Sequence alignment for CL0056

PF00193

HPLN1_RAT/158-253--------------------------------------------------------------------------------
HPLN1_RAT/259-350--------------------------------------------------------------------------------
CSPG2_HUMAN/149-244--------------------------------------------------------------------------------
PGCB_FELCA/156-251--------------------------------------------------------------------------------
PGCB_FELCA/257-353--------------------------------------------------------------------------------
PGCA_HUMAN/152-247--------------------------------------------------------------------------------
PGCA_RAT/486-581--------------------------------------------------------------------------------
PGCA_HUMAN/253-349--------------------------------------------------------------------------------
PGCA_RAT/587-683--------------------------------------------------------------------------------
TSG6_RABIT/35-128--------------------------------------------------------------------------------
CSPG2_HUMAN/250-346--------------------------------------------------------------------------------
CD44_PAPHA/31-119--------------------------------------------------------------------------------

PF00059

LYAM3_MOUSE/49-160--------------------------------------------------------------------------------
B3NA70_DROER/197-283--------------------------------------------------------------------------------
A7SG58_NEMVE/48-146--------------------------------------------------------------------------------
ASGR2_HUMAN/194-302--------------------------------------------------------------------------------
Q28DK0_XENTR/134-267--------------------------------------------------------------------------------
ASGR1_HUMAN/171-279--------------------------------------------------------------------------------
IXXA_PROFL/42-152--------------------------------------------------------------------------------
SFTPD_RAT/269-374--------------------------------------------------------------------------------
LECA_SARPE/42-159--------------------------------------------------------------------------------
Q0NQ70_COWPX/61-155--------------------------------------------------------------------------------
FCER2_HUMAN/180-284--------------------------------------------------------------------------------
KLRG2_HUMAN/310-406--------------------------------------------------------------------------------
Q9N3W1_CAEEL/37-145--------------------------------------------------------------------------------
E4Y143_OIKDI/82-193--------------------------------------------------------------------------------
V001_FOWPN/101-188--------------------------------------------------------------------------------
E5RY41_TRISP/53-163--------------------------------------------------------------------------------
LFC_TACTR/453-566--------------------------------------------------------------------------------
A9J0X0_VACCA/64-164--------------------------------------------------------------------------------
E3LCH6_CAERE/1231-1343--------------------------------------------------------------------------------
E3LJN0_CAERE/2714-2811--------------------------------------------------------------------------------
VGA7_ALHV1/126-224--------------------------------------------------------------------------------
LYAM1_HUMAN/46-157--------------------------------------------------------------------------------
Q6VZ59_CNPV/57-147--------------------------------------------------------------------------------
Q963D6_NECAM/44-162--------------------------------------------------------------------------------
LECG_CROAT/20-133--------------------------------------------------------------------------------
LYAM3_HUMAN/49-160--------------------------------------------------------------------------------
Q9Q8H9_MYXVL/64-168--------------------------------------------------------------------------------
Q6TUP6_YMTV5/64-166--------------------------------------------------------------------------------
MRC1_HUMAN/1252-1357--------------------------------------------------------------------------------
CLC4F_RAT/429-538--------------------------------------------------------------------------------
LEC3_MEGRO/45-152--------------------------------------------------------------------------------
C0HAR6_SALSA/133-268--------------------------------------------------------------------------------
ISP2_OSMMO/55-161--------------------------------------------------------------------------------
LECH_CHICK/98-203--------------------------------------------------------------------------------
Q1HTR2_9POXV/67-181--------------------------------------------------------------------------------
LYAM2_CANFA/30-141--------------------------------------------------------------------------------
MBL2_RAT/140-242--------------------------------------------------------------------------------
Q4SDM0_TETNG/692-804--------------------------------------------------------------------------------
SFTPA_MOUSE/144-248--------------------------------------------------------------------------------
NKG2D_HUMAN/116-213--------------------------------------------------------------------------------
ISP2_HEMAM/58-161--------------------------------------------------------------------------------
Q8V3H6_SWPV1/63-165--------------------------------------------------------------------------------
F1NUD4_CHICK/202-294--------------------------------------------------------------------------------
LPSBP_PERAM/137-254--------------------------------------------------------------------------------
REG3B_MOUSE/57-173--------------------------------------------------------------------------------
MRC1_HUMAN/966-1081--------------------------------------------------------------------------------
A6QPD3_BOVIN/171-271--------------------------------------------------------------------------------
CD72_HUMAN/250-352--------------------------------------------------------------------------------
Q6VZW8_CNPV/55-136--------------------------------------------------------------------------------
C3XRG9_BRAFL/43-156--------------------------------------------------------------------------------
E9GSY7_DAPPU/251-368--------------------------------------------------------------------------------
MBL1_RAT/134-236--------------------------------------------------------------------------------
F1M5M2_RAT/203-312--------------------------------------------------------------------------------
ASGR2_MOUSE/187-295--------------------------------------------------------------------------------
Q8UZH5_9GAMA/120-217--------------------------------------------------------------------------------
SFTPD_BOVIN/264-369--------------------------------------------------------------------------------
Q993G6_9GAMA/140-238--------------------------------------------------------------------------------
A2AIN6_MOUSE/249-342--------------------------------------------------------------------------------
SFTPD_HUMAN/270-375--------------------------------------------------------------------------------
LYAM2_MOUSE/29-140--------------------------------------------------------------------------------
REG3A_HUMAN/57-173--------------------------------------------------------------------------------
IXXB_PROFL/42-144--------------------------------------------------------------------------------
D3IZC8_9POXV/67-162--------------------------------------------------------------------------------
A7SG60_NEMVE/46-144--------------------------------------------------------------------------------
F1RK81_PIG/134-267--------------------------------------------------------------------------------
KLRBA_RAT/111-212--------------------------------------------------------------------------------
SFTPA_RABIT/143-247--------------------------------------------------------------------------------
E2RAK1_CANFA/250-353--------------------------------------------------------------------------------
A9YY98_SHEV/64-167--------------------------------------------------------------------------------
A7XCQ8_9POXV/64-166--------------------------------------------------------------------------------
SFPA2_HUMAN/144-248--------------------------------------------------------------------------------
Q9N3W8_CAEEL/37-145--------------------------------------------------------------------------------
Q06ZZ3_CPRV/55-157--------------------------------------------------------------------------------
Q5BK59_RAT/247-352--------------------------------------------------------------------------------
MRC1_HUMAN/521-627--------------------------------------------------------------------------------
F1P2W2_CHICK/670-781--------------------------------------------------------------------------------
C1IIM8_BOVIN/46-161--------------------------------------------------------------------------------
CLC87_CAEEL/103-224--------------------------------------------------------------------------------
C1C4X9_LITCT/224-318--------------------------------------------------------------------------------
MBL2_HUMAN/144-246--------------------------------------------------------------------------------
C3XXU7_BRAFL/313-420--------------------------------------------------------------------------------
MRC1_HUMAN/380-488--------------------------------------------------------------------------------
KLRBA_MOUSE/111-212--------------------------------------------------------------------------------
LECA_PLEWA/54-166--------------------------------------------------------------------------------
REG3A_RAT/56-172--------------------------------------------------------------------------------
O17575_CAEEL/2720-2817--------------------------------------------------------------------------------
B4KGI3_DROMO/50-166--------------------------------------------------------------------------------
Q6VZE9_CNPV/62-150--------------------------------------------------------------------------------
F1KQ91_ASCSU/56-180--------------------------------------------------------------------------------
NKG2A_HUMAN/136-231--------------------------------------------------------------------------------
Q08F49_DPV84/64-164--------------------------------------------------------------------------------
SFTPA_CANFA/144-248--------------------------------------------------------------------------------
O62171_CAEEL/239-356--------------------------------------------------------------------------------
Q8JJP7_9GAMA/132-231--------------------------------------------------------------------------------
E1BT58_CHICK/214-305--------------------------------------------------------------------------------

PF05966

Q50LD9_9POXV/1-185---------------------------------------------------------------------MMTPEN.....
Q1HTR3_9POXV/2-193---------------------------------------------------------------------ADVEQQADTLP
Q77GH4_LSDV/6-196---------------------------------------------------------------------PKSGTETDY.D
Q9Q8V7_RFVKA/1-172---------------------------------------------------------------------MSLQEN.DVED
Q08F50_DPV84/6-192---------------------------------------------------------------------ITMEEGNDKKD
Q8V3H7_SWPV1/1-185---------------------------------------------------------------------MSVEVNMENVK

PF07979

EAE_ECO27/839-939--------------------------------------------------------------------------------
Q846P2_ECOLX/838-938--------------------------------------------------------------------------------
Q9S6R2_ECOLX/838-939--------------------------------------------------------------------------------
Q8KRL2_ECOLX/838-937--------------------------------------------------------------------------------
O06896_ECOLX/839-940--------------------------------------------------------------------------------
Q8KRK8_ECOLX/838-938--------------------------------------------------------------------------------
Q8VL95_ECOLX/840-935--------------------------------------------------------------------------------
Q9LBG6_ECOLX/835-936--------------------------------------------------------------------------------
Q93K94_ECOLX/838-937--------------------------------------------------------------------------------
Q9R8B4_ECOLX/839-934--------------------------------------------------------------------------------
INVA_YEREN/735-833--------------------------------------------------------------------------------
Q8RSS9_ECOLX/842-948--------------------------------------------------------------------------------
Q8KRL0_ECOLX/839-939--------------------------------------------------------------------------------
Q8KRL1_ECOLX/842-948--------------------------------------------------------------------------------

PF03440

TOX3_BORPE/31-117--------------------------------------------------------------------------------
AER3_AERHY/24-106--------------------------------------------------------------------------------
AERA_AERTR/24-106--------------------------------------------------------------------------------
TOX2_BORPE/30-116--------------------------------------------------------------------------------
AERA_AERSA/26-108--------------------------------------------------------------------------------

PF01413

CO4A4_HUMAN/1573-1689--------------------------------------------------------------------------------
CO4A4_HUMAN/1465-1572--------------------------------------------------------------------------------
CO4A1_CAEEL/1535-1644--------------------------------------------------------------------------------
CO4A1_DROME/1663-1777--------------------------------------------------------------------------------
CO4A1_CAEEL/1645-1758--------------------------------------------------------------------------------
CO4A1_DROME/1555-1662--------------------------------------------------------------------------------
CO4A2_HUMAN/1489-1596--------------------------------------------------------------------------------
CO4A2_HUMAN/1597-1711--------------------------------------------------------------------------------
CO4A3_HUMAN/1555-1668--------------------------------------------------------------------------------
CO4A3_HUMAN/1445-1554--------------------------------------------------------------------------------
Q07265_STRPU/1528-1637--------------------------------------------------------------------------------
CO4A1_HUMAN/1555-1668--------------------------------------------------------------------------------
Q26640_STRPU/1526-1633--------------------------------------------------------------------------------
CO4A6_HUMAN/1467-1574--------------------------------------------------------------------------------
CO4A2_CAEEL/1639-1753--------------------------------------------------------------------------------
CO4A5_HUMAN/1461-1570--------------------------------------------------------------------------------
Q07265_STRPU/1638-1751--------------------------------------------------------------------------------
O18407_DROME/1513-1622--------------------------------------------------------------------------------
O09238_9METZ/629-736--------------------------------------------------------------------------------
Q26640_STRPU/1634-1746--------------------------------------------------------------------------------
CO4A2_CAEEL/1531-1638--------------------------------------------------------------------------------
CO4A6_HUMAN/1575-1690--------------------------------------------------------------------------------
CO4A1_HUMAN/1445-1554--------------------------------------------------------------------------------
CO4A5_HUMAN/1571-1684--------------------------------------------------------------------------------
O09238_9METZ/737-850--------------------------------------------------------------------------------
O18407_DROME/1623-1735--------------------------------------------------------------------------------

PF05473

EV45_EHV1D/19-219TATVDAQAPPLPTKTVPVFAPPLSTPPQPNELVYTKRRRTKRKAKCRC.....................LFFTMGMFALG
EV45_HHV23/4-171RASGPAYQPLAP.....................AASPARARV..PAVA...........................WIGVG
Q782P9_9ALPH/3-191SPTPEDDPRLGPVRGLLRM...........MDETTS.ERHKR.SRSGC......................PRLLCGCTIG
O56871_ILTV/33-274TPSEDQRSHLEKMMAELPFEVRAILEDEPSVCSSTSSSTTSTYSPHPSGELHSMRPENTGGQYWKACKVILLILLGIFLG
Q77Q60_9ALPH/3-192SPTPEDDRDLVVVRGRLRM...........MDNGAEHDRERR.SYTAW......................PHLCCGCTIG
Q5Y0Q7_9ALPH/5-173APERLGYRPLAP....................GGRLAAPGRL..PAAA...........................WLLAG
EV45_HHV11/4-171RASEHAYRPLGP.....................GTPPMRARL..PAAA...........................WVGVG
EV45_EHV4/19-218TAAGNDQAPQLPTKTVLGFTPPLPTLPQPTELVYTKRRRPKRRSRCRC.....................LCFTMGMFAMG
Q77L25_MEHV1/3-193SPTPEDDRDLVVVRGRLRM...........MDSGTETDREQRHPRTTW......................RSICCGCTIG
Q66077_9ALPH/2-174AQLVLTDIPLEDVEN............KNTSSDEETTNLNQKKSTCQC.....................LCVTLGFFAAG
Q69365_FHV1/7-189TSQPLVEIPLVDMEPQPSIHSNEPNPPNKMLTTAISSRRSGI...........................FLFSLGMFFFG

PF00193

HPLN1_RAT/158-253------GVVFPYFPRLGRYNLNFHEARQACL-D---Q--DAVIASFD---------------------------QLYDAW
HPLN1_RAT/259-350------GRFYYLIHPT...KLTYDEAVQACL-N---D--GAQIAKVG---------------------------QIFAAW
CSPG2_HUMAN/149-244------GVVFHYRAATSRYTLNFEAAQKACL-D---V--GAVIATPE---------------------------QLFAAY
PGCB_FELCA/156-251------GVVFLYREGSARYAFSFARAQEACA-R---I--GARIATPE---------------------------QLYAAY
PGCB_FELCA/257-353------GELFLGAPPD...NVTLEEATAYCR-E---R--GAEIATTG---------------------------QLYAAW
PGCA_HUMAN/152-247------GIVFHYRAISTRYTLDFDRAQRACL-Q---N--SAIIATPE---------------------------QLQAAY
PGCA_RAT/486-581------GVVFHYRPGSTRYSLTFEEAQQACI-R---T--GAAIASPE---------------------------QLQAAY
PGCA_HUMAN/253-349------GEVFYATSPE...KFTFQEAANECR-R---L--GARLATTG---------------------------HVYLAW
PGCA_RAT/587-683------GEVFFATQME...QFTFQEAQAFCA-A---Q--NATLASTG---------------------------QLYAAW
TSG6_RABIT/35-128------AGVYHREARSGKYKLTYAEAKAVCE-F---E--GGRLATYK---------------------------QLEAAR
CSPG2_HUMAN/250-346------GDVFHLTVPS...KFTFEEAAKECE-N---Q--DARLATVG---------------------------ELQAAW
CD44_PAPHA/31-119------EGIYHVEKNG.RYSISRTEAADLCK-A---F--NSTLPTMA---------------------------QMEKAL

PF00059

LYAM3_MOUSE/49-160------------------KAYSWNNSRVFCR.R...H--FTDLVAIQN....KNEIAHLNDVIPF.........FNSYYW
B3NA70_DROER/197-283------------------LMVNWVTAARMCR.A...M--GGYLASIDD....EDDLAEIRSNLY..........SYRYYW
A7SG58_NEMVE/48-146------------------TVMNFDKAKLRCF.E...A--GAQLFVKPPGYWHTQVFSDINGIIYGL........STGRYH
ASGR2_HUMAN/194-302------------------SGKAWAEAEKYCQ.L...E--NAHLVVINS....WEEQKFIVQHT...........NPFNTW
Q28DK0_XENTR/134-267------------------SGENYWDAVQTCQ.K...V--NGSLATFTT....DQELKFILAQEWDMEERPYGRKDQRRLW
ASGR1_HUMAN/171-279------------------SGKAWADADNYCR.L...E--DAHLVVVTS....WEEQKFVQHHI...........GPVNTW
IXXA_PROFL/42-152------------------KYKTWEDAERVCTEQA..K--GAHLVSIES....SGEADFVAQLVTQNMKR.....LDFYIW
SFTPD_RAT/269-374------------------SEEPFEDAKEMCR.Q...A--GGQLASPRS....ATENAAVQQLVTA.........HSKAAF
LECA_SARPE/42-159------------------LKYNWHQAWHECA.R...H--DQQLVTIESADKNNAIIDLVKRVVG..........KSHNLW
Q0NQ70_COWPX/61-155------------------DTTNWTASFEYCK.N...M--NGRLACIIN....DTFPKICRYK............GTFDYW
FCER2_HUMAN/180-284------------------GTKQWVHARYACD.D...M--EGQLVSIHS....PEEQDFLTKHA...........SHTGSW
KLRG2_HUMAN/310-406------------------EAQAWEASQAFCS.A...Y--HATLPLL......SHTQDFLGRYP...........VSRHSW
Q9N3W1_CAEEL/37-145------------------YQLTYNASRNYCHHNNPVG--FSNLAYVPD....KETSNYLAVYAHSAFGS.....AAENFW
E4Y143_OIKDI/82-193------------------EPKDFQSALLFCE.K...Q--KGTLANFHE....YFNLRIIS..............ENDEFY
V001_FOWPN/101-188------------------EKVGFRQGIQKCE.K...L--GSDMIGKS.....EEEMK.................ALKNIW
E5RY41_TRISP/53-163------------------QKRTFQHAEQECA.K...L--NAELFFPPS....GKIVLTIP..............HSKEFW
LFC_TACTR/453-566------------------KQRAWERAQGVCT.N...M--AARLAVLDKDLIPSSLTETLRGK............GLTTTW
A9J0X0_VACCA/64-164------------------IKMSTDNAVYQCR.K...L--RARLPRPD.....TRHLRVLFSI............FYKDYW
E3LCH6_CAERE/1231-1343------------------NVLPVPQAMKFCA.S...A--GGYLVDDMD....AGQNEFLNGAA...........AYTQFW
E3LJN0_CAERE/2714-2811------------------SAVTYTKAVEYCK.E...L--GAFVPY.......LRIDDILQTQLAQ.........RIEKFS
VGA7_ALHV1/126-224------------------KTYSFQNCFFACKNI...S--KCFYLYTPQ....NITDPFFDHTL...........RDQDIW
LYAM1_HUMAN/46-157------------------KPMNWQRARRFCR.D...N--YTDLVAIQN....KAEIEYLEKTLPF.........SRSYYW
Q6VZ59_CNPV/57-147------------------LDLKWKDAIDQCH.K...E--HSSLVQVT.....DKDVEFFNKF............GIGCIW
Q963D6_NECAM/44-162------------------PLLEHDKAEIKCW.E...M--GSTLLVAET....LDEYELITDRAK..........ESAWSW
LECG_CROAT/20-133------------------QLKTWEDAEMFCR.KYK.P--GCHLASFHRYGESLEIAEYISDYHK..........GQENVW
LYAM3_HUMAN/49-160------------------KAYSWNISRKYCQ.N...R--YTDLVAIQN....KNEIDYLNKVLPY.........YSSYYW
Q9Q8H9_MYXVL/64-168------------------IQLSVYGGAVLCA.N...H--KARIPKAN.....FRHLKVISLT............YGRDFW
Q6TUP6_YMTV5/64-166------------------IQLTDDGALSVCD.G...Y--RAVLPKTN.....SKHLKVISIT............YGKYFW
MRC1_HUMAN/1252-1357------------------YTRNWGQASLECL.R...M--GSSLVSIES....AAESSFLSYRVEPLK.......SKTNFW
CLC4F_RAT/429-538------------------DKKSWHEAENFCV.S...Q--GAHLASVTS....QEEQAFLVQIT...........NAVDHW
LEC3_MEGRO/45-152------------------YQVRWNDAQLACQ.TVH.P--GAYLATIQS....QLENAFISETV...........SNNRLW
C0HAR6_SALSA/133-268------------------RNENYWQAVDTCQ.K...V--NGSLATFVT....NEELQFILKIEVDFDTEVCERRDQCKFW
ISP2_OSMMO/55-161------------------LQLHWAHAQISCM.K...D--GANLASIHS....LEEYAFVKELTTA.........GLIPAW
LECH_CHICK/98-203------------------SRMSWHKAKAECE.E...M--HSHLIIIDS....YAKQNFVMFRT...........RNERFW
Q1HTR2_9POXV/67-181------------------AAMAMEAAIMRCE.S...M--RAHLPIPY.....YKHAQVVAMTL...........NKDKFW
LYAM2_CANFA/30-141------------------EAMTFDEASTYCQ.Q...R--YTHLVAIQN....QEEIKYLNSMFTY.........TPTYYW
MBL2_RAT/140-242------------------RRMPLNRAKALCS.E...L--QGTVATPRN....AEENRAIQNV............AKDVAF
Q4SDM0_TETNG/692-804------------------ANDSYDNAKLACR.S...H--NAVLASLTT....QKKVDFVLKELQTVSRMYK...TAVTPW
SFTPA_MOUSE/144-248------------------QSVNFDTIREMCT.R...A--GGHIAAPRN....PEENEAIASITKK.........YNTYPY
NKG2D_HUMAN/116-213------------------ESKNWYESQASCM.S...Q--NASLLKVYS....KEDQDLLKL.............VKSYHW
ISP2_HEMAM/58-161------------------TAMTWALAETNCM.K...L--GGHLASIHS....QEEHSFIQTL............NAGVVW
Q8V3H6_SWPV1/63-165------------------VKLTIYGALSLCN.T...Y--NAKIPKTN.....FRHLKVMSLT............YGKQFW
F1NUD4_CHICK/202-294------------------AKKSWWGSYWDCV.E...K--HSRLLVQG.....ESELWVLPHFLQS.........DSAKYW
LPSBP_PERAM/137-254------------------TPKTWDEARIICQ.Q...E--GGHLVIINS....EDESKVLQNLFSKVTKTEGAT.NNDYIF
REG3B_MOUSE/57-173------------------IPQTWFDAELACQ.KR..P--GGHLVSVLN....SAEASFLSSMVKRTGN......SYQYTW
MRC1_HUMAN/966-1081------------------ERKNWQEARKACI.G...F--GGNLVSIQN....EKEQAFLTYHMKD.........STFSAW
A6QPD3_BOVIN/171-271------------------KTVSWSECSDLCV.F...W--NATFLNTER....SRLMCILKLL............AVNQTW
CD72_HUMAN/250-352------------------TSKNWQESQKQCE.T...L--SSKLATFSEIYPQSHSYYFLNSLLPNGG.......SGNSYW
Q6VZW8_CNPV/55-136------------------HKVSWKDGFDRCN......--.............LIGAKMLNNSIL..........SEDRIP
C3XRG9_BRAFL/43-156------------------ASTDYAGAEGLCL.K...H--DGRLIRVMN....IETHEFLLNHILTCIN......QSVSFW
E9GSY7_DAPPU/251-368------------------VQHSWERAADLCK.R...Y--GSDLVVVESYQQNNISEKLAQEQLNPVTH......PDAAFW
MBL1_RAT/134-236------------------ERMPFSKVKALCS.E...L--RGTVAIPRN....AEENKAIQEV............AKTSAF
F1M5M2_RAT/203-312------------------SRESYDSAKLYCY.N...L--SGNLASLTT....SKEVGFVLDEIQKNTQ......QRVSPW
ASGR2_MOUSE/187-295------------------DGLTWAEADQYCQ.L...E--NAHLLVINS....REEQDFVVKHR...........SQFHIW
Q8UZH5_9GAMA/120-217------------------QKHPWDGCFKACAEL...Y--ECTYFYGPT....ANILPVVTGNLK..........ASESLW
SFTPD_BOVIN/264-369------------------SEKTFQDAQQICT.Q...A--GGQLPSPRS....AAENEALTQLATA.........QNKAAF
Q993G6_9GAMA/140-238------------------QTYTWEHCFSVCAQL...H--NCTFFYGPN....ANTSPIVQKNLK..........NGESLW
A2AIN6_MOUSE/249-342------------------TLGSLEESQKYCT.S...L--SSKLAAFDEPSKYYYEVSLPSGLEELLD.......RSKSYW
SFTPD_HUMAN/270-375------------------FVKPFTEAQLLCT.Q...A--GGQLASPRS....AAENAALQQLVVA.........KNEAAF
LYAM2_MOUSE/29-140------------------ELMTYDEASAYCQ.R...D--YTHLVAIQN....KEEINYLNSNLKH.........SPSYYW
REG3A_HUMAN/57-173------------------SPKSWTDADLACQ.KR..P--SGNLVSVLS....GAEGSFVSSLVKSIGN......SYSYVW
IXXB_PROFL/42-144------------------EPKNWADAENFCTQQH..A--GGHLVSFQS....SEEADFVVKLAFQTF.......GHSIFW
D3IZC8_9POXV/67-162------------------VMTNLTLARDICA.S...M--DSDLPATPD....TMFLRGIMSIV...........EATSFW
A7SG60_NEMVE/46-144------------------TVMNFNEAKFKCS.E...A--GAQLFVKPPGYG.YTVFSDMNGIIYCD........HGCRYH
F1RK81_PIG/134-267------------------SGENYWDAAQTCQ.R...V--NGSLAIFST....DQELRFVLAQEWDQPERSFAWQDQHKLW
KLRBA_RAT/111-212------------------TSITWKESLADCG.G...K--GATLLLVQD....QEELRFLRNLTKR.........ISSSFW
SFTPA_RABIT/143-247------------------QSVNFDAIREVCA.R...A--GGRIAVPRS....LEENEAIASIVKE.........RNTYAY
E2RAK1_CANFA/250-353------------------TERSWEESRNHCK.S...L--SSDLAEFSESYVYSHPIAYGNRAWKMLTQIS....PPGSFW
A9YY98_SHEV/64-167------------------LQLSLYGGVMLCN.K...Y--NAKIPNVS.....IRHLKVISLT............YGRQFW
A7XCQ8_9POXV/64-166------------------LQLAANGALNVCN.S...Y--KARLPKTN.....FRHLKVLSLT............YSKHFW
SFPA2_HUMAN/144-248------------------QSITFDAIQEACA.R...A--GGRIAVPRN....PEENEAIASFVKK.........YNTYAY
Q9N3W8_CAEEL/37-145------------------QKMTYDDAHNWCHFKNPVG--FSYLAYVPD....QVTSNYLAVFARTEFGP.....DAEKFW
Q06ZZ3_CPRV/55-157------------------VKMSALNAQTKCR.S...M--GGALPG.......TPETDWVSNVLTDL........SNAPYW
Q5BK59_RAT/247-352------------------TPRSLEESRKYCT.S...L--SSKLAVLNEPPRYSLQDSLPDGLKKLLD.......RSKSYW
MRC1_HUMAN/521-627------------------TLSTFAEANQTCN.N...E--NAYLTTIED....RYEQAFLTSFVGLR........PEKYFW
F1P2W2_CHICK/670-781------------------AKENYDHAKLSCR.S...S--GASLASLTT....QKKVEFVLKELQKMQSSS....KALTPW
C1IIM8_BOVIN/46-161------------------AXETYDNAKLSCR.N...H--NAFLASLTT....QKKVEFVLKQLRIMQSSQSMSKFTLTPW
CLC87_CAEEL/103-224------------------ELLGFAKAERNCF.E...K--QSTLFVANS....IEEWDAIRVQAK..........EAFFSW
C1C4X9_LITCT/224-318------------------NKKRRFLSDKDCE.K...H--DSRLAQVKE....KTLRRLVNI.............TGKEFW
MBL2_HUMAN/144-246------------------EIMTFEKVKALCV.K...F--QASVATPRN....AAENGAIQNL............IKEEAF
C3XXU7_BRAFL/313-420------------------SALTHQDATQACS.A...I--GGRMVDVRD....HQQHQFLADTIAAS........TGASCW
MRC1_HUMAN/380-488------------------EKKIQRDALTTCR.K...E--GGDLTSIHT....IEELDFIISQLGYE........PNDELW
KLRBA_MOUSE/111-212------------------VSNTWEEGLVDCD.G...K--GATLMLIQD....QEELRFLLDSIKE.........KYNSFW
LECA_PLEWA/54-166------------------NAKSWTDAEFYCQ.KLY.P--GAHLASIHS....EDENDFLTEITFKNNS......NYPVVW
REG3A_RAT/56-172------------------TLKSWFQADLACQ.KR..P--SGHLVSILS....GGEASFVSSLVTGRVN......NNQDIW
O17575_CAEEL/2720-2817------------------SAVTFSRAVEYCE.E...L--DAFVPY.......LRINDILQSQLAQ.........RIEKFS
B4KGI3_DROMO/50-166------------------IKHSWEKSAELCR.R...Y--GAELVAIDSYAENNETLAIARASDPNQR.......ASDKYW
Q6VZE9_CNPV/62-150------------------ELANWTDSLKKCR.E...V--GADLVTYPS....DPDTEYDVTRYS..........CFDKHW
F1KQ91_ASCSU/56-180------------------EWLSWNKSNILCS.SAGYN--NSYGITTHNWFLARELSKTMLH.............SEGSYW
NKG2A_HUMAN/136-231------------------ERRTWEESLLACT.S...K--NSSLLSIDN....EEEMKFLSI.............ISPSSW
Q08F49_DPV84/64-164------------------LQLSAYGAVSICN.N...Y--DARLPKAN.....FRHLRVAYLT............YGKVFW
SFTPA_CANFA/144-248------------------QSINFNDIQELCA.G...A--GGQIAAPMS....PEENEAVASIVKK.........YNTYAY
O62171_CAEEL/239-356------------------LPASWSIAQASCHHKG..N--NGHLVNEYS....REKHDFVMAILKTYKEFQ....PTYKYH
Q8JJP7_9GAMA/132-231------------------EVHTFEACFFICARF...S--KCYWFYAPQ....QKDDPIIRRNMK..........PNDQLW
E1BT58_CHICK/214-305------------------VKKSWWGSYWDCV.E...K--HSHLLVQG.....ESELWVLPRFLQA.........DGSMYW

PF05966

Q50LD9_9POXV/1-185.DEEQTSVFSATVYGDKIQGKN...KRKRVI-G---L--CIRISMVISLLSMITMSAFLIVRLNQCMSANEAA-ITDAAV
Q1HTR3_9POXV/2-193LN...........IPEKPRRHPLAARGMACA-I---I--TLRIMVLVSLVSLTTIVAALAVQLRACRQQHE..-GSACAV
Q77GH4_LSDV/6-196ESNNFTAFAGSTIYGYGLKSKKNIKKKVKLI-N---F--CIKISIMASMVSLITITILLAFFNNTCELNQFKE-HKPYFL
Q9Q8V7_RFVKA/1-172SKDEGAAFIGSTIYGNKLK.KKHLIKKVKCV-S---I--LLRVSIVTSIVSLMAITAILALQCSTCDVVKTSA-HISSSI
Q08F50_DPV84/6-192VTENANSFVGSTIYGPKL..KKTKSKKSKWL-S---I--CLRVLVISSILSLMAVATTLALQYSKCKAEYDSI-TNKQSF
Q8V3H7_SWPV1/1-185SEDNATSFSGSTIYGNKLK.KKTNKSKSRCL-A---I--GLRIAIITSLLSLIGIATTLALQYNKCKSVIE..-HNEQSY

PF07979

EAE_ECO27/839-939-------PNSL.IVPNMSKRVTYNDAVNTCK..N--F--GGKLPSSQNELEN......VFKAWGAA--------NKYEYY
Q846P2_ECOLX/838-938-------PSSM.I.VSINERMTYNNAMSSCQ..S--L--SGRLPSSQKELAD......VFDTWGAA--------NKYEHY
Q9S6R2_ECOLX/838-939-------PGSIVIAVDKNTRVTYFDAENKCK..T--N--SANLAQSKELLAN......IYSTWGAA--------NKYPYY
Q8KRL2_ECOLX/838-937-------PQEI.VSLDKNGKVTYDEANSICL..G--N--SAHLSASVDTLKK......VYSQWGPA--------SKYEHY
O06896_ECOLX/839-940-------PDKIVIAVDKINRMTYSAAENKCR..T--I--SANLAPSKSIFGD......TYSKWGAA--------NKYSYY
Q8KRK8_ECOLX/838-938-------PKKI.VSVNSDSRVNYNSASSICG..K--I--NGSLPSSIAELET......LYNKWGAA--------NNYQHY
Q8VL95_ECOLX/840-935-------PNYM.IRVGN..KASYANAMSFCG..N--L--...LPSSQTVLSN......VYNSWGPA--------NGYDHY
Q9LBG6_ECOLX/835-936-------PDNIIIAVDKINRMAYSEAESRCQ..A--I--SSNLAQSKSVLEN......IYSKWGAA--------NKYPYY
Q93K94_ECOLX/838-937-------PQEI.VSLDNSVKVKYDEASGICS..N--N--AAYLSVSVDSLKK......LYSQWGPA--------NKYSHY
Q9R8B4_ECOLX/839-934-------PSYM.IKVDK..QAYYADAMSICK..N--L--...LPSTQTVLSD......IYDSWGAA--------NKYSHY
INVA_YEREN/735-833-------PNLW.VFSGTMSLQSSVEASRNCQRTD--F--TALIESARASNGSRSPDGTLWGEWGSL--------ATYDSA
Q8RSS9_ECOLX/842-948-------PEKI.ITVETQNKVIYSVAEATCS..T--N--SGRLPSSTSELKD......VYNKWGAA--------NSYEGY
Q8KRL0_ECOLX/839-939-------PNSL.IVPNMSKRVTYNDAVNTCK..I--L--GGRLPSSQDELKN......VFNTWGAA--------NKYEYY
Q8KRL1_ECOLX/842-948-------PENI.ITVETQDKVLYNVAKTKCE..M--N--SGRLPSSTSELKD......VYNQWGPA--------NSYDGY

PF03440

TOX3_BORPE/31-117---------PGIVIPPKALFTQQGGAYGRCP-----N--GTRALTVAELRGNAELQTYLRQI------------TPGWSI
AER3_AERHY/24-106---------AEPVYPDQLRLFSLG..QEVCG-----D--KYRPVNREEAQS...VKSNIVGM------------MGQWQI
AERA_AERTR/24-106---------AEPIYPDQLRLFSLG..EDVCG-----T--DYRPINREEAQS...VRNNIVAM------------MGQWQI
TOX2_BORPE/30-116---------PGIVIPPQEQITQHGGPYGRCA-----N--KTRALTVAELRGSGDLQEYLRHV------------TRGWSI
AERA_AERSA/26-108---------HEPVYPDQVKWAGLG..TGVCA-----S--GYRPLTRDEAMS...IKGNLVSR------------MGQWQI

PF01413

CO4A4_HUMAN/1573-1689----------AQA----VAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGD-QGGGQALMSPGSCLE-DFR---AAPFLE
CO4A4_HUMAN/1465-1572----------GFL----LVLHSQTDQEPTCPLGMPRLWTGYSLLYLEG.QE-KAHNQDLGLAGSCLP-VFS---TLPFAY
CO4A1_CAEEL/1535-1644----------GFT----FAKHSQTTAVPQCPPGASQLWEGYSLLYVQG.NG-RASGQDLGQPGSCLS-KFN---TMPFMF
CO4A1_DROME/1663-1777----------ANV----IAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGN-GGGGQALQSPGSCLE-DFR---ATPFIE
CO4A1_CAEEL/1645-1758----------TQI----IAVHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGA-EGTGQSLQSPGSCLE-EFR---AVPFIE
CO4A1_DROME/1555-1662----------GIL----ITRHSQSETVPACSAGHTELWTGYSLLYVDG.ND-YAHNQDLGSPGSCVP-RFS---TLPVLS
CO4A2_HUMAN/1489-1596----------GYL----LVKHSQTDQEPMCPVGMNKLWSGYSLLYFEG.QE-KAHNQDLGLAGSCLA-RFS---TMPFLY
CO4A2_HUMAN/1597-1711----------AIA----IAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGD-EGGGQSLVSPGSCLE-DFR---ATPFIE
CO4A3_HUMAN/1555-1668----------AIA----IAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGS-EGTGQALASPGSCLE-EFR---ASPFLE
CO4A3_HUMAN/1445-1554----------GFV----FTRHSQTTAIPSCPEGTVPLYSGFSFLFVQG.NQ-RAHGQDLGTLGSCLQ-RFT---TMPFLF
Q07265_STRPU/1528-1637----------GFF----ITRHSQTTSIPQCPQGTAKMWHGYSLLFVQG.NE-RGHGQDLGKPGSCLK-RFS---TMPFLF
CO4A1_HUMAN/1555-1668----------AMV----MAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGA-EGSGQALASPGSCLE-EFR---SAPFIE
Q26640_STRPU/1526-1633----------GHF----ITRHSQSRNVPSCPAGTVELWRGFSVLFSMG.NG-HAHHQDLGDAGSCLQ-RFS---TMPFLF
CO4A6_HUMAN/1467-1574----------GYT----LVKHSQSEQVPPCPIGMSQLWVGYSLLFVEG.QE-KAHNQDLGFAGSCLP-RFS---TMPFIY
CO4A2_CAEEL/1639-1753----------ANT----IAVHSQTIQIPNCPAGWSSLWIGYSFAMHTGAGA-EGGGQSPSSPGSCLE-DFR---ATPFIE
CO4A5_HUMAN/1461-1570----------GFL----ITRHSQTTDAPQCPQGTLQVYEGFSLLYVQG.NK-RAHGQDLGTAGSCLR-RFS---TMPFMF
Q07265_STRPU/1638-1751----------AQV----LTVHSQTVNIPDCPDRWGVLWIGYSFMMHTGPGG-EGSGQMLSSPGSCLE-DFR---SSPFIE
O18407_DROME/1513-1622----------GFI----FARHSQSVHVPQCPANTNLLWEGYSLSGNVA.AS-RAVGQDLGQSGSCMM-RFT---TMPYML
O09238_9METZ/629-736----------GLL----LVVHSQTTNIPQCPNDYTRLWVGYSLLQLTG.NG-LGVGQDLGDPGSCMP-SFH---PMPVVR
Q26640_STRPU/1634-1746----------TQS----LAIHSQSQEIPQCPGGWRSLWTGYSFTMYTA.AS-EGGGQGLESVGSCLE-NFR---ATPFIE
CO4A2_CAEEL/1531-1638----------GFV----LVKHSQTTEVPRCPEGQTKLWDGYSLLYIEG.NE-KSHNQDLGHAGSCLQ-RFS---TMPFLF
CO4A6_HUMAN/1575-1690----------SQA----IAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGA-EGGGQSLVSPGSCLE-DFR---ATPFIE
CO4A1_HUMAN/1445-1554----------GFL----VTRHSQTIDDPQCPSGTKILYHGYSLLYVQG.NE-RAHGQDLGTAGSCLR-KFS---TMPFLF
CO4A5_HUMAN/1571-1684----------AVV----IAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGA-EGSGQALASPGSCLE-EFR---SAPFIE
O09238_9METZ/737-850----------SIS----IAVHSQDSNVPDCFPGWVTLWTGFSFLQQTAAQA-EGTGQGLESPGSCLQ-HFR---STPFIG
O18407_DROME/1623-1735----------TRI----IALHSQSMSIPDCPGGWEEMWTGYSYFMSTLDNV-GGVGQNLVSPGSCLE-EFR---AQPVIE

PF05473

EV45_EHV1D/19-219VLMTTAILVSTFI....LTVPIGALRTAPCPAETFGL--GDECVRPVLLNASSNTRNISGVGAVCEEYSEM---AASNGT
EV45_HHV23/4-171AIVGAFALVAALV....LVPPRSSWGLSPCDSGWQEF--NAGCVAWDPTPV.....EHEQAVGGCSA.PAT---LIPRAA
Q782P9_9ALPH/3-191IALTVFVITATVVLASLFAFSYMSLESGTCPHEWIGL--GYSCMRAMGSNA.....TELEALDTCSRHNSK---LVDFTH
O56871_ILTV/33-274LLIFMFVISTVMA....FALPNSTWEGGLCPPDWIQH--LDSCYRAGGGPP...QDTYENAKLSCRALGGK---IASSSK
Q77Q60_9ALPH/3-192IILTMFVIATTLLLASLFAFSYMSLESGTCPKEWIGL--GYSCMRVAGNNA.....TELEALDMCAQHNSK---LVDFTN
Q5Y0Q7_9ALPH/5-173VVLGVVLVLAGLV....LAVPRAAWGLAPCGAGWLEF--NAGCLAWDPTPT.....DYEGAAGGCRA.PAT---LIPRAV
EV45_HHV11/4-171TIIGGVVIIAALV....LVPSRASWALSPCDSGWHEF--NLGCISWDPTPM.....EHEQAVGGCSA.PAT---LIPRAA
EV45_EHV4/19-218VLMTTTLLVSTFV....LTVPMVALRTAPCPAQTFGL--GDECVRPVSLDA.YNSSNSSEIGAVCGAYSEM---PAPDNT
Q77L25_MEHV1/3-193MVFTIFVLVAAVLLGSLFTVSYMAMESGTCPDEWIGL--GYSCMRVAGKNA.....TDLEALDTCARHNSK---LIDFAN
Q66077_9ALPH/2-174ILLTIAAIIFTFI....FTVPLEMLGSINCPPSTFGI--DNVCIEPIKKSI....NSYSELSKICYDRLSN---PINQST
Q69365_FHV1/7-189VILTATIIVCTFI....FTIPVDMLQMPRCPEETVGI--KNCCIRPIRRHV....KSHQDLVATCAEYMEQ---PATASA

PF00193

HPLN1_RAT/158-253RG.-------GL----------DWCNAGWL--------------------SDGSVQY-----------------------
HPLN1_RAT/259-350KLL-------GY----------DRCDAGWL--------------------ADGSVRY-----------------------
CSPG2_HUMAN/149-244ED.-------GF----------EQCDAGWL--------------------ADQTVRY-----------------------
PGCB_FELCA/156-251LG.-------GY----------EQCDAGWL--------------------SDQTVRY-----------------------
PGCB_FELCA/257-353DG.-------GL----------DRCSPGWL--------------------ADGSVRY-----------------------
PGCA_HUMAN/152-247ED.-------GF----------HQCDAGWL--------------------ADQTVRY-----------------------
PGCA_RAT/486-581EA.-------GY----------EQCDAGWL--------------------QDQTVRY-----------------------
PGCA_HUMAN/253-349QA.-------GM----------DMCSAGWL--------------------ADRSVRY-----------------------
PGCA_RAT/587-683SQ.-------GL----------DKCYAGWL--------------------ADGTLRY-----------------------
TSG6_RABIT/35-128KI.-------GF----------HVCAAGWM--------------------AKGRVGY-----------------------
CSPG2_HUMAN/250-346RN.-------GF----------DQCDYGWL--------------------SDASVRH-----------------------
CD44_PAPHA/31-119SI.-------GF----------ETCRYGFI--------------------.EGHVVI-----------------------

PF00059

LYAM3_MOUSE/49-160IGI.......RK----------INNKWTWV--------------------GTNKTLTEE.......AENWADN...EP..
B3NA70_DROER/197-283LSS.........----------....IDLE--------------------GGADNS........................
A7SG58_NEMVE/48-146VGL.......KK----------NNSGLYWL--------------------DGTYLQLS......................
ASGR2_HUMAN/194-302IGL.......TD----------SDGSWKWV--------------------DGTDYRHN........YKNWAVT...QPDN
Q28DK0_XENTR/134-267VGY.QFVITSRN----------HSMEGHWE--------------------VAYKGSAEVFLPPVPIFGTA..........
ASGR1_HUMAN/171-279MGL.......HD----------QNGPWKWV--------------------DGTDYETG........FKNWRPE...QPDD
IXXA_PROFL/42-152IGL...RVQGKV----------KQCNSEWS--------------------DGSSVS..........YENWIEA.......
SFTPD_RAT/269-374LSM.....TDVG----------TEGKFTYP--------------------TGEALV..........YSNWAPG...EP..
LECA_SARPE/42-159LGGNDEYSSSRD----------YGRPFFWS--------------------PTGQAFSFAY.........WSEN...NP..
Q0NQ70_COWPX/61-155VGL.......YR----------TNSQSPWL--------------------NCDNKPYNNI....................
FCER2_HUMAN/180-284IGL.....RNLD----------LKGEFIWV--------------------DGSHVD..........YSNWAPG...EP..
KLRG2_HUMAN/310-406VGA.......WR----------GPQGWHWI--------------------DEAPLPPQLLPED.................
Q9N3W1_CAEEL/37-145IGL.....SRDP----------VSKSLSWD--------------------NGFPVTYTNFG...................
E4Y143_OIKDI/82-193LDV......LSD----------STGQLITS--------------------DGTFLDLPIL....................
V001_FOWPN/101-188TGN.........----------.DHSRFWV--------------------DNRAAA........................
E5RY41_TRISP/53-163IDT........T----------LRKNPVWI--------------------NNPRLDPVQRLYLWPKRLALKED.......
LFC_TACTR/453-566IGL.....HRLD----------AEKPFVWE--------------------LMDRSNVVLNDNLTFWAS............
A9J0X0_VACCA/64-164VSL.........----------KKTNDKWL--------------------DINNDKDIDISKLTNFKQL...........
E3LCH6_CAERE/1231-1343IGL......YRN----------NDGQFVWD--------------------RGTGVTPAPLSQTETYWADNE.........
E3LJN0_CAERE/2714-2811IDM....ITDQE----------RLKAYGVE--------------------DDIHLWIS......................
VGA7_ALHV1/126-224IGT.....FFKK----------LNAALSTI--------------------DNNFDYT.......................
LYAM1_HUMAN/46-157IGI.......RK----------IGGIWTWV--------------------GTNKSLTEE.......AENWGDG...EP..
Q6VZ59_CNPV/57-147MRN......RVT----------SNSTYTIE--------------------SGGVEM........................
Q963D6_NECAM/44-162VGL...TQSDDL----------EHHIPQWS--------------------TSGGVDPILINWLVKPYLAVS.........
LECG_CROAT/20-133IGL.....RDKK----------KDFSWEWT--------------------DRSCTDYLTWDKNQP...............
LYAM3_HUMAN/49-160IGI.......RK----------NNKTWTWV--------------------GTKKALTNE.......AENWADN...EP..
Q9Q8H9_MYXVL/64-168VSL........T----------KQKDGRWI--------------------DINTNKTVNMDSSRELAEIKKK........
Q6TUP6_YMTV5/64-166VGL.........----------KKKNNRWF--------------------DSSTNETVDMNSNVYLTKIKG.........
MRC1_HUMAN/1252-1357IGL......FRN----------VEGTWLWI--------------------NNSPVSFVNWNTG.................
CLC4F_RAT/429-538IGL.....TDQG----------TEGNWRWV--------------------DGTPFDYVQS......RRFWRKG...QPDN
LEC3_MEGRO/45-152IGL.....NDID----------LEGHYVWS--------------------NGEATD..........FTYWSSNN......
C0HAR6_SALSA/133-268VGY.QYVITNQN----------HSLEGHWE--------------------VSYKGLMQVFLPPEGLTNFGEA........
ISP2_OSMMO/55-161IGG.....SDCH----------VSTYWFWM--------------------DSTSMD..........FTDWCAA...QP..
LECH_CHICK/98-203IGL.....TDEN----------QEGEWQWV--------------------DGTDTRSS........FTFWKEG...EP..
Q1HTR2_9POXV/67-181TGL.......KM----------QNATNSWH--------------------NVKDMATVADASGKPHHHGVDSNRYKYAP.
LYAM2_CANFA/30-141IGI.......RK----------VNKKWTWI--------------------GTQKLLTEE.......AKNWAPG...EP..
MBL2_RAT/140-242LGI.....TDQR----------TENVFEDL--------------------TGNRVR..........YTNWNEG...EP..
Q4SDM0_TETNG/692-804VGL......RKI----------NVSYWCWE--------------------DMSPFTNTSLQWLP................
SFTPA_MOUSE/144-248LGV.....IEGQ----------TPGDFHYL--------------------DGASVN..........YTNWYPG...EP..
NKG2D_HUMAN/116-213MGL.....VHIP----------TNGSWQWE--------------------DGSILSPNLLT...................
ISP2_HEMAM/58-161IGG.....SACL----------QAGAWTWS--------------------DGTPMN..........FRSWCST...KP..
Q8V3H6_SWPV1/63-165VSL.........----------SKQGNSWI--------------------DININKTVDMSNSIELTKIRN.........
F1NUD4_CHICK/202-294IGG......IYQ----------WPLDIQWL--------------------DKKPL.........................
LPSBP_PERAM/137-254IGI.....HDRF----------VEGEFITI--------------------FGKPLATTG.......FTRWVDS..IQP..
REG3B_MOUSE/57-173IGLHDPTLGAEP----------NGGGWEWS--------------------NNDVMN..........YFNWERN....P..
MRC1_HUMAN/966-1081TGL.....NDVN----------SEHTFLWT--------------------DGRGVH..........YTNWGKG...YPGG
A6QPD3_BOVIN/171-271LGL.....SYKE----------KDNEWKWE--------------------DGSLPSGLKWHLPK................
CD72_HUMAN/250-352TGL........S----------SNKDWKLT--------------------DDTQRT........................
Q6VZW8_CNPV/55-136VIL.........----------..YKNHWL--------------------DKTGSA........................
C3XRG9_BRAFL/43-156IGL.....EDRL----------NEAVFVYS--------------------DGSTLGSFNRFYGGVD..............
E9GSY7_DAPPU/251-368LGL.....MSLD----------DLSTNTLE--------------------AASGSLVQQY......AGFWQVD.......
MBL1_RAT/134-236LGI.....TDEV----------TEGQFMYV--------------------TGGRLT..........YSNWKKD...EP..
F1M5M2_RAT/203-312VGL......RKI----------NISYWGWE--------------------DMSPFTNTSLQWLP................
ASGR2_MOUSE/187-295IGL.......TD----------RDGSWKWV--------------------DGTDYRSN........YRNWAFT...QPDN
Q8UZH5_9GAMA/120-217VGV........Y----------KVGEGNWT--------------------SLDGGNYQ......................
SFTPD_BOVIN/264-369LSM.....SDTR----------KEGTFIYP--------------------TGEPLV..........YSNWAPQ...EP..
Q993G6_9GAMA/140-238VGI.......YR----------DSKSALWK--------------------SLTEDNCL......................
A2AIN6_MOUSE/249-342IQM.........----------...SKKWR--------------------QDS...........................
SFTPD_HUMAN/270-375LSM.....TDSK----------TEGKFTYP--------------------TGESLV..........YSNWAPG...EP..
LYAM2_MOUSE/29-140IGI.......RK----------VNNVWIWV--------------------GTGKPLTEE.......AQNWAPG...EP..
REG3A_HUMAN/57-173IGLHDPTQGTEP----------NGEGWEWS--------------------SSDVMN..........YFAWERN....P..
IXXB_PROFL/42-144MGL.....SNVW----------NQCNWQWS--------------------NAAMLR..........YKAWAEE.......
D3IZC8_9POXV/67-162MTH........H----------DAYRNVYL--------------------PKRGDRYLGY................YV..
A7SG60_NEMVE/46-144VGL.......KK----------NNSLWYWL--------------------DGAY..........................
F1RK81_PIG/134-267VGY.QYVFTGRN----------SSLEGHWE--------------------VAFKGSPEVLLPPDPGLAAA..........
KLRBA_RAT/111-212IGL.....SYTL----------SDENWKWI--------------------NGSTLNSDVLSI..................
SFTPA_RABIT/143-247LGL.....AEGP----------TAGDFYYL--------------------DGDPVN..........YTNWYPG...EP..
E2RAK1_CANFA/250-353VVH........S----------FLKKWQQV--------------------DNKRGS........................
A9YY98_SHEV/64-167YGL........V----------KKKNNIWV--------------------DVNSNSTVDMNKNTELSNIKK.........
A7XCQ8_9POXV/64-166VGL.........----------KKKDNRWL--------------------DISTNKTIDMNSNIDLTKTKG.........
SFPA2_HUMAN/144-248VGL.....TEGP----------SPGDFRYS--------------------DGTPVN..........YTNWYRG...EP..
Q9N3W8_CAEEL/37-145IGL.....HRNG----------SSGLLEWD--------------------NMRPVVHTNFG...................
Q06ZZ3_CPRV/55-157IKY.......SY----------KFDGLIWR--------------------DIYTNVTVRSLSMTVRSR............
Q5BK59_RAT/247-352IEQ.........----------MSHTVYYP--------------------QNMKNMKGRR....................
MRC1_HUMAN/521-627TGL.....SDIQ----------TKGTFQWT--------------------IEEEVR..........FTHWNS........
F1P2W2_CHICK/670-781VGL......RKI----------NVSYWCWE--------------------DMSPFTNTLLQWLP................
C1IIM8_BOVIN/46-161VGL......RKI----------NVSYWCWE--------------------DMSPFTNSSLQWMP................
CLC87_CAEEL/103-224IGL.VRFTHYEK----------LEQLPRWQ--------------------TEGALNPTKINWLIKPYKPLF.........
C1C4X9_LITCT/224-318VGL..TQFNTHG----------GVWTGKWP--------------------DGSMETL.......................
MBL2_HUMAN/144-246LGI.....TDEK----------TEGQFVDL--------------------TGNRLT..........YTNWNEG...EP..
C3XXU7_BRAFL/313-420LAM.......KT----------APVSIVYS--------------------DGTPVLGGALEWSAGE..............
MRC1_HUMAN/380-488IGL.....NDIK----------IQMYFEWS--------------------DGTPVT..........FTKWLRG...EPS.
KLRBA_MOUSE/111-212IGL.....RYTL----------PDMNWKWI--------------------NGSTLNSDVLKI..................
LECA_PLEWA/54-166VGG.....SDCY----------KDRSFVWT--------------------DGSQWD..........YQKWRQW...EP..
REG3A_RAT/56-172IWLHDPTMGQQP----------NGGGWEWS--------------------NSDVLN..........YLNWDGD....P..
O17575_CAEEL/2720-2817IDL....RTDQE----------RLKPYGMD--------------------DDIPVWIS......................
B4KGI3_DROMO/50-166LGL.....ASLD----------DLRTNTLE--------------------SASGALISQY......SGFWSLQ.......
Q6VZE9_CNPV/62-150VGA.........----------....YKIN--------------------TNS...........................
F1KQ91_ASCSU/56-180TGL..YYEPGMG----------GTSSNAFL--------------------NLTSSFASIS....MYNPLWAKN..EPH..
NKG2A_HUMAN/136-231IGV.....FRNS----------SHHPWVTM--------------------NGLAFKHEIK....................
Q08F49_DPV84/64-164VSL.........----------TRHNNRWS--------------------DINTNKTVDMNGSMELIKL...........
SFTPA_CANFA/144-248LGL.....VESP----------DSGDFQYM--------------------DGAPVN..........YTNWYPG...EP..
O62171_CAEEL/239-356IGL.......NG----------NCSLWKWD--------------------QASGEEQVQLQGWQ................
Q8JJP7_9GAMA/132-231VGI.......FK----------RSPDSQWE--------------------TLDNRTNSY.....................
E1BT58_CHICK/214-305IGS.........----------...SSTWY--------------------QDGHGRRKPL....................

PF05966

Q50LD9_9POXV/1-185AVAAASSTHRKVASSTTQYDHKESCNGLYY--------------------QGSCYILHSDYQL-----------------
Q1HTR3_9POXV/2-193TGTPRILPLAQGGGSVSA....EECQGIYL--------------------DGQCLTRGGDGMV-----------------
Q77GH4_LSDV/6-196KNPNPTTYSDDDTESELNV..YRSCKGIVY--------------------SGYCYTFNSEPKS-----------------
Q9Q8V7_RFVKA/1-172NQYE..................SECKGIVF--------------------DSACYTLHKEPKT-----------------
Q08F50_DPV84/6-192DSYSLVTPDKLYPRSGC.....KECQGIMF--------------------DGDCYQFNPEHKT-----------------
Q8V3H7_SWPV1/1-185NNQDNITPDANYNIVKLY....TGCQGIVY--------------------EYYCLRLVYEPLS-----------------

PF07979

EAE_ECO27/839-939KS--------------------SQTIISWV--------------------QQTAQD------------------------
Q846P2_ECOLX/838-938KT--------------------RNAMISWI--------------------KQTDQD------------------------
Q9S6R2_ECOLX/838-939SG--------------------SKSLTAWI--------------------KQSSSE------------------------
Q8KRL2_ECOLX/838-937T.--------------------QRTINAWI--------------------QQTDKD------------------------
O06896_ECOLX/839-940SG--------------------SNSLTAWI--------------------TQSSSE------------------------
Q8KRK8_ECOLX/838-938T.--------------------QASITAWT--------------------LQTSDD------------------------
Q8VL95_ECOLX/840-935RS--------------------MQSITAWI--------------------TQTEAD------------------------
Q9LBG6_ECOLX/835-936SS--------------------SNSLTAWI--------------------KQSTSD------------------------
Q93K94_ECOLX/838-937T.--------------------QGTINAWI--------------------QQTEQD------------------------
Q9R8B4_ECOLX/839-934SS--------------------MNSITAWI--------------------KQTSSE------------------------
INVA_YEREN/735-833E.--------------------WPSGNYWT--------------------KKTSTD------------------------
Q8RSS9_ECOLX/842-948KG--------------------KNTITAWT--------------------QQTAAD------------------------
Q8KRL0_ECOLX/839-939KS--------------------LLTISSWV--------------------QQTTVD------------------------
Q8KRL1_ECOLX/842-948KG--------------------KNTITAWT--------------------QQTADD------------------------

PF03440

TOX3_BORPE/31-117YGL--------------------YD.GTYL--------------------GQAYGGIIK---------------------
AER3_AERHY/24-106SGL--------------------ANGWVIM--------------------GPGYNGEIK---------------------
AERA_AERTR/24-106SGL--------------------ANNWVIL--------------------GPGYNGEIK---------------------
TOX2_BORPE/30-116FAL--------------------YD.GTYL--------------------GGEYGGVIK---------------------
AERA_AERSA/26-108TGL--------------------ADRWVIM--------------------GPGYNGEIK---------------------

PF01413

CO4A4_HUMAN/1573-1689CQGRQGTCHFFA----------.NKYSFWL--------------------TTVKAD------------------------
CO4A4_HUMAN/1465-1572CNI.HQVCHYAQ----------RNDRSYWL--------------------ASA...------------------------
CO4A1_CAEEL/1535-1644CNM.NSVCHVSS----------RNDYSFWL--------------------STDEP.------------------------
CO4A1_DROME/1663-1777CNGAKGTCHFYE----------.TMTSFWM--------------------YNLESS------------------------
CO4A1_CAEEL/1645-1758CHG.RGTCNYYA----------.TNHGFWL--------------------SIVDQD------------------------
CO4A1_DROME/1555-1662CGQ.NNVCNYAS----------RNDKTFWL--------------------TTN...------------------------
CO4A2_HUMAN/1489-1596CNP.GDVCYYAS----------RNDKSYWL--------------------STT...------------------------
CO4A2_HUMAN/1597-1711CNGGRGTCHYYA----------.NKYSFWL--------------------TTI.PE------------------------
CO4A3_HUMAN/1555-1668CHG.RGTCNYYS----------.NSYSFWL--------------------ASLNPE------------------------
CO4A3_HUMAN/1445-1554CNV.NDVCNFAS----------RNDYSYWL--------------------STPAL.------------------------
Q07265_STRPU/1528-1637CNI.NNVCHVAS----------RNDYSYWL--------------------STTEP.------------------------
CO4A1_HUMAN/1555-1668CHG.RGTCNYYA----------.NAYSFWL--------------------ATIERS------------------------
Q26640_STRPU/1526-1633CNF.NNVCNYAS----------RNDRSYWL--------------------TTN...------------------------
CO4A6_HUMAN/1467-1574CNI.NEVCHYAR----------RNDKSYWL--------------------STT...------------------------
CO4A2_CAEEL/1639-1753CNGARGSCHYFA----------.NKFSFWL--------------------TTIDND------------------------
CO4A5_HUMAN/1461-1570CNI.NNVCNFAS----------RNDYSYWL--------------------STPEP.------------------------
Q07265_STRPU/1638-1751CHG.DGKCNYYA----------.TTYTFWL--------------------SSITGN------------------------
O18407_DROME/1513-1622CDI.TNVCHFAQ----------NNDDSLWL--------------------STAEP.------------------------
O09238_9METZ/629-736CNP.MQRCEFAR----------RKDESYWL--------------------STN...------------------------
Q26640_STRPU/1634-1746CNG.RGNCHFFS----------.NEYSFWL--------------------TVIDEE------------------------
CO4A2_CAEEL/1531-1638CDF.NNVCNYAS----------RNEKSYWL--------------------STS...------------------------
CO4A6_HUMAN/1575-1690CSGARGTCHYFA----------.NKYSFWL--------------------TTVEER------------------------
CO4A1_HUMAN/1445-1554CNI.NNVCNFAS----------RNDYSYWL--------------------STPEP.------------------------
CO4A5_HUMAN/1571-1684CHG.RGTCNYYA----------.NSYSFWL--------------------ATVDVS------------------------
O09238_9METZ/737-850CGG.RGQCSYDS----------.VSGSYWM--------------------IVLDAL------------------------
O18407_DROME/1623-1735CHG.HGRCNYYD----------.ALASFWL--------------------TVIEEQ------------------------

PF05473

EV45_EHV1D/19-219AGLIMSLLDCLN----------VGDSESVMNKLN................LDDTQLAYCNVPSFAE.......-------
EV45_HHV23/4-171AKHLAALTRVQA----------ERSSGYWW....................VNGDGIRTCLRLVDSVSGIDEF.-------
Q782P9_9ALPH/3-191AKILIEAIAPFA----------STDANSSNVF..................RLRDSRTTCVRPTAAGPVAVD..-------
O56871_ILTV/33-274AIGFLTILDRLF----------YWSGSTSPQGLWWADDGGKCANVYFINSIHDDSTASLSTQKMSVALVENLQ-------
Q77Q60_9ALPH/3-192AKTLVEAIVPFG----------STNASFGNIF..................RLRDSRSTCILPTIGGPISVD..-------
Q5Y0Q7_9ALPH/5-173AKQLAAVAGVGA----------RASGAYWW....................VNGDGIKACLRPSDGVGGIDQF.-------
EV45_HHV11/4-171AKQLAAVARVQS----------ARSSGYWW....................VSGDGIRACLRLVDGVGGIDQF.-------
EV45_EHV4/19-218TVLIMNLLDCLN----------IGINESAGEKLN................LTDTPLANCNFSQNSV.......-------
Q77L25_MEHV1/3-193AKVLVEAIAPFG----------VPNAAYGEVF..................RLRDSKTTCIRPTMGGPVSAD..-------
Q66077_9ALPH/2-174INSLLTVLNMFA----------D...........................KNYENVYNCNTMSEK........-------
Q69365_FHV1/7-189VGALIPLLDIFN----------GDGI........................STNDSLYDCILSDEKK.......-------

PF00193

HPLN1_RAT/158-253---PITKPREPCGGQ-------N.TVPG---------------VRNY.......-----------------GFWDKDKSR
HPLN1_RAT/259-350---PISRPRRRCSPT-------E...AA---------------VRFV.......-----------------GFPDKKHKL
CSPG2_HUMAN/149-244---PIRAPRVGCYGD-------KMGKAG---------------VRTY.......-----------------GFR.SPQET
PGCB_FELCA/156-251---PIQTPREACYGD-------MDGFPG---------------VRNY.......-----------------GLV.DPDDL
PGCB_FELCA/257-353---PIVTPSQRCGGG-------L...PG---------------VKTLFLFPNQT-----------------GFP.NKYSR
PGCA_HUMAN/152-247---PIHTPREGCYGD-------KDEFPG---------------VRTY.......-----------------GIR.DTNET
PGCA_RAT/486-581---PIVSPRTPCVGD-------KDSSPG---------------VRTY.......-----------------GVR.PSSET
PGCA_HUMAN/253-349---PISKARPNCGGN-------L...LG---------------VRTVYVHANQT-----------------GYP.DPSSR
PGCA_RAT/587-683---PIVNPRPACGGD-------K...PG---------------VRTVYLYPNQT-----------------GLP.DPLSK
TSG6_RABIT/35-128---PIVKPGSNCGFG-------K...TG---------------IIDY.......-----------------GIRLNRSER
CSPG2_HUMAN/250-346---PVTVARAQCGGG-------L...LG---------------VRTLYRFENQT-----------------GFP.PPDSR
CD44_PAPHA/31-119---PRIHPNSICAAN-------N...TG---------------VYIL.......-----------------..T.SNTSQ

PF00059

LYAM3_MOUSE/49-160...NNKKNNQDCVEI......YIKSNSA---------------PGKWND.....-----------------.EPCFK.RK
B3NA70_DROER/197-283...DNNEISNTCVEL............S---------------NNETKD.....-----------------.QLCTY.EN
A7SG58_NEMVE/48-146.........SNGGYL.......YFMSAY---------------NISHGS.....-----------------.DSCRT..S
ASGR2_HUMAN/194-302WHGHELGGSEDCVEV...........QP---------------DGRWND.....-----------------.DFCLQ.VY
Q28DK0_XENTR/134-267...MSDNENILCAQL.QCFHLPSLRHLG---------------LHSWYA.....-----------------.ENCYE.KS
ASGR1_HUMAN/171-279WYGHGLGGGEDCAHF...........TD---------------DGRWND.....-----------------.DVCQR.PY
IXXA_PROFL/42-152.......ESKTCLGL........EKETD---------------FRKWVN.....-----------------.IYCGQ.QN
SFTPD_RAT/269-374...NNNGGAENCVEI...........FT---------------NGQWND.....-----------------.KACGE.QR
LECA_SARPE/42-159...DNYKHQEHCVHI........WDTKP---------------LYQWND.....-----------------.NDCNV.KM
Q0NQ70_COWPX/61-155...IPIRGVEDYAYL............N---------------NNGIST.....-----------------.ARIYA.DR
FCER2_HUMAN/180-284...TSRSQGEDCVMM...........RG---------------SGRWND.....-----------------.AFCDRKLG
KLRG2_HUMAN/310-406...GEDNLDINCGAL............E---------------EGTLVA.....-----------------.ANCST.PR
Q9N3W1_CAEEL/37-145...SHVGKNYFSEKI............S---------------NAKWDT.....-----------------.LGDND.KS
E4Y143_OIKDI/82-193...HNSTEANKCGIYTFDIVDADNGTIS---------------QDKPVTQAGIS-----------------LIDCIE.EK
V001_FOWPN/101-188...STFDPVNECAYG............T---------------RSSVSEVPKVL-----------------TSPCSV.RR
E5RY41_TRISP/53-163...GKNSSDIECAAF......RRVDNII---------------GGYVCL.....-----------------.HSCRS.LK
LFC_TACTR/453-566...GEPGNETNCVYL.......DIRDQL---------------QPVWKT.....-----------------.KSCFQ.PS
A9J0X0_VACCA/64-164...NSTTDSEACYIY............K---------------SGKLVK.....-----------------.TVCKS.TQ
E3LCH6_CAERE/1231-1343...PSNDPMNQCVYY.......DGRADP---------------KKAWVT.....-----------------.DSCST.PR
E3LJN0_CAERE/2714-2811...SVNIPNTQCGWL..........SAR---------------TRRIGD.....-----------------.VNCNI.LL
VGA7_ALHV1/126-224...AWDELSVYCAYL.........TRRS---------------RSTVYF.....-----------------.TDCTT.SK
LYAM1_HUMAN/46-157...NNKKNKEDCVEI......YIKRNKD---------------AGKWND.....-----------------.DACHK.LK
Q6VZ59_CNPV/57-147...SITFPVVTCACY............E---------------NSKVVL.....-----------------.SDCDQ.EK
Q963D6_NECAM/44-162...NGWTTQAKCAAH...........LN---------------VPAGPSASYTF-----------------FLPCTV.QT
LECG_CROAT/20-133...DHYQNKEFCVEL........VSLTG---------------YRLWND.....-----------------.QVCES.KD
LYAM3_HUMAN/49-160...NNKRNNEDCVEI......YIKSPSA---------------PGKWND.....-----------------.EHCLK.KK
Q9Q8H9_MYXVL/64-168...NTGATDASCYVY............K---------------LNGIQE.....-----------------.ILCNV.VN
Q6TUP6_YMTV5/64-166...KYDNENSICFIY............K---------------MGELKG.....-----------------.VICNV.VN
MRC1_HUMAN/1252-1357...DPSGERNDCVAL..........HAS---------------SGFWSN.....-----------------.IHCSS.YK
CLC4F_RAT/429-538WR.HGNGEREDCVHL.............---------------QRMWND.....-----------------.MACGT.AY
LEC3_MEGRO/45-152...PNNWENQDCGVV........NYDTV---------------TGQWDD.....-----------------.DDCNK.NK
C0HAR6_SALSA/133-268...SPTQDNIFCAQL.QRFQIKSMNERG---------------LHSWHA.....-----------------.ENCYK.KF
ISP2_OSMMO/55-161....DFTLTECCIQI.........NVGV---------------GKCWND.....-----------------.TPCTH.LH
LECH_CHICK/98-203...NNRGFNEDCAHV...........WT---------------SGQWND.....-----------------.VYCTY.EC
Q1HTR2_9POXV/67-181...IHQPGKGDCAVS............L---------------SGVVMQ.....-----------------.HHCEDTSV
LYAM2_CANFA/30-141...NNKQNDEDCVEI......YIKRDKD---------------SGKWND.....-----------------.ERCDK.KK
MBL2_RAT/140-242...NNVGSGENCVVL...........LT---------------NGKWND.....-----------------.VPCSD.SF
Q4SDM0_TETNG/692-804...GEPSDAGFCGYL.........AEPA---------------SSSLKA.....-----------------.QSCINPVN
SFTPA_MOUSE/144-248....RGRGKEKCVEM...........YT---------------DGKWND.....-----------------.KGCLQ.YR
NKG2D_HUMAN/116-213...IIEMQKGDCALY...........AS---------------SFKGYI.....-----------------.ENCST.PN
ISP2_HEMAM/58-161....DDVLAACCMQM.........TAAA---------------DQCWDD.....-----------------.LPCPA.SH
Q8V3H6_SWPV1/63-165...SNNNKNECCYTY............K---------------MGELKE.....-----------------.TVCNI.VN
F1NUD4_CHICK/202-294...SQGEWFAYCAAT............V---------------SGKIVR.....-----------------.KSCRE.EY
LPSBP_PERAM/137-254...DNAGGNENCGSM...........HP---------------NGGLND.....-----------------.IPCPW.KL
REG3B_MOUSE/57-173...STALDRAFCGSL........SRASG---------------FLKWRD.....-----------------.MTCEV.KL
MRC1_HUMAN/966-1081RRSSLSYEDADCVVI......IGGASNE---------------AGKWMD.....-----------------.DTCDS.KR
A6QPD3_BOVIN/171-271...PSMDFQGKCVYA............G---------------VHTVGV.....-----------------.DNCTM.SS
CD72_HUMAN/250-352...RTYAQSSKCNKV........HKTWS---------------WWTLES.....-----------------.ESCRS.SL
Q6VZW8_CNPV/55-136...IFVKDEDYCEFV........NYDNK---------------KPFIST.....-----------------.TSCNS.SM
C3XRG9_BRAFL/43-156...VANEDDSDCVLM.......ATGLIP---------------RWDWWT.....-----------------.EDCSK.HH
E9GSY7_DAPPU/251-368...QPDARKGQCVRA........STANA---------------DQSWAL.....-----------------.SSCES.LL
MBL1_RAT/134-236...NDHGSGEDCVTI...........VD---------------NGLWND.....-----------------.ISCQA.SH
F1M5M2_RAT/203-312...GEPNDSGFCAYL.........ERAA---------------VAGLKA.....-----------------.NPCTSMAD
ASGR2_MOUSE/187-295WQGHEQGGGEDCAEI...........LS---------------DGHWND.....-----------------.NFCQQ.VN
Q8UZH5_9GAMA/120-217...VYQIFGSHCTYV.........SKSS---------------KVPVSH.....-----------------.HECSF.HK
SFTPD_BOVIN/264-369...NNDGGSENCVEI...........FP---------------NGKWND.....-----------------.KVCGE.QR
Q993G6_9GAMA/140-238...VDDIYGSHCTYI.........WNKA---------------KGPSSH.....-----------------.YECNF.HK
A2AIN6_MOUSE/249-342.....DSQSRHCVRI........KTYYQ---------------KWERTI.....-----------------.SKCAE.LH
SFTPD_HUMAN/270-375...NDDGGSEDCVEI...........FT---------------NGKWND.....-----------------.RACGE.KR
LYAM2_MOUSE/29-140...NNKQRNEDCVEI......YIQRTKD---------------SGMWND.....-----------------.ERCNK.KK
REG3A_HUMAN/57-173...STISSPGHCASL........SRSTA---------------FLRWKD.....-----------------.YNCNV.RL
IXXB_PROFL/42-144.........SYCVYF..........KST---------------NNKWRS.....-----------------.RACRM.MA
D3IZC8_9POXV/67-162...EYDKDTHVCLVN.............---------------MQGLMH.....-----------------.HDCDQ.NT
A7SG60_NEMVE/46-144...SFGNSAGSCGYL........YFKSS---------------GIFHGS.....-----------------.DSCKT..S
F1RK81_PIG/134-267...ASDNNVVLCAQL.QRFHFPTLRHRD---------------LHSWRA.....-----------------.ESCQD.KS
KLRBA_RAT/111-212...TGDTEKDSCASV............S---------------QDKVLS.....-----------------.ESCDS.DN
SFTPA_RABIT/143-247....RGQGREKCVEM...........YT---------------DGKWND.....-----------------.KNCLQ.YR
E2RAK1_CANFA/250-353...GYYGQVSRCYKV..........QSS---------------RLKMLP.....-----------------.EVCTS.LL
A9YY98_SHEV/64-167...SSKGDINACYVY............N---------------FGQFKN.....-----------------.VSCNY.VS
A7XCQ8_9POXV/64-166...KYDNENSICFVY............K---------------MGELKG.....-----------------.VICDI.VN
SFPA2_HUMAN/144-248....AGRGKEQCVEM...........YT---------------DGQWND.....-----------------.RNCLY.SR
Q9N3W8_CAEEL/37-145...NNVTKNYFTENI............S---------------DAKWET.....-----------------.LDDNG.KN
Q06ZZ3_CPRV/55-157...GDIHKHPFCAVW.............---------------APKPLA.....-----------------.EPCSN.SH
Q5BK59_RAT/247-352...SDSHSQSSCYLI........KCYHS---------------WWYESS.....-----------------.YTCTD.LF
MRC1_HUMAN/521-627...DMPGRKPGCVAM........RTGIA---------------GGLWDV.....-----------------.LKCDE.KA
F1P2W2_CHICK/670-781...DEPSDAGFCGYL.........AEPS---------------SQGLKA.....-----------------.ATCINEVN
C1IIM8_BOVIN/46-161...SEPSDAGFCGIL.........SEPS---------------TRGLKA.....-----------------.ATCINPLN
CLC87_CAEEL/103-224...NGWSSLANCAAS..........YKS---------------PSSLESASYTY-----------------FYPCTY.ML
C1C4X9_LITCT/224-318...PQPEGDGSCPKL.............---------------GSHLKV.....-----------------.WNCYT.EL
MBL2_HUMAN/144-246...NNAGSDEDCVLL...........LK---------------NGQWND.....-----------------.VPCST.SH
C3XXU7_BRAFL/313-420...PWYPVLDLCVLL.........DSSD---------------NYKAKT.....-----------------.AFCTE.QH
MRC1_HUMAN/380-488...HENNRQEDCVVM..........KGK---------------DGYWAD.....-----------------.RGCEW.PL
KLRBA_MOUSE/111-212...TDDTENDSCAAI............S---------------GDKVTF.....-----------------.ESCNS.DN
LECA_PLEWA/54-166...SNTGGREPCIDF.........NFVT---------------PGLWND.....-----------------.EHCDQ.KF
REG3A_RAT/56-172...SSTVNRGNCGSL........TATSE---------------FLKWGD.....-----------------.HHCDV.EL
O17575_CAEEL/2720-2817...AVNIPNTQCGWL..........RSR---------------SKKIEQ.....-----------------.ANCNL.LT
B4KGI3_DROMO/50-166...QPNAESGECVAA........SFGGK---------------SQSWDL.....-----------------.GTCES.LL
Q6VZE9_CNPV/62-150...QHPDKNDECYYV.............---------------SRGMPTHKGDN-----------------VFLCNV.TI
F1KQ91_ASCSU/56-180...IRYNESLYCLSF.....NAAYPNDL---------------TYGWHL.....-----------------.TNCSQ.RL
NKG2A_HUMAN/136-231...DSDNAELNCAVL............Q---------------VNRLKS.....-----------------.AQCGS.SI
Q08F49_DPV84/64-164...NQKQKKDSCFIY............K---------------SGEMME.....-----------------.TLCNI.VN
SFTPA_CANFA/144-248....RGRGKEQCVEM...........YT---------------DGQWNN.....-----------------.KNCLQ.YR
O62171_CAEEL/239-356...IWAPDFPRCSPM...LEMLEGVTYV---------------TDGWIN.....-----------------.VPSNF.YA
Q8JJP7_9GAMA/132-231...VWDVHGSYCAYV.........TQDS---------------TSPRSY.....-----------------.FNCQS.KK
E1BT58_CHICK/214-305...SGRRLFFHCVLS............A---------------AGKMQS.....-----------------.LSCKK.FY

PF05966

Q50LD9_9POXV/1-185---.FSDAKANCTAESSTLPNKSDVLIT.........WLIDYVEDTWGSDGNPI........TKTTS.DYQDSDISQEVR
Q1HTR3_9POXV/2-193---PLQTANTTCHSKGGRLPS.QTLIRKDPAGGNQVDWLLFYLQGTWTDEGGHFPSADQTRTKRSTDEDGDDDNTHSEVR
Q77GH4_LSDV/6-196---.FNDAYDDCEKKNSELPS.NNLMND.........WISDYLDGTWGEDGNVL........FKEKNQELETIDISDEMR
Q9Q8V7_RFVKA/1-172---.FYEASEDCANQSAVLPF.KTLKDH.........WMWDYLEGTWGVDGYGI........VELV..DLNTYDVSVEMR
Q08F50_DPV84/6-192---.FSEASMDCAGKGYSLPA.TNLMSK.........WIGDYLESTWGEEGYGL........SKERGGNIESPDASAEKR
Q8V3H7_SWPV1/1-185---.FDDAVKSCMKNKGNLPS.SDLMKT.........WLSDYLDGTWGEEGRGL........SKEK..TILEVDISTELR

PF07979

EAE_ECO27/839-939---AKSGVASTYDLV----------------------------KQNPLNN......----------------IKASESNA
Q846P2_ECOLX/838-938---MRQGVASTYDLV----------------------------KKNPLTN.....K----------------VDINKPNA
Q9S6R2_ECOLX/838-939---QSSGVSSTYDLV----------------------------TKNQLIN......----------------VGVNNKNA
Q8KRL2_ECOLX/838-937---KREGVATTYDIV----------------------------TNNMVQN......----------------VSSKTPNA
O06896_ECOLX/839-940---LPSGVSSTYDLI----------------------------TTNSLTN......----------------VKTTDNNA
Q8KRK8_ECOLX/838-938---VKKGVTSTYDLV----------------------------RKNPQLN.....K----------------VNINDNNA
Q8VL95_ECOLX/840-935---KISGVSTTYDLI----------------------------TQNPHKD......----------------VTLNAPNV
Q9LBG6_ECOLX/835-936---SASGVSNTYDLV----------------------------TTNSLTN......----------------VKATDKNA
Q93K94_ECOLX/838-937---KKDSVATTYDIV----------------------------TDNTVIN......----------------VDSTVANA
Q9R8B4_ECOLX/839-934---QSSGVSSTYNLI----------------------------IQNPLPR......----------------VNVNTPNV
INVA_YEREN/735-833---F.....VTMDMT----------------------------TGDIPTS......----------------....AATA
Q8RSS9_ECOLX/842-948---KQSGWTSTFDIV----------------------------TKNEIPNNGSNSK----------------VNVNTANA
Q8KRL0_ECOLX/839-939---MNSGVASTYDLV----------------------------RQNPL.N.....G----------------VETNTTNA
Q8KRL1_ECOLX/842-948---IPKGWTSTFDIV----------------------------TKNEIPNNGIKVK----------------VNVDAANA

PF03440

TOX3_BORPE/31-117---DAPPGAGFIYRE---------------------------------------------------------TFCIT---
AER3_AERHY/24-106---PGSASSTWCYPT---------------------------------------------------------NPATG---
AERA_AERTR/24-106---PGKASTTWCYPT---------------------------------------------------------RPATA---
TOX2_BORPE/30-116---DGTPGGAFDLKT---------------------------------------------------------TFCIM---
AERA_AERSA/26-108---QGTAGETWCYPN---------------------------------------------------------SPVSG---

PF01413

CO4A4_HUMAN/1573-1689---LQFSSAPAPDTL----------------------------KESQ-------------------------AQRQKISR
CO4A4_HUMAN/1465-1572---.....APLPMMP----------------------------LSEE-------------------------AIRPYVSR
CO4A1_CAEEL/1535-1644---.....MTPMMNP----------------------------VTGT-------------------------AIRPYISR
CO4A1_DROME/1663-1777---QPFE.RPQQQTI----------------------------KAG.-------------------------ERQSHVSR
CO4A1_CAEEL/1645-1758---KQFR.KPMSQTL----------------------------KAG.-------------------------GLKDRVSR
CO4A1_DROME/1555-1662---.....AAIPMMP----------------------------VENI-------------------------EIRQYISR
CO4A2_HUMAN/1489-1596---.....APLPMMP----------------------------VAED-------------------------EIKPYISR
CO4A2_HUMAN/1597-1711---QSFQGSPSADTL----------------------------KAG.-------------------------LIRTHISR
CO4A3_HUMAN/1555-1668---RMFR.KPIPSTV----------------------------KAG.-------------------------ELEKIISR
CO4A3_HUMAN/1445-1554---.....MPMNMAP----------------------------ITGR-------------------------ALEPYISR
Q07265_STRPU/1528-1637---.....MPMNMAP----------------------------IRGG-------------------------QLQPFISR
CO4A1_HUMAN/1555-1668---EMFK.KPTPSTL----------------------------KAG.-------------------------ELRTHVSR
Q26640_STRPU/1526-1633---.....EPLPMMP----------------------------LMNQ-------------------------QIDPYISR
CO4A6_HUMAN/1467-1574---.....APIPMMP----------------------------VSQT-------------------------QIPQYISR
CO4A2_CAEEL/1639-1753---SEFK.VPESQTL----------------------------KSG.-------------------------NLRTRVSR
CO4A5_HUMAN/1461-1570---.....MPMSMQP----------------------------LKGQ-------------------------SIQPFISR
Q07265_STRPU/1638-1751---AQFT.MPQSETL----------------------------KAG.-------------------------SLRTRVSR
O18407_DROME/1513-1622---.....MPMTMTP----------------------------IQGR-------------------------DLMKYISR
O09238_9METZ/629-736---.....ATRPPIP----------------------------VSGS-------------------------DIEEHISR
Q26640_STRPU/1634-1746---DQFA.IPRKRTI----------------------------KSG.-------------------------QLQSVVSR
CO4A2_CAEEL/1531-1638---.....EAIPMMP----------------------------VNER-------------------------EIEPYISR
CO4A6_HUMAN/1575-1690---QQFGELPVSETL----------------------------KAG.-------------------------QLHTRVSR
CO4A1_HUMAN/1445-1554---.....MPMSMAP----------------------------ITGE-------------------------NIRPFISR
CO4A5_HUMAN/1571-1684---DMFS.KPQSETL----------------------------KAG.-------------------------DLRTRISR
O09238_9METZ/737-850---NPFQ.DTEPGTY----------------------------PVS.-------------------------DIEKRLSR
O18407_DROME/1623-1735---DQFV.QPRQQTL----------------------------KAD.-------------------------.FTSKISR

PF05473

EV45_EHV1D/19-219---CYTKGFGVCYAA----------------------------RPLS-------------------------PLGELIYK
EV45_HHV23/4-171---CEELAIRICYYP----------------------------RSPG-------------------------GFVRFVTS
Q782P9_9ALPH/3-191---CPRTCTAICQRP----------------------------RPLS-------------------------IVASIIRD
O56871_ILTV/33-274---CSGTAGVICYMS----------------------------PAIS-------------------------PALRYIKA
Q77Q60_9ALPH/3-192---CPRTCSVVCQRP----------------------------RPLS-------------------------TAASIIRD
Q5Y0Q7_9ALPH/5-173---CEGPALRICHHP----------------------------RDAG-------------------------GFVTFVLG
EV45_HHV11/4-171---CEEPALRICYYP----------------------------RSPG-------------------------GFVQFVTS
EV45_EHV4/19-218---CSRKRVGVCYAA----------------------------RPLS-------------------------PLGELIYK
Q77L25_MEHV1/3-193---CPVTCTVICQRP----------------------------RPLS-------------------------TMSSIIRD
Q66077_9ALPH/2-174---TCNSSIAICQTN----------------------------HPLS-------------------------SLGNFVIK
Q69365_FHV1/7-189---SCNTSMAVCQST----------------------------YLPN-------------------------PLSDFIMR

PF00193

HPLN1_RAT/158-253YDVFCF---
HPLN1_RAT/259-350YGVYCF---
CSPG2_HUMAN/149-244YDVYCY---
PGCB_FELCA/156-251YDIYCY---
PGCB_FELCA/257-353FNVYCF---
PGCA_HUMAN/152-247YDVYCF---
PGCA_RAT/486-581YDVYCY---
PGCA_HUMAN/253-349YDAICY---
PGCA_RAT/587-683HHAFCF---
TSG6_RABIT/35-128WDAYCY---
CSPG2_HUMAN/250-346FDAYCF---
CD44_PAPHA/31-119YDTYCF---

PF00059

LYAM3_MOUSE/49-160RALCYT---
B3NA70_DROER/197-283FFICES---
A7SG58_NEMVE/48-146RFICQK---
ASGR2_HUMAN/194-302RWVCEK---
Q28DK0_XENTR/134-267SFLCKR---
ASGR1_HUMAN/171-279RWVCET---
IXXA_PROFL/42-152PFVCEA---
SFTPD_RAT/269-374LVICEF---
LECA_SARPE/42-159GYICEP---
Q0NQ70_COWPX/61-155RWICEV---
FCER2_HUMAN/180-284AWVCDR---
KLRG2_HUMAN/310-406PWVCAK---
Q9N3W1_CAEEL/37-145YFVCSY---
E4Y143_OIKDI/82-193PFICEK---
V001_FOWPN/101-188YLVCKK---
E5RY41_TRISP/53-163NYICQI---
LFC_TACTR/453-566SFACMM---
A9J0X0_VACCA/64-164SVLCVK---
E3LCH6_CAERE/1231-1343PFACHK---
E3LJN0_CAERE/2714-2811PFVCEK---
VGA7_ALHV1/126-224LCLCGQ---
LYAM1_HUMAN/46-157AALCYT---
Q6VZ59_CNPV/57-147PYICYK---
Q963D6_NECAM/44-162YSICEK---
LECG_CROAT/20-133AFLCQC---
LYAM3_HUMAN/49-160HALCYT---
Q9Q8H9_MYXVL/64-168YVICMK---
Q6TUP6_YMTV5/64-166YIICVK---
MRC1_HUMAN/1252-1357GYICKR---
CLC4F_RAT/429-538NWVCKK---
LEC3_MEGRO/45-152NFLCKM---
C0HAR6_SALSA/133-268PFLCKR---
ISP2_OSMMO/55-161ASVCAK---
LECH_CHICK/98-203YYVCEK---
Q1HTR2_9POXV/67-181NVVCSR---
LYAM2_CANFA/30-141LALCYT---
MBL2_RAT/140-242LVVCEF---
Q4SDM0_TETNG/692-804GSLCER---
SFTPA_MOUSE/144-248LAICEF---
NKG2D_HUMAN/116-213TYICMQ---
ISP2_HEMAM/58-161KSVCAM---
Q8V3H6_SWPV1/63-165YILCVK---
F1NUD4_CHICK/202-294AWICEQ---
LPSBP_PERAM/137-254PFVCEV---
REG3B_MOUSE/57-173PYVCKF---
MRC1_HUMAN/966-1081GYICQT---
A6QPD3_BOVIN/171-271SCLCEK---
CD72_HUMAN/250-352PYICEM---
Q6VZW8_CNPV/55-136FYVCVS---
C3XRG9_BRAFL/43-156RFICEY---
E9GSY7_DAPPU/251-368PFVCRA---
MBL1_RAT/134-236TAVCEF---
F1M5M2_RAT/203-312GLVCEK---
ASGR2_MOUSE/187-295RWVCEK---
Q8UZH5_9GAMA/120-217PCLCVS---
SFTPD_BOVIN/264-369LVICEF---
Q993G6_9GAMA/140-238QCLCAS---
A2AIN6_MOUSE/249-342PCICES---
SFTPD_HUMAN/270-375LVVCEF---
LYAM2_MOUSE/29-140LALCYT---
REG3A_HUMAN/57-173PYVCKF---
IXXB_PROFL/42-144QFVCEF---
D3IZC8_9POXV/67-162TVVCVK---
A7SG60_NEMVE/46-144RFICQK---
F1RK81_PIG/134-267SFLCKR---
KLRBA_RAT/111-212IWVCQK---
SFTPA_RABIT/143-247LVICEF---
E2RAK1_CANFA/250-353PCICEM---
A9YY98_SHEV/64-167YIICVK---
A7XCQ8_9POXV/64-166YIVCVK---
SFPA2_HUMAN/144-248LTICEF---
Q9N3W8_CAEEL/37-145YFVCSY---
Q06ZZ3_CPRV/55-157ATVCVI---
Q5BK59_RAT/247-352PCICEL---
MRC1_HUMAN/521-627KFVCKH---
F1P2W2_CHICK/670-781GSVCER---
C1IIM8_BOVIN/46-161GSVCER---
CLC87_CAEEL/103-224YSICER---
C1C4X9_LITCT/224-318NYICEK---
MBL2_HUMAN/144-246LAVCEF---
C3XXU7_BRAFL/313-420NYVCQS---
MRC1_HUMAN/380-488GYICKM---
KLRBA_MOUSE/111-212RWICQK---
LECA_PLEWA/54-166PFICKY---
REG3A_RAT/56-172PFVCKF---
O17575_CAEEL/2720-2817AFICEK---
B4KGI3_DROMO/50-166PFMCRA---
Q6VZE9_CNPV/62-150HWICEK---
F1KQ91_ASCSU/56-180PAICQT---
NKG2A_HUMAN/136-231IYHCKH---
Q08F49_DPV84/64-164YIICVK---
SFTPA_CANFA/144-248LAICEF---
O62171_CAEEL/239-356NYVCET---
Q8JJP7_9GAMA/132-231YCLCAG---
E1BT58_CHICK/214-305PWICEQ---

PF05966

Q50LD9_9POXV/1-185KYFCVKTMN
Q1HTR3_9POXV/2-193GYYCI...N
Q77GH4_LSDV/6-196SYYCVRSFF
Q9Q8V7_RFVKA/1-172KYFCVKSFT
Q08F50_DPV84/6-192NYFCVKSVS
Q8V3H7_SWPV1/1-185SHFCLESFY

PF07979

EAE_ECO27/839-939YATCVK---
Q846P2_ECOLX/838-938YATCVK---
Q9S6R2_ECOLX/838-939FSVCVK---
Q8KRL2_ECOLX/838-937YAVCVK---
O06896_ECOLX/839-940FAVCVK---
Q8KRK8_ECOLX/838-938YAVCVK---
Q8VL95_ECOLX/840-935YAVCVE---
Q9LBG6_ECOLX/835-936FAVCVK---
Q93K94_ECOLX/838-937YAVCIK---
Q9R8B4_ECOLX/839-934YAVCVE---
INVA_YEREN/735-833YPLCAE---
Q8RSS9_ECOLX/842-948FAVCVR---
Q8KRL0_ECOLX/839-939YATCVK---
Q8KRL1_ECOLX/842-948FAVCVK---

PF03440

TOX3_BORPE/31-117---------
AER3_AERHY/24-106---------
AERA_AERTR/24-106---------
TOX2_BORPE/30-116---------
AERA_AERSA/26-108---------

PF01413

CO4A4_HUMAN/1573-1689CQVCVKY--
CO4A4_HUMAN/1465-1572CAVCEAP--
CO4A1_CAEEL/1535-1644CAVCEVP--
CO4A1_DROME/1663-1777CQVCMKN--
CO4A1_CAEEL/1645-1758CQVCLKN--
CO4A1_DROME/1555-1662CVVCEAP--
CO4A2_HUMAN/1489-1596CSVCEAP--
CO4A2_HUMAN/1597-1711CQVCMKN--
CO4A3_HUMAN/1555-1668CQVCMKK--
CO4A3_HUMAN/1445-1554CTVCEGP--
Q07265_STRPU/1528-1637CVVCEAP--
CO4A1_HUMAN/1555-1668CQVCMRR--
Q26640_STRPU/1526-1633CTVCEAP--
CO4A6_HUMAN/1467-1574CSVCEAP--
CO4A2_CAEEL/1639-1753CQVCVKS--
CO4A5_HUMAN/1461-1570CAVCEAP--
Q07265_STRPU/1638-1751CAVCLRN--
O18407_DROME/1513-1622CVVCETT--
O09238_9METZ/629-736CSVCESN--
Q26640_STRPU/1634-1746CRVCQKV--
CO4A2_CAEEL/1531-1638CAVCEAP--
CO4A6_HUMAN/1575-1690CQVCMKS--
CO4A1_HUMAN/1445-1554CAVCEAP--
CO4A5_HUMAN/1571-1684CQVCMKR--
O09238_9METZ/737-850CRVCEWV--
O18407_DROME/1623-1735CTVCRRR--

PF05473

EV45_EHV1D/19-219ARQALRL--
EV45_HHV23/4-171IRNALGL--
Q782P9_9ALPH/3-191ARTSLRL--
O56871_ILTV/33-274LRVALSF--
Q77Q60_9ALPH/3-192ARIYLRL--
Q5Y0Q7_9ALPH/5-173ARDALGL--
EV45_HHV11/4-171TRNALGL--
EV45_EHV4/19-218ARQALRL--
Q77L25_MEHV1/3-193ARVYLHL--
Q66077_9ALPH/2-174IRKIFGF--
Q69365_FHV1/7-189VRQIFSG--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window