Sequence alignment for CL0057

PF12651

C2RWW5_BACCE/9-52-----------------------------------------------------------TRKA-LSNAVRMDLYEQLKKL
A6NT24_9FIRM/10-53-----------------------------------------------------------NRTR-FTSSLKNELVPKWNKL
C2ZCE6_BACCE/106-149-----------------------------------------------------------EKKK-RTFSLNTEVLARLDTI
C4IGY2_CLOBU/11-54-----------------------------------------------------------SRTR-YSSTFNTELLKELKNL
A6LT47_CLOB8/12-55-----------------------------------------------------------NREP-FSTTVNLNYNNLLSEL
B1QGC9_CLOBO/4-47-----------------------------------------------------------HRTR-ISNSIDKDLYNKLKKL
B1RFG8_CLOPF/12-55-----------------------------------------------------------TRIR-FSTSVDIKLAEKLENL
Q1D537_MYXXD/6-49-----------------------------------------------------------RLTS-VVFRLNREKLDALKDL
Q0TUT9_CLOP1/6-49-----------------------------------------------------------NRGR-LATSIDKDLLRKLNLL
C3EDU5_BACTU/11-54-----------------------------------------------------------NRKT-LSNAIAKELWYDLDQL
A1BZH8_BACCE/11-54-----------------------------------------------------------NRKQ-LSTTLANDLNERLEKL
Q08N33_STIAD/29-72-----------------------------------------------------------KKIS-TTIYITPEQYELLKAL
Q08NJ8_STIAD/30-73-----------------------------------------------------------EVVS-THVLVAEEQVQKLREL
Q04FI1_OENOB/1-44-----------------------------------------------------------MKQE-TTFTLEDNLVQKLNTI
A5N8S1_CLOK5/8-51-----------------------------------------------------------NRTR-IYNAVDTILYTKLMQL
A7HBK6_ANADF/4-47-----------------------------------------------------------KKLS-TTVYITPEQDERLKLL
B1QGC3_CLOBO/10-53-----------------------------------------------------------TRER-YSSTFDKELLKKFKEL
Q9YEP4_AERPE/2-45-----------------------------------------------------------AKRR-FGVSIPEDLAQRLDEA
C9KLM4_9FIRM/6-49-----------------------------------------------------------PRTR-FSTSVSKVLYEKLDRI
B4UEI0_ANASK/22-65-----------------------------------------------------------RLEP-MLVRLPPALAAELRNL
C0CM34_9FIRM/23-66-----------------------------------------------------------NRTA-ISTAIDKELYQKLKDY
A2BMU8_HYPBU/1-44-----------------------------------------------------------MKRR-FGISINESIAKMLEVL
B2TQ69_CLOBB/8-51-----------------------------------------------------------TRER-YSASFDKELLASLKDL
B1RFE8_CLOPF/8-51-----------------------------------------------------------NRTP-VGSAMDNKIYYEMKAY
C3AQ62_BACMY/106-149-----------------------------------------------------------EKKK-RTFSICTEILEKLDAV
C0EDY8_9CLOT/8-51-----------------------------------------------------------YRTR-FTSSIKNELMESLNDL
Q17ZT4_CLOD6/4-47-----------------------------------------------------------NRVR-FSSSTKPDLFEKLKQL
A9GWZ6_SORC5/4-47-----------------------------------------------------------KKVS-TTIYITPEQAERLKIL

PF01402

YBFE_SHIFL/52-90--------------------------------------------------------------R-VELKLNAEAVEALNEL
Q9YBV4_AERPE/3-42--------------------------------------------------------------L-VTVKMPEMYVKGIDEL
O69416_ECOLX/15-53--------------------------------------------------------------S-RPVRLTAEEDQEIRKR
REPA_LACPN/8-46--------------------------------------------------------------K-ITLSIPVETNGKLEEL
Q8ZX60_PYRAE/47-86--------------------------------------------------------------L-ISVHVPKKMLEELDEL
P72681_SYNY3/21-59--------------------------------------------------------------Q-TTIRLESKMMERLTKL
Q8ZWZ9_PYRAE/10-49--------------------------------------------------------------L-ISFHVPRSYVEVLDEL
NIKR_CHLTE/6-45--------------------------------------------------------------R-FGISLERKLIESFDRH
Q877Q4_PSESM/12-50--------------------------------------------------------------R-IEIRCTEEDAALIREK
Y4KO_RHISN/4-42--------------------------------------------------------------A-FTVRVKDETASKLDQL
O82927_ECO57/13-51--------------------------------------------------------------V-ITAHVPLPMADKVDQM
VPB19_MYCTU/2-40--------------------------------------------------------------R-TQVTLGKEELELLDRA
Y1433_MYCBO/3-41--------------------------------------------------------------R-TNIYLDEEQTASLDKL
O28529_ARCFU/6-44--------------------------------------------------------------R-VTIALDDESVKIFEEL
Q8GI05_PSERE/52-90--------------------------------------------------------------S-VTAHVPVQLAEKVDLM
Q48913_MYCAV/38-76--------------------------------------------------------------I-LTVRLTEEEMARVRAT
YIIE_SHIFL/3-41--------------------------------------------------------------T-VFLHLSEEAIKRLNKL
Q52335_9ZZZZ/18-56--------------------------------------------------------------V-RTLRFSPVEDETIRKK
Q48832_LACPN/5-43--------------------------------------------------------------K-VGITLTEDTLARLEEI
NIKR_SHIFL/3-42--------------------------------------------------------------R-VTITLDDDLLETLDSL
COPG_STRAG/4-42--------------------------------------------------------------R-LTITLSESVLENLEKM
Y080_METJA/3-41--------------------------------------------------------------R-ISLTIEKNLLKEVDEI
PARD2_CAUCR/12-50--------------------------------------------------------------S-LSIELDSDLDRRLSEI
VPB20_MYCTU/11-49--------------------------------------------------------------R-LQIYIDEDVDRALAVE
Y298_MYCTU/5-43--------------------------------------------------------------K-ISVTVDAAVLAAIDAD
O30230_ARCFU/6-44--------------------------------------------------------------R-ITISLSEDDMKLIEEL
O29882_ARCFU/4-42--------------------------------------------------------------R-LSVSLDDKSKEKLEKM
Q04136_9LACT/9-47--------------------------------------------------------------R-VMISLTKEQDKKLTDM
NIKR1_METTH/3-42--------------------------------------------------------------V-VSVSLGEKLLEEIDAL
Q9I707_PSEAE/4-42--------------------------------------------------------------V-VSFRADDALVAALDEL
E51_SSV1/12-50--------------------------------------------------------------R-LNISISEETYETLQRL
Q88JZ4_PSEPK/2-40--------------------------------------------------------------A-TSIKIDDDLKGRIQHL
Q8GFT4_CITFR/12-50--------------------------------------------------------------R-IQVRCSTEVKAKLTEK
Q888D4_PSESM/12-50--------------------------------------------------------------N-LKLRCLPEEADQIKEK
O30109_ARCFU/6-44--------------------------------------------------------------R-LSVAVDDSIVEILEKL
O73988_PYRHO/6-45--------------------------------------------------------------I-ISVQLPQNLIHGLDSL
Q52179_9BACL/9-47--------------------------------------------------------------R-MQIRLSKTNMQRLQDM
NIKR_HELPY/12-51--------------------------------------------------------------R-FSVSLQQNLLDELDNR
COP6_STAAU/12-50--------------------------------------------------------------A-VTLRLTTEENEILNRI
Q45960_CLOBU/2-40--------------------------------------------------------------R-VNISIPDEVKQFFEDY
O07291_NATPH/4-42--------------------------------------------------------------R-VTVSLDDDTAAALEQL
Q52017_9ZZZZ/4-42--------------------------------------------------------------L-VTLRLDEQQHEKLKEQ
O32744_LACAI/6-44--------------------------------------------------------------R-LTVSFSHKIANQLEEL
O05476_SULIS/7-45--------------------------------------------------------------N-VHIRLREEERKLLKEI
Q8EGZ2_SHEON/6-44--------------------------------------------------------------P-VSVKLDADIKARVEHL
O05474_SULIS/21-59--------------------------------------------------------------I-ITIQLPDELYEEINMV
Q53277_BACTK/3-41--------------------------------------------------------------R-VNTRISKKLNDWLDEY
Q8PJU0_XANAC/2-40--------------------------------------------------------------L-PPIRCYEDEEALVCER
Q45137_BACFG/6-44--------------------------------------------------------------T-TSVTIDRKTFARLDRL

PF09274

Q70W75_YEREN/1-74MALTKQHTS.KTMSFGE--------------------HRDLEKVVNS.-------TPTGKQKR-VNVNFDEEIHIRFKAA
Q9F809_ERWAM/1-76MALEKNHTSSKKMTFGE--------------------HRDLDKVVDSP-------LPSGKSKR-VNVNFNEEKHTRFKAA
Q9KJ82_SALNE/1-76MSLEKAHTSVKKMTFGE--------------------NRDLERVVTAP-------VSSGKIKR-VNVNFDEEKHTRFKAA

PF05534

Q7N3F9_PHOLL/54-104---------------YL--------------------QDCKELNKNPD-------IPYK..GI-FNVRVNPELHRKIAEL
Q88MT9_PSEPK/54-104---------------YI--------------------ETCEKLGREPQ-------KAYS..GK-LSLRLEPALHASVAAK
Q6A7R8_PROAC/60-110---------------RA--------------------NDEPVPEPLST-------RHYS..GK-FQLRLGEDLHRRLVIE
Q73YB6_MYCPA/53-103---------------ES--------------------SGETLPTPMAD-------RHYS..GT-IVVRTSPELHSRLAME
Q7N8L4_PHOLL/59-111---------------YL--------------------EDCNASGIEPY-------ARQEKIKT-FTLRYPESFGERLHCA
Q92KT7_RHIME/1-48---------------M.--------------------..CREKGIEPR-------RKFS..GK-FNVRLDPEDHAAAAVA
Q6MB72_PARUW/52-102---------------YL--------------------DWCKELGQEPE-------KPFS..GN-IHLRLQPDLHAKLAAE
Q7VMR2_HAEDU/57-107---------------YI--------------------EFCQEQGIETC-------KSFS..GN-FNVRITPELHKKASLL
Q7MY97_PHOLL/58-110---------------YI--------------------ETCEEEGINPF-------KEEDKLKS-FTLRYPGWLEARLTAA
Q88G27_PSEPK/52-102---------------YL--------------------DTCASLGQNPE-------IPCK..GS-FNVRVGHDLHLAASVA
Q9RAA8_RICFI/57-107---------------YL--------------------EDCNIVGKIPD-------KPFK..GS-FNVRIEPELHKEVSLY
Q73J27_TREDE/55-105---------------YI--------------------ELCKEAGKPAE-------KSYK..GS-FNIRISPAIHKKAKRQ
Q6SK25_ARTAU/61-111---------------AR--------------------SGEKIPQPLAD-------RKYS..GR-LNLRVSPELHRKLALE
O87467_HAEIF/54-102---------------YL--------------------QDCLELGKEPN-------KPFK..GV-FNVRIGEELHREATII
Q8YLM2_NOSS1/53-103---------------YL--------------------EFCQERGEEPE-------KPFS..GK-LMLRINPELHKIIAIK
Q87BV6_XYLFT/64-114---------------FL--------------------EACKEDSVEPR-------KCYS..GK-FNARISPELHALASEA
Q73KK4_TREDE/52-102---------------YI--------------------NWCREENIEPE-------KPYS..GK-FNIRISPELHKKIAIN
Q92XZ7_RHIME/54-104---------------YL--------------------ETCRKIGKEPQ-------RPYS..GK-MMFRVAPEVHRRAALA
Q73QG2_TREDE/62-112---------------LE--------------------NGFTIPMPQDE-------NNYS..GK-FLLRLPKSLHKELALN
Q6G4L9_BARHE/55-105---------------QH--------------------NGEEVPVPLSH-------GKYS..GK-FQLRIPPELHRKLAIQ
Q9RZI7_DEIRA/54-104---------------YL--------------------AFCAELGEEPE-------KPMS..GK-FNVRISPLLHAQAVAM
Q7P9J0_RICSI/58-108---------------IS--------------------HNQSIPLAPSR-------KEYS..GQ-FNVRVDKRVHRALVLE
Q8X5S8_ECO57/60-112---------------YL--------------------EDCKAAGIEPY-------ARTEKIKT-FTLRYPESLSERLNNA
Q8XYR1_RALSO/55-105---------------FL--------------------EECARRGVEPQ-------KHFS..GK-FMLRVEGKVHEAATIA

PF05509

B8EFN4_SHEB2/13-61----------------------------------------------------------------ITIILTGEYHNKLVNS
Q4LC31_SODGL/14-62----------------------------------------------------------------ITFKLNQEYTALLYAS
B6ESX2_ALISL/7-55----------------------------------------------------------------VNIVMDQKCNHLLNIS
A7DVG3_VIBVU/13-61----------------------------------------------------------------VNIKLSGKHNQILESS
B2LS54_9VIBR/10-58----------------------------------------------------------------VNVKLSEKHNRVLEQS
B8EFW0_SHEB2/41-89----------------------------------------------------------------VNVVLDGKTNEMLEAS
B6ET57_ALISL/12-52----------------------------------------------------------------LWFELDKETNHLLKLQ
A6ASC2_VIBHA/12-60----------------------------------------------------------------IWFEMDSETNRKLEES
Q7MBP1_VIBVY/10-58----------------------------------------------------------------IWFEMDKETNQRLEAS
A7N8Z3_VIBHB/12-60----------------------------------------------------------------IWFELDEDTNRLLEES
Q5DY84_VIBF1/10-58----------------------------------------------------------------IHFQMDKITSNTLEKE
B5PNJ9_SALET/24-72----------------------------------------------------------------VSCSLDEAIDELLMES
A6D5H0_9VIBR/18-66----------------------------------------------------------------VVVVLKGVYAKRLEDS
Q6LW96_PHOPR/20-68----------------------------------------------------------------VTCFLSSFANKLLEES
A8QYN9_9GAMM/15-63----------------------------------------------------------------ISFQLSEEANKLLSES
A7N8V1_VIBHB/9-57----------------------------------------------------------------GQLTLDKQTYALLNQA
E6WK64_PANSA/14-62----------------------------------------------------------------LLVTLSPEMNRELSKA
D4IGT0_ERWAE/12-60----------------------------------------------------------------VLLHLNTEQTEKLSQA
B2VB54_ERWT9/25-73----------------------------------------------------------------VLLKLTPELTKKLSQA
B6ICE9_ECOSE/13-61----------------------------------------------------------------VTLLLRRETNEKLVAA
Q8L370_SALEN/14-62----------------------------------------------------------------VSVYLDEDTNNRLIRA
D2D9E9_KLEPN/14-62----------------------------------------------------------------VLLTLDEETNKLLLGA
B1VC85_ECOLX/14-62----------------------------------------------------------------VLLILDETTNQKLLAA
D2U5U3_SHISO/14-62----------------------------------------------------------------VLLVLDDATNHKLLGA
TRAY1_ECOLI/70-118----------------------------------------------------------------LTMRLDDETNQLLIAA
A6TIF9_KLEP7/67-115----------------------------------------------------------------VMARFDEDTNKKLIAA
A6TIT2_KLEP7/72-120----------------------------------------------------------------LFLRFDEQTNKMLIKA
Q1MKC7_RHIL3/2-50----------------------------------------------------------------LVLQLPADIEARLIEL

PF03869

RMNT_BPP22/2-51---------------------------------------------------------ARDDPH-FNFRMPMEVREKLKFR
RARC_BPP22/4-53---------------------------------------------------------MSKMPQ-FNLRWPREVLDLVRKV
Q9RPY7_PSEAI/13-62---------------------------------------------------------SRTADK-FVVRLPEGMREQIAEV

PF10723

Q663G0_YERPS/1-84M.....SQIENAVTSSS..KRAYRKGNPL........TGAEKQRMSVS-------RKKETHKA-INVFIQNDLKNELLQL
Q93GS8_SALTY/8-88M.....SQIENAVTSSS..KRIYRKGNPL........SSAEKKRLSIS-------RKKTTHKE-LNVFIQNIHKESLQQL
COPB2_ECOLX/1-84M.....SQTENAVTSSSGAKRAYRKGNPL........SDAEKQRLSVA-------RKRASFKE-VKVFLEPKYKAMLMQM
Q8RTD2_ECOLX/1-82M.....SQTENAVTSSSGTKRAYRKGNPL........TLAERQQASLA-------RKRVTHKE-LRVFIPAALKAQLQEM
Q326V9_SHIDS/1-86M.....SQTENAVTSSLSQKRFVRRGKPM........TDSEKQMAAVA-------RKRLTHKE-IKVFVKNPLKDLMVEY
Q1R236_ECOUT/1-86M.....SQIENAVTSSP..KRIYRKGNPL........TGAEKQRISVS-------RKKGTHKA-INVFIQSELKDDLTQL
Q27TF8_ECOK1/1-85M.....SQTENAVTSSSGTKRTYRKGNPV........PARERQRASLA-------RRSNTHKA-FHAVIQARLKDRLSEL
A1JUD2_YERE8/1-78M............IEGVHERKRRPKGPQK........SNASYQRDFWE-------RRKLTHSR-IVMVVPNEVKEDLELL
O07483_YEREN/1-84MRGQRCPQVGNAVTSSSNGKRIYRKGHPM........SASERQQSFVA-------RKRETHKE-IKVLVPNALKNKFQEM
A6TI22_KLEP7/1-92M.....SRSADKTTSSTNAKRAYRKGKPM........SASERQLAAIA-------RKRETHKE-VKVFVKNPLKDVMIAV
Q7BQV5_9ENTR/1-90MGSGMSQAIINIDDSFATGKRRYRKGAPL........SGAEKQCVSTV-------RKKMTHKE-IKIFVHNFLKEDLLEL
Q2VP21_ECOLX/1-85M.....SQTENAVTSSSGAKRAYRKGKPL........SEAERQRAASA-------RKRSVCKE-IKVFVRPELKNYLTSL
Q65AF6_YERPE/1-105MTKSLLLIIIQLRLVALTTLALLHRGIARMCWLLMRCRKWHKPTFSTG-------SRAGTEER-TGILHTNPLKDWMITI
A4SMJ0_AERS4/1-74M.............SQEINVNEPQAAAPH........NNAERQRQHVK-------RKQETHSR-LQCWISNRHAERLQEL
Q48416_KLEPN/1-70M..................SRVVERQVHK........SNLDKQKDYRN-------RIRDTHDQ-LNLYLPKDAKRMLIEI

PF04221

DINJ_ECOLI/4-84------------------------------------------------------------NAF-VRARIDEDLKNQAADV
Q9KML3_VIBCH/3-84------------------------------------------------------------TEM-LSTRIDHDTKIAFTNV
Q9A0Y8_STRP1/13-96------------------------------------------------------------TGT-LNLRVDDSVKSAADDI
Q9PBQ9_XYLFA/4-84------------------------------------------------------------NQL-VQARIDGAIKAEATVV
RELB_SHIFL/1-79------------------------------------------------------------MGS-INLRIDDELKARSYAA
RELB_HAEIN/5-93------------------------------------------------------------NSS-ISFRTVEKTKLEAYQV

PF13467

Q07PP8_RHOP5/4-69-------------------------------------------PVVKR.......SIVVAGHK-TSVSLEEAFWNGMKEI
A8TZV0_9PROT/6-70-------------------------------------------APRKR.......SVTIAGHA-TSVSMEDAFWRRLSQF
Q1NA23_9SPHN/16-85-------------------------------------------PPVKR.......SVTIAGHQ-TAISLEPIFWDALRRA
A3WHC8_9SPHN/13-82-------------------------------------------PPVKR.......SVAIAGHK-TSISLEPLFWDMLKEA
Q2W7L3_MAGSA/4-68-------------------------------------------QPVKR.......SVKIAGHA-TSVTLEAEFWDCLREL
A4TUN3_9PROT/1-65-------------------------------------------MLKKH.......SIIIAGHA-SSITMEPAFWDELKKI
A7HVX0_PARL1/12-78-------------------------------------------GEIKR.......SVTIAGHR-TSISLERPFWDVLKEL
C5AUK2_METEA/8-73-------------------------------------------ENAKR.......SVMIAGHR-TSVSLEAEFWTALQEI
B2IH09_BEII9/16-86-------------------------------------------SIIKH.......SVTIAGHA-TSISLESAFWDALKEI
Q6FZ86_BARQU/2-80-------------------------------------------TSRKI.......SVRIDGHA-TSVSLEQPFLDILKAI
C3MEF5_RHISN/1-67-------------------------------------------MIAKH.......SATLHGHR-TSFTLEDAFWQELKSI
C9TG23_9RHIZ/6-72-------------------------------------------RLRKH.......SVSIRGHA-TSYTLEDPFFKIIEEI
Q11GU9_MESSB/3-69-------------------------------------------APKKR.......SVTIRGHR-TSFSLEDAFYSELERI
A9D3H5_9RHIZ/10-76-------------------------------------------TMRKH.......SVSIRGHR-TSITLENAFMAALRQM
D8JQT3_HYPDA/2-67-------------------------------------------RPEKR.......SFSIQGHR-TSISLEAAFWSALKTA
E3I0W1_RHOVT/37-102-------------------------------------------LPKKR.......SLAIAGHR-TSITLEDAFWRELKAT
C7KDM2_ACEPA/4-70-------------------------------------------HLRKR.......SLILAGHD-TSVALESAFWNTLEDI
A5FXC9_ACICJ/2-68-------------------------------------------NLEKR.......SLSLSGHR-TSVALEPEFWTALEAA
D5VIX9_CAUST/3-68-------------------------------------------GLKKR.......SVNLAGHA-TSLALEPEFWAVLERA
A0NVL5_9RHOB/2-68-------------------------------------------ALLKR.......SLSLHGHR-TSLALEPEFWDVVDAH
Q0AMZ5_MARMM/16-81-------------------------------------------PLLKR.......SLSLAGHR-TSISLEPDFWAELDRL
E0TDI6_PARBH/5-70-------------------------------------------ELIKR.......SVTLRGHR-TSVALEAAFWAALDEW
A0KLC1_AERHH/25-95-------------------------------------------ACTTR.......SVRICGHS-TSIRLENKFWTILEQL
Q0G519_9RHIZ/14-84-------------------------------------------EGETR.......SVRLSGHS-TSIRLEAAFWRTLEHL
A8LPV2_DINSH/14-84-------------------------------------------ACTTR.......RLRLNGQS-TSIRLENSFWAILDEM
A8HUM8_AZOC5/14-84-------------------------------------------QSVTR.......SIRIGGHI-TSVRLENTFWTILEEI
Q8EH51_SHEON/14-84-------------------------------------------ELKTR.......SIRIDGVV-TSVRLEAIFWQIIEEI
C6BV10_DESAD/14-84-------------------------------------------EQITR.......SIRINGAV-TSIRIERRFWNILDEL
A4TW65_9PROT/14-84-------------------------------------------QSVAR.......SVRIGGVV-TSIKVERHFWQILEDI
Q2SKQ2_HAHCH/14-84-------------------------------------------EAHSK.......SVRLRGFV-TSVRLEQRFWALLEEI
Q7MIW4_VIBVY/61-131-------------------------------------------QTITR.......SIRIDGHA-TSVKLEASYWDILQEI
A6WUZ0_OCHA4/14-84-------------------------------------------RQINR.......SVRIGGHS-TSIQLEATFWRLLDEI
B8EK53_METSB/14-84-------------------------------------------QCQTR.......SVRLGGHV-TSIRLEALFWQVLEKL
A9D0B8_9GAMM/23-93-------------------------------------------LPIQK.......SIRIQGHV-TSISLEKLFWDLLDQI
A4XXG0_PSEMY/14-84-------------------------------------------ESRSR.......SLRIHGVV-TTLRLENQFWDILREI
B1SXR3_9BURK/14-84-------------------------------------------ECRTR.......SVRIEGVT-TTIRLENLFWHTLSDL
A2SED0_METPP/14-84-------------------------------------------EPRQR.......SVRIHGVI-TSIRLENLMWRVLSDI
Q57CU3_BRUAB/14-84-------------------------------------------QSVTR.......SLRIDRAV-TSVRLENFFWWTLEDI
A6EV75_9ALTE/24-94-------------------------------------------ISRTH.......SLRIDGMV-TSIRMENAFWNALTEI
B5SFN5_RALSL/14-84-------------------------------------------ETQAR.......SLRLHGVA-TSVRLECLFWDVLEEI
A5FYB5_ACICJ/14-84-------------------------------------------AQTSR.......SVRLSGRS-TSVRLERVFWDALGEI
C3JYT3_PSEFS/33-103-------------------------------------------KPLSR.......SVRLNGFS-TCLRLEQIYWNILTEI
Q141Z3_BURXL/64-134-------------------------------------------KPRQR.......SVRINGLA-TCLRLEEVYWRIIEEI
A4TYI1_9PROT/37-105-------------------------------------------APEKR.......SVRIHGHS-TTIRLEQAFWTVLDEM
D3NY07_AZOS1/12-77-------------------------------------------GLLCR.......NVKVSGRR-TSLRMEPYIWDSLKEI
B6IW11_RHOCS/2-67-------------------------------------------RSICK.......NVTVAGRR-TSVRMEPIMWQCLEEI
B6IVX3_RHOCS/18-84-------------------------------------------PQIIR.......NVTVLGQR-TSVRLEPEMWDALLDV
B6IXV3_RHOCS/23-89-------------------------------------------QLISH.......NVWVNGHR-TSVRLEAVMWKSLHEI
D3NQN8_AZOS1/38-116-------------------------------------------PLRSQ.......NIMIGGHR-TSMRLEPSMWDALEDI
D3NST4_AZOS1/3-70-------------------------------------------ALMSR.......NLVVNGRR-TSMKLEPSVWNYLGEI
D3NR24_AZOS1/9-75-------------------------------------------PMHMR.......NIRVNGKR-TSMKLMPVEWDSLEEI
Q2W502_MAGSA/60-132-------------------------------------------APRKRPVTLICRNIRVKGKR-TSVKLENEFWNALEIM
B6R003_9RHOB/2-68-------------------------------------------SLKKR.......SITLHGHR-TSITLEPEFWSGLEDL
B7QTG9_9RHOB/4-70-------------------------------------------RPRKH.......SLTLRGHR-TSVSLEDEFWDAFREI
A3K2C9_9RHOB/4-70-------------------------------------------RPVKR.......SLTLKGHR-TSVSLEDAFWSEFRRI
Q167I6_ROSDO/4-70-------------------------------------------RPVKH.......SVTLKGHR-TSISLEDEFWQELRRI
A1B3A7_PARDP/21-87-------------------------------------------APSKR.......SVTIGGHR-TSVSLEDAFWRELREL

PF08681

Q8E866_SHEON/19-95--------------------------------------------------------------R-IELKTSPEVKELLERA
Q7N880_PHOLL/12-90--------------------------------------------------------------T-LNLRIRQEDRDLIDRA
Q57KM3_SALCH/11-90--------------------------------------------------------------R-LSLRVSTDAKKLIVRA
Q7N7Z2_PHOLL/8-88--------------------------------------------------------------R-ITTRVSSETKELLERA
Q4CB51_CROWT/8-87--------------------------------------------------------------R-LDLRVTPEQKELLERA
Q92P91_RHIME/11-90--------------------------------------------------------------R-IELRTTREEKRLLTAA
Q5PIQ5_SALPA/13-91--------------------------------------------------------------T-LNLRIKPAERDLIDRA
Q4UXV1_XANC8/13-91--------------------------------------------------------------T-LNLRIKPEERSLIDRA
B3EP86_CHLPB/11-90--------------------------------------------------------------R-LSLRIAAEEKSILMRA
Q7NIQ1_GLOVI/13-92--------------------------------------------------------------R-IDIRTTPAAKRALQET
Q7NLC6_GLOVI/11-90--------------------------------------------------------------R-LEVRVSGDGKALIAQA
Q8D4I7_VIBVU/8-84--------------------------------------------------------------R-VELRVTAEEKRALEEA
B4SB08_PELPB/10-88--------------------------------------------------------------K-LDLRLSQQAKQVLRSA
Q57IR1_SALCH/8-87--------------------------------------------------------------R-IDLRLTDGDKSMIEEA
Q5P620_AROAE/9-88--------------------------------------------------------------R-LEARISKDLHSMLKRA
Q2SAN8_HAHCH/11-89--------------------------------------------------------------R-IDVRASTPVKQLLQEA
A4Y6X3_SHEPC/26-106--------------------------------------------------------------R-IEMRVDAETKQLAERA
Q93ER6_PHOLU/6-85--------------------------------------------------------------R-FDLKMDTDEREVISHA
C1DE12_AZOVD/13-92--------------------------------------------------------------T-LNIRIKPEERSLIDRA
Q4BWD7_CROWT/10-89--------------------------------------------------------------R-VTARVPASVKETLQKA
A5EL48_BRASB/17-96--------------------------------------------------------------R-LETRVTAAQKSLIERA
A4JRY5_BURVG/14-96--------------------------------------------------------------R-VTARLSAEKQEILQLA
Q5X0W2_LEGPA/12-92--------------------------------------------------------------R-IEARVSSEDKDLFKRA
Q5EP84_NEIGO/11-90--------------------------------------------------------------R-FEARITSDTRALLKHA
Q8ZL97_SALTY/13-91--------------------------------------------------------------Q-LNLRAKESQRALIDAA
Q8XPL2_RALSO/16-98--------------------------------------------------------------R-ITARLSADKQELLQLA
Q6LIX8_PHOPR/32-112--------------------------------------------------------------R-ITARVDIDTQELLSQA
Y420_HAEIN/9-88--------------------------------------------------------------R-LEAKVNIDIYELLKQA
Q5P632_AROAE/5-83--------------------------------------------------------------A-INLRALPEQRDLIDHA
Q5NX70_AROAE/9-88--------------------------------------------------------------R-LEARISPDLHALLKRA
Q7N6D8_PHOLL/7-86--------------------------------------------------------------R-FEARMNPELHALIKRA
Q9S0Y9_ECOLX/14-93--------------------------------------------------------------R-IDLRLNEDDKHMIEEA
Q5I739_DICNO/6-83--------------------------------------------------------------R-INIRTTPQAKALIERV
Q3Z4X6_SHISS/35-113--------------------------------------------------------------R-VELKTSPDAKNKLREA
Q7N0J5_PHOLL/11-90--------------------------------------------------------------R-MSLRIASEEKSLLMRA
Q6ZEG7_SYNY3/12-91--------------------------------------------------------------R-LEARISPETKALMQKA
Q87ZN7_PSESM/15-103--------------------------------------------------------------R-LEIKTTDFAKEFIRKA
Q3SNN6_NITWN/19-98--------------------------------------------------------------R-LETRVTADQKKLIERA
Q9KM95_VIBCH/57-136--------------------------------------------------------------R-LDIRLDEEIKAKAEKA
Y4AR_RHISN/23-102--------------------------------------------------------------R-MNFRTKERVKRTIQRA
Q7WCE6_BORPA/11-90--------------------------------------------------------------R-LQVRLNAEAKTVLQRA
O05910_MYCTU/74-152--------------------------------------------------------------R-LAARLTPEQDALIRRA
Q7N3R4_PHOLL/22-101--------------------------------------------------------------R-LVARTSIEIQEIIQRA
Q3REC2_XYLFA/5-83--------------------------------------------------------------S-INLRAMPEQRDLIDQA
Q7TXU2_MYCBO/72-150--------------------------------------------------------------R-LNFRLSPEQEQALRHA

PF07362

Q21DI4_SACD2/10-81-----------------------------------------------------------PKKP-TNLSVNSDLLAKTRAL
A1JQ04_YERE8/7-78-----------------------------------------------------------ATQS-VTMAVERALLSRAREA
Q58WP3_SALDE/19-90-----------------------------------------------------------HKKT-VSVTLEPALLQQARDA
A6A373_VIBCL/10-81-----------------------------------------------------------PKKA-TNLSLNSELLAEAKRL
Q3ZU16_ECOLX/1-72-----------------------------------------------------------MKQR-ITVTVDSDSYQLLKAY
Q6D9V2_ERWCT/1-72-----------------------------------------------------------MKHQ-ISIAVDKDDYQVLSAA
A3T0A7_9RHOB/2-73-----------------------------------------------------------GRVK-VNLTLDASVAETARAL
Q7N4P4_PHOLL/8-79-----------------------------------------------------------LKKT-VSVTVAPELYQQARQV
A4BMU8_9GAMM/10-81-----------------------------------------------------------TRKP-TNLSLDSALLKEAKAL
B0T4X1_CAUSK/2-80-----------------------------------------------------------GKVE-LDIGIDSELLAQAKRL
Q8FLA0_ECOL6/6-77-----------------------------------------------------------TTQS-VTVTVDRELVNRARDA
A5GAE8_GEOUR/22-93-----------------------------------------------------------PKKP-TNLTINSDLLQKAREH
A4TXE4_9PROT/5-76-----------------------------------------------------------PKKS-CNLSINAELLREAKGL
Q5P2R6_AROAE/21-92-----------------------------------------------------------SKKA-TNLSLSADVLAEAKSL
Q1GN85_SPHAL/10-81-----------------------------------------------------------PKKP-TNVSLNAELVEEARRL
Q1NL18_9DELT/11-82-----------------------------------------------------------PKKS-ANLSINSDLLRQAKER
Q0F2A7_9PROT/5-76-----------------------------------------------------------VKRA-VNLRIDESLIDQAKAM
B5EG30_GEOBB/11-82-----------------------------------------------------------PKKS-TNLSINSDLLRLAKER
F2GB87_ALTMD/10-81-----------------------------------------------------------PKKA-TNLSLNSDLLQKARDL
A7HPK7_PARL1/4-75-----------------------------------------------------------PKKA-VNLSIDADLLAKARAL
Q7MZJ1_PHOLL/1-72-----------------------------------------------------------MKHR-VNVTFDKENYLILNSA
B2JXB4_BURP8/9-80-----------------------------------------------------------PRKA-TNVTLPVDVYERAKEL
Q6D8L1_ERWCT/1-72-----------------------------------------------------------MKRW-ISIAVNKDDKQTPNAT
A3J7N2_9ALTE/14-85-----------------------------------------------------------PKKA-TNLSVNSDLLSKTRAL
A0L724_MAGSM/10-81-----------------------------------------------------------KKDR-VNLSMNSELVQKAKAL

PF09957

Q82BL1_STRAW/2-49-------------------------------------------------------------SV-TQIDLDD...EALAEA
VAPB6_MYCTU/2-48-------------------------------------------------------------SV-TQIDLDD...EALADV
Q39AR5_BURS3/1-44-------------------------------------------------------------MR-TTLSLDD...ALLAKA
A0PM00_MYCUA/3-54-------------------------------------------------------------KK-VEIEIDD...DLVQEA
Y634A_MYCTU/16-68-------------------------------------------------------------KR-VEIEVDD...DLIQKV
Q20X13_RHOPB/8-51-------------------------------------------------------------MR-TTIAIDD...ELFAKA
A3Z0W5_9SYNE/1-44-------------------------------------------------------------MR-TTLTLDD...DLLAQA
A1KM99_MYCBP/15-62-------------------------------------------------------------TR-TMIDIDD...DLLARA
Q4C4H3_CROWT/1-47-------------------------------------------------------------MK-TNIIIDE...QLIADA
A2VJB7_MYCTU/7-54-------------------------------------------------------------SR-TNIEIDD...ELVAAA
Q2FLV1_METHJ/1-47-------------------------------------------------------------MA-TNLAVDD...NLISEA
A3YY99_9SYNE/1-47-------------------------------------------------------------MR-TNIVIDD...QLMRDA
Q2JXE5_SYNJA/1-50-------------------------------------------------------------MR-TNVVLDDELIELIERA
A0QC46_MYCA1/1-44-------------------------------------------------------------MR-TTVTIDD...ALLAEA
Q474F3_CUPPJ/8-52-------------------------------------------------------------MR-ATVTIDD...ELYEQA
Q58AH0_RALME/1-44-------------------------------------------------------------MR-TTIALDD...ELLAKA
C1AEZ3_MYCBT/4-56-------------------------------------------------------------KR-TTIELDE...DLVRAA
Q3JAZ0_NITOC/1-47-------------------------------------------------------------MR-TNIDLDD...KLLEAA
A1U2W3_MARAV/1-47-------------------------------------------------------------MR-TNIVIDD...QLMAEA
A1VX34_POLNA/1-45-------------------------------------------------------------MR-TTLTIDD...QLFARA
Q7AQ19_MYCLE/3-56-------------------------------------------------------------KK-VEIEVDD...DLVQEV
A3Z0W8_9SYNE/1-44-------------------------------------------------------------MR-ITLNLDD...ELLSQA
Q73PC1_TREDE/1-47-------------------------------------------------------------MA-TNLAINE...ELLDTA
Q3M6F1_ANAVT/1-47-------------------------------------------------------------MQ-ITLNLDE...SLLNEA
B3EKM2_CHLPB/1-47-------------------------------------------------------------MR-TNIVIDD...KLLREA
A7BR89_9GAMM/1-50-------------------------------------------------------------ME-ITFTIND...HLFLKA
Q73R95_TREDE/1-44-------------------------------------------------------------MR-TTIVLNE...SKIQQA
Q7NCS8_GLOVI/1-47-------------------------------------------------------------MR-TNVELDD...ALLEEA
A3TGX0_9MICO/1-44-------------------------------------------------------------MR-TTVTIDD...ALYERA
A8ZTF6_DESOH/1-44-------------------------------------------------------------MR-TTLNIED...GLIDKA
A3EPI1_9BACT/1-44-------------------------------------------------------------MR-TTVRIDD...SLLSRA
A4BPR4_9GAMM/2-48-------------------------------------------------------------MR-TNIELDD...ELITQA
A5U2R7_MYCTA/7-54-------------------------------------------------------------SR-TNIDIDD...ELAAEV
A3Z9K4_9SYNE/1-44-------------------------------------------------------------MR-TTVNLDD...QLLAQA
Q7D057_AGRT5/1-48-------------------------------------------------------------MR-TNIELDD...ALIAEA
Q07NJ5_RHOP5/1-47-------------------------------------------------------------MR-TNIEIDD...TLMAEA
A3IRW5_9CHRO/1-47-------------------------------------------------------------MA-TNLEIDD...KLIQEA
A0YU49_LYNSP/1-48-------------------------------------------------------------MN-TNIELNE...QLVKEA
Q2FNJ2_METHJ/1-47-------------------------------------------------------------MA-SNLALDD...DLIKEA
A5G896_GEOUR/35-78-------------------------------------------------------------MR-TTLNIED...ALLEKA
A5GB97_GEOUR/1-47-------------------------------------------------------------MA-TNLAIDD...KLLEEA
Q73SG9_MYCPA/11-61-------------------------------------------------------------KK-VEIEVDL...ELVDEA
A4BVI5_9GAMM/1-47-------------------------------------------------------------MR-TNIVIDD...KLMERA
A0ZI46_NODSP/1-47-------------------------------------------------------------MI-NNIVIDE...KLIDDA
A4BVE0_9GAMM/1-44-------------------------------------------------------------MR-TTLNIDD...QLLDEA
A6DJA1_9BACT/2-48-------------------------------------------------------------SR-TNIVLDD...DLVKDC
A0QCC9_MYCA1/3-50-------------------------------------------------------------KT-VEIEVDV...NMIDDA
Q01QU3_SOLUE/1-47-------------------------------------------------------------MR-TNIVIDD...KLMREA
A4XJM6_CALS8/1-47-------------------------------------------------------------MR-TNIILND...ELLKKA
A4A596_9GAMM/1-44-------------------------------------------------------------MR-TTVSIDD...QLFAEA
Q124P4_POLSJ/1-47-------------------------------------------------------------MI-TNIDIDE...VVVAEA

PF13062

C2USY1_BACCE/1-62------------------------------------------------------------MNT-LTIELPQETAEKLDLL
A7GMZ8_BACCN/1-58------------------------------------------------------------MST-LTIELPKDIAEKLDLL

PF07704

Q92LY2_RHIME/1-79-------------------------------------------------------------MP.LYIK-DPEVDRLAEEL
Q1M8C0_RHIL3/1-82-------------------------------------------------------------MS.LSIK-DPEAHRLAQAI
A6X7T6_OCHA4/1-82-------------------------------------------------------------MS.LYIR-DSAVDELAKKV
Q11MS5_MESSB/190-270-------------------------------------------------------------MP.INVN-NPEADALTRRF
A4KK34_MYCTU/1-89-------------------------------------------------------------MS.LNIK-SQRTVALVREL
A6UBT8_SINMW/1-82-------------------------------------------------------------MA.LYIK-DPTVGLMVEQN
A3TQ51_9MICO/1-82-------------------------------------------------------------MA.LNIK-NERVVTLARDV
A5FU30_ACICJ/1-79-------------------------------------------------------------MP.LYIR-DNATAELVAKL
A6WWK7_OCHA4/1-82-------------------------------------------------------------MA.LSIK-TDEADRLAREL
A5EUT0_BRASB/1-81-------------------------------------------------------------MA.FHIK-NPETDALARKV
A4KET8_MYCTU/1-81-------------------------------------------------------------MA.LNIK-DPSVHQAVKQI
A5U403_MYCTA/1-83-------------------------------------------------------------MA.LNIK-DPEVDRLAAEL
Q9F5F2_AGRRH/28-108-------------------------------------------------------------MP.INVN-NPEADALTRKF
A4KHQ1_MYCTU/1-70-------------------------------------------------------------M......-.........EL
Q219N1_RHOPB/1-84-------------------------------------------------------------MA.LSIK-DPETERLARTL
B0T0U9_CAUSK/24-114-------------------------------------------------------------MG.ILIK-NPEAERAVREL
A1T4A5_MYCVP/1-81-------------------------------------------------------------MA.LNIK-DEKVHDAVKQL
Q92TH7_RHIME/9-89-------------------------------------------------------------MA.ININ-DPQADALTRTF
Q92RQ4_RHIME/1-84-------------------------------------------------------------MA.LSIK-DTETEQLARTL
Q7U1L4_MYCBO/1-84-------------------------------------------------------------MA.LSIK-HPEADRLARAL
Q0BQA3_GRABC/5-88-------------------------------------------------------------MAQLNIK-SEDAYVLATEL
Q72LD3_THET2/1-85-------------------------------------------------------------MA.LTIR-NKEVERLAEEV
Q1WLI3_SINMM/1-85-------------------------------------------------------------MS.LNIK-NPATVALADEL
Q07GM2_ROSDO/1-81-------------------------------------------------------------MA.LYIR-DETVDDLAKQV
A3TJ62_9MICO/1-86-------------------------------------------------------------MA.LNIK-DPETDRLAREL
Q2RUX5_RHORT/1-82-------------------------------------------------------------MS.LTIK-DPEAHRLAQAI
Q981I6_RHILO/1-77-------------------------------------------------------------MA.FSVK-DESTDAAVRRL
Q07J94_RHOP5/4-86-------------------------------------------------------------MH.LNIK-NDEAHRLATEL
Q1QF44_NITHX/1-84-------------------------------------------------------------MA.LSIK-DPETEKLARAL

PF03693

PARD_XYLFA/1-78------------------------------------------------------------MSRNTSVALGPHFTSFIDAQ
PARD1_CAUCR/2-82------------------------------------------------------------ASKNTSVVLGDHFQAFIDSQ
PARD_MYCBO/1-81------------------------------------------------------------MGKNTSFVLDEHYSAFIDGE
PARD_VIBCH/1-80------------------------------------------------------------MAKNTSITLGEHFDGFITSQ
PARD_ECO57/1-80------------------------------------------------------------MRKITSVSVGEQLDSFITRM

PF11020

C4YV51_9RICK/4-85-----------------------------------------YKEF....EFDCDFGGQRAKFK.FYIGTPQEGHHPLQFQ
Q2GKE5_ANAPZ/4-85-----------------------------------------VKKF....IIPCEFGGKTSPFA.VYIGEPKPDAHPVQHQ
Q2GG71_EHRCR/4-85-----------------------------------------IKKF....IVPCDFNGQSSPFA.IYIGEPKPENHPVQHQ
Q5PB11_ANAMM/4-85-----------------------------------------IKKF....IIPCEFGGRIAPFA.IYIGEPRPDAHPVQHQ
B3CLM4_WOLPP/5-86-----------------------------------------IKKF....TVQCDFKGQNAPFA.VYIGNPKGDTHPIHHQ
Q2GCJ4_NEOSM/1-82-----------------------------------------MKKF....TVPCQFGSQTAPFT.IYIGSPRRDTHPIYNQ
A5CC80_ORITB/1-82-----------------------------------------MKKL....VINCNFGGQIAPFT.VMIGQPKPDQHPLHFQ
A8GW87_RICB8/1-82-----------------------------------------MKKF....DIDCDFGGQKSKFT.IYIGTPQDGHHPLQFQ
B3S7R4_TRIAD/8-106-----------------------------------------YNQFNDIPVLSPRISSQQELFVDIYIGQPNQGSHPLAFQ

PF07764

Q57468_STRPY/1-71-------------------------------------MIVGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIE
Q83WL2_9ZZZZ/1-71-------------------------------------MIVGNLGAQKEKRNDTPISAKKDIMGDKTVRVRADLHHIIKIE

PF09386

Q1NH10_9SPHN/1-79-------------------------------------------------------------MSRLTIDITEQQHQSLKAL
Q0E6B4_PSEAI/1-79-------------------------------------------------------------MSRLTIDMTDQQHQSLKAL
Q87CU8_XYLFT/1-79-------------------------------------------------------------MSCLTIDITDQQHQSLKAL
Q7N4K2_PHOLL/1-79-------------------------------------------------------------MSRLTIDITDQQHKSLKAL

PF11903

Q4KC28_PSEF5/1-66--------------------------------------------------------------M-GIVKISDELHEQIRVA
B4SF37_PELPB/2-74--------------------------------------------------------------G-MPVRIDDTLYGQARAQ
A6DXG1_9RHOB/1-65--------------------------------------------------------------M-GIVKIAEELHEELRKS
A1V5D0_BURMS/1-73--------------------------------------------------------------M-GIVKISDGMHESLRHA
A4JIY6_BURVG/2-63--------------------------------------------------------------A-INVKLPEALVETAKRY
A6SW35_JANMA/1-73--------------------------------------------------------------M-GIVKITEEMHTNLRLT
Q0HLV2_SHESM/1-65--------------------------------------------------------------M-GIVKISEELHDELRKA
A3JC26_9ALTE/3-67--------------------------------------------------------------T-NSIRLDQNLIEKATIM
Q3KB70_PSEPF/1-73--------------------------------------------------------------M-GIVKISEDMHENLRIS
A0QXV1_MYCS2/6-107--------------------------------------------------------------D-RVTRFAADLVESAAAE
B7X1E9_COMTE/1-73--------------------------------------------------------------M-GIVKISDQLHDQIRVS
A4TQ21_YERPP/1-73--------------------------------------------------------------M-GIVKISDLMHENLRIA
A9BMX0_DELAS/1-73--------------------------------------------------------------M-GIVKISDQLHDQIRLS
A6T935_KLEP7/1-66--------------------------------------------------------------M-GIVKISDLLHDDIRDA
Q48JT9_PSE14/1-73--------------------------------------------------------------M-GLVKISENMHANLRSA
Q7NVK9_CHRVO/1-73--------------------------------------------------------------M-GIVKISERMHDNLRTA
B9CGG2_9BURK/1-73--------------------------------------------------------------M-GIIKISDHMHERLRST
A4X043_RHOS5/2-100--------------------------------------------------------------A-QSVKLADDVMAQVRRE
Q4FSP3_PSYA2/7-71--------------------------------------------------------------T-ASIRLNKALVDKAYAI
A6ULS8_SINMW/2-100--------------------------------------------------------------A-QSVKLADDVMSLVRRE
A1T476_MYCVP/6-107--------------------------------------------------------------D-QVTRVAADLMDSAATE
Q7N5H6_PHOLL/2-66--------------------------------------------------------------A-ISIRLDDDFVNDVKIH
Q3AQ94_CHLCH/4-76--------------------------------------------------------------S-TSIRINQELYEQAKQD
Q1GXH1_METFK/1-73--------------------------------------------------------------M-GIVKISEAMHENIRSA
Q3BNN7_XANC5/75-144--------------------------------------------------------------M-GIVNIDDDLHDQLRRA
A3U039_9RHOB/2-100--------------------------------------------------------------A-QSVKLADEIMSLVRRE
A6DRR2_9BACT/8-74--------------------------------------------------------------A-QSVKLSGDLIARARAF
A8GBI0_SERP5/5-69--------------------------------------------------------------M-GIVKISDALHDDLRLA
Q2SQH0_HAHCH/2-95--------------------------------------------------------------P-QSVRIDDFLIDSARRE
Q13JR3_BURXL/1-70--------------------------------------------------------------M-GIVNIDDDLHDQIRKA
A3UJ97_9RHOB/2-100--------------------------------------------------------------A-QSVKLSDDIMKLVRTE
A4CF05_9GAMM/1-69--------------------------------------------------------------M-GIIKVSDELHQEIRKA
Q5R164_IDILO/1-65--------------------------------------------------------------M-GIVKIDDELHGEIRKA
A4BRK7_9GAMM/11-108--------------------------------------------------------------S-RSVRISDELYELLQRN
Q15VU5_PSEA6/1-66--------------------------------------------------------------M-GIIKISDEVHDEVRKS
Q0RY55_RHOSR/40-141--------------------------------------------------------------T-SPTRIDNELYASAKLV
Q220F4_RHOFD/1-73--------------------------------------------------------------M-GIVKISDQMHENLRVA
A0NTD8_9RHOB/7-105--------------------------------------------------------------A-QSVELCDDVMSLVCCE
A3KVD8_PSEAI/16-86--------------------------------------------------------------V-GLVKISEQLHEEARIA
A6WV11_OCHA4/1-65--------------------------------------------------------------M-GIVKIGDELHEELRKA
A3UEM3_9RHOB/1-65--------------------------------------------------------------M-GIVKIDDELHEDIRRG
Q47D61_DECAR/1-73--------------------------------------------------------------M-GIVKISEHMHENLRLT
Q0AF32_NITEC/4-76--------------------------------------------------------------S-TSIRIDQTLYEQARSE
Q8DFU3_VIBVU/2-66--------------------------------------------------------------A-TSIRLDDDFVSDVKVH
A3Y2K0_9VIBR/3-67--------------------------------------------------------------T-ASVRIDQDLFDKAAIM
A0NZR8_9RHOB/1-68--------------------------------------------------------------M-GIVKIDEDLHEQVRRA
Q0C2J2_HYPNA/1-68--------------------------------------------------------------M-GIVNIDDDLHDQLRKA
A7HVP7_PARL1/11-109--------------------------------------------------------------A-QSIKLADDIMKIVRRE
A3YEZ0_9GAMM/1-66--------------------------------------------------------------M-GIVKISDPLHDEIRKS
A6GRT8_9BURK/5-104--------------------------------------------------------------S-SPIRIQSDLMSNATVL
A1VWL3_POLNA/4-68--------------------------------------------------------------A-IALKLSDELVQDAKAV
A4Y172_PSEMY/1-70--------------------------------------------------------------M-GIVNIDDELHDQIRRA
B4SPJ7_STRM5/1-70--------------------------------------------------------------M-GIVNIDDTLHDQLRRA
A4BJF4_9GAMM/1-65--------------------------------------------------------------M-GIVKINDELHEEVRKA
Q1IDH1_PSEE4/1-65--------------------------------------------------------------M-GIVKISDDLHEDLRVA
Q1NLW1_9DELT/3-75--------------------------------------------------------------T-VPIRIDKELVSAARTA
A6SYS7_JANMA/2-66--------------------------------------------------------------A-IALKLSDELIDLAKSY

PF07878

Q7VCC6_PROMA/12-67-------------------------------------------------------SKSTHDAI-IDQLRACNTPSEILAF
A9BA39_PROM4/13-68-------------------------------------------------------DKGTHDAI-IDQLRACHTTEEIVEF
Q46LP4_PROMT/18-73-------------------------------------------------------GTSANDAL-IDQLRACKNTDEILKF
A2C9K2_PROM3/2-57-------------------------------------------------------SKSTREAI-VDKLRACQTDEQLLAY
A2BQE0_PROMS/12-66-------------------------------------------------------NDSSSHAL-VDELRKRTSEEDILDF
Q7U397_PROMP/14-68-------------------------------------------------------NDSSTHAL-VDVLRKRNTEESILEF
Q7U7V4_SYNPX/2-57-------------------------------------------------------ASDLKERV-LSALRACRSSDDLVAL
A2C9D6_PROM3/12-67-------------------------------------------------------INRMREAI-VDQLRSCSTPEQLLAL
Q3AZ83_SYNS9/18-73-------------------------------------------------------TLPSEDTL-IDALRGCRHTEELEAL
A2BU44_PROM5/9-58-------------------------------------------------------NGRPKSPR-IQVVLPESICEKLTTL
Q7V3I9_PROMP/9-58-------------------------------------------------------NGKPKSPR-IQVVLPELICEQLNIL
Q31D95_PROM9/9-58-------------------------------------------------------NGKPKSPR-IQVVLPELICDQLTIL
A8G287_PROM2/9-58-------------------------------------------------------NGKPKSPR-IQVVLPELICEKLTIL
A2BZQ7_PROM1/9-58-------------------------------------------------------NGKQKSPR-IQVVLPEDLCERLSEL
A5GQX8_SYNR3/13-62-------------------------------------------------------SGRAKSPR-IQVVLPEALLERLAVA
A3YW17_9SYNE/9-58-------------------------------------------------------SGRPKSPR-IQVVLPEELCDRLSAA
Q05W20_9SYNE/9-58-------------------------------------------------------SGKPKSPR-IQVVLPEELCERLAAL
Q7U4A0_SYNPX/9-58-------------------------------------------------------SGKPKSPR-IQVVLPEDLCARLTAL
Q0I761_SYNS3/30-79-------------------------------------------------------SGKPKSPR-IQVVLPEDLCLRLTAL
A2C697_PROM3/30-79-------------------------------------------------------SGKPKSPR-VQVVLPEELCVRLTAL
A9B9H2_PROM4/9-58-------------------------------------------------------SGKPKSPR-IQVVLPENLCDELSCL
Q7VEB2_PROMA/9-58-------------------------------------------------------SGKQKSPR-VQVVLPEELCAQLTFL
Q0I9D3_SYNS3/28-77-------------------------------------------------------AEAATSER-LNVTLPAGIMSRLKQQ
A5GKY5_SYNPW/28-77-------------------------------------------------------AEAAESER-VNVTLPAGVMNRLKQQ
Q05T64_9SYNE/21-70-------------------------------------------------------AEAAESER-LNVTLPGGVMARLKQQ
Q7TV19_PROMM/21-70-------------------------------------------------------ADSAQSER-LNVTLPVGLMNRLKQH
Q3AIE8_SYNSC/28-77-------------------------------------------------------ADAAGSER-INVTLPRGVMHDLKRH

PF01340

METJ_SALTY/2-105-----------------------------------------AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDE
METJ_SHIFL/2-105-----------------------------------------AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDE
METJ_HAEIN/2-105-----------------------------------------ANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNE

PF12651

C2RWW5_BACCE/9-52S----DETK--I-PMSK------LLDEALED-------LISKRK------------------------------------
A6NT24_9FIRM/10-53A----EDTR--I-PKSR------LLDEAIED-------LLKKYE------------------------------------
C2ZCE6_BACCE/106-149S----ESKG--I-QKSK------IVEEALQR-------FLQRYD------------------------------------
C4IGY2_CLOBU/11-54S----QETM--I-PISK------LLDKSLEL-------LLKEYD------------------------------------
A6LT47_CLOB8/12-55S----EKTR--I-AKSK------LTDEALEL-------LFEKYN------------------------------------
B1QGC9_CLOBO/4-47S----KETR--I-PMSR------LLDEAIED-------LLRKHK------------------------------------
B1RFG8_CLOPF/12-55S----SETR--I-PKSK------LIDEAIEL-------LLKNHN------------------------------------
Q1D537_MYXXD/6-49S----RTTR--I-RQSE------YLREAISD-------LLAKYE------------------------------------
Q0TUT9_CLOP1/6-49K----EQTR--I-DRSK------LLDEAIEL-------LLERHN------------------------------------
C3EDU5_BACTU/11-54A----KDTR--I-NKSK------LLDEAVSD-------LLKKYE------------------------------------
A1BZH8_BACCE/11-54K----EDTN--I-PKTR------LLDQAVSL-------LLLFQS------------------------------------
Q08N33_STIAD/29-72N----QKTK--V-PVAE------YIRQGIDL-------VLEKYK------------------------------------
Q08NJ8_STIAD/30-73S----RRTR--I-AQSE------YLREAVED-------LLAKYG------------------------------------
Q04FI1_OENOB/1-44S----KETS--I-PRSE------LVEKMLEN-------LTKEYE------------------------------------
A5N8S1_CLOK5/8-51S----KEIM--I-PISK------LLDKAVEL-------VPREYA------------------------------------
A7HBK6_ANADF/4-47H----ERTR--V-PVAE------YIRQGIDL-------VLEKYR------------------------------------
B1QGC3_CLOBO/10-53S----AETS--I-PISK------LFDKALEL-------VLKEYD------------------------------------
Q9YEP4_AERPE/2-45S----RRLG--V-ERSR------LVEKAVEA-------LLEDYR------------------------------------
C9KLM4_9FIRM/6-49A----EVTG--T-QKTA------LVDEALEL-------LVQKYR------------------------------------
B4UEI0_ANASK/22-65A----RKTR--V-RQSD------YLREAVAD-------LLAKYG------------------------------------
C0CM34_9FIRM/23-66S----DKTG--I-PLSK------LFDKAIAM-------YLESVD------------------------------------
A2BMU8_HYPBU/1-44S----NQTG--V-NRSR------LIEEAIKG-------YLEDHS------------------------------------
B2TQ69_CLOBB/8-51S----KETM--I-PLSK------LLDKGIEL-------LLKEYN------------------------------------
B1RFE8_CLOPF/8-51S----EKTG--I-PISK------ILDKAMSM-------YLESTK------------------------------------
C3AQ62_BACMY/106-149S----AATG--I-HKSR------IVEEALIE-------FLRKYE------------------------------------
C0EDY8_9CLOT/8-51A----DKTR--I-PKSR------LFDEAVED-------LLKKYE------------------------------------
Q17ZT4_CLOD6/4-47S----EQTR--I-PLTK------LIDEALED-------LIKKYK------------------------------------
A9GWZ6_SORC5/4-47H----ERTK--V-PIAV------YIREGIDM-------VLKHYE------------------------------------

PF01402

YBFE_SHIFL/52-90A----ESRN-.M-SRSE------LIEEMLMQ-------QLAA--------------------------------------
Q9YBV4_AERPE/3-42V----RAGR-YS-SRSE------VIRIAVRE-------LLKR--------------------------------------
O69416_ECOLX/15-53A----AECG-.K-TVSG------FLRAAALG-------KKVN--------------------------------------
REPA_LACPN/8-46A----QKYG-.M-TKSG------LVNFLVNQ-------VAEA--------------------------------------
Q8ZX60_PYRAE/47-86V----RRGI-FP-NRSE------AIRAALRD-------LLYK--------------------------------------
P72681_SYNY3/21-59C----AKEG-.L-SREV------LFEALFEH-------YIED--------------------------------------
Q8ZWZ9_PYRAE/10-49V----RMGV-YP-SRSE------AIRAALRE-------LLGK--------------------------------------
NIKR_CHLTE/6-45I----KAQG-YQ-SRSE------ALRDLIRE-------ELLR--------------------------------------
Q877Q4_PSESM/12-50A----LAAE-.I-SVSD------LMRRAALN-------RKIK--------------------------------------
Y4KO_RHISN/4-42A----EKLD-.R-SRSY------MAAEAIEA-------FVEQ--------------------------------------
O82927_ECO57/13-51A----ARLE-.R-SRGW------VIKQALSA-------WLAQ--------------------------------------
VPB19_MYCTU/2-40A----KASG-.A-SRSE------LIRRAIHR-------AYGT--------------------------------------
Y1433_MYCBO/3-41A----AQEG-.V-SRAE------LIRLLLNR-------ALTT--------------------------------------
O28529_ARCFU/6-44K----KELG-.L-SQSE------IIRRVIKF-------YRDY--------------------------------------
Q8GI05_PSERE/52-90A----ERLE-.R-SKNW------IVKQALAA-------WIDQ--------------------------------------
Q48913_MYCAV/38-76A----EERG-.L-PVSA------VVRSLIAH-------ELST--------------------------------------
YIIE_SHIFL/3-41R----GWRK-.V-SRSA------ILREAVEQ-------YLER--------------------------------------
Q52335_9ZZZZ/18-56A----EDSG-.L-TVSA------YIRNAALN-------KRIN--------------------------------------
Q48832_LACPN/5-43C----KEMG-.L-SKSQ------ALSMLVNK-------EYLE--------------------------------------
NIKR_SHIFL/3-42S----QRRG-YN-NRSE------AIRDILRS-------ALAQ--------------------------------------
COPG_STRAG/4-42A----REMG-.L-SKSA------MISVALEN-------YKKG--------------------------------------
Y080_METJA/3-41I----NKER-.I-SRSE------FIRRALEY-------YVKK--------------------------------------
PARD2_CAUCR/12-50A----EGMD-.Q-PKTA------IIERALRD-------FVEL--------------------------------------
VPB20_MYCTU/11-49A----RRRR-.T-SKAA------LIREYVAE-------HLRQ--------------------------------------
Y298_MYCTU/5-43A----RAAG-.L-NRSE------MIEQALRN-------EHLR--------------------------------------
O30230_ARCFU/6-44R----RDSG-.D-SLSK------IFREAIQL-------YYNL--------------------------------------
O29882_ARCFU/4-42R----KMTG-.K-STSE------LIRDLIDL-------GYDI--------------------------------------
Q04136_9LACT/9-47A----KQKG-.F-SKSA------VAALAIEE-------YARK--------------------------------------
NIKR1_METTH/3-42R----DELG-FS-GRSD------VIRVAARM-------LIDE--------------------------------------
Q9I707_PSEAE/4-42A----RATH-.R-DRPY------HLRQALAQ-------YLER--------------------------------------
E51_SSV1/12-50K----AKTG-.K-TMGQ------LIEEAVKL-------LEAE--------------------------------------
Q88JZ4_PSEPK/2-40A----CLRQ-.R-SSHW------IMREAITQ-------YVER--------------------------------------
Q8GFT4_CITFR/12-50A----HEAG-.L-SLSQ------YLIKSGLG-------KRIQ--------------------------------------
Q888D4_PSESM/12-50A----IDSG-.V-SISE------FLRCAALK-------RKTR--------------------------------------
O30109_ARCFU/6-44T----AVEN-.K-TVSD------IIRESIIT-------YAEL--------------------------------------
O73988_PYRHO/6-45V----KRGI-YP-NRSE------AIRVAIRE-------LLKK--------------------------------------
Q52179_9BACL/9-47A----GRYG-.M-SANS------LVSYILGQ-------WLDN--------------------------------------
NIKR_HELPY/12-51I----IKNG-YS-SRSE------LVRDMIRE-------KLVE--------------------------------------
COP6_STAAU/12-50K----EKYN-.I-SKSD------ATGILIKK-------YAKE--------------------------------------
Q45960_CLOBU/2-40S----KKTG-.V-PQSS------LMALALSE-------YKDK--------------------------------------
O07291_NATPH/4-42D----DETG-.A-GQSE------IVRRALSF-------YAGN--------------------------------------
Q52017_9ZZZZ/4-42A----NKLG-.M-TISG------YVRYLVLK-------SSEM--------------------------------------
O32744_LACAI/6-44A----KDQG-.L-TKSG------LLTVLISK-------EIER--------------------------------------
O05476_SULIS/7-45A----QKYD-.I-SESD------VVKIALKK-------LARE--------------------------------------
Q8EGZ2_SHEON/6-44A----ETRK-.R-SSHW------MMREAIRE-------YVER--------------------------------------
O05474_SULIS/21-59C----ERYG-.I-KKSE------FIRNAVIE-------KLIQ--------------------------------------
Q53277_BACTK/3-41S----KESG-.V-PKST------LVHLALEN-------YVNQ--------------------------------------
Q8PJU0_XANAC/2-40A----RDCG-.M-SVGQ------FVLAAALG-------RRTR--------------------------------------
Q45137_BACFG/6-44A----KSNN-.V-SKKD------FLSCALEY-------FEKY--------------------------------------

PF09274

Q70W75_YEREN/1-74C----AKQG--T-SITD------VIKDLVDN-------WLKEND------------------------------------
Q9F809_ERWAM/1-76C----VKNG--T-SITD------VINQLVDN-------WLTEHE------------------------------------
Q9KJ82_SALNE/1-76C----ARKG--T-SITD------VVNQLVDN-------WLKENE------------------------------------

PF05534

Q7N3F9_PHOLL/54-104A----LEED--V-TINA------FVNQAL---------------------------------------------------
Q88MT9_PSEPK/54-104A----ELAE--K-SINQ------WVSDIL---------------------------------------------------
Q6A7R8_PROAC/60-110A----AEQH--L-SLNQ------YVTRKL---------------------------------------------------
Q73YB6_MYCPA/53-103A----AEQR--V-SMNQ------WVVQKL---------------------------------------------------
Q7N8L4_PHOLL/59-111A----AEHQ--I-SVNA------FIIETL---------------------------------------------------
Q92KT7_RHIME/1-48A----AAAG--K-SLNE------WVIGAI---------------------------------------------------
Q6MB72_PARUW/52-102A----KFNG--I-SLNN------YISQTL---------------------------------------------------
Q7VMR2_HAEDU/57-107A----TKQG--L-ALNA------FVYKAI---------------------------------------------------
Q7MY97_PHOLL/58-110A----ISHA--V-SKNQ------FIVQLL---------------------------------------------------
Q88G27_PSEPK/52-102A----TKQS--I-SLND------LTRKAL---------------------------------------------------
Q9RAA8_RICFI/57-107A----MQHG--Y-TLNG------IVKKAL---------------------------------------------------
Q73J27_TREDE/55-105A----IMQG--I-SLNQ------FIQQAV---------------------------------------------------
Q6SK25_ARTAU/61-111A----ANHG--V-PLNR------YATELL---------------------------------------------------
O87467_HAEIF/54-102A----GDR.--.-SLNA------FVTEAI---------------------------------------------------
Q8YLM2_NOSS1/53-103A----KKEG--Q-SLNS------WIEKCL---------------------------------------------------
Q87BV6_XYLFT/64-114A----AAQG--I-SLNQ------FVEQAI---------------------------------------------------
Q73KK4_TREDE/52-102A----KSLN--L-SLNT------FVEKAL---------------------------------------------------
Q92XZ7_RHIME/54-104A----ELSG--K-SLNQ------WAEEVL---------------------------------------------------
Q73QG2_TREDE/62-112A----EHEG--V-SLNQ------YVLYRL---------------------------------------------------
Q6G4L9_BARHE/55-105A----AENG--V-SLNR------YISSKL---------------------------------------------------
Q9RZI7_DEIRA/54-104A----QSQE--I-SLNT------LVERAI---------------------------------------------------
Q7P9J0_RICSI/58-108A----LRAK--I-SLNA------LVSQKL---------------------------------------------------
Q8X5S8_ECO57/60-112A----AQQQ--V-SVNT------YIIETL---------------------------------------------------
Q8XYR1_RALSO/55-105A----AAQG--V-SLNQ------WAAGVL---------------------------------------------------

PF05509

B8EFN4_SHEB2/13-61C----ERSA--R-SKRA------EIQLRIEH-------SLLSFV-----------------------DAPPK---PIKQ-
Q4LC31_SODGL/14-62I----QKTG--K-SRSG------EVKLWVQD-------HLKRFP-----------------------DFNPD---SREV-
B6ESX2_ALISL/7-55K----ETSG--R-TKRN------EAAARLKD-------HLLRFQ-----------------------HQDSW---EVQK-
A7DVG3_VIBVU/13-61K----AYNS--R-TKRA------EAQARLEH-------HLELFG-----------------------VNWEV---PKSK-
B2LS54_9VIBR/10-58K----THSK--R-TKRA------EAQARLEH-------HLDLFG-----------------------VNWEV---PKNN-
B8EFW0_SHEB2/41-89A----KRNN--R-SKRK------EAQARLID-------HLSRFD-----------------------EMGMG---LKGK-
B6ET57_ALISL/12-52A----ERNG--R-SKRA------EALAIVKK-------DIQ...-----------------------.....---QKLT-
A6ASC2_VIBHA/12-60A----EFNK--R-TKRQ------EASFRLSD-------HLTKFD-----------------------RHMTP---RAKA-
Q7MBP1_VIBVY/10-58A----KENK--R-TKRQ------EASFRLSH-------HLTHFD-----------------------EHMKP---RTKN-
A7N8Z3_VIBHB/12-60A----EAND--R-SKRK------EARFRLKD-------HLSKFN-----------------------QHMKP---RAKS-
Q5DY84_VIBF1/10-58A----QKTG--R-SKRQ------EAAIRLAD-------HVARFS-----------------------ALNEF---EYIE-
B5PNJ9_SALET/24-72A----LKSG--R-SKKR------EAELRLED-------HLRRFS-----------------------LVPAE---EQYI-
A6D5H0_9VIBR/18-66C----DESG--R-SLRK------EAKLRLED-------HLNSYS-----------------------NIASV---GNNV-
Q6LW96_PHOPR/20-68I----GRSK--R-SKKK------EAEIRLAD-------HLDRYT-----------------------LIPKS---KCQY-
A8QYN9_9GAMM/15-63C----MRSG--R-KKIP------EAALRLED-------HLIRYR-----------------------SISEL---NQTI-
A7N8V1_VIBHB/9-57S----QRSF--R-SLKK------EASLRLID-------HVQRFH-----------------------HSPQN---KLDE-
E6WK64_PANSA/14-62A----ERSG--R-SKSG------EARLRLMD-------HLTFFS-----------------------EIACS---GKRF-
D4IGT0_ERWAE/12-60A----ERSG--R-SKTK------EALFRLTD-------HLDTYS-----------------------DLATP---GIRF-
B2VB54_ERWT9/25-73A----DRSG--R-SNTK------EAYVRLDD-------HLKSFT-----------------------DLATP---GLRF-
B6ICE9_ECOSE/13-61A----KAAG--R-SKSL------EATLRLTQ-------HLNSVP-----------------------VLGEN---SYWE-
Q8L370_SALEN/14-62K----DRSG--R-SKTI------EVQIRLRD-------HLKRYP-----------------------DFYNE---EIFR-
D2D9E9_KLEPN/14-62R----ERSG--R-TKTN------EALVRLQD-------HLQRYP-----------------------DFYNE---EIFR-
B1VC85_ECOLX/14-62R----DRSG--R-TKTN------EVFIRLKD-------HLNRFP-----------------------DFYNA---SLVK-
D2U5U3_SHISO/14-62R----ERSG--R-TKTN------EVLVRLRD-------HLNRFP-----------------------DFYNL---DAIK-
TRAY1_ECOLI/70-118K----NRSG--W-CKTD------EAADRVID-------HLIKFP-----------------------DFYNS---EIFR-
A6TIF9_KLEP7/67-115K----NKSN--R-SKSH------EVYLRLKA-------HLFEFP-----------------------DFYSS---EVEV-
A6TIT2_KLEP7/72-120K----NRSG--R-SKSL------EVYLRLKA-------HLLEFP-----------------------DFYSS---EVEV-
Q1MKC7_RHIL3/2-50S----RRTG--R-SKCF------YVRQAILA-------HLDDVE-----------------------DIYLA---ERRL-

PF03869

RMNT_BPP22/2-51A----EANG--R-SMNS------ELLQIVQD-------ALSKPS-----------------------PVTG---------
RARC_BPP22/4-53A----EENG--R-SVNS------EIYQRVME-------SFKKEG-----------------------RIGA---------
Q9RPY7_PSEAI/13-62A----RSHH--R-SMNS------EIIARLEQ-------SLLQEG-----------------------ALQD---------

PF10723

Q663G0_YERPS/1-84C----EDSG--L-TQTE------MIERWIQR-------EKAART-----------------------NA...---...A-
Q93GS8_SALTY/8-88C----EETG--T-TQAQ------MIELLIER-------EMAKR.-----------------------.....---...A-
COPB2_ECOLX/1-84C----HEDG--L-TQAE------VLTALIKS-------EAQKRC-----------------------.....---...M-
Q8RTD2_ECOLX/1-82C----EAEG--V-TQAE------MIAELIKQ-------KSAF..-----------------------.....---...S-
Q326V9_SHIDS/1-86C----EREG--I-TQAQ------FVEKIIKD-------ELQRLD-----------------------IL...---...K-
Q1R236_ECOUT/1-86C----KDSG--L-TQKE------MIEHWILK-------EKAAMT-----------------------DA...---.NRK-
Q27TF8_ECOK1/1-85A----DEEG--I-TQAQ------MLEKLIES-------ELKRRA-----------------------T....---...S-
A1JUD2_YERE8/1-78S----SVYG--K-TKTE------VIEQLIKM-------AKDGCG-----------------------F....---...K-
O07483_YEREN/1-84C----NASG--L-SQAE------LFSRLIEK-------A.....-----------------------.....---...E-
A6TI22_KLEP7/1-92C----EEEG--L-TQAQ------FIEKLLER-------ELTERG-----------------------LIDVK---TSHS-
Q7BQV5_9ENTR/1-90C----NEDG--L-TQAE------LIERLIEC-------EMERRA-----------------------K....---...R-
Q2VP21_ECOLX/1-85C----AAEG--V-TQAE------LIERLIEK-------EACHRN-----------------------M....---...A-
Q65AF6_YERPE/1-105C----EEEG--L-TQAQ------FIETLLER-------ELSERG-----------------------VLDVK---TSHS-
A4SMJ0_AERS4/1-74G----MHLE--D-SQAS------LIEQAIDL-------LYQH..-----------------------.....---...E-
Q48416_KLEPN/1-70T----KVKK--L-TQAE------VIEFLVKS-------YYDGL.-----------------------.....---...K-

PF04221

DINJ_ECOLI/4-84L----AGMG--L-TISD------LVRITLTK-------VAREKA-----------------------LPFDL---REP..
Q9KML3_VIBCH/3-84C----DEMG--L-STSQ------AIKLFAKA-------VINHGG-----------------------IPFEL---RVPQP
Q9A0Y8_STRP1/13-96L----KRLG--I-PMST------AIDMFLNQ-------IILTGG-----------------------IPFDV---SLPEA
Q9PBQ9_XYLFA/4-84L----AAMG--L-TISD------AVRLLLTK-------VAQDKA-----------------------LPFEP---LIP..
RELB_SHIFL/1-79L----EKMG--V-TPSE------ALRLMLEY-------IADNER-----------------------LPFKQ---TLLSD
RELB_HAEIN/5-93I----EQYG--L-TPSQ------VFNMFLAQ-------IAKTRS-----------------------IPVDL---NYLRP

PF13467

Q07PP8_RHOP5/4-69S----GLRD--M-TLSE------LVGEI...-------..DSNR.......Q...............QG.NL---SSAIR
A8TZV0_9PROT/6-70A----GERD--Q-SVNS------LVAEI...-------..DRTR.......................ST.NL---SSAVR
Q1NA23_9SPHN/16-85A----GDRS--I-PVNA------LIARI...-------..DLAR....MAADP..............AP.NL---ASAIR
A3WHC8_9SPHN/13-82A----ERET--M-PLSA------LVAKI...-------..DAER....IASAT..............PP.GL---ASAIR
Q2W7L3_MAGSA/4-68A----ESRG--T-SINQ------MVAGI...-------..DSTR.......................EA.NL---SSAIR
A4TUN3_9PROT/1-65S----ERDG--V-SINQ------LVSVI...-------..DTDR.......................DG.NL---SSAIR
A7HVX0_PARL1/12-78A----CTEK--T-SVNE------LVRRI...-------..DTRR.......DG..............QG.SL---SSAIR
C5AUK2_METEA/8-73A----QARG--Q-SVQA------LIGAI...-------..DSER.......G...............AR.NL---SSAIR
B2IH09_BEII9/16-86A----EART--L-SVAA------LIAEI...-------..DAARVESS...PS..............RK.NL---SSAIR
Q6FZ86_BARQU/2-80A----YKKG--Q-SLAF------IITDI...-------...AKR.......TAASESFLFITRLCTPEY.SL---SPSL.
C3MEF5_RHISN/1-67A----KSRG--M-PLAR------LIVEI...-------..DDGR.......GS..............EG.NL---SSAIR
C9TG23_9RHIZ/6-72A----AARN--M-TVAA------LVAEI...-------..DSRR.......ER..............TI.NL---SSALR
Q11GU9_MESSB/3-69A----AAQG--K-PVAA------LIGEI...-------..DASQ.......SR..............NT.NL---SSALR
A9D3H5_9RHIZ/10-76A----DERG--L-AVAA------LIAEI...-------..DSAQ.......ET..............PG.NL---SSAIR
D8JQT3_HYPDA/2-67A----AEDG--L-TLAG------LINAI...-------..DKDR........G..............GA.GL---SSAVR
E3I0W1_RHOVT/37-102A----EEQG--R-TVAA------LVAEI...-------..DAAR.......G...............PA.GL---SAAIR
C7KDM2_ACEPA/4-70A----NQQK--Q-TLPQ------LVTKV...-------..DAAR.......SP..............EQ.SL---ASALR
A5FXC9_ACICJ/2-68A----ARRG--V-ALGT------LVGEV...-------..DAAR.......DP..............DR.PL---ASALR
D5VIX9_CAUST/3-68A----TRDG--A-SLAA------LIQRI...-------..DNAR.......G...............ER.PL---ASACR
A0NVL5_9RHOB/2-68A----DATQ--K-SLAG------LIAEI...-------..DDNR.......DP..............ED.PL---SSAVR
Q0AMZ5_MARMM/16-81A----RDQG--Q-SLAS------LIGEI...-------..DAAR.......................EGEPL---ASSVR
E0TDI6_PARBH/5-70A----VRRG--V-PVAQ------LILDA...-------..DLKR........G..............SQ.GL---ASTLR
A0KLC1_AERHH/25-95C----QAQG--R-SMGL------FLSELYQE-------ALGNGM.......................EMSNF---ASLLR
Q0G519_9RHIZ/14-84A----ESQD--M-SLAK------FLTKLHDE-------VLDLRG.......................EVRNF---ASHLR
A8LPV2_DINSH/14-84A----EAEG--R-STPA------FISTLHGE-------VLEARG.......................EPVNF---TSLLR
A8HUM8_AZOC5/14-84A----ASEG--S-SVAK------FITTLHDE-------VLDCRG.......................EVQNL---ASLLR
Q8EH51_SHEON/14-84A----EDAE--L-SVAV------FLTRIYRE-------VLARQG.......................EVANF---ASLLR
C6BV10_DESAD/14-84A----EEEQ--T-STGK------FISTLHNE-------AYSLNG.......................EISNF---ASLLR
A4TW65_9PROT/14-84A----AEGG--L-SLPQ------FLTQLHDE-------VIERRG.......................EIGNF---ASLLR
Q2SKQ2_HAHCH/14-84A----DSEG--M-STSQ------FMAKLYDE-------VVEKRG.......................EVGNF---ASLLR
Q7MIW4_VIBVY/61-131A----DAQQ--L-TVPK------FISTVYRE-------ALEHNG.......................EVSNF---ASLLR
A6WUZ0_OCHA4/14-84A----ASQN--L-TTPR------FISTLYDE-------ALEANG.......................AIPNF---ASMLR
B8EK53_METSB/14-84A----ASEG--S-TLGR------LLTKLHDE-------SLEFQG.......................GIGNF---TALLR
A9D0B8_9GAMM/23-93A----ESQG--V-KRNQ------FIASLYIE-------ALNHHG.......................DVKNF---TSLLR
A4XXG0_PSEMY/14-84A----EVDG--M-TTNQ------LIAKLYEE-------VMDFRG.......................EVVNF---ASFLR
B1SXR3_9BURK/14-84A----ADTE--I-TTNQ------LIARLHRE-------VTEYAG.......................QTVNF---ASFLR
A2SED0_METPP/14-84A----SEQK--C-TTNA------LITKLYDE-------ATTHRS.......................ESANF---ASFLR
Q57CU3_BRUAB/14-84A----ARDN--L-TVSR------LLGKLYDE-------SRNEGH.......................DLDNF---ASFLR
A6EV75_9ALTE/24-94A----ARDG--M-NLPQ------MITRLYHE-------SIDAGH.......................DLGNF---TSFLR
B5SFN5_RALSL/14-84G----QRDG--L-SVSQ------LIGRLYDE-------LLDRRG.......................EIANF---ASFLR
A5FYB5_ACICJ/14-84A----TAEG--V-SVPR------LIALLHDE-------AEDWFG.......................DIDNL---ASLLR
C3JYT3_PSEFS/33-103A----RINA--C-SVSA------LLSYVDRE-------VHLRYG.......................GVKNF---SGLVR
Q141Z3_BURXL/64-134A----RQES--V-TVGK------LISRWALE-------IDLTQE.......................AICNF---TGFVR
A4TYI1_9PROT/37-105A----REEG--V-TASA------LIARIHDH-------CLVTND.......................R..NL---ASCLR
D3NY07_AZOS1/12-77C----ERER--L-TLNE------ICTQI...-------..DERR......................GDS.NL---TASIR
B6IW11_RHOCS/2-67C----RREG--R-TVHE------IVTLI...-------..DRLR........G..............DG.GL---TAALR
B6IVX3_RHOCS/18-84C----RREG--R-SVHE------VCSRI...-------..AQAK.......PP..............AA.SL---TAAIR
B6IXV3_RHOCS/23-89A----EIEG--T-TIHQ------LISMI...-------..AARR.......HE..............TS.TL---TATIR
D3NQN8_AZOS1/38-116G----RREG--L-TVNR------LCTQIKER-------IEEQARRRGINPEDA..............DV.TL---TSAVR
D3NST4_AZOS1/3-70A----QLRG--K-TVGG------LVSDI...-------..ESGL......PDG..............AD.NL---SAEVR
D3NR24_AZOS1/9-75C----TREN--M-TLSE------LVSKI...-------..DAEC.......RD..............SD.NL---TGCVR
Q2W502_MAGSA/60-132A----DEAH--C-AIDD------LCETA...-------..RRRY.......................EASSL---TSAIR
B6R003_9RHOB/2-68A----RSQG--K-NITA------TIAGI...-------..DDER.......NP..............EN.NL---SSCIR
B7QTG9_9RHOB/4-70A----AADG--R-AIND------LAAEI...-------..DETR.......GV..............DC.GL---ASAIR
A3K2C9_9RHOB/4-70A----AEMD--K-PLNA------LASEI...-------..DEAR.......DP..............EV.GL---ASSIR
Q167I6_ROSDO/4-70S----QENG--K-PING------LVADI...-------..DVKR.......GT..............ST.GL---ASAIR
A1B3A7_PARDP/21-87A----RAGG--R-TTAT------LIAEI...-------..DAAR.......PP..............EV.GL---ATALR

PF08681

Q8E866_SHEON/19-95A----AING-.I-NLTA------FIINNVRE-------KALAIV-----------------------ESETT...LNLNQ
Q7N880_PHOLL/12-90A----KVKG-.K-TVTE------YVLDTIKR-------DAENTL-----------------------LEHSF...MIVSP
Q57KM3_SALCH/11-90A----AIQQ-.T-NLTD------FVVSNVLP-------VAQKIV-----------------------DAAER...VYLTE
Q7N7Z2_PHOLL/8-88L----SLSG-YA-SLNS------FIANAAVA-------EAKRLI-----------------------EQNMR...IQLCQ
Q4CB51_CROWT/8-87A----RLKG-.V-SLSS------YTLFHLIR-------IAKKEI-----------------------EQEER...LILSN
Q92P91_RHIME/11-90A----AHER-.L-DVTS------FIMRAVLP-------AALDVV-----------------------ENAER...ISLSE
Q5PIQ5_SALPA/13-91A----KARG-.K-NRTD------FVLEAARA-------AAEEAL-----------------------IEQRI...IMADP
Q4UXV1_XANC8/13-91A----KARG-.K-NRTD------FMLDAARS-------AAEEAL-----------------------LDQTL...ITASP
B3EP86_CHLPB/11-90A----ALEH-.T-HLTD------FVISKVVS-------AARQVI-----------------------ERHER...LELSE
Q7NIQ1_GLOVI/13-92A----AIEH-.K-TVSG------FLLDSGLK-------ASAQIL-----------------------ADRWF...FLLDD
Q7NLC6_GLOVI/11-90A----QLEG-.R-TVSD------FVVASALE-------AASRTI-----------------------QEHGL...LYLSQ
Q8D4I7_VIBVU/8-84A----LLSN-.T-TVSR------FIAETVAQ-------RVESVI-----------------------AEQKR...LLVAH
B4SB08_PELPB/10-88A----IASN-.R-TLSE------FVLESALS-------RAEETL-----------------------ADRRS...FSLDV
Q57IR1_SALCH/8-87A----AITN-.Q-SITQ------FMLNSAAE-------RAAEVL-----------------------EQHRR...VILNE
Q5P620_AROAE/9-88A----ELQG-.R-TMTD------FVIAAVQD-------AAQRAI-----------------------EQAEV...IRLSL
Q2SAN8_HAHCH/11-89A----RVCH-.K-NVSE------FLLDAGVT-------AATQTL-----------------------ADRRQ...FVLGE
A4Y6X3_SHEPC/26-106A----AALG-CA-SLTE------FMVRLIRD-------NAPQIL-----------------------QSQSA...IEITS
Q93ER6_PHOLU/6-85A----ALMG-.T-TMAA------FVRTAAKE-------KARELL-----------------------GRDSR...ITMTV
C1DE12_AZOVD/13-92A----QVKG-.K-NRTD------FILDAART-------AAEEAL-----------------------LDRAF...IAASP
Q4BWD7_CROWT/10-89A----DLTG-.A-TLNQ------FMVAAAVK-------EAQFVI-----------------------KQEQV...IHLSD
A5EL48_BRASB/17-96A----ALQG-.R-SVTD------FVLASVQD-------AARRTI-----------------------EEHSQ...LTLSV
A4JRY5_BURVG/14-96A----DLSG-.S-TLNQ------FIVQSALR-------AAEQVI-----------------------EQEEVIRSIRLTM
Q5X0W2_LEGPA/12-92A----ELSG-MN-NFTA------FVIKALKD-------ASVKVI-----------------------KEHAL...IELSL
Q5EP84_NEIGO/11-90A----ELQG-.R-SMSE------FVISAARE-------AAQKAV-----------------------ADAEI...LMLSE
Q8ZL97_SALTY/13-91A----EILH-.K-SRTD------FILETACQ-------AAEKVI-----------------------LDRRV...FNFND
Q8XPL2_RALSO/16-98A----DLSG-.S-TLNQ------FVLQSALR-------AAEQVI-----------------------EHEETIKAIKLTV
Q6LIX8_PHOPR/32-112A----AIAG-MS-SINS------FVLSAAVE-------KAKQIM-----------------------ERERA...LKLSQ
Y420_HAEIN/9-88A----AITG-.R-TLTD------FVVSVAYE-------EAKKTI-----------------------SEHQV...LRLAV
Q5P632_AROAE/5-83A----SLLG-.K-NRSD------FMLEAACD-------RAQAVV-----------------------LDQVF...FGLDA
Q5NX70_AROAE/9-88A----EIQG-.R-TMTD------FVVTAVKD-------AAQKAI-----------------------EQAEV...IRLSL
Q7N6D8_PHOLL/7-86A----EIQG-.R-TMTD------FVVSAAQD-------AAQRAI-----------------------EQSEV...LRLSL
Q9S0Y9_ECOLX/14-93A----AMTN-.Q-SISQ------FMVSTASA-------RAAEVI-----------------------DQHRR...LLLNE
Q5I739_DICNO/6-83S----QKLG-.V-SVSS------FMAQSAYE-------KALN.I-----------------------EQSEM...IYLNQ
Q3Z4X6_SHISS/35-113A----QAVG-.V-DLSA------FILSAAME-------RAESVL-----------------------DNQRR...RELSN
Q7N0J5_PHOLL/11-90A----ALQH-.T-NLTE------FVLRNVMP-------AARKVI-----------------------DENER...LELTE
Q6ZEG7_SYNY3/12-91A----ALEG-.R-SLTD------FVVASAQA-------AALKVI-----------------------EQHQT...LQLTI
Q87ZN7_PSESM/15-103A----TVSG-.L-DMTA------FIMASAFE-------KAEVVM-----------------------ENHRR...IELSE
Q3SNN6_NITWN/19-98A----ALQG-.R-TVTD------FVLTSVQE-------AARRAI-----------------------EDHQT...LHLSL
Q9KM95_VIBCH/57-136S----ALLG-LK-SLTE------YVVRLMDE-------DATHVI-----------------------EEHES...IMVKD
Y4AR_RHISN/23-102A----ALSG-.L-DDSA------FTINAAYQ-------SAIATI-----------------------AAHEA...TLLQT
Q7WCE6_BORPA/11-90A----SYRH-.K-TVSQ------FVLTTALA-------EAEKVI-----------------------RENEA...VSLSA
O05910_MYCTU/74-152A----EAEG-.T-DLTN------FTVTAALA-------HARDVL-----------------------ADRRL...FVLTD
Q7N3R4_PHOLL/22-101A----DYSG-.A-TLSQ------FLIESAME-------RARNVI-----------------------ERTET...LHLSI
Q3REC2_XYLFA/5-83A----NLLG-.K-NRSD------FMLEAACE-------RAKAII-----------------------LDQVF...FNLDE
Q7TXU2_MYCBO/72-150A----ALTG-.Q-SLSG------FVLSAAVD-------HAHDLL-----------------------ARANR...IELSE

PF07362

Q21DI4_SACD2/10-81N----INLS--A-TLEQ------ALKQQLAQ.......AEATKW-----------------------AKKNKAAIKAYNS
A1JQ04_YERE8/7-78G----INLS--A-TLTA------ALDAELRQ.......YEAKKW-----------------------QEENNKALEALNR
Q58WP3_SALDE/19-90G----INLS--A-VLTA------ALKEEISA.......TGVERW-----------------------KAENRAGLQELNR
A6A373_VIBCL/10-81N----INLS--A-TMEK------ALEKEVSS.......RLKAEW-----------------------LEQNAEAIEACNE
Q3ZU16_ECOLX/1-72D----VNIS--G-LVST------TMQNEARR.......LRAERW-----------------------QAENQEGMAEVAR
Q6D9V2_ERWCT/1-72G----VNIS--D-LVND------AIGRKARR.......IKAEEW-----------------------KKENRERMEDIAR
A3T0A7_9RHOB/2-73G----LNMS--R-LAEA------AISEAAKA.......ERNRRW-----------------------RIENQQALDTYAQ
Q7N4P4_PHOLL/8-79G----LNLS--A-VLTK------ALISELKA.......VESERW-----------------------KRENKAGMEELNR
A4BMU8_9GAMM/10-81G----INVS--R-SAEA------GISEAVKR.......HKRQRW-----------------------LKENEGALASSNA
B0T4X1_CAUSK/2-80G----ISVA--G-MSET------QLRLHLQKVDPAGAEERARQW-----------------------VEENAAVISELNR
Q8FLA0_ECOL6/6-77G----LNMS--A-TLTV------ALNAELKK.......HAATRW-----------------------REENAEAIAALNQ
A5GAE8_GEOUR/22-93H----INLS--Q-TLEL------RLAELIRE.......EKRRQW-----------------------LEENREAIEVYNR
A4TXE4_9PROT/5-76G----INLS--Q-TLES------ELEKLVRQ.......AKAKAW-----------------------AEENREAIASQTR
Q5P2R6_AROAE/21-92G----INIS--K-ACDE------CLRELVRR.......ERARRW-----------------------KEEYAEFIEVYNR
Q1GN85_SPHAL/10-81E----INVS--E-ACQS------GLAAEVKK.......AREAAW-----------------------KKENRAAIESWND
Q1NL18_9DELT/11-82H----INLS--Q-ALEL------RLAELLRE.......DKCRKW-----------------------HEENEEAIEDYNR
Q0F2A7_9PROT/5-76N----INLS--Q-TLET------SLVAVLRE.......KQKAVW-----------------------LAENSEAVNAYNQ
B5EG30_GEOBB/11-82H----INLS--Q-ALES------RLAEMLRK.......ETSRSW-----------------------QEENREAIEEYNS
F2GB87_ALTMD/10-81K----VNLS--A-TLEQ------ALKDKLKS.......VEEESW-----------------------KKENKAAIAAYNE
A7HPK7_PARL1/4-75D----INLS--A-TFEE------VLRTRARE.......EERKRW-----------------------VEENRDAIEAFNR
Q7MZJ1_PHOLL/1-72G----VNIS--G-FVNK------AMTREAQR.......IKAESW-----------------------KADNRKGLEEIAQ
B2JXB4_BURP8/9-80G----INFS--R-ACEQ------ALRDAIKA.......EEGRRW-----------------------AQENAEFIKNTND
Q6D8L1_ERWCT/1-72W----IPIS--G-LTND------VIDKEDHR.......IKTEVW-----------------------KKENREGMEDVAR
A3J7N2_9ALTE/14-85N----INLS--A-TLER------ALREELAK.......RKAAQW-----------------------ADENRAAITSYNE
A0L724_MAGSM/10-81N----INLS--K-ELEK------HLDKLVAE.......RQQQVW-----------------------KEENQEAIKQYNS

PF09957

Q82BL1_STRAW/2-49M----RLMG.VT-TKKE------TVNAALRD-------YVARIK-----------------------....RL..DAAEK
VAPB6_MYCTU/2-48M----RIAA.VH-TKKE------AVNLAMRD-------YVERFR-----------------------....RI...EALA
Q39AR5_BURS3/1-44Q----QLTG.VT-EKSA------LVKEALRA-------LIARES-----------------------....AR......R
A0PM00_MYCUA/3-54I----RRYR.LA-GPRE------VVHLALRT-------LLAEAG-----------------------EK..GGGDDEYDE
Y634A_MYCTU/16-68I----RRYR.VK-GARE------AVNLALRT-------LLGEAD-----------------------TAE.HGHDDEYDE
Q20X13_RHOPB/8-51Q----QYAG.VK-EKSA------VIKKALQA-------YVESEA-----------------------....AR......R
A3Z0W5_9SYNE/1-44G----TLSG.IK-ERTQ------LIREALKA-------LIERER-----------------------....SR......R
A1KM99_MYCBP/15-62A----KELG.TT-TKKD------TVHAALRA-------ALRASA-----------------------....AR..SLMNR
Q4C4H3_CROWT/1-47L----KVTG.LK-TKKE------VIEMGIKT-------LIDLKK-----------------------....QE...QIKQ
A2VJB7_MYCTU/7-54Q----RMYR.LD-SKRS------AVDLALRR-------LVGEPL-----------------------....GR..DEALA
Q2FLV1_METHJ/1-47L----VIGG.CN-TKKA------AVTEALIE-------YIQRRK-----------------------....QI...QITS
A3YY99_9SYNE/1-47M----QASG.AR-TKRE------AVEIGLRT-------LVRLEQ-----------------------....QK...RIRA
Q2JXE5_SYNJA/1-50R----QLTG.LK-TKRE------IIHEALRT-------LIRLYE-----------------------....QA...EIRN
A0QC46_MYCA1/1-44A----ELTG.VT-ESVA------LLRQGLQT-------LVRVES-----------------------....AR......R
Q474F3_CUPPJ/8-52L----AMADPLM-DKSE------LVQEAIRT-------FIRVQA-----------------------....AK......R
Q58AH0_RALME/1-44Q----AYTG.LS-EKTA------IVREALKA-------LIQREA-----------------------....AK......R
C1AEZ3_MYCBT/4-56Q----AVTG..E-TLRA------TVERALQQ-------LVAAAA-----------------------EQAAARRRRIVDH
Q3JAZ0_NITOC/1-47F----RCVS.VK-SKKE------LVHLALKE-------FVEHHQ-----------------------....RK...DLRE
A1U2W3_MARAV/1-47L----KASG.YE-TKKE------AVEQGLKL-------LVQLSK-----------------------....QQ...EIRK
A1VX34_POLNA/1-45V----ALAEPGI-EKSE------LIRECVKA-------FIQRQA-----------------------....AR......R
Q7AQ19_MYCLE/3-56I----RRYG.LL-GRRE------AVHLALKA-------LLGEPG-----------------------VGGLSEQDPEYDE
A3Z0W8_9SYNE/1-44Q----QLSG.IN-ERTQ------LVREALKA-------LVQRES-----------------------....AR......R
Q73PC1_TREDE/1-47Y----KIGG.YS-TKKE------TVNTALEE-------FIKRRK-----------------------....SE...DLIK
Q3M6F1_ANAVT/1-47F----QLTN.LT-TQEE------LMNLALQE-------FVRSRR-----------------------....KK...NLLD
B3EKM2_CHLPB/1-47F----SVSD.AK-TKKA------LVEEALEV-------LIRLKK-----------------------....RK...DLTE
A7BR89_9GAMM/1-50S----QLTG.IR-DKTT------LIKAGLKA-------LITLEN-----------------------....DKQRSKLDK
Q73R95_TREDE/1-44F----ALTK.IK-TKTE------LIEVAIDN-------LIKKYQ-----------------------....IQ......D
Q7NCS8_GLOVI/1-47F----QLTN.VR-TKKE------LLQLALQE-------LIRARK-----------------------....KR...NLLD
A3TGX0_9MICO/1-44A----ELTG.IS-EKSV------LLRDGLET-------LIRVES-----------------------....AR......R
A8ZTF6_DESOH/1-44S----KMTG.IK-EKTA------LVKLGLEA-------LIARES-----------------------....GK......R
A3EPI1_9BACT/1-44Q----NMTG.LT-SRNA------LLKEALEA-------LIQRES-----------------------....AR......R
A4BPR4_9GAMM/2-48L----RLAK.VR-SKRE------LVHLALKE-------FVENHQ-----------------------....RK...DVLE
A5U2R7_MYCTA/7-54M----RRFG.LT-TKRA------AVDLALRR-------LVGSPL-----------------------....SR..EFLLG
A3Z9K4_9SYNE/1-44Q----ELCG.HL-ERTH------LLKEALQA-------LVERES-----------------------....AR......R
Q7D057_AGRT5/1-48M----EITG.LP-TKKA------TVEKALRD-------LVENLG-----------------------....RR..KALQE
Q07NJ5_RHOP5/1-47Q----KAAG.QA-TKKD------TVEQALRL-------MVRLKK-----------------------....QR...DVAL
A3IRW5_9CHRO/1-47L----KLGG.HR-TKRA------VVEAALKE-------YVQRRK-----------------------....QL...EITE
A0YU49_LYNSP/1-48L----ELTQ.FK-TEKE------VIEFALKE-------LIRTRK-----------------------....KR..KNLLD
Q2FNJ2_METHJ/1-47Q----RIGG.VK-TKKG------VITEALIE-------YIQRRK-----------------------....QI...EIIS
A5G896_GEOUR/35-78A----KLTG.IT-EKTS------LVRLGLQA-------LIAKES-----------------------....SK......R
A5GB97_GEOUR/1-47R----TVGK.HA-TKKA------VVNEALAE-------YIQRRK-----------------------....QA...EIIN
Q73SG9_MYCPA/11-61I----RRFH.LA-DARE------AVNLALRT-------LLHEGD-----------------------S...VASEDEYDE
A4BVI5_9GAMM/1-47L----RLTG.LK-TKRE------VVELALQT-------LLRLRQ-----------------------....QE...QVKQ
A0ZI46_NODSP/1-47I----KATG.IK-TQRE------VIELGLKT-------LIKLKE-----------------------....QE...KIKT
A4BVE0_9GAMM/1-44R----RITG.IT-EKAT------LVREGLRA-------LIERES-----------------------....AR......R
A6DJA1_9BACT/2-48M----NATG.IK-TKKS------LVDYALKE-------LLRKNK-----------------------....QK...RLLD
A0QCC9_MYCA1/3-50I----RRFH.LA-DARE------AVNLALRT-------LIDDAG-----------------------PGHHDG......E
Q01QU3_SOLUE/1-47L----RVTG.LK-TKRD------AVELGLQT-------LLRLGR-----------------------....QA...QIRR
A4XJM6_CALS8/1-47M----EIAG.VK-TKKE------AVEIALKE-------FVENHS-----------------------....RK...KLSE
A4A596_9GAMM/1-44S----RLTG.IT-ENTE------LIRFAIKR-------LVEREA-----------------------....AR......R
Q124P4_POLSJ/1-47M----RLSG.AR-TKRE------VVDRALRE-------MVARAR-----------------------....RP...SIRE

PF13062

C2USY1_BACCE/1-62KQAYEKKTGASI-SEST------LVQTLISK-------EFIQAI-----------------------TPFDLQQFINGKE
A7GMZ8_BACCN/1-58KQVYQKKTGATI-SDS.------...TLISK-------EFVQKI-----------------------TPFDLQQYVIEKE

PF07704

Q92LY2_RHIME/1-79I----SLTK--S.SKVD------AVKDALKHEIA......KRKAVLPVR..ERLAKS.......LAMAREAGPFAPGNHK
Q1M8C0_RHIL3/1-82S----HATG--E.SMTR------VVTEALRERFA....KIERRKGRASV..EELLAI......ADRAAAHVKRPYVDHAE
A6X7T6_OCHA4/1-82Q----KITN--APSKTE------AVRQALQNELK......RAKDSIPLR..DRVKVI.....QDEFAAILGPNPEPFDMK
Q11MS5_MESSB/190-270A----HMAG--V.SITD------AIVIAMKEAIE......RRRDAESPL..QTAARL.....REKHGVSLRKAAKKPLPR
A4KK34_MYCTU/1-89A----ARTG--T.NQTA------AVEDAVARRLSELDREDRARAEARRA..AAEQTL...RDLDKLLSDDDKRLIRRHEV
A6UBT8_SINMW/1-82R----ARLG--VRTKTD------AVRIALQHELD......RVEEEIPPR..EKMAAL.....RQQARHRLGPPVYGVDMK
A3TQ51_9MICO/1-82A----ARTG--T.TQTG------AIESALERYLADLVREAESDSKRRRI..DQLLAE..........IDAERTDGGPTVE
A5FU30_ACICJ/1-79A----KERG--L.TKQD------AVRLAVQAELD......RTREAKPLR..ERLREW.......REANPLPPPTGLKADK
A6WWK7_OCHA4/1-82S----RLTG--E.TMTD------AITQAMRERLD..RLRAEREAQRDYV..ARMKAF........VRERASRYDRRPVTK
A5EUT0_BRASB/1-81A----ALKK--I.GLTE------AVHAALAHELE......REQGKPSLV..DLGVQF.....CRDLRAKGNPAQGQPADK
A4KET8_MYCTU/1-81A----KITG--E.SQAR------AVATAVNERLA.......RLRSDDLA..ARLLAI....GHKTASRMSPEAKRLDHDA
A5U403_MYCTA/1-83A----DRLH--T.SKTA------AIRHALSAQLAFLESRAGDREAQ.......LLDILRTEIWPLLADRSPITKLEREQI
Q9F5F2_AGRRH/28-108A----EMAG--V.GITD------AIVIAMREAIE......RRNRTETPL..QTAARL.....REKHGVAMSEDARKPLAR
A4KHQ1_MYCTU/1-70A----ARMG--E.TLTQ------AVVVAVREQLA...RRTGRTRSISLR..EELAAI....GRRCAALPVLDT.RAADTI
Q219N1_RHOPB/1-84A----RLTG--E.NITT------ATKRAIEQRLS...RLAGPSRKSALL..QEMADI....RRRWSELPVVDD.RTPEEI
B0T0U9_CAUSK/24-114A----DLTG--E.SLTT------AIEIAVKERLE.AKRAAAPRHKPRSV..EEMRAITRKYLTPEARAGLLPPITKADFD
A1T4A5_MYCVP/1-81A----RLTG--E.SQAQ------AVATAVQERLS.......RVQQDDLA..ERLLAL....GRRTAQRMTSATKNLDHGE
Q92TH7_RHIME/9-89A----RMAG--L.SIRE------AIVTAMKEAID......RRRNREKPL..ETARRL.....REKHGIVIGGAASKPLQR
Q92RQ4_RHIME/1-84A----RRTG--E.SITL------ATKRALEERLR...RTDTAARRAALL..EDLEAI....QRRWNAMPVLDS.RSSDDI
Q7U1L4_MYCBO/1-84A----ARTG--E.TLTE------AVVTALRERLA...RETGRARVVPLR..DELAAI....RHRCAALPVVDN.RSAEAI
Q0BQA3_GRABC/5-88A----ALTG--E.SMTM------AVTEALRERLE......RERRLRDHV..SRLQRL...TVLAADIRAHMRGRVSSDHS
Q72LD3_THET2/1-85A----RLAG--E.TKTE------AVRKALEMRL.......RELQRKQGF..DRVIRFLEEEVWPQIPPELLGKGISKEEE
Q1WLI3_SINMM/1-85A----RRQG--I.SKTA------AIHQALSERLH..RMGHGEVSQDRLL..GELRAI....RQRIARLPELDS.RSDEEI
Q07GM2_ROSDO/1-81M----KATG--AINKTE------AVRAALKAQLV......AETQKKPLL..ERINEV......RAMADTIGAPDPDFDMK
A3TJ62_9MICO/1-86A----AATG--E.SITV------AARRAIEERLE...RIHHQQRAIRPVGDDAIDGI....IARGRARPVLDA.RPVDEI
Q2RUX5_RHORT/1-82A----RATG--K.SMAR------VVTEALRERYA....EIEHRQAKASV..EELLAI......ADRAAAQGNRPRVDHAD
Q981I6_RHILO/1-77A----KLKN--M.SLTD------TIRDAVEQEYQ......RSRGAIPLP..QRLKAL.......AERYRAFPETSAQADK
Q07J94_RHOP5/4-86A----QLTG--E.SLTG------AVTAALREQLA...RERRRRQSDKVA..ERLMKI....GNHYASLP..DTGRSPDEI
Q1QF44_NITHX/1-84A----QRTG--E.TITV------ATRRAIEERLK...RTESQARKAALL..EDMEAM....QRRLNALPILDP.RSPDDI

PF03693

PARD_XYLFA/1-78V-----QGGRYG-TASD------VVRAGLRLLEEHETKVKALQD-----------------------ALNVRHQSGEPRP
PARD1_CAUCR/2-82V-----ADGRYG-SASE------VIRAGLRLLEENEAKLAALRA-----------------------ALIEGEESGFIED
PARD_MYCBO/1-81I-----AAGRYR-SASE------VIRSALRLLEDRETQLRALRE-----------------------ALEAGERSGSSTP
PARD_VIBCH/1-80I-----QSGRYG-SASE------VIRSALRLLENQETKLQSLRQ-----------------------LLIEGEQSGDAD.
PARD_ECO57/1-80V-----QSGRYG-SASE------VMRSALRLLEQQESRDEAVRN-----------------------AVIEGLESGESS.

PF11020

C4YV51_9RICK/4-85AKWLSDERG--G-TIPD------EVMKAISQ-------LNDLAK-------------------------KNGVPLPDLCV
Q2GKE5_ANAPZ/4-85NTWLSKERG--G-QVPE------RVINSLER-------LHKLAR-------------------------ENGICFAELCV
Q2GG71_EHRCR/4-85DNWLAKERG--G-NIPE------KIKDSLAK-------LHALAQ-------------------------KNGICFADLCV
Q5PB11_ANAMM/4-85NTWLSKERG--G-SVPE------KVRNSLEK-------LHELAK-------------------------KNGICFADLCV
B3CLM4_WOLPP/5-86DSWLAKERG--G-NIPN------KVKESLQK-------LYKLSQ-------------------------ENGISFPELCA
Q2GCJ4_NEOSM/1-82ATWLSKERG--G-VVPQ------KVMDSLSK-------LRELAE-------------------------ENNVSFEDLCV
A5CC80_ORITB/1-82ANWLSTERG--G-VIPA------EVMDSITQ-------LVELSK-------------------------KYQVPIEELVV
A8GW87_RICB8/1-82SKWLSDERC--G-TIPD------AVMDAVKQ-------LYDLSK-------------------------KNNVSFEDLCV
B3S7R4_TRIAD/8-106LRWLREVRH--G-QIDS------SIHEALSK-------LFQLAN-------------------------GNNLPLEQLIE

PF07764

Q57468_STRPY/1-71T----AKNG--G-NVKE------VMDQALEE-------YIRKYLPDKL--------------------------------
Q83WL2_9ZZZZ/1-71T----AKNG--G-NVKE------VMEIRLRS-------KLKSVLIVHY--------------------------------

PF09386

Q1NH10_9SPHN/1-79A----ALQG--K-TIKQ------YAIERLFPVDAGDDEPWQALK-----------------------ALLGERIAQGLAG
Q0E6B4_PSEAI/1-79A----ALQG--K-TIKQ------YALERLFPGDADADQAWQELK-----------------------TMLGNRINDGLAG
Q87CU8_XYLFT/1-79A----ALQG--K-TVEQ------YALERLFPSDTDADQAWQDLK-----------------------TLVGTRISEGLAG
Q7N4K2_PHOLL/1-79A----ALHG--K-TIKQ------YTLERLFPDMTDSDQAWQELK-----------------------VLLNTRISEGMEG

PF11903

Q4KC28_PSEF5/1-66S----AAMD--R-SINA------QAEFWMKIGLLAE..LNPHLAYN.............................DLINK
B4SF37_PELPB/2-74A----KAEH--R-TIAG------QIEFWAMIGRAAL..DNPDLPID.............................FIRDL
A6DXG1_9RHOB/1-65S----TVMC--R-SINA------QAEFWMKVGMLAE..ANPGLSYI.............................EIMAQ
A1V5D0_BURMS/1-73S----AALS--R-SINA------QAEHWLRIGMLAE..LHPTLSYA.............................EICRL
A4JIY6_BURVG/2-63G----TIEH--R-SVPK------QIEYWSQIGKIAA..ENPDLPFS..............................VIRD
A6SW35_JANMA/1-73S----GAMS--R-SINS------QAEHWLRVGMIAE..LNPGLCYN.............................EICQK
Q0HLV2_SHESM/1-65S----SVMS--R-SINS------QAEFWIRIGMLAE..LHPQLSFN.............................QLVAD
A3JC26_9ALTE/3-67A----KALN--R-TPPK------QIEHWAKIGEMME..DNPDLPYE.............................FVRQA
Q3KB70_PSEPF/1-73S----NALS--R-SINA------QAEHWMRIGMLAE..LYPDLDHH.............................AICRL
A0QXV1_MYCS2/6-107G----ARQS--R-SAKQ------QLDHWARVGRAVS..SQHTAARRRVEAALAGDLALRDLTPEEGVVFNAEISAAIEEN
B7X1E9_COMTE/1-73S----AALG--R-SINA------QAEHWLRVGQLAE..HHPQLNYE.............................GICAL
A4TQ21_YERPP/1-73S----HAMS--R-SINS------QAEHWLKIGMLAE..LYPQLSHH.............................ELARA
A9BMX0_DELAS/1-73S----AALG--R-SINA------QAEHWLRVGQLAE..HHPHLDYA.............................GICAL
A6T935_KLEP7/1-66S----KAMS--R-SVNA------QAEYWIRLGMMSE..LYPELNHQ.............................QIKLL
Q48JT9_PSE14/1-73S----VALS--R-SINA------QAEHWMRIGMLAE..LHPALDYS.............................EICQM
Q7NVK9_CHRVO/1-73S----EALS--R-SINS------QAEHWLRIGMLAE..LNPDLRYS.............................EICQL
B9CGG2_9BURK/1-73S----TALS--R-SINA------QAEHWLRVGMLAE..LNPSASYG.............................DICRM
A4X043_RHOS5/2-100A----ELHS--R-SVAG------QITHWLRLGQAIE..QSGAYDHARVTAALEGRLDTV...ELGEEEEIAWIDAFTEKM
Q4FSP3_PSYA2/7-71S----KAQH--R-TPPK------QIEHWATIGQIME..DNPDLSYE.............................FVRQL
A6ULS8_SINMW/2-100A----ELQS--R-SVAG------QIAHWIKIGRAIE..RSSAFDYSRIKQALEGRLDTT...ELKEGEEAAWLDELTNKM
A1T476_MYCVP/6-107G----ARRS--W-SAEQ------QLDHWARVGRAVS..SQHSVARRKVEAALAGDVHTRELSDEEGVVFNAEISAAIQER
Q7N5H6_PHOLL/2-66A----EASS--R-SVPK------QIEHWAKIGRIAE..DNPDLPYS.............................FILDS
Q3AQ94_CHLCH/4-76A----KLEH--R-SIAG------QIEFWARVGRAAL..DNPDLPVS.............................FIAES
Q1GXH1_METFK/1-73S----NAFS--R-SINS------QAEHWLRVGMLAE..MHPQLNYT.............................DICRL
Q3BNN7_XANC5/75-144C----TVSS--R-SINA------QANFWIKVGMLCE..MHPDTTFQ.............................QIVAE
A3U039_9RHOB/2-100A----DLHS--R-SVAG------QITHWLKIGRAIE..HSGSFDYARITAALEGRLDTT...QLGAEEEVAWLDAFTEKM
A6DRR2_9BACT/8-74A----KAEE--R-SVPK------QIEYWAKIGQQAL..DNPDLPIS.............................FIRDL
A8GBI0_SERP5/5-69S----LTMT--R-SINA------QAEYWIKIGMLAE..FHPELTYP.............................QLVKK
Q2SQH0_HAHCH/2-95A----KGAH--R-SVQG------QIEHWAKIGQMVE..RSGVLSYERIRSFLSGEI........QIDNLNNDERLMASRT
Q13JR3_BURXL/1-70S----AVSC--R-SINA------QAAFWIKVGMLCE..MNPTLSFN.............................EIATR
A3UJ97_9RHOB/2-100S----ERQS--R-SIAG------QIAHWVRIGRAIE..TSGNFDHARINAVLAGEAGPN...TLSDEEHDVWLDAFSAAL
A4CF05_9GAMM/1-69S----AVMA--R-SINA------QAEFWAKMGMLAE..LNPHLTYN.............................E....
Q5R164_IDILO/1-65S----AVMV--R-SINA------QAEYWIKVGMLAE..ANPNMSFS.............................DIMRD
A4BRK7_9GAMM/11-108A----QLMH--R-SIGQ------QLEFLARLGHEIE..TSPFITAKQLRLLMEAAREA....DVGNEVSDERFEAAFSEL
Q15VU5_PSEA6/1-66C----QVMS--R-SINA------QAEFWIKMGRLAE..LNPTLTFS.............................ELIVK
Q0RY55_RHOSR/40-141G----GRMS--R-SAAQ------QIAHWARIGRELE..ASHSVSYRDVADVLDGRRDYDELTDREQAVVRAEWTERITER
Q220F4_RHOFD/1-73G----NALS--R-SINA------QAEHWMRVGMLSE..MHPELDSR.............................EICQL
A0NTD8_9RHOB/7-105A----ELQN--R-SVSE------QITLWLRIGRVIE..KSGAFDQARVSAALAGELQTT...DLTALEKAVWSERFLEKM
A3KVD8_PSEAI/16-86C----KAMS--R-SINA------QAEHWMRIGMLIE..ANPGLTYA.............................QVLRQ
A6WV11_OCHA4/1-65S----DVMC--R-SINA------QAEYWMKIGMLAQ..AHPDLSFN.............................EIVQM
A3UEM3_9RHOB/1-65S----KAMC--R-SINA------QAEFWLKIGMLAE..AHPTLTFN.............................EIVRM
Q47D61_DECAR/1-73S----AALS--R-SINA------QAEHWLRVGMLSE..LNPNLRYG.............................EICRL
Q0AF32_NITEC/4-76A----LVEH--R-TIAG------QIEYWARVGRAAL..DNPDLPVS.............................FIAES
Q8DFU3_VIBVU/2-66A----EAEM--R-SVPK------QIEYWAKIGKIMT..DNPDLPYS.............................FVQES
A3Y2K0_9VIBR/3-67A----KALN--R-TTPK------QIEHWAKIGKMME..DNPDLPYE.............................FVKQA
A0NZR8_9RHOB/1-68S----TVMC--R-SINA------QAEFWMKIGMLAE..ANPTLSFS.............................DIVKM
Q0C2J2_HYPNA/1-68S----TVSC--R-SINA------QATFWIRIGMLCE..MHPTLSFN.............................EIVQR
A7HVP7_PARL1/11-109S----ELQS--R-SVSG------QVAHWVRIGRAIE..KSGNFDYARITAALSGEIGTV...DLTCEEKDVWLDSFVEKM
A3YEZ0_9GAMM/1-66S----NVMS--R-SINS------QAEFWLKMGRLAE..LNPTMTFN.............................DIIQM
A6GRT8_9BURK/5-104G----KLNH--R-SAAE------QIEYWASIGQKVESVLDPETLLQIKAGLLRVKLEQ....VNAPPVSADWVFGNLDMK
A1VWL3_POLNA/4-68A----AAEH--R-SVPK------QIEYWARIGKAVL..ENPELPLR.............................LIQDT
A4Y172_PSEMY/1-70S----SVSN--R-SINA------QAGFWIRIGMLCE..MNPALSFN.............................EVMAA
B4SPJ7_STRM5/1-70C----TVSS--R-SINA------QANFWIRVGMLCE..LNPTLSFQ.............................DIVAS
A4BJF4_9GAMM/1-65S----AVMV--R-SINA------QAEFWMKIGMLAE..ANPTLSFT.............................DIVRE
Q1IDH1_PSEE4/1-65S----AALS--R-SINA------QAEHWIRLGMLAE..LHPQATYQ.............................DLLRQ
Q1NLW1_9DELT/3-75A----KAEF--R-TAQG------QMEFWARVGRAAL..DNPDLPAS.............................FIAES
A6SYS7_JANMA/2-66A----AAEH--R-SVPK------QIEYWARLGKAAE..DNPELPIQ.............................FIKDT

PF07878

Q7VCC6_PROMA/12-67E----KWFD--N-TVNVGPLYTVICDLLRNR-------SISRCTAS----------------------------------
A9BA39_PROM4/13-68E----RWFN--S-TVKEFRLYSVIAELLRNR-------SISRATAS----------------------------------
Q46LP4_PROMT/18-73E----KWFN--S-NIESDKLYKRICELLKNR-------SISRALGS----------------------------------
A2C9K2_PROM3/2-57D----AQFN--I-ESNTGPLYLVICEFLHNR-------TISRAIAA----------------------------------
A2BQE0_PROMS/12-66E----EKFN--S-KNEK.NLHVYICRFLKNR-------SISRGVAS----------------------------------
Q7U397_PROMP/14-68E----EKFN--S-RNEK.NLHIYICRFLKNR-------SISRALAS----------------------------------
Q7U7V4_SYNPX/2-57D----EQLA--I-DCRDAPLHQVICDALRDR-------SVAPVEAA----------------------------------
A2C9D6_PROM3/12-67D----EQIR--V-ETDAGPLYRVICNFLRDR-------TVAPVEAA----------------------------------
Q3AZ83_SYNS9/18-73E----QRLR--G-VSEAPPLFEWICDLLVAR-------RISRGLAA----------------------------------
A2BU44_PROM5/9-58A----ESES--R-TVSN......MAKVLIQE-------GIKNYFEK----------------------------------
Q7V3I9_PROMP/9-58A----ENES--R-TVSN......MAKVLIQQ-------GIKNHLKR----------------------------------
Q31D95_PROM9/9-58A----SNES--R-TVSN......MAKVLIQE-------GIKKYFEK----------------------------------
A8G287_PROM2/9-58A----NNES--R-TVSN......MAKVLIQE-------GIKKYLDK----------------------------------
A2BZQ7_PROM1/9-58A----ERES--R-TVSN......MAKVLIQE-------GVKYHELK----------------------------------
A5GQX8_SYNR3/13-62A----DQDS--R-TVSN......MAKVLIQQ-------GLDRLQGG----------------------------------
A3YW17_9SYNE/9-58A----EAES--R-TVSN......MAKVLIQR-------GLDSLELA----------------------------------
Q05W20_9SYNE/9-58A----EQES--R-TVSN......MAKVLIQQ-------GVQRFEQG----------------------------------
Q7U4A0_SYNPX/9-58A----DQES--R-TVSN......MARVLIQQ-------GVQRHEQS----------------------------------
Q0I761_SYNS3/30-79A----EDES--R-TVSN......MAKVLIQQ-------GVQRYEQG----------------------------------
A2C697_PROM3/30-79A----ELES--R-TVSN......MAKVLIQQ-------GIQRYEQE----------------------------------
A9B9H2_PROM4/9-58A----EKES--R-TVSN......MAKVLIQE-------GLQRFKAT----------------------------------
Q7VEB2_PROMA/9-58A----KKES--R-TVSN......MAKVLIQE-------GVDSLITE----------------------------------
Q0I9D3_SYNS3/28-77A----LKEG--R-SCSS......LATFLIED-------GLRRHTVI----------------------------------
A5GKY5_SYNPW/28-77A----LAEG--R-SCSS......LATFLIED-------GLRRHGTL----------------------------------
Q05T64_9SYNE/21-70A----LQEG--R-SCSS......LATFLIED-------GLRRHTSL----------------------------------
Q7TV19_PROMM/21-70A----LAES--R-SCSS......LASFLIED-------GLRRHRQL----------------------------------
Q3AIE8_SYNSC/28-77A----LAEG--R-SCGN......LAAYLLEE-------ALRRHRPL----------------------------------

PF01340

METJ_SALTY/2-105R----TRRQ--VNNLRHATNSELLCEAFLHAFTGQPLPDDADLR-----------------------KERSDEIPEAAKE
METJ_SHIFL/2-105R----TRRQ--VNNLRHATNSELLCEAFLHAFTGQPLPDDADLR-----------------------KERSDEIPEAAKE
METJ_HAEIN/2-105R----TRRQ--LKSLRHATNSELLCEAFLHAFTGQPLPTDADLM-----------------------KERNDEIPEDAKV

PF12651

C2RWW5_BACCE/9-52---------------------------------------
A6NT24_9FIRM/10-53---------------------------------------
C2ZCE6_BACCE/106-149---------------------------------------
C4IGY2_CLOBU/11-54---------------------------------------
A6LT47_CLOB8/12-55---------------------------------------
B1QGC9_CLOBO/4-47---------------------------------------
B1RFG8_CLOPF/12-55---------------------------------------
Q1D537_MYXXD/6-49---------------------------------------
Q0TUT9_CLOP1/6-49---------------------------------------
C3EDU5_BACTU/11-54---------------------------------------
A1BZH8_BACCE/11-54---------------------------------------
Q08N33_STIAD/29-72---------------------------------------
Q08NJ8_STIAD/30-73---------------------------------------
Q04FI1_OENOB/1-44---------------------------------------
A5N8S1_CLOK5/8-51---------------------------------------
A7HBK6_ANADF/4-47---------------------------------------
B1QGC3_CLOBO/10-53---------------------------------------
Q9YEP4_AERPE/2-45---------------------------------------
C9KLM4_9FIRM/6-49---------------------------------------
B4UEI0_ANASK/22-65---------------------------------------
C0CM34_9FIRM/23-66---------------------------------------
A2BMU8_HYPBU/1-44---------------------------------------
B2TQ69_CLOBB/8-51---------------------------------------
B1RFE8_CLOPF/8-51---------------------------------------
C3AQ62_BACMY/106-149---------------------------------------
C0EDY8_9CLOT/8-51---------------------------------------
Q17ZT4_CLOD6/4-47---------------------------------------
A9GWZ6_SORC5/4-47---------------------------------------

PF01402

YBFE_SHIFL/52-90---------------------------------------
Q9YBV4_AERPE/3-42---------------------------------------
O69416_ECOLX/15-53---------------------------------------
REPA_LACPN/8-46---------------------------------------
Q8ZX60_PYRAE/47-86---------------------------------------
P72681_SYNY3/21-59---------------------------------------
Q8ZWZ9_PYRAE/10-49---------------------------------------
NIKR_CHLTE/6-45---------------------------------------
Q877Q4_PSESM/12-50---------------------------------------
Y4KO_RHISN/4-42---------------------------------------
O82927_ECO57/13-51---------------------------------------
VPB19_MYCTU/2-40---------------------------------------
Y1433_MYCBO/3-41---------------------------------------
O28529_ARCFU/6-44---------------------------------------
Q8GI05_PSERE/52-90---------------------------------------
Q48913_MYCAV/38-76---------------------------------------
YIIE_SHIFL/3-41---------------------------------------
Q52335_9ZZZZ/18-56---------------------------------------
Q48832_LACPN/5-43---------------------------------------
NIKR_SHIFL/3-42---------------------------------------
COPG_STRAG/4-42---------------------------------------
Y080_METJA/3-41---------------------------------------
PARD2_CAUCR/12-50---------------------------------------
VPB20_MYCTU/11-49---------------------------------------
Y298_MYCTU/5-43---------------------------------------
O30230_ARCFU/6-44---------------------------------------
O29882_ARCFU/4-42---------------------------------------
Q04136_9LACT/9-47---------------------------------------
NIKR1_METTH/3-42---------------------------------------
Q9I707_PSEAE/4-42---------------------------------------
E51_SSV1/12-50---------------------------------------
Q88JZ4_PSEPK/2-40---------------------------------------
Q8GFT4_CITFR/12-50---------------------------------------
Q888D4_PSESM/12-50---------------------------------------
O30109_ARCFU/6-44---------------------------------------
O73988_PYRHO/6-45---------------------------------------
Q52179_9BACL/9-47---------------------------------------
NIKR_HELPY/12-51---------------------------------------
COP6_STAAU/12-50---------------------------------------
Q45960_CLOBU/2-40---------------------------------------
O07291_NATPH/4-42---------------------------------------
Q52017_9ZZZZ/4-42---------------------------------------
O32744_LACAI/6-44---------------------------------------
O05476_SULIS/7-45---------------------------------------
Q8EGZ2_SHEON/6-44---------------------------------------
O05474_SULIS/21-59---------------------------------------
Q53277_BACTK/3-41---------------------------------------
Q8PJU0_XANAC/2-40---------------------------------------
Q45137_BACFG/6-44---------------------------------------

PF09274

Q70W75_YEREN/1-74---------------------------------------
Q9F809_ERWAM/1-76---------------------------------------
Q9KJ82_SALNE/1-76---------------------------------------

PF05534

Q7N3F9_PHOLL/54-104---------------------------------------
Q88MT9_PSEPK/54-104---------------------------------------
Q6A7R8_PROAC/60-110---------------------------------------
Q73YB6_MYCPA/53-103---------------------------------------
Q7N8L4_PHOLL/59-111---------------------------------------
Q92KT7_RHIME/1-48---------------------------------------
Q6MB72_PARUW/52-102---------------------------------------
Q7VMR2_HAEDU/57-107---------------------------------------
Q7MY97_PHOLL/58-110---------------------------------------
Q88G27_PSEPK/52-102---------------------------------------
Q9RAA8_RICFI/57-107---------------------------------------
Q73J27_TREDE/55-105---------------------------------------
Q6SK25_ARTAU/61-111---------------------------------------
O87467_HAEIF/54-102---------------------------------------
Q8YLM2_NOSS1/53-103---------------------------------------
Q87BV6_XYLFT/64-114---------------------------------------
Q73KK4_TREDE/52-102---------------------------------------
Q92XZ7_RHIME/54-104---------------------------------------
Q73QG2_TREDE/62-112---------------------------------------
Q6G4L9_BARHE/55-105---------------------------------------
Q9RZI7_DEIRA/54-104---------------------------------------
Q7P9J0_RICSI/58-108---------------------------------------
Q8X5S8_ECO57/60-112---------------------------------------
Q8XYR1_RALSO/55-105---------------------------------------

PF05509

B8EFN4_SHEB2/13-61---------------------------------------
Q4LC31_SODGL/14-62---------------------------------------
B6ESX2_ALISL/7-55---------------------------------------
A7DVG3_VIBVU/13-61---------------------------------------
B2LS54_9VIBR/10-58---------------------------------------
B8EFW0_SHEB2/41-89---------------------------------------
B6ET57_ALISL/12-52---------------------------------------
A6ASC2_VIBHA/12-60---------------------------------------
Q7MBP1_VIBVY/10-58---------------------------------------
A7N8Z3_VIBHB/12-60---------------------------------------
Q5DY84_VIBF1/10-58---------------------------------------
B5PNJ9_SALET/24-72---------------------------------------
A6D5H0_9VIBR/18-66---------------------------------------
Q6LW96_PHOPR/20-68---------------------------------------
A8QYN9_9GAMM/15-63---------------------------------------
A7N8V1_VIBHB/9-57---------------------------------------
E6WK64_PANSA/14-62---------------------------------------
D4IGT0_ERWAE/12-60---------------------------------------
B2VB54_ERWT9/25-73---------------------------------------
B6ICE9_ECOSE/13-61---------------------------------------
Q8L370_SALEN/14-62---------------------------------------
D2D9E9_KLEPN/14-62---------------------------------------
B1VC85_ECOLX/14-62---------------------------------------
D2U5U3_SHISO/14-62---------------------------------------
TRAY1_ECOLI/70-118---------------------------------------
A6TIF9_KLEP7/67-115---------------------------------------
A6TIT2_KLEP7/72-120---------------------------------------
Q1MKC7_RHIL3/2-50---------------------------------------

PF03869

RMNT_BPP22/2-51---------------------------------------
RARC_BPP22/4-53---------------------------------------
Q9RPY7_PSEAI/13-62---------------------------------------

PF10723

Q663G0_YERPS/1-84---------------------------------------
Q93GS8_SALTY/8-88---------------------------------------
COPB2_ECOLX/1-84---------------------------------------
Q8RTD2_ECOLX/1-82---------------------------------------
Q326V9_SHIDS/1-86---------------------------------------
Q1R236_ECOUT/1-86---------------------------------------
Q27TF8_ECOK1/1-85---------------------------------------
A1JUD2_YERE8/1-78---------------------------------------
O07483_YEREN/1-84---------------------------------------
A6TI22_KLEP7/1-92---------------------------------------
Q7BQV5_9ENTR/1-90---------------------------------------
Q2VP21_ECOLX/1-85---------------------------------------
Q65AF6_YERPE/1-105---------------------------------------
A4SMJ0_AERS4/1-74---------------------------------------
Q48416_KLEPN/1-70---------------------------------------

PF04221

DINJ_ECOLI/4-84NQLTIQSIKNSEA---GIDV......HKAKDADDLFDKL
Q9KML3_VIBCH/3-84NEVTASAIQELVE---GKG.......HKAESVEAMLNEL
Q9A0Y8_STRP1/13-96PQRVNVDYMSQEK---FYDK.....LITSFEDAKTCNPQ
Q9PBQ9_XYLFA/4-84NATTIKAMREARA---GKGE......TVTLGELRATIRA
RELB_SHIFL/1-79EDAELVEIVKERL---RNP..........KPVRVTLDEL
RELB_HAEIN/5-93NKETLAAIDELDS---GNAESFFIEASENYSAEEFTKRI

PF13467

Q07PP8_RHOP5/4-69LFVLDYFR-------------------------------
A8TZV0_9PROT/6-70VWVLEQCA-------------------------------
Q1NA23_9SPHN/16-85CWLFLRLA-------------------------------
A3WHC8_9SPHN/13-82VWLVTNAP-------------------------------
Q2W7L3_MAGSA/4-68VFVLNELK-------------------------------
A4TUN3_9PROT/1-65LFVLNDLK-------------------------------
A7HVX0_PARL1/12-78LYVLNALR-------------------------------
C5AUK2_METEA/8-73VFVLGAFR-------------------------------
B2IH09_BEII9/16-86VYILRTVR-------------------------------
Q6FZ86_BARQU/2-80VFVLSFLF-------------------------------
C3MEF5_RHISN/1-67LYVLAWIK-------------------------------
C9TG23_9RHIZ/6-72LHVLDWLK-------------------------------
Q11GU9_MESSB/3-69LYVLAEVK-------------------------------
A9D3H5_9RHIZ/10-76VAVLDWAL-------------------------------
D8JQT3_HYPDA/2-67VWILKRLE-------------------------------
E3I0W1_RHOVT/37-102VYLLGKKA-------------------------------
C7KDM2_ACEPA/4-70VYALEWLK-------------------------------
A5FXC9_ACICJ/2-68VFALTGAG-------------------------------
D5VIX9_CAUST/3-68VFALAEAA-------------------------------
A0NVL5_9RHOB/2-68VWALKRVQ-------------------------------
Q0AMZ5_MARMM/16-81IWVLQALR-------------------------------
E0TDI6_PARBH/5-70VELLAAAR-------------------------------
A0KLC1_AERHH/25-95CSCLVHLE-------------------------------
Q0G519_9RHIZ/14-84CACLVHLE-------------------------------
A8LPV2_DINSH/14-84CTALLYIE-------------------------------
A8HUM8_AZOC5/14-84CSCLIYIS-------------------------------
Q8EH51_SHEON/14-84VACTTHLN-------------------------------
C6BV10_DESAD/14-84VVCTTYLV-------------------------------
A4TW65_9PROT/14-84VVCATYLN-------------------------------
Q2SKQ2_HAHCH/14-84VVCATYLE-------------------------------
Q7MIW4_VIBVY/61-131CACLMYAR-------------------------------
A6WUZ0_OCHA4/14-84TTCALYLM-------------------------------
B8EK53_METSB/14-84CACIGYAA-------------------------------
A9D0B8_9GAMM/23-93SACVQHIL-------------------------------
A4XXG0_PSEMY/14-84VSCTRYLA-------------------------------
B1SXR3_9BURK/14-84VTCLRYES-------------------------------
A2SED0_METPP/14-84VTCVRHLI-------------------------------
Q57CU3_BRUAB/14-84VCCGRYLS-------------------------------
A6EV75_9ALTE/24-94VCAMRYLA-------------------------------
B5SFN5_RALSL/14-84VCCLRYLM-------------------------------
A5FYB5_ACICJ/14-84AACILYRR-------------------------------
C3JYT3_PSEFS/33-103VVCVVHAL-------------------------------
Q141Z3_BURXL/64-134IICVTQLL-------------------------------
A4TYI1_9PROT/37-105VVCLKYIN-------------------------------
D3NY07_AZOS1/12-77VFIVSYYR-------------------------------
B6IW11_RHOCS/2-67IFLVGYLQ-------------------------------
B6IVX3_RHOCS/18-84VFLLSYFR-------------------------------
B6IXV3_RHOCS/23-89AFLVAYFR-------------------------------
D3NQN8_AZOS1/38-116VFIASYYR-------------------------------
D3NST4_AZOS1/3-70MFILNYYK-------------------------------
D3NR24_AZOS1/9-75VYALCYFR-------------------------------
Q2W502_MAGSA/60-132VFVLNSNM-------------------------------
B6R003_9RHOB/2-68VAVLKHFQ-------------------------------
B7QTG9_9RHOB/4-70LHVLRRLR-------------------------------
A3K2C9_9RHOB/4-70VYILHKLI-------------------------------
Q167I6_ROSDO/4-70VFVLEDLK-------------------------------
A1B3A7_PARDP/21-87LFVLAEIV-------------------------------

PF08681

Q8E866_SHEON/19-95RAWAQFE.TILDN...PRKATPVLKTLFS.........E
Q7N880_PHOLL/12-90EIFNAFI.AKLDA...PAVPNERLIKTA.......NMKK
Q57KM3_SALCH/11-90RDTQMIM.EILDN...PPAPNEKLLAAAF......ALPD
Q7N7Z2_PHOLL/8-88EDALAFV.HALEK...PIKVNERFLRAAR......RHKE
Q4CB51_CROWT/8-87QDRDLLL.STLEN...PPPLKGKLKEAIQ......KYKA
Q92P91_RHIME/11-90RDSLRLL.DLLEN...PPAPTPALLAAAR......RRIA
Q5PIQ5_SALPA/13-91EAYQEFL.VRLDQ...TPSPNAALRKTM.......QTPA
Q4UXV1_XANC8/13-91DAYAAFL.ARLDM...PPQPNARLRKTM.......QTPA
B3EP86_CHLPB/11-90RDSQHVL.KLLEE...PPAPNEKLTAAAF......ALPK
Q7NIQ1_GLOVI/13-92KRWEVFV.AAFNA...SPKEHQRLRQLLS......PLGV
Q7NLC6_GLOVI/11-90QDQQIFV.EAILN...PPEPNDELRQAAK......EYQR
Q8D4I7_VIBVU/8-84EQWESVM.SALQN...PVEPTELMKEILS.........S
B4SB08_PELPB/10-88TQWTAFI.AALDA...SPRELPRLKKLF.......QEQS
Q57IR1_SALCH/8-87ASWARVM.DALSH...PPTPNEKLKRAAQ......RLQD
Q5P620_AROAE/9-88ADQECFA.QALLS...PPQPSPALERAFV......RRSK
Q2SAN8_HAHCH/11-89AQWQAFQ.EALDR...PVQSKPRLKKLL.......REPG
A4Y6X3_SHEPC/26-106AQFDHFQ.QVCEA...AAAPHQRLKDAAA......LLDK
Q93ER6_PHOLU/6-85QDFQAFT.TALND...AFTPNAALQNAIN......AVRK
C1DE12_AZOVD/13-92EAYAEFLAARLDR...PPQPNERLRKTL.......QTPA
Q4BWD7_CROWT/10-89VDADKIF.SLIEN...PPVPNDHLKDAIA......RHRA
A5EL48_BRASB/17-96RDSEAFV.DALLN...PRPVNDRLRDTVR......RYRE
A4JRY5_BURVG/14-96DESRRFF.ALLDE...PPKPNEALQRAMA......RFRN
Q5X0W2_LEGPA/12-92RDQQLFV.DSLLK...DTAPNQRLLKAAK......RHKK
Q5EP84_NEIGO/11-90RDQLQFA.QALLN...PSKPNGALSRALE......KHDE
Q8ZL97_SALTY/13-91EQYEEFI.NLLDA...PVADDPVIEKLL.......ARKP
Q8XPL2_RALSO/16-98EQSRRFV.ALLDE...PAKPNEALRRAME......RFRK
Q6LIX8_PHOPR/32-112RDAMMLM.DALDE...PAKPNARLQHAAA......RYKD
Y420_HAEIN/9-88NDQALLI.ESLSK...PFEPNPSMKNALD......VYEA
Q5P632_AROAE/5-83DKFKQFT.AMLDA...PPGPNPGLERLM.......AVQA
Q5NX70_AROAE/9-88ADQQRFA.DALLS...PPKPSTALKRAMA......KHDQ
Q7N6D8_PHOLL/7-86ADQQCFA.QALLN...PPESTPALERAFA......RHRS
Q9S0Y9_ECOLX/14-93ESWNLVM.DAITN...PPAPNDRLKRATN......RLRE
Q5I739_DICNO/6-83AQWQQVL.SLLDD.....EPSEEMNNLLSR.....GYRA
Q3Z4X6_SHISS/35-113QSWELMN.QLIAE...PAQPTLALKALM.......KRKN
Q7N0J5_PHOLL/11-90RDSLHVL.DLLDN...PPAPNDKLLAAAF......ALPK
Q6ZEG7_SYNY3/12-91ADSQAFV.DALLR...PSEPNSKLKKAAL......RHQQ
Q87ZN7_PSESM/15-103KAFSRLH.EILNEEDTDATPTPELLKLMRGQHGQREHRS
Q3SNN6_NITWN/19-98RDSQAFV.QALMK...PLPVNDRLRDTVR......RYRQ
Q9KM95_VIBCH/57-136SVFDEFM.AACNK...VKAPNQALLEAV.......KFTE
Y4AR_RHISN/23-102TDYQAFF.DALDN...PPKPTDRLRDAFK......RYSE
Q7WCE6_BORPA/11-90ADWKMFY.DALSA...PPAPNAALRKAFA......KYQK
O05910_MYCTU/74-152AAWTEFL.AALDR...PVSHKPRLEKLF.......AARS
Q7N3R4_PHOLL/22-101EGADALL.AALEN...PPKANAKLLKAAK......HYKD
Q3REC2_XYLFA/5-83ERFRQFT.VLLNA...PQDTNPGLNRLM.......AIKA
Q7TXU2_MYCBO/72-150AAFRRFV.AALDE...PDEAAPELVRLA.......RRKS

PF07362

Q21DI4_SACD2/10-81FVEENGCFADEYRAF------------------------
A1JQ04_YERE8/7-78FHDEHGCFSDEYRTF------------------------
Q58WP3_SALDE/19-90ITDEHGLLSDDYRTF------------------------
A6A373_VIBCL/10-81LTEKHGLFSDSYRVF------------------------
Q3ZU16_ECOLX/1-72FIEMNGSFADENRDW------------------------
Q6D9V2_ERWCT/1-72FIAKNVFFADENRNG------------------------
A3T0A7_9RHOB/2-73EVEAEGLPLERFRSF------------------------
Q7N4P4_PHOLL/8-79ITNEHGLLSDKYRVF------------------------
A4BMU8_9GAMM/10-81YVEANGLPLAQYRQF------------------------
B0T4X1_CAUSK/2-80FVEEHGAFGAEWRRW------------------------
Q8FLA0_ECOL6/6-77LADETGCFSDEYRSF------------------------
A5GAE8_GEOUR/22-93RIEADGVFSDGLRRF------------------------
A4TXE4_9PROT/5-76WMEKHGLLSDHYRFF------------------------
Q5P2R6_AROAE/21-92IVEAEGVPLAEWRSF------------------------
Q1GN85_SPHAL/10-81YIRENGMPYDEYRQL------------------------
Q1NL18_9DELT/11-82RIKAYGTFSDGLRCF------------------------
Q0F2A7_9PROT/5-76RIEKQGLFSDGLRQF------------------------
B5EG30_GEOBB/11-82RVQSDGTFSDDLRHF------------------------
F2GB87_ALTMD/10-81FIAENGCIGDEYRNF------------------------
A7HPK7_PARL1/4-75RIERDGVWSDGLRRF------------------------
Q7MZJ1_PHOLL/1-72FIEQYGSFADENRNW------------------------
B2JXB4_BURP8/9-80WVEQNGLPLAEYRMF------------------------
Q6D8L1_ERWCT/1-72FITQNGSFADENRNW------------------------
A3J7N2_9ALTE/14-85FVEQHGCFGDEFREF------------------------
A0L724_MAGSM/10-81RVLTDGLFGDKLRQF------------------------

PF09957

Q82BL1_STRAW/2-49L--------------------------------------
VAPB6_MYCTU/2-48R--------------------------------------
Q39AR5_BURS3/1-44L--------------------------------------
A0PM00_MYCUA/3-54F--------------------------------------
Y634A_MYCTU/16-68F--------------------------------------
Q20X13_RHOPB/8-51L--------------------------------------
A3Z0W5_9SYNE/1-44L--------------------------------------
A1KM99_MYCBP/15-62M--------------------------------------
Q4C4H3_CROWT/1-47F--------------------------------------
A2VJB7_MYCTU/7-54L--------------------------------------
Q2FLV1_METHJ/1-47L--------------------------------------
A3YY99_9SYNE/1-47F--------------------------------------
Q2JXE5_SYNJA/1-50L--------------------------------------
A0QC46_MYCA1/1-44L--------------------------------------
Q474F3_CUPPJ/8-52L--------------------------------------
Q58AH0_RALME/1-44L--------------------------------------
C1AEZ3_MYCBT/4-56L--------------------------------------
Q3JAZ0_NITOC/1-47L--------------------------------------
A1U2W3_MARAV/1-47L--------------------------------------
A1VX34_POLNA/1-45L--------------------------------------
Q7AQ19_MYCLE/3-56F--------------------------------------
A3Z0W8_9SYNE/1-44L--------------------------------------
Q73PC1_TREDE/1-47L--------------------------------------
Q3M6F1_ANAVT/1-47L--------------------------------------
B3EKM2_CHLPB/1-47L--------------------------------------
A7BR89_9GAMM/1-50L--------------------------------------
Q73R95_TREDE/1-44L--------------------------------------
Q7NCS8_GLOVI/1-47L--------------------------------------
A3TGX0_9MICO/1-44L--------------------------------------
A8ZTF6_DESOH/1-44L--------------------------------------
A3EPI1_9BACT/1-44L--------------------------------------
A4BPR4_9GAMM/2-48L--------------------------------------
A5U2R7_MYCTA/7-54L--------------------------------------
A3Z9K4_9SYNE/1-44L--------------------------------------
Q7D057_AGRT5/1-48L--------------------------------------
Q07NJ5_RHOP5/1-47A--------------------------------------
A3IRW5_9CHRO/1-47L--------------------------------------
A0YU49_LYNSP/1-48L--------------------------------------
Q2FNJ2_METHJ/1-47Q--------------------------------------
A5G896_GEOUR/35-78L--------------------------------------
A5GB97_GEOUR/1-47L--------------------------------------
Q73SG9_MYCPA/11-61F--------------------------------------
A4BVI5_9GAMM/1-47F--------------------------------------
A0ZI46_NODSP/1-47Y--------------------------------------
A4BVE0_9GAMM/1-44L--------------------------------------
A6DJA1_9BACT/2-48L--------------------------------------
A0QCC9_MYCA1/3-50F--------------------------------------
Q01QU3_SOLUE/1-47L--------------------------------------
A4XJM6_CALS8/1-47L--------------------------------------
A4A596_9GAMM/1-44L--------------------------------------
Q124P4_POLSJ/1-47L--------------------------------------

PF13062

C2USY1_BACCE/1-62---------------------------------------
A7GMZ8_BACCN/1-58---------------------------------------

PF07704

Q92LY2_RHIME/1-79RETDDMWGDD-----------------------------
Q1M8C0_RHIL3/1-82FLYDENGLPK-----------------------------
A6X7T6_OCHA4/1-82KFSDELYEDD-----------------------------
Q11MS5_MESSB/190-270EAFDKMWESE-----------------------------
A4KK34_MYCTU/1-89DLYDDSGLPR-----------------------------
A6UBT8_SINMW/1-82KLMDELWEEA-----------------------------
A3TQ51_9MICO/1-82EIMDEMYDPQ-----------------------------
A5FU30_ACICJ/1-79AFFDDLSGEG-----------------------------
A6WWK7_OCHA4/1-82QEWDEAVGDT-----------------------------
A5EUT0_BRASB/1-81AFRDSLYEDT-----------------------------
A4KET8_MYCTU/1-81LLYDERGLPA-----------------------------
A5U403_MYCTA/1-83LGYD....PA-----------------------------
Q9F5F2_AGRRH/28-108EAFDEMWDDA-----------------------------
A4KHQ1_MYCTU/1-70LGYDERGLPA-----------------------------
Q219N1_RHOPB/1-84LGYDAHGLPR-----------------------------
B0T0U9_CAUSK/24-114EINEIPGLDD-----------------------------
A1T4A5_MYCVP/1-81LLYDDAGLPG-----------------------------
Q92TH7_RHIME/9-89EAYDEMWDDL-----------------------------
Q92RQ4_RHIME/1-84IGYDEDGLPS-----------------------------
Q7U1L4_MYCBO/1-84LGYDERGLPA-----------------------------
Q0BQA3_GRABC/5-88ALYGEGGLPL-----------------------------
Q72LD3_THET2/1-85EEILGYGKEG-----------------------------
Q1WLI3_SINMM/1-85IGYDEHGIPN-----------------------------
Q07GM2_ROSDO/1-81TYTDEMWGDG-----------------------------
A3TJ62_9MICO/1-86LGYDENGLPS-----------------------------
Q2RUX5_RHORT/1-82LLYDEHGLPK-----------------------------
Q981I6_RHILO/1-77AFFDDL..SG-----------------------------
Q07J94_RHOP5/4-86LGYDEHGLPT-----------------------------
Q1QF44_NITHX/1-84IGYDENGVPN-----------------------------

PF03693

PARD_XYLFA/1-78FDSEVFL...SRMHTQ-----------------------
PARD1_CAUCR/2-82FDFDAFIEERSRASAP-----------------------
PARD_MYCBO/1-81FDFDGFLGRKRADASR-----------------------
PARD_VIBCH/1-80YDLDSFINELDSENIR-----------------------
PARD_ECO57/1-80MTLRDIAAERKQKHRV-----------------------

PF11020

C4YV51_9RICK/4-85YALG............SAQEA------------------
Q2GKE5_ANAPZ/4-85YALK............VATTH------------------
Q2GG71_EHRCR/4-85YALT............VASHK------------------
Q5PB11_ANAMM/4-85YALN............VASRN------------------
B3CLM4_WOLPP/5-86YAIT............IVSNN------------------
Q2GCJ4_NEOSM/1-82YALK............VAEQE------------------
A5CC80_ORITB/1-82YALG............SAQGN------------------
A8GW87_RICB8/1-82YALG............TAQEA------------------
B3S7R4_TRIAD/8-106LFLSNPHIDSCFPHSLQSVQN------------------

PF07764

Q57468_STRPY/1-71---------------------------------------
Q83WL2_9ZZZZ/1-71---------------------------------------

PF09386

Q1NH10_9SPHN/1-79GISDKDFGSIVDEELG-----------------------
Q0E6B4_PSEAI/1-79KVSTKSVGEILDEELS-----------------------
Q87CU8_XYLFT/1-79KVSTKSINEILNEELT-----------------------
Q7N4K2_PHOLL/1-79KVSKKSIDEILNEELA-----------------------

PF11903

Q4KC28_PSEF5/1-66LLLNK.......PDLLRGRA-------------------
B4SF37_PELPB/2-74LVARAEGESLSTPFVPEGHR-------------------
A6DXG1_9RHOB/1-65QRKLA........DVKMPEI-------------------
A1V5D0_BURMS/1-73LIETEIQGDEAAPSVDAARS-------------------
A4JIY6_BURVG/2-63ILIAD..........QEEPV-------------------
A6SW35_JANMA/1-73LIEAEQQAGASSRDINLSLE-------------------
Q0HLV2_SHESM/1-65LMKSA........DVNLANV-------------------
A3JC26_9ALTE/3-67IIAQA........ERDAGKL-------------------
Q3KB70_PSEPF/1-73LIRAEQSGGLDLQQVCALAD-------------------
A0QXV1_MYCS2/6-107LAHTDYGQVLAGRGVTTVAL-------------------
B7X1E9_COMTE/1-73LLQQAERELQPVRAHEADAA-------------------
A4TQ21_YERPP/1-73LVQVELQGGADIAKMIYPDA-------------------
A9BMX0_DELAS/1-73LLQEAAATLKLGEPEAAPAP-------------------
A6T935_KLEP7/1-66MLKSG.......SDRLLEVI-------------------
Q48JT9_PSE14/1-73LIRIENAGGTVLTASNFNVA-------------------
Q7NVK9_CHRVO/1-73LLKAGQDGGGLDLRRQAMES-------------------
B9CGG2_9BURK/1-73LIEAEARGGTGAAEPVAGRI-------------------
A4X043_RHOS5/2-100SRPSRTEQAFFAKRQRLGRG-------------------
Q4FSP3_PSYA2/7-71LIAQA........EADAGMV-------------------
A6ULS8_SINMW/2-100AEPTADEQEFFAQRRMLGRG-------------------
A1T476_MYCVP/6-107LASADYGAVLATRGITTVAL-------------------
Q7N5H6_PHOLL/2-66LLAKS........EVNSGKV-------------------
Q3AQ94_CHLCH/4-76LASLAEPREHATPFIPRSSK-------------------
Q1GXH1_METFK/1-73LLHIEQSGSEVGNALKPAGG-------------------
Q3BNN7_XANC5/75-144QLRAA...GVRPQALKPGRA-------------------
A3U039_9RHOB/2-100SYPSEAEEAFFAKRQELGRG-------------------
A6DRR2_9BACT/8-74NVARA......EDPVEVKSI-------------------
A8GBI0_SERP5/5-69MMKDN........ALTLKEI-------------------
Q2SQH0_HAHCH/2-95LFDQFIDDDFSSVTDELKER-------------------
Q13JR3_BURXL/1-70ELRAA...GVVTQAVKVALT-------------------
A3UJ97_9RHOB/2-100AEPSDGEEAFFEGRRQLGRG-------------------
A4CF05_9GAMM/1-69LIKQELARADLHPFATLEDE-------------------
Q5R164_IDILO/1-65QMKLA........DVDIRKA-------------------
A4BRK7_9GAMM/11-108AQMDGNPMLQQRLTAAGRPL-------------------
Q15VU5_PSEA6/1-66ELENA.......NADTALKV-------------------
Q0RY55_RHOSR/40-141REGLNLAEQFAHSGRSYVEL-------------------
Q220F4_RHOFD/1-73LIRAELAGGLDIGVAVTGQL-------------------
A0NTD8_9RHOB/7-105SEPGPREQDFFAELRKNGNA-------------------
A3KVD8_PSEAI/16-86LMDEA..RESDRREQDAARI-------------------
A6WV11_OCHA4/1-65QLRAA........QVELPVL-------------------
A3UEM3_9RHOB/1-65QYEAA........ELDLTRR-------------------
Q47D61_DECAR/1-73LIQAEHQALEDSDLPVSLSK-------------------
Q0AF32_NITEC/4-76LASMAEPRSEATDFVPRSAA-------------------
Q8DFU3_VIBVU/2-66LLASE........EVKLGKV-------------------
A3Y2K0_9VIBR/3-67VIAKA........EKEAGKL-------------------
A0NZR8_9RHOB/1-68QLEAA.....QVPSADAAVA-------------------
Q0C2J2_HYPNA/1-68EMAAA.....GVTPEPLGAA-------------------
A7HVP7_PARL1/11-109GQPGSDEEAWFARRRQLGLG-------------------
A3YEZ0_9GAMM/1-66QLKLED.......EISQADS-------------------
A6GRT8_9BURK/5-104RTTGELKEEVSQNKVRYQAS-------------------
A1VWL3_POLNA/4-68MLSLE........EAKAGRV-------------------
A4Y172_PSEMY/1-70EMRAA...GVAVPPRMADAS-------------------
B4SPJ7_STRM5/1-70ELRAA...GVQPPLLPPGQA-------------------
A4BJF4_9GAMM/1-65QLKQA........DVDVEGQ-------------------
Q1IDH1_PSEE4/1-65LLRQE........QANLKEL-------------------
Q1NLW1_9DELT/3-75LMSMAEPKEESTPFVPRTGL-------------------
A6SYS7_JANMA/2-66LLAIE........KIDAKQL-------------------

PF07878

Q7VCC6_PROMA/12-67---------------------------------------
A9BA39_PROM4/13-68---------------------------------------
Q46LP4_PROMT/18-73---------------------------------------
A2C9K2_PROM3/2-57---------------------------------------
A2BQE0_PROMS/12-66---------------------------------------
Q7U397_PROMP/14-68---------------------------------------
Q7U7V4_SYNPX/2-57---------------------------------------
A2C9D6_PROM3/12-67---------------------------------------
Q3AZ83_SYNS9/18-73---------------------------------------
A2BU44_PROM5/9-58---------------------------------------
Q7V3I9_PROMP/9-58---------------------------------------
Q31D95_PROM9/9-58---------------------------------------
A8G287_PROM2/9-58---------------------------------------
A2BZQ7_PROM1/9-58---------------------------------------
A5GQX8_SYNR3/13-62---------------------------------------
A3YW17_9SYNE/9-58---------------------------------------
Q05W20_9SYNE/9-58---------------------------------------
Q7U4A0_SYNPX/9-58---------------------------------------
Q0I761_SYNS3/30-79---------------------------------------
A2C697_PROM3/30-79---------------------------------------
A9B9H2_PROM4/9-58---------------------------------------
Q7VEB2_PROMA/9-58---------------------------------------
Q0I9D3_SYNS3/28-77---------------------------------------
A5GKY5_SYNPW/28-77---------------------------------------
Q05T64_9SYNE/21-70---------------------------------------
Q7TV19_PROMM/21-70---------------------------------------
Q3AIE8_SYNSC/28-77---------------------------------------

PF01340

METJ_SALTY/2-105IMRELGIDPETWEY-------------------------
METJ_SHIFL/2-105IMREMGINPETWEY-------------------------
METJ_HAEIN/2-105LMRELGVDPESWEY-------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window