Sequence alignment for CL0057

PF12651

A6LT47_CLOB8/12-55--------------------------------------------------------------------------------
Q1D537_MYXXD/6-49--------------------------------------------------------------------------------
Q08NJ8_STIAD/30-73--------------------------------------------------------------------------------
Q04FI1_OENOB/1-44--------------------------------------------------------------------------------
A5N8S1_CLOK5/8-51--------------------------------------------------------------------------------
A7HBK6_ANADF/4-47--------------------------------------------------------------------------------
Q9YEP4_AERPE/2-45--------------------------------------------------------------------------------
A2BMU8_HYPBU/1-44--------------------------------------------------------------------------------
B2TQ69_CLOBB/8-51--------------------------------------------------------------------------------
C3AQ62_BACMY/106-149--------------------------------------------------------------------------------
Q17ZT4_PEPD6/4-47--------------------------------------------------------------------------------
A9GWZ6_SORC5/4-47--------------------------------------------------------------------------------
E3FMN1_STIAD/4-47--------------------------------------------------------------------------------
Q2II40_ANADE/24-64--------------------------------------------------------------------------------
Q8XP25_CLOPE/8-50--------------------------------------------------------------------------------

PF01402

YIIE_ECOLI/6-43--------------------------------------------------------------------------------
VPB20_MYCTU/3-41--------------------------------------------------------------------------------
Q9YBV4_AERPE/3-42--------------------------------------------------------------------------------
Q8ZX60_PYRAE/47-86--------------------------------------------------------------------------------
P72681_SYNY3/21-59--------------------------------------------------------------------------------
Q8ZWZ9_PYRAE/10-49--------------------------------------------------------------------------------
NIKR_CHLTE/6-45--------------------------------------------------------------------------------
Q877Q4_PSESM/12-50--------------------------------------------------------------------------------
Y4KO_SINFN/4-42--------------------------------------------------------------------------------
VPB19_MYCTU/2-40--------------------------------------------------------------------------------
O28529_ARCFU/6-44--------------------------------------------------------------------------------
Y080_METJA/3-41--------------------------------------------------------------------------------
PARD2_CAUCR/12-50--------------------------------------------------------------------------------
O30230_ARCFU/6-44--------------------------------------------------------------------------------
O29882_ARCFU/4-42--------------------------------------------------------------------------------
NIKR1_METTH/3-42--------------------------------------------------------------------------------
Q9I707_PSEAE/4-42--------------------------------------------------------------------------------
E51_SSV1/12-50--------------------------------------------------------------------------------
Q88JZ4_PSEPK/2-40--------------------------------------------------------------------------------
Q888D4_PSESM/12-50--------------------------------------------------------------------------------
O30109_ARCFU/6-44--------------------------------------------------------------------------------
NIKR_HELPY/12-51--------------------------------------------------------------------------------
Q8EGZ2_SHEON/6-44--------------------------------------------------------------------------------
G7YYF2_CLOSI/3-42--------------------------------------------------------------------------------
YBFE_ECOLI/52-88--------------------------------------------------------------------------------
Y298_MYCTU/6-41--------------------------------------------------------------------------------
VPB10_MYCTU/3-39--------------------------------------------------------------------------------
Q327A8_SHIDS/14-51--------------------------------------------------------------------------------
Q3IQM5_NATPD/4-41--------------------------------------------------------------------------------
Q8U3E4_PYRFU/7-45--------------------------------------------------------------------------------
S6AY38_PSERE/10-47--------------------------------------------------------------------------------
V5UCU1_9BURK/15-51--------------------------------------------------------------------------------

PF07878

Q1QQP0_NITHX/90-130--------------------------------------------------------------------------------
Q7U858_SYNPX/33-75--------------------------------------------------------------------------------
A5GQX8_SYNR3/18-60--------------------------------------------------------------------------------
E8SHU9_STAPH/6-48--------------------------------------------------------------------------------
A5GKY5_SYNPW/33-75--------------------------------------------------------------------------------
F4BUC1_METCG/7-49--------------------------------------------------------------------------------
B7JWD3_CYAP8/2-44--------------------------------------------------------------------------------
A8ZLB3_ACAM1/15-57--------------------------------------------------------------------------------
D7E5Q5_NOSA0/6-48--------------------------------------------------------------------------------
Q46HT9_PROMT/14-56--------------------------------------------------------------------------------
B1X2B8_CYAA5/9-51--------------------------------------------------------------------------------
Q7VEB2_PROMA/14-56--------------------------------------------------------------------------------
Q7NMR8_GLOVI/20-62--------------------------------------------------------------------------------
E0UNJ6_CYAP2/6-48--------------------------------------------------------------------------------
Q8YK09_NOSS1/15-57--------------------------------------------------------------------------------
K9VLV1_9CYAN/8-49--------------------------------------------------------------------------------
K9VLX7_9CYAN/14-56--------------------------------------------------------------------------------
Q7V237_PROMP/82-124--------------------------------------------------------------------------------

PF15919

F8GGR0_NITSI/3-126YPIAIE.PGDDK.HAFGVVVPDLPGCFSAGDT.IDEAIDKAKEAIELWLETVIDDGGSVP.H.PKSISEH..Q.ANP..E
F2JW02_MARM1/3-127YPIVLH.T.DDG.DSYSVTVPDVPGCFSAGTT.LNEAIDMAEEAIFFHLEGMLEDGEDVP.V.ASEIAVY..K.DNP..D
E1VAV2_HALED/3-129YPIAIEIA.DEQ.HAYSVVVPDLPGCFSAGDT.FDEAVANAREAIEGHLESLSDHGDPIP.K.TTTIEQH..L.ENP..D
B8GTR2_THISH/3-126YPILIE.P.GSNSTAYSVVVPDLPGCYSAGDT.LDEAIENAEEAILMHLEALIDAGESLP.E.PSSIEMQ..L.NNP..A
F4HBU2_GALAU/3-128YPIGIE.MGDDK.HAFGVIVPDVPGCFSAGDT.LEEAYINAKEAIAFHIEGMLEDGEEFP.L.PTDIKAH..M.NNK..E
F7QNQ0_9BRAD/4-124FIALIH.K.DAD.SDYGVSFPDLPGVISAGST.LDEARDMATEALALHIEGLIEDGEAVP.E.PSSLEDI..M.ANA..D
D8MUK4_ERWBE/3-128YPIAIE.NGDEH.HAYGVTVPDLPGCFSAGET.LEEAVNNAKEAITGHIELLIELGDDIP.A.VSSLSAL..V.ADS..Q
G8M697_9BURK/3-126FALAIH.K.DPD.SCYGVTVPNVPGVFSAGDT.IDEAIQNAKEAIFFHIESIIEDGEEVT.IKSTSIEEL..I.VDP..D
D5BWS5_NITHN/3-123YPVYIH.PGDNK.HAHGVTFPDFPGCFSAADS.WEELPAKIQEAVELYFEG...ETMEIP.P.PTPLEEL..V.QRP..E
Q98J17_RHILO/4-124YIGLIH.K.DAG.SDFGVSFPDFPGVITAGKD.LDDARSMAEEALTLHIEGLVEDGEAIP.E.PSSLQAV..M.ADA..D
E6WDB3_PANSA/3-127FAVYLH.K.ADS.GGYSGFVPDIIGCIFAGDT.IDNAIVDATEAIDAHLESLADRGKTLP.E.AKDISAH..L.DDE..D
A1VQL9_POLNA/3-127YPITIE.P.GNDTTAWGVVVPDLPGCFSAGDT.LEEAMIQAEDAVTAWIEVALDAGQDIP.A.PSHIEAL..RTAHP..E
Q63NA5_BURPS/3-126FPIAVH.K.DDG.SVYGVTVPDIPGVHSWGET.IDDAIKNTREAIVGHVETLIELGEDVEFT.CSTVEEL..V.AKP..E
B4ET85_PROMH/3-129YPAFIE.I.DED.GSASGWFPDIDGCIFAGDS.IEEAHADARSAIDAHFELLSEKGLDIP.S.PKSQQEHLIN.SSG..D
A5GAH3_GEOUR/3-123YPAYVHIG.DDQ.HAHGVTIPDFPGCFSAADE.WEDLPHMIQEAAEVYFEG...EDMPVP.A.PTPLEQL..A.ANP..E
Q1LPG4_CUPMC/14-137FPIAIH.K.DAN.SVYGVTVPDVAGCYSAGES.IEEAVRNAREAITTHVVALLSLGEEVVLK.TTPIGTL..M.AQP..E
A8GFZ4_SERP5/3-129YPAYVH.S.EHD.GSASGFFPDVPGCYFAGDT.LDRAFEDAKSALDAHFELLSEDNQSIP.R.PQAVSFH..L.AQESDT
Q7N448_PHOLL/3-129YPIAIEIG.DEN.HAYGVVVPDISGCFSAGDS.MEDAIKNSKEAITGHLELLAEMNQLPP.E.AKSLDYW..I.KDE..E
Q5HXI2_GLUOX/3-126YPVVIE.RGSET.TAFGVVFPDLPGCFSAGDT.LDEALSCAEEAAAAWIDATLDAGEAVP.S.PSSLDAI..Q.SNP..D
F4GPE1_PUSST/3-127YPIAIE.P.GNDTTAWGVVAPDLPGCFSAADNGIDEAIENAKEAIALWIEEAIANGEIIP.K.PSSITDL..Q.MTG..E
B8DM26_DESVM/3-123YPVIVH.K.DAD.SAYGVILPDFPGCFTAGDT.LEEALANAQEAVELYFEG..ERDAVAP.P.PSPIDAV..L.GSE..D
A9H9S0_GLUDA/10-135YPIVIE.R.GSDAEAYGVVVPDLPGCFSAGDT.FDEAVSNASEAIALWVEDAIDNGQSIP.R.PSSLDGL..R.ASL..E
F9ZMS1_ACICS/3-126YPIAIE.PGDDH.HAYGVVVPDLPGCFSAGDT.LDEAIANAHEAIALWLETVMDDGGTIP.A.PSSVESL..Q.KQP..E
YO14_BPHC1/3-126YPICIE.K.VND..GYVVSVPDVPGCFSAGDT.LSEAMLNAKEAISFHIEGMLEDDEELP.K.SNPIEQY..I.NQP..E
Q5F6D2_NEIG1/4-126.PAALH.K.DEH.SAYGVTIPDLPGCFSCGDT.VEEAVANARSAAYMHIDGMIEDGGFKNLA.VSSIADL..S.QEP..D
Q7VZH1_BORPE/3-127YPIAIE.PGSDT.RAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIP.P.ATSIANH..Q.ANP..E
Q9A3L8_CAUCR/4-124YIALIH.K.DAD.SAFGVSFPDLPGCISVGET.LEEARANAEEALALHVEGMIEDGETLP.A.PSALDEV..M.AAP..G
W8KT83_HALHR/3-127YPIAIE.WGDEH.TATGIVFPDIPGAITAGDT.VEQAYEMAVEVAHIQLEELATAGKAIP.M.PGNITKH..R.QNP..E

PF12441

Q30QH6_SULDN/2-80----------------------------------------------------------KTLP.KFKDQNEEMAFWEKNDV
B0JXE6_MICAN/7-82----------------------------------------------------------KSLP.KFNSTEEIVNFFDSHDL
B4SES2_PELPB/3-79----------------------------------------------------------KKFP.DFKTDDEAEAFVESADL
A6QAG9_SULNB/5-83----------------------------------------------------------KKIP.EFQNEEEERLFWEKHDS
C1F1N0_ACIC5/3-81----------------------------------------------------------KKIP.EFKSEEEEFAFWSKADS
B4SF55_PELPB/6-84----------------------------------------------------------TAIP.EFRSEAEEQEFWSTHDS
A4SVJ8_POLSQ/6-84----------------------------------------------------------KIIP.KFKTEKEERTFWEKNDA
A1BIF8_CHLPD/6-84----------------------------------------------------------KTVP.EFRSEQDEREFWATHDS
B1WWY8_CYAA5/9-85----------------------------------------------------------DPIPEEFSSYEAAAEFWDTHDT
B8GRA9_THISH/6-84----------------------------------------------------------KTVP.EFKSEAEERAFWETHDS
P72819_SYNY3/56-132----------------------------------------------------------KPLP.KMNSDQEAEDLLEQ.DL
A5GA05_GEOUR/6-84----------------------------------------------------------KEVP.AFSSEAEERTFWEQHDS
C7LN80_DESBD/6-82----------------------------------------------------------KQMP.SLRNDAEAEEFVAQADL
Q01SA6_SOLUE/7-85----------------------------------------------------------KTVP.EFQSEDDEREFWATHDS
C3KQS7_SINFN/6-84----------------------------------------------------------KPIP.SFETEAEERAYWETHDS
Q9AAV5_CAUCR/3-77----------------------------------------------------------KAVP.KLTTDDEAEAFLTQ.DL

PF13467

I3THE1_TISMK/5-68--------------------------------------------------------------------------------
A1B158_PARDP/15-82--------------------------------------------------------------------------------
Q2W502_MAGSA/68-131--------------------------------------------------------------------------------
U4KIB5_9VIBR/16-83--------------------------------------------------------------------------------
D7A937_STAND/16-83--------------------------------------------------------------------------------
Q47K48_DECAR/15-83--------------------------------------------------------------------------------
B8EK53_METSB/15-83--------------------------------------------------------------------------------
V6F6E9_9PROT/28-96--------------------------------------------------------------------------------
I3TNF1_TISMK/9-73--------------------------------------------------------------------------------
S6AZN1_PSERE/15-83--------------------------------------------------------------------------------
B4RFD6_PHEZH/4-67--------------------------------------------------------------------------------
A4Z0Q4_BRASO/15-82--------------------------------------------------------------------------------
Q8EH51_SHEON/15-83--------------------------------------------------------------------------------
Q1QJT3_NITHX/17-80--------------------------------------------------------------------------------
U4K818_9VIBR/15-83--------------------------------------------------------------------------------
R5XT33_9PROT/6-68--------------------------------------------------------------------------------
D7A5S3_STAND/15-83--------------------------------------------------------------------------------
A5FXC9_ACICJ/3-65--------------------------------------------------------------------------------
D4ZC71_SHEVD/15-83--------------------------------------------------------------------------------
K7SD13_GLUOY/4-66--------------------------------------------------------------------------------
G2KLR8_MICAA/1-64--------------------------------------------------------------------------------
G8PTZ2_PSEUV/3-67--------------------------------------------------------------------------------
A8IAV7_AZOC5/5-68--------------------------------------------------------------------------------
Q13WI7_BURXL/15-84--------------------------------------------------------------------------------
B2IEK6_BEII9/15-82--------------------------------------------------------------------------------
R5YAT6_9PROT/7-67--------------------------------------------------------------------------------
F2J384_POLGS/15-81--------------------------------------------------------------------------------
Q2K3V5_RHIEC/15-83--------------------------------------------------------------------------------
V6F679_9PROT/38-104--------------------------------------------------------------------------------
Q7CXZ9_AGRFC/2-66--------------------------------------------------------------------------------
C3MEF5_SINFN/3-66--------------------------------------------------------------------------------
B9JH07_AGRRK/7-71--------------------------------------------------------------------------------
Q2YPT7_BRUA2/7-71--------------------------------------------------------------------------------
Q0A5P7_ALKEH/48-113--------------------------------------------------------------------------------
A5VF72_SPHWW/4-70--------------------------------------------------------------------------------
Q2N6Z0_ERYLH/8-73--------------------------------------------------------------------------------
B6INS4_RHOCS/2-64--------------------------------------------------------------------------------
W8RV19_9RHOB/5-69--------------------------------------------------------------------------------
A7HVX0_PARL1/14-77--------------------------------------------------------------------------------
Q2W7L3_MAGSA/5-67--------------------------------------------------------------------------------
A8LPV2_DINSH/15-83--------------------------------------------------------------------------------
Q167Q5_ROSDO/15-83--------------------------------------------------------------------------------
Q15TD7_PSEA6/15-83--------------------------------------------------------------------------------
E3I0W1_RHOVT/38-99--------------------------------------------------------------------------------
Q167I6_ROSDO/5-69--------------------------------------------------------------------------------
A6X0F5_OCHA4/15-83--------------------------------------------------------------------------------
C5AUK2_METEA/10-72--------------------------------------------------------------------------------
R6I0Y9_9PROT/4-68--------------------------------------------------------------------------------
B8IRU4_METNO/15-83--------------------------------------------------------------------------------
B8ELI0_METSB/17-78--------------------------------------------------------------------------------
G8ARW4_AZOBR/20-92--------------------------------------------------------------------------------
G7ZBW3_AZOL4/15-83--------------------------------------------------------------------------------
D4YZT3_SPHJU/21-85--------------------------------------------------------------------------------
I0HQZ1_RUBGI/15-82--------------------------------------------------------------------------------
A9HZ31_BORPD/15-82--------------------------------------------------------------------------------
B0T0E7_CAUSK/20-82--------------------------------------------------------------------------------
B6IVX3_RHOCS/20-83--------------------------------------------------------------------------------
H5WRL6_9BURK/15-83--------------------------------------------------------------------------------
R6I5L9_9PROT/2-65--------------------------------------------------------------------------------
Q88NJ6_PSEPK/37-105--------------------------------------------------------------------------------
Q7VY20_BORPE/16-82--------------------------------------------------------------------------------
Q0KEM8_CUPNH/15-86--------------------------------------------------------------------------------
Q3J4J5_RHOS4/5-69--------------------------------------------------------------------------------
B6JB62_OLICO/35-98--------------------------------------------------------------------------------
G4RFD5_PELHB/1-64--------------------------------------------------------------------------------
Q5LS66_RUEPO/5-69--------------------------------------------------------------------------------
R5XSE7_9PROT/2-65--------------------------------------------------------------------------------
A9HBJ7_GLUDA/7-71--------------------------------------------------------------------------------
B2U9M5_RALPJ/15-83--------------------------------------------------------------------------------
C6BV10_DESAD/15-83--------------------------------------------------------------------------------
A1WLD9_VEREI/15-83--------------------------------------------------------------------------------
V5SG48_9RHIZ/7-70--------------------------------------------------------------------------------
D5BP55_PUNMI/2-63--------------------------------------------------------------------------------
D0IW80_COMT2/15-83--------------------------------------------------------------------------------
V6EZW9_9PROT/2-64--------------------------------------------------------------------------------
B1M524_METRJ/6-68--------------------------------------------------------------------------------
G7Z694_AZOL4/2-65--------------------------------------------------------------------------------
E8RRH3_ASTEC/4-67--------------------------------------------------------------------------------
A1VU33_POLNA/15-83--------------------------------------------------------------------------------
Q11GU9_CHESB/4-68--------------------------------------------------------------------------------
D9QJB1_BRESC/2-64--------------------------------------------------------------------------------
A2SED0_METPP/15-83--------------------------------------------------------------------------------
A1B3A7_PARDP/22-85--------------------------------------------------------------------------------
Q5E5I8_VIBF1/19-85--------------------------------------------------------------------------------
G8B035_AZOBR/15-83--------------------------------------------------------------------------------
K7SIV6_GLUOY/15-83--------------------------------------------------------------------------------
Q28PQ0_JANSC/10-74--------------------------------------------------------------------------------
Q87MR6_VIBPA/16-83--------------------------------------------------------------------------------
R5R7N0_9PROT/5-68--------------------------------------------------------------------------------
Q5NQS8_ZYMMO/14-79--------------------------------------------------------------------------------
R5Q8E2_9PROT/4-65--------------------------------------------------------------------------------
Q141Z3_BURXL/65-133--------------------------------------------------------------------------------
R6ITS5_9PROT/4-68--------------------------------------------------------------------------------
G2KND8_MICAA/35-99--------------------------------------------------------------------------------
Q92NP9_RHIME/6-70--------------------------------------------------------------------------------
Q21US4_RHOFT/16-83--------------------------------------------------------------------------------
W0AMC0_9SPHN/9-75--------------------------------------------------------------------------------
D5AQD4_RHOCB/5-69--------------------------------------------------------------------------------
Q2G3C7_NOVAD/8-72--------------------------------------------------------------------------------
Q2RS87_RHORT/10-72--------------------------------------------------------------------------------
Q0AMZ5_MARMM/17-80--------------------------------------------------------------------------------
A7IN95_XANP2/16-83--------------------------------------------------------------------------------
E0TDI6_PARBH/6-68--------------------------------------------------------------------------------
S5YGZ7_PARAH/15-83--------------------------------------------------------------------------------
B6JB63_OLICO/5-68--------------------------------------------------------------------------------
A1BB74_PARDP/15-83--------------------------------------------------------------------------------
Q0BVF8_GRABC/3-66--------------------------------------------------------------------------------
B6IXV3_RHOCS/24-88--------------------------------------------------------------------------------
G8AK62_AZOBR/2-63--------------------------------------------------------------------------------
R6IQM1_9PROT/1-65--------------------------------------------------------------------------------
F2J2A0_POLGS/3-67--------------------------------------------------------------------------------
W0PKG2_9BURK/15-82--------------------------------------------------------------------------------
J7QMW2_METSZ/14-76--------------------------------------------------------------------------------
M4S774_9SPHN/4-69--------------------------------------------------------------------------------
B8IF14_METNO/8-71--------------------------------------------------------------------------------
A8HUM8_AZOC5/15-83--------------------------------------------------------------------------------
A8LRP0_DINSH/33-97--------------------------------------------------------------------------------
S5YRV8_PARAH/10-74--------------------------------------------------------------------------------
A6WUZ0_OCHA4/15-83--------------------------------------------------------------------------------
G0AAA0_COLFT/37-104--------------------------------------------------------------------------------
F8J5J1_HYPSM/3-66--------------------------------------------------------------------------------
G8AI45_AZOBR/22-97--------------------------------------------------------------------------------
G8ARV8_AZOBR/26-90--------------------------------------------------------------------------------
B6IW11_RHOCS/3-66--------------------------------------------------------------------------------
M9R844_9RHOB/9-72--------------------------------------------------------------------------------
R6J4D7_9PROT/7-67--------------------------------------------------------------------------------
C7JBE2_ACEP3/5-69--------------------------------------------------------------------------------
A6VZH2_MARMS/16-83--------------------------------------------------------------------------------
V9VUQ5_9RHOB/5-69--------------------------------------------------------------------------------
D5BMV3_PUNMI/6-68--------------------------------------------------------------------------------
R5QX40_9PROT/1-65--------------------------------------------------------------------------------
B9JXQ8_AGRVS/8-72--------------------------------------------------------------------------------
Q87Y30_PSESM/6-74--------------------------------------------------------------------------------
A0KLC1_AERHH/26-94--------------------------------------------------------------------------------
Q98KH2_RHILO/5-68--------------------------------------------------------------------------------
A5FYB5_ACICJ/15-82--------------------------------------------------------------------------------
D5QBC0_KOMHA/10-72--------------------------------------------------------------------------------
G2IRZ2_9SPHN/11-78--------------------------------------------------------------------------------
Q2SKQ2_HAHCH/16-83--------------------------------------------------------------------------------
B2IH09_BEII9/17-85--------------------------------------------------------------------------------
Q2K6G5_RHIEC/20-84--------------------------------------------------------------------------------
F6IFI2_9SPHN/8-74--------------------------------------------------------------------------------
B2UET6_RALPJ/16-83--------------------------------------------------------------------------------
Q1GGM9_RUEST/6-70--------------------------------------------------------------------------------

PF03869

RMNT_BPP22/2-51--------------------------------------------------------------------------------
RARC_BPP22/4-53--------------------------------------------------------------------------------
G3XCY4_PSEAE/13-62--------------------------------------------------------------------------------

PF07704

Q92LY2_RHIME/1-78-------------------------------------------------------------------------------M
K9Y1V0_STAC7/1-81-------------------------------------------------------------------------------M
VPB42_MYCTU/1-88-------------------------------------------------------------------------------M
C7NJK7_KYTSD/22-102-------------------------------------------------------------------------------M
Q0BQA3_GRABC/5-87-------------------------------------------------------------------------------M
L0DWF9_THIND/1-83-------------------------------------------------------------------------------M
A6WWK7_OCHA4/1-81-------------------------------------------------------------------------------M
Q2JGF8_FRASC/9-88-------------------------------------------------------------------------------.
W0ABH3_9SPHN/5-83-------------------------------------------------------------------------------.
A6X7T6_OCHA4/1-81-------------------------------------------------------------------------------M
A7IPR5_XANP2/185-260-------------------------------------------------------------------------------.
I6X1P2_PROPF/1-84-------------------------------------------------------------------------------M
I3TVZ0_TISMK/1-81-------------------------------------------------------------------------------M
I3Y9G9_THIV6/1-75-------------------------------------------------------------------------------M
Q20ZG7_RHOPB/1-82-------------------------------------------------------------------------------M
B1M1V3_METRJ/1-75-------------------------------------------------------------------------------M
G8NNV7_GRAMM/6-85-------------------------------------------------------------------------------M
L0J8B6_9MYCO/1-82-------------------------------------------------------------------------------M
F2J715_POLGS/1-79-------------------------------------------------------------------------------M
K7S7C8_PROA4/1-82-------------------------------------------------------------------------------M
B8EP86_METSB/1-76-------------------------------------------------------------------------------M
B8IVJ3_METNO/1-83-------------------------------------------------------------------------------M
C7NLZ4_KYTSD/1-87-------------------------------------------------------------------------------M
C1A9G9_GEMAT/1-83-------------------------------------------------------------------------------M
Y2378_RHIME/1-81-------------------------------------------------------------------------------M
F5XKW7_MICPN/1-83-------------------------------------------------------------------------------M
L0J8W2_9MYCO/1-78-------------------------------------------------------------------------------M
B0T0U9_CAUSK/24-113-------------------------------------------------------------------------------M
VPB30_MYCTU/1-83-------------------------------------------------------------------------------M
Q2RUX5_RHORT/1-81-------------------------------------------------------------------------------M
VPB36_MYCTU/1-81-------------------------------------------------------------------------------M
I6XS64_PROPF/3-79-------------------------------------------------------------------------------P
H6RSW2_BLASD/1-87-------------------------------------------------------------------------------M
Q92TH7_RHIME/9-88-------------------------------------------------------------------------------M
H6RM61_BLASD/1-86-------------------------------------------------------------------------------M
B9JIC8_AGRRK/5-84-------------------------------------------------------------------------------M
D7A0R5_STAND/1-80-------------------------------------------------------------------------------M
B0SW80_CAUSK/41-123-------------------------------------------------------------------------------P
A7IPR8_XANP2/1-84-------------------------------------------------------------------------------M
K9Y7X0_HALP7/1-79-------------------------------------------------------------------------------M
L0GTX7_9GAMM/1-83-------------------------------------------------------------------------------M
D4Z9B0_SPHJU/1-81-------------------------------------------------------------------------------M
C3KNS9_SINFN/1-79-------------------------------------------------------------------------------M
C3KQT0_SINFN/1-80-------------------------------------------------------------------------------M
A6X8D2_OCHA4/6-84-------------------------------------------------------------------------------.
VPB28_MYCTU/1-80-------------------------------------------------------------------------------M
Q981I6_RHILO/1-76-------------------------------------------------------------------------------M
Q6N2A9_RHOPA/1-82-------------------------------------------------------------------------------M
Q219N1_RHOPB/1-83-------------------------------------------------------------------------------M
Q7NGE7_GLOVI/4-85-------------------------------------------------------------------------------.
A1T4A5_MYCVP/1-80-------------------------------------------------------------------------------M
K0FC64_9NOCA/1-82-------------------------------------------------------------------------------M
B1LSI4_METRJ/1-77-------------------------------------------------------------------------------M
C3KQV7_SINFN/1-83-------------------------------------------------------------------------------M
D3PLA4_MEIRD/1-79-------------------------------------------------------------------------------M
L0E2P5_THIND/1-78-------------------------------------------------------------------------------M
B2IL59_BEII9/1-77-------------------------------------------------------------------------------M
U5QCJ3_9CYAN/4-85-------------------------------------------------------------------------------.
C8XHZ8_NAKMY/1-83-------------------------------------------------------------------------------M
Q92RQ4_RHIME/1-83-------------------------------------------------------------------------------M
Q5SKZ1_THET8/1-84-------------------------------------------------------------------------------M
A5FU30_ACICJ/1-78-------------------------------------------------------------------------------M
Q1QF44_NITHX/1-83-------------------------------------------------------------------------------M

PF17206

SEQA_MANSM/1-36--------------------------------------------------------------------------------
W0HVK8_9GAMM/1-36--------------------------------------------------------------------------------
SEQA_VIBTL/1-36--------------------------------------------------------------------------------
SEQA_PSEHT/1-36--------------------------------------------------------------------------------
SEQA_SHEFN/1-36--------------------------------------------------------------------------------
M4R5K5_BIBTR/3-38--------------------------------------------------------------------------------
SEQA_PSYIN/1-36--------------------------------------------------------------------------------
J7SKW3_MORMO/1-36--------------------------------------------------------------------------------
SEQA_PROMH/1-36--------------------------------------------------------------------------------
SEQA_HAMD5/1-36--------------------------------------------------------------------------------

PF16777

O25288_HELPY/1-41------------------------------------------------------------M...................
O25010_HELPY/1-73------------------------------------------------------------MEK............TENTD
E7ABM8_HELFC/1-86------------------------------------------------------------MDKKIPNSIQEALNNKAIQE

PF09957

Q82BL1_STRAW/2-49--------------------------------------------------------------------------------
Q20X13_RHOPB/8-51--------------------------------------------------------------------------------
Q2FLV1_METHJ/1-47--------------------------------------------------------------------------------
Q58AH0_CUPMC/1-44--------------------------------------------------------------------------------
Q3JAZ0_NITOC/1-47--------------------------------------------------------------------------------
A1U2W3_MARHV/1-47--------------------------------------------------------------------------------
A1VX34_POLNA/1-45--------------------------------------------------------------------------------
Q7AQ19_MYCLE/3-56--------------------------------------------------------------------------------
Q73PC1_TREDE/1-47--------------------------------------------------------------------------------
B3EKM2_CHLPB/1-47--------------------------------------------------------------------------------
Q73R95_TREDE/1-44--------------------------------------------------------------------------------
Q7NCS8_GLOVI/1-47--------------------------------------------------------------------------------
A8ZTF6_DESOH/1-44--------------------------------------------------------------------------------
Q7D057_AGRFC/1-48--------------------------------------------------------------------------------
Q2FNJ2_METHJ/1-47--------------------------------------------------------------------------------
A5G896_GEOUR/35-78--------------------------------------------------------------------------------
A5GB97_GEOUR/1-47--------------------------------------------------------------------------------
Q73SG9_MYCPA/11-61--------------------------------------------------------------------------------
A0ZI46_NODSP/1-47--------------------------------------------------------------------------------
Q01QU3_SOLUE/1-47--------------------------------------------------------------------------------
A4XJM6_CALS8/1-47--------------------------------------------------------------------------------
Q124P4_POLSJ/1-47--------------------------------------------------------------------------------
B1WYD1_CYAA5/1-47--------------------------------------------------------------------------------
B2HSG4_MYCMM/3-54--------------------------------------------------------------------------------
B8GLV4_THISH/1-43--------------------------------------------------------------------------------
VAPB6_MYCTU/3-45--------------------------------------------------------------------------------
Y634A_MYCTU/16-68--------------------------------------------------------------------------------
VPB15_MYCTU/7-50--------------------------------------------------------------------------------
VPB11_MYCTU/7-49--------------------------------------------------------------------------------
Q8YSF9_NOSS1/25-71--------------------------------------------------------------------------------

PF09274

E5YNK1_9ENTR/1-74---------------------------------------------------------------------MALTKQHTS.K
Q9F809_ERWAM/1-76---------------------------------------------------------------------MALEKNHTSSK
B0ZE05_ECOLX/1-76---------------------------------------------------------------------MSLEKAHTSVK

PF05509

B8EFN4_SHEB2/13-61--------------------------------------------------------------------------------
Q4LC31_SODGL/14-62--------------------------------------------------------------------------------
B6ESX2_ALISL/7-55--------------------------------------------------------------------------------
A7DVG3_VIBVL/13-61--------------------------------------------------------------------------------
B2LS54_9VIBR/10-58--------------------------------------------------------------------------------
B8EFW0_SHEB2/41-89--------------------------------------------------------------------------------
B6ET57_ALISL/12-52--------------------------------------------------------------------------------
A0A061Q3R7_9VIBR/12-60--------------------------------------------------------------------------------
Q7MBP1_VIBVY/10-58--------------------------------------------------------------------------------
A7N8Z3_VIBCB/12-60--------------------------------------------------------------------------------
Q5DY84_VIBF1/10-58--------------------------------------------------------------------------------
A6D5H0_9VIBR/18-66--------------------------------------------------------------------------------
Q6LW96_PHOPR/20-68--------------------------------------------------------------------------------
A8QYN9_9GAMM/15-63--------------------------------------------------------------------------------
A7N8V1_VIBCB/9-57--------------------------------------------------------------------------------
E6WK64_PANSA/14-62--------------------------------------------------------------------------------
B2VB54_ERWT9/25-73--------------------------------------------------------------------------------
B6ICE9_ECOSE/13-61--------------------------------------------------------------------------------
A0A0T7RY16_SALET/14-62--------------------------------------------------------------------------------
A0A0U5FL61_SHIFL/14-62--------------------------------------------------------------------------------
A0A0D3RK65_KLEPN/14-62--------------------------------------------------------------------------------
A0A0P8E501_ECOLX/14-62--------------------------------------------------------------------------------
A0A024KL39_ECOLX/70-118--------------------------------------------------------------------------------
A6TIF9_KLEP7/67-115--------------------------------------------------------------------------------
A6TIT2_KLEP7/72-120--------------------------------------------------------------------------------
Q1MKC7_RHIL3/2-50--------------------------------------------------------------------------------

PF02697

T0LS63_9EURY/3-63--------------------------------------------------------------------------------
VPB12_SULTO/2-69--------------------------------------------------------------------------------
K0ILD1_NITGG/5-70--------------------------------------------------------------------------------
Y468_SULAC/3-73--------------------------------------------------------------------------------
VAPB3_METAC/4-69--------------------------------------------------------------------------------
VPB21_SULTO/3-69--------------------------------------------------------------------------------
D3RYZ8_FERPA/3-69--------------------------------------------------------------------------------
Y1222_PYRFU/3-69--------------------------------------------------------------------------------
L0K336_9EURY/8-69--------------------------------------------------------------------------------
A4YFM7_METS5/2-68--------------------------------------------------------------------------------
Q96ZV9_SULTO/7-74--------------------------------------------------------------------------------
VPB15_ARCFU/4-66--------------------------------------------------------------------------------
T0LZ28_9EURY/35-97--------------------------------------------------------------------------------
F4BV58_METCG/4-69--------------------------------------------------------------------------------
Y1752_THEKO/3-69--------------------------------------------------------------------------------
D3SWF9_NATMM/7-71--------------------------------------------------------------------------------
H1Z229_9EURY/8-73--------------------------------------------------------------------------------
D3RXH8_FERPA/2-66--------------------------------------------------------------------------------
B9LNT2_HALLT/4-66--------------------------------------------------------------------------------
F7PL26_9EURY/4-69--------------------------------------------------------------------------------
F2KPT0_ARCVS/2-67--------------------------------------------------------------------------------
E6N6M2_9ARCH/6-71--------------------------------------------------------------------------------
VPB16_ARCFU/2-67--------------------------------------------------------------------------------
D3RY16_FERPA/3-67--------------------------------------------------------------------------------
Y1481_ARCFU/2-66--------------------------------------------------------------------------------
K0IGR2_NITGG/4-71--------------------------------------------------------------------------------
E6N5Q0_9ARCH/3-69--------------------------------------------------------------------------------
VAPB3_METJA/5-71--------------------------------------------------------------------------------
VPB18_ARCFU/3-66--------------------------------------------------------------------------------
K0I6Z0_NITGG/1-65--------------------------------------------------------------------------------
T0LWN0_9EURY/4-68--------------------------------------------------------------------------------
K0I6W7_NITGG/3-67--------------------------------------------------------------------------------
F8D5A7_HALXS/4-66--------------------------------------------------------------------------------
T0LIW2_9EURY/4-66--------------------------------------------------------------------------------
A7I6Z1_METB6/4-69--------------------------------------------------------------------------------
VAPB4_PYRFU/3-69--------------------------------------------------------------------------------
D3S0D8_FERPA/2-67--------------------------------------------------------------------------------
L0K2C6_9EURY/4-67--------------------------------------------------------------------------------

PF10723

Q93GS8_SALTY/8-88--------------------------------------------------------------MSQIENAVTSSS..KRIY
Q326V9_SHIDS/1-86--------------------------------------------------------------MSQTENAVTSSLSQKRFV
Q326M6_SHIDS/1-79--------------------------------------------------------------MSQIENAVTSSP..KRIY

PF07362

H0Q687_9RHOO/11-81--------------------------------------------------------------------------------
K0I4M5_9BURK/9-79--------------------------------------------------------------------------------
L0DQK3_THIND/1-68--------------------------------------------------------------------------------
B5EG30_GEOBB/12-82--------------------------------------------------------------------------------
D4YZH7_SPHJU/13-83--------------------------------------------------------------------------------
B2JXB4_PARP8/10-80--------------------------------------------------------------------------------
Q82VK5_NITEU/17-87--------------------------------------------------------------------------------
B0T4X1_CAUSK/3-80--------------------------------------------------------------------------------
E0SK21_DICD3/2-72--------------------------------------------------------------------------------
Q1GN85_SPHAL/11-80--------------------------------------------------------------------------------
Q326Z9_SHIDS/2-72--------------------------------------------------------------------------------
D3VG79_XENNA/22-92--------------------------------------------------------------------------------
W0L945_9GAMM/12-76--------------------------------------------------------------------------------
F5XZ64_RAMTT/9-77--------------------------------------------------------------------------------
G7Z7L4_AZOL4/17-86--------------------------------------------------------------------------------
Q98F99_RHILO/26-96--------------------------------------------------------------------------------
S5Z1L5_PARAH/10-80--------------------------------------------------------------------------------
A5GAE8_GEOUR/23-93--------------------------------------------------------------------------------
Q93GR6_SALTY/2-72--------------------------------------------------------------------------------
A7HPK7_PARL1/5-75--------------------------------------------------------------------------------
E1VR77_9GAMM/21-91--------------------------------------------------------------------------------
G7ZEQ7_AZOL4/20-89--------------------------------------------------------------------------------
Q5P2R6_AROAE/22-92--------------------------------------------------------------------------------
Q32K47_SHIDS/7-77--------------------------------------------------------------------------------
A0L724_MAGMM/11-81--------------------------------------------------------------------------------
A8GC18_SERP5/8-78--------------------------------------------------------------------------------
A1U420_MARHV/11-81--------------------------------------------------------------------------------
Q8PCL0_XANCP/29-98--------------------------------------------------------------------------------
S6AR37_PSERE/11-81--------------------------------------------------------------------------------
Q6D9V2_PECAS/2-71--------------------------------------------------------------------------------
Q21DI4_SACD2/11-81--------------------------------------------------------------------------------
I1XLK6_METNJ/11-81--------------------------------------------------------------------------------
Q7N4P4_PHOLL/9-79--------------------------------------------------------------------------------
Q21U54_RHOFT/9-79--------------------------------------------------------------------------------
C3MCA1_SINFN/7-77--------------------------------------------------------------------------------
B3PDY0_CELJU/63-133--------------------------------------------------------------------------------
C7JJ40_ACEP3/1-66--------------------------------------------------------------------------------
K7SHF6_GLUOY/17-86--------------------------------------------------------------------------------
K7ABL7_9ALTE/6-76--------------------------------------------------------------------------------
E0SMR7_DICD3/9-79--------------------------------------------------------------------------------
C4LCG0_TOLAT/11-81--------------------------------------------------------------------------------
D5QE46_KOMHA/17-86--------------------------------------------------------------------------------
K0C8E2_ALCDB/11-81--------------------------------------------------------------------------------
M4XDA7_PSEDE/11-81--------------------------------------------------------------------------------
H2IXW0_RAHAC/27-92--------------------------------------------------------------------------------
Q2RNE8_RHORT/14-84--------------------------------------------------------------------------------
Q7MZJ1_PHOLL/2-72--------------------------------------------------------------------------------
G7Z9X1_AZOL4/11-74--------------------------------------------------------------------------------
V6F3K3_9PROT/6-76--------------------------------------------------------------------------------
I2B9K4_SHIBC/6-76--------------------------------------------------------------------------------
D3VAK1_XENNA/23-87--------------------------------------------------------------------------------
E6X2R7_NITSE/11-81--------------------------------------------------------------------------------
Q6D8L1_PECAS/2-72--------------------------------------------------------------------------------
G0A2L0_METMM/9-79--------------------------------------------------------------------------------
D6Z0A2_DESAT/12-82--------------------------------------------------------------------------------

PF04221

DINJ_ECOLI/4-84--------------------------------------------------------------------------------
Q9KML3_VIBCH/3-84--------------------------------------------------------------------------------
Q9PBQ9_XYLFA/4-84--------------------------------------------------------------------------------
RELB_HAEIN/5-93--------------------------------------------------------------------------------
RELB_ECOLI/1-78--------------------------------------------------------------------------------
Q9A0Y8_STRP1/13-96--------------------------------------------------------------------------------

PF03693

PARD_XYLFA/1-78--------------------------------------------------------------------------------
PARD1_CAUCR/2-82--------------------------------------------------------------------------------
PARD_VIBCH/1-80--------------------------------------------------------------------------------
PARD1_MYCTU/1-80--------------------------------------------------------------------------------

PF14384

A1AQ37_PELPD/17-82----------------------------------------DAPELTDA.WFEKADLMQGSKLV.................
Q73R28_TREDE/11-81----------------------------------------SDAPKRVAESISLSERIDDFL...................
B0JRR8_MICAN/35-94----------------------------------------DLIPEATGDW.SRAQRGV......................
Q92KN5_RHIME/26-103----------------------------------------DFPELTDE.ELTNMRPARDVLPPEFFKAM...........
Q3J2R4_RHOS4/23-97----------------------------------------DAPEATDA.QLAQARPFTEAFPVLAEA.............
B8F509_HAEPS/13-99----------------------------------------EVRELQAD.DLHQFKPIKDVLPLDFVNLVTTH.......Q
A5GE33_GEOUR/45-107----------------------------------------DNPPLTDE.ELTAARIVR..HG..................
A1WJ32_VEREI/17-83----------------------------------------DAPELGDE.FFERADEYPGDKLV.................
A6WWJ1_OCHA4/29-103----------------------------------------DAPEATDE.QLAKAKPFKEALPEMAAK.............
Q2RSU6_RHORT/41-96----------------------------------------DAAPLADEAWFAQAAIVEP.....................
E3I091_RHOVT/23-97----------------------------------------GNPEWTNE.DFANAKPFAEAFPALAEK.............
Q215B0_RHOPB/13-90----------------------------------------DNPEWTKA.DFARATRFDGIKAKDLTPEM...........
C4K882_HAMD5/42-98----------------------------------------DIPETCEKDW.VGASRGQ......................
Q20YH7_RHOPB/27-93----------------------------------------EIPELTEE.FFARADLYHGGKLV.................
D3SAY2_THISK/33-91----------------------------------------ETREPSED.ETKALRR....V...................
C4KAB9_THASP/30-98----------------------------------------DGSDEDDR.PAAAVELAAGIDAAR................
Q28LR0_JANSC/24-89----------------------------------------KRLEWDLQNHLMDARRIPEAWHEI................
D5X2J5_THIK1/28-104----------------------------------------DNPEWTAE.DFARAKPASEALPPEMYAA............
A8HS57_AZOC5/58-131----------------------------------------DERPRTET.ELALARPFAEALPELVE..............
B1M0P6_METRJ/36-100----------------------------------------EIPELTDA.MLARADFYV..GD..................
A9BQV6_DELAS/27-103----------------------------------------AVPGLRQALQEAKTGQFAAVHTPEQI..............
D5CSA1_SIDLE/6-67----------------------------------------DFTGAKRAKDVAHL..........................
C1DP04_AZOVD/25-95----------------------------------------DADDLYDPNDPTAVDAFWDAATVRR...............
A1WLU7_VEREI/13-87----------------------------------------EVRELTAA.DLRRFKPAHLALPPALQK.............
Q73LQ6_TREDE/25-85----------------------------------------DSPKLTKEQI.ARLRPVHE.....................
A5V5L4_SPHWW/13-90----------------------------------------DNPEWTEQ.DFARARRGDDIPEHIRAAFP...........
A6WZ44_OCHA4/29-94----------------------------------------DAPELTDE.QATQRMTFAEAVRR.................
B0T4V2_CAUSK/34-92----------------------------------------DIPEITDEQW.ATAFRPG......................
B6JFY4_OLICO/17-84----------------------------------------DAPELDDD.FFDRAEIREGDKIIR................
Q8KUW1_SYNE7/45-104----------------------------------------DSPDATELMRAALQQK....R...................
Q0KBY4_CUPNH/27-90----------------------------------------DTYEVSAK.EMQAMKPLGK.RG..................
B6IVZ4_RHOCS/9-71----------------------------------------DAPDLSAPEWQRKFAQARR.....................
Q2KVN5_BORA1/5-79----------------------------------------DSPEWGEA.ELARAKPASEVLPTAFQA.............
Q39RZ9_GEOMG/16-77----------------------------------------DFTDAEPVSETPVL..........................
A8GIR2_SERP5/28-84----------------------------------------DAPTLSDEKW.GTALQGR......................
A9IES8_BORPD/41-97----------------------------------------DIPPLTAEFW.KTAERGK......................
A1VRX0_POLNA/13-87----------------------------------------EVRELTAE.DMRRFKPAHEVLPLELQK.............
Q31JV0_SYNE7/18-82----------------------------------------DLPELTDE.MLSRAVLKQGGKR..................
A1WB35_ACISJ/28-89----------------------------------------DARPFTDA.EWEQVKPLAR.R...................
B2ICD8_BEII9/27-96----------------------------------------DDFEPTDE.ELANARPFAEVFPH.................
Q73L16_TREDE/8-67----------------------------------------DCPPLTKEQIKEFARIAKEQR...................
C3M8F8_HAMD5/13-85----------------------------------------EVRELKEEDFALMRPAEEVLPLSLL...............
C7RRD3_ACCPU/30-92----------------------------------------DAQPLTPAQLKAMVPLRSL.....................
B6IW20_RHOCS/40-99----------------------------------------EMPEVHD..W.SRARRGPP.....................
A8LQR3_DINSH/3-99----------------------------------------DLPPHPLWSDAKGETRAQRLARERLTLHLHGLERDDAWAG
C4KAB3_THASP/28-89----------------------------------------DAIPYTDA.EWEAAKPTIR.C...................
A3N0B8_ACTP2/11-88----------------------------------------ENPEWTDEDF.KNALTFEQMPPALQAL.............
D4ZU97_ARTPN/29-87----------------------------------------DCPEITPEMV.TKAVVR.......................
K9XMQ0_9CHRO/29-86----------------------------------------DCPEITPEMF.AKAVVRRG.....................
Q2L2E1_BORA1/28-86----------------------------------------DTYELSAADLKQMKRMGR......................
Q63NA3_BURPS/28-88----------------------------------------.TFEVPAEDFAKMTRRGKR.....................
Q6N573_RHOPA/22-88----------------------------------------DAPELLDE.FFRTGEIRVDGKI..................
Q7CI23_YERPE/12-90----------------------------------------DNPEWGEAEF.ARARPATEVFTELFGKE............
Q7CP71_SALTY/37-93----------------------------------------DIPASEDGQW.SEAVRGK......................
Q9PD17_XYLFA/28-105----------------------------------------DARELDSQ.WHKGAKLACEAFSPEIYT.............
V6F518_9PROT/28-104----------------------------------------DSPELTDANF.ANARPASEVLANYLGAT............

PF07764

T0VBY9_9ENTE/1-69------------------------------------------------------------------------------M.
I3U5Z1_ENTFC/1-71------------------------------------------------------------------------------MI

PF17414

F4HAL0_GALAU/88-147--------------------------------------------------------------------------------
MATP_PHOPR/88-147--------------------------------------------------------------------------------
MATP_HAEDU/88-147--------------------------------------------------------------------------------
M1S7Y5_MORMO/88-147--------------------------------------------------------------------------------
Q5E5A7_VIBF1/88-147--------------------------------------------------------------------------------
MATP_VIBTL/88-147--------------------------------------------------------------------------------
I2BAK8_SHIBC/88-147--------------------------------------------------------------------------------
E0WTV2_9ENTR/88-147--------------------------------------------------------------------------------
M4R6X9_BIBTR/88-147--------------------------------------------------------------------------------
M9WUL5_MANHA/88-147--------------------------------------------------------------------------------
Q2NU72_SODGM/88-147--------------------------------------------------------------------------------
B4EVD5_PROMH/88-147--------------------------------------------------------------------------------
A6VPA7_ACTSZ/88-147--------------------------------------------------------------------------------
X2H502_9GAMM/88-147--------------------------------------------------------------------------------
MATP_PHOLL/88-147--------------------------------------------------------------------------------

PF16762

C7RVN5_ACCPU/5-80--------------------------------------------------------------------------------
A1TQN5_ACIAC/2-78--------------------------------------------------------------------------------
Q9PHI2_XYLFA/2-78--------------------------------------------------------------------------------
C7JJ67_ACEP3/2-78--------------------------------------------------------------------------------
A4VQ14_PSEU5/2-78--------------------------------------------------------------------------------
M4SBY8_9SPHN/3-78--------------------------------------------------------------------------------
I3Y769_THIV6/5-79--------------------------------------------------------------------------------
R5EAP8_9BURK/2-74--------------------------------------------------------------------------------
Q5P0S5_AROAE/2-78--------------------------------------------------------------------------------
R5PIP0_9BURK/9-86--------------------------------------------------------------------------------
E1VKG4_9GAMM/2-78--------------------------------------------------------------------------------

PF11903

Q4KC28_PSEF5/1-66--------------------------------------------------------------------------------
B4SF37_PELPB/2-74--------------------------------------------------------------------------------
A0QXV1_MYCS2/6-107--------------------------------------------------------------------------------
A9BMX0_DELAS/1-73--------------------------------------------------------------------------------
A6T935_KLEP7/1-66--------------------------------------------------------------------------------
Q7NVK9_CHRVO/1-73--------------------------------------------------------------------------------
A1T476_MYCVP/6-107--------------------------------------------------------------------------------
Q3AQ94_CHLCH/4-76--------------------------------------------------------------------------------
Q1GXH1_METFK/1-73--------------------------------------------------------------------------------
Q2SQH0_HAHCH/2-95--------------------------------------------------------------------------------
Q13JR3_BURXL/1-70--------------------------------------------------------------------------------
Q15VU5_PSEA6/1-66--------------------------------------------------------------------------------
Q0RY55_RHOJR/40-141--------------------------------------------------------------------------------
Q220F4_RHOFT/1-73--------------------------------------------------------------------------------
Q47D61_DECAR/1-73--------------------------------------------------------------------------------
Q0C2J2_HYPNA/1-68--------------------------------------------------------------------------------
A7HVP7_PARL1/11-109--------------------------------------------------------------------------------
A4Y172_PSEMY/1-70--------------------------------------------------------------------------------
D0J2S6_COMT2/1-68--------------------------------------------------------------------------------
Q63SV8_BURPS/1-72--------------------------------------------------------------------------------

PF11020

F4F896_VERMA/2-77-----------------------------------------------------------.........IDCQFGTARASF
B3S7R4_TRIAD/8-90-----------------------------------------------------------YNQFNDIPVLSPRISSQQELF
Q2GKE5_ANAPZ/4-84-----------------------------------------------------------VKKF....IIPCEFGGKTSPF
B9KIB3_ANAMF/4-84-----------------------------------------------------------IKKF....IIPCEFGGRIAPF
F7XUD1_MIDMI/1-81-----------------------------------------------------------MKKF....EVPCFFGGSRSVV
Q2GCJ4_NEOSM/1-81-----------------------------------------------------------MKKF....TVPCQFGSQTAPF
K9QB18_9NOSO/702-781-----------------------------------------------------------.KRF....TVPITCGTIKSPF
A5CC80_ORITB/1-81-----------------------------------------------------------MKKL....VINCNFGGQIAPF
Q2GG71_EHRCR/4-84-----------------------------------------------------------IKKF....IVPCDFNGQSSPF

PF15970

B4EVM4_PROMH/3-83------------------------------------------------------------------------------NY
Q0WCU1_YERPE/3-83------------------------------------------------------------------------------SY

PF10784

E1I390_ECOLX/6-77--------------------------------------------------------------------------------
A0A028AHT8_ECOLX/8-78--------------------------------------------------------------------------------
B7T4Y5_KLEPN/5-76--------------------------------------------------------------------------------
D2AJQ5_SHIF2/10-81--------------------------------------------------------------------------------
A7ZGW0_ECO24/8-78--------------------------------------------------------------------------------
A0A026RDF4_ECOLX/8-79--------------------------------------------------------------------------------
A6TIQ1_KLEP7/4-74--------------------------------------------------------------------------------
A7M7F6_9GAMM/10-80--------------------------------------------------------------------------------
A0A143DV46_ECOLX/6-77--------------------------------------------------------------------------------
I2RCP5_ECOLX/6-77--------------------------------------------------------------------------------
A6TIQ1_KLEP7/109-178--------------------------------------------------------------------------------

PF08870

R5X372_9CLOT/4-111--------------------------------------------------------------------------------
B0JNR9_MICAN/7-117--------------------------------------------------------------------------------
K9UL30_9CYAN/9-118--------------------------------------------------------------------------------
K8GJN7_9CYAN/8-118--------------------------------------------------------------------------------
K9XZW3_STAC7/7-117--------------------------------------------------------------------------------
R7K532_9FIRM/4-112--------------------------------------------------------------------------------
D1AEG3_THECD/6-115--------------------------------------------------------------------------------
K9Z1H5_CYAAP/7-117--------------------------------------------------------------------------------
W0E949_9FIRM/5-115--------------------------------------------------------------------------------
V6K4J2_STRRC/5-116--------------------------------------------------------------------------------
K4IEY7_PSYTT/2-118--------------------------------------------------------------------------------
D6CZD3_9BACE/5-107--------------------------------------------------------------------------------
B8FD42_DESAA/6-115--------------------------------------------------------------------------------
A5G4D6_GEOUR/7-118--------------------------------------------------------------------------------
Q82J53_STRAW/10-120--------------------------------------------------------------------------------
L0H1B2_9GAMM/8-117--------------------------------------------------------------------------------
I3Z2Y2_BELBD/5-108--------------------------------------------------------------------------------
K9PPN2_9CYAN/7-117--------------------------------------------------------------------------------
Q11AI6_CHESB/5-115--------------------------------------------------------------------------------
K9YCG7_HALP7/7-117--------------------------------------------------------------------------------
Q2S6R4_HAHCH/5-109--------------------------------------------------------------------------------
Q10Y61_TRIEI/7-117--------------------------------------------------------------------------------
F4L4C0_HALH1/5-110--------------------------------------------------------------------------------
R5HMI8_9FIRM/4-109--------------------------------------------------------------------------------
D4ZRL0_ARTPN/7-117--------------------------------------------------------------------------------
A7I566_METB6/7-112--------------------------------------------------------------------------------
D4ZK78_SHEVD/5-115--------------------------------------------------------------------------------
C1F5K3_ACIC5/21-129--------------------------------------------------------------------------------
C4LF32_TOLAT/5-110--------------------------------------------------------------------------------
K9YIM9_CYASC/15-125--------------------------------------------------------------------------------
E0UFG8_CYAP2/7-117--------------------------------------------------------------------------------
A6Q5M6_NITSB/1-122--------------------------------------------------------------------------------
Q16C14_ROSDO/5-114--------------------------------------------------------------------------------
B1MK94_MYCA9/5-115--------------------------------------------------------------------------------
E0SAH1_DICD3/5-112--------------------------------------------------------------------------------
A8AM62_CITK8/5-110--------------------------------------------------------------------------------
Q3ICW0_PSEHT/11-117--------------------------------------------------------------------------------
R5NP02_9CLOT/11-121--------------------------------------------------------------------------------
Q12MQ9_SHEDO/7-111--------------------------------------------------------------------------------
S6ABQ5_9PROT/5-107--------------------------------------------------------------------------------
K9V144_9CYAN/7-117--------------------------------------------------------------------------------
K7AC95_9ALTE/5-111--------------------------------------------------------------------------------

PF01340

METJ_VIBVY/3-99--------------------------------------------------------------------------------
Q15NT2_PSEA6/6-102--------------------------------------------------------------------------------
K7AFK6_9ALTE/6-102--------------------------------------------------------------------------------
Q489Q2_COLP3/3-99--------------------------------------------------------------------------------
METJ_SALTY/3-99--------------------------------------------------------------------------------
Q5QV41_IDILO/2-95--------------------------------------------------------------------------------

PF07181

VIRC2_AGRFC/1-200MGIRKPALSVGEARRLAAARPEIVHPSLPVATQNSTLPQPPENLDEEDRRPAPATAKRCHSSDQQSMLTVDALSSTTAPE
Q2K2E4_RHIEC/1-199MGIRKPALSVDEAKRLAAARPGIIHPDLQHFSRDAAAPRLPQRAGHEERRTTSALAKR.SGPESQSIRTVDALNSSTAPE
B9K406_AGRVS/3-202MGIHKPALSVGEAKRLAAARPEIVQTVPTRFSQGAQPPRLPER.GRPLDRPLPTAAKRRDNFDRQLVLTADALSSAAAPE

PF11423

M1RN95_MORMO/53-80--------------------------------------------------------------------------------
RMNT_BPP22/53-80--------------------------------------------------------------------------------

PF10802

Y366_METJA/14-87--------------------------------------------------------------------------------
Q6LZ85_METMP/6-80--------------------------------------------------------------------------------
Q6M002_METMP/6-80--------------------------------------------------------------------------------
D7DQS3_METV3/5-78--------------------------------------------------------------------------------

PF08972

Q6N1R0_RHOPA/3-76--------------------------------------------------------------------------------
Q73QJ0_TREDE/2-73--------------------------------------------------------------------------------
Q20YW9_RHOPB/21-94--------------------------------------------------------------------------------
A0ZK26_NODSP/6-80--------------------------------------------------------------------------------
Q5SJJ5_THET8/3-73--------------------------------------------------------------------------------
Q21AP4_RHOPB/7-78--------------------------------------------------------------------------------

PF08681

Q8E866_SHEON/19-95--------------------------------------------------------------------------------
Q7N880_PHOLL/12-90--------------------------------------------------------------------------------
Q7N7Z2_PHOLL/8-88--------------------------------------------------------------------------------
Q92P91_RHIME/11-90--------------------------------------------------------------------------------
B3EP86_CHLPB/11-90--------------------------------------------------------------------------------
Q7NIQ1_GLOVI/13-92--------------------------------------------------------------------------------
Q7NLC6_GLOVI/11-90--------------------------------------------------------------------------------
B4SB08_PELPB/10-88--------------------------------------------------------------------------------
Q5P620_AROAE/9-88--------------------------------------------------------------------------------
Q2SAN8_HAHCH/11-89--------------------------------------------------------------------------------
C1DE12_AZOVD/13-92--------------------------------------------------------------------------------
Q8ZL97_SALTY/13-91--------------------------------------------------------------------------------
Q8XPL2_RALSO/16-98--------------------------------------------------------------------------------
Q6LIX8_PHOPR/32-112--------------------------------------------------------------------------------
Y420_HAEIN/9-88--------------------------------------------------------------------------------
Q5P632_AROAE/5-83--------------------------------------------------------------------------------
Q5NX70_AROAE/9-88--------------------------------------------------------------------------------
Q7N6D8_PHOLL/7-86--------------------------------------------------------------------------------
Q7N0J5_PHOLL/11-90--------------------------------------------------------------------------------
Q6ZEG7_SYNY3/12-91--------------------------------------------------------------------------------
Q87ZN7_PSESM/15-103--------------------------------------------------------------------------------
Q3SNN6_NITWN/19-98--------------------------------------------------------------------------------
Q9KM95_VIBCH/57-136--------------------------------------------------------------------------------
Y4AR_SINFN/23-102--------------------------------------------------------------------------------
O05910_MYCTU/74-152--------------------------------------------------------------------------------
Q7N3R4_PHOLL/22-101--------------------------------------------------------------------------------
I6XFC2_MYCTU/72-148--------------------------------------------------------------------------------
Q8P668_XANCP/14-88--------------------------------------------------------------------------------
Q8ZKC7_SALTY/14-88--------------------------------------------------------------------------------
Q8ZMH5_SALTY/14-91--------------------------------------------------------------------------------
Q9PHI1_XYLFA/6-80--------------------------------------------------------------------------------

PF05534

Q7N3F9_PHOLL/54-104--------------------------------------------------------------------------------
Q88MT9_PSEPK/54-104--------------------------------------------------------------------------------
Q6A7R8_PROAC/60-110--------------------------------------------------------------------------------
Q73YB6_MYCPA/53-103--------------------------------------------------------------------------------
Q7N8L4_PHOLL/59-111--------------------------------------------------------------------------------
Q92KT7_RHIME/1-48--------------------------------------------------------------------------------
Q6MB72_PARUW/52-102--------------------------------------------------------------------------------
Q7VMR2_HAEDU/57-107--------------------------------------------------------------------------------
Q7MY97_PHOLL/58-110--------------------------------------------------------------------------------
Q88G27_PSEPK/52-102--------------------------------------------------------------------------------
Q73J27_TREDE/55-105--------------------------------------------------------------------------------
Q8YLM2_NOSS1/53-103--------------------------------------------------------------------------------
Q73KK4_TREDE/52-102--------------------------------------------------------------------------------
Q92XZ7_RHIME/54-104--------------------------------------------------------------------------------
Q73QG2_TREDE/62-112--------------------------------------------------------------------------------
Q9RZI7_DEIRA/54-104--------------------------------------------------------------------------------
Q8XYR1_RALSO/55-105--------------------------------------------------------------------------------
A1RCN0_ARTAT/63-111--------------------------------------------------------------------------------
Q9PCT7_XYLFA/64-114--------------------------------------------------------------------------------

PF09386

Q7N4K2_PHOLL/1-79--------------------------------------------------------------------------------

PF12651

A6LT47_CLOB8/12-55--------------------NR---EPFSTTVNLNYNNLLSEL--S------------E-KTR---I---AKSKLTD---
Q1D537_MYXXD/6-49--------------------RL---TSVVFRLNREKLDALKDL--S------------R-TTR---I---RQSEYLR---
Q08NJ8_STIAD/30-73--------------------EV---VSTHVLVAEEQVQKLREL--S------------R-RTR---I---AQSEYLR---
Q04FI1_OENOB/1-44--------------------MK---QETTFTLEDNLVQKLNTI--S------------K-ETS---I---PRSELVE---
A5N8S1_CLOK5/8-51--------------------NR---TRIYNAVDTILYTKLMQL--S------------K-EIM---I---PISKLLD---
A7HBK6_ANADF/4-47--------------------KK---LSTTVYITPEQDERLKLL--H------------E-RTR---V---PVAEYIR---
Q9YEP4_AERPE/2-45--------------------AK---RRFGVSIPEDLAQRLDEA--S------------R-RLG---V---ERSRLVE---
A2BMU8_HYPBU/1-44--------------------MK---RRFGISINESIAKMLEVL--S------------N-QTG---V---NRSRLIE---
B2TQ69_CLOBB/8-51--------------------TR---ERYSASFDKELLASLKDL--S------------K-ETM---I---PLSKLLD---
C3AQ62_BACMY/106-149--------------------EK---KKRTFSICTEILEKLDAV--S------------A-ATG---I---HKSRIVE---
Q17ZT4_PEPD6/4-47--------------------NR---VRFSSSTKPDLFEKLKQL--S------------E-QTR---I---PLTKLID---
A9GWZ6_SORC5/4-47--------------------KK---VSTTIYITPEQAERLKIL--H------------E-RTK---V---PIAVYIR---
E3FMN1_STIAD/4-47--------------------KK---ISTTIYITPEQYELLKAL--N------------Q-KTK---V---PVAEYIR---
Q2II40_ANADE/24-64--------------------..---EPMLVRLPPALAAELRNL--A------------R-KTR---V---RQSDYLR---
Q8XP25_CLOPE/8-50--------------------NR---TPVGSAMDNKIYYEMKAY--S------------E-KTG---I---PISKILD---

PF01402

YIIE_ECOLI/6-43--------------------------.VFLHLSEEAIKRLNKL--R------------G-WRK--.V---SRSAILR---
VPB20_MYCTU/3-41--------------------------RLQIYIDEDVDRALAVE--A------------R-RRR--.T---SKAALIR---
Q9YBV4_AERPE/3-42--------------------------LVTVKMPEMYVKGIDEL--V------------R-AGR--YS---SRSEVIR---
Q8ZX60_PYRAE/47-86--------------------------LISVHVPKKMLEELDEL--V------------R-RGI--FP---NRSEAIR---
P72681_SYNY3/21-59--------------------------QTTIRLESKMMERLTKL--C------------A-KEG--.L---SREVLFE---
Q8ZWZ9_PYRAE/10-49--------------------------LISFHVPRSYVEVLDEL--V------------R-MGV--YP---SRSEAIR---
NIKR_CHLTE/6-45--------------------------RFGISLERKLIESFDRH--I------------K-AQG--YQ---SRSEALR---
Q877Q4_PSESM/12-50--------------------------RIEIRCTEEDAALIREK--A------------L-AAE--.I---SVSDLMR---
Y4KO_SINFN/4-42--------------------------AFTVRVKDETASKLDQL--A------------E-KLD--.R---SRSYMAA---
VPB19_MYCTU/2-40--------------------------RTQVTLGKEELELLDRA--A------------K-ASG--.A---SRSELIR---
O28529_ARCFU/6-44--------------------------RVTIALDDESVKIFEEL--K------------K-ELG--.L---SQSEIIR---
Y080_METJA/3-41--------------------------RISLTIEKNLLKEVDEI--I------------N-KER--.I---SRSEFIR---
PARD2_CAUCR/12-50--------------------------SLSIELDSDLDRRLSEI--A------------E-GMD--.Q---PKTAIIE---
O30230_ARCFU/6-44--------------------------RITISLSEDDMKLIEEL--R------------R-DSG--.D---SLSKIFR---
O29882_ARCFU/4-42--------------------------RLSVSLDDKSKEKLEKM--R------------K-MTG--.K---STSELIR---
NIKR1_METTH/3-42--------------------------VVSVSLGEKLLEEIDAL--R------------D-ELG--FS---GRSDVIR---
Q9I707_PSEAE/4-42--------------------------VVSFRADDALVAALDEL--A------------R-ATH--.R---DRPYHLR---
E51_SSV1/12-50--------------------------RLNISISEETYETLQRL--K------------A-KTG--.K---TMGQLIE---
Q88JZ4_PSEPK/2-40--------------------------ATSIKIDDDLKGRIQHL--A------------C-LRQ--.R---SSHWIMR---
Q888D4_PSESM/12-50--------------------------NLKLRCLPEEADQIKEK--A------------I-DSG--.V---SISEFLR---
O30109_ARCFU/6-44--------------------------RLSVAVDDSIVEILEKL--T------------A-VEN--.K---TVSDIIR---
NIKR_HELPY/12-51--------------------------RFSVSLQQNLLDELDNR--I------------I-KNG--YS---SRSELVR---
Q8EGZ2_SHEON/6-44--------------------------PVSVKLDADIKARVEHL--A------------E-TRK--.R---SSHWMMR---
G7YYF2_CLOSI/3-42--------------------------RVTITLDDDLLETLDSL--S------------Q-RRG--YN---NRSEAIR---
YBFE_ECOLI/52-88--------------------------RVELKLNAEAVEALNEL--A------------E-SRN--.M---SRSELIE---
Y298_MYCTU/6-41--------------------------.ISVTVDAAVLAAIDAD--A------------R-AAG--.L---NRSEMIE---
VPB10_MYCTU/3-39--------------------------RTNIYLDEEQTASLDKL--A------------A-QEG--.V---SRAELIR---
Q327A8_SHIDS/14-51--------------------------.ITAHVPLPMADKVDQM--A------------A-RLE--.R---SRGWVIK---
Q3IQM5_NATPD/4-41--------------------------RVTVSLDDDTAAALEQL--D------------D-ETG--.A---GQSEIVR---
Q8U3E4_PYRFU/7-45--------------------------.ISVQLPQSLIHGLDAL--V------------K-RGI--YP---NRSEAIR---
S6AY38_PSERE/10-47--------------------------.VTAHVPVQLAEKVDLM--A------------E-RLE--.R---SKNWIVK---
V5UCU1_9BURK/15-51--------------------------..PIRCYEDEEALVRER--A------------R-DCG--.M---SVGQFVL---

PF07878

Q1QQP0_NITHX/90-130---------------------S---VRINVTLPADVLEQIDRH--A------------A-SEG---F---TRSGFLA---
Q7U858_SYNPX/33-75---------------------S---ERINVTLPRGVMDELKRH--A------------L-EEG---R---SCGNLAA---
A5GQX8_SYNR3/18-60---------------------S---PRIQVVLPEALLERLAVA--A------------D-QDS---R---TVSNMAK---
E8SHU9_STAPH/6-48---------------------N---TRISVTVSKDNRDKLKEL--A------------K-KEN---R---SMSNMVE---
A5GKY5_SYNPW/33-75---------------------S---ERVNVTLPAGVMNRLKQQ--A------------L-AEG---R---SCSSLAT---
F4BUC1_METCG/7-49---------------------S---KRVAVTLPDDAREFLEQE--A------------K-ETG---V---PLSNLMS---
B7JWD3_CYAP8/2-44---------------------S---KRVYLTLPDKVYEALERW--A------------D-EQG---R---PVANLAA---
A8ZLB3_ACAM1/15-57---------------------M---TRINITVPEDLLEEFKEY--C------------D-SQV---R---SVSSQIQ---
D7E5Q5_NOSA0/6-48---------------------G---KRVNVTFPVEVYERVAGL--A------------S-DET---R---TVSQMIV---
Q46HT9_PROMT/14-56---------------------S---PRIQVVLPEDLCERLSEL--A------------E-RES---R---TVSNMAK---
B1X2B8_CYAA5/9-51---------------------G---KRISITLSDEILEDLEIW--A------------Q-QRG---Q---TVAGLAA---
Q7VEB2_PROMA/14-56---------------------S---PRVQVVLPEELCAQLTFL--A------------K-KES---R---TVSNMAK---
Q7NMR8_GLOVI/20-62---------------------L---DRVVAYVPTELKKELEQW--A------------E-AEE---R---SVSWLVA---
E0UNJ6_CYAP2/6-48---------------------S---KRLNLSLPEHLYDDLRIW--A------------D-HQG---R---SMANLAN---
Q8YK09_NOSS1/15-57---------------------T---KRTTIVLPDAVYEDLQLW--A------------D-EEG---R---ATANLVA---
K9VLV1_9CYAN/8-49---------------------.---GRVTAYLPEEIQKALEEW--A------------E-EDS---R---SVSSLAT---
K9VLX7_9CYAN/14-56---------------------S---PRVAFYPPPEIKEKLEKL--A------------S-IER---R---SISQMAL---
Q7V237_PROMP/82-124---------------------S---NKVQISVPSNLNYLLKVW--A------------A-AEG---R---DLSSVAF---

PF15919

F8GGR0_NITSI/3-126YKG..WVWAVVTIDLAELSDKV---ERINITLPSRVLRRIDAA--A------------K-EAG...E..-SRSGFIA---
F2JW02_MARM1/3-127FAD..GIWAVASVDITPLLGKS---EKINVTLPHLLISKIDKA--V------------A-SNPQ.YK..-NRSAFLA---
E1VAV2_HALED/3-129YKG..WVWATVEVDITPYLGKS---HKINVTLPELLIKRIDTA--V------------A-KQGDVYQ..-SRSGFLS---
B8GTR2_THISH/3-126YKD..WIRAMVDIDMSRIQGPA---QRINITIPKRVLRAIDAA--A------------A-RAH...E..-TRSGFLA---
F4HBU2_GALAU/3-128FEG..FTFTFVDVDLSHLMGKA---EKINITLPALLLHKIDAF--I------------A-THPE.YK..-SRSGFLA---
F7QNQ0_9BRAD/4-124NRD..GVAVLIAAP..PVSVKS---VRVNVTLPSDVLEQIDQY--A------------E-REG...F..-TRSGFLA---
D8MUK4_ERWBE/3-128YAG..YTWALVDVDLARLLGGT---EKINVTLPKSLIDRIDRC--V------------A-THPE.FK..-SRSGFLA---
G8M697_9BURK/3-126FAG..AIWAYVEVDLSKLDARP---ERINISLPRFVLHKIDSY--V------------E-ARH...E..-TRSGFLA---
D5BWS5_NITHN/3-123FEG..GVWMMVDIDFSRVRPKA---VRINISLPEALVRRIDEY--A------------K-AHQ...M..-SRSGFLA---
Q98J17_RHILO/4-124NRD..GVAILVAAKTE..ARKA---VRINVTLPDDVLRRIDAF--A------------E-AHG...Y..-TRSGFLA---
E6WDB3_PANSA/3-127CQN..GIWAYVDIDVSKYDGKA---VKLNITLPQNLLVRIDTF--V------------E-THK...EFN-SRSGFLA---
A1VQL9_POLNA/3-127FDG..WLWALVKVDPAMLDDTV---ERVNISLPRRVLRRLDAR--A------------R-TAG...E..-TRSGFIA---
Q63NA5_BURPS/3-126YAG..AVWALVSVDLSQLDSKP---ERINVSIPRFVLHKIDAY--V------------A-SRH...E..-TRSGFLA---
B4ET85_PROMH/3-129YNN..GIWLLVDVDMDKYDGRA---ERINITLPHRLLSRIDTI--V------------K-TNP...EYG-SRSGFIA---
A5GAH3_GEOUR/3-123YQG..GVWLLVDIDLSKLKVKA---KRVNITMSENLLHEIDRY--A------------E-QYH...M..-TRSGLLA---
Q1LPG4_CUPMC/14-137YAD..AIWALADIDMSKLDARP---ERINISLPRFVLHKIDMF--V------------E-RRH...E..-TRSGFLA---
A8GFZ4_SERP5/3-129LNG..GQWLLVDINMDKFDGRA---ERINITLPHRLLNRIDSM--V------------Q-QHPG.YG..-SRSAFLA---
Q7N448_PHOLL/3-129YAG..WAWAVIDIDVEPYLGKS---TKFNVTLPDLLSKKIDDQ--V------------K-ASPNLYK..-NRSHFLQ---
Q5HXI2_GLUOX/3-126YQG..WTVGIVTIDPAILDDRV---ERANISLPRRVLERLDAL--A------------R-ASR...E..-SRSGMIA---
F4GPE1_PUSST/3-127YDG..WIWAIAEVDPALIDDTT---ERVNITLPRRILALLDQR--A------------K-SAG...E..-SRSGYIA---
B8DM26_DESVM/3-123ARD..GAVLLADIDLSFLDTTS---VPVNITMPVHIRNTIDRA--A------------K-ARG...M..-SRSAFMV---
A9H9S0_GLUDA/10-135WSGPEWIWGFASVDPTLFDDTS---ERVNITLPRRVLARLDSR--A------------K-DAG...E..-TRSGFIA---
F9ZMS1_ACICS/3-126FSG..WIWAVVPVDLAKLSDRV---ERVNITLPARVLRRIDAA--A------------R-AAG...E..-SRSGYLA---
YO14_BPHC1/3-126YKD..FIVTVVDVDLTHLMGKA---EKINITVPALLLHRIDQF--I------------A-THPE.YK..-NRSNFLS---
Q5F6D2_NEIG1/4-126YHG..ATWVMIEIDPAKISRQQ---IRFNVSWPQYLLDRVDEY--T------------S-ANH...E..-TRSGFLA---
Q7VZH1_BORPE/3-127FAN..WIWAIADVDPAVLDETV---ERVNITIPRRILKRLDDR--A------------R-AAG...E..-SRSSYIA---
Q9A3L8_CAUCR/4-124NRD..GVVILVPLK..TVQPRT---VRVNITLPETTLREIDAF--A------------E-TYG...Y..-TRSGLLA---
W8KT83_HALHR/3-127FAG..WGWGLVEIDITPYLGKT---EKINVTLPGRVVKQIDQY--V------------S-LHG..IK..-SRSAFLT---

PF12441

Q30QH6_SULDN/2-80TDFFDVKSAKVVRF.SKLKKST---KTISLRLPEDMLETIKVR--A------------N-ALD---I---PYQSFIK---
B0JXE6_MICAN/7-82GEF..ESELPEVNFDVDLKKKH---YLV..AIDADLMVKLLEV--A------------R-EQQ---I---SVEMLVN---
B4SES2_PELPB/3-79SEY.DFSGMVPMRF..ELKRKD---TSISLRLPEELLNEVRMN--A------------K-RLG---I---PYQRFMR---
A6QAG9_SULNB/5-83SEFIDWENVRSVRF.PNLKKST---RSISLRLPEDMLERLKSR--A------------N-AMD---I---PYQSYIK---
C1F1N0_ACIC5/3-81TEFVDWSKAEHKKL.PNLKPTL---RTISVRLPVAMVEDLKIL--A------------H-QRD---V---PYQSLMK---
B4SF55_PELPB/6-84TEFVDWNKAGKALF.PNLKPTM---KTISLRLPEPMLNHLKIL--A------------N-ERD---V---PYQSLLK---
A4SVJ8_POLSQ/6-84SEYFDLSKAVRVTM.PNLKPTT---ASISLRLSQSFLENIKLQ--A------------N-KLD---V---PYQSLMQ---
A1BIF8_CHLPD/6-84SEYIDWEKAGTAIF.PDLKPTM---KTISLRLPEQMLNRIKVL--A------------N-ERD---V---PYQSLLK---
B1WWY8_CYAA5/9-85TDY..LDDFETVQLEAELQQRH---FEV..EIDEDIMEVLSQQ--A------------Q-KKG---V---AISQLVN---
B8GRA9_THISH/6-84SEYLDLSQAVPTSL.PNLKPST---KTISLRLPVSLLERIKIE--A------------N-KRD---M---PYQSLIK---
P72819_SYNY3/56-132TDYLVPENFTKTTF..EFAPKD---KSITLRLSSELLTAVKNT--A------------S-AQG---M---NYQKYIR---
A5GA05_GEOUR/6-84TEYVDWSQAKRVTL.PNLKPTT---QSISLRLPVSLLESIKSA--A------------N-SRD---V---PYQSLIK---
C7LN80_DESBD/6-82SQY.DLSGFKPMQF..EIEPKA---AALNMRIPVGLLEAVKAK--A------------K-AKG---I---PYTRYVR---
Q01SA6_SOLUE/7-85TEYIDWPTGRQVKF.PNLKPAL---RTISLRLPVYMLEDLKIL--A------------N-KRD---V---PYQSLLK---
C3KQS7_SINFN/6-84SDYVDWSKAASVRL.PNLRPSS---TSISLRLPNTLLERIKVA--A------------A-KRD---V---PYQSLIK---
Q9AAV5_CAUCR/3-77SDL.NFSQFKPMRF..ELEKKE---ARVNMRLPEPLLEAVKKR--A------------S-ARG---I---PYQRFIR---

PF13467

I3THE1_TISMK/5-68------------LINRNVVVEG.--RRTSIRLEADMWDALTEI--C------------Q-REG---C---RIHELAT---
A1B158_PARDP/15-82------------SRTHSLRIDG.--VATSIRIENHFWDTLAEI--G------------A-RDG---M---TVAQLIT---
Q2W502_MAGSA/68-131------------LICRNIRVKG.--KRTSVKLENEFWNALEIM--A------------D-EAH---C---AIDDLCE---
U4KIB5_9VIBR/16-83------------.ISRSVRLGG.--HSTSVRLEAKFWTIIDDI--A------------E-KQH---M---TTGQFLS---
D7A937_STAND/16-83------------.RLKSVRLNG.--FSTSVRLENLYWQVLDEI--A------------Q-RDG---M---SLPQLLA---
Q47K48_DECAR/15-83------------SRARSIRIHG.--FVTKIRLENLFWDILAEL--A------------G-NEG---M---TTNQLIA---
B8EK53_METSB/15-83------------CQTRSVRLGG.--HVTSIRLEALFWQVLEKL--A------------A-SEG---S---TLGRLLT---
V6F6E9_9PROT/28-96------------SVARSVRIGG.--VVTSIKVERHFWQILEDI--A------------A-EGG---L---SLPQFLT---
I3TNF1_TISMK/9-73------------VEKRSVSIQG.--HRTSVSLEAPFWRVLKRA--A------------R-ARG---I---SLGALVA---
S6AZN1_PSERE/15-83------------SRSRSLRIRG.--VVTTLRLENQFWDILREI--A------------E-VDG---M---TTNQLIT---
B4RFD6_PHEZH/4-67------------LKKRSVLLSG.--HATSIALEPEFWAVLDEM--A------------R-ARG---V---SLAALIV---
A4Z0Q4_BRASO/15-82------------SQTRSLRIGG.--HSTSIRLELAFWDTLEEI--A------------A-KEG---M---SVAKFVT---
Q8EH51_SHEON/15-83------------LKTRSIRIDG.--VVTSVRLEAIFWQIIEEI--A------------E-DAE---L---SVAVFLT---
Q1QJT3_NITHX/17-80------------VVKRSVIVGG.--HKTSVSLEDAFWTSLKDI--A------------M-RRG---M---TLSTQIA---
U4K818_9VIBR/15-83------------LKTRSIRIDG.--VVTSIRLEAIFWQIIEDI--A------------K-KSE---L---SIGAFVT---
R5XT33_9PROT/6-68------------..NRVISIYN.--RKTSMRLAPAEWEAIDTI--C------------R-REN---I---KRKKLFE---
D7A5S3_STAND/15-83------------SQTRSVRIGG.--HSTSIRLEAAFWTVLEEV--A------------A-HQG---M---SLGKFVT---
A5FXC9_ACICJ/3-65------------LEKRSLSLSG.--HRTSVALEPEFWTALEAA--A------------A-RRG---V---ALGTLVG---
D4ZC71_SHEVD/15-83------------PIQKSIRIQG.--HVTSISLEKLFWDLLDQI--A------------E-SQG---V---KRNQFIA---
K7SD13_GLUOY/4-66------------LIKRSLSLSG.--HRTSVALEPEFWAVLDQM--A------------A-HQN---L---SFSALVA---
G2KLR8_MICAA/1-64------------MRKHSVKIAG.--HQTSITLEDEFWAALQSI--A------------R-TRA---Q---TINDLVT---
G8PTZ2_PSEUV/3-67------------LKKRSITLHG.--HRTSITLEPEFWSGLEDL--A------------R-SQG---K---NITATIA---
A8IAV7_AZOC5/5-68------------VVKRSIVIAG.--HKTSVSLEDAFWDALKEI--A------------G-QRR---L---TLSDLVA---
Q13WI7_BURXL/15-84------------SRTRSLRIHG.--VITTVRLENLFWDVLHEI--A------------A-REN---M---TTSQFAV---
B2IEK6_BEII9/15-82------------CQTRSIRLGG.--HVTSIRLETLFWRILEEI--A------------A-LEG---T---SLGRFLT---
R5YAT6_9PROT/7-67------------...KVIFIDK.--RKTSMRLANAEWEAIDSI--C------------K-REN---I---KRNNLLE---
F2J384_POLGS/15-81------------PETRRLRLNG.--QSTSIRLERSFWDILDEI--A------------A-SEG---L---STPAFVS---
Q2K3V5_RHIEC/15-83------------STTRSLRIDG.--MVTSVRLENFFWSKLEEI--A------------R-RDG---M---NVVQLIT---
V6F679_9PROT/38-104------------PEKRSVRIHG.--HSTTIRLEQAFWTVLDEM--A------------R-EEG---V---TASALIA---
Q7CXZ9_AGRFC/2-66------------IRKHSATLHG.--HRTSISLEDAFWDELKII--A------------E-RRK---V---SFAALLA---
C3MEF5_SINFN/3-66------------.AKHSATLHG.--HRTSFTLEDAFWQELKSI--A------------K-SRG---M---PLARLIV---
B9JH07_AGRRK/7-71------------IRKHSATLHG.--HRTSFSLEDAFWSELKAI--A------------K-ARG---T---SLAALIS---
Q2YPT7_BRUA2/7-71------------LRKHSVSIRG.--HATSYTLEDPFFKIIEEI--A------------A-ARN---M---TVAALVA---
Q0A5P7_ALKEH/48-113------------.GRRSLRIDG.--HCTTIRLEQAFWSVLEEI--S------------A-EEG---M---TIPEIIA---
A5VF72_SPHWW/4-70------------PVKRSVNIAG.--HATSITLEPPFWDALVRA--A------------G-EEG---V---PLNALVA---
Q2N6Z0_ERYLH/8-73------------PVKRSVEIAG.--HKTSISLEPVFWNMLRAA--A------------E-ARA---V---PINALVA---
B6INS4_RHOCS/2-64------------IKKRSVLVAG.--HPTSVTLEEPFWEALKEL--A------------A-ARG---V---PVGTLIE---
W8RV19_9RHOB/5-69------------PRKRSLTLKG.--HRTSVSLEDAFWTEFQRI--A------------A-ARG---S---SVNDLAA---
A7HVX0_PARL1/14-77------------.IKRSVTIAG.--HRTSISLERPFWDVLKEL--A------------C-TEK---T---SVNELVR---
Q2W7L3_MAGSA/5-67------------PVKRSVKIAG.--HATSVTLEAEFWDCLREL--A------------E-SRG---T---SINQMVA---
A8LPV2_DINSH/15-83------------CTTRRLRLNG.--QSTSIRLENSFWAILDEM--A------------E-AEG---R---STPAFIS---
Q167Q5_ROSDO/15-83------------CTTRRLRLNG.--QSTSIRLENAFWEVIDEI--A------------Q-SEG---T---TAPCFIS---
Q15TD7_PSEA6/15-83------------SRTKSLRIEG.--VVTSIRLENFFWDVLAEI--A------------F-RDD---M---SVNQLIT---
E3I0W1_RHOVT/38-99------------PKKRSLAIAG.--HRTSITLEDAFWRELKAT--A------------E-EQG---R---TVAALVA---
Q167I6_ROSDO/5-69------------PVKHSVTLKG.--HRTSISLEDEFWQELRRI--S------------Q-ENG---K---PINGLVA---
A6X0F5_OCHA4/15-83------------SVTRSLRIDG.--VVTSVRLENFFWWALEDI--A------------A-RDD---L---TVSRLIG---
C5AUK2_METEA/10-72------------.AKRSVMIAG.--HRTSVSLEAEFWTALQEI--A------------Q-ARG---Q---SVQALIG---
R6I0Y9_9PROT/4-68------------LLKRIIIINQ.--RRTSMRLCQEEWNALDDI--C------------R-TEK---T---NRNTLIG---
B8IRU4_METNO/15-83------------CETRSLRIGG.--HSTSLRLETAFWMILEDI--A------------R-QEN---L---SVAKFAT---
B8ELI0_METSB/17-78------------.VKHSLTIAG.--HRTSISLERAFWERLKRI--A------------A-ERG---S---SLAACVA---
G8ARW4_AZOBR/20-92------------LVARTVKLFG.--HPTQLRLEPSYWEALDDI--C------------H-RED---L---TVDELCS---
G7ZBW3_AZOL4/15-83------------ARSRSVRIHG.--MVTSIRLENLFWNVLADI--A------------A-EQG---I---TTNRLIV---
D4YZT3_SPHJU/21-85------------PVKRSVTIAG.--HQTAISLEPIFWQALRAA--A------------A-REG---L---PINALIA---
I0HQZ1_RUBGI/15-82------------SRTRSVRLHG.--VVTSVRLENLHWAVLEEI--A------------A-RDG---L---SVAQLIE---
A9HZ31_BORPD/15-82------------SDTRSLRLHG.--VATSVRLERLFWSVLEEI--A------------A-RDG---M---RVNQLIE---
B0T0E7_CAUSK/20-82------------LKKRSINLAG.--HATSLALEPEFWAVLQAA--A------------T-ADA---I---SIAGLIQ---
B6IVX3_RHOCS/20-83------------.IIRNVTVLG.--QRTSVRLEPEMWDALLDV--C------------R-REG---R---SVHEVCS---
H5WRL6_9BURK/15-83------------QRSRTIRIHG.--VLTSIRLENMVWDTLAEM--A------------E-EEG---C---TTNHLIV---
R6I5L9_9PROT/2-65------------.LKKSVVIANR--HSTSISLEPEFMEELEAI--A------------R-QKG---L---SVNQLVT---
Q88NJ6_PSEPK/37-105------------PVSRSVRLNG.--FSTCLRLEAVYWGILERI--A------------A-ANR---C---SVSAVLS---
Q7VY20_BORPE/16-82------------.QARSLRLHG.--VATSVRLEQLFWDVLEEI--A------------A-RDG---M---RVTQLIE---
Q0KEM8_CUPNH/15-86------------SQSRSLRLHG.--VATSIRLESLFWEVLEEL--A------------R-RDD---M---TVNQLIT---
Q3J4J5_RHOS4/5-69------------PEKHSLTLKG.--HRTSVSLEADFWRAFREI--A------------A-ERG---L---PLNALAA---
B6JB62_OLICO/35-98------------VIKRSVVVDG.--HKTSVSLEDAFWASLKDI--A------------A-RRG---L---SLSMQIA---
G4RFD5_PELHB/1-64------------MRKRSLTIAG.--HRTSIALEPPFWEALQSI--A------------D-ARK---V---SLPNLIA---
Q5LS66_RUEPO/5-69------------PVKRSLTLRG.--HRTSVSLEDAFWRAFREI--A------------K-EKD---M---PINVLAG---
R5XSE7_9PROT/2-65------------.RKFSVIIAGR--HATSISLEDEFYAALCAL--A------------A-ERN---M---TLNKLVT---
A9HBJ7_GLUDA/7-71------------LVKRSLVLSG.--HRTSVALEPEFWSALEEM--A------------R-ARG---L---GVAALIG---
B2U9M5_RALPJ/15-83------------SRTRSVRIHG.--VHTSIRLENFVWDTLAIL--A------------A-DEN---M---TTNALIV---
C6BV10_DESAD/15-83------------QITRSIRING.--AVTSIRIERRFWNILDEL--A------------E-EEQ---T---STGKFIS---
A1WLD9_VEREI/15-83------------QRTRSVRLHG.--VLTSIRLENMVWDILAEI--A------------E-AEG---R---TTNTLIA---
V5SG48_9RHIZ/7-70------------PVKRSFSIRG.--HRTSISLEAPFWDALKQA--A------------A-REG---V---SLASLIA---
D5BP55_PUNMI/2-63------------.KKRSVTIHG.--HRTSISLEDPFWDSLNEI--A------------T-KRG---Q---SLASLIT---
D0IW80_COMT2/15-83------------HRARSIRLHG.--VATSIRLENLFWQVLEEI--A------------A-RDG---Y---TVPQLCT---
V6EZW9_9PROT/2-64------------LKKHSIIIAG.--HASSITMEPAFWDELKKI--S------------E-RDG---V---SINQLVS---
B1M524_METRJ/6-68------------.TKRSVMIAG.--HRTSVSLEDPFWAALRAI--A------------E-ARG---Q---SVQALIG---
G7Z694_AZOL4/2-65------------.QMRNIRVNG.--KRTSMKLMPVEWESLEEI--C------------T-REH---M---TMSELVS---
E8RRH3_ASTEC/4-67------------LRKRSVNLAG.--HATSVALEPEFWVVLETM--A------------K-ERR---I---SLAALIA---
A1VU33_POLNA/15-83------------SRIRSVRLHG.--VATSIRLENLFWDVLGDI--A------------S-RDG---M---SVPQLCT---
Q11GU9_CHESB/4-68------------PKKRSVTIRG.--HRTSFSLEDAFYSELERI--A------------A-AQG---K---PVAALIG---
D9QJB1_BRESC/2-64------------LKKRSVTLAG.--HATSVALEPEFWAVLDGI--A------------A-ERN---L---SHAGLLV---
A2SED0_METPP/15-83------------PRQRSVRIHG.--VITSIRLENLMWRVLSDI--A------------S-EQK---C---TTNALIT---
A1B3A7_PARDP/22-85------------PSKRSVTIGG.--HRTSVSLEDAFWRELREL--A------------R-AGG---R---TTATLIA---
Q5E5I8_VIBF1/19-85------------.ITRSIRIDG.--HATSVKLEASFWETLEEI--A------------E-YQG---L---SVPRFIS---
G8B035_AZOBR/15-83------------MVTRRVRLSG.--HSTSVCLEAAFWGALEEI--A------------A-MQG---V---SLGRFLS---
K7SIV6_GLUOY/15-83------------SRTRSLRIHG.--VVTTIRLENMFWDVLTEI--A------------A-ADG---M---TVNQLIT---
Q28PQ0_JANSC/10-74------------PRKRSLTLQG.--HRTSVSLEDAFWADLQTI--A------------E-GRG---Q---SVNALVA---
Q87MR6_VIBPA/16-83------------.ITRSIRIDG.--HATSVKLESSFWTILEEI--A------------S-AQD---M---TVPKFIS---
R5R7N0_9PROT/5-68------------.ANRIININK.--RKTSMRLCSKEWEALDDI--C------------K-REG---I---NRNRLIE---
Q5NQS8_ZYMMO/14-79------------LVKRSVMIAG.--HSTSISLEPLFWQALEQA--A------------S-KRA---L---PLNALIA---
R5Q8E2_9PROT/4-65------------.KKYSVMISG.--HRTSISLEPEFWEEIKRL--A------------R-EEN---I---SVAALVA---
Q141Z3_BURXL/65-133------------PRQRSVRING.--LATCLRLEEVYWRIIEEI--A------------R-QES---V---TVGKLIS---
R6ITS5_9PROT/4-68------------LSSRVITIHK.--RKTTMRLCKNEWEALKDI--C------------K-REK---I---NRKMLLE---
G2KND8_MICAA/35-99------------LVSRNITVLG.--RRTSVRLEPEMWGALRDI--A------------K-RER---C---RIHDVCS---
Q92NP9_RHIME/6-70------------VVKHSATLHG.--HRTSFTLEEPFWLELKSI--A------------R-DRD---M---PLARLIA---
Q21US4_RHOFT/16-83------------.TTRSIRLHG.--VVTSVRLENLFWDTLEEI--G------------A-RDG---M---TVPQLLS---
W0AMC0_9SPHN/9-75------------PIKRSVTIAG.--HQTSISLEPIFWTALRDA--A------------E-AES---L---PLNALIA---
D5AQD4_RHOCB/5-69------------PRKHSLTLGG.--HRTSVSLEDAFWTGFKEL--A------------A-ARG---L---GLNEAAR---
Q2G3C7_NOVAD/8-72------------PVKRSVEIAG.--HKTSISLEPLFWDMLRDA--A------------A-REG---V---PINALVA---
Q2RS87_RHORT/10-72------------VRKRSVTIAG.--HRTSVSLEEPFWDALKDL--A------------K-ARG---Q---SVNDMVT---
Q0AMZ5_MARMM/17-80------------LLKRSLSLAG.--HRTSISLEPDFWAELDRL--A------------R-DQG---Q---SLASLIG---
A7IN95_XANP2/16-83------------.ETRALRLNG.--FSTSVRLEAFFWNVIEDI--A------------A-RDG---L---SVNRLLA---
E0TDI6_PARBH/6-68------------LIKRSVTLRG.--HRTSVALEAAFWAALDEW--A------------V-RRG---V---PVAQLIL---
S5YGZ7_PARAH/15-83------------PVTRKLRLNG.--QSTSIRLEQAFWDILDEI--A------------I-SEG---Q---TTPGFLS---
B6JB63_OLICO/5-68------------VVKRSIVVAG.--HKTSVSLEEAFWNGMKEI--S------------S-ARG---M---TLSELVG---
A1BB74_PARDP/15-83------------PVTRKLRLNG.--QSTSIRLEQAFWDILDDI--A------------A-GEG---M---ATPAFLS---
Q0BVF8_GRABC/3-66------------LIKRSFSLSG.--HRTSVALEPEFWTMLTNI--A------------S-GQS---Q---TLAQLIA---
B6IXV3_RHOCS/24-88------------LISHNVWVNG.--HRTSVRLEAVMWKSLHEI--A------------E-IEG---T---TIHQLIS---
G8AK62_AZOBR/2-63------------.KKRSVLIAG.--HPTSVSLEEEFWEALKGL--A------------Q-ARG---M---SVNALIE---
R6IQM1_9PROT/1-65------------MRKKSVVIAGR--HQTSISLEDEFYAELAAI--A------------K-EKG---V---SINQLVT---
F2J2A0_POLGS/3-67------------LVKRSLTLKG.--HRTSLALEPEFWQVLDET--A------------R-SRK---A---SLASVVD---
W0PKG2_9BURK/15-82------------CRSRSVRIAK.--VVTSIKLENMFWEVLAEL--A------------R-RDG---T---TTNQLIA---
J7QMW2_METSZ/14-76------------VVKHSVVIAG.--HRTSVSLEDAFWRALKDI--A------------A-QES---V---SLAALIA---
M4S774_9SPHN/4-69------------PVKRSVMIAG.--HSTSISLEPPFWDALVAA--A------------R-AED---I---PLNALVA---
B8IF14_METNO/8-71------------LRKRSVMIAG.--HRTSVSLEGPFWEALQQL--A------------A-ARG---L---SVQALIG---
A8HUM8_AZOC5/15-83------------SVTRSIRIGG.--HITSVRLENTFWTILEEI--A------------A-SEG---S---SVAKFIT---
A8LRP0_DINSH/33-97------------PVKRSLTLRG.--HRTSVSLEDEFWTAFRDM--A------------A-DRN---M---PINALAA---
S5YRV8_PARAH/10-74------------PAKHSVTIDG.--HRTSVSLEEAFWRELRAI--A------------Q-VQQ---T---TPAALIA---
A6WUZ0_OCHA4/15-83------------QINRSVRIGG.--HSTSIQLEATFWRLLDEI--A------------A-SQN---L---TTPRFIS---
G0AAA0_COLFT/37-104------------SRARSVRIMG.--VITTIKLENLFWQTLAEL--A------------A-DND---L---TTNQLIA---
F8J5J1_HYPSM/3-66------------PEKRSFSIQG.--HRTSISLESAFWVALKEA--A------------A-EDG---M---TLAGLIN---
G8AI45_AZOBR/22-97------------.KSMNIMIAG.--RRTSMRLEPTMWDALEDI--A------------R-REG---L---TVNGLCT---
G8ARV8_AZOBR/26-90------------VVTRSLTIGG.--RRASLRLEATIWDGLKDI--A------------K-SQG---K---SLEALCA---
B6IW11_RHOCS/3-66------------SICKNVTVAG.--RRTSVRMEPIMWQCLEEI--C------------R-REG---R---TVHEIVT---
M9R844_9RHOB/9-72------------PAKHSVTLRG.--HRTSISLEPEFWQEFRSI--A------------T-LRN---Q---TLNGLAI---
R6J4D7_9PROT/7-67------------...KVLIING.--RRTSMRLCLSEWCALERI--C------------R-EEK---L---SRNRLIE---
C7JBE2_ACEP3/5-69------------LRKRSLILAG.--HDTSVALESAFWNTLEDI--A------------N-QQK---Q---TLPQLVT---
A6VZH2_MARMS/16-83------------.VTRSLRIDG.--MVTSIRLESFFWFTLEEI--A------------Q-RDK---L---SLSQMIA---
V9VUQ5_9RHOB/5-69------------PKKHSLTLRG.--HRTSVSLEDEFWDAFREI--A------------S-EDQ---R---AINDLAA---
D5BMV3_PUNMI/6-68------------.QKRNIRLAH.--LRTTIVLEPYIWDCISDI--L------------R-RES---I---DLDSFCQ---
R5QX40_9PROT/1-65------------MRKQSVIIANR--HSTSISLEDEFFDELKEL--A------------R-QKD---M---SINQLVT---
B9JXQ8_AGRVS/8-72------------IRKHSISLHG.--HRTSFSLEDAFWQEIRAI--A------------E-NRN---V---AIAALIA---
Q87Y30_PSESM/6-74------------PHSKSVRLNG.--LATCLRLENVYWNILTGI--A------------T-SNE---C---SVNAVLS---
A0KLC1_AERHH/26-94------------CTTRSVRICG.--HSTSIRLENKFWTILEQL--C------------Q-AQG---R---SMGLFLS---
Q98KH2_RHILO/5-68------------.EKRSVTIRG.--HRTSYSLEKPFYDDLVAI--A------------A-ARK---L---TLAALVA---
A5FYB5_ACICJ/15-82------------QTSRSVRLSG.--RSTSVRLERVFWDALGEI--A------------T-AEG---V---SVPRLIA---
D5QBC0_KOMHA/10-72------------LHKRSMMLSG.--HRTSVALEPEFWGALERM--A------------R-ARG---V---GLTILIA---
G2IRZ2_9SPHN/11-78------------PVKRSMTIAG.--HTTSISLEPLFWHALEER--A------------R-AEA---L---PLSALVA---
Q2SKQ2_HAHCH/16-83------------.HSKSVRLRG.--FVTSVRLEQRFWALLEEI--A------------D-SEG---M---STSQFMA---
B2IH09_BEII9/17-85------------IIKHSVTIAG.--HATSISLESAFWDALKEI--A------------E-ART---L---SVAALIA---
Q2K6G5_RHIEC/20-84------------IRKHSATLHG.--HRTSFSLEDEFWAELKTI--A------------A-SRS---M---SLAALIS---
F6IFI2_9SPHN/8-74------------PIKRSVEIAG.--HKTSISLEPVFWDLLKDR--A------------A-AEK---I---PVNALIA---
B2UET6_RALPJ/16-83------------.LARSLRLHG.--VATSVRLECLFWEVLEEI--G------------Q-RDG---L---TVNQLIS---
Q1GGM9_RUEST/6-70------------PKKRSLTLRG.--HRTSVSLEDAFWSEFRRL--A------------A-REG---R---AINELAA---

PF03869

RMNT_BPP22/2-51-------------------ARDD--PHFNFRMPMEVREKLKFR--A------------E-ANG---R---SMNSELL---
RARC_BPP22/4-53-------------------MSKM--PQFNLRWPREVLDLVRKV--A------------E-ENG---R---SVNSEIY---
G3XCY4_PSEAE/13-62-------------------SRTA--DKFVVRLPEGMREQIAEV--A------------R-SHH---R---SMNSEII---

PF07704

Q92LY2_RHIME/1-78P.LYIKDPEVDRLAEELISLTKS--.SKVDAVKDALKHEIAKR--K............A-VLP---VRE-RLAKSLA---
K9Y1V0_STAC7/1-81A.INIKNVEADRLARELSEITGE--.TITEAVIKSLAERLERE--KNKQI........T-PLP---LQQ-ELLNIAQ---
VPB42_MYCTU/1-88S.LNIKSQRTVALVRELAARTGT--.NQTAAVEDAVARRLSEL--DREDRARAEARRAA-AEQ---TLR-DLDKLLS---
C7NJK7_KYTSD/22-102A.LTIKNDRVCDLAREAAQRSGQ--.SQVSVIEQALERYLAD.--.............H-AEP---VGR-RVDEVLA---
Q0BQA3_GRABC/5-87AQLNIKSEDAYVLATELAALTGE--.SMTMAVTEALRERLERE--RRLR.........D-HVS---RLQ-RLTVLAA---
L0DWF9_THIND/1-83A.LNIRNPEADRLAAELAQATGE--.TKTEAVIQAMRDRLDRV--RRER.........G-GTR---LAD-ELDEIAR---
A6WWK7_OCHA4/1-81A.LSIKTDEADRLARELSRLTGE--.TMTDAITQAMRERLDRL--RAERE........A-QRD---YVA-RMKAFVR---
Q2JGF8_FRASC/9-88..LNIKNEEAQRLSRELAELTGE--.TVTTAVLVAVRERLERM--RADRD........E-GEQ---RAA-RIVALGR---
W0ABH3_9SPHN/5-83..LNIKDPEAHRLAQAIAQETGE--.PMTRVVVEALRDRLSRI--ERR..........R-ERA---SVS-ELLAIAD---
A6X7T6_OCHA4/1-81S.LYIRDSAVDELAKKVQKITNA--PSKTEAVRQALQNELKRA--K............D-SIP---LRD-RVKVIQD---
A7IPR5_XANP2/185-260..LQIRDERARVLAEQLAARRKV--.TMTEAVIQALEGELTRE--K............D-KEP---LAS-RLKQIAT---
I6X1P2_PROPF/1-84A.LNIKNKRVCELARQAADRFET--.TQVDVIERALLELLNHE--EK...........V-RQA---RFE-RIMELAG---
I3TVZ0_TISMK/1-81S.LNVKDPEARRLAQAIADATGQ--.SMSRVVTEALRERYARL--RQP..........S-AKA---SVE-ELLAIAD---
I3Y9G9_THIV6/1-75P.LQIANPTVIVKVERLARATGL--.NKTAAVERAVDRLLSEL--E............S-ARP---PAA-SLLAQFD---
Q20ZG7_RHOPB/1-82H.LNIKNDEAHRLATELAELTGE--.SLTAAVTAALREQLVRE--RRRR.........Q-TDQ---AAE-QLMKIGR---
B1M1V3_METRJ/1-75P.LNIRSEEVNQLAEKLASRAGV--.SKTEAVRLALANELERR--E............S-CLS---LAE-RLKPLLD---
G8NNV7_GRAMM/6-85A.LHITNPAVEQKVRSLASVTGE--.SITEAIGAAAEERLIRF--NAAGKN.......L-SSP---SVE-EVLAMIR---
L0J8B6_9MYCO/1-82A.LIIDDPEVERLATEVAAKMGI--.TEIAAICEALRSARRAF--GIV..........Q-RPD---RAE-DLLEVMR---
F2J715_POLGS/1-79P.INVNNPEADALTRKFAHMAGV--.SITDAIVIAMKEAIERR--R............H-EET---PLQ-TAARLRE---
K7S7C8_PROA4/1-82A.LNIKDPDTDRLARELAEETGE--.TLTSALHAALAERLTRV--RRQ..........H-RVS---SRP-DLHHYIE---
B8EP86_METSB/1-76P.LYIKDDTVAELVAELAARRRV--.SKQEAVRQAVSAELERM--A............E-AIP---LRD-RFVRLRQ---
B8IVJ3_METNO/1-83A.LSIKDPETERLARTLAERTGE--.TITVATRKALEERLRRV--GSDA.........R-KAA---LLE-DLAACRR---
C7NLZ4_KYTSD/1-87A.LNIKNERVHQLAREAAALRGT--.SQTSALEAALEEYLERH--AAGRR........S-EDE---RWE-RVTALVD---
C1A9G9_GEMAT/1-83A.INIKSPEAEKLVRELAELTGE--.SITDAIQHAVRERLTRE--RLRKLG.......A-VER---SWS-RVQRIQE---
Y2378_RHIME/1-81A.LYIKDPTVDRMAEKLQERLGV--RTKTDAVRIALQHELDRV--E............D-EIP---LRE-KLAALRQ---
F5XKW7_MICPN/1-83A.LNIKDPETDRLARELAAATGE--.SITVAARRAIEERLERV--RARA.........D-AGS---ASV-DLGDLIE---
L0J8W2_9MYCO/1-78P.LTVEDEEVIRLADDLMQRLHL--PSRIDAIRYALQAQIN..--.............L-TQS---RTE-DLLNVMA---
B0T0U9_CAUSK/24-113G.ILIKNPEAERAVRELADLTGE--.SLTTAIEIAVKERLEAK--RAAAPR.......H-KPR---SVE-EMRAITR---
VPB30_MYCTU/1-83A.LSIKHPEADRLARALAARTGE--.TLTEAVVTALRERLARE--TGRA.........R-VVP---LRD-ELAAIRH---
Q2RUX5_RHORT/1-81S.LTIKDPEAHRLAQAIARATGK--.SMARVVTEALRERYAEI--EHR..........Q-AKA---SVE-ELLAIAD---
VPB36_MYCTU/1-81A.LNIKDPEVDRLAAELADRLHT--.SKTAAIRHALSAQLAFL--ES...........R-AGD---REA-QLLDILR---
I6XS64_PROPF/3-79..LIIDDPRVRAMVDHLAKQRGV--.TATEVIRDAVEQQLTK.--.............D-EQR---RLD-RLAAIEE---
H6RSW2_BLASD/1-87S.LNIKNAEVEDLARRVAAVTGT--.SITAAVAQALREKLARL--QVDSPVD......T-AAH---RAA-RIRAVAK---
Q92TH7_RHIME/9-88A.ININDPQADALTRTFARMAGL--.SIREAIVTAMKEAIDRR--R............N-REK---PLE-TARRLRE---
H6RM61_BLASD/1-86G.LNIKNPETEELARQLADATGE--.NLTRAITVAVRERLDRI--QRRGTA.......A-AAD---RTA-LLQRIAG---
B9JIC8_AGRRK/5-84A.INVNNREADALTRKFAHMAGV--.SISDAIVIAMKEAIAKR--S............D-AET---PHQ-TAMRLRE---
D7A0R5_STAND/1-80A.LFIRDPEVDALAEEVRRLTKA--RTKTEAVRSALKAQLAEA--R............R-AQP---LRK-RLARSKA---
B0SW80_CAUSK/41-123..IQIRNAEVVENIRELARLRGA--.GLTETVEAAVRETLERE--RRHQTASLEGRRAK-VME---TLE-RFWALPR---
A7IPR8_XANP2/1-84S.LNIKNPATVALADELARRQGV--.TKTAAIHQALSERLHRM--GYGDT........A-QAR---LLG-ELRAIRE---
K9Y7X0_HALP7/1-79A.INIKNPDVDRLIQELRAMTGE--.GPTEIVKRALEREYQEL--RRER.........R-QTQ---LAE-NLSKLQE---
L0GTX7_9GAMM/1-83A.LNIRNPETERLAERISELTGE--.TKTAAVTRALRERLERL--QREH.........S-GQS---LAD-RLDAIAC---
D4Z9B0_SPHJU/1-81S.LNVKDPEAHRLAQAIAQATGQ--.SMTRVVTEALRERFARI--ERQ..........K-SKA---SVA-ELLTIAD---
C3KNS9_SINFN/1-79S.LYIRDGAVDELAKQVQQAINA--PNKTEAVRRALLNELERA--R............Q-AVP---LKD-RIKRLQN---
C3KQT0_SINFN/1-80S.LYIRDDDVDALAKKVQQVTRA--PTKTEAVRRALQNELARA--E............Q-AVP---LKE-RVKKIQD---
A6X8D2_OCHA4/6-84..LSVRSSKARDLAHSLAKRTGQ--.PINKLVERALERYDQEL--.............R-QQQ---ALT-PMDALLD---
VPB28_MYCTU/1-80A.LNIKDPSVHQAVKQIAKITGE--.SQARAVATAVNERLARL--.............R-SDD---LAA-RLLAIGH---
Q981I6_RHILO/1-76A.FSVKDESTDAAVRRLAKLKNM--.SLTDTIRDAVEQEYQRS--R............G-AIP---LPQ-RLKALAE---
Q6N2A9_RHOPA/1-82H.LNIKNDEAHQLATELARMTGE--.SLTAAVTNALREQLARE--HRRR.........Q-TDQ---IAQ-RLLKIGG---
Q219N1_RHOPB/1-83A.LSIKDPETERLARTLARLTGE--.NITTATKRAIEQRLSRL--AGPS.........R-KSA---LLQ-EMADIRR---
Q7NGE7_GLOVI/4-85..INIKSDKAYRMANELSRLTGE--.SVTQAITTAIEERLEKI--RAQTRS.......R-REG---IAE-RLLALGT---
A1T4A5_MYCVP/1-80A.LNIKDEKVHDAVKQLARLTGE--.SQAQAVATAVQERLSRV--.............Q-QDD---LAE-RLLALGR---
K0FC64_9NOCA/1-82G.LNIKNEQVHALVREAAERTGM--.TQTGVIEEALKRMLKEL--DA...........E-HET---VLD-DLRTISA---
B1LSI4_METRJ/1-77P.LYVKDPQVDALATQLMALLGT--.SKTDAVRRALQNEIARQ--T............N-RPD---LVA-RTADFVR---
C3KQV7_SINFN/1-83A.LSIKDLETERLAKALAEKTGE--.TITMATRRALEERLRRL--ANAG.........N-RDV---LLE-ELAASRK---
D3PLA4_MEIRD/1-79A.LTVKNPEVERLAEEVARLTGE--.TKTEAIRKALLERKARL--LY...........P-QRP---SKE-SVLEFLE---
L0E2P5_THIND/1-78P.LQIANPEVVRKVDELAKATGL--.SKTAAVGRAVDRMLSEL--GGDA.........R-QAD---RLS-ALLAQLD---
B2IL59_BEII9/1-77P.LFIKDASVDELAAELAHLLSV--.NKTEAVRLALRQALDRE--K............A-TES---LAE-QAVRFCR---
U5QCJ3_9CYAN/4-85..LNIKSDRAYQMATELSRLTGE--.SVTQAVTQAIEERLERM--RGQTRR.......R-RQG---IAR-RLLALST---
C8XHZ8_NAKMY/1-83V.LNIKDPETDRLARELAAEAGE--.SLTVATRRAIEERLSRL--RARK.........R-AND---PDL-GLDEFIR---
Q92RQ4_RHIME/1-83A.LSIKDTETEQLARTLARRTGE--.SITLATKRALEERLRRT--DTAA.........R-RAA---LLE-DLEAIQR---
Q5SKZ1_THET8/1-84A.LTIRNKEVERLAEEVARLAGE--.TKTEAVRKALEMRLREL--.............Q-RKR---SFD-RVIRFLE---
A5FU30_ACICJ/1-78P.LYIRDNATAELVAKLAKERGL--.TKQDAVRLAVQAELDRT--R............E-AKP---LRE-RLREWRE---
Q1QF44_NITHX/1-83A.LSIKDPETEKLARALAQRTGE--.TITVATRRAIEERLKRT--ESQA.........R-KAA---LLE-DMEAMQR---

PF17206

SEQA_MANSM/1-36--------------------------MKIIEVDEELYQYIASQ--T------------K-SIG---E---SASDILR---
W0HVK8_9GAMM/1-36--------------------------MKTIEVDEDLYRYIAGH--T------------Q-HIG---E---SASDILR---
SEQA_VIBTL/1-36--------------------------MKTIEVDEDLYRFIAGQ--T------------E-RIG---E---SASDILR---
SEQA_PSEHT/1-36--------------------------MKQIDIDDELYQYIASN--T------------Q-SIG---E---SASTILR---
SEQA_SHEFN/1-36--------------------------MKYIEIDEELYRFIASK--T------------E-RIG---E---SASDILR---
M4R5K5_BIBTR/3-38--------------------------MKTIEVDDELYHYIASR--T------------Q-VIG---E---SSSDILR---
SEQA_PSYIN/1-36--------------------------MKNIEIEDDLYKYILAN--I------------E-AFG---E---TPSQILR---
J7SKW3_MORMO/1-36--------------------------MKTIDVDEELYSYIASH--T------------Q-HIG---E---SASEILR---
SEQA_PROMH/1-36--------------------------MKKIEIDDELYRYIASE--T------------R-HIG---E---SASDILR---
SEQA_HAMD5/1-36--------------------------MKLIEVDEELYRYIAAH--T------------Q-YIG---E---SASEILR---

PF16777

O25288_HELPY/1-41.......................--...TFYLSKDEHDVLRRL--A------------D-EEV---E---SVNSFVK---
O25010_HELPY/1-73ETRLRGTKNKLGRKPKADANKKT--RAVSLYFSDEQYQKLEKM--A------------N-EEE---E---SVGSYIK---
E7ABM8_HELFC/1-86NTFAKKDKAKPGRKSIPEHLKQK--FVVSFYLSKEEYTILENL--A------------N-QEA---D---SVGFFIK---

PF09957

Q82BL1_STRAW/2-49-------------------------SVTQIDLDDEALAEAMRL--MG.VTT-------K-KET---VNA-ALRDYVA---
Q20X13_RHOPB/8-51-------------------------MRTTIAIDDELFAKAQQY--AG.VKE-------K-SAV---IKK-ALQAYVE---
Q2FLV1_METHJ/1-47-------------------------MATNLAVDDNLISEALVI--GG.CNT-------K-KAA---VTE-ALIEYIQ---
Q58AH0_CUPMC/1-44-------------------------MRTTIALDDELLAKAQAY--TG.LSE-------K-TAI---VRE-ALKALIQ---
Q3JAZ0_NITOC/1-47-------------------------MRTNIDLDDKLLEAAFRC--VS.VKS-------K-KEL---VHL-ALKEFVE---
A1U2W3_MARHV/1-47-------------------------MRTNIVIDDQLMAEALKA--SG.YET-------K-KEA---VEQ-GLKLLVQ---
A1VX34_POLNA/1-45-------------------------MRTTLTIDDQLFARAVAL--AEPGIE-------K-SEL---IRE-CVKAFIQ---
Q7AQ19_MYCLE/3-56-------------------------KKVEIEVDDDLVQEVIRR--YG.LLG-------R-REA---VHL-ALKALLG---
Q73PC1_TREDE/1-47-------------------------MATNLAINEELLDTAYKI--GG.YST-------K-KET---VNT-ALEEFIK---
B3EKM2_CHLPB/1-47-------------------------MRTNIVIDDKLLREAFSV--SD.AKT-------K-KAL---VEE-ALEVLIR---
Q73R95_TREDE/1-44-------------------------MRTTIVLNESKIQQAFAL--TK.IKT-------K-TEL---IEV-AIDNLIK---
Q7NCS8_GLOVI/1-47-------------------------MRTNVELDDALLEEAFQL--TN.VRT-------K-KEL---LQL-ALQELIR---
A8ZTF6_DESOH/1-44-------------------------MRTTLNIEDGLIDKASKM--TG.IKE-------K-TAL---VKL-GLEALIA---
Q7D057_AGRFC/1-48-------------------------MRTNIELDDALIAEAMEI--TG.LPT-------K-KAT---VEK-ALRDLVE---
Q2FNJ2_METHJ/1-47-------------------------MASNLALDDDLIKEAQRI--GG.VKT-------K-KGV---ITE-ALIEYIQ---
A5G896_GEOUR/35-78-------------------------MRTTLNIEDALLEKAAKL--TG.ITE-------K-TSL---VRL-GLQALIA---
A5GB97_GEOUR/1-47-------------------------MATNLAIDDKLLEEARTV--GK.HAT-------K-KAV---VNE-ALAEYIQ---
Q73SG9_MYCPA/11-61-------------------------KKVEIEVDLELVDEAIRR--FH.LAD-------A-REA---VNL-ALRTLLH---
A0ZI46_NODSP/1-47-------------------------MINNIVIDEKLIDDAIKA--TG.IKT-------Q-REV---IEL-GLKTLIK---
Q01QU3_SOLUE/1-47-------------------------MRTNIVIDDKLMREALRV--TG.LKT-------K-RDA---VEL-GLQTLLR---
A4XJM6_CALS8/1-47-------------------------MRTNIILNDELLKKAMEI--AG.VKT-------K-KEA---VEI-ALKEFVE---
Q124P4_POLSJ/1-47-------------------------MITNIDIDEVVVAEAMRL--SG.ART-------K-REV---VDR-ALREMVA---
B1WYD1_CYAA5/1-47-------------------------MATNLEIDDQLIQEALKI--GG.HST-------K-REV---VEA-ALKEYVQ---
B2HSG4_MYCMM/3-54-------------------------KKVEIEIDDDLVQEAIRR--YR.LAG-------P-REV---VHL-ALRTLLA---
B8GLV4_THISH/1-43-------------------------MRTTLNIDDQLLAEAQRI--TG.MTE-------K-AAL---VRE-GLRALIE---
VAPB6_MYCTU/3-45-------------------------.VTQIDLDDEALADVMRI--AA.VHT-------K-KEA---VNL-AMRDYVE---
Y634A_MYCTU/16-68-------------------------KRVEIEVDDDLIQKVIRR--YR.VKG-------A-REA---VNL-ALRTLLG---
VPB15_MYCTU/7-50-------------------------SRTNIEIDDELVAAAQRM--YR.LDS-------K-RSA---VDL-ALRRLVG---
VPB11_MYCTU/7-49-------------------------SRTNIDIDDELAAEVMRR--FG.LTT-------K-RAA---VDL-ALRRLVG---
Q8YSF9_NOSS1/25-71-------------------------MQITLNLDESLLNEAFQL--TN.LTT-------Q-EEL---MNL-ALQEFVR---

PF09274

E5YNK1_9ENTR/1-74TMSFGEHRDLEKVVNS.TPTGKQ--KRVNVNFDEEIHIRFKAA--C------------A-KQG---T---SITDVIK---
Q9F809_ERWAM/1-76KMTFGEHRDLDKVVDSPLPSGKS--KRVNVNFNEEKHTRFKAA--C------------V-KNG---T---SITDVIN---
B0ZE05_ECOLX/1-76KMTFGENRDLERVVTAPVSSGKI--KRVNVNFDEEKHTRFKAA--C------------A-RKG---T---SITDVVN---

PF05509

B8EFN4_SHEB2/13-61---------------------------ITIILTGEYHNKLVNS--C------------E-RSA---RSK-RAEIQLR---
Q4LC31_SODGL/14-62---------------------------ITFKLNQEYTALLYAS--I------------Q-KTG---KSR-SGEVKLW---
B6ESX2_ALISL/7-55---------------------------VNIVMDQKCNHLLNIS--K------------E-TSG---RTK-RNEAAAR---
A7DVG3_VIBVL/13-61---------------------------VNIKLSGKHNQILESS--K------------A-YNS---RTK-RAEAQAR---
B2LS54_9VIBR/10-58---------------------------VNVKLSEKHNRVLEQS--K------------T-HSK---RTK-RAEAQAR---
B8EFW0_SHEB2/41-89---------------------------VNVVLDGKTNEMLEAS--A------------K-RNN---RSK-RKEAQAR---
B6ET57_ALISL/12-52---------------------------LWFELDKETNHLLKLQ--A------------E-RNG---RSK-RAEALAI---
A0A061Q3R7_9VIBR/12-60---------------------------IWFEMDSETNRKLEES--A------------E-FNK---RTK-RQEASFR---
Q7MBP1_VIBVY/10-58---------------------------IWFEMDKETNQRLEAS--A------------K-ENK---RTK-RQEASFR---
A7N8Z3_VIBCB/12-60---------------------------IWFELDEDTNRLLEES--A------------E-AND---RSK-RKEARFR---
Q5DY84_VIBF1/10-58---------------------------IHFQMDKITSNTLEKE--A------------Q-KTG---RSK-RQEAAIR---
A6D5H0_9VIBR/18-66---------------------------VVVVLKGVYAKRLEDS--C------------D-ESG---RSL-RKEAKLR---
Q6LW96_PHOPR/20-68---------------------------VTCFLSSFANKLLEES--I------------G-RSK---RSK-KKEAEIR---
A8QYN9_9GAMM/15-63---------------------------ISFQLSEEANKLLSES--C------------M-RSG---RKK-IPEAALR---
A7N8V1_VIBCB/9-57---------------------------GQLTLDKQTYALLNQA--S------------Q-RSF---RSL-KKEASLR---
E6WK64_PANSA/14-62---------------------------LLVTLSPEMNRELSKA--A------------E-RSG---RSK-SGEARLR---
B2VB54_ERWT9/25-73---------------------------VLLKLTPELTKKLSQA--A------------D-RSG---RSN-TKEAYVR---
B6ICE9_ECOSE/13-61---------------------------VTLLLRRETNEKLVAA--A------------K-AAG---RSK-SLEATLR---
A0A0T7RY16_SALET/14-62---------------------------VSVYLDEDTNNRLIRA--K------------D-RSG---RSK-TIEVQIR---
A0A0U5FL61_SHIFL/14-62---------------------------VLLTLDEETNKLLLGA--R------------E-RSG---RTK-TNEALVR---
A0A0D3RK65_KLEPN/14-62---------------------------VLLILDETTNQKLLAA--R------------D-RSG---RTK-TNEVFIR---
A0A0P8E501_ECOLX/14-62---------------------------VLLVLDDATNHKLLGA--R------------E-RSG---RTK-TNEVLVR---
A0A024KL39_ECOLX/70-118---------------------------LTMRLDDETNQLLIAA--K------------N-RSG---WCK-TDEAADR---
A6TIF9_KLEP7/67-115---------------------------VMARFDEDTNKKLIAA--K------------N-KSN---RSK-SHEVYLR---
A6TIT2_KLEP7/72-120---------------------------LFLRFDEQTNKMLIKA--K------------N-RSG---RSK-SLEVYLR---
Q1MKC7_RHIL3/2-50---------------------------LVLQLPADIEARLIEL--S------------R-RTG---RSK-CFYVRQA---

PF02697

T0LS63_9EURY/3-63---------------------------KTITIKKSVYDELLGF--K------------K-.EN---E---SFSDLLD---
VPB12_SULTO/2-69---------------------------KTIMIRDDVYKKLLEI--K------------G-..D---K---SFSEIIE---
K0ILD1_NITGG/5-70---------------------------HSITITEEAYKALKRK--K------------K-.ET---E---SFTDVIL---
Y468_SULAC/3-73---------------------------KVITISDDVYDKLSKL--K------------K-..G---R---SFSETIN---
VAPB3_METAC/4-69---------------------------RTISISEEAYEKLKSL--K------------S-SEK---D---SFSDVIL---
VPB21_SULTO/3-69---------------------------KTITISEEAYRLLLSE--K------------R-.EG---E---SFSDVII---
D3RYZ8_FERPA/3-69---------------------------KTITIADDVYNELVKI--K------------G-..S---R---SFSEVIR---
Y1222_PYRFU/3-69---------------------------KTITISDDVYNELLRI--K------------G-..N---K---SFSEVLR---
L0K336_9EURY/8-69---------------------------.NVRLTEEAYQRLKSR--K------------Q-.EG---E---SFSDTVE---
A4YFM7_METS5/2-68---------------------------KIVVIEDDVYRKLVEI--K------------G-..D---K---SFSEIIE---
Q96ZV9_SULTO/7-74---------------------------.TISISEEVKEKLEIE--K------------G-..D---M---SWDEFLL---
VPB15_ARCFU/4-66---------------------------KTITITLEAYERLKRE--K------------R-.EG---E---SFSDVII---
T0LZ28_9EURY/35-97---------------------------KNISISEDAYLRLSEL--K------------L-.KN---E---SFTELIY---
F4BV58_METCG/4-69---------------------------KTISIRDDVYKLLKDA--K------------R-.EE---E---SFSDAIE---
Y1752_THEKO/3-69---------------------------KTITIADDVYYELVKM--K------------G-..K---K---SFSELLR---
D3SWF9_NATMM/7-71---------------------------.QIRVSDRVKRHLDRR--R------------R-.EG---E---SCNDVLE---
H1Z229_9EURY/8-73---------------------------RSISISDSTYDDLKKL--K------------K-.PD---M---SFSDAID---
D3RXH8_FERPA/2-66---------------------------KTISIRDDVYKRLAEM--K------------E-.EG---E---SFSDVIE---
B9LNT2_HALLT/4-66---------------------------KTISLDEEAYERLKSH--K------------R-.EG---E---SFSDVVK---
F7PL26_9EURY/4-69---------------------------KTISLKEETYERLRRA--K------------G-.DD---E---SFSDAID---
F2KPT0_ARCVS/2-67---------------------------KTISIRDDVYNKLVSM--K------------E-.DG---E---SFSDVIE---
E6N6M2_9ARCH/6-71---------------------------KTITIRDDIYLELVKR--K------------R-.DG---E---SFSDVIG---
VPB16_ARCFU/2-67---------------------------KNIMVRDEVYEKLQKM--K------------K-.GR---E---SFSDVIL---
D3RY16_FERPA/3-67---------------------------KTISISDDVYELLVKI--K------------G-..K---R---SFSEVIR---
Y1481_ARCFU/2-66---------------------------KTISIRDDVYRKLLEM--K------------D-.EE---D---SFSDVIE---
K0IGR2_NITGG/4-71---------------------------KTIMISEEAYEILKKR--K------------R-.PN---E---SFTDVII---
E6N5Q0_9ARCH/3-69---------------------------KVISLSDEAYAALKRI--K------------R-.EG---E---SFSDVVL---
VAPB3_METJA/5-71---------------------------ATITIDDDVYKELLKL--K------------G-..R---K---SVSEFIK---
VPB18_ARCFU/3-66---------------------------KTISISDDVYEMLVKI--K------------G-..K---R---SFSEVIR---
K0I6Z0_NITGG/1-65---------------------------...MLSDEAYNALKAA--K------------K-.EG---E---SFSDVIL---
T0LWN0_9EURY/4-68---------------------------KNIALRDDVYKKLKEV--K------------G-.PN---E---SFSDAIE---
K0I6W7_NITGG/3-67---------------------------KPVMLSDEAYKALKAE--K------------R-.EG---E---SFSDVIL---
F8D5A7_HALXS/4-66---------------------------KTISLDEEAYERLKAR--K------------K-.EG---E---SFSETVK---
T0LIW2_9EURY/4-66---------------------------RNISISDEAYHKLRDM--K------------M-.KN---E---SFTDVIN---
A7I6Z1_METB6/4-69---------------------------KTISITEEAYERLKSL--K------------N-DEA---T---SFSEVIV---
VAPB4_PYRFU/3-69---------------------------KTITVSDDVYNELLRI--K------------G-..K---K---SFSELLR---
D3S0D8_FERPA/2-67---------------------------KTITISDEVYEKLVRI--K------------G-..K---K---SFSAIID---
L0K2C6_9EURY/4-67---------------------------KTIGVREEVYERLKAR--K------------R-.ED---E---SFTDLVN---

PF10723

Q93GS8_SALTY/8-88RKGNPLSSAEKKRLSISRKKTTH--KELNVFIQNIHKESLQQL--C------------E-ETG---T---TQAQMIE---
Q326V9_SHIDS/1-86RRGKPMTDSEKQMAAVARKRLTH--KEIKVFVKNPLKDLMVEY--C------------E-REG---I---TQAQFVE---
Q326M6_SHIDS/1-79RKGNPLTGAEKQRISVSRKKGTH--KAINVFIQSELKDDLTQL--C------------K-DSG---L---TQKEMIE---

PF07362

H0Q687_9RHOO/11-81----------------------R--KATNVTLGEGLLAEAKAL--D------------I-NIS---Q---AAEAGVA---
K0I4M5_9BURK/9-79----------------------K--KSTNLSLNSKVLEAARDM--G------------M-NIS---Q---TVDELLA---
L0DQK3_THIND/1-68----------------------.--..MNLSIDAELLAEARRF--G------------L-NLS---G---LLEERLS---
B5EG30_GEOBB/12-82----------------------K--KSTNLSINSDLLRLAKER--H------------I-NLS---Q---ALESRLA---
D4YZH7_SPHJU/13-83----------------------R--KPTNVSLDIALVAEAKRL--G------------L-NIS---R---ACEVGLI---
B2JXB4_PARP8/10-80----------------------R--KATNVTLPVDVYERAKEL--G------------I-NFS---R---ACEQALR---
Q82VK5_NITEU/17-87----------------------K--RAINLSLSADVLDAARQL--D------------I-NIS---Q---VCDTYLR---
B0T4X1_CAUSK/3-80----------------------K--VELDIGIDSELLAQAKRL--G------------I-SVA---G---MSETQLR---
E0SK21_DICD3/2-72----------------------K--HRVSVTVDKDNYQVLSAA--G------------V-NIS---G---LVNDAIG---
Q1GN85_SPHAL/11-80----------------------K--KPTNVSLNAELVEEARRL--E------------I-NVS---E---ACQSGLA---
Q326Z9_SHIDS/2-72----------------------K--QRITVTIDSDSYQLLKSA--N------------V-NIS---G---LVNTAMQ---
D3VG79_XENNA/22-92----------------------K--KTVSVTVSPELYEQAKQI--G------------L-NFS---A---ILTQALI---
W0L945_9GAMM/12-76----------------------K--RSTNVYLTASLVDAARSM--D------------M-NLS---A---TLDRLLA---
F5XZ64_RAMTT/9-77----------------------K--RAVNLSLSEHLIEQARQY--S------------T-NLS---A---TVDELLA---
G7Z7L4_AZOL4/17-86----------------------K--QRVDITLNEDLLRLAQGY--T------------D-NLS---G---TIETLLA---
Q98F99_RHILO/26-96----------------------R--KSAKISTSLQLLEDAKVL--S------------I-DIS---R---AAETGIA---
S5Z1L5_PARAH/10-80----------------------R--KPANLSLDQSLLAEARAL--G------------I-NLS---R---AAEAGLR---
A5GAE8_GEOUR/23-93----------------------K--KPTNLTINSDLLQKAREH--H------------I-NLS---Q---TLELRLA---
Q93GR6_SALTY/2-72----------------------K--QRITVTVDSDSYQLLKAY--D------------V-NIS---G---LVSTTMQ---
A7HPK7_PARL1/5-75----------------------K--KAVNLSIDADLLAKARAL--D------------I-NLS---A---TFEEVLR---
E1VR77_9GAMM/21-91----------------------K--KPTNVTINSDLLAKAKEL--K------------I-NLS---A---TLEAALI---
G7ZEQ7_AZOL4/20-89----------------------K--RATNVSLNSDLLEQAKAL--G------------I-NVS---R---ACERGLA---
Q5P2R6_AROAE/22-92----------------------K--KATNLSLSADVLAEAKSL--G------------I-NIS---K---ACDECLR---
Q32K47_SHIDS/7-77----------------------T--QSVTVTVDRELVNRARDA--G------------L-NMS---A---TLTVALN---
A0L724_MAGMM/11-81----------------------K--DRVNLSMNSELVQKAKAL--N------------I-NLS---K---ELEKHLD---
A8GC18_SERP5/8-78----------------------T--QSVTMTVERSLLSRAREA--G------------I-NLS---A---TLNAALD---
A1U420_MARHV/11-81----------------------R--KPTNLSLDSALLKEAKSL--G------------I-NVS---R---SAEAGIA---
Q8PCL0_XANCP/29-98----------------------K--KPLNLTINSDLAAQARAM--T------------G-NLS---A---KVEELLA---
S6AR37_PSERE/11-81----------------------K--KAANLSINSDLLSKARAL--D------------I-NLS---A---TLEQALA---
Q6D9V2_PECAS/2-71----------------------K--HQISIAVDKDDYQVLSAA--G------------V-NIS---D---LVNDAIG---
Q21DI4_SACD2/11-81----------------------K--KPTNLSVNSDLLAKTRAL--N------------I-NLS---A---TLEQALK---
I1XLK6_METNJ/11-81----------------------K--KPTNLSVNSDLLKKSKAM--N------------I-NLS---A---TLEQALT---
Q7N4P4_PHOLL/9-79----------------------K--KTVSVTVAPELYQQARQV--G------------L-NLS---A---VLTKALI---
Q21U54_RHOFT/9-79----------------------K--RPVNLSITADTIDKAKAL--G------------M-NLS---K---TVDALLG---
C3MCA1_SINFN/7-77----------------------R--RPTNLSLDGDLLSQARDL--K------------I-NVS---R---AAEEGIA---
B3PDY0_CELJU/63-133----------------------K--KPTNVSINSDLLEKARAL--N------------I-NLS---A---TLEQALA---
C7JJ40_ACEP3/1-66----------------------.--....MTLPAQLLEEARSL--D------------L-NIS---Q---ACEQGLK---
K7SHF6_GLUOY/17-86----------------------R--RPVNLSLNTDLLAQVREV--T------------P-NLS---A---TVETLLG---
K7ABL7_9ALTE/6-76----------------------K--VPCNTSIDAAVIKEARAL--I------------L-SPS---A---ILEEALS---
E0SMR7_DICD3/9-79----------------------K--KTVSVTLEPALLQQAREA--G------------I-NLS---A---TLAEALK---
C4LCG0_TOLAT/11-81----------------------K--KATNLSLNSELLAEAKRL--N------------I-NLS---A---TMEKALV---
D5QE46_KOMHA/17-86----------------------R--RPVNLSLNADLLAQVRQV--T------------P-NLS---A---TVETLLG---
K0C8E2_ALCDB/11-81----------------------K--KAANLSINSDLLNKTRAL--N------------I-NLS---A---TLERALR---
M4XDA7_PSEDE/11-81----------------------K--KPTNLSLNSDLLKKAREL--D------------V-NLS---A---VLEEALA---
H2IXW0_RAHAC/27-92----------------------K--KRTNVTLSADLLEQAKAF--G------------I-NLS---A---TFDKALG---
Q2RNE8_RHORT/14-84----------------------R--RATNVSISAPILAEARAL--E------------V-NIS---R---AAEKVLV---
Q7MZJ1_PHOLL/2-72----------------------K--HRVNVTFDKENYLILNSA--G------------V-NIS---G---FVNKAMT---
G7Z9X1_AZOL4/11-74----------------------K--RDVTLSLDEDILHRAQSL--P------------G-DLS---E---RVEKLLA---
V6F3K3_9PROT/6-76----------------------K--KSCNLSINAELLREAKGL--G------------I-NLS---Q---TLEVQLE---
I2B9K4_SHIBC/6-76----------------------T--QSVTVTLERDLIAAARAA--G------------V-NMS---Q---TLAAALD---
D3VAK1_XENNA/23-87----------------------K--KSTNVYLTAALVETARSM--N------------I-NLS---A---TLDKLLA---
E6X2R7_NITSE/11-81----------------------K--KATNISLNSDLVRKAKLY--G------------I-NLS---Q---TLEVALE---
Q6D8L1_PECAS/2-72----------------------K--RWISIAVNKDDKQTPNAT--W------------I-PIS---G---LTNDVID---
G0A2L0_METMM/9-79----------------------K--KATNITLSADVLAEAKAL--N------------I-NIS---Q---ACDLYLR---
D6Z0A2_DESAT/12-82----------------------R--RATNISISARLLDEARLL--Q------------V-NIS---R---AAEQGVA---

PF04221

DINJ_ECOLI/4-84----------------------N--AFVRARIDEDLKNQAADV--L------------A-GMG---L---TISDLVR---
Q9KML3_VIBCH/3-84----------------------T--EMLSTRIDHDTKIAFTNV--C------------D-EMG---L---STSQAIK---
Q9PBQ9_XYLFA/4-84----------------------N--QLVQARIDGAIKAEATVV--L------------A-AMG---L---TISDAVR---
RELB_HAEIN/5-93----------------------N--SSISFRTVEKTKLEAYQV--I------------E-QYG---L---TPSQVFN---
RELB_ECOLI/1-78----------------------M--GSINLRIDDELKARSYAA--L------------E-KMG---V---TPSEALR---
Q9A0Y8_STRP1/13-96----------------------T--GTLNLRVDDSVKSAADDI--L------------K-RLG---I---PMSTAID---

PF03693

PARD_XYLFA/1-78---------------------MS--RNTSVALGPHFTSFIDAQ---------------V-QGG---RYG-TASDVVR---
PARD1_CAUCR/2-82---------------------AS--KNTSVVLGDHFQAFIDSQ---------------V-ADG---RYG-SASEVIR---
PARD_VIBCH/1-80---------------------MA--KNTSITLGEHFDGFITSQ---------------I-QSG---RYG-SASEVIR---
PARD1_MYCTU/1-80---------------------MG--KNTSFVLDEHYSAFIDGE---------------I-AAG---RYR-SASEVIR---

PF14384

A1AQ37_PELPD/17-82........RRGRPAG....QTKA--.LQTVRFDLDVLAAFKA.--.------------T.GKG---...-.WQTRMN---
Q73R28_TREDE/11-81...........PPPDRLIRKSEK--VKITITLDCESVAFFKA.--.------------S.AKK---NNV-KYQTMIN---
B0JRR8_MICAN/35-94............FYRPL....KQ--.QITLSLDADLIDWFKTQ--A------------TQEEG---...-.YQTSIN---
Q92KN5_RHIME/26-103...EEHRRSRGRPSLE...HPKK--.QVTLRLDEDVIAKFRA.--.------------G.GKG---...-.WQSRMN---
Q3J2R4_RHOS4/23-97....MRRSAGGRPKLD...APKM--.SVSLRLDQDVVAHFKA.--.------------G.GPG---...-.WQSRMN---
B8F509_HAEPS/13-99NEMERQGKIKTGRGKQK.KPTKQ--.AITLRLSPEVIEAFKS.--.------------T.GQG---...-.WQTRIN---
A5GE33_GEOUR/45-107.........RGRPKKD...RPKK--.AVSLRIDPEVLAYFKG.--.------------T.GKG---...-.WQSRID---
A1WJ32_VEREI/17-83........HRGRPRLA...RPQQ--.LLTILFDADVIEAFKA.--.------------T.GSG---...-.WQTRMN---
A6WWJ1_OCHA4/29-103....MEKAIRGRPRID...DPKT--.PVTIRLDQDVVQRFKA.--.------------T.GKG---...-.WQSRMN---
Q2RSU6_RHORT/41-96...............PL....KE--.AVSIRLDKDVLAFFKT.--.------------T.STR---...-.YQTRIN---
E3I091_RHOVT/23-97....MRKNVGGRPKSD...APKV--.AVSLRLDQDVVDKFRA.--.------------T.GAG---...-.WQTRIN---
Q215B0_RHOPB/13-90...LARIRGQRGPQKA...PTKI--.AVSIRLSPEVVSHFKA.--.------------T.GAG---...-.WQGRID---
C4K882_HAMD5/42-98............FYRPI....KK--.QLTVRIDADVLEWLKS.--.------------E.GDG---...-.YQSRLN---
Q20YH7_RHOPB/27-93........QRGRPKSD...APKQ--.LVSLRLDAEVLRWFKA.--.------------T.GAG---...-.YQARMG---
D3SAY2_THISK/33-91..........GRPPLP...VTKE--.RITIRLSPDVVEAFRA.--.------------T.GKG---...-.WQTRMD---
C4KAB9_THASP/30-98.......RKRGRPVGS...GTKE--.QVAIRIDHDILEAFRA.--.------------G.GPG---...-.WQTRMN---
Q28LR0_JANSC/24-89.......STRRS.......SPKK--.QLTVRFDEDVVKFFKS.--.------------A.GPG---...-.YQSRMN---
D5X2J5_THIK1/28-104...LVAKRPRGRPKAD...ETKV--.FTAIRLDADLLETFKS.--.------------T.GKG---...-.WQTRVN---
A8HS57_AZOC5/58-131......SIKRGRGRPKV.DSPKQ--.AVTLRLSPETIERFRK.--.------------T.GKD---...-.WRTRMS---
B1M0P6_METRJ/36-100.........RFVPRGPT.GRSDE--.MVAIHLLPEIVAHFRA.--.------------Q.GPG---...-.WQARIN---
A9BQV6_DELAS/27-103.....AARKRGRPQGSVKADAKI--.ATNIRFDPDVLQALKA.--.------------T.GQG---...-.WQTRVN---
D5CSA1_SIDLE/6-67............AKLQT.EMAGK--TRITMRVDNSVLALYKA.--.------------R.AET---SGG-SYQTMMN---
C1DP04_AZOVD/25-95.......RGERGPQKA...PTKQ--.QVSLRLSPEVLAYFKA.--.------------G.GSG---...-.WQTRLD---
A1WLU7_VEREI/13-87....TLGMRVRGPQKA...PTKQ--.ATTIRLSPDVMAAFKA.--.------------T.GHG---...-.WQTRID---
Q73LQ6_TREDE/25-85............AYWNV.TPIKK--.KISIKIDADILAVLQS.--.------------L.GKG---...-.YQTRIN---
A5V5L4_SPHWW/13-90...KAGKRGRPVGSTS...SNKT--.QVALRIDNDTIARFKA.--.------------G.GPG---...-.WQSRMN---
A6WZ44_OCHA4/29-94.........TRGPGKK...APKE--.TVTLRLDPDVVEAFKA.--.------------D.GPG---...-.WQGRVN---
B0T4V2_CAUSK/34-92............LHRPI....KM--.PVTIRLDADVVGWFKEH--A------------G.DKP---...-.YQSEIN---
B6JFY4_OLICO/17-84........RGRPPLGL...VAKK--.SVTLRLDDDVIAAYRE.--.------------T.GAG---...-.WQSRIN---
Q8KUW1_SYNE7/45-104..........GRPPSL...NPKT--.QIAIRLDRDIVEAFRA.--.------------G.GPG---...-.WQTRMN---
Q0KBY4_CUPNH/27-90.........RGRPRLA...STKE--.LVSIRYDADILDAFRA.--.------------S.GEG---...-.WQTLMN---
B6IVZ4_RHOCS/9-71............GRPPA.QARPK--VATSLRLDADVVERLRQ.--.------------D.GPG---...-.WQTRAN---
Q2KVN5_BORA1/5-79....KLGLRRRGPQKS...PTKQ--.AVTIRLSPEVLDTFKA.--.------------S.GAG---...-.WQTRID---
Q39RZ9_GEOMG/16-77............AKFQA.ETGGK--SRITMRVDNDVLATFKA.--.------------R.AEI---IGG-NYQTLMN---
A8GIR2_SERP5/28-84............FYKPM....KV--.SKTVRIDADILEWLQR.--.------------P.GKG---...-.YQKRLN---
A9IES8_BORPD/41-97............FYKPT....KT--.STTVRIDSDVLAWLRS.--.------------Q.GKG---...-.YQSRIN---
A1VRX0_POLNA/13-87....TLGMRVRGPQKA...PPKV--.STTIRLSPEVVEAFRA.--.------------G.GDG---...-.WQTRID---
Q31JV0_SYNE7/18-82.........IGRPRSQ...SPKV--.AISLRLEAEVLQRWRD.--.------------S.GPG---...-.WQTRMA---
A1WB35_ACISJ/28-89..........GRPLGS...GTKA--.QVTLRLDVEVLEKFKA.--.------------S.GDG---...-.WQTRIN---
B2ICD8_BEII9/27-96........LAETIRRRG.PLKKK--EAVSIRIDIDVLQKLRA.--.------------T.GSG---...-.WQSRVN---
Q73L16_TREDE/8-67...........K.......LRKK--QVVAIRLSPETAEKVKA.--.------------L.GKG---...-.YSSVLS---
C3M8F8_HAMD5/13-85.......KTLGIRGPQK.APTKQ--.KITIRLSQEVVDAFRA.--.------------T.GKH---...-.WQSRMD---
C7RRD3_ACCPU/30-92............RGRPK.SENKK--LLVSVRYSPEVVAYFKS.--.------------T.GEG---...-.WQSRMD---
B6IW20_RHOCS/40-99...........SLYRPV....KE--.VVTIRLDADVLHWFRDH--A------------AGGRG---...-.YQTRIN---
A8LQR3_DINSH/3-99RIQALVPDAWQTLEADLPLVEKK--TKVTLRLDESVAKFFRA.--.------------M.GPG---...-.YQARIN---
C4KAB3_THASP/28-89..........GRPPAA...VTKE--.RITIRLSRDVVEQFRA.--.------------T.GDG---...-.WQTRMD---
A3N0B8_ACTP2/11-88....VIESRERKRGRPV.AQTKK--VSVTIRYSQSVIDAFKS.--.------------T.GKG---...-.WQSRMN---
D4ZU97_ARTPN/29-87............RGSPN.YQTKT--.QVTLSIDSDVLDWFKS.--.------------Q.GQS---...-.YQTEIN---
K9XMQ0_9CHRO/29-86..............LPA.TKAKA--.QVTLRIDSDVLEWFKS.--.------------Q.GRG---...-.YQTQIN---
Q2L2E1_BORA1/28-86............PKAE...VTKE--.RISIRLSPDVLESFRA.--.------------T.GAG---...-.WQTRVD---
Q63NA3_BURPS/28-88............GRPPL.EAPKV--.QLTVRYDVDIVDAFKA.--.------------T.GEG---...-.WQTRMN---
Q6N573_RHOPA/22-88.........VRRGRPPLGTQPKS--.SVTLRLDADVLDAYRA.--.------------L.GRG---...-.WQSQIN---
Q7CI23_YERPE/12-90....GAEKVIKTRGRPKLANPKE--.PVKLRIDHDVVDAYRA.--.------------Q.GDG---...-.WQTKMN---
Q7CP71_SALTY/37-93............FFRPL....KT--.QASVRIDADVMEWLKR.--.------------P.GKG---...-.YQTRLN---
Q9PD17_XYLFA/28-105....ALVAMKRPRGRPKADQTKV--.FTAIRLDADLLEAFKA.--.------------T.GKG---...-.WQTRVN---
V6F518_9PROT/28-104....ETEALLRRRGRPLKADRKV--.DIKLRIDPDVVEALRS.--.------------G.GKG---...-.WQTRAN---

PF07764

T0VBY9_9ENTE/1-69.GNLGAQKAKRNDTPISAKKDIM--GDKTVRVRADLHHIIKIE--T------------AKNGG-------NVKEVMD---
I3U5Z1_ENTFC/1-71VGNLGAQKEKRNDTPISAKKDIM--GDKTVRVRADLHHIIKIE--T------------AKNGG-------NVKEVME---

PF17414

F4HAL0_GALAU/88-147---------------------ST--KKKSIDLDYAVWLRLSRY--S------------R-KMK---M---TLSQTIM---
MATP_PHOPR/88-147---------------------HT--RKKSIDLDYRVWEKLAEK--S------------Q-ELG---S---TLSDTIE---
MATP_HAEDU/88-147---------------------TT--KKKSIDLDYASWLRLSKY--S------------K-THA---M---TLSETIN---
M1S7Y5_MORMO/88-147---------------------HT--RKKSVDLEFLVWQRLSAL--S------------Q-RRG---S---TLSDTIV---
Q5E5A7_VIBF1/88-147---------------------HT--RKKSIDLDYRVWEKLSLR--A------------Q-DLD---S---TLSDTIE---
MATP_VIBTL/88-147---------------------HT--KKKSIDLDYRVWEKLSQR--A------------N-ELG---C---TLSDAIE---
I2BAK8_SHIBC/88-147---------------------HT--RKKSIDLEYLVWQRLAGL--S------------Q-RRG---N---TLSETIV---
E0WTV2_9ENTR/88-147---------------------HT--RKKSIDLEFSVWQRLSIL--A------------H-HYQ---R---TLSETLI---
M4R6X9_BIBTR/88-147---------------------ST--RKKSIDLDYASWLRLSKL--S------------N-SME---M---TLSECIH---
M9WUL5_MANHA/88-147---------------------TT--KKKSIDLEYSSWLRLSKY--A------------K-SQK---L---TLSEAIV---
Q2NU72_SODGM/88-147---------------------HT--RKKSIDLEYLVWQRLAAL--A------------Q-RRG---S---TLSETIV---
B4EVD5_PROMH/88-147---------------------HT--RKKSIDLTFKVWQRLSAL--S------------Q-RRG---L---TLSETIV---
A6VPA7_ACTSZ/88-147---------------------ST--KKKSIDLEYGVWSRLSKY--S------------R-KMN---M---TLSETIS---
X2H502_9GAMM/88-147---------------------NT--RKKSIDLEFLVWQRLANL--A------------K-RRG---C---TLSQTIT---
MATP_PHOLL/88-147---------------------HT--RKKSIDLDFPVWHRLSAL--S------------Q-RRG---N---TLSETII---

PF16762

C7RVN5_ACCPU/5-80---------------------ET--TRLTVTFSRETDLALRAF--L--------------GAQ.GMRKG-DLSKFIE---
A1TQN5_ACIAC/2-78---------------------NT--VRWNIAVSPDVDQSVRMF--I--------------AAQGGGRKG-DLSRFIE---
Q9PHI2_XYLFA/2-78---------------------ST--VRWNLAVSPDTDQSVRMF--L--------------ASQGGGRKG-DLSRFIE---
C7JJ67_ACEP3/2-78---------------------ST--TRWNIAVSSEVDQSVRMF--L--------------AANGGGRKG-DLSRFIE---
A4VQ14_PSEU5/2-78---------------------NT--IRWNVAVSADTDQSLRMF--L--------------ASQGGGRKG-DLSRFIE---
M4SBY8_9SPHN/3-78---------------------DA--TRWTVNVAPETDIEVRTY--L--------------AQR.GMKKG-DLSRFIE---
I3Y769_THIV6/5-79---------------------DQ--TRWTVTVSQQTDIALRTF--L--------------AQR.GLKKG-ALSVFIE---
R5EAP8_9BURK/2-74---------------------GK--AEWSVTVSDELNDAVMAY--L--------------AKSGQGVEG-.LSNLVE---
Q5P0S5_AROAE/2-78---------------------PT--TRWNVAVSTETDQALRMF--L--------------ASQGGGRKG-DLSRFIE---
R5PIP0_9BURK/9-86---------------------SN--VKWNISVPPDFDEATRIY--L--------------ASH.GGKKG-ALSSLVQ---
E1VKG4_9GAMM/2-78---------------------DT--VRWNLAVSADTDQALRLF--L--------------ASQGGGRKG-DLSRFVE---

PF11903

Q4KC28_PSEF5/1-66---MGIVKISDELHEQIRVASAA--MDRSINAQAEFWMKIGLL--A--------------ELN---PHL-AYN....---
B4SF37_PELPB/2-74---GMPVRIDDTLYGQARAQAKA--EHRTIAGQIEFWAMIGRA--A--------------LDN---PDL-PID....---
A0QXV1_MYCS2/6-107---DRVTRFAADLVESAAAEGAR--QSRSAKQQLDHWARVGRA--V--------------SSQ---HTA-ARRRVEA---
A9BMX0_DELAS/1-73---MGIVKISDQLHDQIRLSSAA--LGRSINAQAEHWLRVGQL--A--------------EHH---PHL-DYA....---
A6T935_KLEP7/1-66---MGIVKISDLLHDDIRDASKA--MSRSVNAQAEYWIRLGMM--S--------------ELY---PEL-NHQ....---
Q7NVK9_CHRVO/1-73---MGIVKISERMHDNLRTASEA--LSRSINSQAEHWLRIGML--A--------------ELN---PDL-RYS....---
A1T476_MYCVP/6-107---DQVTRVAADLMDSAATEGAR--RSWSAEQQLDHWARVGRA--V--------------SSQ---HSV-ARRKVEA---
Q3AQ94_CHLCH/4-76---STSIRINQELYEQAKQDAKL--EHRSIAGQIEFWARVGRA--A--------------LDN---PDL-PVS....---
Q1GXH1_METFK/1-73---MGIVKISEAMHENIRSASNA--FSRSINSQAEHWLRVGML--A--------------EMH---PQL-NYT....---
Q2SQH0_HAHCH/2-95---PQSVRIDDFLIDSARREAKG--AHRSVQGQIEHWAKIGQM--V--------------ERS---GVL-SYERIRS---
Q13JR3_BURXL/1-70---MGIVNIDDDLHDQIRKASAV--SCRSINAQAAFWIKVGML--C--------------EMN---PTL-SFN....---
Q15VU5_PSEA6/1-66---MGIIKISDEVHDEVRKSCQV--MSRSINAQAEFWIKMGRL--A--------------ELN---PTL-TFS....---
Q0RY55_RHOJR/40-141---TSPTRIDNELYASAKLVGGR--MSRSAAQQIAHWARIGRE--L--------------EAS---HSV-SYRDVAD---
Q220F4_RHOFT/1-73---MGIVKISDQMHENLRVAGNA--LSRSINAQAEHWMRVGML--S--------------EMH---PEL-DSR....---
Q47D61_DECAR/1-73---MGIVKISEHMHENLRLTSAA--LSRSINAQAEHWLRVGML--S--------------ELN---PNL-RYG....---
Q0C2J2_HYPNA/1-68---MGIVNIDDDLHDQLRKASTV--SCRSINAQATFWIRIGML--C--------------EMH---PTL-SFN....---
A7HVP7_PARL1/11-109---AQSIKLADDIMKIVRRESEL--QSRSVSGQVAHWVRIGRA--I--------------EKS---GNF-DYARITA---
A4Y172_PSEMY/1-70---MGIVNIDDELHDQIRRASSV--SNRSINAQAGFWIRIGML--C--------------EMN---PAL-SFN....---
D0J2S6_COMT2/1-68---MGIVKISDQLHDQIRVSSAA--LGRSINAQAEHWLRVGQL--A--------------EHH---PQL-NYE....---
Q63SV8_BURPS/1-72---MGIVKISDGMHESLRHASAA--LSRSINAQAEHWLRIGML--A--------------ELH---PTL-SYA....---

PF11020

F4F896_VERMA/2-77.PLYVGEPAVGTHPMEQQSAWLQ--RVRGGSVPTEVMDAFATL--F------------TIALE---NNV-SFEELCA---
B3S7R4_TRIAD/8-90VDIYIGQPNQGSHPLAFQLRWLR--EVRHGQIDSSIHEALSKL--F------------QLANG---NNL-PLEQLIE---
Q2GKE5_ANAPZ/4-84.AVYIGEPKPDAHPVQHQNTWLS--KERGGQVPERVINSLERL--H------------KLARE---NGI-CFAELCV---
B9KIB3_ANAMF/4-84.AIYIGEPRPDAHPVQHQNTWLS--KERGGSVPEKVRNSLEKL--H------------ELAKK---NGI-CFADLCV---
F7XUD1_MIDMI/1-81.PLYIGNPEPTHSPIHFQADWLS--KERGGQVPPQIVESLIKI--Q------------KLAAD---NSV-EFEELCY---
Q2GCJ4_NEOSM/1-81.TIYIGSPRRDTHPIYNQATWLS--KERGGVVPQKVMDSLSKL--R------------ELAEE---NNV-SFEDLCV---
K9QB18_9NOSO/702-781.HVYVWDWKLNEPPTTAQFDWVE--KARGCEVPKDVVESFQKL--Y------------KIARE---NNV-SFADLTV---
A5CC80_ORITB/1-81.TVMIGQPKPDQHPLHFQANWLS--TERGGVIPAEVMDSITQL--V------------ELSKK---YQV-PIEELVV---
Q2GG71_EHRCR/4-84.AIYIGEPKPENHPVQHQDNWLA--KERGGNIPEKIKDSLAKL--H------------ALAQK---NGI-CFADLCV---

PF15970

B4EVM4_PROMH/3-83PATSHFDEESETYEITYRDFDNI--HAVAYTEDDIELEASDIL--H------------V-GLE---EFI-SSKMPIP---
Q0WCU1_YERPE/3-83PASYTVDEASGEYHIHYRDFPEL--NSVTYSLEDVELEAQEGI--K------------N-GVA---AEM-EERRLIP---

PF10784

E1I390_ECOLX/6-77-------------------------RTIAFKLNPDVNQTDKIV--C------------DTLDS---IPQ-GERSRLN---
A0A028AHT8_ECOLX/8-78-------------------------KKFTLYLHPEK.AADFQT--L------------EAIES---VPR-SERGELF---
B7T4Y5_KLEPN/5-76-------------------------RKCSFYIYPERNAADRVA--D------------GFLEK---LPQ-KERGRAM---
D2AJQ5_SHIF2/10-81-------------------------KKVVAYLHPALYPQDNLT--Q------------QTIDS---LPV-QMRGDFY---
A7ZGW0_ECO24/8-78-------------------------KKLSLYLHPED.SADCLA--L------------AEIET---VPR-KKRGELY---
A0A026RDF4_ECOLX/8-79-------------------------RRCSFELFPDERTGDKIA--D------------ELIAN---EKL-KERGRFM---
A6TIQ1_KLEP7/4-74-------------------------GQYSFYLHSDD.RTDIAA--M------------ATIST---ISQ-PLRGEFI---
A7M7F6_9GAMM/10-80-------------------------RKFTSYLQLDC.EADRRA--L------------DVVES---ISQ-RVRGDFL---
A0A143DV46_ECOLX/6-77-------------------------RRISFYLKPAAVKSEQEA--C------------NYLDS---LPA-SERSRAQ---
I2RCP5_ECOLX/6-77-------------------------RRISFYLKPAAVKNEGKA--C------------AWLDS---LTP-EARKSGQ---
A6TIQ1_KLEP7/109-178-------------------------RRYTLTLQNG..RSGERV--E------------SVLTE---ASS-RLRGDLL---

PF08870

R5X372_9CLOT/4-111--RLKTSLQTKEIFEELGSRMNL..KP.FALSKLAISMSLTNN--EPIEN.....FKSIDNNG---LEL.NRQTITA...
B0JNR9_MICAN/7-117--RFRLSQTAKDSLIKLKRYTKI..DQWNILCRWAFCRSLAEP--SLPSP.....VPIPADSN---VEL.SWKVFGG...
K9UL30_9CYAN/9-118--.IKLSQTAKDQLIKLKRITKI..DRWNVLCRWAFYRSLAET--APPSL.....IPIPADSN---LEM.SWQVFAG...
K8GJN7_9CYAN/8-118--RVRISQAAKDQLIKLKRVTKI..DQWNILCRWALCRSLAEP--TPPSP.....VAIPADSN---VEM.TWQVFGG...
K9XZW3_STAC7/7-117--RIRLSTTAKEQLIKLKRITKI..EQWNILCRWAFCYSLAEP--SIPTS.....VPINLDSN---VEM.NWNVFGG...
R7K532_9FIRM/4-112--KLKTSKETMRVFNDISANIHL..QP.FALAKIAIALSIRES--AELDA....DSFNTDTDG---LEL.NRQTITG...
D1AEG3_THECD/6-115--.IRLSQPAKDQLIKLKRITGI..KNWNVLCRWALALSLQDP--SPPLV.....REIVTDSN---IEM.NWKTFAG...
K9Z1H5_CYAAP/7-117--RIKLSKKAKDQLIKLRKVTKI..EQWNILCRWGFCRSLREK--HTPAP.....YPIPADSN---VEM.SWNTFGG...
W0E949_9FIRM/5-115--QIKLSNQSKDKLSRLKGKTGI..KNWNVLCRWALCFSLSEE--TIPTD.....LDFPADSN---VEM.SWHTFAG...
V6K4J2_STRRC/5-116--RIRLSKTAKDQLSWLKRHTGI..THWNVLCRWALALSLRDE--TTPLV.....KDIVTDSN---VEM.DWKTFAG...
K4IEY7_PSYTT/2-118--RIKISKENDELLYKLKTLYNF..KSEGIVPRIAFSNSLLLG--KIFDA...EKDVIPNSDG---KEFRDDKAIFGNVI
D6CZD3_9BACE/5-107--.IKTSKINKDIVTDLSRKFNL..GAENIIARIALTYSLSKD--RKLSL.....SDIADSQG---KEY.SKNVLFG...
B8FD42_DESAA/6-115--.IRLSEEAKSRLTRIKTRTGV..TQWNVLCRWAFCLSLAEE--SVPAP.....ANIPSDSN---VEM.KWKVFGG...
A5G4D6_GEOUR/7-118--HVRVSTKGKEILIKIKRRTGL..EHWNEVCRVALCHSLSNP--TSPPK.....LERVSDST---IDI.EWKTFAG...
Q82J53_STRAW/10-120--HVRLSQPAKDRLSYLKRTTGV..TQWNVLCRWALLLSLRDP--STPLV.....KDIVTDSN---VEM.SWRTFAG...
L0H1B2_9GAMM/8-117--.VRTSRQGRDQLIKLKKYTGA..AHWNELCRWALCASLAEP--NVPPL.....HTQKLEGG---VEM.SWRVFAG...
I3Z2Y2_BELBD/5-108--.IKTSKENKERVVQLTRKLNL..GAENVIARIAFAYSLGNE--HKVNL.....SEVHDSQG---KEY.TYKVLFG...
K9PPN2_9CYAN/7-117--RIKLSQTAKDQLTKLKRSTKI..DQWNILCRWAFCRSLAES--TTPSP.....VPIPQDSN---VEM.SWRVFGG...
Q11AI6_CHESB/5-115--KLRISADATSKLRSLRQRTGV..TP.NLLCRMAIMTSLEEG--PLGGA......AIPDEDG---SEF.NAYTLTG...
K9YCG7_HALP7/7-117--RIRLSKTGREQLIKLKRYTKI..EQWNILCRWAFCRSLAEP--TKPSP.....VPIPSDSN---LEL.TWRVFGG...
Q2S6R4_HAHCH/5-109--KMKISEKAFTSLRRLQNNTGL..TV.NIGARLAFFASIERG--FTWNG......DDIQLTQ---REL.DKYSWLG...
Q10Y61_TRIEI/7-117--RIRLSQVAKEQLTKLKRNTKI..DQWNILCRWAFCCSLAEL--SIPSP.....VPIPADSN---LEL.TWRIFGG...
F4L4C0_HALH1/5-110--.IKTSELSFELIRKFTSRFQV..QAENVVPRIALSYSIAKG--RKMRL.....PEVKDSRG---KEY.KDSILLG...
R5HMI8_9FIRM/4-109--RLKTSKRTQEIFEELENRTNY..KP.YTLVKHAIAWSILEK--KSVAD......YKSDSDG---LDL.NRQTITG...
D4ZRL0_ARTPN/7-117--RFRLSETAKDQLIKLKRITKI..DQWNILCRWGFCRSLGES--SPPSP.....VPIANYSN---VEL.TWRVFAG...
A7I566_METB6/7-112--RLRISEKATFRLSQLKGKTGL..TP.NIICRIAICYSLNDP--SIPNP......ADYDERG---QEI.NRYSLTG...
D4ZK78_SHEVD/5-115--RMNLTKQTEEHLKKLKQYTGI..AP.NVSSRIAFFRSIESG--FTYLPAEPIETERKLDGN---LVL.DKITWMG...
C1F5K3_ACIC5/21-129--.IRVSERAKQQLITLKRNTGI..EHWNVLCRWALCVSLQEP--SKPPI.....EGESALSS---LEM.HWKTFAG...
C4LF32_TOLAT/5-110--RMNLSLSTEEQLKKLKSYTGI..TP.NISARIAFFRSIESD--FRYSG.....QEAKLDGT---LVL.DKFTWLG...
K9YIM9_CYASC/15-125--RIKISKKGKDQLIRLKRITKI..ENWNVLCRWAFCRSLAEE--TKPTP.....YPIPSDSN---LEM.TWQVFGG...
E0UFG8_CYAP2/7-117--RIHISQTAREQLIKLKRYTKI..ENWNILCRWAFCRSLAEP--SIPSP.....VPLPPNSN---VEM.SWQVFGG...
A6Q5M6_NITSB/1-122--.MRTTSFVEKQIPKIAKLLGFENEPKWITIRFAIFVSLSLN--KPLDV....TKKIDFSGG---KVY.NLEVITGKGK
Q16C14_ROSDO/5-114--KFRISSTATGQVRIISQRSGL..TP.NLVCRMAMLSSFEAG--PISGA......ADDAGEG---QEF.NAYTLFG...
B1MK94_MYCA9/5-115--HIRLTTTARDQLVTLKRRTGI..TQWNVLCRWALCRSLGES--APPPV.....AKLVFDSN---VEM.TWRVFAG...
E0SAH1_DICD3/5-112--RMVLSRQTEEQLRKLKGYTGI..TP.NIAARLAFFRSVESE--FRYYP...ERDSKKLDGA---MTL.DKITWLG...
A8AM62_CITK8/5-110--RLQLNIRVEDQLKRLKASTGV..NP.NISARIAFFRSVESG--YRFDG.....NDYKTDGN---MSM.DKAVWLG...
Q3ICW0_PSEHT/11-117--.IKLSEKQKQQLVRLKSKTGI..ENWNVLCRWALCMSLAED--SIPPV.....EEIPSDSN---VEM.SWKVFAG...
R5NP02_9CLOT/11-121--QIKLSNISKDRLGRLKGKTGI..KNWNVLCRWALCYSLSEN--TMPTD.....LPIISDSN---VEM.SWYTFGG...
Q12MQ9_SHEDO/7-111--.LKLTKETEELLRRLKLKAKV..TP.NVVSRLAFFKSVESG--YRYHD.....PSIKLDGS---LVL.DKVTWLG...
S6ABQ5_9PROT/5-107--RLHISKHATDTLKQIKGRTGV..TP.NILCRMALTLSLEEG--HEPNP......DTVDLTG---QEF.NLATLLG...
K9V144_9CYAN/7-117--RVKLSQTAKEQLIKLKRITKI..EQWNILCRWALCRSLSEK--TPPSP.....TPIRLDSN---VEM.TWRVFGG...
K7AC95_9ALTE/5-111--RMQLSKTVEEQLKKLKGSTGI..TP.NVSARIAFFRSIESD--YTYQP....EIAYKLDGS---LVL.DKFTWLG...

PF01340

METJ_VIBVY/3-99-----DWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKVLTDE--R------------T-RRQINNLRHATNSELLC---
Q15NT2_PSEA6/6-102-----KWNGKYIHPYAEHGKKSEQVKKVTVSIPLKVLKVLTDE--R------------T-RRQVNNLRHATNSELLC---
K7AFK6_9ALTE/6-102-----KWNGEYIHPYAEHGKKSEMVKKVTVSIPLKVLKVLTDE--R------------T-RRQVNNLRHATNSELLC---
Q489Q2_COLP3/3-99-----QWNEEYINPYAEHGKKSEQVKKITVSIPLRVLKVLTDE--R------------T-RRQVNNLRHATNSELLC---
METJ_SALTY/3-99-----EWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDE--R------------T-RRQVNNLRHATNSELLC---
Q5QV41_IDILO/2-95-----KWNGEYIYPYAEHGRKSQQVKKVTVSIPTRVLKVLTDE--R------------T-RRQINNLRHATNSELLC---

PF07181

VIRC2_AGRFC/1-200KIQVFLSARPPAPEVSKIYDNLILQYSPSKSLQMILRRALGDF--EN-----------MLADG-------SFRAAPKSYP
Q2K2E4_RHIEC/1-199KVQVFLSARPPAPGVSEIYDSLILQYSASKSLQMILRRALDDF--VT-----------MLMDG-------SFSKASQSYP
B9K406_AGRVS/3-202KIQIFLSARPPAPEVSKIYDTLILQYSASKSLQMILRRALADF--ES-----------MLEDG-------SFSTAPKSYP

PF11423

M1RN95_MORMO/53-80-------------------------RNEAERMADHHAEMFKKT--V---------------FD-------TLVKLYG---
RMNT_BPP22/53-80-------------------------RNDAERLADEQSELVKKM--V---------------FD-------TLKDLYK---

PF10802

Y366_METJA/14-87---------TFYLYKNIDGRKLRYLLHKLENVENVDIDTLRRA--I------------E-AEK-------KYKRSIT---
Q6LZ85_METMP/6-80---------TLGLIENVDRRTARYILHKVEDMNAISPDILKKA--T------------E-PKK-------QFRKTLS---
Q6M002_METMP/6-80---------HLNLIEEIDAIAVRYFLHQIQNLESVDVEKLGKA--S------------K-LPK-------KCSRTLK---
D7DQS3_METV3/5-78---------.FNLYKNIGARELRYYVHKMENCENIAPETIAEI--K------------N-RNL-------KTKKLLT---

PF08972

Q6N1R0_RHOPA/3-76------------------------VLVIQVTYDEEAGVWVAQS--D--------------DIP.LVTEADTYEVLYR---
Q73QJ0_TREDE/2-73------------------------EYIIKINWDNEAGVWIATS--D--------------DIRGLVLESGSIDALME---
Q20YW9_RHOPB/21-94------------------------TLTIQVDYDEEAGVWVAEC--S--------------EIS.LVTEADTFEILFR---
A0ZK26_NODSP/6-80------------------------TIKVQAFWDAEASVWVADA--S--------------NLPGLVTEAETIEQLTK---
Q5SJJ5_THET8/3-73------------------------TLKVQALWDGEAGVWVAES--D--------------DVPGLATEAATLEELLA---
Q21AP4_RHOPB/7-78------------------------IFTVSAVWDADAGVWSGHC--D--------------DIP.AAADAPTLDELLA---

PF08681

Q8E866_SHEON/19-95--------------------------RIELKTSPEVKELLERA--A------------A-ING.INLTAFIINNVREKAL
Q7N880_PHOLL/12-90--------------------------TLNLRIRQEDRDLIDRA--A------------K-VKG.KTVTEYVLDTIKRDAE
Q7N7Z2_PHOLL/8-88--------------------------RITTRVSSETKELLERA--L------------S-LSGYASLNSFIANAAVAEAK
Q92P91_RHIME/11-90--------------------------RIELRTTREEKRLLTAA--A------------A-HER.LDVTSFIMRAVLPAAL
B3EP86_CHLPB/11-90--------------------------RLSLRIAAEEKSILMRA--A------------A-LEH.THLTDFVISKVVSAAR
Q7NIQ1_GLOVI/13-92--------------------------RIDIRTTPAAKRALQET--A------------A-IEH.KTVSGFLLDSGLKASA
Q7NLC6_GLOVI/11-90--------------------------RLEVRVSGDGKALIAQA--A------------Q-LEG.RTVSDFVVASALEAAS
B4SB08_PELPB/10-88--------------------------KLDLRLSQQAKQVLRSA--A------------I-ASN.RTLSEFVLESALSRAE
Q5P620_AROAE/9-88--------------------------RLEARISKDLHSMLKRA--A------------E-LQG.RTMTDFVIAAVQDAAQ
Q2SAN8_HAHCH/11-89--------------------------RIDVRASTPVKQLLQEA--A------------R-VCH.KNVSEFLLDAGVTAAT
C1DE12_AZOVD/13-92--------------------------TLNIRIKPEERSLIDRA--A------------Q-VKG.KNRTDFILDAARTAAE
Q8ZL97_SALTY/13-91--------------------------QLNLRAKESQRALIDAA--A------------E-ILH.KSRTDFILETACQAAE
Q8XPL2_RALSO/16-98--------------------------RITARLSADKQELLQLA--A------------D-LSG.STLNQFVLQSALRAAE
Q6LIX8_PHOPR/32-112--------------------------RITARVDIDTQELLSQA--A------------A-IAGMSSINSFVLSAAVEKAK
Y420_HAEIN/9-88--------------------------RLEAKVNIDIYELLKQA--A------------A-ITG.RTLTDFVVSVAYEEAK
Q5P632_AROAE/5-83--------------------------AINLRALPEQRDLIDHA--A------------S-LLG.KNRSDFMLEAACDRAQ
Q5NX70_AROAE/9-88--------------------------RLEARISPDLHALLKRA--A------------E-IQG.RTMTDFVVTAVKDAAQ
Q7N6D8_PHOLL/7-86--------------------------RFEARMNPELHALIKRA--A------------E-IQG.RTMTDFVVSAAQDAAQ
Q7N0J5_PHOLL/11-90--------------------------RMSLRIASEEKSLLMRA--A------------A-LQH.TNLTEFVLRNVMPAAR
Q6ZEG7_SYNY3/12-91--------------------------RLEARISPETKALMQKA--A------------A-LEG.RSLTDFVVASAQAAAL
Q87ZN7_PSESM/15-103--------------------------RLEIKTTDFAKEFIRKA--A------------T-VSG.LDMTAFIMASAFEKAE
Q3SNN6_NITWN/19-98--------------------------RLETRVTADQKKLIERA--A------------A-LQG.RTVTDFVLTSVQEAAR
Q9KM95_VIBCH/57-136--------------------------RLDIRLDEEIKAKAEKA--S------------A-LLGLKSLTEYVVRLMDEDAT
Y4AR_SINFN/23-102--------------------------RMNFRTKERVKRTIQRA--A------------A-LSG.LDDSAFTINAAYQSAI
O05910_MYCTU/74-152--------------------------RLAARLTPEQDALIRRA--A------------E-AEG.TDLTNFTVTAALAHAR
Q7N3R4_PHOLL/22-101--------------------------RLVARTSIEIQEIIQRA--A------------D-YSG.ATLSQFLIESAMERAR
I6XFC2_MYCTU/72-148--------------------------RLNFRLSPEQEQALRHA--A------------A-LTG.QSLSGFVLSAAVDHAH
Q8P668_XANCP/14-88--------------------------.LNLRIKPEERSLIDRA--A------------K-ARG.KNRTDFMLDAARSAAE
Q8ZKC7_SALTY/14-88--------------------------.LNLRIKPAERDLIDRA--A------------K-ARG.KNRTDFVLEAARAAAE
Q8ZMH5_SALTY/14-91--------------------------RLSLRVSTDAKKLIVRA--A------------A-IQQ.TNLTDFVVSNILPVAQ
Q9PHI1_XYLFA/6-80--------------------------.INLRAMPEQRDLIDQA--A------------N-LLG.KNRSDFMLEAACERAK

PF05534

Q7N3F9_PHOLL/54-104--------------------------YLQDCKELNKNPDIPYK..G------------I-FN------------------
Q88MT9_PSEPK/54-104--------------------------YIETCEKLGREPQKAYS..G------------K-LS------------------
Q6A7R8_PROAC/60-110--------------------------RANDEPVPEPLSTRHYS..G------------K-FQ------------------
Q73YB6_MYCPA/53-103--------------------------ESSGETLPTPMADRHYS..G------------T-IV------------------
Q7N8L4_PHOLL/59-111--------------------------YLEDCNASGIEPYARQEKIK------------T-FT------------------
Q92KT7_RHIME/1-48--------------------------M...CREKGIEPRRKFS..G------------K-FN------------------
Q6MB72_PARUW/52-102--------------------------YLDWCKELGQEPEKPFS..G------------N-IH------------------
Q7VMR2_HAEDU/57-107--------------------------YIEFCQEQGIETCKSFS..G------------N-FN------------------
Q7MY97_PHOLL/58-110--------------------------YIETCEEEGINPFKEEDKLK------------S-FT------------------
Q88G27_PSEPK/52-102--------------------------YLDTCASLGQNPEIPCK..G------------S-FN------------------
Q73J27_TREDE/55-105--------------------------YIELCKEAGKPAEKSYK..G------------S-FN------------------
Q8YLM2_NOSS1/53-103--------------------------YLEFCQERGEEPEKPFS..G------------K-LM------------------
Q73KK4_TREDE/52-102--------------------------YINWCREENIEPEKPYS..G------------K-FN------------------
Q92XZ7_RHIME/54-104--------------------------YLETCRKIGKEPQRPYS..G------------K-MM------------------
Q73QG2_TREDE/62-112--------------------------LENGFTIPMPQDENNYS..G------------K-FL------------------
Q9RZI7_DEIRA/54-104--------------------------YLAFCAELGEEPEKPMS..G------------K-FN------------------
Q8XYR1_RALSO/55-105--------------------------FLEECARRGVEPQKHFS..G------------K-FM------------------
A1RCN0_ARTAT/63-111--------------------------..SGEKIPQPLADRKYS..G------------R-LN------------------
Q9PCT7_XYLFA/64-114--------------------------FLEACKEDSVEPRKCYS..G------------K-FN------------------

PF09386

Q7N4K2_PHOLL/1-79------------------------MSRLTIDITDQQHKSLKAL--A------------A-LHG-KTIKQYTLERLFPDMT

PF12651

A6LT47_CLOB8/12-55---E-A-----------------------------LELL-------------FEKYN------
Q1D537_MYXXD/6-49---E-A-----------------------------ISDL-------------LAKYE------
Q08NJ8_STIAD/30-73---E-A-----------------------------VEDL-------------LAKYG------
Q04FI1_OENOB/1-44---K-M-----------------------------LENL-------------TKEYE------
A5N8S1_CLOK5/8-51---K-A-----------------------------VELV-------------PREYA------
A7HBK6_ANADF/4-47---Q-G-----------------------------IDLV-------------LEKYR------
Q9YEP4_AERPE/2-45---K-A-----------------------------VEAL-------------LEDYR------
A2BMU8_HYPBU/1-44---E-A-----------------------------IKGY-------------LEDHS------
B2TQ69_CLOBB/8-51---K-G-----------------------------IELL-------------LKEYN------
C3AQ62_BACMY/106-149---E-A-----------------------------LIEF-------------LRKYE------
Q17ZT4_PEPD6/4-47---E-A-----------------------------LEDL-------------IKKYK------
A9GWZ6_SORC5/4-47---E-G-----------------------------IDMV-------------LKHYE------
E3FMN1_STIAD/4-47---Q-G-----------------------------IDLV-------------LEKYK------
Q2II40_ANADE/24-64---E-A-----------------------------VADL-------------LAKY.------
Q8XP25_CLOPE/8-50---K-A-----------------------------MSMY-------------LEST.------

PF01402

YIIE_ECOLI/6-43---E-A-----------------------------VEQY-------------LER--------
VPB20_MYCTU/3-41---E-Y-----------------------------VAEH-------------LRQ--------
Q9YBV4_AERPE/3-42---I-A-----------------------------VREL-------------LKR--------
Q8ZX60_PYRAE/47-86---A-A-----------------------------LRDL-------------LYK--------
P72681_SYNY3/21-59---A-L-----------------------------FEHY-------------IED--------
Q8ZWZ9_PYRAE/10-49---A-A-----------------------------LREL-------------LGK--------
NIKR_CHLTE/6-45---D-L-----------------------------IREE-------------LLR--------
Q877Q4_PSESM/12-50---R-A-----------------------------ALNR-------------KIK--------
Y4KO_SINFN/4-42---E-A-----------------------------IEAF-------------VEQ--------
VPB19_MYCTU/2-40---R-A-----------------------------IHRA-------------YGT--------
O28529_ARCFU/6-44---R-V-----------------------------IKFY-------------RDY--------
Y080_METJA/3-41---R-A-----------------------------LEYY-------------VKK--------
PARD2_CAUCR/12-50---R-A-----------------------------LRDF-------------VEL--------
O30230_ARCFU/6-44---E-A-----------------------------IQLY-------------YNL--------
O29882_ARCFU/4-42---D-L-----------------------------IDLG-------------YDI--------
NIKR1_METTH/3-42---V-A-----------------------------ARML-------------IDE--------
Q9I707_PSEAE/4-42---Q-A-----------------------------LAQY-------------LER--------
E51_SSV1/12-50---E-A-----------------------------VKLL-------------EAE--------
Q88JZ4_PSEPK/2-40---E-A-----------------------------ITQY-------------VER--------
Q888D4_PSESM/12-50---C-A-----------------------------ALKR-------------KTR--------
O30109_ARCFU/6-44---E-S-----------------------------IITY-------------AEL--------
NIKR_HELPY/12-51---D-M-----------------------------IREK-------------LVE--------
Q8EGZ2_SHEON/6-44---E-A-----------------------------IREY-------------VER--------
G7YYF2_CLOSI/3-42---D-I-----------------------------LRSA-------------LAQ--------
YBFE_ECOLI/52-88---E-M-----------------------------LMQQ-------------L..--------
Y298_MYCTU/6-41---Q-A-----------------------------LRNE-------------H..--------
VPB10_MYCTU/3-39---L-L-----------------------------LNRA-------------L..--------
Q327A8_SHIDS/14-51---Q-A-----------------------------LSAW-------------LAQ--------
Q3IQM5_NATPD/4-41---R-A-----------------------------LSFY-------------AA.--------
Q8U3E4_PYRFU/7-45---V-A-----------------------------IREL-------------LKK--------
S6AY38_PSERE/10-47---Q-A-----------------------------LAAW-------------IDQ--------
V5UCU1_9BURK/15-51---A-A-----------------------------ALGR-------------RTR--------

PF07878

Q1QQP0_NITHX/90-130---H-A-----------------------------AKKA-------------LAA..------
Q7U858_SYNPX/33-75---Y-L-----------------------------VEEA-------------LRRHR------
A5GQX8_SYNR3/18-60---V-L-----------------------------IQQG-------------LDRLQ------
E8SHU9_STAPH/6-48---H-L-----------------------------ITSY-------------IERSS------
A5GKY5_SYNPW/33-75---F-L-----------------------------IEDG-------------LRRHG------
F4BUC1_METCG/7-49---Y-I-----------------------------AVKY-------------VREEK------
B7JWD3_CYAP8/2-44---Y-L-----------------------------VERA-------------VEKAE------
A8ZLB3_ACAM1/15-57---F-F-----------------------------MKQA-------------VESNQ------
D7E5Q5_NOSA0/6-48---V-L-----------------------------CQEA-------------MVARE------
Q46HT9_PROMT/14-56---V-L-----------------------------IQEG-------------VKYHE------
B1X2B8_CYAA5/9-51---L-L-----------------------------VEKA-------------VTEAQ------
Q7VEB2_PROMA/14-56---V-L-----------------------------IQEG-------------VDSLI------
Q7NMR8_GLOVI/20-62---K-L-----------------------------IDRA-------------LQQRR------
E0UNJ6_CYAP2/6-48---F-L-----------------------------LERS-------------ISTAK------
Q8YK09_NOSS1/15-57---F-L-----------------------------VEQA-------------IRAKF------
K9VLV1_9CYAN/8-49---Y-L-----------------------------LTKS-------------VRERQ------
K9VLX7_9CYAN/14-56---L-L-----------------------------VEEG-------------LERAQ------
Q7V237_PROMP/82-124---Q-C-----------------------------LETG-------------LREMK------

PF15919

F8GGR0_NITSI/3-126---K-L-----------------------------A---------------------------
F2JW02_MARM1/3-127---Q-V-----------------------------S---------------------------
E1VAV2_HALED/3-129---R-A-----------------------------A---------------------------
B8GTR2_THISH/3-126---R-A-----------------------------G---------------------------
F4HBU2_GALAU/3-128---Q-L-----------------------------A---------------------------
F7QNQ0_9BRAD/4-124---Q-A-----------------------------A---------------------------
D8MUK4_ERWBE/3-128---Q-V-----------------------------A---------------------------
G8M697_9BURK/3-126---R-V-----------------------------A---------------------------
D5BWS5_NITHN/3-123---K-V-----------------------------A---------------------------
Q98J17_RHILO/4-124---K-A-----------------------------A---------------------------
E6WDB3_PANSA/3-127---D-L-----------------------------A---------------------------
A1VQL9_POLNA/3-127---R-M-----------------------------A---------------------------
Q63NA5_BURPS/3-126---R-A-----------------------------A---------------------------
B4ET85_PROMH/3-129---T-A-----------------------------T---------------------------
A5GAH3_GEOUR/3-123---Q-A-----------------------------A---------------------------
Q1LPG4_CUPMC/14-137---R-V-----------------------------A---------------------------
A8GFZ4_SERP5/3-129---A-A-----------------------------A---------------------------
Q7N448_PHOLL/3-129---V-A-----------------------------A---------------------------
Q5HXI2_GLUOX/3-126---A-M-----------------------------T---------------------------
F4GPE1_PUSST/3-127---Q-M-----------------------------T---------------------------
B8DM26_DESVM/3-123---E-S-----------------------------A---------------------------
A9H9S0_GLUDA/10-135---K-L-----------------------------A---------------------------
F9ZMS1_ACICS/3-126---R-C-----------------------------A---------------------------
YO14_BPHC1/3-126---Q-L-----------------------------A---------------------------
Q5F6D2_NEIG1/4-126---K-A-----------------------------A---------------------------
Q7VZH1_BORPE/3-127---H-L-----------------------------A---------------------------
Q9A3L8_CAUCR/4-124---R-A-----------------------------A---------------------------
W8KT83_HALHR/3-127---R-A-----------------------------A---------------------------

PF12441

Q30QH6_SULDN/2-80---M-L-----------------------------LQKE------------------------
B0JXE6_MICAN/7-82---S-W-----------------------------CRDK------------------------
B4SES2_PELPB/3-79---L-A-----------------------------IERA------------------------
A6QAG9_SULNB/5-83---M-L-----------------------------LQKE------------------------
C1F1N0_ACIC5/3-81---I-Y-----------------------------LADR------------------------
B4SF55_PELPB/6-84---M-F-----------------------------LKER------------------------
A4SVJ8_POLSQ/6-84---I-W-----------------------------LAEK------------------------
A1BIF8_CHLPD/6-84---M-F-----------------------------LKER------------------------
B1WWY8_CYAA5/9-85---D-V-----------------------------LREK------------------------
B8GRA9_THISH/6-84---A-W-----------------------------LAKD------------------------
P72819_SYNY3/56-132---E-V-----------------------------LEQS------------------------
A5GA05_GEOUR/6-84---I-W-----------------------------LSEK------------------------
C7LN80_DESBD/6-82---M-L-----------------------------LEAD------------------------
Q01SA6_SOLUE/7-85---V-F-----------------------------LAER------------------------
C3KQS7_SINFN/6-84---V-W-----------------------------LSEK------------------------
Q9AAV5_CAUCR/3-77---E-A-----------------------------LET.------------------------

PF13467

I3THE1_TISMK/5-68---M-VN.......STR.....RES.....TLTAAIRVF-------------IMNYY------
A1B158_PARDP/15-82---R-L........WHEAMDADHD...LG.NFTSFLRVC-------------CARY.------
Q2W502_MAGSA/68-131---T-A........RRR....YEAS.....SLTSAIRVF-------------VLNSN------
U4KIB5_9VIBR/16-83---L-L........YDEATELHGE...VS.NFASLLRCS-------------CVMYL------
D7A937_STAND/16-83---K-L........HEELVFAHGE...VE.NFASFLRVC-------------CGRYL------
Q47K48_DECAR/15-83---K-L........YDEIEAYRGE...VE.NFASFLRVT-------------CLRYL------
B8EK53_METSB/15-83---K-L........HDESLEFQGG...IG.NFTALLRCA-------------CIGYA------
V6F6E9_9PROT/28-96---Q-L........HDEVIERRGE...IG.NFASLLRVV-------------CATYL------
I3TNF1_TISMK/9-73---A-ID.......AAR...RVDRV.....NLSSALRLF-------------ALAE.------
S6AZN1_PSERE/15-83---K-L........YDEVMDYRGE...VV.NFASFLRVS-------------CTRYL------
B4RFD6_PHEZH/4-67---G-ID.......RAR.....AGR.....PLASACRLA-------------ALDYA------
A4Z0Q4_BRASO/15-82---T-L........YAEVLDHHGE...VK.NFASLLRCS-------------CLIY.------
Q8EH51_SHEON/15-83---R-I........YREVLARQGE...VA.NFASLLRVA-------------CTTHL------
Q1QJT3_NITHX/17-80---S-ID.......TDR.....RTS.....NLSSAIRLY-------------VLEHF------
U4K818_9VIBR/15-83---Q-I........YKEVLEKRGE...IR.NFASLLRVA-------------CTTHL------
R5XT33_9PROT/6-68---L-ID.......ANK....DEKM.....GLTSSVRLF-------------SLIYY------
D7A5S3_STAND/15-83---K-L........HDEVLDLHGE...VR.NFASLLRCS-------------CLIFL------
A5FXC9_ACICJ/3-65---E-VD.......AAR....DPDR.....PLASALRVF-------------ALT..------
D4ZC71_SHEVD/15-83---S-L........YIEALNHHGD...VK.NFTSLLRSA-------------CVQHI------
K7SD13_GLUOY/4-66---S-ID.......AKR....TPDR.....PLASALRVA-------------ALM..------
G2KLR8_MICAA/1-64---E-ID.......EGR.....GDH.....NLSSALRVF-------------VLKTI------
G8PTZ2_PSEUV/3-67---G-ID.......DER....NPEN.....NLSSCIRVA-------------VLKHF------
A8IAV7_AZOC5/5-68---T-ID.......SGR.....NQG.....NLSSAIRLF-------------VLDYY------
Q13WI7_BURXL/15-84---Q-L........YDELIALRGE...LPTNFASFLRVC-------------CLRYL------
B2IEK6_BEII9/15-82---K-L........HDDSLEFRDG...IG.NFTAYLRCA-------------CIYH.------
R5YAT6_9PROT/7-67---M-IN.......ARK....DAKM.....GLTCSVRLF-------------SLIY.------
F2J384_POLGS/15-81---R-L........HSEVLELRGE...AP.NFTSLLRCA-------------CLI..------
Q2K3V5_RHIEC/15-83---R-L........HHESIDAGHD...LG.NFTSFLRVC-------------CARYL------
V6F679_9PROT/38-104---R-I........HDHCLVTNDR......NLASCLRVV-------------CLKYI------
Q7CXZ9_AGRFC/2-66---E-ID.......DSR....PADS.....NLSSSLRVY-------------VLNWL------
C3MEF5_SINFN/3-66---E-ID.......DGR....GSEG.....NLSSAIRLY-------------VLAWI------
B9JH07_AGRRK/7-71---E-ID.......DGR....EPES.....NLSSALRLY-------------VLKWL------
Q2YPT7_BRUA2/7-71---E-ID.......SRR....ERTI.....NLSSALRLH-------------VLDWL------
Q0A5P7_ALKEH/48-113---Q-V........QYHCQSVNDK......NMASCLRVL-------------CLKYI------
A5VF72_SPHWW/4-70---R-ID.......VDR.IADDDLP.....NLASAIRVW-------------LFRR.------
Q2N6Z0_ERYLH/8-73---Q-ID.......EER.IRAATPP.....GLASAIRVW-------------LVT..------
B6INS4_RHOCS/2-64---E-VD.......ATR......TG.....NLSSALRVH-------------VLEAV------
W8RV19_9RHOB/5-69---E-VD.......AAR....GLSS.....GLASAIRVF-------------VLDEV------
A7HVX0_PARL1/14-77---R-ID.......TRR....DGQG.....SLSSAIRLY-------------VLNAL------
Q2W7L3_MAGSA/5-67---G-ID.......STR......EA.....NLSSAIRVF-------------VLNEL------
A8LPV2_DINSH/15-83---T-L........HGEVLEARGE...PV.NFTSLLRCT-------------ALLYI------
Q167Q5_ROSDO/15-83---K-L........HTEVLEKRGE...PK.NFTSLLRCA-------------CLKFA------
Q15TD7_PSEA6/15-83---K-L........YFESQEAELD...LS.NFTSFLRVC-------------CSRYL------
E3I0W1_RHOVT/38-99---E-ID.......AAR.....GPA.....GLSAAIRVY-------------LLG..------
Q167I6_ROSDO/5-69---D-ID.......VKR....GTST.....GLASAIRVF-------------VLEDL------
A6X0F5_OCHA4/15-83---K-L........YDESRNEGHD...LD.NFASFLRVC-------------CGRYL------
C5AUK2_METEA/10-72---A-ID.......SER.....GAR.....NLSSAIRVF-------------VLGAF------
R6I0Y9_9PROT/4-68---L-LE.......NIP....DRKL.....GLTYLTRLF-------------MLMYY------
B8IRU4_METNO/15-83---K-L........HDEVLERHGE...VR.NFASLLRCS-------------CLIYL------
B8ELI0_METSB/17-78---E-ID.......AAR.....GSA.....NLSSAIRVY-------------ILQS.------
G8ARW4_AZOBR/20-92---D-L........KDRLDSQSRRSRGVAVSLANAVRVF-------------IVGYY------
G7ZBW3_AZOL4/15-83---T-L........HDEVVEVHGT...IQ.NLASFLRVS-------------CVRYL------
D4YZT3_SPHJU/21-85---R-ID.......VAR.MATAAPP.....NLASAIRCW-------------LF...------
I0HQZ1_RUBGI/15-82---T-L........YDELVAERGA...VG.NFASFLRVC-------------ALRY.------
A9HZ31_BORPD/15-82---R-L........YDELVEYRGE...AA.NFTSFLRVC-------------CLRY.------
B0T0E7_CAUSK/20-82---R-ID.......AGR.....GER.....PLASACRVF-------------ALLR.------
B6IVX3_RHOCS/20-83---R-IA.......QAK....PPAA.....SLTAAIRVF-------------LLSYF------
H5WRL6_9BURK/15-83---Q-F........HDEIMAHRGE...VP.NFASFLRVT-------------GMRYL------
R6I5L9_9PROT/2-65---E-ID.......SKR.....EHE.....NLSSAIRIY-------------ILNHL------
Q88NJ6_PSEPK/37-105---Y-V........DREVHLRQGG...VR.NFSGLIRVI-------------CVAWL------
Q7VY20_BORPE/16-82---R-L........YDELVQYRGE...AA.NFTSFLRVC-------------CLRY.------
Q0KEM8_CUPNH/15-86---R-L........HDELTEHRGSEAVAG.NFSSFLRVC-------------CLRYL------
Q3J4J5_RHOS4/5-69---E-VD.......EAR....DPEV.....GLASALRVF-------------VLRHY------
B6JB62_OLICO/35-98---T-ID.......QNR.....QTN.....NLSSAIRLF-------------VLDYF------
G4RFD5_PELHB/1-64---E-ID.......ETR.....EDP.....NLSSAIRVF-------------VLAWF------
Q5LS66_RUEPO/5-69---D-ID.......AAR....DPET.....GLASAIRVY-------------VLGWY------
R5XSE7_9PROT/2-65---E-ID.......GTR.....TTP.....NLSSALRLY-------------VLKSL------
A9HBJ7_GLUDA/7-71---G-ID.......ATR....DPAR.....PLASALRVA-------------ALQEA------
B2U9M5_RALPJ/15-83---Q-F........HDEILHHRGD...VQ.NFTSFLRVT-------------CLRYL------
C6BV10_DESAD/15-83---T-L........HNEAYSLNGE...IS.NFASLLRVV-------------CTTYL------
A1WLD9_VEREI/15-83---K-F........HDEILASRGE...VP.NFASFLRIA-------------CMRYL------
V5SG48_9RHIZ/7-70---R-ID.......EAR.....GTA.....GLSSAVRVW-------------ILDDV------
D5BP55_PUNMI/2-63---E-ID.......KNR......DG.....GLSSALRLF-------------VFAEL------
D0IW80_COMT2/15-83---K-L........YDELLAERGA...VD.NFSSFLRVC-------------CTRYL------
V6EZW9_9PROT/2-64---V-ID.......TDR......DG.....NLSSAIRLF-------------VLNDL------
B1M524_METRJ/6-68---H-ID.......AGR.....DGQ.....NLSSAIRVF-------------VLEAV------
G7Z694_AZOL4/2-65---K-ID.......AER....QDSD.....NLTGCVRVF-------------ALCYF------
E8RRH3_ASTEC/4-67---E-LD.......TKR.....GES.....LLASFCRLS-------------ALAFV------
A1VU33_POLNA/15-83---R-L........HDELEAERQG...IE.NFASFLRVC-------------CGRYL------
Q11GU9_CHESB/4-68---E-ID.......ASQ....SRNT.....NLSSALRLY-------------VLAEV------
D9QJB1_BRESC/2-64---W-ID.......QTR.....GRR.....PLASACRLL-------------ALEH.------
A2SED0_METPP/15-83---K-L........YDEATTHRSE...SA.NFASFLRVT-------------CVRHL------
A1B3A7_PARDP/22-85---E-ID.......AAR....PPEV.....GLATALRLF-------------VLAE.------
Q5E5I8_VIBF1/19-85---T-I........YKEALEHNGE...VT.NFASLLRCA-------------CLIY.------
G8B035_AZOBR/15-83---K-L........HDEVLARGVE...RR.NFAGLLRCA-------------CLTYA------
K7SIV6_GLUOY/15-83---N-L........SDEILELRGE...LP.NMASFLRVS-------------CLRYL------
Q28PQ0_JANSC/10-74---E-ID.......AAR....GVSA.....GLASAIRVF-------------VLRTV------
Q87MR6_VIBPA/16-83---T-V........YQEALEYNGE...VN.NFASLLRCA-------------CLTYA------
R5R7N0_9PROT/5-68---M-IE.......NAK....TERL.....GLTYSTRLF-------------LVLYY------
Q5NQS8_ZYMMO/14-79---R-ID.......AER.VKAADMP.....NLASALRLW-------------LLF..------
R5Q8E2_9PROT/4-65---D-ID.......NSR......NG.....NLSSALRLF-------------VLKKL------
Q141Z3_BURXL/65-133---R-W........ALEIDLTQEA...IC.NFTGFVRII-------------CVTQL------
R6ITS5_9PROT/4-68---M-IE.......SRK....DPKL.....GLTPSIRLF-------------SLVYL------
G2KND8_MICAA/35-99---L-IQ.......LRK....NPNT.....SLTAAIRVF-------------LMLYY------
Q92NP9_RHIME/6-70---E-ID.......DGR....GQDG.....NLSSALRVY-------------VLAWV------
Q21US4_RHOFT/16-83---T-L........YDELLTHRGD...IP.NYSSFLRVC-------------ALRYL------
W0AMC0_9SPHN/9-75---R-ID.......AER.IRADDPP.....NLGSAIRIW-------------LFRK.------
D5AQD4_RHOCB/5-69---E-ID.......AAR....DPGT.....GLATAIRLA-------------VLRHY------
Q2G3C7_NOVAD/8-72---R-ID.......AER.IASPTPP.....GLAGAIRLW-------------LV...------
Q2RS87_RHORT/10-72---E-ID.......AGR......SG.....NLSSAIRIK-------------VLEAY------
Q0AMZ5_MARMM/17-80---E-ID.......AAR.....EGE.....PLASSVRIW-------------VLQAL------
A7IN95_XANP2/16-83---R-L........YDEKAEAGRD...ID.NFTSFLRVC-------------CGRYL------
E0TDI6_PARBH/6-68---D-AD.......LKR.....GSQ.....GLASTLRVE-------------LLAA.------
S5YGZ7_PARAH/15-83---T-L........QSEVLELEGE...PV.NFTSLLRCA-------------CLVQL------
B6JB63_OLICO/5-68---E-ID.......SQR.....KQG.....NLSSAIRLF-------------VLDHY------
A1BB74_PARDP/15-83---T-L........QSEVLQLRGE...PV.NFTSLLRCA-------------CLVQL------
Q0BVF8_GRABC/3-66---M-VD.......ASR....NPDR.....PLASALRVL-------------ALEA.------
B6IXV3_RHOCS/24-88---M-IA.......ARR....HETS.....TLTATIRAF-------------LVAYF------
G8AK62_AZOBR/2-63---E-ID.......STR......SG.....NLSSAIRVH-------------VLNAV------
R6IQM1_9PROT/1-65---E-ID.......SAR.....EHE.....NLSGAIRVY-------------ILKYL------
F2J2A0_POLGS/3-67---A-ID.......GER....PPEQ.....ALSSAVRVW-------------VIRTL------
W0PKG2_9BURK/15-82---T-L........YDEVYAYRGE...AT.NFTSFLRVT-------------CMRY.------
J7QMW2_METSZ/14-76---R-VD.......AGR.....GEA.....NLSSALRVF-------------VLER.------
M4S774_9SPHN/4-69---Q-ID.......ADR.VLDPDPP.....NLASAIRVW-------------LFE..------
B8IF14_METNO/8-71---R-ID.......AGR.....AEQ.....NLSSAIRVF-------------VLREV------
A8HUM8_AZOC5/15-83---T-L........HDEVLDCRGE...VQ.NLASLLRCS-------------CLIYI------
A8LRP0_DINSH/33-97---E-ID.......AER....GADL.....GLASAIRLA-------------ILRHY------
S5YRV8_PARAH/10-74---A-ID.......HQR....PPEV.....GLATAIRLY-------------VLAEV------
A6WUZ0_OCHA4/15-83---T-L........YDEALEANGA...IP.NFASMLRTT-------------CALYL------
G0AAA0_COLFT/37-104---K-L........HDEVTTHLGE...AS.NFASFLRVT-------------CLRY.------
F8J5J1_HYPSM/3-66---S-ID.......KTR.....GEA.....GLSSAVRVW-------------LLERL------
G8AI45_AZOBR/22-97---L-IKDRLDEQIRRR....GPGADNAEVTLTSAVRVF-------------IAAYF------
G8ARV8_AZOBR/26-90---D-IH.......DSR....TEGI.....PFATSVRVY-------------VLNHF------
B6IW11_RHOCS/3-66---L-ID.......RLR.....GDG.....GLTAALRIF-------------LVGYL------
M9R844_9RHOB/9-72---E-ID.......EAR.....GDV.....GLASAIRVF-------------VLNSL------
R6J4D7_9PROT/7-67---I-IE.......NSN....RVHL.....GLTYLTRLF-------------TLFY.------
C7JBE2_ACEP3/5-69---K-VD.......AAR....SPEQ.....SLASALRVY-------------ALEWL------
A6VZH2_MARMS/16-83---K-L........NHEALDAGHN...LD.NFTSFLRVC-------------AMRYL------
V9VUQ5_9RHOB/5-69---E-ID.......EIR....GEDC.....GLASAIRLF-------------VLRRL------
D5BMV3_PUNMI/6-68---E-ID.......KRRQFS..........SLASSMRIV-------------TLFYF------
R5QX40_9PROT/1-65---E-ID.......AVR.....EQE.....NLSSAIRVY-------------ILKEL------
B9JXQ8_AGRVS/8-72---D-ID.......SKR....PADC.....NLSSALRLY-------------VLEWL------
Q87Y30_PSESM/6-74---Y-I........DREVHLRYGG...VK.NFSGLIRVV-------------CVAHL------
A0KLC1_AERHH/26-94---E-L........YQEALGNGME...MS.NFASLLRCS-------------CLVHL------
Q98KH2_RHILO/5-68---E-VD.......EKR....PRDT.....NLSSALRLH-------------VLEWA------
A5FYB5_ACICJ/15-82---L-L........HDEAEDWFGD...ID.NLASLLRAA-------------CILY.------
D5QBC0_KOMHA/10-72---R-ID.......TTR....DPMR.....TLASALRVA-------------ALL..------
G2IRZ2_9SPHN/11-78---R-ID.......AER.IARTEPP.....NLASAIRCW-------------LLAQA------
Q2SKQ2_HAHCH/16-83---K-L........YDEVVEKRGE...VG.NFASLLRVV-------------CATYL------
B2IH09_BEII9/17-85---E-ID.......AARVESSPSRK.....NLSSAIRVY-------------ILRTV------
Q2K6G5_RHIEC/20-84---E-ID.......DHR....PPDS.....NLSSALRLH-------------VLSWA------
F6IFI2_9SPHN/8-74---R-ID.......AER.LEAETPP.....GLASAVRVW-------------LALS.------
B2UET6_RALPJ/16-83---K-L........YDELFERRGE...VA.NFASFLRVC-------------CLRYL------
Q1GGM9_RUEST/6-70---E-ID.......EQR....GTDC.....GLASAIRLY-------------VLSAL------

PF03869

RMNT_BPP22/2-51---Q-I-----------------------------VQDA-------------LSKPSPVT--G
RARC_BPP22/4-53---Q-R-----------------------------VMES-------------FKKEGRIG--A
G3XCY4_PSEAE/13-62---A-R-----------------------------LEQS-------------LLQEGALQ--D

PF07704

Q92LY2_RHIME/1-78---M-ARE...............AGPFAPGNHKRETDDM...---------.WGD--------
K9Y1V0_STAC7/1-81---R-YQT.............LPTLDNRTEEEILGYNDG...---------....--------
VPB42_MYCTU/1-88---.-................DDDKRLIRRHEVDLYDDS...---------.GLP--------
C7NJK7_KYTSD/22-102---R-IDA..........SLAPGDAAAMRVELDRLYDER...---------.GLP--------
Q0BQA3_GRABC/5-87---D-IRA..............HMRGRVSSDHSALYGEG...---------.GLP--------
L0DWF9_THIND/1-83---A-CAA.............LPVRDRRSAEEILGYDEH...---------.GLP--------
A6WWK7_OCHA4/1-81---E-RAS................RYDRRPVTKQEWDEA...---------.VGD--------
Q2JGF8_FRASC/9-88---Q-TAA.............AVPPPGLSIED..LYDEH...---------.GLP--------
W0ABH3_9SPHN/5-83---R-AAR..............MVTKPYAQHGDELYDEN...---------.GLP--------
A6X7T6_OCHA4/1-81---E-FAA.............ILGPNPEPFDMKKFSDEL...---------.YED--------
A7IPR5_XANP2/185-260---A-LAA......EAQPGGREMTKDE........VDEM...---------.WG.--------
I6X1P2_PROPF/1-84---E-IHD..........SMTDEEREALRNVDQEIYDED...---------.GLP--------
I3TVZ0_TISMK/1-81---H-AAA..............HVKRPYLEHGDLLYDER...---------.GLP--------
I3Y9G9_THIV6/1-75---R-IPD.............RTDALD.....PLAWDDL...---------.GLP--------
Q20ZG7_RHOPB/1-82---R-YAS.............LP.DSGRSADDILGYDEH...---------.GLP--------
B1M1V3_METRJ/1-75---R-MDA..........VPRTGLEAD.....KAFYDSL...---------....--------
G8NNV7_GRAMM/6-85---S-FNL....................KPINEDLTDDEILG---------YG..--------
L0J8B6_9MYCO/1-82---T-EIR...PLITDRRPVLRSEREQ.....TLGYD.....---------....--------
F2J715_POLGS/1-79---Q-HGV.............KLDAAARQPLPREAYDEL...---------.WE.--------
K7S7C8_PROA4/1-82---R-ARA.............RAVLDDRDADEIIGYDEN...---------.GLP--------
B8EP86_METSB/1-76---E-HPL..........PPVTGQKAD.....KAFFDGL...---------.A..--------
B8IVJ3_METNO/1-83---R-WST.............LPVLDPRSADEILGYDEN...---------.GLP--------
C7NLZ4_KYTSD/1-87---Q-IRI..........DLQDAGSGSLSEELTDLYDDD...---------.GLP--------
C1A9G9_GEMAT/1-83---R-IAG.............GAAASDVTTESVIGYDDQ...---------.G..--------
Y2378_RHIME/1-81---Q-ARD.............RLGPPVHGIDMKKLMDEL...---------.WEE--------
F5XKW7_MICPN/1-83---R-ARS.............RPDLDVRSAEEILGYGDD...---------.GLP--------
L0J8W2_9MYCO/1-78---T-EVW...PLLNDGHPITKQDREQ.....ILDYD.....---------....--------
B0T0U9_CAUSK/24-113---K-YLT............PEARAGLLPPITKADFDEINEI---------PGLD--------
VPB30_MYCTU/1-83---R-CAA.............LPVVDNRSAEAILGYDER...---------.GLP--------
Q2RUX5_RHORT/1-81---R-AAA..............QGNRPRVDHADLLYDEH...---------.GLP--------
VPB36_MYCTU/1-81---T-EIW...PLLADRSPITKLEREQ.....ILGYD.....---------....--------
I6XS64_PROPF/3-79---L-QAE.............AAPYRHLFLTDDDIHDED...---------.GLP--------
H6RSW2_BLASD/1-87---E-IAP............RFRGDVATVEHGDLLYDDA...---------.GMP--------
Q92TH7_RHIME/9-88---K-HGI.............VIGGAASKPLQREAYDEM...---------.WDD--------
H6RM61_BLASD/1-86---D-AAD............RWVEPYRSSDHGDLLYDET...---------.GLP--------
B9JIC8_AGRRK/5-84---K-HGI.............ALNNQTQKPLPRDVFDAM...---------.WDE--------
D7A0R5_STAND/1-80---L-ADA..............MGRGDPDFDMKAFTDSL...---------.WGD--------
B0SW80_CAUSK/41-123---T-GEI.....................LTDADLYDED...---------.GFP--------
A7IPR8_XANP2/1-84---R-VAR.............LPELDTRSDEEIVGFDEH...---------.GIP--------
K9Y7X0_HALP7/1-79---I-AQT.................KVQYFDPNTLYDEN...---------.GLP--------
L0GTX7_9GAMM/1-83---R-MAR.............LPVRDARTPEEILGYDDN...---------.GLP--------
D4Z9B0_SPHJU/1-81---R-AAT..............HVKRPYVDHAELFYDDN...---------.GLP--------
C3KNS9_SINFN/1-79---E-VRA..............MGPDDPDFDMKKFADEQ...---------.WG.--------
C3KQT0_SINFN/1-80---S-VRA.............KMGPNTPGFDMKKFTDEM...---------.WE.--------
A6X8D2_OCHA4/6-84---L-MAE......GRRSVPEGTTSAH.....DDLYDEH...---------.GLP--------
VPB28_MYCTU/1-80---K-TAS............RMSPEAKRLDHDALLYDER...---------.GLP--------
Q981I6_RHILO/1-76---R-YRA..........FPETSAQAD.....KAFFDDL...---------.S..--------
Q6N2A9_RHOPA/1-82---R-YAA.............LP.DTGRTPDEILGYDEN...---------.GLP--------
Q219N1_RHOPB/1-83---R-WSE.............LPVVDDRTPEEILGYDAH...---------.GLP--------
Q7NGE7_GLOVI/4-85---R-SVA.............LPILDPRAPDEIL.YDEN...---------.GLP--------
A1T4A5_MYCVP/1-80---R-TAQ............RMTSATKNLDHGELLYDDA...---------.GLP--------
K0FC64_9NOCA/1-82---D-MHA............IVRESGYPPLTTDDLYDDE...---------.GLP--------
B1LSI4_METRJ/1-77---A-LHE..............RAGPDRKPADAAFID.....---------.GLY--------
C3KQV7_SINFN/1-83---R-WAR.............LPVADNRSADEILGYDGN...---------.GLP--------
D3PLA4_MEIRD/1-79---R-EVWAKLPPESLGKAPTKAEQEE...............---------....--------
L0E2P5_THIND/1-78---R-IPE.............RADAYD.....PLSWDEH...---------.GLP--------
B2IL59_BEII9/1-77---D-LRA.............RSHPERGQPADKAFFDEL...---------....--------
U5QCJ3_9CYAN/4-85---R-STA.............LPVLDPRPPDEIL.YDAH...---------.GLP--------
C8XHZ8_NAKMY/1-83---R-GRE.............RAVLDERSPDDIIGYDEH...---------.GLP--------
Q92RQ4_RHIME/1-83---R-WNA.............MPVLDSRSSDDIIGYDED...---------.GLP--------
Q5SKZ1_THET8/1-84---E-EVWPQIPPELLGKGLSKEEEEE.....ILGYGKE...---------....--------
A5FU30_ACICJ/1-78---A-NPL..........PPPTGLKAD.....KAFFDDL...---------.SGE--------
Q1QF44_NITHX/1-83---R-LNA.............LPILDPRSPDDIIGYDEN...---------.GVP--------

PF17206

SEQA_MANSM/1-36---R-L-----------------------------LNLP------------------------
W0HVK8_9GAMM/1-36---R-M-----------------------------LKFT------------------------
SEQA_VIBTL/1-36---R-L-----------------------------LLVD------------------------
SEQA_PSEHT/1-36---R-L-----------------------------LNLS------------------------
SEQA_SHEFN/1-36---R-L-----------------------------LNLS------------------------
M4R5K5_BIBTR/3-38---R-L-----------------------------LRLP------------------------
SEQA_PSYIN/1-36---R-L-----------------------------LSLP------------------------
J7SKW3_MORMO/1-36---R-M-----------------------------LNLG------------------------
SEQA_PROMH/1-36---R-L-----------------------------LKLD------------------------
SEQA_HAMD5/1-36---R-M-----------------------------FSLT------------------------

PF16777

O25288_HELPY/1-41---R-H----------------------------ILKTI-------------IYKKG------
O25010_HELPY/1-73---R-Y----------------------------ILKAL-------------RKIE.------
E7ABM8_HELFC/1-86---R-Y----------------------------VLKNL-------------VHGKG------

PF09957

Q82BL1_STRAW/2-49---R-I----------------K....RL....DAAEKL------------------------
Q20X13_RHOPB/8-51---S-E----------------A....AR........RL------------------------
Q2FLV1_METHJ/1-47---R-R----------------K....QI.....QITSL------------------------
Q58AH0_CUPMC/1-44---R-E----------------A....AK........RL------------------------
Q3JAZ0_NITOC/1-47---H-H----------------Q....RK.....DLREL------------------------
A1U2W3_MARHV/1-47---L-S----------------K....QQ.....EIRKL------------------------
A1VX34_POLNA/1-45---R-Q----------------A....AR........RL------------------------
Q7AQ19_MYCLE/3-56---E-P----------------GVGGLSEQ..DPEYDEF------------------------
Q73PC1_TREDE/1-47---R-R----------------K....SE.....DLIKL------------------------
B3EKM2_CHLPB/1-47---L-K----------------K....RK.....DLTEL------------------------
Q73R95_TREDE/1-44---K-Y----------------Q....IQ........DL------------------------
Q7NCS8_GLOVI/1-47---A-R----------------K....KR.....NLLDL------------------------
A8ZTF6_DESOH/1-44---R-E----------------S....GK........RL------------------------
Q7D057_AGRFC/1-48---N-L----------------G....RR....KALQEL------------------------
Q2FNJ2_METHJ/1-47---R-R----------------K....QI.....EIISQ------------------------
A5G896_GEOUR/35-78---K-E----------------S....SK........RL------------------------
A5GB97_GEOUR/1-47---R-R----------------K....QA.....EIINL------------------------
Q73SG9_MYCPA/11-61---E-G----------------D...SVAS..EDEYDEF------------------------
A0ZI46_NODSP/1-47---L-K----------------E....QE.....KIKTY------------------------
Q01QU3_SOLUE/1-47---L-G----------------R....QA.....QIRRL------------------------
A4XJM6_CALS8/1-47---N-H----------------S....RK.....KLSEL------------------------
Q124P4_POLSJ/1-47---R-A----------------R....RP.....SIREL------------------------
B1WYD1_CYAA5/1-47---R-R----------------K....QL.....EITEL------------------------
B2HSG4_MYCMM/3-54---E-A----------------GE.NGGGD...DEYDEF------------------------
B8GLV4_THISH/1-43---R-E----------------S....AR........R.------------------------
VAPB6_MYCTU/3-45---R-F----------------R....RI.....EA...------------------------
Y634A_MYCTU/16-68---E-A----------------D...TAEHGHDDEYDEF------------------------
VPB15_MYCTU/7-50---E-P----------------L....GR....DE....------------------------
VPB11_MYCTU/7-49---S-P----------------L....SR.....E....------------------------
Q8YSF9_NOSS1/25-71---S-R----------------R....KK.....NLLDL------------------------

PF09274

E5YNK1_9ENTR/1-74---D-L-----------------------------VDNW-------------LKEND------
Q9F809_ERWAM/1-76---Q-L-----------------------------VDNW-------------LTEHE------
B0ZE05_ECOLX/1-76---Q-L-----------------------------VDNW-------------LKENE------

PF05509

B8EFN4_SHEB2/13-61---I-E------------------------HSLLSFVDAPPK---------PIKQ--------
Q4LC31_SODGL/14-62---V-Q------------------------DHLKRFPDFNPD---------SREV--------
B6ESX2_ALISL/7-55---L-K------------------------DHLLRFQHQDSW---------EVQK--------
A7DVG3_VIBVL/13-61---L-E------------------------HHLELFGVNWEV---------PKSK--------
B2LS54_9VIBR/10-58---L-E------------------------HHLDLFGVNWEV---------PKNN--------
B8EFW0_SHEB2/41-89---L-I------------------------DHLSRFDEMGMG---------LKGK--------
B6ET57_ALISL/12-52---V-K------------------------KDIQ........---------QKLT--------
A0A061Q3R7_9VIBR/12-60---L-S------------------------DHLTKFDRHMTP---------RAKA--------
Q7MBP1_VIBVY/10-58---L-S------------------------HHLTHFDEHMKP---------RTKN--------
A7N8Z3_VIBCB/12-60---L-K------------------------DHLSKFNQHMKP---------RAKS--------
Q5DY84_VIBF1/10-58---L-A------------------------DHVARFSALNEF---------EYIE--------
A6D5H0_9VIBR/18-66---L-E------------------------DHLNSYSNIASV---------GNNV--------
Q6LW96_PHOPR/20-68---L-A------------------------DHLDRYTLIPKS---------KCQY--------
A8QYN9_9GAMM/15-63---L-E------------------------DHLIRYRSISEL---------NQTI--------
A7N8V1_VIBCB/9-57---L-I------------------------DHVQRFHHSPQN---------KLDE--------
E6WK64_PANSA/14-62---L-M------------------------DHLTFFSEIACS---------GKRF--------
B2VB54_ERWT9/25-73---L-D------------------------DHLKSFTDLATP---------GLRF--------
B6ICE9_ECOSE/13-61---L-T------------------------QHLNSVPVLGEN---------SYWE--------
A0A0T7RY16_SALET/14-62---L-R------------------------DHLKRYPDFYNE---------EIFR--------
A0A0U5FL61_SHIFL/14-62---L-Q------------------------DHLQRYPDFYNE---------EIFR--------
A0A0D3RK65_KLEPN/14-62---L-K------------------------DHLNRFPDFYNA---------SLVK--------
A0A0P8E501_ECOLX/14-62---L-R------------------------DHLNRFPDFYNL---------DAIK--------
A0A024KL39_ECOLX/70-118---V-I------------------------DHLIKFPDFYNS---------EIFR--------
A6TIF9_KLEP7/67-115---L-K------------------------AHLFEFPDFYSS---------EVEV--------
A6TIT2_KLEP7/72-120---L-K------------------------AHLLEFPDFYSS---------EVEV--------
Q1MKC7_RHIL3/2-50---I-L------------------------AHLDDVEDIYLA---------ERRL--------

PF02697

T0LS63_9EURY/3-63---R-L.....VKSQSKKDLLLSLRGSV..........EFED---------KNGLLMDLE--K
VPB12_SULTO/2-69---E-LIE...ESLSVRRKKIEKYFGIL...NEEEA.RGLAK---------EIEEMRKRT--D
K0ILD1_NITGG/5-70---R-LTG...EGNIRQFRELLESKDF....PDRELADNIEK---------ASKEFGE..--.
Y468_SULAC/3-73---E-LIEFYNKNRKGNKDVLLQMFGIL...NEEEA.TEMAS---------ETLNIRKSF--R
VAPB3_METAC/4-69---R-Y.....YPKKRKLSEVLAEIG.....PNPELADAIEK---------VSGEMRAE.--K
VPB21_SULTO/3-69---R-LVK...SSRKN....IMDYAGIWGDMNDEEVNKLFED---------LKKMWERW.--.
D3RYZ8_FERPA/3-69---E-LL....KARRGNSEVLVKMFGVL...SEEEA.DRAKR---------KIEEIEKEF--E
Y1222_PYRFU/3-69---E-LL....KERKGNKEVLKRIFGIL...SEEEY.QEVKK---------RLKELEGEF--E
L0K336_9EURY/8-69---R-IAG...ERS......LLDLAGIL...SDEEA.EEMRD---------AIDERETQS--R
A4YFM7_METS5/2-68---N-LIE...ELKVARNKRLMKFFGIL...KEDEA.KQLEE---------DVRSVREEF--.
Q96ZV9_SULTO/7-74---L-LIEEYRKKKVERG..IDKLREIL...TDEDI.KKIED---------SHKKMHEEF--R
VPB15_ARCFU/4-66---R-LTE........KRRDLLEFAGKW.....KDSGEEIEK---------IILEGRKEF--D
T0LZ28_9EURY/35-97---R-LTN...KSN......VLDLRGIM...SEDEG.KSIEK---------NIRESRKMS--K
F4BV58_METCG/4-69---R-LLK...KDKVN....LSEYFGAL...KEDPILDRLEA---------DSKRIREMA--R
Y1752_THEKO/3-69---E-LIG...KKKKGNLDVLMIAFGTR...TPEEV.EELKK---------ELKEVEEWM--.
D3SWF9_NATMM/7-71---R-LFE......KDGEHDLLAGFGRW...SDDHA.DRVRE---------ARKKEKEKS--K
H1Z229_9EURY/8-73---I-LLE...KQKTG....TDRFFGVL...AGSPVLDEIQK---------LTEENRHNA--K
D3RXH8_FERPA/2-66---K-LLK...KKNTN....IKKYFGVL...KDSEVLDEIEK---------IL.EMRRSA--R
B9LNT2_HALLT/4-66---R-IAG...ERS......WTEVAGIL...SEDEA.DELES---------LVEEGRSRS--R
F7PL26_9EURY/4-69---R-LLG......GDDGHPLFDLVGLL...DDAEA.ERVRE---------RADKFRENV--D
F2KPT0_ARCVS/2-67---K-LLK...RERFN....IEEYFGVL...RESSVLDEIME---------YSRKARKSA--R
E6N6M2_9ARCH/6-71---R-LLK...RSRVN....IGEFFGCM...KDSPLLEELES---------STRRLREMA--R
VPB16_ARCFU/2-67---R-LIE...GRKKRGIEILERYAGSL...SDSEL....EK---------IVMEERRKF--R
D3RY16_FERPA/3-67---D-LI.....KKEGNFDLLLIAFGTR...NDEEV.EELKR---------EIGEAEKWM--.
Y1481_ARCFU/2-66---K-LLK...RKKTD....IRRYFGVL...KDSEVLDEIEK---------SL.NARKSA--R
K0IGR2_NITGG/4-71---R-L.....GYEKGSAKRLLELAKSREPISSDTA.KIMEE---------TSREFRKN.--.
E6N5Q0_9ARCH/3-69---R-LVG......QAKYRPLSEFAGRW...AGDDIDKVFEE---------ILRERERAE--S
VAPB3_METJA/5-71---E-LLE...ERKRKNLDVFMIAFGSR...SEEDV.EKLKK---------ELKEAEKWM--.
VPB18_ARCFU/3-66---E-LV.....KKEGNFDLLMVAFGTR...SEEEV.EKLKR---------EMKEVEEW.--.
K0I6Z0_NITGG/1-65---R-......KFPKGDPARILAVVKSMK..PNPDLSQSVRQ---------ASKEMRRDF--K
T0LWN0_9EURY/4-68---E-LLK...RKGS.....LLPLWSSL...SESEGMDLIET---------DLKAIRNGA--K
K0I6W7_NITGG/3-67---R-......KFQKGNAGAILAYYKKRG..PNYDLANAVEE---------ASRKLRK..--.
F8D5A7_HALXS/4-66---R-LAG...ERS......WNEVAGIL...SEEEA.SDLES---------AIEEGRTRS--R
T0LIW2_9EURY/4-66---R-LTK...KTS......ILELKGLL...SISEA.DSILN---------SIEESRKLS--R
A7I6Z1_METB6/4-69---K-Y.....YPIRRKLSDVLEELG.....DCTAFADTIGR---------VSKEMRKT.--K
VAPB4_PYRFU/3-69---E-LL....REKKGNSVALKHIYGIL...NGEEY.RETRK---------RLKELEKEF--E
D3S0D8_FERPA/2-67---E-LIK...RNVEKRIEMLIKSAEKT...GYED...ELEK---------ISKEIRKSF--R
L0K2C6_9EURY/4-67---R-LLD...ETTTD....WREEFGTL...DETDA.DELEQ---------LVADSRKRA--.

PF10723

Q93GS8_SALTY/8-88---L-L----------------------------IEREMAKR---------...A--------
Q326V9_SHIDS/1-86---K-I----------------------------IKDELQRL---------DILK--------
Q326M6_SHIDS/1-79---H-W----------------------------ILKEKAA.---------....--------

PF07362

H0Q687_9RHOO/11-81---R-AVA.......ERRAELWLAENRNALESSNAYVEAHGL---------PLARYRMF----
K0I4M5_9BURK/9-79---A-EVQ.......RRYWERWNAANQEAIAAYNARIESEGL---------PLAQYRTF----
L0DQK3_THIND/1-68---G-AVR.......EQRRKLWLAENTGAIEDYNSRIDARGS---------YADRVRRF----
B5EG30_GEOBB/12-82---E-MLR.......KETSRSWQEENREAIEEYNSRVQSDGT---------FSDDLRHF----
D4YZH7_SPHJU/13-83---E-QIA.......KERGRLWRVENASALASSNDYVEQNGL---------PLTRHRQF----
B2JXB4_PARP8/10-80---D-AIK.......AEEGRRWAQENAEFIKNTNDWVEQNGL---------PLAEYRMF----
Q82VK5_NITEU/17-87---E-VVR.......HEQERRWREEHADFITAYNATIEAENL---------PLDEWRSF----
B0T4X1_CAUSK/3-80---L-HLQKVDPAGAEERARQWVEENAAVISELNRFVEEHGA---------FGAEWRRW----
E0SK21_DICD3/2-72---K-EAR.......RIKAEEWKKENREGMEEVARFIAQHGS---------FADENRNW----
Q1GN85_SPHAL/11-80---A-EVK.......KAREAAWKKENRAAIESWNDYIRENGM---------PYDEYRQ.----
Q326Z9_SHIDS/2-72---K-EAR.......RLRAERWQAENQQGMAEIARFIEMNGS---------FADENRDW----
D3VG79_XENNA/22-92---A-ELK.......SAAAEQWKRDNREGFEELNRITREHGL---------LSDQYRTF----
W0L945_9GAMM/12-76---Q-AIE.......AKKNER..EKEKADIQAMNLFMEKAGM---------LSDD....----
F5XZ64_RAMTT/9-77---D-YVSQQ.....QQARGSHQQWAAACAAGWNEIYEKVGS---------FADE....----
G7Z7L4_AZOL4/17-86---A-WMQDE.....RRKRDDDPAHRRKVVAAWNAFDEKHGR---------FADE...W----
Q98F99_RHILO/26-96---K-AIA.......KKKTLQWQAENKKAIASSNGYVSRNGL---------PLAKYRPF----
S5Z1L5_PARAH/10-80---Q-AVR.......EAQAAAWKQENAAALASSNAWVDENDL---------PLARYRPF----
A5GAE8_GEOUR/23-93---E-LIR.......EEKRRQWLEENREAIEVYNRRIEADGV---------FSDGLRRF----
Q93GR6_SALTY/2-72---N-EAR.......RLRAERWQEENREGMAEVASFIEANGS---------FADDNRNW----
A7HPK7_PARL1/5-75---T-RAR.......EEERKRWVEENRDAIEAFNRRIERDGV---------WSDGLRRF----
E1VR77_9GAMM/21-91---E-LVN.......AKQRELWKRENKTAIEAYNQLVDEHGT---------FSDELRSF----
G7ZEQ7_AZOL4/20-89---D-QIA.......ELQRKRWLEENREALASSNAYVEAHGL---------PLARYRP.----
Q5P2R6_AROAE/22-92---E-LVR.......RERARRWKEEYAEFIEVYNRIVEAEGV---------PLAEWRSF----
Q32K47_SHIDS/7-77---A-ELK.......KHAATRWREENAEAIAALNQLADETGC---------FSDEYRRF----
A0L724_MAGMM/11-81---K-LVA.......ERQQQVWKEENQEAIKQYNSRVLTDGL---------FGDKLRQF----
A8GC18_SERP5/8-78---A-ELR.......QHEMRKWKEDNREAIEALNRFHDEHGC---------FSDEYRTF----
A1U420_MARHV/11-81---E-AVK.......LHKRSKWLNENAEAIESSNAYVEANGL---------PLARHRQF----
Q8PCL0_XANCP/29-98---D-YVTKE.....RDSHSARAMELQRAASEWKTFTDAHGS---------FADE...F----
S6AR37_PSERE/11-81---D-ALK.......ARQRELWLEENRTAMAAYNEKVEAEGV---------FSDDVRRF----
Q6D9V2_PECAS/2-71---R-KAR.......RIKAEEWKKENRERMEDIARFIAKNVF---------FADENRN.----
Q21DI4_SACD2/11-81---Q-QLA.......QAEATKWAKKNKAAIKAYNSFVEENGC---------FADEYRAF----
I1XLK6_METNJ/11-81---D-KLA.......KLNSEKWAEENKNAIQAYNEFVEEHGC---------FGDEFREF----
Q7N4P4_PHOLL/9-79---S-ELK.......AVESERWKRENKAGMEELNRITNEHGL---------LSDKYRVF----
Q21U54_RHOFT/9-79---E-EVN.......RRYWEKWNEDNQVAIDHYNARIDSEGL---------PLAKYRSF----
C3MCA1_SINFN/7-77---Q-AVR.......AEQERLWRVENAKSIVDANDFVEKRGL---------PLAKLRQF----
B3PDY0_CELJU/63-133---E-QLR.......NEQRAQWLRENADAIKAYNQFVESNGT---------FSDSIRKF----
C7JJ40_ACEP3/1-66---S-AIA.......SVRAQQWLAENRSSLEASRQYVEKNGL---------PLADYRNF----
K7SHF6_GLUOY/17-86---D-YLQSA.....RQQREDEQRKLDGVIDAMNDLHARHGF---------LSDE...F----
K7ABL7_9ALTE/6-76---K-AVK.......VAKYERWCQENQQAIAQHNRKIDEQGT---------FSEKLRSY----
E0SMR7_DICD3/9-79---R-EIR.......ASEAERWQRENRAGLQELNRITDEHGL---------LSDDYRTF----
C4LCG0_TOLAT/11-81---Q-EVH.......EKKKAEWLQQNVEAISACNELTEKHGL---------FSDSFRAF----
D5QE46_KOMHA/17-86---D-YLHAA.....REKREDEQRQLDSVIDVVNALHARHGF---------LSDE...F----
K0C8E2_ALCDB/11-81---E-ELA.......RHESARWVEENRAAITKYNESVEQHGC---------FGDEFREF----
M4XDA7_PSEDE/11-81---E-EVK.......QRLARQWLEQNREAIDSYNRHVEENGV---------FSEGLRSF----
H2IXW0_RAHAC/27-92---E-AVK.......EKQRTLFLEENQQAMDSCNAFTEKAGL---------FSQ.....----
Q2RNE8_RHORT/14-84---L-AIA.......ERRADLWLAENRTALASSNAFVEEHGL---------PLAKYQRF----
Q7MZJ1_PHOLL/2-72---R-EAQ.......RIKAESWKADNRKGLEEIAQFIEQYGS---------FADENRNW----
G7Z9X1_AZOL4/11-74---D-EV..........AKADRERRLDDVIEAWNRFDEKHGS---------FADQ....----
V6F3K3_9PROT/6-76---K-LVR.......EARAKAWAEENRDAIESQNRWIEKHGL---------FSDHFRFF----
I2B9K4_SHIBC/6-76---A-ELK.......KHASTRWKEENREGLEALNRFHDEHGH---------FSDDYRAF----
D3VAK1_XENNA/23-87---Q-EIE.......ARKNEQ..IQEKQDMQAMNAFIERAGM---------FTDD....----
E6X2R7_NITSE/11-81---R-IVK.......EKEEKQWRKENRTAIEVQNRRVEKEGA---------FSDEFRRF----
Q6D8L1_PECAS/2-72---K-EDH.......RIKTEVWKKENREGMEDVARFITQNGS---------FADENRNW----
G0A2L0_METMM/9-79---N-LVR.......GEREKRWQQEHAEFIAAYNQTVEQEGL---------PLDEWRSF----
D6Z0A2_DESAT/12-82---Q-ATA.......ERRAQLWLEENQAALESSNEYAERNGL---------PLARYRSF----

PF04221

DINJ_ECOLI/4-84---I-TLTKVAREKALPFDLREP..NQLTIQSIKNSEAGIDV......HKAKDADDLFDK--L
Q9KML3_VIBCH/3-84---L-FAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKG.......HKAESVEAMLNE--L
Q9PBQ9_XYLFA/4-84---L-LLTKVAQDKALPFEPLIP..NATTIKAMREARAGKGE......TVTLGELRATIR--A
RELB_HAEIN/5-93---M-FLAQIAKTRSIPVDLNYLRPNKETLAAIDELDSGNAESFFIEASENYSAEEFTKR--I
RELB_ECOLI/1-78---L-MLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNP..........KPVRVTLDE--.
Q9A0Y8_STRP1/13-96---M-FLNQIILTGGIPFDVSLPEAPQRVNVDYMSQEKFYDK.....LITSFEDAKTGNR--Q

PF03693

PARD_XYLFA/1-78---A-GLRLLEEHETKVKALQDALNVRHQSGEPRPFDSEVFL----------...SRMHT--Q
PARD1_CAUCR/2-82---A-GLRLLEENEAKLAALRAALIEGEESGFIEDFDFDAFI----------EERSRASA--P
PARD_VIBCH/1-80---S-ALRLLENQETKLQSLRQLLIEGEQSGDAD.YDLDSFI----------NELDSENI--R
PARD1_MYCTU/1-80---S-ALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFL----------GRKRADAS--.

PF14384

A1AQ37_PELPD/17-82---E-A-----------------------------LREWL-----------------------
Q73R28_TREDE/11-81---E-I-----------------------------LSKYA-----------------------
B0JRR8_MICAN/35-94---R-A-----------------------------LREYV-----------------------
Q92KN5_RHIME/26-103---E-A-----------------------------LRKAA-----------------------
Q3J2R4_RHOS4/23-97---R-A-----------------------------LREAV-----------------------
B8F509_HAEPS/13-99---E-V-----------------------------LLKHI-----------------------
A5GE33_GEOUR/45-107---A-A-----------------------------LKEWM-----------------------
A1WJ32_VEREI/17-83---D-A-----------------------------LKDWV-----------------------
A6WWJ1_OCHA4/29-103---E-A-----------------------------LRKAV-----------------------
Q2RSU6_RHORT/41-96---A-V-----------------------------LRAYM-----------------------
E3I091_RHOVT/23-97---D-V-----------------------------LRRAV-----------------------
Q215B0_RHOPB/13-90---D-A-----------------------------LRKIV-----------------------
C4K882_HAMD5/42-98---R-I-----------------------------LRSAM-----------------------
Q20YH7_RHOPB/27-93---E-V-----------------------------LKSHM-----------------------
D3SAY2_THISK/33-91---S-A-----------------------------LKDWL-----------------------
C4KAB9_THASP/30-98---D-A-----------------------------LREWV-----------------------
Q28LR0_JANSC/24-89---D-V-----------------------------LRAFM-----------------------
D5X2J5_THIK1/28-104---A-A-----------------------------LRQYL-----------------------
A8HS57_AZOC5/58-131---E-A-----------------------------LDKAV-----------------------
B1M0P6_METRJ/36-100---A-A-----------------------------LMEAI-----------------------
A9BQV6_DELAS/27-103---E-L-----------------------------LRADI-----------------------
D5CSA1_SIDLE/6-67---E-A-----------------------------LKQYA-----------------------
C1DP04_AZOVD/25-95---Q-A-----------------------------LKEYV-----------------------
A1WLU7_VEREI/13-87---D-A-----------------------------LKDWL-----------------------
Q73LQ6_TREDE/25-85---S-I-----------------------------LREAI-----------------------
A5V5L4_SPHWW/13-90---E-A-----------------------------LRKAA-----------------------
A6WZ44_OCHA4/29-94---E-A-----------------------------LRKAK-----------------------
B0T4V2_CAUSK/34-92---R-V-----------------------------LRQHV-----------------------
B6JFY4_OLICO/17-84---A-D-----------------------------LRKAR-----------------------
Q8KUW1_SYNE7/45-104---A-A-----------------------------LREWL-----------------------
Q0KBY4_CUPNH/27-90---A-T-----------------------------LNVAL-----------------------
B6IVZ4_RHOCS/9-71---A-L-----------------------------LRNAL-----------------------
Q2KVN5_BORA1/5-79---A-A-----------------------------LKDWL-----------------------
Q39RZ9_GEOMG/16-77---D-A-----------------------------LRQFA-----------------------
A8GIR2_SERP5/28-84---A-V-----------------------------LRAAM-----------------------
A9IES8_BORPD/41-97---A-I-----------------------------LRREM-----------------------
A1VRX0_POLNA/13-87---A-A-----------------------------LKDWL-----------------------
Q31JV0_SYNE7/18-82---E-L-----------------------------LSKET-----------------------
A1WB35_ACISJ/28-89---E-A-----------------------------LKSWV-----------------------
B2ICD8_BEII9/27-96---D-V-----------------------------LREFV-----------------------
Q73L16_TREDE/8-67---R-I-----------------------------IDEAF-----------------------
C3M8F8_HAMD5/13-85---C-A-----------------------------MKNWL-----------------------
C7RRD3_ACCPU/30-92---G-V-----------------------------LRQYV-----------------------
B6IW20_RHOCS/40-99---A-A-----------------------------LRAYM-----------------------
A8LQR3_DINSH/3-99---R-L-----------------------------LATYA-----------------------
C4KAB3_THASP/28-89---A-A-----------------------------LKDWL-----------------------
A3N0B8_ACTP2/11-88---Q-V-----------------------------LEDYV-----------------------
D4ZU97_ARTPN/29-87---R-L-----------------------------LRSYM-----------------------
K9XMQ0_9CHRO/29-86---Q-L-----------------------------LRAY.-----------------------
Q2L2E1_BORA1/28-86---A-A-----------------------------LRDWL-----------------------
Q63NA3_BURPS/28-88---D-A-----------------------------LREWL-----------------------
Q6N573_RHOPA/22-88---A-D-----------------------------LRRV.-----------------------
Q7CI23_YERPE/12-90---E-A-----------------------------LRDYA-----------------------
Q7CP71_SALTY/37-93---A-I-----------------------------LREAM-----------------------
Q9PD17_XYLFA/28-105---A-A-----------------------------LRQFI-----------------------
V6F518_9PROT/28-104---E-I-----------------------------LRK..-----------------------

PF07764

T0VBY9_9ENTE/1-69---Q-A-----------------------------LEEY-------------IRKYLPDK--L
I3U5Z1_ENTFC/1-71---I-R-----------------------------LRSK-------------LKSVLIVQ--Y

PF17414

F4HAL0_GALAU/88-147---Y-M---------IDEQESKALYESQIHAMKKNLQELL-----------------------
MATP_PHOPR/88-147---Y-L---------LSESNRTETVTKTVSDIRKDLSDLL-----------------------
MATP_HAEDU/88-147---H-L---------IDERENQHLYSEQMAKMKASLKDLL-----------------------
M1S7Y5_MORMO/88-147---Q-L---------LEDAERKEKYATKMTSLKEDLQSLL-----------------------
Q5E5A7_VIBF1/88-147---Y-L---------LSEASKTEKVSRTVSSLKADLHELL-----------------------
MATP_VIBTL/88-147---Y-L---------VSEASRSEQASKTVTNLKEDLSKLL-----------------------
I2BAK8_SHIBC/88-147---Q-L---------IEDAERKEQYETQMSSLKQDLQALL-----------------------
E0WTV2_9ENTR/88-147---Q-L---------IEDAEYKKKYVEQISSLKQELKGML-----------------------
M4R6X9_BIBTR/88-147---Y-L---------IDESENKQIYTEQVDKMKQNLKALL-----------------------
M9WUL5_MANHA/88-147---K-L---------TDELENKQLYLEQVAKMKSSLKDLL-----------------------
Q2NU72_SODGM/88-147---T-L---------LEDAERKEKYDKTLSSLRSDLKAIL-----------------------
B4EVD5_PROMH/88-147---Q-L---------IEDAERKEQYALKVHNLKDGLIELL-----------------------
A6VPA7_ACTSZ/88-147---Y-M---------IDERESKALYESQMSAMKAGLKDLL-----------------------
X2H502_9GAMM/88-147---Q-L---------IEDAEQKEQYATKVSTIKDDLQSLL-----------------------
MATP_PHOLL/88-147---Q-L---------IEDAERKEKYANQMSSLKHDLEAIL-----------------------

PF16762

C7RVN5_ACCPU/5-80---D-AVRWRMFDQAVQGVKAR..NADVDVGDLQAAIDE-------------ACAAVRS----
A1TQN5_ACIAC/2-78---E-AVRAYLFERAVEQAKAA..TAGMGEAELNDLIDE-------------AVQWARE----
Q9PHI2_XYLFA/2-78---E-AVRTYIFERAVEDAKAA..NANVSEADLTAIVNE-------------AVQWARE----
C7JJ67_ACEP3/2-78---D-AVRSYLLEQAVEQAKAA..SEDMSEAELADLVNE-------------AVQWARG----
A4VQ14_PSEU5/2-78---E-AVRAHILELSAEQAKAA..NAHLSEAELTNAVDE-------------ALDWARK----
M4SBY8_9SPHN/3-78---E-SVKWRLLDLTLAEARAG..FDDLSVDELDSLIEE-------------AVADARK----
I3Y769_THIV6/5-79---E-AVQRRLRELTLGETRQEA.ERPQDQDRVQDFVDA-------------PLMEA..----
R5EAP8_9BURK/2-74---N-AVGKFVKDPRALDKES.....DVTEGEISDMINA-------------AVQRTKE----
Q5P0S5_AROAE/2-78---E-AVRAHILELSAEEAKAA..NADVSEKDLSAMVEE-------------ALDWAKA----
R5PIP0_9BURK/9-86---K-AVSRYIISSLAEEAKEEVRTSGLSQDDLDKIIAD-------------GVMWAKE----
E1VKG4_9GAMM/2-78---E-AVRAHILELTAEQAKAA..NAEVNEDDLSAMVDE-------------ALNWARQ----

PF11903

Q4KC28_PSEF5/1-66---.-........................DLINKLLLNK......-------.PDLLRGR--A
B4SF37_PELPB/2-74---.-........................FIRDLLVARAEGESLS-------TPFVPEGH--R
A0QXV1_MYCS2/6-107---A-LAGDLALRDLTPEEGVVFNAEISAAIEENLAHTDYGQVLA-------GRGVTTVA--L
A9BMX0_DELAS/1-73---.-........................GICALLLQEAAATLKL-------GEPEAAPA--P
A6T935_KLEP7/1-66---.-........................QIKLLMLKSG......-------.SDRLLEV--I
Q7NVK9_CHRVO/1-73---.-........................EICQLLLKAGQDGGGL-------DLRRQAME--S
A1T476_MYCVP/6-107---A-LAGDVHTRELSDEEGVVFNAEISAAIQERLASADYGAVLA-------TRGITTVA--L
Q3AQ94_CHLCH/4-76---.-........................FIAESLASLAEPREHA-------TPFIPRSS--K
Q1GXH1_METFK/1-73---.-........................DICRLLLHIEQSGSEV-------GNALKPAG--G
Q2SQH0_HAHCH/2-95---F-LSGEI........QIDNLNNDERLMASRTLFDQFIDDDFS-------SVTDELKE--R
Q13JR3_BURXL/1-70---.-........................EIATRELRAA...GVV-------TQAVKVAL--T
Q15VU5_PSEA6/1-66---.-........................ELIVKELENA......-------.NADTALK--V
Q0RY55_RHOJR/40-141---V-LDGRRDYDELTDREQAVVRAEWTERITERREGLNLAEQFA-------HSGRSYVE--L
Q220F4_RHOFT/1-73---.-........................EICQLLIRAELAGGLD-------IGVAVTGQ--L
Q47D61_DECAR/1-73---.-........................EICRLLIQAEHQALED-------SDLPVSLS--K
Q0C2J2_HYPNA/1-68---.-........................EIVQREMAAA.....G-------VTPEPLGA--A
A7HVP7_PARL1/11-109---A-LSGEIGTV...DLTCEEKDVWLDSFVEKMGQPGSDEEAWF-------ARRRQLGL--G
A4Y172_PSEMY/1-70---.-........................EVMAAEMRAA...GVA-------VPPRMADA--S
D0J2S6_COMT2/1-68---.-........................GICALLLQQAERELQP-------ASAH....--.
Q63SV8_BURPS/1-72---.-........................EICRLLIETEIQGDEA-------APSVDAAR--.

PF11020

F4F896_VERMA/2-77---Y-A-----------------------------MEQATD----------------------
B3S7R4_TRIAD/8-90---L-F-----------------------------LSN...----------------------
Q2GKE5_ANAPZ/4-84---Y-A-----------------------------LKVATT----------------------
B9KIB3_ANAMF/4-84---Y-A-----------------------------LNVASR----------------------
F7XUD1_MIDMI/1-81---Y-A-----------------------------LEAANN----------------------
Q2GCJ4_NEOSM/1-81---Y-A-----------------------------LKVAEQ----------------------
K9QB18_9NOSO/702-781---Y-A-----------------------------LSNANQ----------------------
A5CC80_ORITB/1-81---Y-A-----------------------------LGSAQG----------------------
Q2GG71_EHRCR/4-84---Y-A-----------------------------LTVASH----------------------

PF15970

B4EVM4_PROMH/3-83---M-P------------SEPQSGDFIVYLPPISCLKIA------------------------
Q0WCU1_YERPE/3-83---A-P------------SALQPGDIAVHVPILVRLKAE------------------------

PF10784

E1I390_ECOLX/6-77---R-AALTAGLALYRQDPRTPFLLCELLTKETTFSDIVNIL---------------------
A0A028AHT8_ECOLX/8-78---R-NAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLL---------------------
B7T4Y5_KLEPN/5-76---R-AMMLCGAALMKQDERLPFLIAEFLTESTSMQDIQRII---------------------
D2AJQ5_SHIF2/10-81---R-QSLICGAALYSVAPRLLTLISVFFSEKITAENLVKLI---------------------
A7ZGW0_ECO24/8-78---R-QALITGLIMHQLDERIPAVLTALFTRELNADEVISQI---------------------
A0A026RDF4_ECOLX/8-79---R-AMLVTGAAFAAIDKRLPLLISELLTENTTLDDINKVI---------------------
A6TIQ1_KLEP7/4-74---R-TAATAGAVVYQVDARLPALIPVFFAGQLSAVRLCAVM---------------------
A7M7F6_9GAMM/10-80---R-NAIITTAALHQLDPRLPVLLATLYNGQLTSEQLVNLV---------------------
A0A143DV46_ECOLX/6-77---R-AAFLAGLALIKRNPAFAYWMAEWPEDNLPFNTVSIKE---------------------
I2RCP5_ECOLX/6-77---R-VAFLAGLALMKINPAEAYRLAAWADDEALSLTQTRTE---------------------
A6TIQ1_KLEP7/109-178---R-NLIITGLALHTTAPELPRLLASMPVPPTSVSELQALV---------------------

PF08870

R5X372_9CLOT/4-111...Q.YDLLFKALIE....QHAGKHLTDDEYFPNHAKLHIDRGAVMLKNRYNYSS--------
B0JNR9_MICAN/7-117...E.MADIFLIALK.QRCHQDGLGT.DKETLTQQFRLHLHRGIGYLAGDTKLKK--------
K9UL30_9CYAN/9-118...E.LADISILALK.QRCYRDGLDL.TPEILAQQFRLHLHRGIGYLAGDPNMRK--------
K8GJN7_9CYAN/8-118...A.IADLLTIALK.QRCCNDGLPT.DRETLAIQFRLHLHRGIGYLAGDSTIKT--------
K9XZW3_STAC7/7-117...E.IADILLLALK.KRCDRDGLET.NQETLKMQFILHLHRGISYLAGELDFKN--------
R7K532_9FIRM/4-112...E.YDDLFKALII....NKNGCDLSEEEYFPKYLKAHLDRGAKLLYAEYKYSG--------
D1AEG3_THECD/6-115...A.YGDIYLALLK.QRCVADGQEP.TEENVSHTLTVHLHRGIGHLAGRKDLKN--------
K9Z1H5_CYAAP/7-117...E.IAEILLLALI.HRCHQDGFET.NAETLNQQFRLHLHRGINYLVTDLESKT--------
W0E949_9FIRM/5-115...E.NHEIYNALIL.AWCIKDGLPT.DEETLAKYFKLHLNRGIAYLSGTNVIKS--------
V6K4J2_STRRC/5-116...TIYGDIYLALLK.QRCLADGEEP.TEEALSRTLTVHIHRGIGYMHGRRDLRS--------
K4IEY7_PSYTT/2-118GNVS.NTIIFKSVLD....QHYGRNTFEDE.FIKLFKLHLNHGLDIWNTKIEKAN--------
D6CZD3_9BACE/5-107...S.NLPYYIGLIC....VKYGLYK.TDKDIPKYIKLHIDDGLQLMNKEL....--------
B8FD42_DESAA/6-115...E.HHELYLALLE.QRCKKDGFEI.SNEVINEQFKLHLHRGINYLFSNKDASS--------
A5G4D6_GEOUR/7-118...Q.YQKEFAAMIM.LRSKQHGININDREEIAQYFRSHLERGIVSLQTSKDVSS--------
Q82J53_STRAW/10-120...Q.YGDLYLALLK.QRCVAIGEEP.NDENIQRVLTVHVHRGIGYLGADKQMAT--------
L0H1B2_9GAMM/8-117...D.QQDLFRSLII.LRASKDGFPS.DSEGIGECFRAHLHRGLNFLSSGLDTRS--------
I3Z2Y2_BELBD/5-108...D.YGDFYMAILC....VHYNIHI.SDKDLARYVKMHIDDGLEMIEKEFK...--------
K9PPN2_9CYAN/7-117...E.MSDILLLALK.QRCHNDGYPT.DKETLATQFRLHLHRGIGYLAGDPNIKK--------
Q11AI6_CHESB/5-115...E.YGALIAAFLRFVEEGQEPDPPLEDEILLDRLRGHIHRGVGTLSVRAKSPA--------
K9YCG7_HALP7/7-117...E.MSNVFILALK.QRCYQDGLGT.DAETLAEQFRLHLHRGISYLAGDPNLRS--------
Q2S6R4_HAHCH/5-109...D.HGDIIEMLLK......QKYPNLDNKDYYKAWAIHVDDGAIVIENKSSLES--------
Q10Y61_TRIEI/7-117...K.FADILLVALK.QRCHNDGIGI.DQETLASQFRLHLHRGIGYLAGDPNIKN--------
F4L4C0_HALH1/5-110...K.HRTFFIALIC....QHYEIYK.TDENIRKYIKMHIDDGLELMDKFFESN.--------
R5HMI8_9FIRM/4-109...D.NDTYFKVLIE....QVEGRYLTDEEYFPQYVKAHIDRGSQLLLDMYNHA.--------
D4ZRL0_ARTPN/7-117...E.MSNILTTALK.QRCYEDGLGT.SPETLEQQFRLHLHRGIGYLAGDSELQT--------
A7I566_METB6/7-112...E.WDTFFIALVK.ERCIHDKLDP..EEDLYDQLRAHLNRGVFGIFPQIKS..--------
D4ZK78_SHEVD/5-115...D.TQLVSEQLLK......LKYPGLEGRPLMSAWAAHVEDGIAAIRNHRKIND--------
C1F5K3_ACIC5/21-129...H.EEDAYKAVLL.ARVIKDFGTV.SPSLISTQFRLHLHRGISRLAG.KKIRS--------
C4LF32_TOLAT/5-110...E.TSDITELMLK......LYYPNLDGKKYQQAWAAHVEYGISSLRNHKSLLN--------
K9YIM9_CYASC/15-125...N.MGDVLLLALR.QRCYQDGLEL.DDVTLKEQFLLHLHRGIGYLVGDMNLKK--------
E0UFG8_CYAP2/7-117...E.MADVLLIALK.MRCYNDGLGT.DQETLAHQFRLHLHRGIGYLAGDMTIKK--------
A6Q5M6_NITSB/1-122LELSGEQGDYNDIIAVIAANADNVQLKNEKEFEKRLEYHCERGFQILASSLNENS--------
Q16C14_ROSDO/5-114...D.FQPLFIDLLKYVEFGAEEIET.DDSDLLARLRLHIDRGVRQLSVRLKSPA--------
B1MK94_MYCA9/5-115...E.HGDELLALVR.YRCHVDGLAT.DDDTIGQQLRLHLHRGIGYLVGDPRVTN--------
E0SAH1_DICD3/5-112...E.TLQATELVLK......MLYPQLEQKILIKAWAAHVEDGIAALRNYRNLKD--------
A8AM62_CITK8/5-110...D.TGVATELILK......MLYPNFDGKKMMQAWAAHVDDGSASLRNHRELIS--------
Q3ICW0_PSEHT/11-117...E.YADVYLAVLR.EAYQKQSAHL.EGVHFGDFLKLHLNRGISFSLSFPS...--------
R5NP02_9CLOT/11-121...E.YSDIYDALMI.AWCKRMNLST.DEETLSKYFKLHLERGIAHLSGTNFIKN--------
Q12MQ9_SHEDO/7-111...D.LTLVIDCTLK......MLYPSLDSKELEKAWATHVQHGVKTLRSAKSLVD--------
S6ABQ5_9PROT/5-107...D.AALVYESLLK......QAHGDLTPKQAQQMLAGHIDNGVGKIKHAKNV..--------
K9V144_9CYAN/7-117...E.ISDMLLIVLK.QRCYNDGLGT.EKETLAEQLHLHLHRGIGYLAGDSNIKK--------
K7AC95_9ALTE/5-111...K.TQLVTELLLK......QKYPELEGKGLQTAWASHVEHGISSLRNVKSLHK--------

PF01340

METJ_VIBVY/3-99---EAFLHAYTGQPLPTDEDLRKDRPDDIPTEAKELMTAMGIE--------------------
Q15NT2_PSEA6/6-102---EAFLHAFTGQPLPNDNDLQKDNDNRIPSDALRIMQEMGID--------------------
K7AFK6_9ALTE/6-102---EAFLHAFTGQPLPDDEDLGKDNTQLIPKEVRKLMMEMNLS--------------------
Q489Q2_COLP3/3-99---EAFLHAFTGQPLPDDEDLAKDNNEKLPASVRRLLEAKGIT--------------------
METJ_SALTY/3-99---EAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMRELGID--------------------
Q5QV41_IDILO/2-95---EAFLHAFTGQPLPEDEDLQKSNPNKIPKAVREELEAR...--------------------

PF07181

VIRC2_AGRFC/1-200IPHT-AFEKSIIVQTSRMFPVSLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKA..T
Q2K2E4_RHIEC/1-199IPQE-TSEKRVIVQTSRMLPVSALKIARDHFDPSGLETSRAFGLKLATAALASFFDAAKA..P
B9K406_AGRVS/3-202ISH.-VVNKPIIVQTSRMFPVSLLELARNHFDPLRLETARAFGHKLATAALASFFATEKTRKE

PF11423

M1RN95_MORMO/53-80---------------------------------------------------------------
RMNT_BPP22/53-80---------------------------------------------------------------

PF10802

Y366_METJA/14-87---L-------TEEEEVIIQRLGKSANLLLNCE.LVKLD------------------------
Q6LZ85_METMP/6-80---L-------SDIEKKIVEKHGKATSLLMNCYIVMNRE------------------------
Q6M002_METMP/6-80---L-------SEEEQKIIKKAGKLTGHLVNYVILTERE------------------------
D7DQS3_METV3/5-78---L-------SDKENEIVSRYGIGANFLLNCIIFQEEE------------------------

PF08972

Q6N1R0_RHOPA/3-76---K-MPDLIQDVLVENADPR.AGTDVPFELVTSSRAAPRFQV--------------------
Q73QJ0_TREDE/2-73---R-VRYAVPDLLQENNQIP..HNQTTLHFCAEKSERM..YA--------------------
Q20YW9_RHOPB/21-94---K-LPDMIQDVLTDNADPR.AGTDVRFELITHSHPRPRSRV--------------------
A0ZK26_NODSP/6-80---K-LEMMIPELMELNQASSFGKKPVVLDLTS.HFQQPIGVG--------------------
Q5SJJ5_THET8/3-73---K-LAVMVPELLEENGVAL..ELPVELRLEA...TRPLVFS--------------------
Q21AP4_RHOPB/7-78---K-VSAMTLDLLPDNHPGV.DPAQVYLQITALREAQP..AA--------------------

PF08681

Q8E866_SHEON/19-95AIVESETT...LNLNQRAWAQFE.TILDN...PRKATPVLKTLFS.........E--------
Q7N880_PHOLL/12-90NTLLEHSF...MIVSPEIFNAFI.AKLDA...PAVPNERLIKTA.......NMKK--------
Q7N7Z2_PHOLL/8-88RLIEQNMR...IQLCQEDALAFV.HALEK...PIKVNERFLRAAR......RHKE--------
Q92P91_RHIME/11-90DVVENAER...ISLSERDSLRLL.DLLEN...PPAPTPALLAAAR......RRIA--------
B3EP86_CHLPB/11-90QVIERHER...LELSERDSQHVL.KLLEE...PPAPNEKLTAAAF......ALPK--------
Q7NIQ1_GLOVI/13-92QILADRWF...FLLDDKRWEVFV.AAFNA...SPKEHQRLRQLLS......PLGV--------
Q7NLC6_GLOVI/11-90RTIQEHGL...LYLSQQDQQIFV.EAILN...PPEPNDELRQAAK......EYQR--------
B4SB08_PELPB/10-88ETLADRRS...FSLDVTQWTAFI.AALDA...SPRELPRLKKLF.......QEQS--------
Q5P620_AROAE/9-88RAIEQAEV...IRLSLADQECFA.QALLS...PPQPSPALERAFV......RRSK--------
Q2SAN8_HAHCH/11-89QTLADRRQ...FVLGEAQWQAFQ.EALDR...PVQSKPRLKKLL.......REPG--------
C1DE12_AZOVD/13-92EALLDRAF...IAASPEAYAEFLAARLDR...PPQPNERLRKTL.......QTPA--------
Q8ZL97_SALTY/13-91KVILDRRV...FNFNDEQYEEFI.NLLDA...PVADDPVIEKLL.......ARKP--------
Q8XPL2_RALSO/16-98QVIEHEETIKAIKLTVEQSRRFV.ALLDE...PAKPNEALRRAME......RFRK--------
Q6LIX8_PHOPR/32-112QIMERERA...LKLSQRDAMMLM.DALDE...PAKPNARLQHAAA......RYKD--------
Y420_HAEIN/9-88KTISEHQV...LRLAVNDQALLI.ESLSK...PFEPNPSMKNALD......VYEA--------
Q5P632_AROAE/5-83AVVLDQVF...FGLDADKFKQFT.AMLDA...PPGPNPGLERLM.......AVQA--------
Q5NX70_AROAE/9-88KAIEQAEV...IRLSLADQQRFA.DALLS...PPKPSTALKRAMA......KHDQ--------
Q7N6D8_PHOLL/7-86RAIEQSEV...LRLSLADQQCFA.QALLN...PPESTPALERAFA......RHRS--------
Q7N0J5_PHOLL/11-90KVIDENER...LELTERDSLHVL.DLLDN...PPAPNDKLLAAAF......ALPK--------
Q6ZEG7_SYNY3/12-91KVIEQHQT...LQLTIADSQAFV.DALLR...PSEPNSKLKKAAL......RHQQ--------
Q87ZN7_PSESM/15-103VVMENHRR...IELSEKAFSRLH.EILNEEDTDATPTPELLKLMRGQHGQREHRS--------
Q3SNN6_NITWN/19-98RAIEDHQT...LHLSLRDSQAFV.QALMK...PLPVNDRLRDTVR......RYRQ--------
Q9KM95_VIBCH/57-136HVIEEHES...IMVKDSVFDEFM.AACNK...VKAPNQALLEAV.......KFTE--------
Y4AR_SINFN/23-102ATIAAHEA...TLLQTTDYQAFF.DALDN...PPKPTDRLRDAFK......RYSE--------
O05910_MYCTU/74-152DVLADRRL...FVLTDAAWTEFL.AALDR...PVSHKPRLEKLF.......AARS--------
Q7N3R4_PHOLL/22-101NVIERTET...LHLSIEGADALL.AALEN...PPKANAKLLKAAK......HYKD--------
I6XFC2_MYCTU/72-148DLLARANR...IELSEAAFRRFV.AALDE...PDEAAPELVRLAR......R...--------
Q8P668_XANCP/14-88EALLDQTL...ITASPDAYAAFL.ARLDM...PPQPNARLRKTMQ..........--------
Q8ZKC7_SALTY/14-88EALIEQRI...IMADPEAYQEFL.VRLDQ...TPSPNAALRKTMQ..........--------
Q8ZMH5_SALTY/14-91KIVDAAER...VYLTERDTKMIM.EILDN...PPAPNEKLLAAAF......AL..--------
Q9PHI1_XYLFA/6-80AIILDQVF...FNLDEERFRQFT.VLLDG...PQDTNLGLNRLM.......A...--------

PF05534

Q7N3F9_PHOLL/54-104-----------VRVNPELHRKIAELALEE---DVTINAFVNQAL-------------------
Q88MT9_PSEPK/54-104-----------LRLEPALHASVAAKAELA---EKSINQWVSDIL-------------------
Q6A7R8_PROAC/60-110-----------LRLGEDLHRRLVIEAAEQ---HLSLNQYVTRKL-------------------
Q73YB6_MYCPA/53-103-----------VRTSPELHSRLAMEAAEQ---RVSMNQWVVQKL-------------------
Q7N8L4_PHOLL/59-111-----------LRYPESFGERLHCAAAEH---QISVNAFIIETL-------------------
Q92KT7_RHIME/1-48-----------VRLDPEDHAAAAVAAAAA---GKSLNEWVIGAI-------------------
Q6MB72_PARUW/52-102-----------LRLQPDLHAKLAAEAKFN---GISLNNYISQTL-------------------
Q7VMR2_HAEDU/57-107-----------VRITPELHKKASLLATKQ---GLALNAFVYKAI-------------------
Q7MY97_PHOLL/58-110-----------LRYPGWLEARLTAAAISH---AVSKNQFIVQLL-------------------
Q88G27_PSEPK/52-102-----------VRVGHDLHLAASVAATKQ---SISLNDLTRKAL-------------------
Q73J27_TREDE/55-105-----------IRISPAIHKKAKRQAIMQ---GISLNQFIQQAV-------------------
Q8YLM2_NOSS1/53-103-----------LRINPELHKIIAIKAKKE---GQSLNSWIEKCL-------------------
Q73KK4_TREDE/52-102-----------IRISPELHKKIAINAKSL---NLSLNTFVEKAL-------------------
Q92XZ7_RHIME/54-104-----------FRVAPEVHRRAALAAELS---GKSLNQWAEEVL-------------------
Q73QG2_TREDE/62-112-----------LRLPKSLHKELALNAEHE---GVSLNQYVLYRL-------------------
Q9RZI7_DEIRA/54-104-----------VRISPLLHAQAVAMAQSQ---EISLNTLVERAI-------------------
Q8XYR1_RALSO/55-105-----------LRVEGKVHEAATIAAAAQ---GVSLNQWAAGVL-------------------
A1RCN0_ARTAT/63-111-----------LRVSPELHRKLALEAANH---GVPLNRYATELL-------------------
Q9PCT7_XYLFA/64-114-----------ARISPELHALASEAAAAQ---GISLNQFVEQAI-------------------

PF09386

Q7N4K2_PHOLL/1-79DSDQAW-----QELKVLLNTRIS-EGMEGKVSKKSIDEILNEELA------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window