Sequence alignment for CL0057

PF12651

A6LT47_CLOB8/12-55--------------------------------------------------------------------------------
Q1D537_MYXXD/6-49--------------------------------------------------------------------------------
Q08NJ8_STIAD/30-73--------------------------------------------------------------------------------
Q04FI1_OENOB/1-44--------------------------------------------------------------------------------
A5N8S1_CLOK5/8-51--------------------------------------------------------------------------------
A7HBK6_ANADF/4-47--------------------------------------------------------------------------------
Q9YEP4_AERPE/2-45--------------------------------------------------------------------------------
A2BMU8_HYPBU/1-44--------------------------------------------------------------------------------
B2TQ69_CLOBB/8-51--------------------------------------------------------------------------------
C3AQ62_BACMY/106-149--------------------------------------------------------------------------------
Q17ZT4_PEPD6/4-47--------------------------------------------------------------------------------
A9GWZ6_SORC5/4-47--------------------------------------------------------------------------------
E3FMN1_STIAD/4-47--------------------------------------------------------------------------------
Q2II40_ANADE/24-64--------------------------------------------------------------------------------
Q8XP25_CLOPE/8-50--------------------------------------------------------------------------------

PF01402

Q9YBV4_AERPE/3-42--------------------------------------------------------------------------------
Q8ZX60_PYRAE/47-86--------------------------------------------------------------------------------
P72681_SYNY3/21-59--------------------------------------------------------------------------------
Q8ZWZ9_PYRAE/10-49--------------------------------------------------------------------------------
NIKR_CHLTE/6-45--------------------------------------------------------------------------------
Q877Q4_PSESM/12-50--------------------------------------------------------------------------------
Y4KO_RHISN/4-42--------------------------------------------------------------------------------
VPB19_MYCTU/2-40--------------------------------------------------------------------------------
O28529_ARCFU/6-44--------------------------------------------------------------------------------
Y080_METJA/3-41--------------------------------------------------------------------------------
PARD2_CAUCR/12-50--------------------------------------------------------------------------------
O30230_ARCFU/6-44--------------------------------------------------------------------------------
O29882_ARCFU/4-42--------------------------------------------------------------------------------
NIKR1_METTH/3-42--------------------------------------------------------------------------------
Q9I707_PSEAE/4-42--------------------------------------------------------------------------------
E51_SSV1/12-50--------------------------------------------------------------------------------
Q88JZ4_PSEPK/2-40--------------------------------------------------------------------------------
Q888D4_PSESM/12-50--------------------------------------------------------------------------------
O30109_ARCFU/6-44--------------------------------------------------------------------------------
NIKR_HELPY/12-51--------------------------------------------------------------------------------
Q8EGZ2_SHEON/6-44--------------------------------------------------------------------------------
G7YYF2_CLOSI/3-42--------------------------------------------------------------------------------
YBFE_ECOLI/52-88--------------------------------------------------------------------------------
YIIE_ECOLI/4-41--------------------------------------------------------------------------------
Y298_MYCTU/6-41--------------------------------------------------------------------------------
VPB20_MYCTU/11-49--------------------------------------------------------------------------------
VPB10_MYCTU/3-39--------------------------------------------------------------------------------
Q327A8_SHIDS/14-51--------------------------------------------------------------------------------
Q3IQM5_NATPD/4-41--------------------------------------------------------------------------------
Q8U3E4_PYRFU/7-45--------------------------------------------------------------------------------
S6AY38_PSERE/10-47--------------------------------------------------------------------------------
V5UCU1_9BURK/15-51--------------------------------------------------------------------------------

PF07878

Q1QQP0_NITHX/90-130--------------------------------------------------------------------------------
Q7U858_SYNPX/33-75--------------------------------------------------------------------------------
A5GQX8_SYNR3/18-60--------------------------------------------------------------------------------
E8SHU9_STAPH/6-48--------------------------------------------------------------------------------
A5GKY5_SYNPW/33-75--------------------------------------------------------------------------------
F4BUC1_METCG/7-49--------------------------------------------------------------------------------
B7JWD3_CYAP8/2-44--------------------------------------------------------------------------------
A8ZLB3_ACAM1/15-57--------------------------------------------------------------------------------
D7E5Q5_NOSA0/6-48--------------------------------------------------------------------------------
Q46HT9_PROMT/14-56--------------------------------------------------------------------------------
B1X2B8_CYAA5/9-51--------------------------------------------------------------------------------
Q7VEB2_PROMA/14-56--------------------------------------------------------------------------------
Q7NMR8_GLOVI/20-62--------------------------------------------------------------------------------
E0UNJ6_CYAP2/6-48--------------------------------------------------------------------------------
Q8YK09_NOSS1/15-57--------------------------------------------------------------------------------
K9VLV1_9CYAN/8-49--------------------------------------------------------------------------------
K9VLX7_9CYAN/14-56--------------------------------------------------------------------------------
Q7V237_PROMP/82-124--------------------------------------------------------------------------------

PF15919

F8GGR0_NITSI/3-126YPIAIE.PGDDK.HAFGVVVPDLPGCFSAGDT.IDEAIDKAKEAIELWLETVIDDGGSVP.H.PKSISEH..Q.ANP..E
F2JW02_MARM1/3-127YPIVLH.T.DDG.DSYSVTVPDVPGCFSAGTT.LNEAIDMAEEAIFFHLEGMLEDGEDVP.V.ASEIAVY..K.DNP..D
E1VAV2_HALED/3-129YPIAIEIA.DEQ.HAYSVVVPDLPGCFSAGDT.FDEAVANAREAIEGHLESLSDHGDPIP.K.TTTIEQH..L.ENP..D
B8GTR2_THISH/3-126YPILIE.P.GSNSTAYSVVVPDLPGCYSAGDT.LDEAIENAEEAILMHLEALIDAGESLP.E.PSSIEMQ..L.NNP..A
F2KE11_PSEBN/3-128YPIAIS.MGDDK.HAWGVEVPDIPGCFSAGDD.LDEAMAMAREAIEGHFEVLAEDGSPIP.S.ANTVTLH..A.ANP..A
F4HBU2_GALAU/3-128YPIGIE.MGDDK.HAFGVIVPDVPGCFSAGDT.LEEAYINAKEAIAFHIEGMLEDGEEFP.L.PTDIKAH..M.NNK..E
F7QNQ0_9BRAD/4-124FIALIH.K.DAD.SDYGVSFPDLPGVISAGST.LDEARDMATEALALHIEGLIEDGEAVP.E.PSSLEDI..M.ANA..D
D8MUK4_ERWBE/3-128YPIAIE.NGDEH.HAYGVTVPDLPGCFSAGET.LEEAVNNAKEAITGHIELLIELGDDIP.A.VSSLSAL..V.ADS..Q
G8M697_9BURK/3-126FALAIH.K.DPD.SCYGVTVPNVPGVFSAGDT.IDEAIQNAKEAIFFHIESIIEDGEEVT.IKSTSIEEL..I.VDP..D
Q1QQP0_NITHX/4-124FIALIH.K.DAD.SDYGVSFPDLPGCVTAGTT.LDEARDMAAEALALHLEGMAEDGEGVP.E.PASLEEV..M.ADP..V
D5BWS5_NITHN/3-123YPVYIH.PGDNK.HAHGVTFPDFPGCFSAADS.WEELPAKIQEAVELYFEG...ETMEIP.P.PTPLEEL..V.QRP..E
Q98J17_RHILO/4-124YIGLIH.K.DAG.SDFGVSFPDFPGVITAGKD.LDDARSMAEEALTLHIEGLVEDGEAIP.E.PSSLQAV..M.ADA..D
E6WDB3_PANSA/3-127FAVYLH.K.ADS.GGYSGFVPDIIGCIFAGDT.IDNAIVDATEAIDAHLESLADRGKTLP.E.AKDISAH..L.DDE..D
A1VQL9_POLNA/3-127YPITIE.P.GNDTTAWGVVVPDLPGCFSAGDT.LEEAMIQAEDAVTAWIEVALDAGQDIP.A.PSHIEAL..RTAHP..E
Q63NA5_BURPS/3-126FPIAVH.K.DDG.SVYGVTVPDIPGVHSWGET.IDDAIKNTREAIVGHVETLIELGEDVEFT.CSTVEEL..V.AKP..E
B4ET85_PROMH/3-129YPAFIE.I.DED.GSASGWFPDIDGCIFAGDS.IEEAHADARSAIDAHFELLSEKGLDIP.S.PKSQQEHLIN.SSG..D
D5CBF0_ENTCC/3-129YPAYIH.S.DPD.GSASGFFPDVPGCFFAGNS.LDDAFQDARDALTAHFEALFEMDEELP.L.PGNVEAH..L.EATPGD
A5GAH3_GEOUR/3-123YPAYVHIG.DDQ.HAHGVTIPDFPGCFSAADE.WEDLPHMIQEAAEVYFEG...EDMPVP.A.PTPLEQL..A.ANP..E
Q1LPG4_RALME/14-137FPIAIH.K.DAN.SVYGVTVPDVAGCYSAGES.IEEAVRNAREAITTHVVALLSLGEEVVLK.TTPIGTL..M.AQP..E
A8GFZ4_SERP5/3-129YPAYVH.S.EHD.GSASGFFPDVPGCYFAGDT.LDRAFEDAKSALDAHFELLSEDNQSIP.R.PQAVSFH..L.AQESDT
Q7N448_PHOLL/3-129YPIAIEIG.DEN.HAYGVVVPDISGCFSAGDS.MEDAIKNSKEAITGHLELLAEMNQLPP.E.AKSLDYW..I.KDE..E
Q5HXI2_GLUOX/3-126YPVVIE.RGSET.TAFGVVFPDLPGCFSAGDT.LDEALSCAEEAAAAWIDATLDAGEAVP.S.PSSLDAI..Q.SNP..D
F4GPE1_PUSST/3-127YPIAIE.P.GNDTTAWGVVAPDLPGCFSAADNGIDEAIENAKEAIALWIEEAIANGEIIP.K.PSSITDL..Q.MTG..E
B8DM26_DESVM/3-123YPVIVH.K.DAD.SAYGVILPDFPGCFTAGDT.LEEALANAQEAVELYFEG..ERDAVAP.P.PSPIDAV..L.GSE..D
A9H9S0_GLUDA/10-135YPIVIE.R.GSDAEAYGVVVPDLPGCFSAGDT.FDEAVSNASEAIALWVEDAIDNGQSIP.R.PSSLDGL..R.ASL..E
F9ZMS1_ACICS/3-126YPIAIE.PGDDH.HAYGVVVPDLPGCFSAGDT.LDEAIANAHEAIALWLETVMDDGGTIP.A.PSSVESL..Q.KQP..E
YO14_BPHC1/3-126YPICIE.K.VND..GYVVSVPDVPGCFSAGDT.LSEAMLNAKEAISFHIEGMLEDDEELP.K.SNPIEQY..I.NQP..E
Q5F6D2_NEIG1/4-126.PAALH.K.DEH.SAYGVTIPDLPGCFSCGDT.VEEAVANARSAAYMHIDGMIEDGGFKNLA.VSSIADL..S.QEP..D
Q7VZH1_BORPE/3-127YPIAIE.PGSDT.RAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIP.P.ATSIANH..Q.ANP..E
Q9A3L8_CAUCR/4-124YIALIH.K.DAD.SAFGVSFPDLPGCISVGET.LEEARANAEEALALHVEGMIEDGETLP.A.PSALDEV..M.AAP..G
W8KT83_HALHR/3-127YPIAIE.WGDEH.TATGIVFPDIPGAITAGDT.VEQAYEMAVEVAHIQLEELATAGKAIP.M.PGNITKH..R.QNP..E

PF12441

Q30QH6_SULDN/2-80----------------------------------------------------------KTLP.KFKDQNEEMAFWEKNDV
B0JXE6_MICAN/7-82----------------------------------------------------------KSLP.KFNSTEEIVNFFDSHDL
B4SES2_PELPB/3-79----------------------------------------------------------KKFP.DFKTDDEAEAFVESADL
A6QAG9_SULNB/5-83----------------------------------------------------------KKIP.EFQNEEEERLFWEKHDS
C1F1N0_ACIC5/3-81----------------------------------------------------------KKIP.EFKSEEEEFAFWSKADS
B4SF55_PELPB/6-84----------------------------------------------------------TAIP.EFRSEAEEQEFWSTHDS
A4SVJ8_POLSQ/6-84----------------------------------------------------------KIIP.KFKTEKEERTFWEKNDA
A1BIF8_CHLPD/6-84----------------------------------------------------------KTVP.EFRSEQDEREFWATHDS
B1WWY8_CYAA5/9-85----------------------------------------------------------DPIPEEFSSYEAAAEFWDTHDT
B8GRA9_THISH/6-84----------------------------------------------------------KTVP.EFKSEAEERAFWETHDS
P72819_SYNY3/56-132----------------------------------------------------------KPLP.KMNSDQEAEDLLEQ.DL
A5GA05_GEOUR/6-84----------------------------------------------------------KEVP.AFSSEAEERTFWEQHDS
C7LN80_DESBD/6-82----------------------------------------------------------KQMP.SLRNDAEAEEFVAQADL
Q01SA6_SOLUE/7-85----------------------------------------------------------KTVP.EFQSEDDEREFWATHDS
C3KQS7_RHISN/6-84----------------------------------------------------------KPIP.SFETEAEERAYWETHDS
Q9AAV5_CAUCR/3-77----------------------------------------------------------KAVP.KLTTDDEAEAFLTQ.DL

PF13467

I3THE1_TISMK/5-68--------------------------------------------------------------------------------
A1B158_PARDP/15-82--------------------------------------------------------------------------------
Q2W502_MAGSA/68-131--------------------------------------------------------------------------------
U4KIB5_9VIBR/16-83--------------------------------------------------------------------------------
D7A937_STAND/16-83--------------------------------------------------------------------------------
Q47K48_DECAR/15-83--------------------------------------------------------------------------------
B8EK53_METSB/15-83--------------------------------------------------------------------------------
V6F6E9_9PROT/28-96--------------------------------------------------------------------------------
I3TNF1_TISMK/9-73--------------------------------------------------------------------------------
S6AZN1_PSERE/15-83--------------------------------------------------------------------------------
B4RFD6_PHEZH/4-67--------------------------------------------------------------------------------
A4Z0Q4_BRASO/15-82--------------------------------------------------------------------------------
Q8EH51_SHEON/15-83--------------------------------------------------------------------------------
Q1QJT3_NITHX/17-80--------------------------------------------------------------------------------
U4K818_9VIBR/15-83--------------------------------------------------------------------------------
R5XT33_9PROT/6-68--------------------------------------------------------------------------------
D7A5S3_STAND/15-83--------------------------------------------------------------------------------
A5FXC9_ACICJ/3-65--------------------------------------------------------------------------------
D4ZC71_SHEVD/15-83--------------------------------------------------------------------------------
K7SD13_GLUOY/4-66--------------------------------------------------------------------------------
G2KLR8_MICAA/1-64--------------------------------------------------------------------------------
G8PTZ2_PSEUV/3-67--------------------------------------------------------------------------------
A8IAV7_AZOC5/5-68--------------------------------------------------------------------------------
Q13WI7_BURXL/15-84--------------------------------------------------------------------------------
B2IEK6_BEII9/15-82--------------------------------------------------------------------------------
R5YAT6_9PROT/7-67--------------------------------------------------------------------------------
F2J384_POLGS/15-81--------------------------------------------------------------------------------
U5T3K9_9GAMM/16-83--------------------------------------------------------------------------------
Q2K3V5_RHIEC/15-83--------------------------------------------------------------------------------
V6F679_9PROT/38-104--------------------------------------------------------------------------------
Q7CXZ9_AGRT5/2-66--------------------------------------------------------------------------------
C3MEF5_RHISN/3-66--------------------------------------------------------------------------------
B9JH07_AGRRK/7-71--------------------------------------------------------------------------------
Q2YPT7_BRUA2/7-71--------------------------------------------------------------------------------
Q0A5P7_ALKEH/48-113--------------------------------------------------------------------------------
A5VF72_SPHWW/4-70--------------------------------------------------------------------------------
Q2N6Z0_ERYLH/8-73--------------------------------------------------------------------------------
B6INS4_RHOCS/2-64--------------------------------------------------------------------------------
W8RV19_9RHOB/5-69--------------------------------------------------------------------------------
G2I0K7_GLUMN/18-81--------------------------------------------------------------------------------
A7HVX0_PARL1/14-77--------------------------------------------------------------------------------
Q2W7L3_MAGSA/5-67--------------------------------------------------------------------------------
A8LPV2_DINSH/15-83--------------------------------------------------------------------------------
Q167Q5_ROSDO/15-83--------------------------------------------------------------------------------
Q15TD7_PSEA6/15-83--------------------------------------------------------------------------------
E3I0W1_RHOVT/38-99--------------------------------------------------------------------------------
Q167I6_ROSDO/5-69--------------------------------------------------------------------------------
A6X0F5_OCHA4/15-83--------------------------------------------------------------------------------
C5AUK2_METEA/10-72--------------------------------------------------------------------------------
R6I0Y9_9PROT/4-68--------------------------------------------------------------------------------
B8IRU4_METNO/15-83--------------------------------------------------------------------------------
B8ELI0_METSB/17-78--------------------------------------------------------------------------------
G8ARW4_AZOBR/20-92--------------------------------------------------------------------------------
G7ZBW3_AZOL4/15-83--------------------------------------------------------------------------------
D4YZT3_SPHJU/21-85--------------------------------------------------------------------------------
I0HQZ1_RUBGI/15-82--------------------------------------------------------------------------------
A9HZ31_BORPD/15-82--------------------------------------------------------------------------------
B0T0E7_CAUSK/20-82--------------------------------------------------------------------------------
B6IVX3_RHOCS/20-83--------------------------------------------------------------------------------
H5WRL6_9BURK/15-83--------------------------------------------------------------------------------
R6I5L9_9PROT/2-65--------------------------------------------------------------------------------
Q88NJ6_PSEPK/37-105--------------------------------------------------------------------------------
Q7VY20_BORPE/16-82--------------------------------------------------------------------------------
Q0KEM8_CUPNH/15-86--------------------------------------------------------------------------------
Q3J4J5_RHOS4/5-69--------------------------------------------------------------------------------
B6JB62_OLICO/35-98--------------------------------------------------------------------------------
E4PET2_MARAH/15-83--------------------------------------------------------------------------------
G4RFD5_PELHB/1-64--------------------------------------------------------------------------------
Q5LS66_RUEPO/5-69--------------------------------------------------------------------------------
R5XSE7_9PROT/2-65--------------------------------------------------------------------------------
A9HBJ7_GLUDA/7-71--------------------------------------------------------------------------------
B2U9M5_RALPJ/15-83--------------------------------------------------------------------------------
C6BV10_DESAD/15-83--------------------------------------------------------------------------------
A1WLD9_VEREI/15-83--------------------------------------------------------------------------------
V5SG48_9RHIZ/7-70--------------------------------------------------------------------------------
D5BP55_PUNMI/2-63--------------------------------------------------------------------------------
D0IW80_COMT2/15-83--------------------------------------------------------------------------------
V6EZW9_9PROT/2-64--------------------------------------------------------------------------------
B1M524_METRJ/6-68--------------------------------------------------------------------------------
G7Z694_AZOL4/2-65--------------------------------------------------------------------------------
Q6G2S1_BARHE/14-77--------------------------------------------------------------------------------
E8RRH3_ASTEC/4-67--------------------------------------------------------------------------------
A1VU33_POLNA/15-83--------------------------------------------------------------------------------
Q11GU9_CHESB/4-68--------------------------------------------------------------------------------
D9QJB1_BRESC/2-64--------------------------------------------------------------------------------
A2SED0_METPP/15-83--------------------------------------------------------------------------------
A1B3A7_PARDP/22-85--------------------------------------------------------------------------------
Q5E5I8_VIBF1/19-85--------------------------------------------------------------------------------
G8B035_AZOBR/15-83--------------------------------------------------------------------------------
K7SIV6_GLUOY/15-83--------------------------------------------------------------------------------
Q28PQ0_JANSC/10-74--------------------------------------------------------------------------------
Q87MR6_VIBPA/16-83--------------------------------------------------------------------------------
R5R7N0_9PROT/5-68--------------------------------------------------------------------------------
Q5NQS8_ZYMMO/14-79--------------------------------------------------------------------------------
R5Q8E2_9PROT/4-65--------------------------------------------------------------------------------
Q141Z3_BURXL/65-133--------------------------------------------------------------------------------
R6ITS5_9PROT/4-68--------------------------------------------------------------------------------
G2KND8_MICAA/35-99--------------------------------------------------------------------------------
Q92NP9_RHIME/6-70--------------------------------------------------------------------------------
Q21US4_ALBFT/16-83--------------------------------------------------------------------------------
W0AMC0_9SPHN/9-75--------------------------------------------------------------------------------
D5AQD4_RHOCB/5-69--------------------------------------------------------------------------------
Q2G3C7_NOVAD/8-72--------------------------------------------------------------------------------
Q2RS87_RHORT/10-72--------------------------------------------------------------------------------
Q0AMZ5_MARMM/17-80--------------------------------------------------------------------------------
A7IN95_XANP2/16-83--------------------------------------------------------------------------------
E0TDI6_PARBH/6-68--------------------------------------------------------------------------------
S5YGZ7_PARAH/15-83--------------------------------------------------------------------------------
B6JB63_OLICO/5-68--------------------------------------------------------------------------------
A1BB74_PARDP/15-83--------------------------------------------------------------------------------
Q0BVF8_GRABC/3-66--------------------------------------------------------------------------------
B6IXV3_RHOCS/24-88--------------------------------------------------------------------------------
G8AK62_AZOBR/2-63--------------------------------------------------------------------------------
R6IQM1_9PROT/1-65--------------------------------------------------------------------------------
F2J2A0_POLGS/3-67--------------------------------------------------------------------------------
W0PKG2_9BURK/15-82--------------------------------------------------------------------------------
J7QMW2_METSZ/14-76--------------------------------------------------------------------------------
M4S774_9SPHN/4-69--------------------------------------------------------------------------------
B8IF14_METNO/8-71--------------------------------------------------------------------------------
A8HUM8_AZOC5/15-83--------------------------------------------------------------------------------
A8LRP0_DINSH/33-97--------------------------------------------------------------------------------
S5YRV8_PARAH/10-74--------------------------------------------------------------------------------
A6WUZ0_OCHA4/15-83--------------------------------------------------------------------------------
G0AAA0_COLFT/37-104--------------------------------------------------------------------------------
F8J5J1_HYPSM/3-66--------------------------------------------------------------------------------
G8AI45_AZOBR/22-97--------------------------------------------------------------------------------
G8ARV8_AZOBR/26-90--------------------------------------------------------------------------------
B6IW11_RHOCS/3-66--------------------------------------------------------------------------------
M9R844_9RHOB/9-72--------------------------------------------------------------------------------
R6J4D7_9PROT/7-67--------------------------------------------------------------------------------
C7JBE2_ACEP3/5-69--------------------------------------------------------------------------------
A6VZH2_MARMS/16-83--------------------------------------------------------------------------------
V9VUQ5_9RHOB/5-69--------------------------------------------------------------------------------
D5BMV3_PUNMI/6-68--------------------------------------------------------------------------------
R5QX40_9PROT/1-65--------------------------------------------------------------------------------
B9JXQ8_AGRVS/8-72--------------------------------------------------------------------------------
Q87Y30_PSESM/6-74--------------------------------------------------------------------------------
A0KLC1_AERHH/26-94--------------------------------------------------------------------------------
Q98KH2_RHILO/5-68--------------------------------------------------------------------------------
A5FYB5_ACICJ/15-82--------------------------------------------------------------------------------
D5QBC0_KOMHA/10-72--------------------------------------------------------------------------------
G2IRZ2_9SPHN/11-78--------------------------------------------------------------------------------
Q2SKQ2_HAHCH/16-83--------------------------------------------------------------------------------
F2K501_PSEBN/34-101--------------------------------------------------------------------------------
B2IH09_BEII9/17-85--------------------------------------------------------------------------------
Q2K6G5_RHIEC/20-84--------------------------------------------------------------------------------
F6IFI2_9SPHN/8-74--------------------------------------------------------------------------------
B2UET6_RALPJ/16-83--------------------------------------------------------------------------------
Q1GGM9_RUEST/6-70--------------------------------------------------------------------------------

PF03869

RMNT_BPP22/2-51--------------------------------------------------------------------------------
RARC_BPP22/4-53--------------------------------------------------------------------------------
G3XCY4_PSEAE/13-62--------------------------------------------------------------------------------

PF07704

Q92LY2_RHIME/1-78-------------------------------------------------------------------------------M
K9Y1V0_STAC7/1-81-------------------------------------------------------------------------------M
VPB42_MYCTU/1-88-------------------------------------------------------------------------------M
C7NJK7_KYTSD/22-102-------------------------------------------------------------------------------M
Q0BQA3_GRABC/5-87-------------------------------------------------------------------------------M
L0DWF9_THIND/1-83-------------------------------------------------------------------------------M
A6WWK7_OCHA4/1-81-------------------------------------------------------------------------------M
Q2JGF8_FRASC/9-88-------------------------------------------------------------------------------.
W0ABH3_9SPHN/5-83-------------------------------------------------------------------------------.
A6X7T6_OCHA4/1-81-------------------------------------------------------------------------------M
A7IPR5_XANP2/185-260-------------------------------------------------------------------------------.
I6X1P2_PROPF/1-84-------------------------------------------------------------------------------M
I3TVZ0_TISMK/1-81-------------------------------------------------------------------------------M
I3Y9G9_THIV6/1-75-------------------------------------------------------------------------------M
Q20ZG7_RHOPB/1-82-------------------------------------------------------------------------------M
B1M1V3_METRJ/1-75-------------------------------------------------------------------------------M
G8NNV7_GRAMM/6-85-------------------------------------------------------------------------------M
L0J8B6_MYCSM/1-82-------------------------------------------------------------------------------M
F2J715_POLGS/1-79-------------------------------------------------------------------------------M
K7S7C8_PROA4/1-82-------------------------------------------------------------------------------M
B8EP86_METSB/1-76-------------------------------------------------------------------------------M
B8IVJ3_METNO/1-83-------------------------------------------------------------------------------M
C7NLZ4_KYTSD/1-87-------------------------------------------------------------------------------M
C1A9G9_GEMAT/1-83-------------------------------------------------------------------------------M
Y2378_RHIME/1-81-------------------------------------------------------------------------------M
F5XKW7_MICPN/1-83-------------------------------------------------------------------------------M
L0J8W2_MYCSM/1-78-------------------------------------------------------------------------------M
B0T0U9_CAUSK/24-113-------------------------------------------------------------------------------M
VPB30_MYCTU/1-83-------------------------------------------------------------------------------M
Q2RUX5_RHORT/1-81-------------------------------------------------------------------------------M
VPB36_MYCTU/1-81-------------------------------------------------------------------------------M
I6XS64_PROPF/3-79-------------------------------------------------------------------------------P
H6RSW2_BLASD/1-87-------------------------------------------------------------------------------M
Q92TH7_RHIME/9-88-------------------------------------------------------------------------------M
H6RM61_BLASD/1-86-------------------------------------------------------------------------------M
B9JIC8_AGRRK/5-84-------------------------------------------------------------------------------M
D7A0R5_STAND/1-80-------------------------------------------------------------------------------M
B0SW80_CAUSK/41-123-------------------------------------------------------------------------------P
A7IPR8_XANP2/1-84-------------------------------------------------------------------------------M
K9Y7X0_HALP7/1-79-------------------------------------------------------------------------------M
L0GTX7_9GAMM/1-83-------------------------------------------------------------------------------M
D4Z9B0_SPHJU/1-81-------------------------------------------------------------------------------M
C3KNS9_RHISN/1-79-------------------------------------------------------------------------------M
C3KQT0_RHISN/1-80-------------------------------------------------------------------------------M
A6X8D2_OCHA4/6-84-------------------------------------------------------------------------------.
VPB28_MYCTU/1-80-------------------------------------------------------------------------------M
Q981I6_RHILO/1-76-------------------------------------------------------------------------------M
Q6N2A9_RHOPA/1-82-------------------------------------------------------------------------------M
Q219N1_RHOPB/1-83-------------------------------------------------------------------------------M
Q7NGE7_GLOVI/4-85-------------------------------------------------------------------------------.
A1T4A5_MYCVP/1-80-------------------------------------------------------------------------------M
K0FC64_9NOCA/1-82-------------------------------------------------------------------------------M
B1LSI4_METRJ/1-77-------------------------------------------------------------------------------M
C3KQV7_RHISN/1-83-------------------------------------------------------------------------------M
D3PLA4_MEIRD/1-79-------------------------------------------------------------------------------M
L0E2P5_THIND/1-78-------------------------------------------------------------------------------M
B2IL59_BEII9/1-77-------------------------------------------------------------------------------M
U5QCJ3_9CYAN/4-85-------------------------------------------------------------------------------.
C8XHZ8_NAKMY/1-83-------------------------------------------------------------------------------M
Q92RQ4_RHIME/1-83-------------------------------------------------------------------------------M
Q5SKZ1_THET8/1-84-------------------------------------------------------------------------------M
A5FU30_ACICJ/1-78-------------------------------------------------------------------------------M
Q1QF44_NITHX/1-83-------------------------------------------------------------------------------M

PF09957

Q82BL1_STRAW/2-49--------------------------------------------------------------------------------
Q20X13_RHOPB/8-51--------------------------------------------------------------------------------
Q2FLV1_METHJ/1-47--------------------------------------------------------------------------------
Q58AH0_RALME/1-44--------------------------------------------------------------------------------
Q3JAZ0_NITOC/1-47--------------------------------------------------------------------------------
A1U2W3_MARAV/1-47--------------------------------------------------------------------------------
A1VX34_POLNA/1-45--------------------------------------------------------------------------------
Q7AQ19_MYCLE/3-56--------------------------------------------------------------------------------
Q73PC1_TREDE/1-47--------------------------------------------------------------------------------
B3EKM2_CHLPB/1-47--------------------------------------------------------------------------------
Q73R95_TREDE/1-44--------------------------------------------------------------------------------
Q7NCS8_GLOVI/1-47--------------------------------------------------------------------------------
A8ZTF6_DESOH/1-44--------------------------------------------------------------------------------
Q7D057_AGRT5/1-48--------------------------------------------------------------------------------
Q2FNJ2_METHJ/1-47--------------------------------------------------------------------------------
A5G896_GEOUR/35-78--------------------------------------------------------------------------------
A5GB97_GEOUR/1-47--------------------------------------------------------------------------------
Q73SG9_MYCPA/11-61--------------------------------------------------------------------------------
A0ZI46_NODSP/1-47--------------------------------------------------------------------------------
Q01QU3_SOLUE/1-47--------------------------------------------------------------------------------
A4XJM6_CALS8/1-47--------------------------------------------------------------------------------
Q124P4_POLSJ/1-47--------------------------------------------------------------------------------
B1WYD1_CYAA5/1-47--------------------------------------------------------------------------------
B2HSG4_MYCMM/3-54--------------------------------------------------------------------------------
B8GLV4_THISH/1-43--------------------------------------------------------------------------------
VAPB6_MYCTU/3-45--------------------------------------------------------------------------------
Y634A_MYCTU/16-68--------------------------------------------------------------------------------
VPB15_MYCTU/7-50--------------------------------------------------------------------------------
VPB11_MYCTU/7-49--------------------------------------------------------------------------------
Q8YSF9_NOSS1/25-71--------------------------------------------------------------------------------

PF09274

E5YNK1_9ENTR/1-74---------------------------------------------------------------------MALTKQHTS.K
A0A034V0K1_ERWAM/1-76---------------------------------------------------------------------MALEKNHTSSK
B0ZE05_ECOLX/1-76---------------------------------------------------------------------MSLEKAHTSVK

PF05509

B8EFN4_SHEB2/13-61--------------------------------------------------------------------------------
Q4LC31_SODGL/14-62--------------------------------------------------------------------------------
B6ESX2_ALISL/7-55--------------------------------------------------------------------------------
A7DVG3_VIBVL/13-61--------------------------------------------------------------------------------
B2LS54_9VIBR/10-58--------------------------------------------------------------------------------
B8EFW0_SHEB2/41-89--------------------------------------------------------------------------------
B6ET57_ALISL/12-52--------------------------------------------------------------------------------
A6ASC2_VIBCY/12-60--------------------------------------------------------------------------------
Q7MBP1_VIBVY/10-58--------------------------------------------------------------------------------
A7N8Z3_VIBCB/12-60--------------------------------------------------------------------------------
Q5DY84_VIBF1/10-58--------------------------------------------------------------------------------
B5PNJ9_SALET/24-72--------------------------------------------------------------------------------
A6D5H0_9VIBR/18-66--------------------------------------------------------------------------------
Q6LW96_PHOPR/20-68--------------------------------------------------------------------------------
A8QYN9_9GAMM/15-63--------------------------------------------------------------------------------
A7N8V1_VIBCB/9-57--------------------------------------------------------------------------------
E6WK64_PANSA/14-62--------------------------------------------------------------------------------
D4IGT0_ERWAE/12-60--------------------------------------------------------------------------------
B2VB54_ERWT9/25-73--------------------------------------------------------------------------------
B6ICE9_ECOSE/13-61--------------------------------------------------------------------------------
A0A023MW99_SALEN/14-62--------------------------------------------------------------------------------
A0A026GSK1_ECOLX/14-62--------------------------------------------------------------------------------
A0A024LLK2_ECOLX/14-62--------------------------------------------------------------------------------
A0A025IEW1_ECOLX/14-62--------------------------------------------------------------------------------
A0A024KL39_ECOLX/70-118--------------------------------------------------------------------------------
A6TIF9_KLEP7/67-115--------------------------------------------------------------------------------
A0A016QUU3_KLEPN/72-120--------------------------------------------------------------------------------
Q1MKC7_RHIL3/2-50--------------------------------------------------------------------------------

PF07362

H0Q687_9RHOO/11-81--------------------------------------------------------------------------------
K0I4M5_9BURK/9-79--------------------------------------------------------------------------------
L0DQK3_THIND/1-68--------------------------------------------------------------------------------
B5EG30_GEOBB/12-82--------------------------------------------------------------------------------
D4YZH7_SPHJU/13-83--------------------------------------------------------------------------------
B2JXB4_BURP8/10-80--------------------------------------------------------------------------------
Q82VK5_NITEU/17-87--------------------------------------------------------------------------------
B0T4X1_CAUSK/3-80--------------------------------------------------------------------------------
E0SK21_DICD3/2-72--------------------------------------------------------------------------------
Q1GN85_SPHAL/11-80--------------------------------------------------------------------------------
Q326Z9_SHIDS/2-72--------------------------------------------------------------------------------
D3VG79_XENNA/22-92--------------------------------------------------------------------------------
W0L945_SERFO/12-76--------------------------------------------------------------------------------
F5XZ64_RAMTT/9-77--------------------------------------------------------------------------------
G7Z7L4_AZOL4/17-86--------------------------------------------------------------------------------
Q98F99_RHILO/26-96--------------------------------------------------------------------------------
S5Z1L5_PARAH/10-80--------------------------------------------------------------------------------
A5GAE8_GEOUR/23-93--------------------------------------------------------------------------------
Q93GR6_SALTY/2-72--------------------------------------------------------------------------------
A7HPK7_PARL1/5-75--------------------------------------------------------------------------------
E1VR77_9GAMM/21-91--------------------------------------------------------------------------------
G7ZEQ7_AZOL4/20-89--------------------------------------------------------------------------------
Q5P2R6_AROAE/22-92--------------------------------------------------------------------------------
Q32K47_SHIDS/7-77--------------------------------------------------------------------------------
A0L724_MAGSM/11-81--------------------------------------------------------------------------------
A8GC18_SERP5/8-78--------------------------------------------------------------------------------
A1U420_MARAV/11-81--------------------------------------------------------------------------------
Q8PCL0_XANCP/29-98--------------------------------------------------------------------------------
S6AR37_PSERE/11-81--------------------------------------------------------------------------------
Q6D9V2_PECAS/2-71--------------------------------------------------------------------------------
Q21DI4_SACD2/11-81--------------------------------------------------------------------------------
I1XLK6_METNJ/11-81--------------------------------------------------------------------------------
Q7N4P4_PHOLL/9-79--------------------------------------------------------------------------------
F2GB87_ALTMD/11-81--------------------------------------------------------------------------------
Q21U54_ALBFT/9-79--------------------------------------------------------------------------------
C3MCA1_RHISN/7-77--------------------------------------------------------------------------------
B3PDY0_CELJU/63-133--------------------------------------------------------------------------------
C7JJ40_ACEP3/1-66--------------------------------------------------------------------------------
R9VLC6_9ENTR/11-81--------------------------------------------------------------------------------
K7SHF6_GLUOY/17-86--------------------------------------------------------------------------------
K7ABL7_9ALTE/6-76--------------------------------------------------------------------------------
E0SMR7_DICD3/9-79--------------------------------------------------------------------------------
C4LCG0_TOLAT/11-81--------------------------------------------------------------------------------
D5QE46_KOMHA/17-86--------------------------------------------------------------------------------
K0C8E2_ALCDB/11-81--------------------------------------------------------------------------------
M4XDA7_PSEDE/11-81--------------------------------------------------------------------------------
H2IXW0_RAHAC/27-92--------------------------------------------------------------------------------
Q2RNE8_RHORT/14-84--------------------------------------------------------------------------------
Q7MZJ1_PHOLL/2-72--------------------------------------------------------------------------------
G7Z9X1_AZOL4/11-74--------------------------------------------------------------------------------
V6F3K3_9PROT/6-76--------------------------------------------------------------------------------
I2B9K4_SHIBC/6-76--------------------------------------------------------------------------------
B2VJI7_ERWT9/12-75--------------------------------------------------------------------------------
D3VAK1_XENNA/23-87--------------------------------------------------------------------------------
E6X2R7_NITSE/11-81--------------------------------------------------------------------------------
Q6D8L1_PECAS/2-72--------------------------------------------------------------------------------
G0A2L0_METMM/9-79--------------------------------------------------------------------------------
D6Z0A2_DESAT/12-82--------------------------------------------------------------------------------

PF10723

Q93GS8_SALTY/8-88--------------------------------------------------------------------------------
Q326V9_SHIDS/1-86--------------------------------------------------------------------------------
Q326M6_SHIDS/1-79--------------------------------------------------------------------------------

PF04221

DINJ_ECOLI/4-84--------------------------------------------------------------------------------
Q9KML3_VIBCH/3-84--------------------------------------------------------------------------------
Q9PBQ9_XYLFA/4-84--------------------------------------------------------------------------------
RELB_HAEIN/5-93--------------------------------------------------------------------------------
RELB_ECOLI/1-78--------------------------------------------------------------------------------
Q9A0Y8_STRP1/13-96--------------------------------------------------------------------------------

PF03693

PARD_XYLFA/1-78--------------------------------------------------------------------------------
PARD1_CAUCR/2-82--------------------------------------------------------------------------------
PARD_VIBCH/1-80--------------------------------------------------------------------------------
PARD1_MYCTU/1-80--------------------------------------------------------------------------------

PF14384

A1AQ37_PELPD/17-82----------------------------------------DAPELTDA.WFEKADLMQGSKLV.................
Q73R28_TREDE/11-81----------------------------------------SDAPKRVAESISLSERIDDFL...................
B0JRR8_MICAN/35-94----------------------------------------DLIPEATGDW.SRAQRGV......................
Q92KN5_RHIME/26-103----------------------------------------DFPELTDE.ELTNMRPARDVLPPEFFKAM...........
Q3J2R4_RHOS4/23-97----------------------------------------DAPEATDA.QLAQARPFTEAFPVLAEA.............
B8F509_HAEPS/13-99----------------------------------------EVRELQAD.DLHQFKPIKDVLPLDFVNLVTTH.......Q
A5GE33_GEOUR/45-107----------------------------------------DNPPLTDE.ELTAARIVR..HG..................
A1WJ32_VEREI/17-83----------------------------------------DAPELGDE.FFERADEYPGDKLV.................
A6WWJ1_OCHA4/29-103----------------------------------------DAPEATDE.QLAKAKPFKEALPEMAAK.............
Q2RSU6_RHORT/41-96----------------------------------------DAAPLADEAWFAQAAIVEP.....................
E3I091_RHOVT/23-97----------------------------------------GNPEWTNE.DFANAKPFAEAFPALAEK.............
Q215B0_RHOPB/13-90----------------------------------------DNPEWTKA.DFARATRFDGIKAKDLTPEM...........
C4K882_HAMD5/42-98----------------------------------------DIPETCEKDW.VGASRGQ......................
Q20YH7_RHOPB/27-93----------------------------------------EIPELTEE.FFARADLYHGGKLV.................
D3SAY2_THISK/33-91----------------------------------------ETREPSED.ETKALRR....V...................
C4KAB9_THASP/30-98----------------------------------------DGSDEDDR.PAAAVELAAGIDAAR................
Q28LR0_JANSC/24-89----------------------------------------KRLEWDLQNHLMDARRIPEAWHEI................
D5X2J5_THIK1/28-104----------------------------------------DNPEWTAE.DFARAKPASEALPPEMYAA............
A8HS57_AZOC5/58-131----------------------------------------DERPRTET.ELALARPFAEALPELVE..............
B1M0P6_METRJ/36-100----------------------------------------EIPELTDA.MLARADFYV..GD..................
A9BQV6_DELAS/27-103----------------------------------------AVPGLRQALQEAKTGQFAAVHTPEQI..............
D5CSA1_SIDLE/6-67----------------------------------------DFTGAKRAKDVAHL..........................
C1DP04_AZOVD/25-95----------------------------------------DADDLYDPNDPTAVDAFWDAATVRR...............
A1WLU7_VEREI/13-87----------------------------------------EVRELTAA.DLRRFKPAHLALPPALQK.............
Q73LQ6_TREDE/25-85----------------------------------------DSPKLTKEQI.ARLRPVHE.....................
A5V5L4_SPHWW/13-90----------------------------------------DNPEWTEQ.DFARARRGDDIPEHIRAAFP...........
A6WZ44_OCHA4/29-94----------------------------------------DAPELTDE.QATQRMTFAEAVRR.................
B0T4V2_CAUSK/34-92----------------------------------------DIPEITDEQW.ATAFRPG......................
B6JFY4_OLICO/17-84----------------------------------------DAPELDDD.FFDRAEIREGDKIIR................
C5D0R5_VARPS/7-82----------------------------------------EMAQFEKDLLQSMGEMKRGEHA..................
Q8KUW1_SYNE7/45-104----------------------------------------DSPDATELMRAALQQK....R...................
Q0KBY4_CUPNH/27-90----------------------------------------DTYEVSAK.EMQAMKPLGK.RG..................
B6IVZ4_RHOCS/9-71----------------------------------------DAPDLSAPEWQRKFAQARR.....................
Q2KVN5_BORA1/5-79----------------------------------------DSPEWGEA.ELARAKPASEVLPTAFQA.............
Q39RZ9_GEOMG/16-77----------------------------------------DFTDAEPVSETPVL..........................
A8GIR2_SERP5/28-84----------------------------------------DAPTLSDEKW.GTALQGR......................
A9IES8_BORPD/41-97----------------------------------------DIPPLTAEFW.KTAERGK......................
A1VRX0_POLNA/13-87----------------------------------------EVRELTAE.DMRRFKPAHEVLPLELQK.............
Q31JV0_SYNE7/18-82----------------------------------------DLPELTDE.MLSRAVLKQGGKR..................
A1WB35_ACISJ/28-89----------------------------------------DARPFTDA.EWEQVKPLAR.R...................
B2ICD8_BEII9/27-96----------------------------------------DDFEPTDE.ELANARPFAEVFPH.................
Q73L16_TREDE/8-67----------------------------------------DCPPLTKEQIKEFARIAKEQR...................
C3M8F8_HAMD5/13-85----------------------------------------EVRELKEEDFALMRPAEEVLPLSLL...............
C7RRD3_ACCPU/30-92----------------------------------------DAQPLTPAQLKAMVPLRSL.....................
B6IW20_RHOCS/40-99----------------------------------------EMPEVHD..W.SRARRGPP.....................
A8LQR3_DINSH/3-99----------------------------------------DLPPHPLWSDAKGETRAQRLARERLTLHLHGLERDDAWAG
C4KAB3_THASP/28-89----------------------------------------DAIPYTDA.EWEAAKPTIR.C...................
A3N0B8_ACTP2/11-88----------------------------------------ENPEWTDEDF.KNALTFEQMPPALQAL.............
D4ZU97_ARTPN/29-87----------------------------------------DCPEITPEMV.TKAVVR.......................
K9XMQ0_9CHRO/29-86----------------------------------------DCPEITPEMF.AKAVVRRG.....................
Q2L2E1_BORA1/28-86----------------------------------------DTYELSAADLKQMKRMGR......................
Q63NA3_BURPS/28-88----------------------------------------.TFEVPAEDFAKMTRRGKR.....................
Q6N573_RHOPA/22-88----------------------------------------DAPELLDE.FFRTGEIRVDGKI..................
Q7CI23_YERPE/12-90----------------------------------------DNPEWGEAEF.ARARPATEVFTELFGKE............
Q7CP71_SALTY/37-93----------------------------------------DIPASEDGQW.SEAVRGK......................
Q9PD17_XYLFA/28-105----------------------------------------DARELDSQ.WHKGAKLACEAFSPEIYT.............
V6F518_9PROT/28-104----------------------------------------DSPELTDANF.ANARPASEVLANYLGAT............

PF16777

I9TP66_HELPX/21-81--------------------------------------------------------------------------------
I9SLK1_HELPX/21-81--------------------------------------------------------------------------------
M3NJJ4_HELPX/21-81--------------------------------------------------------------------------------
J0RAY0_HELPX/2-62--------------------------------------------------------------------------------

PF07764

T0VBY9_9ENTE/1-69--------------------------------------------------------------------------------
I3U5Z1_ENTFC/1-71--------------------------------------------------------------------------------

PF11903

Q4KC28_PSEF5/1-66--------------------------------------------------------------------------------
B4SF37_PELPB/2-74--------------------------------------------------------------------------------
A0QXV1_MYCS2/6-107--------------------------------------------------------------------------------
A9BMX0_DELAS/1-73--------------------------------------------------------------------------------
A6T935_KLEP7/1-66--------------------------------------------------------------------------------
Q7NVK9_CHRVO/1-73--------------------------------------------------------------------------------
A1T476_MYCVP/6-107--------------------------------------------------------------------------------
Q3AQ94_CHLCH/4-76--------------------------------------------------------------------------------
Q1GXH1_METFK/1-73--------------------------------------------------------------------------------
Q2SQH0_HAHCH/2-95--------------------------------------------------------------------------------
Q13JR3_BURXL/1-70--------------------------------------------------------------------------------
Q15VU5_PSEA6/1-66--------------------------------------------------------------------------------
Q0RY55_RHOSR/40-141--------------------------------------------------------------------------------
Q220F4_ALBFT/1-73--------------------------------------------------------------------------------
Q47D61_DECAR/1-73--------------------------------------------------------------------------------
Q0C2J2_HYPNA/1-68--------------------------------------------------------------------------------
A7HVP7_PARL1/11-109--------------------------------------------------------------------------------
A4Y172_PSEMY/1-70--------------------------------------------------------------------------------
D0J2S6_COMT2/1-68--------------------------------------------------------------------------------
Q63SV8_BURPS/1-72--------------------------------------------------------------------------------

PF11020

F4F896_VERMA/2-77--------------------------------------------------------------------------------
Q73H58_WOLPM/5-85--------------------------------------------------------------------------------
B3S7R4_TRIAD/8-90--------------------------------------------------------------------------------
Q2GKE5_ANAPZ/4-84--------------------------------------------------------------------------------
C4YV51_9RICK/4-84--------------------------------------------------------------------------------
B9KIB3_ANAMF/4-84--------------------------------------------------------------------------------
F7XUD1_MIDMI/1-81--------------------------------------------------------------------------------
Q2GCJ4_NEOSM/1-81--------------------------------------------------------------------------------
K9QB18_9NOSO/702-781--------------------------------------------------------------------------------
A5CC80_ORITB/1-81--------------------------------------------------------------------------------
Q2GG71_EHRCR/4-84--------------------------------------------------------------------------------

PF15970

B4EVM4_PROMH/3-83--------------------------------------------------------------------------------
Q0WCU1_YERPE/3-83--------------------------------------------------------------------------------

PF01340

METJ_VIBVY/3-99--------------------------------------------------------------------------------
Q15NT2_PSEA6/6-102--------------------------------------------------------------------------------
K7AFK6_9ALTE/6-102--------------------------------------------------------------------------------
Q489Q2_COLP3/3-99--------------------------------------------------------------------------------
METJ_SALTY/3-99--------------------------------------------------------------------------------
Q5QV41_IDILO/2-95--------------------------------------------------------------------------------

PF10715

REGB_BPT4/2-151-----------------------------------------------------------TINTEVFIRRNKLRRHFESEF

PF08681

Q8E866_SHEON/19-95--------------------------------------------------------------------------------
Q7N880_PHOLL/12-90--------------------------------------------------------------------------------
Q7N7Z2_PHOLL/8-88--------------------------------------------------------------------------------
Q92P91_RHIME/11-90--------------------------------------------------------------------------------
B3EP86_CHLPB/11-90--------------------------------------------------------------------------------
Q7NIQ1_GLOVI/13-92--------------------------------------------------------------------------------
Q7NLC6_GLOVI/11-90--------------------------------------------------------------------------------
B4SB08_PELPB/10-88--------------------------------------------------------------------------------
Q5P620_AROAE/9-88--------------------------------------------------------------------------------
Q2SAN8_HAHCH/11-89--------------------------------------------------------------------------------
C1DE12_AZOVD/13-92--------------------------------------------------------------------------------
Q8ZL97_SALTY/13-91--------------------------------------------------------------------------------
Q8XPL2_RALSO/16-98--------------------------------------------------------------------------------
Q6LIX8_PHOPR/32-112--------------------------------------------------------------------------------
Y420_HAEIN/9-88--------------------------------------------------------------------------------
Q5P632_AROAE/5-83--------------------------------------------------------------------------------
Q5NX70_AROAE/9-88--------------------------------------------------------------------------------
Q7N6D8_PHOLL/7-86--------------------------------------------------------------------------------
Q7N0J5_PHOLL/11-90--------------------------------------------------------------------------------
Q6ZEG7_SYNY3/12-91--------------------------------------------------------------------------------
Q87ZN7_PSESM/15-103--------------------------------------------------------------------------------
Q3SNN6_NITWN/19-98--------------------------------------------------------------------------------
Q9KM95_VIBCH/57-136--------------------------------------------------------------------------------
Y4AR_RHISN/23-102--------------------------------------------------------------------------------
O05910_MYCTU/74-152--------------------------------------------------------------------------------
Q7N3R4_PHOLL/22-101--------------------------------------------------------------------------------
I6XFC2_MYCTU/72-148--------------------------------------------------------------------------------
Q8P668_XANCP/14-88--------------------------------------------------------------------------------
Q8ZKC7_SALTY/14-88--------------------------------------------------------------------------------
Q8ZMH5_SALTY/14-91--------------------------------------------------------------------------------
Q9PHI1_XYLFA/6-80--------------------------------------------------------------------------------

PF05534

Q7N3F9_PHOLL/54-104--------------------------------------------------------------------------------
Q88MT9_PSEPK/54-104--------------------------------------------------------------------------------
Q6A7R8_PROAC/60-110--------------------------------------------------------------------------------
Q73YB6_MYCPA/53-103--------------------------------------------------------------------------------
Q7N8L4_PHOLL/59-111--------------------------------------------------------------------------------
Q92KT7_RHIME/1-48--------------------------------------------------------------------------------
Q6MB72_PARUW/52-102--------------------------------------------------------------------------------
Q7VMR2_HAEDU/57-107--------------------------------------------------------------------------------
Q7MY97_PHOLL/58-110--------------------------------------------------------------------------------
Q88G27_PSEPK/52-102--------------------------------------------------------------------------------
Q73J27_TREDE/55-105--------------------------------------------------------------------------------
Q8YLM2_NOSS1/53-103--------------------------------------------------------------------------------
Q73KK4_TREDE/52-102--------------------------------------------------------------------------------
Q92XZ7_RHIME/54-104--------------------------------------------------------------------------------
Q73QG2_TREDE/62-112--------------------------------------------------------------------------------
Q6G4L9_BARHE/55-105--------------------------------------------------------------------------------
Q9RZI7_DEIRA/54-104--------------------------------------------------------------------------------
Q8XYR1_RALSO/55-105--------------------------------------------------------------------------------
A1RCN0_ARTAT/63-111--------------------------------------------------------------------------------
Q9PCT7_XYLFA/64-114--------------------------------------------------------------------------------

PF09386

Q7N4K2_PHOLL/1-79--------------------------------------------------------------------------------

PF12651

A6LT47_CLOB8/12-55--------------------NR-EP--FS----------------------------TTVNLNY-----NNLLSE--L-S
Q1D537_MYXXD/6-49--------------------RL-TS--VV----------------------------FRLNREK-----LDALKD--L-S
Q08NJ8_STIAD/30-73--------------------EV-VS--TH----------------------------VLVAEEQ-----VQKLRE--L-S
Q04FI1_OENOB/1-44--------------------MK-QE--TT----------------------------FTLEDNL-----VQKLNT--I-S
A5N8S1_CLOK5/8-51--------------------NR-TR--IY----------------------------NAVDTIL-----YTKLMQ--L-S
A7HBK6_ANADF/4-47--------------------KK-LS--TT----------------------------VYITPEQ-----DERLKL--L-H
Q9YEP4_AERPE/2-45--------------------AK-RR--FG----------------------------VSIPEDL-----AQRLDE--A-S
A2BMU8_HYPBU/1-44--------------------MK-RR--FG----------------------------ISINESI-----AKMLEV--L-S
B2TQ69_CLOBB/8-51--------------------TR-ER--YS----------------------------ASFDKEL-----LASLKD--L-S
C3AQ62_BACMY/106-149--------------------EK-KK--RT----------------------------FSICTEI-----LEKLDA--V-S
Q17ZT4_PEPD6/4-47--------------------NR-VR--FS----------------------------SSTKPDL-----FEKLKQ--L-S
A9GWZ6_SORC5/4-47--------------------KK-VS--TT----------------------------IYITPEQ-----AERLKI--L-H
E3FMN1_STIAD/4-47--------------------KK-IS--TT----------------------------IYITPEQ-----YELLKA--L-N
Q2II40_ANADE/24-64--------------------..-EP--ML----------------------------VRLPPAL-----AAELRN--L-A
Q8XP25_CLOPE/8-50--------------------NR-TP--VG----------------------------SAMDNKI-----YYEMKA--Y-S

PF01402

Q9YBV4_AERPE/3-42------------------------L--VT----------------------------VKMPEMY-----VKGIDE--L-V
Q8ZX60_PYRAE/47-86------------------------L--IS----------------------------VHVPKKM-----LEELDE--L-V
P72681_SYNY3/21-59------------------------Q--TT----------------------------IRLESKM-----MERLTK--L-C
Q8ZWZ9_PYRAE/10-49------------------------L--IS----------------------------FHVPRSY-----VEVLDE--L-V
NIKR_CHLTE/6-45------------------------R--FG----------------------------ISLERKL-----IESFDR--H-I
Q877Q4_PSESM/12-50------------------------R--IE----------------------------IRCTEED-----AALIRE--K-A
Y4KO_RHISN/4-42------------------------A--FT----------------------------VRVKDET-----ASKLDQ--L-A
VPB19_MYCTU/2-40------------------------R--TQ----------------------------VTLGKEE-----LELLDR--A-A
O28529_ARCFU/6-44------------------------R--VT----------------------------IALDDES-----VKIFEE--L-K
Y080_METJA/3-41------------------------R--IS----------------------------LTIEKNL-----LKEVDE--I-I
PARD2_CAUCR/12-50------------------------S--LS----------------------------IELDSDL-----DRRLSE--I-A
O30230_ARCFU/6-44------------------------R--IT----------------------------ISLSEDD-----MKLIEE--L-R
O29882_ARCFU/4-42------------------------R--LS----------------------------VSLDDKS-----KEKLEK--M-R
NIKR1_METTH/3-42------------------------V--VS----------------------------VSLGEKL-----LEEIDA--L-R
Q9I707_PSEAE/4-42------------------------V--VS----------------------------FRADDAL-----VAALDE--L-A
E51_SSV1/12-50------------------------R--LN----------------------------ISISEET-----YETLQR--L-K
Q88JZ4_PSEPK/2-40------------------------A--TS----------------------------IKIDDDL-----KGRIQH--L-A
Q888D4_PSESM/12-50------------------------N--LK----------------------------LRCLPEE-----ADQIKE--K-A
O30109_ARCFU/6-44------------------------R--LS----------------------------VAVDDSI-----VEILEK--L-T
NIKR_HELPY/12-51------------------------R--FS----------------------------VSLQQNL-----LDELDN--R-I
Q8EGZ2_SHEON/6-44------------------------P--VS----------------------------VKLDADI-----KARVEH--L-A
G7YYF2_CLOSI/3-42------------------------R--VT----------------------------ITLDDDL-----LETLDS--L-S
YBFE_ECOLI/52-88------------------------R--VE----------------------------LKLNAEA-----VEALNE--L-A
YIIE_ECOLI/4-41------------------------.--VF----------------------------LHLSEEA-----IKRLNK--L-R
Y298_MYCTU/6-41------------------------.--IS----------------------------VTVDAAV-----LAAIDA--D-A
VPB20_MYCTU/11-49------------------------R--LQ----------------------------IYIDEDV-----DRALAV--E-A
VPB10_MYCTU/3-39------------------------R--TN----------------------------IYLDEEQ-----TASLDK--L-A
Q327A8_SHIDS/14-51------------------------.--IT----------------------------AHVPLPM-----ADKVDQ--M-A
Q3IQM5_NATPD/4-41------------------------R--VT----------------------------VSLDDDT-----AAALEQ--L-D
Q8U3E4_PYRFU/7-45------------------------.--IS----------------------------VQLPQSL-----IHGLDA--L-V
S6AY38_PSERE/10-47------------------------.--VT----------------------------AHVPVQL-----AEKVDL--M-A
V5UCU1_9BURK/15-51------------------------.--.P----------------------------IRCYEDE-----EALVRE--R-A

PF07878

Q1QQP0_NITHX/90-130---------------------S-VR--IN----------------------------VTLPADV-----LEQIDR--H-A
Q7U858_SYNPX/33-75---------------------S-ER--IN----------------------------VTLPRGV-----MDELKR--H-A
A5GQX8_SYNR3/18-60---------------------S-PR--IQ----------------------------VVLPEAL-----LERLAV--A-A
E8SHU9_STAPH/6-48---------------------N-TR--IS----------------------------VTVSKDN-----RDKLKE--L-A
A5GKY5_SYNPW/33-75---------------------S-ER--VN----------------------------VTLPAGV-----MNRLKQ--Q-A
F4BUC1_METCG/7-49---------------------S-KR--VA----------------------------VTLPDDA-----REFLEQ--E-A
B7JWD3_CYAP8/2-44---------------------S-KR--VY----------------------------LTLPDKV-----YEALER--W-A
A8ZLB3_ACAM1/15-57---------------------M-TR--IN----------------------------ITVPEDL-----LEEFKE--Y-C
D7E5Q5_NOSA0/6-48---------------------G-KR--VN----------------------------VTFPVEV-----YERVAG--L-A
Q46HT9_PROMT/14-56---------------------S-PR--IQ----------------------------VVLPEDL-----CERLSE--L-A
B1X2B8_CYAA5/9-51---------------------G-KR--IS----------------------------ITLSDEI-----LEDLEI--W-A
Q7VEB2_PROMA/14-56---------------------S-PR--VQ----------------------------VVLPEEL-----CAQLTF--L-A
Q7NMR8_GLOVI/20-62---------------------L-DR--VV----------------------------AYVPTEL-----KKELEQ--W-A
E0UNJ6_CYAP2/6-48---------------------S-KR--LN----------------------------LSLPEHL-----YDDLRI--W-A
Q8YK09_NOSS1/15-57---------------------T-KR--TT----------------------------IVLPDAV-----YEDLQL--W-A
K9VLV1_9CYAN/8-49---------------------.-GR--VT----------------------------AYLPEEI-----QKALEE--W-A
K9VLX7_9CYAN/14-56---------------------S-PR--VA----------------------------FYPPPEI-----KEKLEK--L-A
Q7V237_PROMP/82-124---------------------S-NK--VQ----------------------------ISVPSNL-----NYLLKV--W-A

PF15919

F8GGR0_NITSI/3-126YKG..WVWAVVTIDLAELSDKV-ER--IN----------------------------ITLPSRV-----LRRIDA--A-A
F2JW02_MARM1/3-127FAD..GIWAVASVDITPLLGKS-EK--IN----------------------------VTLPHLL-----ISKIDK--A-V
E1VAV2_HALED/3-129YKG..WVWATVEVDITPYLGKS-HK--IN----------------------------VTLPELL-----IKRIDT--A-V
B8GTR2_THISH/3-126YKD..WIRAMVDIDMSRIQGPA-QR--IN----------------------------ITIPKRV-----LRAIDA--A-A
F2KE11_PSEBN/3-128YAG..CTWALVDIDVTKYLGKA-QK--LN----------------------------ITLPGYL-----LNRIDE--Y-V
F4HBU2_GALAU/3-128FEG..FTFTFVDVDLSHLMGKA-EK--IN----------------------------ITLPALL-----LHKIDA--F-I
F7QNQ0_9BRAD/4-124NRD..GVAVLIAAP..PVSVKS-VR--VN----------------------------VTLPSDV-----LEQIDQ--Y-A
D8MUK4_ERWBE/3-128YAG..YTWALVDVDLARLLGGT-EK--IN----------------------------VTLPKSL-----IDRIDR--C-V
G8M697_9BURK/3-126FAG..AIWAYVEVDLSKLDARP-ER--IN----------------------------ISLPRFV-----LHKIDS--Y-V
Q1QQP0_NITHX/4-124NRD..GVAVLVAAPAP..AVKS-VR--IN----------------------------VTLPADV-----LEQIDR--H-A
D5BWS5_NITHN/3-123FEG..GVWMMVDIDFSRVRPKA-VR--IN----------------------------ISLPEAL-----VRRIDE--Y-A
Q98J17_RHILO/4-124NRD..GVAILVAAKTE..ARKA-VR--IN----------------------------VTLPDDV-----LRRIDA--F-A
E6WDB3_PANSA/3-127CQN..GIWAYVDIDVSKYDGKA-VK--LN----------------------------ITLPQNL-----LVRIDT--F-V
A1VQL9_POLNA/3-127FDG..WLWALVKVDPAMLDDTV-ER--VN----------------------------ISLPRRV-----LRRLDA--R-A
Q63NA5_BURPS/3-126YAG..AVWALVSVDLSQLDSKP-ER--IN----------------------------VSIPRFV-----LHKIDA--Y-V
B4ET85_PROMH/3-129YNN..GIWLLVDVDMDKYDGRA-ER--IN----------------------------ITLPHRL-----LSRIDT--I-V
D5CBF0_ENTCC/3-129FIG..GQWLLVDINMKQFDGKA-ER--IN----------------------------ITLPRRL-----LVKIDS--F-V
A5GAH3_GEOUR/3-123YQG..GVWLLVDIDLSKLKVKA-KR--VN----------------------------ITMSENL-----LHEIDR--Y-A
Q1LPG4_RALME/14-137YAD..AIWALADIDMSKLDARP-ER--IN----------------------------ISLPRFV-----LHKIDM--F-V
A8GFZ4_SERP5/3-129LNG..GQWLLVDINMDKFDGRA-ER--IN----------------------------ITLPHRL-----LNRIDS--M-V
Q7N448_PHOLL/3-129YAG..WAWAVIDIDVEPYLGKS-TK--FN----------------------------VTLPDLL-----SKKIDD--Q-V
Q5HXI2_GLUOX/3-126YQG..WTVGIVTIDPAILDDRV-ER--AN----------------------------ISLPRRV-----LERLDA--L-A
F4GPE1_PUSST/3-127YDG..WIWAIAEVDPALIDDTT-ER--VN----------------------------ITLPRRI-----LALLDQ--R-A
B8DM26_DESVM/3-123ARD..GAVLLADIDLSFLDTTS-VP--VN----------------------------ITMPVHI-----RNTIDR--A-A
A9H9S0_GLUDA/10-135WSGPEWIWGFASVDPTLFDDTS-ER--VN----------------------------ITLPRRV-----LARLDS--R-A
F9ZMS1_ACICS/3-126FSG..WIWAVVPVDLAKLSDRV-ER--VN----------------------------ITLPARV-----LRRIDA--A-A
YO14_BPHC1/3-126YKD..FIVTVVDVDLTHLMGKA-EK--IN----------------------------ITVPALL-----LHRIDQ--F-I
Q5F6D2_NEIG1/4-126YHG..ATWVMIEIDPAKISRQQ-IR--FN----------------------------VSWPQYL-----LDRVDE--Y-T
Q7VZH1_BORPE/3-127FAN..WIWAIADVDPAVLDETV-ER--VN----------------------------ITIPRRI-----LKRLDD--R-A
Q9A3L8_CAUCR/4-124NRD..GVVILVPLK..TVQPRT-VR--VN----------------------------ITLPETT-----LREIDA--F-A
W8KT83_HALHR/3-127FAG..WGWGLVEIDITPYLGKT-EK--IN----------------------------VTLPGRV-----VKQIDQ--Y-V

PF12441

Q30QH6_SULDN/2-80TDFFDVKSAKVVRF.SKLKKST-KT--IS----------------------------LRLPEDM-----LETIKV--R-A
B0JXE6_MICAN/7-82GEF..ESELPEVNFDVDLKKKH-YL--V.----------------------------.AIDADL-----MVKLLE--V-A
B4SES2_PELPB/3-79SEY.DFSGMVPMRF..ELKRKD-TS--IS----------------------------LRLPEEL-----LNEVRM--N-A
A6QAG9_SULNB/5-83SEFIDWENVRSVRF.PNLKKST-RS--IS----------------------------LRLPEDM-----LERLKS--R-A
C1F1N0_ACIC5/3-81TEFVDWSKAEHKKL.PNLKPTL-RT--IS----------------------------VRLPVAM-----VEDLKI--L-A
B4SF55_PELPB/6-84TEFVDWNKAGKALF.PNLKPTM-KT--IS----------------------------LRLPEPM-----LNHLKI--L-A
A4SVJ8_POLSQ/6-84SEYFDLSKAVRVTM.PNLKPTT-AS--IS----------------------------LRLSQSF-----LENIKL--Q-A
A1BIF8_CHLPD/6-84SEYIDWEKAGTAIF.PDLKPTM-KT--IS----------------------------LRLPEQM-----LNRIKV--L-A
B1WWY8_CYAA5/9-85TDY..LDDFETVQLEAELQQRH-FE--V.----------------------------.EIDEDI-----MEVLSQ--Q-A
B8GRA9_THISH/6-84SEYLDLSQAVPTSL.PNLKPST-KT--IS----------------------------LRLPVSL-----LERIKI--E-A
P72819_SYNY3/56-132TDYLVPENFTKTTF..EFAPKD-KS--IT----------------------------LRLSSEL-----LTAVKN--T-A
A5GA05_GEOUR/6-84TEYVDWSQAKRVTL.PNLKPTT-QS--IS----------------------------LRLPVSL-----LESIKS--A-A
C7LN80_DESBD/6-82SQY.DLSGFKPMQF..EIEPKA-AA--LN----------------------------MRIPVGL-----LEAVKA--K-A
Q01SA6_SOLUE/7-85TEYIDWPTGRQVKF.PNLKPAL-RT--IS----------------------------LRLPVYM-----LEDLKI--L-A
C3KQS7_RHISN/6-84SDYVDWSKAASVRL.PNLRPSS-TS--IS----------------------------LRLPNTL-----LERIKV--A-A
Q9AAV5_CAUCR/3-77SDL.NFSQFKPMRF..ELEKKE-AR--VN----------------------------MRLPEPL-----LEAVKK--R-A

PF13467

I3THE1_TISMK/5-68------------LINRNVVVEG.RR--TS----------------------------IRLEADM-----WDALTE--I-C
A1B158_PARDP/15-82------------SRTHSLRIDG.VA--TS----------------------------IRIENHF-----WDTLAE--I-G
Q2W502_MAGSA/68-131------------LICRNIRVKG.KR--TS----------------------------VKLENEF-----WNALEI--M-A
U4KIB5_9VIBR/16-83------------.ISRSVRLGG.HS--TS----------------------------VRLEAKF-----WTIIDD--I-A
D7A937_STAND/16-83------------.RLKSVRLNG.FS--TS----------------------------VRLENLY-----WQVLDE--I-A
Q47K48_DECAR/15-83------------SRARSIRIHG.FV--TK----------------------------IRLENLF-----WDILAE--L-A
B8EK53_METSB/15-83------------CQTRSVRLGG.HV--TS----------------------------IRLEALF-----WQVLEK--L-A
V6F6E9_9PROT/28-96------------SVARSVRIGG.VV--TS----------------------------IKVERHF-----WQILED--I-A
I3TNF1_TISMK/9-73------------VEKRSVSIQG.HR--TS----------------------------VSLEAPF-----WRVLKR--A-A
S6AZN1_PSERE/15-83------------SRSRSLRIRG.VV--TT----------------------------LRLENQF-----WDILRE--I-A
B4RFD6_PHEZH/4-67------------LKKRSVLLSG.HA--TS----------------------------IALEPEF-----WAVLDE--M-A
A4Z0Q4_BRASO/15-82------------SQTRSLRIGG.HS--TS----------------------------IRLELAF-----WDTLEE--I-A
Q8EH51_SHEON/15-83------------LKTRSIRIDG.VV--TS----------------------------VRLEAIF-----WQIIEE--I-A
Q1QJT3_NITHX/17-80------------VVKRSVIVGG.HK--TS----------------------------VSLEDAF-----WTSLKD--I-A
U4K818_9VIBR/15-83------------LKTRSIRIDG.VV--TS----------------------------IRLEAIF-----WQIIED--I-A
R5XT33_9PROT/6-68------------..NRVISIYN.RK--TS----------------------------MRLAPAE-----WEAIDT--I-C
D7A5S3_STAND/15-83------------SQTRSVRIGG.HS--TS----------------------------IRLEAAF-----WTVLEE--V-A
A5FXC9_ACICJ/3-65------------LEKRSLSLSG.HR--TS----------------------------VALEPEF-----WTALEA--A-A
D4ZC71_SHEVD/15-83------------PIQKSIRIQG.HV--TS----------------------------ISLEKLF-----WDLLDQ--I-A
K7SD13_GLUOY/4-66------------LIKRSLSLSG.HR--TS----------------------------VALEPEF-----WAVLDQ--M-A
G2KLR8_MICAA/1-64------------MRKHSVKIAG.HQ--TS----------------------------ITLEDEF-----WAALQS--I-A
G8PTZ2_PSEUV/3-67------------LKKRSITLHG.HR--TS----------------------------ITLEPEF-----WSGLED--L-A
A8IAV7_AZOC5/5-68------------VVKRSIVIAG.HK--TS----------------------------VSLEDAF-----WDALKE--I-A
Q13WI7_BURXL/15-84------------SRTRSLRIHG.VI--TT----------------------------VRLENLF-----WDVLHE--I-A
B2IEK6_BEII9/15-82------------CQTRSIRLGG.HV--TS----------------------------IRLETLF-----WRILEE--I-A
R5YAT6_9PROT/7-67------------...KVIFIDK.RK--TS----------------------------MRLANAE-----WEAIDS--I-C
F2J384_POLGS/15-81------------PETRRLRLNG.QS--TS----------------------------IRLERSF-----WDILDE--I-A
U5T3K9_9GAMM/16-83------------.STRSVRLSG.FV--TS----------------------------IRLENEF-----WSILES--L-S
Q2K3V5_RHIEC/15-83------------STTRSLRIDG.MV--TS----------------------------VRLENFF-----WSKLEE--I-A
V6F679_9PROT/38-104------------PEKRSVRIHG.HS--TT----------------------------IRLEQAF-----WTVLDE--M-A
Q7CXZ9_AGRT5/2-66------------IRKHSATLHG.HR--TS----------------------------ISLEDAF-----WDELKI--I-A
C3MEF5_RHISN/3-66------------.AKHSATLHG.HR--TS----------------------------FTLEDAF-----WQELKS--I-A
B9JH07_AGRRK/7-71------------IRKHSATLHG.HR--TS----------------------------FSLEDAF-----WSELKA--I-A
Q2YPT7_BRUA2/7-71------------LRKHSVSIRG.HA--TS----------------------------YTLEDPF-----FKIIEE--I-A
Q0A5P7_ALKEH/48-113------------.GRRSLRIDG.HC--TT----------------------------IRLEQAF-----WSVLEE--I-S
A5VF72_SPHWW/4-70------------PVKRSVNIAG.HA--TS----------------------------ITLEPPF-----WDALVR--A-A
Q2N6Z0_ERYLH/8-73------------PVKRSVEIAG.HK--TS----------------------------ISLEPVF-----WNMLRA--A-A
B6INS4_RHOCS/2-64------------IKKRSVLVAG.HP--TS----------------------------VTLEEPF-----WEALKE--L-A
W8RV19_9RHOB/5-69------------PRKRSLTLKG.HR--TS----------------------------VSLEDAF-----WTEFQR--I-A
G2I0K7_GLUMN/18-81------------LRKRSLNLSG.HR--TS----------------------------VALEPEF-----WCALHL--I-A
A7HVX0_PARL1/14-77------------.IKRSVTIAG.HR--TS----------------------------ISLERPF-----WDVLKE--L-A
Q2W7L3_MAGSA/5-67------------PVKRSVKIAG.HA--TS----------------------------VTLEAEF-----WDCLRE--L-A
A8LPV2_DINSH/15-83------------CTTRRLRLNG.QS--TS----------------------------IRLENSF-----WAILDE--M-A
Q167Q5_ROSDO/15-83------------CTTRRLRLNG.QS--TS----------------------------IRLENAF-----WEVIDE--I-A
Q15TD7_PSEA6/15-83------------SRTKSLRIEG.VV--TS----------------------------IRLENFF-----WDVLAE--I-A
E3I0W1_RHOVT/38-99------------PKKRSLAIAG.HR--TS----------------------------ITLEDAF-----WRELKA--T-A
Q167I6_ROSDO/5-69------------PVKHSVTLKG.HR--TS----------------------------ISLEDEF-----WQELRR--I-S
A6X0F5_OCHA4/15-83------------SVTRSLRIDG.VV--TS----------------------------VRLENFF-----WWALED--I-A
C5AUK2_METEA/10-72------------.AKRSVMIAG.HR--TS----------------------------VSLEAEF-----WTALQE--I-A
R6I0Y9_9PROT/4-68------------LLKRIIIINQ.RR--TS----------------------------MRLCQEE-----WNALDD--I-C
B8IRU4_METNO/15-83------------CETRSLRIGG.HS--TS----------------------------LRLETAF-----WMILED--I-A
B8ELI0_METSB/17-78------------.VKHSLTIAG.HR--TS----------------------------ISLERAF-----WERLKR--I-A
G8ARW4_AZOBR/20-92------------LVARTVKLFG.HP--TQ----------------------------LRLEPSY-----WEALDD--I-C
G7ZBW3_AZOL4/15-83------------ARSRSVRIHG.MV--TS----------------------------IRLENLF-----WNVLAD--I-A
D4YZT3_SPHJU/21-85------------PVKRSVTIAG.HQ--TA----------------------------ISLEPIF-----WQALRA--A-A
I0HQZ1_RUBGI/15-82------------SRTRSVRLHG.VV--TS----------------------------VRLENLH-----WAVLEE--I-A
A9HZ31_BORPD/15-82------------SDTRSLRLHG.VA--TS----------------------------VRLERLF-----WSVLEE--I-A
B0T0E7_CAUSK/20-82------------LKKRSINLAG.HA--TS----------------------------LALEPEF-----WAVLQA--A-A
B6IVX3_RHOCS/20-83------------.IIRNVTVLG.QR--TS----------------------------VRLEPEM-----WDALLD--V-C
H5WRL6_9BURK/15-83------------QRSRTIRIHG.VL--TS----------------------------IRLENMV-----WDTLAE--M-A
R6I5L9_9PROT/2-65------------.LKKSVVIANRHS--TS----------------------------ISLEPEF-----MEELEA--I-A
Q88NJ6_PSEPK/37-105------------PVSRSVRLNG.FS--TC----------------------------LRLEAVY-----WGILER--I-A
Q7VY20_BORPE/16-82------------.QARSLRLHG.VA--TS----------------------------VRLEQLF-----WDVLEE--I-A
Q0KEM8_CUPNH/15-86------------SQSRSLRLHG.VA--TS----------------------------IRLESLF-----WEVLEE--L-A
Q3J4J5_RHOS4/5-69------------PEKHSLTLKG.HR--TS----------------------------VSLEADF-----WRAFRE--I-A
B6JB62_OLICO/35-98------------VIKRSVVVDG.HK--TS----------------------------VSLEDAF-----WASLKD--I-A
E4PET2_MARAH/15-83------------SRTHSLRIDG.MV--TS----------------------------VRMENAF-----WQVLAE--L-A
G4RFD5_PELHB/1-64------------MRKRSLTIAG.HR--TS----------------------------IALEPPF-----WEALQS--I-A
Q5LS66_RUEPO/5-69------------PVKRSLTLRG.HR--TS----------------------------VSLEDAF-----WRAFRE--I-A
R5XSE7_9PROT/2-65------------.RKFSVIIAGRHA--TS----------------------------ISLEDEF-----YAALCA--L-A
A9HBJ7_GLUDA/7-71------------LVKRSLVLSG.HR--TS----------------------------VALEPEF-----WSALEE--M-A
B2U9M5_RALPJ/15-83------------SRTRSVRIHG.VH--TS----------------------------IRLENFV-----WDTLAI--L-A
C6BV10_DESAD/15-83------------QITRSIRING.AV--TS----------------------------IRIERRF-----WNILDE--L-A
A1WLD9_VEREI/15-83------------QRTRSVRLHG.VL--TS----------------------------IRLENMV-----WDILAE--I-A
V5SG48_9RHIZ/7-70------------PVKRSFSIRG.HR--TS----------------------------ISLEAPF-----WDALKQ--A-A
D5BP55_PUNMI/2-63------------.KKRSVTIHG.HR--TS----------------------------ISLEDPF-----WDSLNE--I-A
D0IW80_COMT2/15-83------------HRARSIRLHG.VA--TS----------------------------IRLENLF-----WQVLEE--I-A
V6EZW9_9PROT/2-64------------LKKHSIIIAG.HA--SS----------------------------ITMEPAF-----WDELKK--I-S
B1M524_METRJ/6-68------------.TKRSVMIAG.HR--TS----------------------------VSLEDPF-----WAALRA--I-A
G7Z694_AZOL4/2-65------------.QMRNIRVNG.KR--TS----------------------------MKLMPVE-----WESLEE--I-C
Q6G2S1_BARHE/14-77------------LQKISVRIEG.HA--TS----------------------------VSLEQPF-----LDILKT--I-A
E8RRH3_ASTEC/4-67------------LRKRSVNLAG.HA--TS----------------------------VALEPEF-----WVVLET--M-A
A1VU33_POLNA/15-83------------SRIRSVRLHG.VA--TS----------------------------IRLENLF-----WDVLGD--I-A
Q11GU9_CHESB/4-68------------PKKRSVTIRG.HR--TS----------------------------FSLEDAF-----YSELER--I-A
D9QJB1_BRESC/2-64------------LKKRSVTLAG.HA--TS----------------------------VALEPEF-----WAVLDG--I-A
A2SED0_METPP/15-83------------PRQRSVRIHG.VI--TS----------------------------IRLENLM-----WRVLSD--I-A
A1B3A7_PARDP/22-85------------PSKRSVTIGG.HR--TS----------------------------VSLEDAF-----WRELRE--L-A
Q5E5I8_VIBF1/19-85------------.ITRSIRIDG.HA--TS----------------------------VKLEASF-----WETLEE--I-A
G8B035_AZOBR/15-83------------MVTRRVRLSG.HS--TS----------------------------VCLEAAF-----WGALEE--I-A
K7SIV6_GLUOY/15-83------------SRTRSLRIHG.VV--TT----------------------------IRLENMF-----WDVLTE--I-A
Q28PQ0_JANSC/10-74------------PRKRSLTLQG.HR--TS----------------------------VSLEDAF-----WADLQT--I-A
Q87MR6_VIBPA/16-83------------.ITRSIRIDG.HA--TS----------------------------VKLESSF-----WTILEE--I-A
R5R7N0_9PROT/5-68------------.ANRIININK.RK--TS----------------------------MRLCSKE-----WEALDD--I-C
Q5NQS8_ZYMMO/14-79------------LVKRSVMIAG.HS--TS----------------------------ISLEPLF-----WQALEQ--A-A
R5Q8E2_9PROT/4-65------------.KKYSVMISG.HR--TS----------------------------ISLEPEF-----WEEIKR--L-A
Q141Z3_BURXL/65-133------------PRQRSVRING.LA--TC----------------------------LRLEEVY-----WRIIEE--I-A
R6ITS5_9PROT/4-68------------LSSRVITIHK.RK--TT----------------------------MRLCKNE-----WEALKD--I-C
G2KND8_MICAA/35-99------------LVSRNITVLG.RR--TS----------------------------VRLEPEM-----WGALRD--I-A
Q92NP9_RHIME/6-70------------VVKHSATLHG.HR--TS----------------------------FTLEEPF-----WLELKS--I-A
Q21US4_ALBFT/16-83------------.TTRSIRLHG.VV--TS----------------------------VRLENLF-----WDTLEE--I-G
W0AMC0_9SPHN/9-75------------PIKRSVTIAG.HQ--TS----------------------------ISLEPIF-----WTALRD--A-A
D5AQD4_RHOCB/5-69------------PRKHSLTLGG.HR--TS----------------------------VSLEDAF-----WTGFKE--L-A
Q2G3C7_NOVAD/8-72------------PVKRSVEIAG.HK--TS----------------------------ISLEPLF-----WDMLRD--A-A
Q2RS87_RHORT/10-72------------VRKRSVTIAG.HR--TS----------------------------VSLEEPF-----WDALKD--L-A
Q0AMZ5_MARMM/17-80------------LLKRSLSLAG.HR--TS----------------------------ISLEPDF-----WAELDR--L-A
A7IN95_XANP2/16-83------------.ETRALRLNG.FS--TS----------------------------VRLEAFF-----WNVIED--I-A
E0TDI6_PARBH/6-68------------LIKRSVTLRG.HR--TS----------------------------VALEAAF-----WAALDE--W-A
S5YGZ7_PARAH/15-83------------PVTRKLRLNG.QS--TS----------------------------IRLEQAF-----WDILDE--I-A
B6JB63_OLICO/5-68------------VVKRSIVVAG.HK--TS----------------------------VSLEEAF-----WNGMKE--I-S
A1BB74_PARDP/15-83------------PVTRKLRLNG.QS--TS----------------------------IRLEQAF-----WDILDD--I-A
Q0BVF8_GRABC/3-66------------LIKRSFSLSG.HR--TS----------------------------VALEPEF-----WTMLTN--I-A
B6IXV3_RHOCS/24-88------------LISHNVWVNG.HR--TS----------------------------VRLEAVM-----WKSLHE--I-A
G8AK62_AZOBR/2-63------------.KKRSVLIAG.HP--TS----------------------------VSLEEEF-----WEALKG--L-A
R6IQM1_9PROT/1-65------------MRKKSVVIAGRHQ--TS----------------------------ISLEDEF-----YAELAA--I-A
F2J2A0_POLGS/3-67------------LVKRSLTLKG.HR--TS----------------------------LALEPEF-----WQVLDE--T-A
W0PKG2_9BURK/15-82------------CRSRSVRIAK.VV--TS----------------------------IKLENMF-----WEVLAE--L-A
J7QMW2_METSZ/14-76------------VVKHSVVIAG.HR--TS----------------------------VSLEDAF-----WRALKD--I-A
M4S774_9SPHN/4-69------------PVKRSVMIAG.HS--TS----------------------------ISLEPPF-----WDALVA--A-A
B8IF14_METNO/8-71------------LRKRSVMIAG.HR--TS----------------------------VSLEGPF-----WEALQQ--L-A
A8HUM8_AZOC5/15-83------------SVTRSIRIGG.HI--TS----------------------------VRLENTF-----WTILEE--I-A
A8LRP0_DINSH/33-97------------PVKRSLTLRG.HR--TS----------------------------VSLEDEF-----WTAFRD--M-A
S5YRV8_PARAH/10-74------------PAKHSVTIDG.HR--TS----------------------------VSLEEAF-----WRELRA--I-A
A6WUZ0_OCHA4/15-83------------QINRSVRIGG.HS--TS----------------------------IQLEATF-----WRLLDE--I-A
G0AAA0_COLFT/37-104------------SRARSVRIMG.VI--TT----------------------------IKLENLF-----WQTLAE--L-A
F8J5J1_HYPSM/3-66------------PEKRSFSIQG.HR--TS----------------------------ISLESAF-----WVALKE--A-A
G8AI45_AZOBR/22-97------------.KSMNIMIAG.RR--TS----------------------------MRLEPTM-----WDALED--I-A
G8ARV8_AZOBR/26-90------------VVTRSLTIGG.RR--AS----------------------------LRLEATI-----WDGLKD--I-A
B6IW11_RHOCS/3-66------------SICKNVTVAG.RR--TS----------------------------VRMEPIM-----WQCLEE--I-C
M9R844_9RHOB/9-72------------PAKHSVTLRG.HR--TS----------------------------ISLEPEF-----WQEFRS--I-A
R6J4D7_9PROT/7-67------------...KVLIING.RR--TS----------------------------MRLCLSE-----WCALER--I-C
C7JBE2_ACEP3/5-69------------LRKRSLILAG.HD--TS----------------------------VALESAF-----WNTLED--I-A
A6VZH2_MARMS/16-83------------.VTRSLRIDG.MV--TS----------------------------IRLESFF-----WFTLEE--I-A
V9VUQ5_9RHOB/5-69------------PKKHSLTLRG.HR--TS----------------------------VSLEDEF-----WDAFRE--I-A
D5BMV3_PUNMI/6-68------------.QKRNIRLAH.LR--TT----------------------------IVLEPYI-----WDCISD--I-L
R5QX40_9PROT/1-65------------MRKQSVIIANRHS--TS----------------------------ISLEDEF-----FDELKE--L-A
B9JXQ8_AGRVS/8-72------------IRKHSISLHG.HR--TS----------------------------FSLEDAF-----WQEIRA--I-A
Q87Y30_PSESM/6-74------------PHSKSVRLNG.LA--TC----------------------------LRLENVY-----WNILTG--I-A
A0KLC1_AERHH/26-94------------CTTRSVRICG.HS--TS----------------------------IRLENKF-----WTILEQ--L-C
Q98KH2_RHILO/5-68------------.EKRSVTIRG.HR--TS----------------------------YSLEKPF-----YDDLVA--I-A
A5FYB5_ACICJ/15-82------------QTSRSVRLSG.RS--TS----------------------------VRLERVF-----WDALGE--I-A
D5QBC0_KOMHA/10-72------------LHKRSMMLSG.HR--TS----------------------------VALEPEF-----WGALER--M-A
G2IRZ2_9SPHN/11-78------------PVKRSMTIAG.HT--TS----------------------------ISLEPLF-----WHALEE--R-A
Q2SKQ2_HAHCH/16-83------------.HSKSVRLRG.FV--TS----------------------------VRLEQRF-----WALLEE--I-A
F2K501_PSEBN/34-101------------PLARSIRLNG.FA--TC----------------------------LRLEQVY-----WDILGD--M-A
B2IH09_BEII9/17-85------------IIKHSVTIAG.HA--TS----------------------------ISLESAF-----WDALKE--I-A
Q2K6G5_RHIEC/20-84------------IRKHSATLHG.HR--TS----------------------------FSLEDEF-----WAELKT--I-A
F6IFI2_9SPHN/8-74------------PIKRSVEIAG.HK--TS----------------------------ISLEPVF-----WDLLKD--R-A
B2UET6_RALPJ/16-83------------.LARSLRLHG.VA--TS----------------------------VRLECLF-----WEVLEE--I-G
Q1GGM9_RUEST/6-70------------PKKRSLTLRG.HR--TS----------------------------VSLEDAF-----WSEFRR--L-A

PF03869

RMNT_BPP22/2-51-------------------ARDDPH--FN----------------------------FRMPMEV-----REKLKF--R-A
RARC_BPP22/4-53-------------------MSKMPQ--FN----------------------------LRWPREV-----LDLVRK--V-A
G3XCY4_PSEAE/13-62-------------------SRTADK--FV----------------------------VRLPEGM-----REQIAE--V-A

PF07704

Q92LY2_RHIME/1-78P.LYIKDPEVDRLAEELISLTKS.S--KV----------------------------DAVKDAL-----KHEIAK--R-K
K9Y1V0_STAC7/1-81A.INIKNVEADRLARELSEITGE.T--IT----------------------------EAVIKSL-----AERLER--E-K
VPB42_MYCTU/1-88S.LNIKSQRTVALVRELAARTGT.N--QT----------------------------AAVEDAV-----ARRLSE--L-D
C7NJK7_KYTSD/22-102A.LTIKNDRVCDLAREAAQRSGQ.S--QV----------------------------SVIEQAL-----ERYLAD--.-.
Q0BQA3_GRABC/5-87AQLNIKSEDAYVLATELAALTGE.S--MT----------------------------MAVTEAL-----RERLER--E-R
L0DWF9_THIND/1-83A.LNIRNPEADRLAAELAQATGE.T--KT----------------------------EAVIQAM-----RDRLDR--V-R
A6WWK7_OCHA4/1-81A.LSIKTDEADRLARELSRLTGE.T--MT----------------------------DAITQAM-----RERLDR--L-R
Q2JGF8_FRASC/9-88..LNIKNEEAQRLSRELAELTGE.T--VT----------------------------TAVLVAV-----RERLER--M-R
W0ABH3_9SPHN/5-83..LNIKDPEAHRLAQAIAQETGE.P--MT----------------------------RVVVEAL-----RDRLSR--I-E
A6X7T6_OCHA4/1-81S.LYIRDSAVDELAKKVQKITNAPS--KT----------------------------EAVRQAL-----QNELKR--A-K
A7IPR5_XANP2/185-260..LQIRDERARVLAEQLAARRKV.T--MT----------------------------EAVIQAL-----EGELTR--E-K
I6X1P2_PROPF/1-84A.LNIKNKRVCELARQAADRFET.T--QV----------------------------DVIERAL-----LELLNH--E-E
I3TVZ0_TISMK/1-81S.LNVKDPEARRLAQAIADATGQ.S--MS----------------------------RVVTEAL-----RERYAR--L-R
I3Y9G9_THIV6/1-75P.LQIANPTVIVKVERLARATGL.N--KT----------------------------AAVERAV-----DRLLSE--L-E
Q20ZG7_RHOPB/1-82H.LNIKNDEAHRLATELAELTGE.S--LT----------------------------AAVTAAL-----REQLVR--E-R
B1M1V3_METRJ/1-75P.LNIRSEEVNQLAEKLASRAGV.S--KT----------------------------EAVRLAL-----ANELER--R-E
G8NNV7_GRAMM/6-85A.LHITNPAVEQKVRSLASVTGE.S--IT----------------------------EAIGAAA-----EERLIR--F-N
L0J8B6_MYCSM/1-82A.LIIDDPEVERLATEVAAKMGI.T--EI----------------------------AAICEAL-----RSARRA--F-G
F2J715_POLGS/1-79P.INVNNPEADALTRKFAHMAGV.S--IT----------------------------DAIVIAM-----KEAIER--R-R
K7S7C8_PROA4/1-82A.LNIKDPDTDRLARELAEETGE.T--LT----------------------------SALHAAL-----AERLTR--V-R
B8EP86_METSB/1-76P.LYIKDDTVAELVAELAARRRV.S--KQ----------------------------EAVRQAV-----SAELER--M-A
B8IVJ3_METNO/1-83A.LSIKDPETERLARTLAERTGE.T--IT----------------------------VATRKAL-----EERLRR--V-G
C7NLZ4_KYTSD/1-87A.LNIKNERVHQLAREAAALRGT.S--QT----------------------------SALEAAL-----EEYLER--H-A
C1A9G9_GEMAT/1-83A.INIKSPEAEKLVRELAELTGE.S--IT----------------------------DAIQHAV-----RERLTR--E-R
Y2378_RHIME/1-81A.LYIKDPTVDRMAEKLQERLGVRT--KT----------------------------DAVRIAL-----QHELDR--V-E
F5XKW7_MICPN/1-83A.LNIKDPETDRLARELAAATGE.S--IT----------------------------VAARRAI-----EERLER--V-R
L0J8W2_MYCSM/1-78P.LTVEDEEVIRLADDLMQRLHLPS--RI----------------------------DAIRYAL-----QAQIN.--.-.
B0T0U9_CAUSK/24-113G.ILIKNPEAERAVRELADLTGE.S--LT----------------------------TAIEIAV-----KERLEA--K-R
VPB30_MYCTU/1-83A.LSIKHPEADRLARALAARTGE.T--LT----------------------------EAVVTAL-----RERLAR--E-T
Q2RUX5_RHORT/1-81S.LTIKDPEAHRLAQAIARATGK.S--MA----------------------------RVVTEAL-----RERYAE--I-E
VPB36_MYCTU/1-81A.LNIKDPEVDRLAAELADRLHT.S--KT----------------------------AAIRHAL-----SAQLAF--L-E
I6XS64_PROPF/3-79..LIIDDPRVRAMVDHLAKQRGV.T--AT----------------------------EVIRDAV-----EQQLTK--.-.
H6RSW2_BLASD/1-87S.LNIKNAEVEDLARRVAAVTGT.S--IT----------------------------AAVAQAL-----REKLAR--L-Q
Q92TH7_RHIME/9-88A.ININDPQADALTRTFARMAGL.S--IR----------------------------EAIVTAM-----KEAIDR--R-R
H6RM61_BLASD/1-86G.LNIKNPETEELARQLADATGE.N--LT----------------------------RAITVAV-----RERLDR--I-Q
B9JIC8_AGRRK/5-84A.INVNNREADALTRKFAHMAGV.S--IS----------------------------DAIVIAM-----KEAIAK--R-S
D7A0R5_STAND/1-80A.LFIRDPEVDALAEEVRRLTKART--KT----------------------------EAVRSAL-----KAQLAE--A-R
B0SW80_CAUSK/41-123..IQIRNAEVVENIRELARLRGA.G--LT----------------------------ETVEAAV-----RETLER--E-R
A7IPR8_XANP2/1-84S.LNIKNPATVALADELARRQGV.T--KT----------------------------AAIHQAL-----SERLHR--M-G
K9Y7X0_HALP7/1-79A.INIKNPDVDRLIQELRAMTGE.G--PT----------------------------EIVKRAL-----EREYQE--L-R
L0GTX7_9GAMM/1-83A.LNIRNPETERLAERISELTGE.T--KT----------------------------AAVTRAL-----RERLER--L-Q
D4Z9B0_SPHJU/1-81S.LNVKDPEAHRLAQAIAQATGQ.S--MT----------------------------RVVTEAL-----RERFAR--I-E
C3KNS9_RHISN/1-79S.LYIRDGAVDELAKQVQQAINAPN--KT----------------------------EAVRRAL-----LNELER--A-R
C3KQT0_RHISN/1-80S.LYIRDDDVDALAKKVQQVTRAPT--KT----------------------------EAVRRAL-----QNELAR--A-E
A6X8D2_OCHA4/6-84..LSVRSSKARDLAHSLAKRTGQ.P--IN----------------------------KLVERAL-----ERYDQE--L-.
VPB28_MYCTU/1-80A.LNIKDPSVHQAVKQIAKITGE.S--QA----------------------------RAVATAV-----NERLAR--L-.
Q981I6_RHILO/1-76A.FSVKDESTDAAVRRLAKLKNM.S--LT----------------------------DTIRDAV-----EQEYQR--S-R
Q6N2A9_RHOPA/1-82H.LNIKNDEAHQLATELARMTGE.S--LT----------------------------AAVTNAL-----REQLAR--E-H
Q219N1_RHOPB/1-83A.LSIKDPETERLARTLARLTGE.N--IT----------------------------TATKRAI-----EQRLSR--L-A
Q7NGE7_GLOVI/4-85..INIKSDKAYRMANELSRLTGE.S--VT----------------------------QAITTAI-----EERLEK--I-R
A1T4A5_MYCVP/1-80A.LNIKDEKVHDAVKQLARLTGE.S--QA----------------------------QAVATAV-----QERLSR--V-.
K0FC64_9NOCA/1-82G.LNIKNEQVHALVREAAERTGM.T--QT----------------------------GVIEEAL-----KRMLKE--L-D
B1LSI4_METRJ/1-77P.LYVKDPQVDALATQLMALLGT.S--KT----------------------------DAVRRAL-----QNEIAR--Q-T
C3KQV7_RHISN/1-83A.LSIKDLETERLAKALAEKTGE.T--IT----------------------------MATRRAL-----EERLRR--L-A
D3PLA4_MEIRD/1-79A.LTVKNPEVERLAEEVARLTGE.T--KT----------------------------EAIRKAL-----LERKAR--L-L
L0E2P5_THIND/1-78P.LQIANPEVVRKVDELAKATGL.S--KT----------------------------AAVGRAV-----DRMLSE--L-G
B2IL59_BEII9/1-77P.LFIKDASVDELAAELAHLLSV.N--KT----------------------------EAVRLAL-----RQALDR--E-K
U5QCJ3_9CYAN/4-85..LNIKSDRAYQMATELSRLTGE.S--VT----------------------------QAVTQAI-----EERLER--M-R
C8XHZ8_NAKMY/1-83V.LNIKDPETDRLARELAAEAGE.S--LT----------------------------VATRRAI-----EERLSR--L-R
Q92RQ4_RHIME/1-83A.LSIKDTETEQLARTLARRTGE.S--IT----------------------------LATKRAL-----EERLRR--T-D
Q5SKZ1_THET8/1-84A.LTIRNKEVERLAEEVARLAGE.T--KT----------------------------EAVRKAL-----EMRLRE--L-.
A5FU30_ACICJ/1-78P.LYIRDNATAELVAKLAKERGL.T--KQ----------------------------DAVRLAV-----QAELDR--T-R
Q1QF44_NITHX/1-83A.LSIKDPETEKLARALAQRTGE.T--IT----------------------------VATRRAI-----EERLKR--T-E

PF09957

Q82BL1_STRAW/2-49-----------------------SV--TQ----------------------------IDLDDEA-----LAEAMR--L-M
Q20X13_RHOPB/8-51-----------------------MR--TT----------------------------IAIDDEL-----FAKAQQ--Y-A
Q2FLV1_METHJ/1-47-----------------------MA--TN----------------------------LAVDDNL-----ISEALV--I-G
Q58AH0_RALME/1-44-----------------------MR--TT----------------------------IALDDEL-----LAKAQA--Y-T
Q3JAZ0_NITOC/1-47-----------------------MR--TN----------------------------IDLDDKL-----LEAAFR--C-V
A1U2W3_MARAV/1-47-----------------------MR--TN----------------------------IVIDDQL-----MAEALK--A-S
A1VX34_POLNA/1-45-----------------------MR--TT----------------------------LTIDDQL-----FARAVA--L-A
Q7AQ19_MYCLE/3-56-----------------------KK--VE----------------------------IEVDDDL-----VQEVIR--R-Y
Q73PC1_TREDE/1-47-----------------------MA--TN----------------------------LAINEEL-----LDTAYK--I-G
B3EKM2_CHLPB/1-47-----------------------MR--TN----------------------------IVIDDKL-----LREAFS--V-S
Q73R95_TREDE/1-44-----------------------MR--TT----------------------------IVLNESK-----IQQAFA--L-T
Q7NCS8_GLOVI/1-47-----------------------MR--TN----------------------------VELDDAL-----LEEAFQ--L-T
A8ZTF6_DESOH/1-44-----------------------MR--TT----------------------------LNIEDGL-----IDKASK--M-T
Q7D057_AGRT5/1-48-----------------------MR--TN----------------------------IELDDAL-----IAEAME--I-T
Q2FNJ2_METHJ/1-47-----------------------MA--SN----------------------------LALDDDL-----IKEAQR--I-G
A5G896_GEOUR/35-78-----------------------MR--TT----------------------------LNIEDAL-----LEKAAK--L-T
A5GB97_GEOUR/1-47-----------------------MA--TN----------------------------LAIDDKL-----LEEART--V-G
Q73SG9_MYCPA/11-61-----------------------KK--VE----------------------------IEVDLEL-----VDEAIR--R-F
A0ZI46_NODSP/1-47-----------------------MI--NN----------------------------IVIDEKL-----IDDAIK--A-T
Q01QU3_SOLUE/1-47-----------------------MR--TN----------------------------IVIDDKL-----MREALR--V-T
A4XJM6_CALS8/1-47-----------------------MR--TN----------------------------IILNDEL-----LKKAME--I-A
Q124P4_POLSJ/1-47-----------------------MI--TN----------------------------IDIDEVV-----VAEAMR--L-S
B1WYD1_CYAA5/1-47-----------------------MA--TN----------------------------LEIDDQL-----IQEALK--I-G
B2HSG4_MYCMM/3-54-----------------------KK--VE----------------------------IEIDDDL-----VQEAIR--R-Y
B8GLV4_THISH/1-43-----------------------MR--TT----------------------------LNIDDQL-----LAEAQR--I-T
VAPB6_MYCTU/3-45-----------------------.V--TQ----------------------------IDLDDEA-----LADVMR--I-A
Y634A_MYCTU/16-68-----------------------KR--VE----------------------------IEVDDDL-----IQKVIR--R-Y
VPB15_MYCTU/7-50-----------------------SR--TN----------------------------IEIDDEL-----VAAAQR--M-Y
VPB11_MYCTU/7-49-----------------------SR--TN----------------------------IDIDDEL-----AAEVMR--R-F
Q8YSF9_NOSS1/25-71-----------------------MQ--IT----------------------------LNLDESL-----LNEAFQ--L-T

PF09274

E5YNK1_9ENTR/1-74TMSFGEHRDLEKVVNS.TPTGKQKR--VN----------------------------VNFDEEI-----HIRFKA--A-C
A0A034V0K1_ERWAM/1-76KMTFGEHRDLDKVVDSPLPSGKSKR--VN----------------------------VNFNEEK-----HTRFKA--A-C
B0ZE05_ECOLX/1-76KMTFGENRDLERVVTAPVSSGKIKR--VN----------------------------VNFDEEK-----HTRFKA--A-C

PF05509

B8EFN4_SHEB2/13-61---------------------------IT----------------------------IILTGEY-----HNKLVN--S-C
Q4LC31_SODGL/14-62---------------------------IT----------------------------FKLNQEY-----TALLYA--S-I
B6ESX2_ALISL/7-55---------------------------VN----------------------------IVMDQKC-----NHLLNI--S-K
A7DVG3_VIBVL/13-61---------------------------VN----------------------------IKLSGKH-----NQILES--S-K
B2LS54_9VIBR/10-58---------------------------VN----------------------------VKLSEKH-----NRVLEQ--S-K
B8EFW0_SHEB2/41-89---------------------------VN----------------------------VVLDGKT-----NEMLEA--S-A
B6ET57_ALISL/12-52---------------------------LW----------------------------FELDKET-----NHLLKL--Q-A
A6ASC2_VIBCY/12-60---------------------------IW----------------------------FEMDSET-----NRKLEE--S-A
Q7MBP1_VIBVY/10-58---------------------------IW----------------------------FEMDKET-----NQRLEA--S-A
A7N8Z3_VIBCB/12-60---------------------------IW----------------------------FELDEDT-----NRLLEE--S-A
Q5DY84_VIBF1/10-58---------------------------IH----------------------------FQMDKIT-----SNTLEK--E-A
B5PNJ9_SALET/24-72---------------------------VS----------------------------CSLDEAI-----DELLME--S-A
A6D5H0_9VIBR/18-66---------------------------VV----------------------------VVLKGVY-----AKRLED--S-C
Q6LW96_PHOPR/20-68---------------------------VT----------------------------CFLSSFA-----NKLLEE--S-I
A8QYN9_9GAMM/15-63---------------------------IS----------------------------FQLSEEA-----NKLLSE--S-C
A7N8V1_VIBCB/9-57---------------------------GQ----------------------------LTLDKQT-----YALLNQ--A-S
E6WK64_PANSA/14-62---------------------------LL----------------------------VTLSPEM-----NRELSK--A-A
D4IGT0_ERWAE/12-60---------------------------VL----------------------------LHLNTEQ-----TEKLSQ--A-A
B2VB54_ERWT9/25-73---------------------------VL----------------------------LKLTPEL-----TKKLSQ--A-A
B6ICE9_ECOSE/13-61---------------------------VT----------------------------LLLRRET-----NEKLVA--A-A
A0A023MW99_SALEN/14-62---------------------------VS----------------------------VYLDEDT-----NNRLIR--A-K
A0A026GSK1_ECOLX/14-62---------------------------VL----------------------------LTLDEET-----NKLLLG--A-R
A0A024LLK2_ECOLX/14-62---------------------------VL----------------------------LILDETT-----NQKLLA--A-R
A0A025IEW1_ECOLX/14-62---------------------------VL----------------------------LVLDDAT-----NHKLLG--A-R
A0A024KL39_ECOLX/70-118---------------------------LT----------------------------MRLDDET-----NQLLIA--A-K
A6TIF9_KLEP7/67-115---------------------------VM----------------------------ARFDEDT-----NKKLIA--A-K
A0A016QUU3_KLEPN/72-120---------------------------LF----------------------------LRFDEQT-----NKMLIK--A-K
Q1MKC7_RHIL3/2-50---------------------------LV----------------------------LQLPADI-----EARLIE--L-S

PF07362

H0Q687_9RHOO/11-81-------RKATNVTLGEGLLAEAKA--LD----------------------------INISQAA-----EAGVAR--A-V
K0I4M5_9BURK/9-79-------KKSTNLSLNSKVLEAARD--MG----------------------------MNISQTV-----DELLAA--E-V
L0DQK3_THIND/1-68-------...MNLSIDAELLAEARR--FG----------------------------LNLSGLL-----EERLSG--A-V
B5EG30_GEOBB/12-82-------KKSTNLSINSDLLRLAKE--RH----------------------------INLSQAL-----ESRLAE--M-L
D4YZH7_SPHJU/13-83-------RKPTNVSLDIALVAEAKR--LG----------------------------LNISRAC-----EVGLIE--Q-I
B2JXB4_BURP8/10-80-------RKATNVTLPVDVYERAKE--LG----------------------------INFSRAC-----EQALRD--A-I
Q82VK5_NITEU/17-87-------KRAINLSLSADVLDAARQ--LD----------------------------INISQVC-----DTYLRE--V-V
B0T4X1_CAUSK/3-80-------KVELDIGIDSELLAQAKR--LG----------------------------ISVAGMS-----ETQLRL--H-L
E0SK21_DICD3/2-72-------KHRVSVTVDKDNYQVLSA--AG----------------------------VNISGLV-----NDAIGK--E-A
Q1GN85_SPHAL/11-80-------KKPTNVSLNAELVEEARR--LE----------------------------INVSEAC-----QSGLAA--E-V
Q326Z9_SHIDS/2-72-------KQRITVTIDSDSYQLLKS--AN----------------------------VNISGLV-----NTAMQK--E-A
D3VG79_XENNA/22-92-------KKTVSVTVSPELYEQAKQ--IG----------------------------LNFSAIL-----TQALIA--E-L
W0L945_SERFO/12-76-------KRSTNVYLTASLVDAARS--MD----------------------------MNLSATL-----DRLLAQ--A-I
F5XZ64_RAMTT/9-77-------KRAVNLSLSEHLIEQARQ--YS----------------------------TNLSATV-----DELLAD--Y-V
G7Z7L4_AZOL4/17-86-------KQRVDITLNEDLLRLAQG--YT----------------------------DNLSGTI-----ETLLAA--W-M
Q98F99_RHILO/26-96-------RKSAKISTSLQLLEDAKV--LS----------------------------IDISRAA-----ETGIAK--A-I
S5Z1L5_PARAH/10-80-------RKPANLSLDQSLLAEARA--LG----------------------------INLSRAA-----EAGLRQ--A-V
A5GAE8_GEOUR/23-93-------KKPTNLTINSDLLQKARE--HH----------------------------INLSQTL-----ELRLAE--L-I
Q93GR6_SALTY/2-72-------KQRITVTVDSDSYQLLKA--YD----------------------------VNISGLV-----STTMQN--E-A
A7HPK7_PARL1/5-75-------KKAVNLSIDADLLAKARA--LD----------------------------INLSATF-----EEVLRT--R-A
E1VR77_9GAMM/21-91-------KKPTNVTINSDLLAKAKE--LK----------------------------INLSATL-----EAALIE--L-V
G7ZEQ7_AZOL4/20-89-------KRATNVSLNSDLLEQAKA--LG----------------------------INVSRAC-----ERGLAD--Q-I
Q5P2R6_AROAE/22-92-------KKATNLSLSADVLAEAKS--LG----------------------------INISKAC-----DECLRE--L-V
Q32K47_SHIDS/7-77-------TQSVTVTVDRELVNRARD--AG----------------------------LNMSATL-----TVALNA--E-L
A0L724_MAGSM/11-81-------KDRVNLSMNSELVQKAKA--LN----------------------------INLSKEL-----EKHLDK--L-V
A8GC18_SERP5/8-78-------TQSVTMTVERSLLSRARE--AG----------------------------INLSATL-----NAALDA--E-L
A1U420_MARAV/11-81-------RKPTNLSLDSALLKEAKS--LG----------------------------INVSRSA-----EAGIAE--A-V
Q8PCL0_XANCP/29-98-------KKPLNLTINSDLAAQARA--MT----------------------------GNLSAKV-----EELLAD--Y-V
S6AR37_PSERE/11-81-------KKAANLSINSDLLSKARA--LD----------------------------INLSATL-----EQALAD--A-L
Q6D9V2_PECAS/2-71-------KHQISIAVDKDDYQVLSA--AG----------------------------VNISDLV-----NDAIGR--K-A
Q21DI4_SACD2/11-81-------KKPTNLSVNSDLLAKTRA--LN----------------------------INLSATL-----EQALKQ--Q-L
I1XLK6_METNJ/11-81-------KKPTNLSVNSDLLKKSKA--MN----------------------------INLSATL-----EQALTD--K-L
Q7N4P4_PHOLL/9-79-------KKTVSVTVAPELYQQARQ--VG----------------------------LNLSAVL-----TKALIS--E-L
F2GB87_ALTMD/11-81-------KKATNLSLNSDLLQKARD--LK----------------------------VNLSATL-----EQALKD--K-L
Q21U54_ALBFT/9-79-------KRPVNLSITADTIDKAKA--LG----------------------------MNLSKTV-----DALLGE--E-V
C3MCA1_RHISN/7-77-------RRPTNLSLDGDLLSQARD--LK----------------------------INVSRAA-----EEGIAQ--A-V
B3PDY0_CELJU/63-133-------KKPTNVSINSDLLEKARA--LN----------------------------INLSATL-----EQALAE--Q-L
C7JJ40_ACEP3/1-66-------.....MTLPAQLLEEARS--LD----------------------------LNISQAC-----EQGLKS--A-I
R9VLC6_9ENTR/11-81-------KQNVSVTVERELLEQARK--EG----------------------------INLSQTL-----ATALQG--E-L
K7SHF6_GLUOY/17-86-------RRPVNLSLNTDLLAQVRE--VT----------------------------PNLSATV-----ETLLGD--Y-L
K7ABL7_9ALTE/6-76-------KVPCNTSIDAAVIKEARA--LI----------------------------LSPSAIL-----EEALSK--A-V
E0SMR7_DICD3/9-79-------KKTVSVTLEPALLQQARE--AG----------------------------INLSATL-----AEALKR--E-I
C4LCG0_TOLAT/11-81-------KKATNLSLNSELLAEAKR--LN----------------------------INLSATM-----EKALVQ--E-V
D5QE46_KOMHA/17-86-------RRPVNLSLNADLLAQVRQ--VT----------------------------PNLSATV-----ETLLGD--Y-L
K0C8E2_ALCDB/11-81-------KKAANLSINSDLLNKTRA--LN----------------------------INLSATL-----ERALRE--E-L
M4XDA7_PSEDE/11-81-------KKPTNLSLNSDLLKKARE--LD----------------------------VNLSAVL-----EEALAE--E-V
H2IXW0_RAHAC/27-92-------KKRTNVTLSADLLEQAKA--FG----------------------------INLSATF-----DKALGE--A-V
Q2RNE8_RHORT/14-84-------RRATNVSISAPILAEARA--LE----------------------------VNISRAA-----EKVLVL--A-I
Q7MZJ1_PHOLL/2-72-------KHRVNVTFDKENYLILNS--AG----------------------------VNISGFV-----NKAMTR--E-A
G7Z9X1_AZOL4/11-74-------KRDVTLSLDEDILHRAQS--LP----------------------------GDLSERV-----EKLLAD--E-V
V6F3K3_9PROT/6-76-------KKSCNLSINAELLREAKG--LG----------------------------INLSQTL-----EVQLEK--L-V
I2B9K4_SHIBC/6-76-------TQSVTVTLERDLIAAARA--AG----------------------------VNMSQTL-----AAALDA--E-L
B2VJI7_ERWT9/12-75-------KRSTNVYLTASLVDKARS--MD----------------------------MNLSATL-----DNLLAQ--A-I
D3VAK1_XENNA/23-87-------KKSTNVYLTAALVETARS--MN----------------------------INLSATL-----DKLLAQ--E-I
E6X2R7_NITSE/11-81-------KKATNISLNSDLVRKAKL--YG----------------------------INLSQTL-----EVALER--I-V
Q6D8L1_PECAS/2-72-------KRWISIAVNKDDKQTPNA--TW----------------------------IPISGLT-----NDVIDK--E-D
G0A2L0_METMM/9-79-------KKATNITLSADVLAEAKA--LN----------------------------INISQAC-----DLYLRN--L-V
D6Z0A2_DESAT/12-82-------RRATNISISARLLDEARL--LQ----------------------------VNISRAA-----EQGVAQ--A-T

PF10723

Q93GS8_SALTY/8-88------MSQIENAVTSSS..KRIYR--KG----------------------------NPLSSAE-----KKRLSI--S-R
Q326V9_SHIDS/1-86------MSQTENAVTSSLSQKRFVR--RG----------------------------KPMTDSE-----KQMAAV--A-R
Q326M6_SHIDS/1-79------MSQIENAVTSSP..KRIYR--KG----------------------------NPLTGAE-----KQRISV--S-R

PF04221

DINJ_ECOLI/4-84---NAFVRARIDEDLKNQAADVLAG--MG----------------------------LTISDLV-----RITLTK--V-A
Q9KML3_VIBCH/3-84---TEMLSTRIDHDTKIAFTNVCDE--MG----------------------------LSTSQAI-----KLFAKA--V-I
Q9PBQ9_XYLFA/4-84---NQLVQARIDGAIKAEATVVLAA--MG----------------------------LTISDAV-----RLLLTK--V-A
RELB_HAEIN/5-93---NSSISFRTVEKTKLEAYQVIEQ--YG----------------------------LTPSQVF-----NMFLAQ--I-A
RELB_ECOLI/1-78---MGSINLRIDDELKARSYAALEK--MG----------------------------VTPSEAL-----RLMLEY--I-A
Q9A0Y8_STRP1/13-96---TGTLNLRVDDSVKSAADDILKR--LG----------------------------IPMSTAI-----DMFLNQ--I-I

PF03693

PARD_XYLFA/1-78---------------------MSRN--TS----------------------------VALGPHF-----TSFIDA--Q-V
PARD1_CAUCR/2-82---------------------ASKN--TS----------------------------VVLGDHF-----QAFIDS--Q-V
PARD_VIBCH/1-80---------------------MAKN--TS----------------------------ITLGEHF-----DGFITS--Q-I
PARD1_MYCTU/1-80---------------------MGKN--TS----------------------------FVLDEHY-----SAFIDG--E-I

PF14384

A1AQ37_PELPD/17-82........RRGRPAG....QTKA.L..QT----------------------------VRFDLDV.....LAAFKA..T.G
Q73R28_TREDE/11-81...........PPPDRLIRKSEKVK..IT----------------------------ITLDCES.....VAFFKA..S.A
B0JRR8_MICAN/35-94............FYRPL....KQ.Q..IT----------------------------LSLDADL.....IDWFKTQATQE
Q92KN5_RHIME/26-103...EEHRRSRGRPSLE...HPKK.Q..VT----------------------------LRLDEDV.....IAKFRA..G.G
Q3J2R4_RHOS4/23-97....MRRSAGGRPKLD...APKM.S..VS----------------------------LRLDQDV.....VAHFKA..G.G
B8F509_HAEPS/13-99NEMERQGKIKTGRGKQK.KPTKQ.A..IT----------------------------LRLSPEV.....IEAFKS..T.G
A5GE33_GEOUR/45-107.........RGRPKKD...RPKK.A..VS----------------------------LRIDPEV.....LAYFKG..T.G
A1WJ32_VEREI/17-83........HRGRPRLA...RPQQ.L..LT----------------------------ILFDADV.....IEAFKA..T.G
A6WWJ1_OCHA4/29-103....MEKAIRGRPRID...DPKT.P..VT----------------------------IRLDQDV.....VQRFKA..T.G
Q2RSU6_RHORT/41-96...............PL....KE.A..VS----------------------------IRLDKDV.....LAFFKT..T.S
E3I091_RHOVT/23-97....MRKNVGGRPKSD...APKV.A..VS----------------------------LRLDQDV.....VDKFRA..T.G
Q215B0_RHOPB/13-90...LARIRGQRGPQKA...PTKI.A..VS----------------------------IRLSPEV.....VSHFKA..T.G
C4K882_HAMD5/42-98............FYRPI....KK.Q..LT----------------------------VRIDADV.....LEWLKS..E.G
Q20YH7_RHOPB/27-93........QRGRPKSD...APKQ.L..VS----------------------------LRLDAEV.....LRWFKA..T.G
D3SAY2_THISK/33-91..........GRPPLP...VTKE.R..IT----------------------------IRLSPDV.....VEAFRA..T.G
C4KAB9_THASP/30-98.......RKRGRPVGS...GTKE.Q..VA----------------------------IRIDHDI.....LEAFRA..G.G
Q28LR0_JANSC/24-89.......STRRS.......SPKK.Q..LT----------------------------VRFDEDV.....VKFFKS..A.G
D5X2J5_THIK1/28-104...LVAKRPRGRPKAD...ETKV.F..TA----------------------------IRLDADL.....LETFKS..T.G
A8HS57_AZOC5/58-131......SIKRGRGRPKV.DSPKQ.A..VT----------------------------LRLSPET.....IERFRK..T.G
B1M0P6_METRJ/36-100.........RFVPRGPT.GRSDE.M..VA----------------------------IHLLPEI.....VAHFRA..Q.G
A9BQV6_DELAS/27-103.....AARKRGRPQGSVKADAKI.A..TN----------------------------IRFDPDV.....LQALKA..T.G
D5CSA1_SIDLE/6-67............AKLQT.EMAGKTR..IT----------------------------MRVDNSV.....LALYKA..R.A
C1DP04_AZOVD/25-95.......RGERGPQKA...PTKQ.Q..VS----------------------------LRLSPEV.....LAYFKA..G.G
A1WLU7_VEREI/13-87....TLGMRVRGPQKA...PTKQ.A..TT----------------------------IRLSPDV.....MAAFKA..T.G
Q73LQ6_TREDE/25-85............AYWNV.TPIKK.K..IS----------------------------IKIDADI.....LAVLQS..L.G
A5V5L4_SPHWW/13-90...KAGKRGRPVGSTS...SNKT.Q..VA----------------------------LRIDNDT.....IARFKA..G.G
A6WZ44_OCHA4/29-94.........TRGPGKK...APKE.T..VT----------------------------LRLDPDV.....VEAFKA..D.G
B0T4V2_CAUSK/34-92............LHRPI....KM.P..VT----------------------------IRLDADV.....VGWFKEHAG.D
B6JFY4_OLICO/17-84........RGRPPLGL...VAKK.S..VT----------------------------LRLDDDV.....IAAYRE..T.G
C5D0R5_VARPS/7-82..........AVHTPAQIEARKRGRPAGS----------------------------VKADAKVSTAIRLEALKA..A.G
Q8KUW1_SYNE7/45-104..........GRPPSL...NPKT.Q..IA----------------------------IRLDRDI.....VEAFRA..G.G
Q0KBY4_CUPNH/27-90.........RGRPRLA...STKE.L..VS----------------------------IRYDADI.....LDAFRA..S.G
B6IVZ4_RHOCS/9-71............GRPPA.QARPKVA..TS----------------------------LRLDADV.....VERLRQ..D.G
Q2KVN5_BORA1/5-79....KLGLRRRGPQKS...PTKQ.A..VT----------------------------IRLSPEV.....LDTFKA..S.G
Q39RZ9_GEOMG/16-77............AKFQA.ETGGKSR..IT----------------------------MRVDNDV.....LATFKA..R.A
A8GIR2_SERP5/28-84............FYKPM....KV.S..KT----------------------------VRIDADI.....LEWLQR..P.G
A9IES8_BORPD/41-97............FYKPT....KT.S..TT----------------------------VRIDSDV.....LAWLRS..Q.G
A1VRX0_POLNA/13-87....TLGMRVRGPQKA...PPKV.S..TT----------------------------IRLSPEV.....VEAFRA..G.G
Q31JV0_SYNE7/18-82.........IGRPRSQ...SPKV.A..IS----------------------------LRLEAEV.....LQRWRD..S.G
A1WB35_ACISJ/28-89..........GRPLGS...GTKA.Q..VT----------------------------LRLDVEV.....LEKFKA..S.G
B2ICD8_BEII9/27-96........LAETIRRRG.PLKKKEA..VS----------------------------IRIDIDV.....LQKLRA..T.G
Q73L16_TREDE/8-67...........K.......LRKKQV..VA----------------------------IRLSPET.....AEKVKA..L.G
C3M8F8_HAMD5/13-85.......KTLGIRGPQK.APTKQ.K..IT----------------------------IRLSQEV.....VDAFRA..T.G
C7RRD3_ACCPU/30-92............RGRPK.SENKKLL..VS----------------------------VRYSPEV.....VAYFKS..T.G
B6IW20_RHOCS/40-99...........SLYRPV....KE.V..VT----------------------------IRLDADV.....LHWFRDHAAGG
A8LQR3_DINSH/3-99RIQALVPDAWQTLEADLPLVEKKTK..VT----------------------------LRLDESV.....AKFFRA..M.G
C4KAB3_THASP/28-89..........GRPPAA...VTKE.R..IT----------------------------IRLSRDV.....VEQFRA..T.G
A3N0B8_ACTP2/11-88....VIESRERKRGRPV.AQTKKVS..VT----------------------------IRYSQSV.....IDAFKS..T.G
D4ZU97_ARTPN/29-87............RGSPN.YQTKT.Q..VT----------------------------LSIDSDV.....LDWFKS..Q.G
K9XMQ0_9CHRO/29-86..............LPA.TKAKA.Q..VT----------------------------LRIDSDV.....LEWFKS..Q.G
Q2L2E1_BORA1/28-86............PKAE...VTKE.R..IS----------------------------IRLSPDV.....LESFRA..T.G
Q63NA3_BURPS/28-88............GRPPL.EAPKV.Q..LT----------------------------VRYDVDI.....VDAFKA..T.G
Q6N573_RHOPA/22-88.........VRRGRPPLGTQPKS.S..VT----------------------------LRLDADV.....LDAYRA..L.G
Q7CI23_YERPE/12-90....GAEKVIKTRGRPKLANPKE.P..VK----------------------------LRIDHDV.....VDAYRA..Q.G
Q7CP71_SALTY/37-93............FFRPL....KT.Q..AS----------------------------VRIDADV.....MEWLKR..P.G
Q9PD17_XYLFA/28-105....ALVAMKRPRGRPKADQTKV.F..TA----------------------------IRLDADL.....LEAFKA..T.G
V6F518_9PROT/28-104....ETEALLRRRGRPLKADRKV.D..IK----------------------------LRIDPDV.....VEALRS..G.G

PF16777

I9TP66_HELPX/21-81--------------------KRNFS--VT----------------------------FYLSKEE-----HDVLRR--L--
I9SLK1_HELPX/21-81--------------------KRNFS--VT----------------------------FYLSKEE-----HDVLRR--L--
M3NJJ4_HELPX/21-81--------------------KRNFS--VT----------------------------FYLSKEE-----HDVLRR--L--
J0RAY0_HELPX/2-62--------------------KRNFS--VT----------------------------FYLSKEE-----HDVLRR--L--

PF07764

T0VBY9_9ENTE/1-69M..GNLGAQKAKRNDTPISAKKDIMGDKT----------------------------VRVRADL-----HHIIKI--E-T
I3U5Z1_ENTFC/1-71MIVGNLGAQKEKRNDTPISAKKDIMGDKT----------------------------VRVRADL-----HHIIKI--E-T

PF11903

Q4KC28_PSEF5/1-66---MGIVKISDELHEQIRVASAAMD--RS----------------------------INAQAEF-----WMKIGL--L-A
B4SF37_PELPB/2-74---GMPVRIDDTLYGQARAQAKAEH--RT----------------------------IAGQIEF-----WAMIGR--A-A
A0QXV1_MYCS2/6-107---DRVTRFAADLVESAAAEGARQS--RS----------------------------AKQQLDH-----WARVGR--A-V
A9BMX0_DELAS/1-73---MGIVKISDQLHDQIRLSSAALG--RS----------------------------INAQAEH-----WLRVGQ--L-A
A6T935_KLEP7/1-66---MGIVKISDLLHDDIRDASKAMS--RS----------------------------VNAQAEY-----WIRLGM--M-S
Q7NVK9_CHRVO/1-73---MGIVKISERMHDNLRTASEALS--RS----------------------------INSQAEH-----WLRIGM--L-A
A1T476_MYCVP/6-107---DQVTRVAADLMDSAATEGARRS--WS----------------------------AEQQLDH-----WARVGR--A-V
Q3AQ94_CHLCH/4-76---STSIRINQELYEQAKQDAKLEH--RS----------------------------IAGQIEF-----WARVGR--A-A
Q1GXH1_METFK/1-73---MGIVKISEAMHENIRSASNAFS--RS----------------------------INSQAEH-----WLRVGM--L-A
Q2SQH0_HAHCH/2-95---PQSVRIDDFLIDSARREAKGAH--RS----------------------------VQGQIEH-----WAKIGQ--M-V
Q13JR3_BURXL/1-70---MGIVNIDDDLHDQIRKASAVSC--RS----------------------------INAQAAF-----WIKVGM--L-C
Q15VU5_PSEA6/1-66---MGIIKISDEVHDEVRKSCQVMS--RS----------------------------INAQAEF-----WIKMGR--L-A
Q0RY55_RHOSR/40-141---TSPTRIDNELYASAKLVGGRMS--RS----------------------------AAQQIAH-----WARIGR--E-L
Q220F4_ALBFT/1-73---MGIVKISDQMHENLRVAGNALS--RS----------------------------INAQAEH-----WMRVGM--L-S
Q47D61_DECAR/1-73---MGIVKISEHMHENLRLTSAALS--RS----------------------------INAQAEH-----WLRVGM--L-S
Q0C2J2_HYPNA/1-68---MGIVNIDDDLHDQLRKASTVSC--RS----------------------------INAQATF-----WIRIGM--L-C
A7HVP7_PARL1/11-109---AQSIKLADDIMKIVRRESELQS--RS----------------------------VSGQVAH-----WVRIGR--A-I
A4Y172_PSEMY/1-70---MGIVNIDDELHDQIRRASSVSN--RS----------------------------INAQAGF-----WIRIGM--L-C
D0J2S6_COMT2/1-68---MGIVKISDQLHDQIRVSSAALG--RS----------------------------INAQAEH-----WLRVGQ--L-A
Q63SV8_BURPS/1-72---MGIVKISDGMHESLRHASAALS--RS----------------------------INAQAEH-----WLRIGM--L-A

PF11020

F4F896_VERMA/2-77------.........IDCQFGTARASF.P----------------------------LYVGEPAVGTHPMEQQSA--WLQ
Q73H58_WOLPM/5-85------IKKF....TVQCDFKGQSSPF.A----------------------------IYIGNPKSDAHPIHHQDS--WLV
B3S7R4_TRIAD/8-90------YNQFNDIPVLSPRISSQQELFVD----------------------------IYIGQPNQGSHPLAFQLR--WLR
Q2GKE5_ANAPZ/4-84------VKKF....IIPCEFGGKTSPF.A----------------------------VYIGEPKPDAHPVQHQNT--WLS
C4YV51_9RICK/4-84------YKEF....EFDCDFGGQRAKF.K----------------------------FYIGTPQEGHHPLQFQAK--WLS
B9KIB3_ANAMF/4-84------IKKF....IIPCEFGGRIAPF.A----------------------------IYIGEPRPDAHPVQHQNT--WLS
F7XUD1_MIDMI/1-81------MKKF....EVPCFFGGSRSVV.P----------------------------LYIGNPEPTHSPIHFQAD--WLS
Q2GCJ4_NEOSM/1-81------MKKF....TVPCQFGSQTAPF.T----------------------------IYIGSPRRDTHPIYNQAT--WLS
K9QB18_9NOSO/702-781------.KRF....TVPITCGTIKSPF.H----------------------------VYVWDWKLNEPPTTAQFD--WVE
A5CC80_ORITB/1-81------MKKL....VINCNFGGQIAPF.T----------------------------VMIGQPKPDQHPLHFQAN--WLS
Q2GG71_EHRCR/4-84------IKKF....IVPCDFNGQSSPF.A----------------------------IYIGEPKPENHPVQHQDN--WLA

PF15970

B4EVM4_PROMH/3-83-----NYPATSHFDEESETYEITYRDFDN----------------------------IHAVAYT-----EDDIEL--E-A
Q0WCU1_YERPE/3-83-----SYPASYTVDEASGEYHIHYRDFPE----------------------------LNSVTYS-----LEDVEL--E-A

PF01340

METJ_VIBVY/3-99---DWNGEYISPYAEHGKKSEQVKK--IT----------------------------VSIPLKV-----LKVLTD--ERT
Q15NT2_PSEA6/6-102---KWNGKYIHPYAEHGKKSEQVKK--VT----------------------------VSIPLKV-----LKVLTD--ERT
K7AFK6_9ALTE/6-102---KWNGEYIHPYAEHGKKSEMVKK--VT----------------------------VSIPLKV-----LKVLTD--ERT
Q489Q2_COLP3/3-99---QWNEEYINPYAEHGKKSEQVKK--IT----------------------------VSIPLRV-----LKVLTD--ERT
METJ_SALTY/3-99---EWSGEYISPYAEHGKKSEQVKK--IT----------------------------VSIPLKV-----LKILTD--ERT
Q5QV41_IDILO/2-95---KWNGEYIYPYAEHGRKSQQVKK--VT----------------------------VSIPTRV-----LKVLTD--ERT

PF10715

REGB_BPT4/2-151RQINNEIREASKAAGVSSFHLKYSQHLLD----------------------------RAIQREIDETYVFELFHKIKD-H

PF08681

Q8E866_SHEON/19-95-----RIELKTSPEVKELLERA--AAING.INLTAFIINNVREKALAIVESETT...LNLNQRA-----WAQFE.--T-I
Q7N880_PHOLL/12-90-----TLNLRIRQEDRDLIDRA--AKVKG.KTVTEYVLDTIKRDAENTLLEHSF...MIVSPEI-----FNAFI.--A-K
Q7N7Z2_PHOLL/8-88-----RITTRVSSETKELLERA--LSLSGYASLNSFIANAAVAEAKRLIEQNMR...IQLCQED-----ALAFV.--H-A
Q92P91_RHIME/11-90-----RIELRTTREEKRLLTAA--AAHER.LDVTSFIMRAVLPAALDVVENAER...ISLSERD-----SLRLL.--D-L
B3EP86_CHLPB/11-90-----RLSLRIAAEEKSILMRA--AALEH.THLTDFVISKVVSAARQVIERHER...LELSERD-----SQHVL.--K-L
Q7NIQ1_GLOVI/13-92-----RIDIRTTPAAKRALQET--AAIEH.KTVSGFLLDSGLKASAQILADRWF...FLLDDKR-----WEVFV.--A-A
Q7NLC6_GLOVI/11-90-----RLEVRVSGDGKALIAQA--AQLEG.RTVSDFVVASALEAASRTIQEHGL...LYLSQQD-----QQIFV.--E-A
B4SB08_PELPB/10-88-----KLDLRLSQQAKQVLRSA--AIASN.RTLSEFVLESALSRAEETLADRRS...FSLDVTQ-----WTAFI.--A-A
Q5P620_AROAE/9-88-----RLEARISKDLHSMLKRA--AELQG.RTMTDFVIAAVQDAAQRAIEQAEV...IRLSLAD-----QECFA.--Q-A
Q2SAN8_HAHCH/11-89-----RIDVRASTPVKQLLQEA--ARVCH.KNVSEFLLDAGVTAATQTLADRRQ...FVLGEAQ-----WQAFQ.--E-A
C1DE12_AZOVD/13-92-----TLNIRIKPEERSLIDRA--AQVKG.KNRTDFILDAARTAAEEALLDRAF...IAASPEA-----YAEFLA--A-R
Q8ZL97_SALTY/13-91-----QLNLRAKESQRALIDAA--AEILH.KSRTDFILETACQAAEKVILDRRV...FNFNDEQ-----YEEFI.--N-L
Q8XPL2_RALSO/16-98-----RITARLSADKQELLQLA--ADLSG.STLNQFVLQSALRAAEQVIEHEETIKAIKLTVEQ-----SRRFV.--A-L
Q6LIX8_PHOPR/32-112-----RITARVDIDTQELLSQA--AAIAGMSSINSFVLSAAVEKAKQIMERERA...LKLSQRD-----AMMLM.--D-A
Y420_HAEIN/9-88-----RLEAKVNIDIYELLKQA--AAITG.RTLTDFVVSVAYEEAKKTISEHQV...LRLAVND-----QALLI.--E-S
Q5P632_AROAE/5-83-----AINLRALPEQRDLIDHA--ASLLG.KNRSDFMLEAACDRAQAVVLDQVF...FGLDADK-----FKQFT.--A-M
Q5NX70_AROAE/9-88-----RLEARISPDLHALLKRA--AEIQG.RTMTDFVVTAVKDAAQKAIEQAEV...IRLSLAD-----QQRFA.--D-A
Q7N6D8_PHOLL/7-86-----RFEARMNPELHALIKRA--AEIQG.RTMTDFVVSAAQDAAQRAIEQSEV...LRLSLAD-----QQCFA.--Q-A
Q7N0J5_PHOLL/11-90-----RMSLRIASEEKSLLMRA--AALQH.TNLTEFVLRNVMPAARKVIDENER...LELTERD-----SLHVL.--D-L
Q6ZEG7_SYNY3/12-91-----RLEARISPETKALMQKA--AALEG.RSLTDFVVASAQAAALKVIEQHQT...LQLTIAD-----SQAFV.--D-A
Q87ZN7_PSESM/15-103-----RLEIKTTDFAKEFIRKA--ATVSG.LDMTAFIMASAFEKAEVVMENHRR...IELSEKA-----FSRLH.--E-I
Q3SNN6_NITWN/19-98-----RLETRVTADQKKLIERA--AALQG.RTVTDFVLTSVQEAARRAIEDHQT...LHLSLRD-----SQAFV.--Q-A
Q9KM95_VIBCH/57-136-----RLDIRLDEEIKAKAEKA--SALLGLKSLTEYVVRLMDEDATHVIEEHES...IMVKDSV-----FDEFM.--A-A
Y4AR_RHISN/23-102-----RMNFRTKERVKRTIQRA--AALSG.LDDSAFTINAAYQSAIATIAAHEA...TLLQTTD-----YQAFF.--D-A
O05910_MYCTU/74-152-----RLAARLTPEQDALIRRA--AEAEG.TDLTNFTVTAALAHARDVLADRRL...FVLTDAA-----WTEFL.--A-A
Q7N3R4_PHOLL/22-101-----RLVARTSIEIQEIIQRA--ADYSG.ATLSQFLIESAMERARNVIERTET...LHLSIEG-----ADALL.--A-A
I6XFC2_MYCTU/72-148-----RLNFRLSPEQEQALRHA--AALTG.QSLSGFVLSAAVDHAHDLLARANR...IELSEAA-----FRRFV.--A-A
Q8P668_XANCP/14-88-----.LNLRIKPEERSLIDRA--AKARG.KNRTDFMLDAARSAAEEALLDQTL...ITASPDA-----YAAFL.--A-R
Q8ZKC7_SALTY/14-88-----.LNLRIKPAERDLIDRA--AKARG.KNRTDFVLEAARAAAEEALIEQRI...IMADPEA-----YQEFL.--V-R
Q8ZMH5_SALTY/14-91-----RLSLRVSTDAKKLIVRA--AAIQQ.TNLTDFVVSNILPVAQKIVDAAER...VYLTERD-----TKMIM.--E-I
Q9PHI1_XYLFA/6-80-----.INLRAMPEQRDLIDQA--ANLLG.KNRSDFMLEAACERAKAIILDQVF...FNLDEER-----FRQFT.--V-L

PF05534

Q7N3F9_PHOLL/54-104-----YLQDCKELNKNPDIPYK..GIFN-----------------------------VRVNPEL-----HRKIAE--L-A
Q88MT9_PSEPK/54-104-----YIETCEKLGREPQKAYS..GKLS-----------------------------LRLEPAL-----HASVAA--K-A
Q6A7R8_PROAC/60-110-----RANDEPVPEPLSTRHYS..GKFQ-----------------------------LRLGEDL-----HRRLVI--E-A
Q73YB6_MYCPA/53-103-----ESSGETLPTPMADRHYS..GTIV-----------------------------VRTSPEL-----HSRLAM--E-A
Q7N8L4_PHOLL/59-111-----YLEDCNASGIEPYARQEKIKTFT-----------------------------LRYPESF-----GERLHC--A-A
Q92KT7_RHIME/1-48-----M...CREKGIEPRRKFS..GKFN-----------------------------VRLDPED-----HAAAAV--A-A
Q6MB72_PARUW/52-102-----YLDWCKELGQEPEKPFS..GNIH-----------------------------LRLQPDL-----HAKLAA--E-A
Q7VMR2_HAEDU/57-107-----YIEFCQEQGIETCKSFS..GNFN-----------------------------VRITPEL-----HKKASL--L-A
Q7MY97_PHOLL/58-110-----YIETCEEEGINPFKEEDKLKSFT-----------------------------LRYPGWL-----EARLTA--A-A
Q88G27_PSEPK/52-102-----YLDTCASLGQNPEIPCK..GSFN-----------------------------VRVGHDL-----HLAASV--A-A
Q73J27_TREDE/55-105-----YIELCKEAGKPAEKSYK..GSFN-----------------------------IRISPAI-----HKKAKR--Q-A
Q8YLM2_NOSS1/53-103-----YLEFCQERGEEPEKPFS..GKLM-----------------------------LRINPEL-----HKIIAI--K-A
Q73KK4_TREDE/52-102-----YINWCREENIEPEKPYS..GKFN-----------------------------IRISPEL-----HKKIAI--N-A
Q92XZ7_RHIME/54-104-----YLETCRKIGKEPQRPYS..GKMM-----------------------------FRVAPEV-----HRRAAL--A-A
Q73QG2_TREDE/62-112-----LENGFTIPMPQDENNYS..GKFL-----------------------------LRLPKSL-----HKELAL--N-A
Q6G4L9_BARHE/55-105-----QHNGEEVPVPLSHGKYS..GKFQ-----------------------------LRIPPEL-----HRKLAI--Q-A
Q9RZI7_DEIRA/54-104-----YLAFCAELGEEPEKPMS..GKFN-----------------------------VRISPLL-----HAQAVA--M-A
Q8XYR1_RALSO/55-105-----FLEECARRGVEPQKHFS..GKFM-----------------------------LRVEGKV-----HEAATI--A-A
A1RCN0_ARTAT/63-111-----..SGEKIPQPLADRKYS..GRLN-----------------------------LRVSPEL-----HRKLAL--E-A
Q9PCT7_XYLFA/64-114-----FLEACKEDSVEPRKCYS..GKFN-----------------------------ARISPEL-----HALASE--A-A

PF09386

Q7N4K2_PHOLL/1-79---MSRLTIDITDQQHKSLKAL--AALHG-KTIKQYTLERLFPDMTDSDQAW-----QELKVLL-----NTRIS---E-G

PF12651

A6LT47_CLOB8/12-55------------E-------KTR---I--AKSKLTDEA-----------------------------LELL----FEKYN
Q1D537_MYXXD/6-49------------R-------TTR---I--RQSEYLREA-----------------------------ISDL----LAKYE
Q08NJ8_STIAD/30-73------------R-------RTR---I--AQSEYLREA-----------------------------VEDL----LAKYG
Q04FI1_OENOB/1-44------------K-------ETS---I--PRSELVEKM-----------------------------LENL----TKEYE
A5N8S1_CLOK5/8-51------------K-------EIM---I--PISKLLDKA-----------------------------VELV----PREYA
A7HBK6_ANADF/4-47------------E-------RTR---V--PVAEYIRQG-----------------------------IDLV----LEKYR
Q9YEP4_AERPE/2-45------------R-------RLG---V--ERSRLVEKA-----------------------------VEAL----LEDYR
A2BMU8_HYPBU/1-44------------N-------QTG---V--NRSRLIEEA-----------------------------IKGY----LEDHS
B2TQ69_CLOBB/8-51------------K-------ETM---I--PLSKLLDKG-----------------------------IELL----LKEYN
C3AQ62_BACMY/106-149------------A-------ATG---I--HKSRIVEEA-----------------------------LIEF----LRKYE
Q17ZT4_PEPD6/4-47------------E-------QTR---I--PLTKLIDEA-----------------------------LEDL----IKKYK
A9GWZ6_SORC5/4-47------------E-------RTK---V--PIAVYIREG-----------------------------IDMV----LKHYE
E3FMN1_STIAD/4-47------------Q-------KTK---V--PVAEYIRQG-----------------------------IDLV----LEKYK
Q2II40_ANADE/24-64------------R-------KTR---V--RQSDYLREA-----------------------------VADL----LAKY.
Q8XP25_CLOPE/8-50------------E-------KTG---I--PISKILDKA-----------------------------MSMY----LEST.

PF01402

Q9YBV4_AERPE/3-42------------R-------AGR--YS--SRSEVIRIA-----------------------------VREL----LKR--
Q8ZX60_PYRAE/47-86------------R-------RGI--FP--NRSEAIRAA-----------------------------LRDL----LYK--
P72681_SYNY3/21-59------------A-------KEG--.L--SREVLFEAL-----------------------------FEHY----IED--
Q8ZWZ9_PYRAE/10-49------------R-------MGV--YP--SRSEAIRAA-----------------------------LREL----LGK--
NIKR_CHLTE/6-45------------K-------AQG--YQ--SRSEALRDL-----------------------------IREE----LLR--
Q877Q4_PSESM/12-50------------L-------AAE--.I--SVSDLMRRA-----------------------------ALNR----KIK--
Y4KO_RHISN/4-42------------E-------KLD--.R--SRSYMAAEA-----------------------------IEAF----VEQ--
VPB19_MYCTU/2-40------------K-------ASG--.A--SRSELIRRA-----------------------------IHRA----YGT--
O28529_ARCFU/6-44------------K-------ELG--.L--SQSEIIRRV-----------------------------IKFY----RDY--
Y080_METJA/3-41------------N-------KER--.I--SRSEFIRRA-----------------------------LEYY----VKK--
PARD2_CAUCR/12-50------------E-------GMD--.Q--PKTAIIERA-----------------------------LRDF----VEL--
O30230_ARCFU/6-44------------R-------DSG--.D--SLSKIFREA-----------------------------IQLY----YNL--
O29882_ARCFU/4-42------------K-------MTG--.K--STSELIRDL-----------------------------IDLG----YDI--
NIKR1_METTH/3-42------------D-------ELG--FS--GRSDVIRVA-----------------------------ARML----IDE--
Q9I707_PSEAE/4-42------------R-------ATH--.R--DRPYHLRQA-----------------------------LAQY----LER--
E51_SSV1/12-50------------A-------KTG--.K--TMGQLIEEA-----------------------------VKLL----EAE--
Q88JZ4_PSEPK/2-40------------C-------LRQ--.R--SSHWIMREA-----------------------------ITQY----VER--
Q888D4_PSESM/12-50------------I-------DSG--.V--SISEFLRCA-----------------------------ALKR----KTR--
O30109_ARCFU/6-44------------A-------VEN--.K--TVSDIIRES-----------------------------IITY----AEL--
NIKR_HELPY/12-51------------I-------KNG--YS--SRSELVRDM-----------------------------IREK----LVE--
Q8EGZ2_SHEON/6-44------------E-------TRK--.R--SSHWMMREA-----------------------------IREY----VER--
G7YYF2_CLOSI/3-42------------Q-------RRG--YN--NRSEAIRDI-----------------------------LRSA----LAQ--
YBFE_ECOLI/52-88------------E-------SRN--.M--SRSELIEEM-----------------------------LMQQ----L..--
YIIE_ECOLI/4-41------------G-------WRK--.V--SRSAILREA-----------------------------VEQY----LER--
Y298_MYCTU/6-41------------R-------AAG--.L--NRSEMIEQA-----------------------------LRNE----H..--
VPB20_MYCTU/11-49------------R-------RRR--.T--SKAALIREY-----------------------------VAEH----LRQ--
VPB10_MYCTU/3-39------------A-------QEG--.V--SRAELIRLL-----------------------------LNRA----L..--
Q327A8_SHIDS/14-51------------A-------RLE--.R--SRGWVIKQA-----------------------------LSAW----LAQ--
Q3IQM5_NATPD/4-41------------D-------ETG--.A--GQSEIVRRA-----------------------------LSFY----AA.--
Q8U3E4_PYRFU/7-45------------K-------RGI--YP--NRSEAIRVA-----------------------------IREL----LKK--
S6AY38_PSERE/10-47------------E-------RLE--.R--SKNWIVKQA-----------------------------LAAW----IDQ--
V5UCU1_9BURK/15-51------------R-------DCG--.M--SVGQFVLAA-----------------------------ALGR----RTR--

PF07878

Q1QQP0_NITHX/90-130------------A-------SEG---F--TRSGFLAHA-----------------------------AKKA----LAA..
Q7U858_SYNPX/33-75------------L-------EEG---R--SCGNLAAYL-----------------------------VEEA----LRRHR
A5GQX8_SYNR3/18-60------------D-------QDS---R--TVSNMAKVL-----------------------------IQQG----LDRLQ
E8SHU9_STAPH/6-48------------K-------KEN---R--SMSNMVEHL-----------------------------ITSY----IERSS
A5GKY5_SYNPW/33-75------------L-------AEG---R--SCSSLATFL-----------------------------IEDG----LRRHG
F4BUC1_METCG/7-49------------K-------ETG---V--PLSNLMSYI-----------------------------AVKY----VREEK
B7JWD3_CYAP8/2-44------------D-------EQG---R--PVANLAAYL-----------------------------VERA----VEKAE
A8ZLB3_ACAM1/15-57------------D-------SQV---R--SVSSQIQFF-----------------------------MKQA----VESNQ
D7E5Q5_NOSA0/6-48------------S-------DET---R--TVSQMIVVL-----------------------------CQEA----MVARE
Q46HT9_PROMT/14-56------------E-------RES---R--TVSNMAKVL-----------------------------IQEG----VKYHE
B1X2B8_CYAA5/9-51------------Q-------QRG---Q--TVAGLAALL-----------------------------VEKA----VTEAQ
Q7VEB2_PROMA/14-56------------K-------KES---R--TVSNMAKVL-----------------------------IQEG----VDSLI
Q7NMR8_GLOVI/20-62------------E-------AEE---R--SVSWLVAKL-----------------------------IDRA----LQQRR
E0UNJ6_CYAP2/6-48------------D-------HQG---R--SMANLANFL-----------------------------LERS----ISTAK
Q8YK09_NOSS1/15-57------------D-------EEG---R--ATANLVAFL-----------------------------VEQA----IRAKF
K9VLV1_9CYAN/8-49------------E-------EDS---R--SVSSLATYL-----------------------------LTKS----VRERQ
K9VLX7_9CYAN/14-56------------S-------IER---R--SISQMALLL-----------------------------VEEG----LERAQ
Q7V237_PROMP/82-124------------A-------AEG---R--DLSSVAFQC-----------------------------LETG----LREMK

PF15919

F8GGR0_NITSI/3-126------------K-------EAG...E..SRSGFIAKL-----------------------------A------------
F2JW02_MARM1/3-127------------A-------SNPQ.YK..NRSAFLAQV-----------------------------S------------
E1VAV2_HALED/3-129------------A-------KQGDVYQ..SRSGFLSRA-----------------------------A------------
B8GTR2_THISH/3-126------------A-------RAH...E..TRSGFLARA-----------------------------G------------
F2KE11_PSEBN/3-128------------L-------HHPE.EK..SRSGFLASA-----------------------------A------------
F4HBU2_GALAU/3-128------------A-------THPE.YK..SRSGFLAQL-----------------------------A------------
F7QNQ0_9BRAD/4-124------------E-------REG...F..TRSGFLAQA-----------------------------A------------
D8MUK4_ERWBE/3-128------------A-------THPE.FK..SRSGFLAQV-----------------------------A------------
G8M697_9BURK/3-126------------E-------ARH...E..TRSGFLARV-----------------------------A------------
Q1QQP0_NITHX/4-124------------A-------SEG...F..TRSGFLAHA-----------------------------A------------
D5BWS5_NITHN/3-123------------K-------AHQ...M..SRSGFLAKV-----------------------------A------------
Q98J17_RHILO/4-124------------E-------AHG...Y..TRSGFLAKA-----------------------------A------------
E6WDB3_PANSA/3-127------------E-------THK...EFNSRSGFLADL-----------------------------A------------
A1VQL9_POLNA/3-127------------R-------TAG...E..TRSGFIARM-----------------------------A------------
Q63NA5_BURPS/3-126------------A-------SRH...E..TRSGFLARA-----------------------------A------------
B4ET85_PROMH/3-129------------K-------TNP...EYGSRSGFIATA-----------------------------T------------
D5CBF0_ENTCC/3-129------------N-------EHP...QFSNRSAFLAEA-----------------------------A------------
A5GAH3_GEOUR/3-123------------E-------QYH...M..TRSGLLAQA-----------------------------A------------
Q1LPG4_RALME/14-137------------E-------RRH...E..TRSGFLARV-----------------------------A------------
A8GFZ4_SERP5/3-129------------Q-------QHPG.YG..SRSAFLAAA-----------------------------A------------
Q7N448_PHOLL/3-129------------K-------ASPNLYK..NRSHFLQVA-----------------------------A------------
Q5HXI2_GLUOX/3-126------------R-------ASR...E..SRSGMIAAM-----------------------------T------------
F4GPE1_PUSST/3-127------------K-------SAG...E..SRSGYIAQM-----------------------------T------------
B8DM26_DESVM/3-123------------K-------ARG...M..SRSAFMVES-----------------------------A------------
A9H9S0_GLUDA/10-135------------K-------DAG...E..TRSGFIAKL-----------------------------A------------
F9ZMS1_ACICS/3-126------------R-------AAG...E..SRSGYLARC-----------------------------A------------
YO14_BPHC1/3-126------------A-------THPE.YK..NRSNFLSQL-----------------------------A------------
Q5F6D2_NEIG1/4-126------------S-------ANH...E..TRSGFLAKA-----------------------------A------------
Q7VZH1_BORPE/3-127------------R-------AAG...E..SRSSYIAHL-----------------------------A------------
Q9A3L8_CAUCR/4-124------------E-------TYG...Y..TRSGLLARA-----------------------------A------------
W8KT83_HALHR/3-127------------S-------LHG..IK..SRSAFLTRA-----------------------------A------------

PF12441

Q30QH6_SULDN/2-80------------N-------ALD---I--PYQSFIKML-----------------------------LQKE---------
B0JXE6_MICAN/7-82------------R-------EQQ---I--SVEMLVNSW-----------------------------CRDK---------
B4SES2_PELPB/3-79------------K-------RLG---I--PYQRFMRLA-----------------------------IERA---------
A6QAG9_SULNB/5-83------------N-------AMD---I--PYQSYIKML-----------------------------LQKE---------
C1F1N0_ACIC5/3-81------------H-------QRD---V--PYQSLMKIY-----------------------------LADR---------
B4SF55_PELPB/6-84------------N-------ERD---V--PYQSLLKMF-----------------------------LKER---------
A4SVJ8_POLSQ/6-84------------N-------KLD---V--PYQSLMQIW-----------------------------LAEK---------
A1BIF8_CHLPD/6-84------------N-------ERD---V--PYQSLLKMF-----------------------------LKER---------
B1WWY8_CYAA5/9-85------------Q-------KKG---V--AISQLVNDV-----------------------------LREK---------
B8GRA9_THISH/6-84------------N-------KRD---M--PYQSLIKAW-----------------------------LAKD---------
P72819_SYNY3/56-132------------S-------AQG---M--NYQKYIREV-----------------------------LEQS---------
A5GA05_GEOUR/6-84------------N-------SRD---V--PYQSLIKIW-----------------------------LSEK---------
C7LN80_DESBD/6-82------------K-------AKG---I--PYTRYVRML-----------------------------LEAD---------
Q01SA6_SOLUE/7-85------------N-------KRD---V--PYQSLLKVF-----------------------------LAER---------
C3KQS7_RHISN/6-84------------A-------KRD---V--PYQSLIKVW-----------------------------LSEK---------
Q9AAV5_CAUCR/3-77------------S-------ARG---I--PYQRFIREA-----------------------------LET.---------

PF13467

I3THE1_TISMK/5-68------------Q-------REG---C--RIHELATMVN.......STR.....RES.....TLTAAIRVF----IMNYY
A1B158_PARDP/15-82------------A-------RDG---M--TVAQLITRL........WHEAMDADHD...LG.NFTSFLRVC----CARY.
Q2W502_MAGSA/68-131------------D-------EAH---C--AIDDLCETA........RRR....YEAS.....SLTSAIRVF----VLNSN
U4KIB5_9VIBR/16-83------------E-------KQH---M--TTGQFLSLL........YDEATELHGE...VS.NFASLLRCS----CVMYL
D7A937_STAND/16-83------------Q-------RDG---M--SLPQLLAKL........HEELVFAHGE...VE.NFASFLRVC----CGRYL
Q47K48_DECAR/15-83------------G-------NEG---M--TTNQLIAKL........YDEIEAYRGE...VE.NFASFLRVT----CLRYL
B8EK53_METSB/15-83------------A-------SEG---S--TLGRLLTKL........HDESLEFQGG...IG.NFTALLRCA----CIGYA
V6F6E9_9PROT/28-96------------A-------EGG---L--SLPQFLTQL........HDEVIERRGE...IG.NFASLLRVV----CATYL
I3TNF1_TISMK/9-73------------R-------ARG---I--SLGALVAAID.......AAR...RVDRV.....NLSSALRLF----ALAE.
S6AZN1_PSERE/15-83------------E-------VDG---M--TTNQLITKL........YDEVMDYRGE...VV.NFASFLRVS----CTRYL
B4RFD6_PHEZH/4-67------------R-------ARG---V--SLAALIVGID.......RAR.....AGR.....PLASACRLA----ALDYA
A4Z0Q4_BRASO/15-82------------A-------KEG---M--SVAKFVTTL........YAEVLDHHGE...VK.NFASLLRCS----CLIY.
Q8EH51_SHEON/15-83------------E-------DAE---L--SVAVFLTRI........YREVLARQGE...VA.NFASLLRVA----CTTHL
Q1QJT3_NITHX/17-80------------M-------RRG---M--TLSTQIASID.......TDR.....RTS.....NLSSAIRLY----VLEHF
U4K818_9VIBR/15-83------------K-------KSE---L--SIGAFVTQI........YKEVLEKRGE...IR.NFASLLRVA----CTTHL
R5XT33_9PROT/6-68------------R-------REN---I--KRKKLFELID.......ANK....DEKM.....GLTSSVRLF----SLIYY
D7A5S3_STAND/15-83------------A-------HQG---M--SLGKFVTKL........HDEVLDLHGE...VR.NFASLLRCS----CLIFL
A5FXC9_ACICJ/3-65------------A-------RRG---V--ALGTLVGEVD.......AAR....DPDR.....PLASALRVF----ALT..
D4ZC71_SHEVD/15-83------------E-------SQG---V--KRNQFIASL........YIEALNHHGD...VK.NFTSLLRSA----CVQHI
K7SD13_GLUOY/4-66------------A-------HQN---L--SFSALVASID.......AKR....TPDR.....PLASALRVA----ALM..
G2KLR8_MICAA/1-64------------R-------TRA---Q--TINDLVTEID.......EGR.....GDH.....NLSSALRVF----VLKTI
G8PTZ2_PSEUV/3-67------------R-------SQG---K--NITATIAGID.......DER....NPEN.....NLSSCIRVA----VLKHF
A8IAV7_AZOC5/5-68------------G-------QRR---L--TLSDLVATID.......SGR.....NQG.....NLSSAIRLF----VLDYY
Q13WI7_BURXL/15-84------------A-------REN---M--TTSQFAVQL........YDELIALRGE...LPTNFASFLRVC----CLRYL
B2IEK6_BEII9/15-82------------A-------LEG---T--SLGRFLTKL........HDDSLEFRDG...IG.NFTAYLRCA----CIYH.
R5YAT6_9PROT/7-67------------K-------REN---I--KRNNLLEMIN.......ARK....DAKM.....GLTCSVRLF----SLIY.
F2J384_POLGS/15-81------------A-------SEG---L--STPAFVSRL........HSEVLELRGE...AP.NFTSLLRCA----CLI..
U5T3K9_9GAMM/16-83------------A-------EQR---R--TVPQFIAEI........HDEVVARQGE...VR.NLASLLRVC----CARYL
Q2K3V5_RHIEC/15-83------------R-------RDG---M--NVVQLITRL........HHESIDAGHD...LG.NFTSFLRVC----CARYL
V6F679_9PROT/38-104------------R-------EEG---V--TASALIARI........HDHCLVTNDR......NLASCLRVV----CLKYI
Q7CXZ9_AGRT5/2-66------------E-------RRK---V--SFAALLAEID.......DSR....PADS.....NLSSSLRVY----VLNWL
C3MEF5_RHISN/3-66------------K-------SRG---M--PLARLIVEID.......DGR....GSEG.....NLSSAIRLY----VLAWI
B9JH07_AGRRK/7-71------------K-------ARG---T--SLAALISEID.......DGR....EPES.....NLSSALRLY----VLKWL
Q2YPT7_BRUA2/7-71------------A-------ARN---M--TVAALVAEID.......SRR....ERTI.....NLSSALRLH----VLDWL
Q0A5P7_ALKEH/48-113------------A-------EEG---M--TIPEIIAQV........QYHCQSVNDK......NMASCLRVL----CLKYI
A5VF72_SPHWW/4-70------------G-------EEG---V--PLNALVARID.......VDR.IADDDLP.....NLASAIRVW----LFRR.
Q2N6Z0_ERYLH/8-73------------E-------ARA---V--PINALVAQID.......EER.IRAATPP.....GLASAIRVW----LVT..
B6INS4_RHOCS/2-64------------A-------ARG---V--PVGTLIEEVD.......ATR......TG.....NLSSALRVH----VLEAV
W8RV19_9RHOB/5-69------------A-------ARG---S--SVNDLAAEVD.......AAR....GLSS.....GLASAIRVF----VLDEV
G2I0K7_GLUMN/18-81------------Q-------TRG---L--TLVGLVAQVD.......GAR....PPDR.....PLASALRVE----ALRE.
A7HVX0_PARL1/14-77------------C-------TEK---T--SVNELVRRID.......TRR....DGQG.....SLSSAIRLY----VLNAL
Q2W7L3_MAGSA/5-67------------E-------SRG---T--SINQMVAGID.......STR......EA.....NLSSAIRVF----VLNEL
A8LPV2_DINSH/15-83------------E-------AEG---R--STPAFISTL........HGEVLEARGE...PV.NFTSLLRCT----ALLYI
Q167Q5_ROSDO/15-83------------Q-------SEG---T--TAPCFISKL........HTEVLEKRGE...PK.NFTSLLRCA----CLKFA
Q15TD7_PSEA6/15-83------------F-------RDD---M--SVNQLITKL........YFESQEAELD...LS.NFTSFLRVC----CSRYL
E3I0W1_RHOVT/38-99------------E-------EQG---R--TVAALVAEID.......AAR.....GPA.....GLSAAIRVY----LLG..
Q167I6_ROSDO/5-69------------Q-------ENG---K--PINGLVADID.......VKR....GTST.....GLASAIRVF----VLEDL
A6X0F5_OCHA4/15-83------------A-------RDD---L--TVSRLIGKL........YDESRNEGHD...LD.NFASFLRVC----CGRYL
C5AUK2_METEA/10-72------------Q-------ARG---Q--SVQALIGAID.......SER.....GAR.....NLSSAIRVF----VLGAF
R6I0Y9_9PROT/4-68------------R-------TEK---T--NRNTLIGLLE.......NIP....DRKL.....GLTYLTRLF----MLMYY
B8IRU4_METNO/15-83------------R-------QEN---L--SVAKFATKL........HDEVLERHGE...VR.NFASLLRCS----CLIYL
B8ELI0_METSB/17-78------------A-------ERG---S--SLAACVAEID.......AAR.....GSA.....NLSSAIRVY----ILQS.
G8ARW4_AZOBR/20-92------------H-------RED---L--TVDELCSDL........KDRLDSQSRRSRGVAVSLANAVRVF----IVGYY
G7ZBW3_AZOL4/15-83------------A-------EQG---I--TTNRLIVTL........HDEVVEVHGT...IQ.NLASFLRVS----CVRYL
D4YZT3_SPHJU/21-85------------A-------REG---L--PINALIARID.......VAR.MATAAPP.....NLASAIRCW----LF...
I0HQZ1_RUBGI/15-82------------A-------RDG---L--SVAQLIETL........YDELVAERGA...VG.NFASFLRVC----ALRY.
A9HZ31_BORPD/15-82------------A-------RDG---M--RVNQLIERL........YDELVEYRGE...AA.NFTSFLRVC----CLRY.
B0T0E7_CAUSK/20-82------------T-------ADA---I--SIAGLIQRID.......AGR.....GER.....PLASACRVF----ALLR.
B6IVX3_RHOCS/20-83------------R-------REG---R--SVHEVCSRIA.......QAK....PPAA.....SLTAAIRVF----LLSYF
H5WRL6_9BURK/15-83------------E-------EEG---C--TTNHLIVQF........HDEIMAHRGE...VP.NFASFLRVT----GMRYL
R6I5L9_9PROT/2-65------------R-------QKG---L--SVNQLVTEID.......SKR.....EHE.....NLSSAIRIY----ILNHL
Q88NJ6_PSEPK/37-105------------A-------ANR---C--SVSAVLSYV........DREVHLRQGG...VR.NFSGLIRVI----CVAWL
Q7VY20_BORPE/16-82------------A-------RDG---M--RVTQLIERL........YDELVQYRGE...AA.NFTSFLRVC----CLRY.
Q0KEM8_CUPNH/15-86------------R-------RDD---M--TVNQLITRL........HDELTEHRGSEAVAG.NFSSFLRVC----CLRYL
Q3J4J5_RHOS4/5-69------------A-------ERG---L--PLNALAAEVD.......EAR....DPEV.....GLASALRVF----VLRHY
B6JB62_OLICO/35-98------------A-------RRG---L--SLSMQIATID.......QNR.....QTN.....NLSSAIRLF----VLDYF
E4PET2_MARAH/15-83------------E-------RDG---M--NLPQMITRL........YHESIDAGHD...LG.NFTSFLRVC----ALRYL
G4RFD5_PELHB/1-64------------D-------ARK---V--SLPNLIAEID.......ETR.....EDP.....NLSSAIRVF----VLAWF
Q5LS66_RUEPO/5-69------------K-------EKD---M--PINVLAGDID.......AAR....DPET.....GLASAIRVY----VLGWY
R5XSE7_9PROT/2-65------------A-------ERN---M--TLNKLVTEID.......GTR.....TTP.....NLSSALRLY----VLKSL
A9HBJ7_GLUDA/7-71------------R-------ARG---L--GVAALIGGID.......ATR....DPAR.....PLASALRVA----ALQEA
B2U9M5_RALPJ/15-83------------A-------DEN---M--TTNALIVQF........HDEILHHRGD...VQ.NFTSFLRVT----CLRYL
C6BV10_DESAD/15-83------------E-------EEQ---T--STGKFISTL........HNEAYSLNGE...IS.NFASLLRVV----CTTYL
A1WLD9_VEREI/15-83------------E-------AEG---R--TTNTLIAKF........HDEILASRGE...VP.NFASFLRIA----CMRYL
V5SG48_9RHIZ/7-70------------A-------REG---V--SLASLIARID.......EAR.....GTA.....GLSSAVRVW----ILDDV
D5BP55_PUNMI/2-63------------T-------KRG---Q--SLASLITEID.......KNR......DG.....GLSSALRLF----VFAEL
D0IW80_COMT2/15-83------------A-------RDG---Y--TVPQLCTKL........YDELLAERGA...VD.NFSSFLRVC----CTRYL
V6EZW9_9PROT/2-64------------E-------RDG---V--SINQLVSVID.......TDR......DG.....NLSSAIRLF----VLNDL
B1M524_METRJ/6-68------------E-------ARG---Q--SVQALIGHID.......AGR.....DGQ.....NLSSAIRVF----VLEAV
G7Z694_AZOL4/2-65------------T-------REH---M--TMSELVSKID.......AER....QDSD.....NLTGCVRVF----ALCYF
Q6G2S1_BARHE/14-77------------R-------KKG---Q--SLAFIITDID.......SKR....PQQV.....NLSSSLRIY----ALQS.
E8RRH3_ASTEC/4-67------------K-------ERR---I--SLAALIAELD.......TKR.....GES.....LLASFCRLS----ALAFV
A1VU33_POLNA/15-83------------S-------RDG---M--SVPQLCTRL........HDELEAERQG...IE.NFASFLRVC----CGRYL
Q11GU9_CHESB/4-68------------A-------AQG---K--PVAALIGEID.......ASQ....SRNT.....NLSSALRLY----VLAEV
D9QJB1_BRESC/2-64------------A-------ERN---L--SHAGLLVWID.......QTR.....GRR.....PLASACRLL----ALEH.
A2SED0_METPP/15-83------------S-------EQK---C--TTNALITKL........YDEATTHRSE...SA.NFASFLRVT----CVRHL
A1B3A7_PARDP/22-85------------R-------AGG---R--TTATLIAEID.......AAR....PPEV.....GLATALRLF----VLAE.
Q5E5I8_VIBF1/19-85------------E-------YQG---L--SVPRFISTI........YKEALEHNGE...VT.NFASLLRCA----CLIY.
G8B035_AZOBR/15-83------------A-------MQG---V--SLGRFLSKL........HDEVLARGVE...RR.NFAGLLRCA----CLTYA
K7SIV6_GLUOY/15-83------------A-------ADG---M--TVNQLITNL........SDEILELRGE...LP.NMASFLRVS----CLRYL
Q28PQ0_JANSC/10-74------------E-------GRG---Q--SVNALVAEID.......AAR....GVSA.....GLASAIRVF----VLRTV
Q87MR6_VIBPA/16-83------------S-------AQD---M--TVPKFISTV........YQEALEYNGE...VN.NFASLLRCA----CLTYA
R5R7N0_9PROT/5-68------------K-------REG---I--NRNRLIEMIE.......NAK....TERL.....GLTYSTRLF----LVLYY
Q5NQS8_ZYMMO/14-79------------S-------KRA---L--PLNALIARID.......AER.VKAADMP.....NLASALRLW----LLF..
R5Q8E2_9PROT/4-65------------R-------EEN---I--SVAALVADID.......NSR......NG.....NLSSALRLF----VLKKL
Q141Z3_BURXL/65-133------------R-------QES---V--TVGKLISRW........ALEIDLTQEA...IC.NFTGFVRII----CVTQL
R6ITS5_9PROT/4-68------------K-------REK---I--NRKMLLEMIE.......SRK....DPKL.....GLTPSIRLF----SLVYL
G2KND8_MICAA/35-99------------K-------RER---C--RIHDVCSLIQ.......LRK....NPNT.....SLTAAIRVF----LMLYY
Q92NP9_RHIME/6-70------------R-------DRD---M--PLARLIAEID.......DGR....GQDG.....NLSSALRVY----VLAWV
Q21US4_ALBFT/16-83------------A-------RDG---M--TVPQLLSTL........YDELLTHRGD...IP.NYSSFLRVC----ALRYL
W0AMC0_9SPHN/9-75------------E-------AES---L--PLNALIARID.......AER.IRADDPP.....NLGSAIRIW----LFRK.
D5AQD4_RHOCB/5-69------------A-------ARG---L--GLNEAAREID.......AAR....DPGT.....GLATAIRLA----VLRHY
Q2G3C7_NOVAD/8-72------------A-------REG---V--PINALVARID.......AER.IASPTPP.....GLAGAIRLW----LV...
Q2RS87_RHORT/10-72------------K-------ARG---Q--SVNDMVTEID.......AGR......SG.....NLSSAIRIK----VLEAY
Q0AMZ5_MARMM/17-80------------R-------DQG---Q--SLASLIGEID.......AAR.....EGE.....PLASSVRIW----VLQAL
A7IN95_XANP2/16-83------------A-------RDG---L--SVNRLLARL........YDEKAEAGRD...ID.NFTSFLRVC----CGRYL
E0TDI6_PARBH/6-68------------V-------RRG---V--PVAQLILDAD.......LKR.....GSQ.....GLASTLRVE----LLAA.
S5YGZ7_PARAH/15-83------------I-------SEG---Q--TTPGFLSTL........QSEVLELEGE...PV.NFTSLLRCA----CLVQL
B6JB63_OLICO/5-68------------S-------ARG---M--TLSELVGEID.......SQR.....KQG.....NLSSAIRLF----VLDHY
A1BB74_PARDP/15-83------------A-------GEG---M--ATPAFLSTL........QSEVLQLRGE...PV.NFTSLLRCA----CLVQL
Q0BVF8_GRABC/3-66------------S-------GQS---Q--TLAQLIAMVD.......ASR....NPDR.....PLASALRVL----ALEA.
B6IXV3_RHOCS/24-88------------E-------IEG---T--TIHQLISMIA.......ARR....HETS.....TLTATIRAF----LVAYF
G8AK62_AZOBR/2-63------------Q-------ARG---M--SVNALIEEID.......STR......SG.....NLSSAIRVH----VLNAV
R6IQM1_9PROT/1-65------------K-------EKG---V--SINQLVTEID.......SAR.....EHE.....NLSGAIRVY----ILKYL
F2J2A0_POLGS/3-67------------R-------SRK---A--SLASVVDAID.......GER....PPEQ.....ALSSAVRVW----VIRTL
W0PKG2_9BURK/15-82------------R-------RDG---T--TTNQLIATL........YDEVYAYRGE...AT.NFTSFLRVT----CMRY.
J7QMW2_METSZ/14-76------------A-------QES---V--SLAALIARVD.......AGR.....GEA.....NLSSALRVF----VLER.
M4S774_9SPHN/4-69------------R-------AED---I--PLNALVAQID.......ADR.VLDPDPP.....NLASAIRVW----LFE..
B8IF14_METNO/8-71------------A-------ARG---L--SVQALIGRID.......AGR.....AEQ.....NLSSAIRVF----VLREV
A8HUM8_AZOC5/15-83------------A-------SEG---S--SVAKFITTL........HDEVLDCRGE...VQ.NLASLLRCS----CLIYI
A8LRP0_DINSH/33-97------------A-------DRN---M--PINALAAEID.......AER....GADL.....GLASAIRLA----ILRHY
S5YRV8_PARAH/10-74------------Q-------VQQ---T--TPAALIAAID.......HQR....PPEV.....GLATAIRLY----VLAEV
A6WUZ0_OCHA4/15-83------------A-------SQN---L--TTPRFISTL........YDEALEANGA...IP.NFASMLRTT----CALYL
G0AAA0_COLFT/37-104------------A-------DND---L--TTNQLIAKL........HDEVTTHLGE...AS.NFASFLRVT----CLRY.
F8J5J1_HYPSM/3-66------------A-------EDG---M--TLAGLINSID.......KTR.....GEA.....GLSSAVRVW----LLERL
G8AI45_AZOBR/22-97------------R-------REG---L--TVNGLCTLIKDRLDEQIRRR....GPGADNAEVTLTSAVRVF----IAAYF
G8ARV8_AZOBR/26-90------------K-------SQG---K--SLEALCADIH.......DSR....TEGI.....PFATSVRVY----VLNHF
B6IW11_RHOCS/3-66------------R-------REG---R--TVHEIVTLID.......RLR.....GDG.....GLTAALRIF----LVGYL
M9R844_9RHOB/9-72------------T-------LRN---Q--TLNGLAIEID.......EAR.....GDV.....GLASAIRVF----VLNSL
R6J4D7_9PROT/7-67------------R-------EEK---L--SRNRLIEIIE.......NSN....RVHL.....GLTYLTRLF----TLFY.
C7JBE2_ACEP3/5-69------------N-------QQK---Q--TLPQLVTKVD.......AAR....SPEQ.....SLASALRVY----ALEWL
A6VZH2_MARMS/16-83------------Q-------RDK---L--SLSQMIAKL........NHEALDAGHN...LD.NFTSFLRVC----AMRYL
V9VUQ5_9RHOB/5-69------------S-------EDQ---R--AINDLAAEID.......EIR....GEDC.....GLASAIRLF----VLRRL
D5BMV3_PUNMI/6-68------------R-------RES---I--DLDSFCQEID.......KRRQFS..........SLASSMRIV----TLFYF
R5QX40_9PROT/1-65------------R-------QKD---M--SINQLVTEID.......AVR.....EQE.....NLSSAIRVY----ILKEL
B9JXQ8_AGRVS/8-72------------E-------NRN---V--AIAALIADID.......SKR....PADC.....NLSSALRLY----VLEWL
Q87Y30_PSESM/6-74------------T-------SNE---C--SVNAVLSYI........DREVHLRYGG...VK.NFSGLIRVV----CVAHL
A0KLC1_AERHH/26-94------------Q-------AQG---R--SMGLFLSEL........YQEALGNGME...MS.NFASLLRCS----CLVHL
Q98KH2_RHILO/5-68------------A-------ARK---L--TLAALVAEVD.......EKR....PRDT.....NLSSALRLH----VLEWA
A5FYB5_ACICJ/15-82------------T-------AEG---V--SVPRLIALL........HDEAEDWFGD...ID.NLASLLRAA----CILY.
D5QBC0_KOMHA/10-72------------R-------ARG---V--GLTILIARID.......TTR....DPMR.....TLASALRVA----ALL..
G2IRZ2_9SPHN/11-78------------R-------AEA---L--PLSALVARID.......AER.IARTEPP.....NLASAIRCW----LLAQA
Q2SKQ2_HAHCH/16-83------------D-------SEG---M--STSQFMAKL........YDEVVEKRGE...VG.NFASLLRVV----CATYL
F2K501_PSEBN/34-101------------Q-------LNS---C--SISTLLSHV........DREVHLRHGG...VR.NFSALVRVV----CVVH.
B2IH09_BEII9/17-85------------E-------ART---L--SVAALIAEID.......AARVESSPSRK.....NLSSAIRVY----ILRTV
Q2K6G5_RHIEC/20-84------------A-------SRS---M--SLAALISEID.......DHR....PPDS.....NLSSALRLH----VLSWA
F6IFI2_9SPHN/8-74------------A-------AEK---I--PVNALIARID.......AER.LEAETPP.....GLASAVRVW----LALS.
B2UET6_RALPJ/16-83------------Q-------RDG---L--TVNQLISKL........YDELFERRGE...VA.NFASFLRVC----CLRYL
Q1GGM9_RUEST/6-70------------A-------REG---R--AINELAAEID.......EQR....GTDC.....GLASAIRLY----VLSAL

PF03869

RMNT_BPP22/2-51------------E-------ANG---R--SMNSELLQI-----------------------------VQDA----LSKPS
RARC_BPP22/4-53------------E-------ENG---R--SVNSEIYQR-----------------------------VMES----FKKEG
G3XCY4_PSEAE/13-62------------R-------SHH---R--SMNSEIIAR-----------------------------LEQS----LLQEG

PF07704

Q92LY2_RHIME/1-78............A-------VLP---VRERLAKSLAMARE...............AGPFAPGNHKRETDDM....WGD--
K9Y1V0_STAC7/1-81NKQI........T-------PLP---LQQELLNIAQRYQT.............LPTLDNRTEEEILGYNDG.......--
VPB42_MYCTU/1-88REDRARAEARRAA-------AEQ---TLRDLDKLLS.................DDDKRLIRRHEVDLYDDS....GLP--
C7NJK7_KYTSD/22-102............H-------AEP---VGRRVDEVLARIDA..........SLAPGDAAAMRVELDRLYDER....GLP--
Q0BQA3_GRABC/5-87RLR.........D-------HVS---RLQRLTVLAADIRA..............HMRGRVSSDHSALYGEG....GLP--
L0DWF9_THIND/1-83RER.........G-------GTR---LADELDEIARACAA.............LPVRDRRSAEEILGYDEH....GLP--
A6WWK7_OCHA4/1-81AERE........A-------QRD---YVARMKAFVRERAS................RYDRRPVTKQEWDEA....VGD--
Q2JGF8_FRASC/9-88ADRD........E-------GEQ---RAARIVALGRQTAA.............AVPPPGLSIED..LYDEH....GLP--
W0ABH3_9SPHN/5-83RR..........R-------ERA---SVSELLAIADRAAR..............MVTKPYAQHGDELYDEN....GLP--
A6X7T6_OCHA4/1-81............D-------SIP---LRDRVKVIQDEFAA.............ILGPNPEPFDMKKFSDEL....YED--
A7IPR5_XANP2/185-260............D-------KEP---LASRLKQIATALAA......EAQPGGREMTKDE........VDEM....WG.--
I6X1P2_PROPF/1-84K...........V-------RQA---RFERIMELAGEIHD..........SMTDEEREALRNVDQEIYDED....GLP--
I3TVZ0_TISMK/1-81QP..........S-------AKA---SVEELLAIADHAAA..............HVKRPYLEHGDLLYDER....GLP--
I3Y9G9_THIV6/1-75............S-------ARP---PAASLLAQFDRIPD.............RTDALD.....PLAWDDL....GLP--
Q20ZG7_RHOPB/1-82RRR.........Q-------TDQ---AAEQLMKIGRRYAS.............LP.DSGRSADDILGYDEH....GLP--
B1M1V3_METRJ/1-75............S-------CLS---LAERLKPLLDRMDA..........VPRTGLEAD.....KAFYDSL.......--
G8NNV7_GRAMM/6-85AAGKN.......L-------SSP---SVEEVLAMIRSFNL....................KPINEDLTDDEILGYG..--
L0J8B6_MYCSM/1-82IV..........Q-------RPD---RAEDLLEVMRTEIR...PLITDRRPVLRSEREQ.....TLGYD.........--
F2J715_POLGS/1-79............H-------EET---PLQTAARLREQHGV.............KLDAAARQPLPREAYDEL....WE.--
K7S7C8_PROA4/1-82RQ..........H-------RVS---SRPDLHHYIERARA.............RAVLDDRDADEIIGYDEN....GLP--
B8EP86_METSB/1-76............E-------AIP---LRDRFVRLRQEHPL..........PPVTGQKAD.....KAFFDGL....A..--
B8IVJ3_METNO/1-83SDA.........R-------KAA---LLEDLAACRRRWST.............LPVLDPRSADEILGYDEN....GLP--
C7NLZ4_KYTSD/1-87AGRR........S-------EDE---RWERVTALVDQIRI..........DLQDAGSGSLSEELTDLYDDD....GLP--
C1A9G9_GEMAT/1-83LRKLG.......A-------VER---SWSRVQRIQERIAG.............GAAASDVTTESVIGYDDQ....G..--
Y2378_RHIME/1-81............D-------EIP---LREKLAALRQQARD.............RLGPPVHGIDMKKLMDEL....WEE--
F5XKW7_MICPN/1-83ARA.........D-------AGS---ASVDLGDLIERARS.............RPDLDVRSAEEILGYGDD....GLP--
L0J8W2_MYCSM/1-78............L-------TQS---RTEDLLNVMATEVW...PLLNDGHPITKQDREQ.....ILDYD.........--
B0T0U9_CAUSK/24-113AAAPR.......H-------KPR---SVEEMRAITRKYLT............PEARAGLLPPITKADFDEINEIPGLD--
VPB30_MYCTU/1-83GRA.........R-------VVP---LRDELAAIRHRCAA.............LPVVDNRSAEAILGYDER....GLP--
Q2RUX5_RHORT/1-81HR..........Q-------AKA---SVEELLAIADRAAA..............QGNRPRVDHADLLYDEH....GLP--
VPB36_MYCTU/1-81S...........R-------AGD---REAQLLDILRTEIW...PLLADRSPITKLEREQ.....ILGYD.........--
I6XS64_PROPF/3-79............D-------EQR---RLDRLAAIEELQAE.............AAPYRHLFLTDDDIHDED....GLP--
H6RSW2_BLASD/1-87VDSPVD......T-------AAH---RAARIRAVAKEIAP............RFRGDVATVEHGDLLYDDA....GMP--
Q92TH7_RHIME/9-88............N-------REK---PLETARRLREKHGI.............VIGGAASKPLQREAYDEM....WDD--
H6RM61_BLASD/1-86RRGTA.......A-------AAD---RTALLQRIAGDAAD............RWVEPYRSSDHGDLLYDET....GLP--
B9JIC8_AGRRK/5-84............D-------AET---PHQTAMRLREKHGI.............ALNNQTQKPLPRDVFDAM....WDE--
D7A0R5_STAND/1-80............R-------AQP---LRKRLARSKALADA..............MGRGDPDFDMKAFTDSL....WGD--
B0SW80_CAUSK/41-123RHQTASLEGRRAK-------VME---TLERFWALPRTGEI.....................LTDADLYDED....GFP--
A7IPR8_XANP2/1-84YGDT........A-------QAR---LLGELRAIRERVAR.............LPELDTRSDEEIVGFDEH....GIP--
K9Y7X0_HALP7/1-79RER.........R-------QTQ---LAENLSKLQEIAQT.................KVQYFDPNTLYDEN....GLP--
L0GTX7_9GAMM/1-83REH.........S-------GQS---LADRLDAIACRMAR.............LPVRDARTPEEILGYDDN....GLP--
D4Z9B0_SPHJU/1-81RQ..........K-------SKA---SVAELLTIADRAAT..............HVKRPYVDHAELFYDDN....GLP--
C3KNS9_RHISN/1-79............Q-------AVP---LKDRIKRLQNEVRA..............MGPDDPDFDMKKFADEQ....WG.--
C3KQT0_RHISN/1-80............Q-------AVP---LKERVKKIQDSVRA.............KMGPNTPGFDMKKFTDEM....WE.--
A6X8D2_OCHA4/6-84............R-------QQQ---ALTPMDALLDLMAE......GRRSVPEGTTSAH.....DDLYDEH....GLP--
VPB28_MYCTU/1-80............R-------SDD---LAARLLAIGHKTAS............RMSPEAKRLDHDALLYDER....GLP--
Q981I6_RHILO/1-76............G-------AIP---LPQRLKALAERYRA..........FPETSAQAD.....KAFFDDL....S..--
Q6N2A9_RHOPA/1-82RRR.........Q-------TDQ---IAQRLLKIGGRYAA.............LP.DTGRTPDEILGYDEN....GLP--
Q219N1_RHOPB/1-83GPS.........R-------KSA---LLQEMADIRRRWSE.............LPVVDDRTPEEILGYDAH....GLP--
Q7NGE7_GLOVI/4-85AQTRS.......R-------REG---IAERLLALGTRSVA.............LPILDPRAPDEIL.YDEN....GLP--
A1T4A5_MYCVP/1-80............Q-------QDD---LAERLLALGRRTAQ............RMTSATKNLDHGELLYDDA....GLP--
K0FC64_9NOCA/1-82A...........E-------HET---VLDDLRTISADMHA............IVRESGYPPLTTDDLYDDE....GLP--
B1LSI4_METRJ/1-77............N-------RPD---LVARTADFVRALHE..............RAGPDRKPADAAFID......GLY--
C3KQV7_RHISN/1-83NAG.........N-------RDV---LLEELAASRKRWAR.............LPVADNRSADEILGYDGN....GLP--
D3PLA4_MEIRD/1-79Y...........P-------QRP---SKESVLEFLEREVWAKLPPESLGKAPTKAEQEE...................--
L0E2P5_THIND/1-78GDA.........R-------QAD---RLSALLAQLDRIPE.............RADAYD.....PLSWDEH....GLP--
B2IL59_BEII9/1-77............A-------TES---LAEQAVRFCRDLRA.............RSHPERGQPADKAFFDEL.......--
U5QCJ3_9CYAN/4-85GQTRR.......R-------RQG---IARRLLALSTRSTA.............LPVLDPRPPDEIL.YDAH....GLP--
C8XHZ8_NAKMY/1-83ARK.........R-------AND---PDLGLDEFIRRGRE.............RAVLDERSPDDIIGYDEH....GLP--
Q92RQ4_RHIME/1-83TAA.........R-------RAA---LLEDLEAIQRRWNA.............MPVLDSRSSDDIIGYDED....GLP--
Q5SKZ1_THET8/1-84............Q-------RKR---SFDRVIRFLEEEVWPQIPPELLGKGLSKEEEEE.....ILGYGKE.......--
A5FU30_ACICJ/1-78............E-------AKP---LRERLREWREANPL..........PPPTGLKAD.....KAFFDDL....SGE--
Q1QF44_NITHX/1-83SQA.........R-------KAA---LLEDMEAMQRRLNA.............LPILDPRSPDDIIGYDEN....GVP--

PF09957

Q82BL1_STRAW/2-49G.VTT-------K-------KET---VNAALRDYVARI----------------K....RL....DAAEKL---------
Q20X13_RHOPB/8-51G.VKE-------K-------SAV---IKKALQAYVESE----------------A....AR........RL---------
Q2FLV1_METHJ/1-47G.CNT-------K-------KAA---VTEALIEYIQRR----------------K....QI.....QITSL---------
Q58AH0_RALME/1-44G.LSE-------K-------TAI---VREALKALIQRE----------------A....AK........RL---------
Q3JAZ0_NITOC/1-47S.VKS-------K-------KEL---VHLALKEFVEHH----------------Q....RK.....DLREL---------
A1U2W3_MARAV/1-47G.YET-------K-------KEA---VEQGLKLLVQLS----------------K....QQ.....EIRKL---------
A1VX34_POLNA/1-45EPGIE-------K-------SEL---IRECVKAFIQRQ----------------A....AR........RL---------
Q7AQ19_MYCLE/3-56G.LLG-------R-------REA---VHLALKALLGEP----------------GVGGLSEQ..DPEYDEF---------
Q73PC1_TREDE/1-47G.YST-------K-------KET---VNTALEEFIKRR----------------K....SE.....DLIKL---------
B3EKM2_CHLPB/1-47D.AKT-------K-------KAL---VEEALEVLIRLK----------------K....RK.....DLTEL---------
Q73R95_TREDE/1-44K.IKT-------K-------TEL---IEVAIDNLIKKY----------------Q....IQ........DL---------
Q7NCS8_GLOVI/1-47N.VRT-------K-------KEL---LQLALQELIRAR----------------K....KR.....NLLDL---------
A8ZTF6_DESOH/1-44G.IKE-------K-------TAL---VKLGLEALIARE----------------S....GK........RL---------
Q7D057_AGRT5/1-48G.LPT-------K-------KAT---VEKALRDLVENL----------------G....RR....KALQEL---------
Q2FNJ2_METHJ/1-47G.VKT-------K-------KGV---ITEALIEYIQRR----------------K....QI.....EIISQ---------
A5G896_GEOUR/35-78G.ITE-------K-------TSL---VRLGLQALIAKE----------------S....SK........RL---------
A5GB97_GEOUR/1-47K.HAT-------K-------KAV---VNEALAEYIQRR----------------K....QA.....EIINL---------
Q73SG9_MYCPA/11-61H.LAD-------A-------REA---VNLALRTLLHEG----------------D...SVAS..EDEYDEF---------
A0ZI46_NODSP/1-47G.IKT-------Q-------REV---IELGLKTLIKLK----------------E....QE.....KIKTY---------
Q01QU3_SOLUE/1-47G.LKT-------K-------RDA---VELGLQTLLRLG----------------R....QA.....QIRRL---------
A4XJM6_CALS8/1-47G.VKT-------K-------KEA---VEIALKEFVENH----------------S....RK.....KLSEL---------
Q124P4_POLSJ/1-47G.ART-------K-------REV---VDRALREMVARA----------------R....RP.....SIREL---------
B1WYD1_CYAA5/1-47G.HST-------K-------REV---VEAALKEYVQRR----------------K....QL.....EITEL---------
B2HSG4_MYCMM/3-54R.LAG-------P-------REV---VHLALRTLLAEA----------------GE.NGGGD...DEYDEF---------
B8GLV4_THISH/1-43G.MTE-------K-------AAL---VREGLRALIERE----------------S....AR........R.---------
VAPB6_MYCTU/3-45A.VHT-------K-------KEA---VNLAMRDYVERF----------------R....RI.....EA...---------
Y634A_MYCTU/16-68R.VKG-------A-------REA---VNLALRTLLGEA----------------D...TAEHGHDDEYDEF---------
VPB15_MYCTU/7-50R.LDS-------K-------RSA---VDLALRRLVGEP----------------L....GR....DE....---------
VPB11_MYCTU/7-49G.LTT-------K-------RAA---VDLALRRLVGSP----------------L....SR.....E....---------
Q8YSF9_NOSS1/25-71N.LTT-------Q-------EEL---MNLALQEFVRSR----------------R....KK.....NLLDL---------

PF09274

E5YNK1_9ENTR/1-74------------A-------KQG---T--SITDVIKDL-----------------------------VDNW----LKEND
A0A034V0K1_ERWAM/1-76------------V-------KNG---T--SITDVINQL-----------------------------VDNW----LTEHE
B0ZE05_ECOLX/1-76------------A-------RKG---T--SITDVVNQL-----------------------------VDNW----LKENE

PF05509

B8EFN4_SHEB2/13-61------------E-------RSA---RSKRAEIQLRIE------------------------HSLLSFVDAPPKPIKQ--
Q4LC31_SODGL/14-62------------Q-------KTG---KSRSGEVKLWVQ------------------------DHLKRFPDFNPDSREV--
B6ESX2_ALISL/7-55------------E-------TSG---RTKRNEAAARLK------------------------DHLLRFQHQDSWEVQK--
A7DVG3_VIBVL/13-61------------A-------YNS---RTKRAEAQARLE------------------------HHLELFGVNWEVPKSK--
B2LS54_9VIBR/10-58------------T-------HSK---RTKRAEAQARLE------------------------HHLDLFGVNWEVPKNN--
B8EFW0_SHEB2/41-89------------K-------RNN---RSKRKEAQARLI------------------------DHLSRFDEMGMGLKGK--
B6ET57_ALISL/12-52------------E-------RNG---RSKRAEALAIVK------------------------KDIQ........QKLT--
A6ASC2_VIBCY/12-60------------E-------FNK---RTKRQEASFRLS------------------------DHLTKFDRHMTPRAKA--
Q7MBP1_VIBVY/10-58------------K-------ENK---RTKRQEASFRLS------------------------HHLTHFDEHMKPRTKN--
A7N8Z3_VIBCB/12-60------------E-------AND---RSKRKEARFRLK------------------------DHLSKFNQHMKPRAKS--
Q5DY84_VIBF1/10-58------------Q-------KTG---RSKRQEAAIRLA------------------------DHVARFSALNEFEYIE--
B5PNJ9_SALET/24-72------------L-------KSG---RSKKREAELRLE------------------------DHLRRFSLVPAEEQYI--
A6D5H0_9VIBR/18-66------------D-------ESG---RSLRKEAKLRLE------------------------DHLNSYSNIASVGNNV--
Q6LW96_PHOPR/20-68------------G-------RSK---RSKKKEAEIRLA------------------------DHLDRYTLIPKSKCQY--
A8QYN9_9GAMM/15-63------------M-------RSG---RKKIPEAALRLE------------------------DHLIRYRSISELNQTI--
A7N8V1_VIBCB/9-57------------Q-------RSF---RSLKKEASLRLI------------------------DHVQRFHHSPQNKLDE--
E6WK64_PANSA/14-62------------E-------RSG---RSKSGEARLRLM------------------------DHLTFFSEIACSGKRF--
D4IGT0_ERWAE/12-60------------E-------RSG---RSKTKEALFRLT------------------------DHLDTYSDLATPGIRF--
B2VB54_ERWT9/25-73------------D-------RSG---RSNTKEAYVRLD------------------------DHLKSFTDLATPGLRF--
B6ICE9_ECOSE/13-61------------K-------AAG---RSKSLEATLRLT------------------------QHLNSVPVLGENSYWE--
A0A023MW99_SALEN/14-62------------D-------RSG---RSKTIEVQIRLR------------------------DHLKRYPDFYNEEIFR--
A0A026GSK1_ECOLX/14-62------------E-------RSG---RTKTNEALVRLQ------------------------DHLQRYPDFYNEEIFR--
A0A024LLK2_ECOLX/14-62------------D-------RSG---RTKTNEVFIRLK------------------------DHLNRFPDFYNASLVK--
A0A025IEW1_ECOLX/14-62------------E-------RSG---RTKTNEVLVRLR------------------------DHLNRFPDFYNLDAIK--
A0A024KL39_ECOLX/70-118------------N-------RSG---WCKTDEAADRVI------------------------DHLIKFPDFYNSEIFR--
A6TIF9_KLEP7/67-115------------N-------KSN---RSKSHEVYLRLK------------------------AHLFEFPDFYSSEVEV--
A0A016QUU3_KLEPN/72-120------------N-------RSG---RSKSLEVYLRLK------------------------AHLLEFPDFYSSEVEV--
Q1MKC7_RHIL3/2-50------------R-------RTG---RSKCFYVRQAIL------------------------AHLDDVEDIYLAERRL--

PF07362

H0Q687_9RHOO/11-81------------A.......ERRAELWLAENRNALESS----------------NAYVEAHGLPLARYRMF---------
K0I4M5_9BURK/9-79------------Q.......RRYWERWNAANQEAIAAY----------------NARIESEGLPLAQYRTF---------
L0DQK3_THIND/1-68------------R.......EQRRKLWLAENTGAIEDY----------------NSRIDARGSYADRVRRF---------
B5EG30_GEOBB/12-82------------R.......KETSRSWQEENREAIEEY----------------NSRVQSDGTFSDDLRHF---------
D4YZH7_SPHJU/13-83------------A.......KERGRLWRVENASALASS----------------NDYVEQNGLPLTRHRQF---------
B2JXB4_BURP8/10-80------------K.......AEEGRRWAQENAEFIKNT----------------NDWVEQNGLPLAEYRMF---------
Q82VK5_NITEU/17-87------------R.......HEQERRWREEHADFITAY----------------NATIEAENLPLDEWRSF---------
B0T4X1_CAUSK/3-80------------QKVDPAGAEERARQWVEENAAVISEL----------------NRFVEEHGAFGAEWRRW---------
E0SK21_DICD3/2-72------------R.......RIKAEEWKKENREGMEEV----------------ARFIAQHGSFADENRNW---------
Q1GN85_SPHAL/11-80------------K.......KAREAAWKKENRAAIESW----------------NDYIRENGMPYDEYRQ.---------
Q326Z9_SHIDS/2-72------------R.......RLRAERWQAENQQGMAEI----------------ARFIEMNGSFADENRDW---------
D3VG79_XENNA/22-92------------K.......SAAAEQWKRDNREGFEEL----------------NRITREHGLLSDQYRTF---------
W0L945_SERFO/12-76------------E.......AKKNER..EKEKADIQAM----------------NLFMEKAGMLSDD....---------
F5XZ64_RAMTT/9-77------------SQQ.....QQARGSHQQWAAACAAGW----------------NEIYEKVGSFADE....---------
G7Z7L4_AZOL4/17-86------------QDE.....RRKRDDDPAHRRKVVAAW----------------NAFDEKHGRFADE...W---------
Q98F99_RHILO/26-96------------A.......KKKTLQWQAENKKAIASS----------------NGYVSRNGLPLAKYRPF---------
S5Z1L5_PARAH/10-80------------R.......EAQAAAWKQENAAALASS----------------NAWVDENDLPLARYRPF---------
A5GAE8_GEOUR/23-93------------R.......EEKRRQWLEENREAIEVY----------------NRRIEADGVFSDGLRRF---------
Q93GR6_SALTY/2-72------------R.......RLRAERWQEENREGMAEV----------------ASFIEANGSFADDNRNW---------
A7HPK7_PARL1/5-75------------R.......EEERKRWVEENRDAIEAF----------------NRRIERDGVWSDGLRRF---------
E1VR77_9GAMM/21-91------------N.......AKQRELWKRENKTAIEAY----------------NQLVDEHGTFSDELRSF---------
G7ZEQ7_AZOL4/20-89------------A.......ELQRKRWLEENREALASS----------------NAYVEAHGLPLARYRP.---------
Q5P2R6_AROAE/22-92------------R.......RERARRWKEEYAEFIEVY----------------NRIVEAEGVPLAEWRSF---------
Q32K47_SHIDS/7-77------------K.......KHAATRWREENAEAIAAL----------------NQLADETGCFSDEYRRF---------
A0L724_MAGSM/11-81------------A.......ERQQQVWKEENQEAIKQY----------------NSRVLTDGLFGDKLRQF---------
A8GC18_SERP5/8-78------------R.......QHEMRKWKEDNREAIEAL----------------NRFHDEHGCFSDEYRTF---------
A1U420_MARAV/11-81------------K.......LHKRSKWLNENAEAIESS----------------NAYVEANGLPLARHRQF---------
Q8PCL0_XANCP/29-98------------TKE.....RDSHSARAMELQRAASEW----------------KTFTDAHGSFADE...F---------
S6AR37_PSERE/11-81------------K.......ARQRELWLEENRTAMAAY----------------NEKVEAEGVFSDDVRRF---------
Q6D9V2_PECAS/2-71------------R.......RIKAEEWKKENRERMEDI----------------ARFIAKNVFFADENRN.---------
Q21DI4_SACD2/11-81------------A.......QAEATKWAKKNKAAIKAY----------------NSFVEENGCFADEYRAF---------
I1XLK6_METNJ/11-81------------A.......KLNSEKWAEENKNAIQAY----------------NEFVEEHGCFGDEFREF---------
Q7N4P4_PHOLL/9-79------------K.......AVESERWKRENKAGMEEL----------------NRITNEHGLLSDKYRVF---------
F2GB87_ALTMD/11-81------------K.......SVEEESWKKENKAAIAAY----------------NEFIAENGCIGDEYRNF---------
Q21U54_ALBFT/9-79------------N.......RRYWEKWNEDNQVAIDHY----------------NARIDSEGLPLAKYRSF---------
C3MCA1_RHISN/7-77------------R.......AEQERLWRVENAKSIVDA----------------NDFVEKRGLPLAKLRQF---------
B3PDY0_CELJU/63-133------------R.......NEQRAQWLRENADAIKAY----------------NQFVESNGTFSDSIRKF---------
C7JJ40_ACEP3/1-66------------A.......SVRAQQWLAENRSSLEAS----------------RQYVEKNGLPLADYRNF---------
R9VLC6_9ENTR/11-81------------R.......NLAAERWKRENAAAIADL----------------NEFIAERGHFSDEHRKF---------
K7SHF6_GLUOY/17-86------------QSA.....RQQREDEQRKLDGVIDAM----------------NDLHARHGFLSDE...F---------
K7ABL7_9ALTE/6-76------------K.......VAKYERWCQENQQAIAQH----------------NRKIDEQGTFSEKLRSY---------
E0SMR7_DICD3/9-79------------R.......ASEAERWQRENRAGLQEL----------------NRITDEHGLLSDDYRTF---------
C4LCG0_TOLAT/11-81------------H.......EKKKAEWLQQNVEAISAC----------------NELTEKHGLFSDSFRAF---------
D5QE46_KOMHA/17-86------------HAA.....REKREDEQRQLDSVIDVV----------------NALHARHGFLSDE...F---------
K0C8E2_ALCDB/11-81------------A.......RHESARWVEENRAAITKY----------------NESVEQHGCFGDEFREF---------
M4XDA7_PSEDE/11-81------------K.......QRLARQWLEQNREAIDSY----------------NRHVEENGVFSEGLRSF---------
H2IXW0_RAHAC/27-92------------K.......EKQRTLFLEENQQAMDSC----------------NAFTEKAGLFSQ.....---------
Q2RNE8_RHORT/14-84------------A.......ERRADLWLAENRTALASS----------------NAFVEEHGLPLAKYQRF---------
Q7MZJ1_PHOLL/2-72------------Q.......RIKAESWKADNRKGLEEI----------------AQFIEQYGSFADENRNW---------
G7Z9X1_AZOL4/11-74------------..........AKADRERRLDDVIEAW----------------NRFDEKHGSFADQ....---------
V6F3K3_9PROT/6-76------------R.......EARAKAWAEENRDAIESQ----------------NRWIEKHGLFSDHFRFF---------
I2B9K4_SHIBC/6-76------------K.......KHASTRWKEENREGLEAL----------------NRFHDEHGHFSDDYRAF---------
B2VJI7_ERWT9/12-75------------E.......AKKYQS..EQEKEDMQAM----------------NVLMAEAGTLTD.....---------
D3VAK1_XENNA/23-87------------E.......ARKNEQ..IQEKQDMQAM----------------NAFIERAGMFTDD....---------
E6X2R7_NITSE/11-81------------K.......EKEEKQWRKENRTAIEVQ----------------NRRVEKEGAFSDEFRRF---------
Q6D8L1_PECAS/2-72------------H.......RIKTEVWKKENREGMEDV----------------ARFITQNGSFADENRNW---------
G0A2L0_METMM/9-79------------R.......GEREKRWQQEHAEFIAAY----------------NQTVEQEGLPLDEWRSF---------
D6Z0A2_DESAT/12-82------------A.......ERRAQLWLEENQAALESS----------------NEYAERNGLPLARYRSF---------

PF10723

Q93GS8_SALTY/8-88--------------------KKT---THKELNVFIQNI-----------HKESLQQLCEETGTTQAQMIELLIEREMAKR
Q326V9_SHIDS/1-86--------------------KRL---THKEIKVFVKNP-----------LKDLMVEYCEREGITQAQFVEKIIKDELQRL
Q326M6_SHIDS/1-79--------------------KKG---THKAINVFIQSE-----------LKDDLTQLCKDSGLTQKEMIEHWILKEKAA.

PF04221

DINJ_ECOLI/4-84------------REKALPFDLREP..NQLTIQSIKNSE---------AGIDV......HKAKDADDLFDKL---------
Q9KML3_VIBCH/3-84------------NHGGIPFELRVPQPNEVTASAIQELV---------EGKG.......HKAESVEAMLNEL---------
Q9PBQ9_XYLFA/4-84------------QDKALPFEPLIP..NATTIKAMREAR---------AGKGE......TVTLGELRATIRA---------
RELB_HAEIN/5-93------------KTRSIPVDLNYLRPNKETLAAIDELD---------SGNAESFFIEASENYSAEEFTKRI---------
RELB_ECOLI/1-78------------DNERLPFKQTLLSDEDAELVEIVKER---------LRNP..........KPVRVTLDE.---------
Q9A0Y8_STRP1/13-96------------LTGGIPFDVSLPEAPQRVNVDYMSQE---------KFYDK.....LITSFEDAKTGNRQ---------

PF03693

PARD_XYLFA/1-78--------------------QGG---RYGTASDVVRAGLRLLEEHETKVKALQDALNVRHQSGEPRPFDSEVFL...SRM
PARD1_CAUCR/2-82--------------------ADG---RYGSASEVIRAGLRLLEENEAKLAALRAALIEGEESGFIEDFDFDAFIEERSRA
PARD_VIBCH/1-80--------------------QSG---RYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDAD.YDLDSFINELDSE
PARD1_MYCTU/1-80--------------------AAG---RYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRAD

PF14384

A1AQ37_PELPD/17-82--------------------KG....WQTRMNEALREWL-----------------------------------------
Q73R28_TREDE/11-81--------------------KKNNVKYQTMINEILSKYA-----------------------------------------
B0JRR8_MICAN/35-94--------------------EG....YQTSINRALREYV-----------------------------------------
Q92KN5_RHIME/26-103--------------------KG....WQSRMNEALRKAA-----------------------------------------
Q3J2R4_RHOS4/23-97--------------------PG....WQSRMNRALREAV-----------------------------------------
B8F509_HAEPS/13-99--------------------QG....WQTRINEVLLKHI-----------------------------------------
A5GE33_GEOUR/45-107--------------------KG....WQSRIDAALKEWM-----------------------------------------
A1WJ32_VEREI/17-83--------------------SG....WQTRMNDALKDWV-----------------------------------------
A6WWJ1_OCHA4/29-103--------------------KG....WQSRMNEALRKAV-----------------------------------------
Q2RSU6_RHORT/41-96--------------------TR....YQTRINAVLRAYM-----------------------------------------
E3I091_RHOVT/23-97--------------------AG....WQTRINDVLRRAV-----------------------------------------
Q215B0_RHOPB/13-90--------------------AG....WQGRIDDALRKIV-----------------------------------------
C4K882_HAMD5/42-98--------------------DG....YQSRLNRILRSAM-----------------------------------------
Q20YH7_RHOPB/27-93--------------------AG....YQARMGEVLKSHM-----------------------------------------
D3SAY2_THISK/33-91--------------------KG....WQTRMDSALKDWL-----------------------------------------
C4KAB9_THASP/30-98--------------------PG....WQTRMNDALREWV-----------------------------------------
Q28LR0_JANSC/24-89--------------------PG....YQSRMNDVLRAFM-----------------------------------------
D5X2J5_THIK1/28-104--------------------KG....WQTRVNAALRQYL-----------------------------------------
A8HS57_AZOC5/58-131--------------------KD....WRTRMSEALDKAV-----------------------------------------
B1M0P6_METRJ/36-100--------------------PG....WQARINAALMEAI-----------------------------------------
A9BQV6_DELAS/27-103--------------------QG....WQTRVNELLRADI-----------------------------------------
D5CSA1_SIDLE/6-67--------------------ETSGGSYQTMMNEALKQYA-----------------------------------------
C1DP04_AZOVD/25-95--------------------SG....WQTRLDQALKEYV-----------------------------------------
A1WLU7_VEREI/13-87--------------------HG....WQTRIDDALKDWL-----------------------------------------
Q73LQ6_TREDE/25-85--------------------KG....YQTRINSILREAI-----------------------------------------
A5V5L4_SPHWW/13-90--------------------PG....WQSRMNEALRKAA-----------------------------------------
A6WZ44_OCHA4/29-94--------------------PG....WQGRVNEALRKAK-----------------------------------------
B0T4V2_CAUSK/34-92--------------------KP....YQSEINRVLRQHV-----------------------------------------
B6JFY4_OLICO/17-84--------------------AG....WQSRINADLRKAR-----------------------------------------
C5D0R5_VARPS/7-82--------------------PG....WQTRANDALRDVF-----------------------------------------
Q8KUW1_SYNE7/45-104--------------------PG....WQTRMNAALREWL-----------------------------------------
Q0KBY4_CUPNH/27-90--------------------EG....WQTLMNATLNVAL-----------------------------------------
B6IVZ4_RHOCS/9-71--------------------PG....WQTRANALLRNAL-----------------------------------------
Q2KVN5_BORA1/5-79--------------------AG....WQTRIDAALKDWL-----------------------------------------
Q39RZ9_GEOMG/16-77--------------------EIIGGNYQTLMNDALRQFA-----------------------------------------
A8GIR2_SERP5/28-84--------------------KG....YQKRLNAVLRAAM-----------------------------------------
A9IES8_BORPD/41-97--------------------KG....YQSRINAILRREM-----------------------------------------
A1VRX0_POLNA/13-87--------------------DG....WQTRIDAALKDWL-----------------------------------------
Q31JV0_SYNE7/18-82--------------------PG....WQTRMAELLSKET-----------------------------------------
A1WB35_ACISJ/28-89--------------------DG....WQTRINEALKSWV-----------------------------------------
B2ICD8_BEII9/27-96--------------------SG....WQSRVNDVLREFV-----------------------------------------
Q73L16_TREDE/8-67--------------------KG....YSSVLSRIIDEAF-----------------------------------------
C3M8F8_HAMD5/13-85--------------------KH....WQSRMDCAMKNWL-----------------------------------------
C7RRD3_ACCPU/30-92--------------------EG....WQSRMDGVLRQYV-----------------------------------------
B6IW20_RHOCS/40-99--------------------RG....YQTRINAALRAYM-----------------------------------------
A8LQR3_DINSH/3-99--------------------PG....YQARINRLLATYA-----------------------------------------
C4KAB3_THASP/28-89--------------------DG....WQTRMDAALKDWL-----------------------------------------
A3N0B8_ACTP2/11-88--------------------KG....WQSRMNQVLEDYV-----------------------------------------
D4ZU97_ARTPN/29-87--------------------QS....YQTEINRLLRSYM-----------------------------------------
K9XMQ0_9CHRO/29-86--------------------RG....YQTQINQLLRAY.-----------------------------------------
Q2L2E1_BORA1/28-86--------------------AG....WQTRVDAALRDWL-----------------------------------------
Q63NA3_BURPS/28-88--------------------EG....WQTRMNDALREWL-----------------------------------------
Q6N573_RHOPA/22-88--------------------RG....WQSQINADLRRV.-----------------------------------------
Q7CI23_YERPE/12-90--------------------DG....WQTKMNEALRDYA-----------------------------------------
Q7CP71_SALTY/37-93--------------------KG....YQTRLNAILREAM-----------------------------------------
Q9PD17_XYLFA/28-105--------------------KG....WQTRVNAALRQFI-----------------------------------------
V6F518_9PROT/28-104--------------------KG....WQTRANEILRK..-----------------------------------------

PF16777

I9TP66_HELPX/21-81--------------------ADE---EVESVNSFVKRH--------ILKTIIYKKGTNQDSSINCDSSSRL---------
I9SLK1_HELPX/21-81--------------------ADE---EVESVNSFVKRH--------ILKTIIYKKGTNQDSSINCDSSSRL---------
M3NJJ4_HELPX/21-81--------------------ADE---EVESVNSFVKRH--------ILKTIIYKKGTNQDSSINCDSSSRL---------
J0RAY0_HELPX/2-62--------------------ADE---EVESVNSFVKRH--------ILKTIIYKKGTNQDSSINCDSSSRL---------

PF07764

T0VBY9_9ENTE/1-69--------------------AKNGGNVKEVMDQALEEY------------------------IRKYLPDKL---------
I3U5Z1_ENTFC/1-71--------------------AKNGGNVKEVMEIRLRSK------------------------LKSVLIVQY---------

PF11903

Q4KC28_PSEF5/1-66------------E-------LNPHLAYN.............................DLINKLLLNK.......PDLLRG
B4SF37_PELPB/2-74------------L-------DNPDLPID.............................FIRDLLVARAEGESLSTPFVPEG
A0QXV1_MYCS2/6-107------------S-------SQHTAARRRVEAALAGDLALRDLTPEEGVVFNAEISAAIEENLAHTDYGQVLAGRGVTTV
A9BMX0_DELAS/1-73------------E-------HHPHLDYA.............................GICALLLQEAAATLKLGEPEAAP
A6T935_KLEP7/1-66------------E-------LYPELNHQ.............................QIKLLMLKSG.......SDRLLE
Q7NVK9_CHRVO/1-73------------E-------LNPDLRYS.............................EICQLLLKAGQDGGGLDLRRQAM
A1T476_MYCVP/6-107------------S-------SQHSVARRKVEAALAGDVHTRELSDEEGVVFNAEISAAIQERLASADYGAVLATRGITTV
Q3AQ94_CHLCH/4-76------------L-------DNPDLPVS.............................FIAESLASLAEPREHATPFIPRS
Q1GXH1_METFK/1-73------------E-------MHPQLNYT.............................DICRLLLHIEQSGSEVGNALKPA
Q2SQH0_HAHCH/2-95------------E-------RSGVLSYERIRSFLSGEI........QIDNLNNDERLMASRTLFDQFIDDDFSSVTDELK
Q13JR3_BURXL/1-70------------E-------MNPTLSFN.............................EIATRELRAA...GVVTQAVKVA
Q15VU5_PSEA6/1-66------------E-------LNPTLTFS.............................ELIVKELENA.......NADTAL
Q0RY55_RHOSR/40-141------------E-------ASHSVSYRDVADVLDGRRDYDELTDREQAVVRAEWTERITERREGLNLAEQFAHSGRSYV
Q220F4_ALBFT/1-73------------E-------MHPELDSR.............................EICQLLIRAELAGGLDIGVAVTG
Q47D61_DECAR/1-73------------E-------LNPNLRYG.............................EICRLLIQAEHQALEDSDLPVSL
Q0C2J2_HYPNA/1-68------------E-------MHPTLSFN.............................EIVQREMAAA.....GVTPEPLG
A7HVP7_PARL1/11-109------------E-------KSGNFDYARITAALSGEIGTV...DLTCEEKDVWLDSFVEKMGQPGSDEEAWFARRRQLG
A4Y172_PSEMY/1-70------------E-------MNPALSFN.............................EVMAAEMRAA...GVAVPPRMAD
D0J2S6_COMT2/1-68------------E-------HHPQLNYE.............................GICALLLQQAERELQPASAH...
Q63SV8_BURPS/1-72------------E-------LHPTLSYA.............................EICRLLIETEIQGDEAAPSVDAA

PF11020

F4F896_VERMA/2-77--------------------RVRGGSVPTEVMDAFATL----------------FTIALENNVSFEELCAYAMEQATD--
Q73H58_WOLPM/5-85--------------------KERGGNIPNKVKESLQKL----------------YKLSQENGVSFSELCAYAITVVSN--
B3S7R4_TRIAD/8-90--------------------EVRHGQIDSSIHEALSKL----------------FQLANGNNLPLEQLIELFLSN...--
Q2GKE5_ANAPZ/4-84--------------------KERGGQVPERVINSLERL----------------HKLARENGICFAELCVYALKVATT--
C4YV51_9RICK/4-84--------------------DERGGTIPDEVMKAISQL----------------NDLAKKNGVPLPDLCVYALGSAQE--
B9KIB3_ANAMF/4-84--------------------KERGGSVPEKVRNSLEKL----------------HELAKKNGICFADLCVYALNVASR--
F7XUD1_MIDMI/1-81--------------------KERGGQVPPQIVESLIKI----------------QKLAADNSVEFEELCYYALEAANN--
Q2GCJ4_NEOSM/1-81--------------------KERGGVVPQKVMDSLSKL----------------RELAEENNVSFEDLCVYALKVAEQ--
K9QB18_9NOSO/702-781--------------------KARGCEVPKDVVESFQKL----------------YKIARENNVSFADLTVYALSNANQ--
A5CC80_ORITB/1-81--------------------TERGGVIPAEVMDSITQL----------------VELSKKYQVPIEELVVYALGSAQG--
Q2GG71_EHRCR/4-84--------------------KERGGNIPEKIKDSLAKL----------------HALAQKNGICFADLCVYALTVASH--

PF15970

B4EVM4_PROMH/3-83--------------------SDI---LHVGLEEFISSK---------------MPIPMPSEPQSGDFIVYLPPISCLKIA
Q0WCU1_YERPE/3-83--------------------QEG---IKNGVAAEMEER---------------RLIPAPSALQPGDIAVHVPILVRLKAE

PF01340

METJ_VIBVY/3-99------------R-------RQINNLRHATNSELLCEA--FLHAYTGQPLPTDEDLRKDRPDDIPTEAKELMTAMGIE--
Q15NT2_PSEA6/6-102------------R-------RQVNNLRHATNSELLCEA--FLHAFTGQPLPNDNDLQKDNDNRIPSDALRIMQEMGID--
K7AFK6_9ALTE/6-102------------R-------RQVNNLRHATNSELLCEA--FLHAFTGQPLPDDEDLGKDNTQLIPKEVRKLMMEMNLS--
Q489Q2_COLP3/3-99------------R-------RQVNNLRHATNSELLCEA--FLHAFTGQPLPDDEDLAKDNNEKLPASVRRLLEAKGIT--
METJ_SALTY/3-99------------R-------RQVNNLRHATNSELLCEA--FLHAFTGQPLPDDADLRKERSDEIPEAAKEIMRELGID--
Q5QV41_IDILO/2-95------------R-------RQINNLRHATNSELLCEA--FLHAFTGQPLPEDEDLQKSNPNKIPKAVREELEAR...--

PF10715

REGB_BPT4/2-151VLEVNEFLSMPPRPDIDEDFIDGVEYRPGRLEITDGNLWLGFTVCKPNEKFKDPSLQCRMAIINSRRLPGKASKAVIK--

PF08681

Q8E866_SHEON/19-95--------------------LDN...PRKATPVLKTLFS.........E-------------------------------
Q7N880_PHOLL/12-90--------------------LDA...PAVPNERLIKTA.......NMKK-------------------------------
Q7N7Z2_PHOLL/8-88--------------------LEK...PIKVNERFLRAAR......RHKE-------------------------------
Q92P91_RHIME/11-90--------------------LEN...PPAPTPALLAAAR......RRIA-------------------------------
B3EP86_CHLPB/11-90--------------------LEE...PPAPNEKLTAAAF......ALPK-------------------------------
Q7NIQ1_GLOVI/13-92--------------------FNA...SPKEHQRLRQLLS......PLGV-------------------------------
Q7NLC6_GLOVI/11-90--------------------ILN...PPEPNDELRQAAK......EYQR-------------------------------
B4SB08_PELPB/10-88--------------------LDA...SPRELPRLKKLF.......QEQS-------------------------------
Q5P620_AROAE/9-88--------------------LLS...PPQPSPALERAFV......RRSK-------------------------------
Q2SAN8_HAHCH/11-89--------------------LDR...PVQSKPRLKKLL.......REPG-------------------------------
C1DE12_AZOVD/13-92--------------------LDR...PPQPNERLRKTL.......QTPA-------------------------------
Q8ZL97_SALTY/13-91--------------------LDA...PVADDPVIEKLL.......ARKP-------------------------------
Q8XPL2_RALSO/16-98--------------------LDE...PAKPNEALRRAME......RFRK-------------------------------
Q6LIX8_PHOPR/32-112--------------------LDE...PAKPNARLQHAAA......RYKD-------------------------------
Y420_HAEIN/9-88--------------------LSK...PFEPNPSMKNALD......VYEA-------------------------------
Q5P632_AROAE/5-83--------------------LDA...PPGPNPGLERLM.......AVQA-------------------------------
Q5NX70_AROAE/9-88--------------------LLS...PPKPSTALKRAMA......KHDQ-------------------------------
Q7N6D8_PHOLL/7-86--------------------LLN...PPESTPALERAFA......RHRS-------------------------------
Q7N0J5_PHOLL/11-90--------------------LDN...PPAPNDKLLAAAF......ALPK-------------------------------
Q6ZEG7_SYNY3/12-91--------------------LLR...PSEPNSKLKKAAL......RHQQ-------------------------------
Q87ZN7_PSESM/15-103--------------------LNEEDTDATPTPELLKLMRGQHGQREHRS-------------------------------
Q3SNN6_NITWN/19-98--------------------LMK...PLPVNDRLRDTVR......RYRQ-------------------------------
Q9KM95_VIBCH/57-136--------------------CNK...VKAPNQALLEAV.......KFTE-------------------------------
Y4AR_RHISN/23-102--------------------LDN...PPKPTDRLRDAFK......RYSE-------------------------------
O05910_MYCTU/74-152--------------------LDR...PVSHKPRLEKLF.......AARS-------------------------------
Q7N3R4_PHOLL/22-101--------------------LEN...PPKANAKLLKAAK......HYKD-------------------------------
I6XFC2_MYCTU/72-148--------------------LDE...PDEAAPELVRLAR......R...-------------------------------
Q8P668_XANCP/14-88--------------------LDM...PPQPNARLRKTMQ..........-------------------------------
Q8ZKC7_SALTY/14-88--------------------LDQ...TPSPNAALRKTMQ..........-------------------------------
Q8ZMH5_SALTY/14-91--------------------LDN...PPAPNEKLLAAAF......AL..-------------------------------
Q9PHI1_XYLFA/6-80--------------------LDG...PQDTNLGLNRLM.......A...-------------------------------

PF05534

Q7N3F9_PHOLL/54-104--------------------LEE---DVTINAFVNQAL------------------------------------------
Q88MT9_PSEPK/54-104--------------------ELA---EKSINQWVSDIL------------------------------------------
Q6A7R8_PROAC/60-110--------------------AEQ---HLSLNQYVTRKL------------------------------------------
Q73YB6_MYCPA/53-103--------------------AEQ---RVSMNQWVVQKL------------------------------------------
Q7N8L4_PHOLL/59-111--------------------AEH---QISVNAFIIETL------------------------------------------
Q92KT7_RHIME/1-48--------------------AAA---GKSLNEWVIGAI------------------------------------------
Q6MB72_PARUW/52-102--------------------KFN---GISLNNYISQTL------------------------------------------
Q7VMR2_HAEDU/57-107--------------------TKQ---GLALNAFVYKAI------------------------------------------
Q7MY97_PHOLL/58-110--------------------ISH---AVSKNQFIVQLL------------------------------------------
Q88G27_PSEPK/52-102--------------------TKQ---SISLNDLTRKAL------------------------------------------
Q73J27_TREDE/55-105--------------------IMQ---GISLNQFIQQAV------------------------------------------
Q8YLM2_NOSS1/53-103--------------------KKE---GQSLNSWIEKCL------------------------------------------
Q73KK4_TREDE/52-102--------------------KSL---NLSLNTFVEKAL------------------------------------------
Q92XZ7_RHIME/54-104--------------------ELS---GKSLNQWAEEVL------------------------------------------
Q73QG2_TREDE/62-112--------------------EHE---GVSLNQYVLYRL------------------------------------------
Q6G4L9_BARHE/55-105--------------------AEN---GVSLNRYISSKL------------------------------------------
Q9RZI7_DEIRA/54-104--------------------QSQ---EISLNTLVERAI------------------------------------------
Q8XYR1_RALSO/55-105--------------------AAQ---GVSLNQWAAGVL------------------------------------------
A1RCN0_ARTAT/63-111--------------------ANH---GVPLNRYATELL------------------------------------------
Q9PCT7_XYLFA/64-114--------------------AAQ---GISLNQFVEQAI------------------------------------------

PF09386

Q7N4K2_PHOLL/1-79--------------------MEGKVSKKSIDEILNEELA-----------------------------------------

PF12651

A6LT47_CLOB8/12-55----
Q1D537_MYXXD/6-49----
Q08NJ8_STIAD/30-73----
Q04FI1_OENOB/1-44----
A5N8S1_CLOK5/8-51----
A7HBK6_ANADF/4-47----
Q9YEP4_AERPE/2-45----
A2BMU8_HYPBU/1-44----
B2TQ69_CLOBB/8-51----
C3AQ62_BACMY/106-149----
Q17ZT4_PEPD6/4-47----
A9GWZ6_SORC5/4-47----
E3FMN1_STIAD/4-47----
Q2II40_ANADE/24-64----
Q8XP25_CLOPE/8-50----

PF01402

Q9YBV4_AERPE/3-42----
Q8ZX60_PYRAE/47-86----
P72681_SYNY3/21-59----
Q8ZWZ9_PYRAE/10-49----
NIKR_CHLTE/6-45----
Q877Q4_PSESM/12-50----
Y4KO_RHISN/4-42----
VPB19_MYCTU/2-40----
O28529_ARCFU/6-44----
Y080_METJA/3-41----
PARD2_CAUCR/12-50----
O30230_ARCFU/6-44----
O29882_ARCFU/4-42----
NIKR1_METTH/3-42----
Q9I707_PSEAE/4-42----
E51_SSV1/12-50----
Q88JZ4_PSEPK/2-40----
Q888D4_PSESM/12-50----
O30109_ARCFU/6-44----
NIKR_HELPY/12-51----
Q8EGZ2_SHEON/6-44----
G7YYF2_CLOSI/3-42----
YBFE_ECOLI/52-88----
YIIE_ECOLI/4-41----
Y298_MYCTU/6-41----
VPB20_MYCTU/11-49----
VPB10_MYCTU/3-39----
Q327A8_SHIDS/14-51----
Q3IQM5_NATPD/4-41----
Q8U3E4_PYRFU/7-45----
S6AY38_PSERE/10-47----
V5UCU1_9BURK/15-51----

PF07878

Q1QQP0_NITHX/90-130----
Q7U858_SYNPX/33-75----
A5GQX8_SYNR3/18-60----
E8SHU9_STAPH/6-48----
A5GKY5_SYNPW/33-75----
F4BUC1_METCG/7-49----
B7JWD3_CYAP8/2-44----
A8ZLB3_ACAM1/15-57----
D7E5Q5_NOSA0/6-48----
Q46HT9_PROMT/14-56----
B1X2B8_CYAA5/9-51----
Q7VEB2_PROMA/14-56----
Q7NMR8_GLOVI/20-62----
E0UNJ6_CYAP2/6-48----
Q8YK09_NOSS1/15-57----
K9VLV1_9CYAN/8-49----
K9VLX7_9CYAN/14-56----
Q7V237_PROMP/82-124----

PF15919

F8GGR0_NITSI/3-126----
F2JW02_MARM1/3-127----
E1VAV2_HALED/3-129----
B8GTR2_THISH/3-126----
F2KE11_PSEBN/3-128----
F4HBU2_GALAU/3-128----
F7QNQ0_9BRAD/4-124----
D8MUK4_ERWBE/3-128----
G8M697_9BURK/3-126----
Q1QQP0_NITHX/4-124----
D5BWS5_NITHN/3-123----
Q98J17_RHILO/4-124----
E6WDB3_PANSA/3-127----
A1VQL9_POLNA/3-127----
Q63NA5_BURPS/3-126----
B4ET85_PROMH/3-129----
D5CBF0_ENTCC/3-129----
A5GAH3_GEOUR/3-123----
Q1LPG4_RALME/14-137----
A8GFZ4_SERP5/3-129----
Q7N448_PHOLL/3-129----
Q5HXI2_GLUOX/3-126----
F4GPE1_PUSST/3-127----
B8DM26_DESVM/3-123----
A9H9S0_GLUDA/10-135----
F9ZMS1_ACICS/3-126----
YO14_BPHC1/3-126----
Q5F6D2_NEIG1/4-126----
Q7VZH1_BORPE/3-127----
Q9A3L8_CAUCR/4-124----
W8KT83_HALHR/3-127----

PF12441

Q30QH6_SULDN/2-80----
B0JXE6_MICAN/7-82----
B4SES2_PELPB/3-79----
A6QAG9_SULNB/5-83----
C1F1N0_ACIC5/3-81----
B4SF55_PELPB/6-84----
A4SVJ8_POLSQ/6-84----
A1BIF8_CHLPD/6-84----
B1WWY8_CYAA5/9-85----
B8GRA9_THISH/6-84----
P72819_SYNY3/56-132----
A5GA05_GEOUR/6-84----
C7LN80_DESBD/6-82----
Q01SA6_SOLUE/7-85----
C3KQS7_RHISN/6-84----
Q9AAV5_CAUCR/3-77----

PF13467

I3THE1_TISMK/5-68----
A1B158_PARDP/15-82----
Q2W502_MAGSA/68-131----
U4KIB5_9VIBR/16-83----
D7A937_STAND/16-83----
Q47K48_DECAR/15-83----
B8EK53_METSB/15-83----
V6F6E9_9PROT/28-96----
I3TNF1_TISMK/9-73----
S6AZN1_PSERE/15-83----
B4RFD6_PHEZH/4-67----
A4Z0Q4_BRASO/15-82----
Q8EH51_SHEON/15-83----
Q1QJT3_NITHX/17-80----
U4K818_9VIBR/15-83----
R5XT33_9PROT/6-68----
D7A5S3_STAND/15-83----
A5FXC9_ACICJ/3-65----
D4ZC71_SHEVD/15-83----
K7SD13_GLUOY/4-66----
G2KLR8_MICAA/1-64----
G8PTZ2_PSEUV/3-67----
A8IAV7_AZOC5/5-68----
Q13WI7_BURXL/15-84----
B2IEK6_BEII9/15-82----
R5YAT6_9PROT/7-67----
F2J384_POLGS/15-81----
U5T3K9_9GAMM/16-83----
Q2K3V5_RHIEC/15-83----
V6F679_9PROT/38-104----
Q7CXZ9_AGRT5/2-66----
C3MEF5_RHISN/3-66----
B9JH07_AGRRK/7-71----
Q2YPT7_BRUA2/7-71----
Q0A5P7_ALKEH/48-113----
A5VF72_SPHWW/4-70----
Q2N6Z0_ERYLH/8-73----
B6INS4_RHOCS/2-64----
W8RV19_9RHOB/5-69----
G2I0K7_GLUMN/18-81----
A7HVX0_PARL1/14-77----
Q2W7L3_MAGSA/5-67----
A8LPV2_DINSH/15-83----
Q167Q5_ROSDO/15-83----
Q15TD7_PSEA6/15-83----
E3I0W1_RHOVT/38-99----
Q167I6_ROSDO/5-69----
A6X0F5_OCHA4/15-83----
C5AUK2_METEA/10-72----
R6I0Y9_9PROT/4-68----
B8IRU4_METNO/15-83----
B8ELI0_METSB/17-78----
G8ARW4_AZOBR/20-92----
G7ZBW3_AZOL4/15-83----
D4YZT3_SPHJU/21-85----
I0HQZ1_RUBGI/15-82----
A9HZ31_BORPD/15-82----
B0T0E7_CAUSK/20-82----
B6IVX3_RHOCS/20-83----
H5WRL6_9BURK/15-83----
R6I5L9_9PROT/2-65----
Q88NJ6_PSEPK/37-105----
Q7VY20_BORPE/16-82----
Q0KEM8_CUPNH/15-86----
Q3J4J5_RHOS4/5-69----
B6JB62_OLICO/35-98----
E4PET2_MARAH/15-83----
G4RFD5_PELHB/1-64----
Q5LS66_RUEPO/5-69----
R5XSE7_9PROT/2-65----
A9HBJ7_GLUDA/7-71----
B2U9M5_RALPJ/15-83----
C6BV10_DESAD/15-83----
A1WLD9_VEREI/15-83----
V5SG48_9RHIZ/7-70----
D5BP55_PUNMI/2-63----
D0IW80_COMT2/15-83----
V6EZW9_9PROT/2-64----
B1M524_METRJ/6-68----
G7Z694_AZOL4/2-65----
Q6G2S1_BARHE/14-77----
E8RRH3_ASTEC/4-67----
A1VU33_POLNA/15-83----
Q11GU9_CHESB/4-68----
D9QJB1_BRESC/2-64----
A2SED0_METPP/15-83----
A1B3A7_PARDP/22-85----
Q5E5I8_VIBF1/19-85----
G8B035_AZOBR/15-83----
K7SIV6_GLUOY/15-83----
Q28PQ0_JANSC/10-74----
Q87MR6_VIBPA/16-83----
R5R7N0_9PROT/5-68----
Q5NQS8_ZYMMO/14-79----
R5Q8E2_9PROT/4-65----
Q141Z3_BURXL/65-133----
R6ITS5_9PROT/4-68----
G2KND8_MICAA/35-99----
Q92NP9_RHIME/6-70----
Q21US4_ALBFT/16-83----
W0AMC0_9SPHN/9-75----
D5AQD4_RHOCB/5-69----
Q2G3C7_NOVAD/8-72----
Q2RS87_RHORT/10-72----
Q0AMZ5_MARMM/17-80----
A7IN95_XANP2/16-83----
E0TDI6_PARBH/6-68----
S5YGZ7_PARAH/15-83----
B6JB63_OLICO/5-68----
A1BB74_PARDP/15-83----
Q0BVF8_GRABC/3-66----
B6IXV3_RHOCS/24-88----
G8AK62_AZOBR/2-63----
R6IQM1_9PROT/1-65----
F2J2A0_POLGS/3-67----
W0PKG2_9BURK/15-82----
J7QMW2_METSZ/14-76----
M4S774_9SPHN/4-69----
B8IF14_METNO/8-71----
A8HUM8_AZOC5/15-83----
A8LRP0_DINSH/33-97----
S5YRV8_PARAH/10-74----
A6WUZ0_OCHA4/15-83----
G0AAA0_COLFT/37-104----
F8J5J1_HYPSM/3-66----
G8AI45_AZOBR/22-97----
G8ARV8_AZOBR/26-90----
B6IW11_RHOCS/3-66----
M9R844_9RHOB/9-72----
R6J4D7_9PROT/7-67----
C7JBE2_ACEP3/5-69----
A6VZH2_MARMS/16-83----
V9VUQ5_9RHOB/5-69----
D5BMV3_PUNMI/6-68----
R5QX40_9PROT/1-65----
B9JXQ8_AGRVS/8-72----
Q87Y30_PSESM/6-74----
A0KLC1_AERHH/26-94----
Q98KH2_RHILO/5-68----
A5FYB5_ACICJ/15-82----
D5QBC0_KOMHA/10-72----
G2IRZ2_9SPHN/11-78----
Q2SKQ2_HAHCH/16-83----
F2K501_PSEBN/34-101----
B2IH09_BEII9/17-85----
Q2K6G5_RHIEC/20-84----
F6IFI2_9SPHN/8-74----
B2UET6_RALPJ/16-83----
Q1GGM9_RUEST/6-70----

PF03869

RMNT_BPP22/2-51PVTG
RARC_BPP22/4-53RIGA
G3XCY4_PSEAE/13-62ALQD

PF07704

Q92LY2_RHIME/1-78----
K9Y1V0_STAC7/1-81----
VPB42_MYCTU/1-88----
C7NJK7_KYTSD/22-102----
Q0BQA3_GRABC/5-87----
L0DWF9_THIND/1-83----
A6WWK7_OCHA4/1-81----
Q2JGF8_FRASC/9-88----
W0ABH3_9SPHN/5-83----
A6X7T6_OCHA4/1-81----
A7IPR5_XANP2/185-260----
I6X1P2_PROPF/1-84----
I3TVZ0_TISMK/1-81----
I3Y9G9_THIV6/1-75----
Q20ZG7_RHOPB/1-82----
B1M1V3_METRJ/1-75----
G8NNV7_GRAMM/6-85----
L0J8B6_MYCSM/1-82----
F2J715_POLGS/1-79----
K7S7C8_PROA4/1-82----
B8EP86_METSB/1-76----
B8IVJ3_METNO/1-83----
C7NLZ4_KYTSD/1-87----
C1A9G9_GEMAT/1-83----
Y2378_RHIME/1-81----
F5XKW7_MICPN/1-83----
L0J8W2_MYCSM/1-78----
B0T0U9_CAUSK/24-113----
VPB30_MYCTU/1-83----
Q2RUX5_RHORT/1-81----
VPB36_MYCTU/1-81----
I6XS64_PROPF/3-79----
H6RSW2_BLASD/1-87----
Q92TH7_RHIME/9-88----
H6RM61_BLASD/1-86----
B9JIC8_AGRRK/5-84----
D7A0R5_STAND/1-80----
B0SW80_CAUSK/41-123----
A7IPR8_XANP2/1-84----
K9Y7X0_HALP7/1-79----
L0GTX7_9GAMM/1-83----
D4Z9B0_SPHJU/1-81----
C3KNS9_RHISN/1-79----
C3KQT0_RHISN/1-80----
A6X8D2_OCHA4/6-84----
VPB28_MYCTU/1-80----
Q981I6_RHILO/1-76----
Q6N2A9_RHOPA/1-82----
Q219N1_RHOPB/1-83----
Q7NGE7_GLOVI/4-85----
A1T4A5_MYCVP/1-80----
K0FC64_9NOCA/1-82----
B1LSI4_METRJ/1-77----
C3KQV7_RHISN/1-83----
D3PLA4_MEIRD/1-79----
L0E2P5_THIND/1-78----
B2IL59_BEII9/1-77----
U5QCJ3_9CYAN/4-85----
C8XHZ8_NAKMY/1-83----
Q92RQ4_RHIME/1-83----
Q5SKZ1_THET8/1-84----
A5FU30_ACICJ/1-78----
Q1QF44_NITHX/1-83----

PF09957

Q82BL1_STRAW/2-49----
Q20X13_RHOPB/8-51----
Q2FLV1_METHJ/1-47----
Q58AH0_RALME/1-44----
Q3JAZ0_NITOC/1-47----
A1U2W3_MARAV/1-47----
A1VX34_POLNA/1-45----
Q7AQ19_MYCLE/3-56----
Q73PC1_TREDE/1-47----
B3EKM2_CHLPB/1-47----
Q73R95_TREDE/1-44----
Q7NCS8_GLOVI/1-47----
A8ZTF6_DESOH/1-44----
Q7D057_AGRT5/1-48----
Q2FNJ2_METHJ/1-47----
A5G896_GEOUR/35-78----
A5GB97_GEOUR/1-47----
Q73SG9_MYCPA/11-61----
A0ZI46_NODSP/1-47----
Q01QU3_SOLUE/1-47----
A4XJM6_CALS8/1-47----
Q124P4_POLSJ/1-47----
B1WYD1_CYAA5/1-47----
B2HSG4_MYCMM/3-54----
B8GLV4_THISH/1-43----
VAPB6_MYCTU/3-45----
Y634A_MYCTU/16-68----
VPB15_MYCTU/7-50----
VPB11_MYCTU/7-49----
Q8YSF9_NOSS1/25-71----

PF09274

E5YNK1_9ENTR/1-74----
A0A034V0K1_ERWAM/1-76----
B0ZE05_ECOLX/1-76----

PF05509

B8EFN4_SHEB2/13-61----
Q4LC31_SODGL/14-62----
B6ESX2_ALISL/7-55----
A7DVG3_VIBVL/13-61----
B2LS54_9VIBR/10-58----
B8EFW0_SHEB2/41-89----
B6ET57_ALISL/12-52----
A6ASC2_VIBCY/12-60----
Q7MBP1_VIBVY/10-58----
A7N8Z3_VIBCB/12-60----
Q5DY84_VIBF1/10-58----
B5PNJ9_SALET/24-72----
A6D5H0_9VIBR/18-66----
Q6LW96_PHOPR/20-68----
A8QYN9_9GAMM/15-63----
A7N8V1_VIBCB/9-57----
E6WK64_PANSA/14-62----
D4IGT0_ERWAE/12-60----
B2VB54_ERWT9/25-73----
B6ICE9_ECOSE/13-61----
A0A023MW99_SALEN/14-62----
A0A026GSK1_ECOLX/14-62----
A0A024LLK2_ECOLX/14-62----
A0A025IEW1_ECOLX/14-62----
A0A024KL39_ECOLX/70-118----
A6TIF9_KLEP7/67-115----
A0A016QUU3_KLEPN/72-120----
Q1MKC7_RHIL3/2-50----

PF07362

H0Q687_9RHOO/11-81----
K0I4M5_9BURK/9-79----
L0DQK3_THIND/1-68----
B5EG30_GEOBB/12-82----
D4YZH7_SPHJU/13-83----
B2JXB4_BURP8/10-80----
Q82VK5_NITEU/17-87----
B0T4X1_CAUSK/3-80----
E0SK21_DICD3/2-72----
Q1GN85_SPHAL/11-80----
Q326Z9_SHIDS/2-72----
D3VG79_XENNA/22-92----
W0L945_SERFO/12-76----
F5XZ64_RAMTT/9-77----
G7Z7L4_AZOL4/17-86----
Q98F99_RHILO/26-96----
S5Z1L5_PARAH/10-80----
A5GAE8_GEOUR/23-93----
Q93GR6_SALTY/2-72----
A7HPK7_PARL1/5-75----
E1VR77_9GAMM/21-91----
G7ZEQ7_AZOL4/20-89----
Q5P2R6_AROAE/22-92----
Q32K47_SHIDS/7-77----
A0L724_MAGSM/11-81----
A8GC18_SERP5/8-78----
A1U420_MARAV/11-81----
Q8PCL0_XANCP/29-98----
S6AR37_PSERE/11-81----
Q6D9V2_PECAS/2-71----
Q21DI4_SACD2/11-81----
I1XLK6_METNJ/11-81----
Q7N4P4_PHOLL/9-79----
F2GB87_ALTMD/11-81----
Q21U54_ALBFT/9-79----
C3MCA1_RHISN/7-77----
B3PDY0_CELJU/63-133----
C7JJ40_ACEP3/1-66----
R9VLC6_9ENTR/11-81----
K7SHF6_GLUOY/17-86----
K7ABL7_9ALTE/6-76----
E0SMR7_DICD3/9-79----
C4LCG0_TOLAT/11-81----
D5QE46_KOMHA/17-86----
K0C8E2_ALCDB/11-81----
M4XDA7_PSEDE/11-81----
H2IXW0_RAHAC/27-92----
Q2RNE8_RHORT/14-84----
Q7MZJ1_PHOLL/2-72----
G7Z9X1_AZOL4/11-74----
V6F3K3_9PROT/6-76----
I2B9K4_SHIBC/6-76----
B2VJI7_ERWT9/12-75----
D3VAK1_XENNA/23-87----
E6X2R7_NITSE/11-81----
Q6D8L1_PECAS/2-72----
G0A2L0_METMM/9-79----
D6Z0A2_DESAT/12-82----

PF10723

Q93GS8_SALTY/8-88...A
Q326V9_SHIDS/1-86DILK
Q326M6_SHIDS/1-79....

PF04221

DINJ_ECOLI/4-84----
Q9KML3_VIBCH/3-84----
Q9PBQ9_XYLFA/4-84----
RELB_HAEIN/5-93----
RELB_ECOLI/1-78----
Q9A0Y8_STRP1/13-96----

PF03693

PARD_XYLFA/1-78HTQ-
PARD1_CAUCR/2-82SAP-
PARD_VIBCH/1-80NIR-
PARD1_MYCTU/1-80AS.-

PF14384

A1AQ37_PELPD/17-82----
Q73R28_TREDE/11-81----
B0JRR8_MICAN/35-94----
Q92KN5_RHIME/26-103----
Q3J2R4_RHOS4/23-97----
B8F509_HAEPS/13-99----
A5GE33_GEOUR/45-107----
A1WJ32_VEREI/17-83----
A6WWJ1_OCHA4/29-103----
Q2RSU6_RHORT/41-96----
E3I091_RHOVT/23-97----
Q215B0_RHOPB/13-90----
C4K882_HAMD5/42-98----
Q20YH7_RHOPB/27-93----
D3SAY2_THISK/33-91----
C4KAB9_THASP/30-98----
Q28LR0_JANSC/24-89----
D5X2J5_THIK1/28-104----
A8HS57_AZOC5/58-131----
B1M0P6_METRJ/36-100----
A9BQV6_DELAS/27-103----
D5CSA1_SIDLE/6-67----
C1DP04_AZOVD/25-95----
A1WLU7_VEREI/13-87----
Q73LQ6_TREDE/25-85----
A5V5L4_SPHWW/13-90----
A6WZ44_OCHA4/29-94----
B0T4V2_CAUSK/34-92----
B6JFY4_OLICO/17-84----
C5D0R5_VARPS/7-82----
Q8KUW1_SYNE7/45-104----
Q0KBY4_CUPNH/27-90----
B6IVZ4_RHOCS/9-71----
Q2KVN5_BORA1/5-79----
Q39RZ9_GEOMG/16-77----
A8GIR2_SERP5/28-84----
A9IES8_BORPD/41-97----
A1VRX0_POLNA/13-87----
Q31JV0_SYNE7/18-82----
A1WB35_ACISJ/28-89----
B2ICD8_BEII9/27-96----
Q73L16_TREDE/8-67----
C3M8F8_HAMD5/13-85----
C7RRD3_ACCPU/30-92----
B6IW20_RHOCS/40-99----
A8LQR3_DINSH/3-99----
C4KAB3_THASP/28-89----
A3N0B8_ACTP2/11-88----
D4ZU97_ARTPN/29-87----
K9XMQ0_9CHRO/29-86----
Q2L2E1_BORA1/28-86----
Q63NA3_BURPS/28-88----
Q6N573_RHOPA/22-88----
Q7CI23_YERPE/12-90----
Q7CP71_SALTY/37-93----
Q9PD17_XYLFA/28-105----
V6F518_9PROT/28-104----

PF16777

I9TP66_HELPX/21-81----
I9SLK1_HELPX/21-81----
M3NJJ4_HELPX/21-81----
J0RAY0_HELPX/2-62----

PF07764

T0VBY9_9ENTE/1-69----
I3U5Z1_ENTFC/1-71----

PF11903

Q4KC28_PSEF5/1-66RA--
B4SF37_PELPB/2-74HR--
A0QXV1_MYCS2/6-107AL--
A9BMX0_DELAS/1-73AP--
A6T935_KLEP7/1-66VI--
Q7NVK9_CHRVO/1-73ES--
A1T476_MYCVP/6-107AL--
Q3AQ94_CHLCH/4-76SK--
Q1GXH1_METFK/1-73GG--
Q2SQH0_HAHCH/2-95ER--
Q13JR3_BURXL/1-70LT--
Q15VU5_PSEA6/1-66KV--
Q0RY55_RHOSR/40-141EL--
Q220F4_ALBFT/1-73QL--
Q47D61_DECAR/1-73SK--
Q0C2J2_HYPNA/1-68AA--
A7HVP7_PARL1/11-109LG--
A4Y172_PSEMY/1-70AS--
D0J2S6_COMT2/1-68..--
Q63SV8_BURPS/1-72R.--

PF11020

F4F896_VERMA/2-77----
Q73H58_WOLPM/5-85----
B3S7R4_TRIAD/8-90----
Q2GKE5_ANAPZ/4-84----
C4YV51_9RICK/4-84----
B9KIB3_ANAMF/4-84----
F7XUD1_MIDMI/1-81----
Q2GCJ4_NEOSM/1-81----
K9QB18_9NOSO/702-781----
A5CC80_ORITB/1-81----
Q2GG71_EHRCR/4-84----

PF15970

B4EVM4_PROMH/3-83----
Q0WCU1_YERPE/3-83----

PF01340

METJ_VIBVY/3-99----
Q15NT2_PSEA6/6-102----
K7AFK6_9ALTE/6-102----
Q489Q2_COLP3/3-99----
METJ_SALTY/3-99----
Q5QV41_IDILO/2-95----

PF10715

REGB_BPT4/2-151----

PF08681

Q8E866_SHEON/19-95----
Q7N880_PHOLL/12-90----
Q7N7Z2_PHOLL/8-88----
Q92P91_RHIME/11-90----
B3EP86_CHLPB/11-90----
Q7NIQ1_GLOVI/13-92----
Q7NLC6_GLOVI/11-90----
B4SB08_PELPB/10-88----
Q5P620_AROAE/9-88----
Q2SAN8_HAHCH/11-89----
C1DE12_AZOVD/13-92----
Q8ZL97_SALTY/13-91----
Q8XPL2_RALSO/16-98----
Q6LIX8_PHOPR/32-112----
Y420_HAEIN/9-88----
Q5P632_AROAE/5-83----
Q5NX70_AROAE/9-88----
Q7N6D8_PHOLL/7-86----
Q7N0J5_PHOLL/11-90----
Q6ZEG7_SYNY3/12-91----
Q87ZN7_PSESM/15-103----
Q3SNN6_NITWN/19-98----
Q9KM95_VIBCH/57-136----
Y4AR_RHISN/23-102----
O05910_MYCTU/74-152----
Q7N3R4_PHOLL/22-101----
I6XFC2_MYCTU/72-148----
Q8P668_XANCP/14-88----
Q8ZKC7_SALTY/14-88----
Q8ZMH5_SALTY/14-91----
Q9PHI1_XYLFA/6-80----

PF05534

Q7N3F9_PHOLL/54-104----
Q88MT9_PSEPK/54-104----
Q6A7R8_PROAC/60-110----
Q73YB6_MYCPA/53-103----
Q7N8L4_PHOLL/59-111----
Q92KT7_RHIME/1-48----
Q6MB72_PARUW/52-102----
Q7VMR2_HAEDU/57-107----
Q7MY97_PHOLL/58-110----
Q88G27_PSEPK/52-102----
Q73J27_TREDE/55-105----
Q8YLM2_NOSS1/53-103----
Q73KK4_TREDE/52-102----
Q92XZ7_RHIME/54-104----
Q73QG2_TREDE/62-112----
Q6G4L9_BARHE/55-105----
Q9RZI7_DEIRA/54-104----
Q8XYR1_RALSO/55-105----
A1RCN0_ARTAT/63-111----
Q9PCT7_XYLFA/64-114----

PF09386

Q7N4K2_PHOLL/1-79----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window