT-------YDL--------------------ITQNPHKD......VTL------NAP--
Q9LBG6_ECOLX/835-936SNSLTAWIKQSTSDSASGVSNT-------YDL--------------------VTTNSLTN......VKA------TDK--
E7UB01_ECOLX/838-937QGTINAWIQQTEQDKKDSVATT-------YDI--------------------VTDNTVIN......VDS------TVA--
Q9R8B4_ECOLX/839-934MNSITAWIKQTSSEQSSGVSST-------YNL--------------------IIQNPLPR......VNV------NTP--
INVA_YEREN/735-833WPSGNYWTKKTSTDF.....VT-------MDM--------------------TTGDIPTS.........------.AA--
Q8RSS9_ECOLX/842-948KNTITAWTQQTAADKQSGWTST-------FDI--------------------VTKNEIPNNGSNSKVNV------NTA--
Q8KRL0_ECOLX/839-939LLTISSWVQQTTVDMNSGVAST-------YDL--------------------VRQNPL.N.....GVET------NTT--
Q8KRL1_ECOLX/842-948KNTITAWTQQTADDIPKGWTST-------FDI--------------------VTKNEIPNNGIKVKVNV------DAA--

PF05473

A5A7J2_9ALPH/19-219ASNGTAGLIMSLLDCLNVGDSE-------SVMNKLN................LDDTQLAYCNVPSFAE.......CYT--
G9I267_HHV2/4-171IPRAAAKHLAALTRVQAERSSG-------YWW....................VNGDGIRTCLRLVDSVSGIDEF.CEE--
O89243_9ALPH/3-191VDFTHAKILIEAIAPFASTDAN-------SSNVF..................RLRDSRTTCVRPTAAGPVAVD..CPR--
O56871_ILTV/33-274ASSSKAIGFLTILDRLFYWSGS-------TSPQGLWWADDGGKCANVYFINSIHDDSTASLSTQKMSVALVENLQCSG--
EV45_GAHVM/3-192VDFTNAKTLVEAIVPFGSTNAS-------FGNIF..................RLRDSRSTCILPTIGGPISVD..CPR--
Q5Y0Q7_9ALPH/5-173IPRAVAKQLAAVAGVGARASGA-------YWW....................VNGDGIKACLRPSDGVGGIDQF.CEG--
D3YPA9_HHV1/4-171IPRAAAKQLAAVARVQSARSSG-------YWW....................VSGDGIRACLRLVDGVGGIDQF.CEE--
EV45_EHV4/19-218APDNTTVLIMNLLDCLNIGINE-------SAGEKLN................LTDTPLANCNFSQNSV.......CSR--
EV45_MEHVH/3-193IDFANAKVLVEAIAPFGVPNAA-------YGEVF..................RLRDSKTTCIRPTMGGPVSAD..CPV--
Q66077_9ALPH/2-174INQSTINSLLTVLNMFAD....-------.......................KNYENVYNCNTMSEK........TCN--
Q69365_FHV1/7-189ATASAVGALIPLLDIFNGDGI.-------.......................STNDSLYDCILSDEKK.......SCN--

PF05966

Q9Q8V7_RFVKA/1-172MRKYFCVKSFT-----------------
Q8V3H7_SWPV1/1-185LRSHFCLESFY-----------------
Q08FM0_DPV83/7-191KRNYFCVKSV.-----------------

PF00059

F1M5M2_RAT/203-312ADGLVCEK--------------------
F1RK81_PIG/131-264KSSFLCKR--------------------
F1P2W2_CHICK/678-795VNGSVCER--------------------
LYAM3_MOUSE/49-160RKRALCYT--------------------
ASGR2_HUMAN/194-302VYRWVCEK--------------------
ASGR1_HUMAN/171-279PYRWVCET--------------------
SFTPD_RAT/269-374QRLVICEF--------------------
FCER2_HUMAN/180-284LGAWVCDR--------------------
Q9N3W1_CAEEL/37-145KSYFVCSY--------------------
E4Y143_OIKDI/82-193EKPFICEK--------------------
E5RY41_TRISP/53-163LKNYICQI--------------------
E3LCH6_CAERE/1231-1343PRPFACHK--------------------
E3LJN0_CAERE/2714-2811LLPFVCEK--------------------
VGA7_ALHV1/126-224SKLCLCGQ--------------------
LYAM1_HUMAN/46-157LKAALCYT--------------------
LYAM3_HUMAN/49-160KKHALCYT--------------------
Q9Q8H9_MYXVL/64-168VNYVICMK--------------------
Q6TUP6_YMTV5/64-166VNYIICVK--------------------
MRC1_HUMAN/1252-1357YKGYICKR--------------------
CLC4F_RAT/429-538AYNWVCKK--------------------
LECH_CHICK/98-203ECYYVCEK--------------------
LYAM2_CANFA/30-141KKLALCYT--------------------
MBL2_RAT/140-242SFLVVCEF--------------------
SFTPA_MOUSE/144-248YRLAICEF--------------------
NKG2D_HUMAN/116-213PNTYICMQ--------------------
Q8V3H6_SWPV1/63-165VNYILCVK--------------------
REG3B_MOUSE/57-173KLPYVCKF--------------------
MRC1_HUMAN/966-1081KRGYICQT--------------------
CD72_HUMAN/250-352SLPYICEM--------------------
C3XRG9_BRAFL/43-156HHRFICEY--------------------
E9GSY7_DAPPU/251-368LLPFVCRA--------------------
MBL1_RAT/134-236SHTAVCEF--------------------
ASGR2_MOUSE/187-295VNRWVCEK--------------------
SFTPD_BOVIN/264-369QRLVICEF--------------------
SFTPD_HUMAN/270-375KRLVVCEF--------------------
LYAM2_MOUSE/29-140KKLALCYT--------------------
REG3A_HUMAN/57-173RLPYVCKF--------------------
KLRBA_RAT/111-212DNIWVCQK--------------------
SFTPA_RABIT/143-247YRLVICEF--------------------
SFPA2_HUMAN/144-248SRLTICEF--------------------
Q9N3W8_CAEEL/37-145KNYFVCSY--------------------
Q06ZZ3_CPRVZ/55-157SHATVCVI--------------------
Q5BK59_RAT/247-352LFPCICEL--------------------
MRC1_HUMAN/521-627KAKFVCKH--------------------
CLC87_CAEEL/103-224MLYSICER--------------------
MBL2_HUMAN/144-246SHLAVCEF--------------------
C3XXU7_BRAFL/313-420QHNYVCQS--------------------
MRC1_HUMAN/380-488PLGYICKM--------------------
KLRBA_MOUSE/111-212DNRWICQK--------------------
REG3A_RAT/56-172ELPFVCKF--------------------
O17575_CAEEL/2720-2817LTAFICEK--------------------
B4KGI3_DROMO/50-166LLPFMCRA--------------------
SFTPA_CANFA/144-248YRLAICEF--------------------
O62171_CAEEL/239-356YANYVCET--------------------
F6XBY4_XENTR/135-267KSSFLCKR--------------------
H2TF65_TAKRU/131-265KFPFLCKR--------------------
H3CYY2_TETNG/729-839VNGSLCER--------------------
Q8MJ16_BOVIN/792-906LNGSVCER--------------------

PF01413

T1ID05_RHOPR/1486-1593SRCVVCEA--------------------
U6HG85_ECHMU/1508-1613SRCVVCEA--------------------
C3YKJ6_BRAFL/595-702SRCSVCQT--------------------
G7Y6J4_CLOSI/1487-1601SKCRVCMK--------------------
CO4A1_BOVIN/116-227SRCQVCMR--------------------
V8P2H6_OPHHA/592-698SRCVVCE.--------------------
B7Q188_IXOSC/1169-1276SRCSVCES--------------------
G3NKN3_GASAC/350-461SRCRVCMK--------------------
B4KGC9_DROMO/1668-1780SRCQVCVK--------------------
G3PLA6_GASAC/1558-1669SRCRVCRK--------------------
M4AMB5_XIPMA/1525-1634SRCNVCL.--------------------
E5SK06_TRISP/1694-1805SRCQVCMK--------------------
B3MP84_DROAN/1557-1662SRCVVCEA--------------------
D6WLB9_TRICA/1645-1756SRCAVCIR--------------------
H1A1E6_TAEGU/68-181SRCQVCLK--------------------
J9JR68_ACYPI/1664-1776SRCQVCIR--------------------
H2TV78_TAKRU/1005-1117SQCHVCLR--------------------
G4V697_SCHMA/1361-1468SRCIVCQS--------------------
F6XEM0_MACMU/252-366SRCQVCVK--------------------
H9JWX6_BOMMO/1602-1711SRCTVCMR--------------------
C3YYN7_BRAFL/329-436SRCVVCET--------------------
G1KCR9_ANOCA/1458-1564SRCIVCE.--------------------
E0VEK8_PEDHC/1629-1740SRCSVCMR--------------------
B0WDA5_CULQU/1510-1617SRCSVCET--------------------
H2LZX2_ORYLA/1532-1645SRCQVCSK--------------------
K1R004_CRAGI/72-175SRCSVCEA--------------------
U6HLY4_ECHMU/1554-1662SRCVVCES--------------------
B3S7P7_TRIAD/67-172SRCTVCEA--------------------
T1GCH0_MEGSC/798-904AKCVVCRR--------------------
C3YYY5_BRAFL/58-187GRCRVCM.--------------------
W5KGN1_ASTMX/1375-1482SRCSVCEA--------------------
G4V697_SCHMA/1472-1585SRCSVCRR--------------------
H0ZD00_TAEGU/698-809SRCQVCMK--------------------
T1ID48_RHOPR/1487-1592SRCVVCEV--------------------
G1KC91_ANOCA/1562-1676GRCQVCMK--------------------
M3ZRX3_XIPMA/134-239SKCSVCES--------------------
H3AGX1_LATCH/1534-1644SRCQVCMK--------------------
H3AVQ2_LATCH/1396-1501SKCAVCEA--------------------
I3JUM0_ORENI/1491-1603SQCNVCHR--------------------
J9EZI1_WUCBA/240-345SRCAVCEA--------------------
F6XFD7_CIOIN/1621-1732SRCQVCT.--------------------
B0WDA4_CULQU/1453-1558SRCTVCEA--------------------
H2TDN6_TAKRU/1497-1608SRCRVCMS--------------------
H2TDN6_TAKRU/1387-1494SRCAVCET--------------------
I3IXK0_ORENI/1447-1554SRCSVCEA--------------------
D6WLB9_TRICA/1535-1642SRCSVCES--------------------
W5KH26_ASTMX/1396-1500SRCVVCET--------------------
Q7PVR6_ANOGA/670-777SRCSVCES--------------------
Q9VMV5_DROME/1516-1623SRCVVCET--------------------
G3WDY8_SARHA/1171-1282SRCQVCMK--------------------
C3ZDE0_BRAFL/114-225SRCQVCIK--------------------
D6WLB7_TRICA/1694-1806SRCQVCIK--------------------
T1IZ15_STRMM/1635-1746SRCNVCRK--------------------
I3LDI9_PIG/153-260SRCTVCEA--------------------
B7Q188_IXOSC/1279-1390SRCQVCRR--------------------
CO4A2_BOVIN/5-110SRCSVCEA--------------------
M3ZRX3_XIPMA/242-353SRCRVCMK--------------------
C3ZDE0_BRAFL/5-110SRCAVCEA--------------------
E9IRC9_SOLIN/82-187SRCVVCEV--------------------
F1R5V4_DANRE/1438-1545SRCSVCEA--------------------
G7Y6J4_CLOSI/1377-1484ARCVVCEA--------------------
F1QW09_DANRE/1446-1550SRCVVCEA--------------------
M4AJS4_XIPMA/1454-1558SRCVVCEA--------------------
G4V8A7_SCHMA/2868-2983SRCRVCTK--------------------
T1FRZ7_HELRO/1555-1658SRCVVCE.--------------------
T1FST9_HELRO/1255-1360SRCVVCEV--------------------
E4X7Q9_OIKDI/981-1083SRCSVCEV--------------------
W4YIV2_STRPU/235-345SRCRVCQK--------------------
E5SK06_TRISP/1584-1690SRCVVCE.--------------------
K1RH30_CRAGI/1513-1626SRCQVCMK--------------------
J9EZI1_WUCBA/348-460SRCQVCIK--------------------
C3YKJ4_BRAFL/2-108SRCTVCLT--------------------
K1RH30_CRAGI/1405-1510SRCVVCDA--------------------
H2M087_ORYLA/509-614SRCSVCEA--------------------
C3YKJ4_BRAFL/112-221SRCRVC..--------------------
W4WSD7_ATTCE/1399-1506SRCSVCEA--------------------
T1L4B8_TETUR/1360-1471SRCSVCI.--------------------
T1EG21_HELRO/620-730SRCSVCL.--------------------
G4V8A7_SCHMA/1398-1505ARCVVCEA--------------------
T1INC3_STRMM/426-538SRCQVCIK--------------------
W5MT75_LEPOC/1535-1646SRCQVCMK--------------------
I3IXK0_ORENI/1558-1669SRCRVCMN--------------------
W5KH26_ASTMX/1504-1616SRCIVCMS--------------------
U6IF53_HYMMI/1667-1784SRCRVCMR--------------------
F6VJG0_CIOIN/1571-1682SRCQVCMR--------------------
C3Y8Z7_BRAFL/28-134GRCVVCQT--------------------
F1QYN1_DANRE/1552-1664SRCQVCMK--------------------
T1IZ15_STRMM/1525-1632SRCVVCET--------------------
W4WSD7_ATTCE/1509-1619SRCAVCLR--------------------
W5L7X5_ASTMX/1573-1684SRCIVCMK--------------------
A7SQ52_NEMVE/112-223SRCQVCQK--------------------
K1QZZ6_CRAGI/238-349SRCRVCAR--------------------
T1EG21_HELRO/510-617GRCVVCEA--------------------
B0WDA5_CULQU/1620-1730SRCIVCRR--------------------
G4V8A8_SCHMA/1656-1769GKCAVCMR--------------------
H9KBV4_APIME/1508-1615SRCSVCEA--------------------
W5LJS4_ASTMX/114-218SRCVVCEA--------------------
Q9VMV5_DROME/1626-1736SRCTVCRR--------------------
B4NRX0_DROSI/205-317SRCQVCMK--------------------
E9IRC9_SOLIN/190-302SRCQVCIK--------------------
E9GYE4_DAPPU/267-374SRCSVCET--------------------
F1R5V4_DANRE/1548-1656SRCQVCMK--------------------
E0VEK7_PEDHC/2309-2414SRCVVCEA--------------------
F6VJG0_CIOIN/1461-1568SRCAVCET--------------------
K7I6X3_CAEJA/317-428SRCQVCLK--------------------
U6HLY4_ECHMU/1665-1777SRCSVCRK--------------------
X1WQB7_ACYPI/360-471SRCSVCLR--------------------
A7SQ52_NEMVE/4-109GRCAVCEV--------------------
F1QW09_DANRE/1554-1665SRCSICMM--------------------
C3XSD7_BRAFL/244-353SRCVVCST--------------------
G6DMY2_DANPL/1689-1794SRCVVCEV--------------------
H9KBV4_APIME/1618-1728SRCVVCLR--------------------
F1QYN1_DANRE/1443-1548SRCSVCEV--------------------
CO4A1_BOVIN/6-113SRCAVCEA--------------------
H3AVQ2_LATCH/1504-1618SRCRVCMK--------------------
W4YIV2_STRPU/127-232SRCTVCEA--------------------
W5MT75_LEPOC/1425-1532SRCTVCET--------------------
E0VEK8_PEDHC/1519-1626SRCAVCEA--------------------
F6XFD7_CIOIN/1513-1618SRCSVCES--------------------
C3YYX1_BRAFL/102-217GRCRVCM.--------------------
B4NRX0_DROSI/97-202SRCVVCEA--------------------
I3IXM4_ORENI/1411-1514SRCVVCEA--------------------
T1L4B8_TETUR/1252-1357SRCVVCES--------------------
T1FST9_HELRO/1364-1474SRCHVCAK--------------------
B3S7P5_TRIAD/1401-1510SRCIVCKK--------------------
T1FRZ7_HELRO/1662-1772SRCSVCSR--------------------
U6HG85_ECHMU/1616-1731SKCRVCMK--------------------
F6XEM0_MACMU/144-249SRCAVCEA--------------------
H2RQC6_TAKRU/392-502GKCNVCM.--------------------
C3YYN7_BRAFL/439-564GRCRVCMW--------------------
T1INC3_STRMM/318-423SRCVVCEA--------------------
Q7PVR6_ANOGA/780-890SRCIVCRR--------------------
G7Y6J5_CLOSI/1648-1763SRCRVCLK--------------------
W5KGN1_ASTMX/1485-1596SRCRVCMK--------------------
E9GYE4_DAPPU/377-488SRCAVCQR--------------------
G4V8A7_SCHMA/2756-2862ARCVVCEA--------------------
G3PLB8_GASAC/1546-1658SQCHVCLR--------------------
F6TRQ1_ORNAN/140-245SRCSVCEA--------------------
K7I6X3_CAEJA/207-314SRCAVCEV--------------------
M4AMB5_XIPMA/1415-1519SRCVVCET--------------------
C3YKJ6_BRAFL/706-819SKCRVCMA--------------------
G3PLA6_GASAC/1448-1555SRCSVCET--------------------
I3JUK2_ORENI/1430-1537SRCSVCET--------------------
C3ZDD7_BRAFL/4-111SRCVVCEA--------------------
H9JWX6_BOMMO/1492-1599SRCQVCEA--------------------
B3S7P5_TRIAD/1291-1396GRCSVCEA--------------------
G6DMY2_DANPL/1797-1909SRCAVCIK--------------------
K7IPX3_NASVI/1375-1482SRCSVCEA--------------------
H0VSI7_CAVPO/1423-1530SRCVVCEA--------------------
G3NH33_GASAC/256-367SRCQVCMK--------------------
B3S7P7_TRIAD/175-288SRCSVCLR--------------------
X1WQB7_ACYPI/250-357SRCSVCEA--------------------
T1ID48_RHOPR/1595-1706SRCQVCI.--------------------
T1ID05_RHOPR/1596-1706SRCVVCLR--------------------
W5MTA0_LEPOC/1446-1550SRCAVCEA--------------------
G3NKK3_GASAC/1416-1520SRCIVCEA--------------------
G3NKN3_GASAC/240-347SRCSVCEA--------------------
C3ZDD7_BRAFL/114-224SRCQVCM.--------------------
C3Y818_BRAFL/251-355SRCTLCQA--------------------
CO4A2_BOVIN/113-225SRCQVCMK--------------------
F1PHG6_CANFA/1571-1684SRCQVCMR--------------------
G3NKK3_GASAC/1525-1637GRCSVCMR--------------------
I3LDI9_PIG/263-374SRCQVCMK--------------------
G4V8A8_SCHMA/1546-1652SRCAVCEA--------------------
T1GCH0_MEGSC/688-795SRCSVCET--------------------
C3ZSP6_BRAFL/193-300SRCIVCEV--------------------

PF00193

F7EKW5_ORNAN/2173-2265RWDAYCY---------------------
H2V249_TAKRU/245-334KYGVYCY---------------------
H3C6Z8_TETNG/32-122KFDALCY---------------------
M4AF12_XIPMA/277-366KFGVYCY---------------------
H2UTV0_TAKRU/465-559QYDVFCY---------------------
H9H0Q3_MELGA/103-198RYDAYCF---------------------
E7EYE0_DANRE/2154-2245TWDTFCY---------------------
H3BAD0_LATCH/584-679RYAAFCF---------------------
H2L317_ORYLA/231-326RHGAFCY---------------------
H9H1H3_MELGA/121-215RFDAFCF---------------------
F6YUQ6_XENTR/161-255RYDAFCF---------------------
M4AP18_XIPMA/155-249RYDVYCF---------------------
H3D6N5_TETNG/90-184LFDVYCF---------------------
R4GBT0_ANOCA/33-126KYNAIC.---------------------
F6TXD5_ORNAN/240-323RFDVYCF---------------------
C3Y1K4_BRAFL/989-1073KYDVYC.---------------------
W5K9E6_ASTMX/11-100KFDVYCF---------------------
M3ZEZ9_XIPMA/32-120HFDAHCY---------------------
F6RUD0_XENTR/42-130DFHAYCF---------------------
G3PSB5_GASAC/251-347RHGLYCY---------------------
A7SD47_NEMVE/72-164KLDAYCY---------------------
W5L2D8_ASTMX/166-260RFDTFCF---------------------
Q6PID9_HUMAN/153-247TYDVYCF---------------------
H2S086_TAKRU/390-483LFDVFCF---------------------
C3Y1K4_BRAFL/449-534KFYVWC.---------------------
M3Y9K7_MUSPF/34-128RYDVFCF---------------------
H3CYG5_TETNG/270-358KFGVYC.---------------------
G3P7B0_GASAC/113-206RYDVFCF---------------------
W5PN42_SHEEP/45-129RHRAYCH---------------------
I3KB63_ORENI/6-96KYDVYCY---------------------
F6PXC5_XENTR/501-595HFDVYCY---------------------
I3KEY5_ORENI/519-614HHDAYCF---------------------
U3IUX8_ANAPL/519-613TYDVYCY---------------------
F1QR32_DANRE/150-244LFDVYCF---------------------
H2S086_TAKRU/182-272SFGVYCY---------------------
W5M456_LEPOC/19-112QLDTFC.---------------------
H3A5H2_LATCH/51-143KWDAYCY---------------------
E7FBG3_DANRE/75-163KYDALCY---------------------
C3ZUC3_BRAFL/5-93TWDAWCY---------------------
H3A6L9_LATCH/10-102KWDVYCY---------------------
I3JV73_ORENI/216-308LYDAYCY---------------------
Q86W61_HUMAN/251-346RFDAYCF---------------------
E1BUN0_CHICK/268-356RFGVFCY---------------------
F1Q4Q0_DANRE/249-344RLGAYCF---------------------
W5KSF4_ASTMX/2192-2284NWDTFCY---------------------
Q6PID9_HUMAN/478-572TYDVYCF---------------------
H3AUC6_LATCH/32-120KYDAFCF---------------------
H3CE81_TETNG/233-328HYDAFCY---------------------
F1N2Y8_BOVIN/163-257LYDVYCF---------------------
H2MXA1_ORYLA/38-130QWDVYCY---------------------
F6QGU9_XENTR/2171-2263TWDVFCY---------------------
H2M1W8_ORYLA/238-327KYGVYCF---------------------
H2L7V4_ORYLA/456-550RYDVYCY---------------------
H2V249_TAKRU/143-237RYDVFCF---------------------
V8P6B4_OPHHA/1137-1229TWDVFCY---------------------
F1R511_DANRE/142-233QYDVYCY---------------------
H2S2Y1_TAKRU/183-278MLGAYCF---------------------
H0ZUW2_TAEGU/54-148RYDAFCF---------------------
G3NJP2_GASAC/150-244LYDVYCY---------------------
W5NA53_LEPOC/559-654RYDAYCF---------------------
M4A2R4_XIPMA/143-237RFDVFCF---------------------
R0LX51_ANAPL/4-97QYDAFC.---------------------
I3K6I5_ORENI/169-263HYDVFCF---------------------
G3PXC4_GASAC/265-353KHGVYCY---------------------
F1MKY3_BOVIN/32-125TYNALC.---------------------
H3CYG5_TETNG/171-263HFDAFCF---------------------
A7RGE0_NEMVE/165-256TFDAFCY---------------------
W5NA53_LEPOC/458-552RYDVYCY---------------------
G3NVP1_GASAC/175-269RYDAFCF---------------------
U3IX07_ANAPL/2191-2283TWDVFCY---------------------
U3JRF4_FICAL/33-126QYDAFC.---------------------
W5M859_LEPOC/38-125KFDVFCF---------------------
C3Y1K4_BRAFL/25-116KFDVWC.---------------------
H2M1W8_ORYLA/137-231HFDVFCY---------------------
I3IZ94_ORENI/167-260RFDAFCF---------------------
E1BUN0_CHICK/167-261RFDVFCF---------------------
I3JZL7_ORENI/18-112KYDVYCY---------------------
G3U8V2_LOXAF/163-264RYDAFCF---------------------
Q1LXE1_DANRE/141-235RYDVFCF---------------------
F6PXV1_XENTR/200-294RFDAFCF---------------------
C3ZUI3_BRAFL/586-672TWDAWCF---------------------
W5M1S0_LEPOC/221-316KFGAYCF---------------------
H3CE81_TETNG/549-644RYDAYCF---------------------
H2UTV0_TAKRU/255-350RYDAICF---------------------
V8P5V5_OPHHA/237-332RYDAICY---------------------
I3ML99_SPETR/46-129TFRAYCH---------------------
E7F6T0_DANRE/33-122LSDVYCF---------------------
TSG6_RABIT/36-128RWDAYCY---------------------
W5NA53_LEPOC/255-350RYDAICY---------------------
Q6PID9_HUMAN/254-349RYDAICY---------------------
W5LHH4_ASTMX/148-241HFDAFCF---------------------
H3A9N1_LATCH/268-362RYNVFC.---------------------
V8P5V5_OPHHA/497-591KFDVYCY---------------------
M3YNU2_MUSPF/32-125TYSAFC.---------------------
I3JJ27_ORENI/627-722RFDAYCF---------------------
F6QHJ0_ORNAN/2-95RYNALC.---------------------
H2UTP0_TAKRU/161-255QFDAFCF---------------------
I3KG10_ORENI/253-348KFGAYCF---------------------
W5LE59_ASTMX/41-129GYDAFCY---------------------
U3J8X0_ANAPL/250-345KFDAYCY---------------------
H2L7U2_ORYLA/280-369KFGVYCY---------------------
H0V051_CAVPO/262-357RFDAYCF---------------------
F6PXN1_XENTR/157-251KYDVYCF---------------------
H0ZII5_TAEGU/32-120RYDAYCY---------------------
W5NCW4_LEPOC/2171-2263TWDTFCY---------------------
I3KG10_ORENI/152-246TYDVYCY---------------------
F6TIG3_CIOIN/20-106TWDAFCY---------------------
W5MB73_LEPOC/260-350LYGAYCF---------------------
W5KJN6_ASTMX/458-552RYDVYCY---------------------
H2L317_ORYLA/130-224KYDVYCF---------------------
G3PBZ4_GASAC/32-121LYDAYCF---------------------
H3B5H7_LATCH/153-247TYDVYCY---------------------
F8W252_DANRE/560-655RYDAYCF---------------------
Q6PID9_HUMAN/579-674RHHAFCF---------------------
H0V0Q4_CAVPO/2172-2264VWDVFCY---------------------
F6QZI7_MONDO/42-134KYDALC.---------------------
F7A729_XENTR/115-208KYDAFCF---------------------
HPLN3_MOUSE/267-356RYGVYCY---------------------
H2YC92_CIOSA/35-121TWDAFCY---------------------
K7EA70_ORNAN/119-214KFDAYCY---------------------
M3Y9K7_MUSPF/135-225LYGVYCF---------------------
L9KBI4_TUPCH/149-242RYDAFCF---------------------
Q86W61_HUMAN/150-244TYDVYCY---------------------
F7ATS6_XENTR/4-99KYDVYCF---------------------
F6UCQ1_XENTR/163-257TYDVYCY---------------------
G1KI55_ANOCA/52-134KARAYCY---------------------
F8W252_DANRE/459-553QYDVYCY---------------------
H3BB99_LATCH/271-361KYGVYCY---------------------
H9GJW7_ANOCA/562-657KHHAFCF---------------------
I3KG12_ORENI/112-205QFDVFCY---------------------
H3D620_TETNG/265-360RHDVYCF---------------------
H3D7T0_TETNG/183-278KFGVYCF---------------------
H2VEJ2_TAKRU/83-177HYDVFCF---------------------
W5KBY4_ASTMX/2208-2300PYDAYCY---------------------
F6PXV1_XENTR/301-390KFGVYCY---------------------
W5LZK3_LEPOC/33-122RYDAYCY---------------------
H3BGU3_LATCH/2206-2298RWDAFCY---------------------
F6UCQ1_XENTR/264-357KFGAYCF---------------------
G3PXC4_GASAC/164-258RFDVFCF---------------------
G5AR83_HETGA/94-188LYDVYCY---------------------
F6RL05_MONDO/2173-2265RWDAYCY---------------------
V8NUK1_OPHHA/265-360KFDAYCF---------------------
H2MZH4_ORYLA/2159-2251KYDAYCY---------------------
H2UTV0_TAKRU/154-248TYDVYCF---------------------
F1QVB2_DANRE/169-263RFDAFCF---------------------
G3UW60_MOUSE/36-128KYNALC.---------------------
W5L2C8_ASTMX/556-651RHDAYCF---------------------
G3PSB5_GASAC/150-244EYDVYCY---------------------
F7GLT0_MONDO/2208-2299LWDVFCY---------------------
K7EA70_ORNAN/18-112RYDVYCF---------------------
W5MB73_LEPOC/159-253RYDAFCF---------------------
M3WN53_FELCA/2207-2299RWDTYCY---------------------
H3CE81_TETNG/132-226TYDVYCF---------------------
W5KJN9_ASTMX/170-264RYDVFCF---------------------
C3Y1K4_BRAFL/161-249KHDAWC.---------------------
F1R6C2_DANRE/4-93KFDVYCF---------------------
G3HQN1_CRIGR/1449-1541MWDVFCY---------------------
W5KJN9_ASTMX/271-360KHGVYCY---------------------
D3ZWH1_RAT/2209-2301RWDAYCY---------------------
H3D6N5_TETNG/191-286LFDAYCF---------------------
M4AV85_XIPMA/521-615RYDVYCY---------------------
W5KNW0_ASTMX/239-323LYGAYCY---------------------
H2UTV0_TAKRU/566-661RYDAYCF---------------------
H2UD03_TAKRU/255-349RYDAYCF---------------------
H9G9P6_ANOCA/239-335RYDVFCF---------------------
H2L7V4_ORYLA/557-652RYDAYCF---------------------
H3D620_TETNG/164-258LYDVHCY---------------------
H0YCV9_HUMAN/11-98QYDTYCF---------------------
H3A9N1_LATCH/167-261MYDVYCY---------------------
U3IUX8_ANAPL/620-715RHHAFCF---------------------
M3XGZ3_LATCH/42-127PFDALCF---------------------
H2TWG7_TAKRU/1997-2088TWDTFCY---------------------
H3AR94_LATCH/2141-2232TWDVYCY---------------------
G1KG37_ANOCA/2217-2309QWDAYCY---------------------
F6PXC5_XENTR/602-697KYHAFCF---------------------
W5KML6_ASTMX/146-240TYDVYCY---------------------
H2L317_ORYLA/587-681RYDAYC.---------------------
H3D7T0_TETNG/82-176KYDVYCY---------------------
W5K8P3_ASTMX/43-127LFDVFCF---------------------
W5LMV1_ASTMX/2-91RLAAFC.---------------------
M3VUP6_FELCA/45-129KFLAYCY---------------------
W5MZE9_LEPOC/36-128RWDVFCY---------------------
I3IZ90_ORENI/163-257LYDVYCY---------------------
W5M1S0_LEPOC/120-214TYDVYCY---------------------
F6PXN1_XENTR/258-352RFDAYC.---------------------
G3NVP1_GASAC/277-366NFGVYCY---------------------
F6PZ03_XENTR/37-125RYDAYCY---------------------
A2CF10_DANRE/147-240NYDAFCF---------------------
G1KL45_ANOCA/151-245TYDVYCY---------------------
F1QVB2_DANRE/270-359KHGVYCY---------------------
V8P471_OPHHA/222-316RFDVFCF---------------------
G1KCR2_ANOCA/32-120RYDTYCF---------------------
W5MN99_LEPOC/159-253RFDAFCF---------------------
I3JZL7_ORENI/119-215RHGAFCF---------------------
I3IZ90_ORENI/264-359RHDVYCF---------------------
H3B5H7_LATCH/254-349KFDAYCF---------------------
H9GPN6_ANOCA/261-356KFDAYCY---------------------
G3UPK3_MELGA/183-278KFDAYCY---------------------
I3JV73_ORENI/115-209LFDVYCF---------------------
W5L2C8_ASTMX/455-549HYDVYCY---------------------
H2S2Y1_TAKRU/82-176TYDVYCY---------------------
H2S086_TAKRU/82-175LFDVFCF---------------------
W5NA55_LEPOC/169-263RYDAFCF---------------------
G3NIT0_GASAC/1023-1115KYDAYCY---------------------
G3UPK3_MELGA/82-176LYDVYCY---------------------
W5KML6_ASTMX/247-341RLGAFCF---------------------
H3D621_TETNG/129-221NFDAFCF---------------------
U3K2S4_FICAL/2229-2321TWDAFCY---------------------
W5KJN6_ASTMX/559-654KYDAYCF---------------------
I3KUU2_ORENI/263-358LHDVYCF---------------------
G1KSH3_ANOCA/2201-2293TWDVFCY---------------------
H2MVR1_ORYLA/2188-2279TWDGFCY---------------------
F1QR32_DANRE/251-342RFDAFCY---------------------
H3CE81_TETNG/448-542RYDVYCY---------------------
H0UZZ3_CAVPO/256-351RFNVYCF---------------------
C3ZYF8_BRAFL/3-96TLNRYC.---------------------
H3BAD0_LATCH/483-577TYDVYCY---------------------
G3T4I8_LOXAF/263-353KYGVYCY---------------------
E9QHN0_DANRE/150-244KYDVYCY---------------------
G3U8V2_LOXAF/271-361LFGVYCY---------------------
L5LVH7_MYODS/44-129KFRAYCY---------------------
G7PQQ7_MACFA/47-129QFAAYCY---------------------
E7F537_DANRE/496-591RYDVYCY---------------------
W5MX80_LEPOC/2209-2300KYDAFCF---------------------
H0ZUW2_TAEGU/155-245LFGVYCF---------------------
G3P4E1_GASAC/27-116KFGVFCF---------------------
M4AV85_XIPMA/622-716RFDAYC.---------------------
I3KEY0_ORENI/273-362KFGVYCY---------------------
G3Q0U6_GASAC/146-239RFDAFCF---------------------
H2UD03_TAKRU/154-248LFDVYCY---------------------
G3T4I8_LOXAF/162-256RYDVFCF---------------------

PF03440

TOX3_BORPE/31-117ETF--CIT--------------------
TOX2_BORPE/30-116TTF--CIM--------------------
A0KFE5_AERHH/24-105TNP--VT.--------------------

PF07979

EAE_ECO27/839-939NAYATCVK--------------------
Q846P2_ECOLX/838-938NAYATCVK--------------------
Q9S6R2_ECOLX/838-939NAFSVCVK--------------------
Q8KRL2_ECOLX/838-937NAYAVCVK--------------------
O06896_ECOLX/839-940NAFAVCVK--------------------
Q8KRK8_ECOLX/838-938NAYAVCVK--------------------
A0A024Z842_ECOLX/840-935NVYAVCVE--------------------
Q9LBG6_ECOLX/835-936NAFAVCVK--------------------
E7UB01_ECOLX/838-937NAYAVCIK--------------------
Q9R8B4_ECOLX/839-934NVYAVCVE--------------------
INVA_YEREN/735-833TAYPLCAE--------------------
Q8RSS9_ECOLX/842-948NAFAVCVR--------------------
Q8KRL0_ECOLX/839-939NAYATCVK--------------------
Q8KRL1_ECOLX/842-948NAFAVCVK--------------------

PF05473

A5A7J2_9ALPH/19-219KGFGVCYAARPLSPLGELIYKARQALRL
G9I267_HHV2/4-171LAIRICYYPRSPGGFVRFVTSIRNALGL
O89243_9ALPH/3-191TCTAICQRPRPLSIVASIIRDARTSLRL
O56871_ILTV/33-274TAGVICYMSPAISPALRYIKALRVALSF
EV45_GAHVM/3-192TCSVVCQRPRPLSTAASIIRDARIYLRL
Q5Y0Q7_9ALPH/5-173PALRICHHPRDAGGFVTFVLGARDALGL
D3YPA9_HHV1/4-171PALRICYYPRSPGGFVQFVTSTRNALGL
EV45_EHV4/19-218KRVGVCYAARPLSPLGELIYKARQALRL
EV45_MEHVH/3-193TCTVICQRPRPLSTMSSIIRDARVYLHL
Q66077_9ALPH/2-174SSIAICQTNHPLSSLGNFVIKIRKIFGF
Q69365_FHV1/7-189TSMAVCQSTYLPNPLSDFIMRVRQIFSG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window