Sequence alignment for CL0061

PF01053

CYSD_EMENI/10-428-----------ETLQLHAGQEPDP..ATNSRAVPIYATTSYTFNDS----------------------------------
CYS3_YEAST/10-390-----------ATKAIHAGEHVD...VHGSVIEPISLSTTFKQS..----------------------------------
MET17_YEAST/6-436-----------DTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENS----------------------------------
O02215_CAEEL/69-449-----------STSHAKPLSNADP......VVVPIYHSSTYRFKTV----------------------------------
METC_ECOLI/7-392-----------DTQLVNAGRSKK..YTLGAVNSVIQRASSLVFDSV----------------------------------
CGL2_CAEEL/8-386-----------GTAAIHVGQEPEQ.WDMNQVVPPISLSSTYKQD..----------------------------------
METC_HAEIN/8-393-----------STMFIHSGRQKR..FSQGSVNPVLQRASSLLFDSI----------------------------------
METC_ARATH/88-460-----------STLLVNLDNKFDP...FDAMSTPLYQTATFKQP..----------------------------------
CGS1_ARATH/176-561-----------GSLTVHAGERLGRGIVTDAITTPVVNTSAYFFKKT----------------------------------
METI_BACSU/6-363-----------ETKLAQIGNRSDE..VTGTVSAPIYLSTAYRHR..----------------------------------
MCCB_BACSU/4-377-----------KTLMIHGGITGDE..KTGAVSVPIYQVSTYKQP..----------------------------------
CGL_HUMAN/19-395-----------ATQAIHVGQDPEQ.WTSRAVVPPISLSTTFKQG..----------------------------------
METZ_PSEAE/20-401-----------DTLAVRAGQR...RTPEGEHGEALFTTSSYVFRTA----------------------------------
METC_BACSU/9-382-----------ETQLVHNPFKTDGG..TGAVSVPIQHASTFHQS..----------------------------------
METB_ECOLI/6-381-----------ATIAVRSGLNDDE..QYGCVVPPIHLSSTYNFT..----------------------------------
STR3_YEAST/7-405-----------DTVVVNTGSQND...QHSASVPPVYLSTTFKVD..----------------------------------
CYSD_SCHPO/9-427-----------ETLQLHAGQE.P.DAATSSRAVPIYATTSYVFRDC----------------------------------
METB_MYCLE/15-388-----------ATKAIHAGYRPDP..ATGAVNVPIYASSTFAQD..----------------------------------
METB_HAEIN/8-366-----------DTLLAQAGNRSDE..RTGAVSAPIFLSTAYGHC..----------------------------------
O15565_TRIVA/12-395-----------DTLSIHANPQ...KDQFGAIVAPIYQTSTFLFDNC----------------------------------
METB_HELPY/4-377-----------QTKLIHGGISEDA..TTGAVSVPIYQTSTYRQD..----------------------------------
A2FEV4_TRIVA/9-392-----------ATACIHANPQKD...QFGAAIPPIYQTSTFVFDNC----------------------------------
B0SQZ9_LEPBP/8-432-----------ETIALHGGQEPDP..TTTSRAVPLYQTTSYVFKDT----------------------------------
B2FLU7_STRMK/14-389-----------ATLAIHGGQSPDP..STGAVMPPIYATSTYAQS..----------------------------------
K7VKJ5_MAIZE/100-483-----------.SLAVHAGERLGRRIATDAITTPVVNTSAYWFNNS----------------------------------
METZ_MYCTU/21-405-----------.TVGVRGGMLR...SGFEETAEAMYLTSGYVYGSA----------------------------------
Q5AXC9_EMENI/40-405-----------.TELVYTESN.D...QYNASSVPIYQSATFKQS..----------------------------------

PF01041

ERBS_SACEN/13-363---------------------LELRSDIDQACRRVLGSG.WYLH------------------------------------
P72893_SYNY3/11-365---------------------PSITELEVEYATDAARNG.WGDR------------------------------------
P73264_SYNY3/14-373---------------------DDEIEFFLDEARQILKSG.TLIL------------------------------------
O27256_METTH/7-356---------------------PIIDEEEIQEVIKVLKSG.FIAQ------------------------------------
P74668_SYNY3/13-379---------------------QRIKAEIQQAVNGVLESG.QFIL------------------------------------
RFBH_SALTY/40-430---------------------VIGAKELQLMVEASLDG...WLT------------------------------------
PSEC_HELPY/9-366---------------------PCLDKEDKKAVLEVLNSK.QLTQ------------------------------------
Y1066_METJA/12-379---------------------PCIGEEEINEVIDTLKSD.WITM------------------------------------
ARNB_ECOLI/10-374---------------------PAMGVEELAAVKEVLESG.WITT------------------------------------
SPSC_BACSU/14-382---------------------PLIGKEEIQEVTETLESG.WLSK------------------------------------
O26434_METTH/7-359---------------------PSIGNEELENVLEALKSG.WISS------------------------------------
NTDA_BACSU/78-432---------------------NDEVEDILNTLTEVLPTG.KFTS------------------------------------
A4F7N3_SACEN/33-380---------------------.....RFFARLEWALNNN.WLTN------------------------------------
B1W368_STRGG/23-413---------------------.QPGDRALKSLEDVLTSGRWTIS------------------------------------
B1W386_STRGG/12-373---------------------.QLTDDDIEAAVAALRSNRLVGQ------------------------------------
C6W8U4_ACTMD/18-373---------------------..DDAERTALLRALDQGQ.WWRV------------------------------------
F7YJG4_VIBA7/13-366---------------------.QYEQELKDACTRVIDSG.WYIL------------------------------------
RIFK_AMYMS/15-372---------------------.YDDAERNGLVRALEQGQ.WWRM------------------------------------
Y3402_MYCTU/52-405---------------------.......AEDFVQIAQAN.WYTN------------------------------------
Q5KV33_GEOKA/14-364---------------------.QLKPEIMRVLDEVMRSS.RFIL------------------------------------
Q79H47_BORPE/14-362---------------------...RDTINPRIQAVLDHG.QFIM------------------------------------
Q7W0M1_BORPE/26-405---------------------.DIGEAEIQAVTESMRSG.WLTT------------------------------------
Q9ABJ3_CAUCR/28-397---------------------.TIEEDDIAAVAEALRGD.FLTT------------------------------------
Q9KVA5_VIBCH/9-360---------------------..LDGNERKYLNDCIDSG.WVSS------------------------------------

PF01212

GLY1_ASHGO/17-304----------------------DFRSDTFTTPTREMIEAA.LTA------------------------------------
GLY1_YEAST/16-303----------------------DLRSDTFTTPTAEMMEAA.LEA------------------------------------
Q7QAI2_ANOGA/21-308----------------------DFRSDTISVPTPSMRQAM.FTA------------------------------------
YF64_CAEEL/68-359----------------------DLRSDTVTVPSVEMRRAM.AEA------------------------------------
Q8Y182_RALSO/3-296----------------------HFASDNYAGFCPESLKYF.LEA------------------------------------
Q9RUR9_DEIRA/13-296----------------------DLRSDTVTKPTPAMREAM.ATA------------------------------------
Q8A7N2_BACTN/47-423----------------------DLITDS...GTGAMSDRQWAGM------------------------------------
THA2_ARATH/11-300----------------------DLRSDTVTKPTESMRSAM.ANA------------------------------------
Q8RCY7_CALS4/5-290----------------------DLRSDTVTQPTPEMREAM.YKA------------------------------------
Q89ID2_BRADU/23-308----------------------NLLSDTQTKPTAAMREAM.ARA------------------------------------
Q7MUT3_PORGI/47-424----------------------DLLTDS...GTGAMSDRQWSAM------------------------------------
Q9VCK6_DROME/8-304----------------------DLRSDTVSQPTDKMRARM.ATA------------------------------------
LTAE_PSEAE/7-299----------------------QFASDNYSGICPEAWAAM.AEA------------------------------------
TPL_PASMU/47-424----------------------DLLTDS...GTSAMSDKQWAGL------------------------------------
TNAA1_SYMTH/45-421----------------------DLLTDS...GTGAMSQFQWSAM------------------------------------
TNAA_CALS4/50-428----------------------DLLTDS...GTAAMSDYQWAGM------------------------------------
GLY1_SCHPO/30-313----------------------DFRSDTLTVPTDEMRRIM.YEA------------------------------------
Q9X266_THEMA/3-287----------------------DLRSDTVTKPTEEMRKAM.AQA------------------------------------
TNAA_PHOLL/46-432----------------------DLLTDS...GTGAMSDRQWAGI------------------------------------
Q88AI0_PSESM/7-297----------------------QFASDNYSGICPEAWAAM.EQA------------------------------------
Q89N26_BRADU/13-294----------------------DLRSDTVTLPTAAMLERM.QRA------------------------------------
Q7MEV9_VIBVY/2-285----------------------DFRSDTVTRPTPAMREAM.ANA------------------------------------
TNAA_CLOTE/60-438----------------------DLLTDS...GTNAMSDDQWAGV------------------------------------
Q9A3V8_CAUCR/9-299----------------------DFASDNVAGAMPEVMEAL.IAA------------------------------------
TNAA_HALSA/42-412----------------------DLLTDS...GTGTMSNDQWAAM------------------------------------
Q7NHQ7_GLOVI/7-294----------------------DLRSDTVTRPTRAMRAAM.FEA------------------------------------
TNAA_CHRVO/47-428----------------------DLLTDS...GTGAMSDRQWAGL------------------------------------
TNAA_AERPE/52-428----------------------DLLTDS...GTGSMSIYQWAAL------------------------------------
Q896G8_CLOTE/5-288----------------------DLRSDTVTKPTENMRKAM.FKA------------------------------------
Q9HMP3_HALSA/22-307----------------------DLRSDTVATPTEAMREAA.AQA------------------------------------
Q8EC07_SHEON/3-286----------------------DLRSDTVTQPTEAMRLAM.SRA------------------------------------
Q7NQ31_CHRVO/5-289----------------------DLRSDTVTHPTPAMRRAM.AEA------------------------------------
D5AL49_RHOCB/46-420----------------------DLLTDS...GTGAMSSLQWAAV------------------------------------
D5AV45_RHOCB/2-292----------------------QFASDNTAGVAPEIMAAL.AAA------------------------------------
G3XD13_PSEAE/5-283----------------------DLRSDTVTQPTAGMREAM.AAA------------------------------------
I0DW76_PROSM/47-432----------------------DLLTDS...GTNAMSDQQWAAM------------------------------------
LTAE_ECOLI/3-280----------------------DLRSDTVTRPSRAMLEAM.MAA------------------------------------
TPL_SYMTH/47-422----------------------DLLTDS...GTNAMSDRQWGAL------------------------------------
Q59NC4_CANAL/14-300----------------------EFRSDTFTVPTRAMVEDGFMNA------------------------------------
Q7VW60_BORPE/3-283----------------------DLRSDTVTRPSAAMRQAM.AAA------------------------------------
TPL_FUSNN/49-425----------------------DLLTDS...GTNAMSDKQWGGL------------------------------------
Q8RHQ6_FUSNN/51-505----------------------DMLSDS...GTTAMTDQQWSAM------------------------------------
THA1_ARATH/7-295----------------------DLRSDTVTRPTDAMREAM.CNA------------------------------------
Q98A67_RHILO/12-297----------------------.FTSDNIAGVSPEVIAAI.TAC------------------------------------

PF06838

YNBB_BACSU/11-416-------------LKKTAMEVEADIAGIHKQIEEISERNEWRVLQS----------------------------------
Q8EQP5_OCEIH/1-405-------------MESLIEQAEQDCSLQQKDIQKNVEINQKRVLNA----------------------------------
Q8Y7I1_LISMO/4-408-------------IQAMRKKVEVQIADLQNETDEIAEFNQAKVLDA----------------------------------
Q97I22_CLOAB/19-425-------------VLELYERALNDVEKEFKYYDEIREYNQLKVLKA----------------------------------
Q8XL83_CLOPE/19-425-------------TIKLYNQAIIDVENEFKIYDEIREYNQLKVLKA----------------------------------
Q8DHD9_THEEB/26-430-------------RTSLLTAAQGALVTRFAEIDGRVKKNLDRVLAA----------------------------------
Q54763_SYNE7/3-407-------------TPQLVSEAEAELLQIFVGLDVQVKENLGRVLEA----------------------------------
Q8RA65_CALS4/17-421-------------VIELIESAEKSCLDIFKKIDEIVEYNQYKVIYH----------------------------------
Q9KAC8_BACHD/11-416-------------IEKAKRNAEQKIVSNVEHVEHIALVNQKRVLDA----------------------------------
Q8YWL0_NOSS1/20-424-------------SLEQLRQAEQALLEIFSGIDAQVKQNLKRVLEA----------------------------------
Q55407_SYNY3/3-407-------------YSSFLKQAEENLVPIFSEIDAKVKENLYKVIEA----------------------------------
Q895H5_CLOTE/19-425-------------TLDLYEKALKDIEPQFKTYDEIREFNQLKVLNA----------------------------------
Q5HPN4_STAEQ/5-406-------------.SNLVEKVENTLIPYFRKIEKRALFNQEKVLNA----------------------------------

PF03841

SELA_PSEAE/79-451-----------------------VFNLTGTVLHTNLGRALLPDEAI----------------------------------
SELA_CAMJE/71-423-----------------------VINASGVVIHTNLGRSVIHEELY----------------------------------
SELA_PASMU/81-448-----------------------VHNLTGTILHTNLGRALWSDAAQ----------------------------------
SELA_HAEIN/82-449-----------------------VHNLTGTVLHTNLGRALWSEAAQ----------------------------------
SELA_RHIME/80-448-----------------------LFNLTGTVLHTNLGRALLAQEAV----------------------------------
SELA_ECOLI/83-452-----------------------VINLTGTVLHTNLGRALQAEAAV----------------------------------
SELA_AQUAE/72-435-----------------------VINATGVVINTNLGRAPLSKDVI----------------------------------
C7LWD8_DESBD/82-448-----------------------VINATGVVIHTNLGRSILAEEAA----------------------------------
SELA_MOOTA/80-445-----------------------VINATGVVLHTNLGRAILSPAAR----------------------------------
W8TF72_EUBAC/86-450-----------------------LINATGVVVHTNLGRSPMAEEIK----------------------------------

PF00266

SERC_ECOLI/4-350--------------------IFNFSSGPAMLPAEVLKQAQQELRDW-------------------------NG--LGT--
CSD_PSEPK/23-389--------------------TYLDSAATTQKPQALLDALSHYYGHG-------------------------AA--NVH--
CSD_CHLTR/19-388--------------------VYLDSAATTHKPQCVIDSIVDYYSSS-------------------------YA--TVN--
CSD_XYLFA/36-404--------------------IYFDNANTAQKPQAVITATDTFYRRH-------------------------NA--NIS--
NIFS_NOSS1/4-365--------------------IYLDNNATTKVDPDVVEAIMPYLTDY-------------------------YG--NP.--
CSD_STRCO/31-406--------------------VYLDNAATSQKPRQVLDALSEYYERY-------------------------NA--NVH--
CSD_TREPA/20-390--------------------HYLDSAATTQRPAPVLERVMHYHTHL-------------------------NG--NAG--
CSD_UREPA/18-385--------------------IYLDSSATSLKPQVVIDAIVDYYTKY-------------------------ST--NPH--
CSD_METTH/20-389--------------------VYLDAASTTPTPLPVVRAMTEYFKEY-------------------------NA--NTG--
SUFS_DICD3/30-399--------------------AYLDSAASAQKPLAVIDRERDFYLHE-------------------------YA--AVH--
CSD_VIBCH/25-393--------------------VYLDSAATTQKPQCVIDAISHYYSQH-------------------------NA--NVH--
SUFS_ECOLI/25-394--------------------AYLDSAASAQKPSQVIDAEAEFYRHG-------------------------YA--AVH--
CSD_PSEAE/23-389--------------------TYLDSAATAQKPQAVLDALNGYYLGG-------------------------AA--NVH--
CSD_AERPE/21-399--------------------VYLDNAASTLKPRRVVEAMREFSYRS-------------------------YA--NVH--
CSD_PASMU/44-409--------------------VYLDSAATALKPQVLTDATIAFYQ.S-------------------------AG--SVH--
SERC_HAEIN/4-348--------------------VFNFSAGPAMIFPEVLQKAQNELINW-------------------------LN--QGV--
SUFS_BACSU/23-391--------------------VYLDSAATSQKPRAVIETLDKYYNQY-------------------------NS--NVH--
NFS1_YEAST/100-462--------------------IYLDMQATTPTDPRVLDTMLKFYTGL-------------------------YG--NPH--
SPYA_CALJA/45-398--------------------RLLLGPGPSNLPPRTMAAGGLQ....-------------------------..--...--
SUFS_WIGBR/25-395--------------------IYLDNAASSQKPKCVLQREIIYSSKE-------------------------HS--AVH--
SUFS_YERPE/25-394--------------------VYLDSAASAQKPQAVIDKELHFYRDG-------------------------YA--AVH--
CSD_THEMA/23-400--------------------VYLDSAATTLKPKQVVKKLEEFYYNS-------------------------YA--NVH--
SERC_RABIT/7-357--------------------IVNFGPGPAKLPHSVLLEIQKELLDY-------------------------KG--LGI--
CSD_MYCPN/25-391--------------------VNFDNAATSIALDTVSQACKEYYELF-------------------------SV--NPH--
CSD_MYCPA/301-670--------------------IWFDNAATTQKPQVVIDRLSHFYAHE-------------------------NS--NIH--
CSD_HAEIN/60-425--------------------IYLDNAATTLKPQVLIDRTAEFYA.S-------------------------AG--SVH--
CSD_BORBU/33-410--------------------IYFDNAATSQKPKNVIYSNVEYYENY-------------------------NA--NVH--
NIFS_BACSU/2-366--------------------IYLDYAATTPICEEALTVYQKLSMDM-------------------------YG--NA.--
CSDA_ECOLI/21-388--------------------VYLDSAATALKPEAVVEATQQFYSLS-------------------------AG--NVH--
CSD_BACHD/23-391--------------------VYLDSAATSQKPIAVIEALDDYYRRY-------------------------NS--NVH--
D5ARX2_RHOCB/6-368--------------------IYLDNNATTRVFPEVVAAMLPYFTEH-------------------------FG--NA.--
K9ZIC0_ANACC/6-351--------------------.MLMIPGPTPVPEAALLALAKH....-------------------------..--...--
CSD_MYCTU/32-403--------------------.YLDSGATSQRPLQVLDAEREFLTAS-------------------------NG--AVH--
Q2FZY5_STAA8/32-401--------------------.YLDSTATSQTPVQVLNVLEDYYKRY-------------------------NS--NVH--
Q8U4C4_PYRFU/18-386--------------------IYFDNTATSLTPKPVIEAMDEYYLKY-------------------------RA--NVH--

PF00155

AAT_ECOLI/26-392-----------PGKINLGIGVYKDETGKTPVLTSVKKAEQY.....-------------------------..--...--
HIS8_BACSU/29-356-----------DKVVKLASNENPYG.....CSEAAKEAL.......-------------------------..--...--
HEM1_EMENI/192-555-----------EKVTVWCSNDYLGMGRN.PEVLATMHKTLDT....-------------------------..--.YG--
AATC_BOVIN/31-405-----------PRKVNLGVGAYRTDDSQPWVLPVVRKVEQR.....-------------------------..--..I--
AAT_SULSO/35-391-----------IKIIDFGIGQPDLP.....TFKRIRDAAKE.....-------------------------..--...--
TYRB_ECOLI/26-393-----------SDKVNLSIGLYYNEDGIIPQLQAVAEAEAR.....-------------------------..--..L--
AAT_HAEIN/26-392-----------ENKINLGIGVYKDAQGTTPIMHAVKEAEKR.....-------------------------..--...--
HIS8_ACEPA/24-347-----------TDLIKLNTNESPYG.....PSPRALEAIR......-------------------------..--...--
AAT_BACY2/32-387-----------IDVIGLGAGEPDFN.....TPQNIMDAAID.....-------------------------..--...--
1A12_ARATH/48-432-----------IIQMGLAENQLCLD.....LIKDWVKENPEASI..-------------------------CT--LEG--
BIOF_MYCLE/36-373-----------ATELDLASNDYLGLSQH.PDVIDGGVAALRV....-------------------------..--.WG--
HIS8_HALVD/30-351-----------EDLTKLSSNENPHG.....PSPKAVAAI.......-------------------------..--...--
1A11_CUCMA/50-431-----------VIQMGLAENQLSFD.....MIVDWIRKHPEASI..-------------------------CT--PKG--
BNA3_YEAST/54-437-----------RELINLGQGFFSYS.....PPQFAIKEAQK.....-------------------------..--...--
LCB2_YEAST/155-515-----------YPCMNLSSYNYLGFAQSKGQCTDAALESVDK....-------------------------..--.YS--
PHHC_PSEAE/28-393-----------ADKLDLGVGVYKDAQGLTPILRSVKLAEQR.....-------------------------..--...--
HEM0_CHICK/121-466-----------TSVELWCSSDYLGLSRH.PAVLRAARAALDA....-------------------------..--.HG--
BIOF_ECOLI/39-380-----------RQYLNFSSNDYLGLSHH.PQIIRAWQQGAEQ....-------------------------..--.FG--
1A11_ORYSI/50-438-----------IIQMGLAENQLSFD.....LLEEWLEKNPHALGLR-------------------------RE--GGG--
AATB_RHIML/41-402-----------KPVIILGAGEPDFD.....TPDHVKQAASD.....-------------------------..--...--
HIS8_SCHPO/26-373-----------SEGVLLDANECAYG.....SVI.............-------------------------..--...--
ATTY_TRYCR/33-406-----------KPIIKLSVGDPTLDKNL.LTSAAQIKKLKE.....-------------------------..--...--
1A1C_DIACA/49-429-----------VIQMGLAENQLCFD.....LVTEWLLKNPQASI..-------------------------CT--NEG--
1A14_SOLLC/53-434-----------VIQMGLAENQLSVD.....LIEEWIKRNPKASI..-------------------------CT--NDG--
ATTY_RHIME/26-386-----------PGKVDLGVGVYRDETGRTPIFRAVKAAEKR.....-------------------------..--...--
AATA_RHIME/31-392-----------RDVIGLGAGEPDFD.....TPDNIKKAAID.....-------------------------..--...--
AATM_YEAST/44-441-----------VNKIDLTVGIYKDGWGKVTTFPSVAKAQKLI....-------------------------..--.ES--
E7KDT6_YEASA/27-375-----------TEGILLDANENAHG.....PTPV............-------------------------..--...--
HEM1_RHIRD/46-391-----------KDVTVWCSNDYLGMGQN.PKVIEAMKAAIDH....-------------------------..--.CG--
AAT4_ARATH/29-395-----------PVKLNLSAGTYRTEEGKPLVLDVVRRAEQQ.....-------------------------..--...--
AAT1_ARATH/57-423-----------PEKVNVGVGAYRDDNGKPVVLECVREAEKR.....-------------------------..--...--
AAT1_MEDSA/42-410-----------PIKLNLGVGAYRTEEGKPLVLDVVRRVERQ.....-------------------------..--..L--
COBC_PSEDE/23-328-----------EDWLDLSTGIN........PCPVALPAVPE.....-------------------------..--...--
HIS8_LACLA/22-345-----------TDIIKLNTNENPY......PPTSVAQLFNE.....-------------------------..--...--
HIS8_ECOLI/29-351-----------NGDVWLNANEYPTAVEF..................-------------------------..--...--
AAT2_BACSU/32-384-----------AHIINLGQGNPDLP.....TPPHIVEALRE.....-------------------------..--...--
1A12_CUCMA/40-424-----------IIQMGLAENQLSFD.....LLESWLSKNPDAAS..-------------------------FK--RDG--
BIOF_LYSSH/37-379-----------KKFLLFSSNNYLGLATD.SRLKKKATEGISK....-------------------------..--.YG--
BIOF_HAEIN/35-380-----------RKMLNMSSNDYLGLASN....ENLRQSFLQQYG..-------------------------GN--FPS--
MALY_ECOLI/28-382-----------ADLLPFTISDMDFA.....TAPCIIEALNQ.....-------------------------..--...--
1A1C_SOYBN/48-431-----------VIQMGLAENQLTSD.....LVEDWILNNPEASI..-------------------------CT--PEG--
ATTY_HUMAN/71-434-----------KTMISLSIGDPTVFGNL.PTDPEVTQAMKD.....-------------------------..--...--
KBL_ECOLI/42-387-----------SHVINFCANNYLGLANH.PDLIAAAKAGMDS....-------------------------..--.HG--
HIS8_STRCO/26-360-----------DVPVRLNTNENPYP.....LPEALVERIAE.....-------------------------..--.RV--
AAT5_ARATH/77-445-----------GMKLNLGVGAYRTEELQPYVLNVVKKAENL.....-------------------------..--...--
E7KGL9_YEASA/145-545-----------TNVFNLASNNFLQLSAT.EPVKEVVKTTIKN....-------------------------..--.YG--
1A12_SOLLC/48-430-----------VIQMGLAENQLCLD.....LIEDWIKRNPKGSI..-------------------------.C--SEG--
AATM_BOVIN/57-425-----------SKKMNLGVGAYRDDNGKPYVLPSVRKAEAQ.....-------------------------..--...--

PF04864

TAR2_ARATH/79-436---------------------INLKFGDPTVYERYWQENGEVTTMV-------------------------IP--GWQ--
TAR4_ARATH/91-449---------------------VDANSGDPLFLEPFWMRQAERSAIL-------------------------VS--GWH--
TAR1_ARATH/26-381---------------------INLDQGDPTAFQEYWMKKKDRCTVV-------------------------IP--AWD--
Q76BK3_ALLCE/104-465---------------------ADVVSGDSLFLEEYWMRHKSNTAVL-------------------------IS--GWH--
TAA1_ARATH/25-384---------------------VNLDHGDPTAYEEYWRKMGDRCTVT-------------------------IR--GCD--
O04927_ALLTU/87-452---------------------ADVASGDALFLEEYWKDHKENTAVL-------------------------VS--GWH--
Q942G4_ORYSJ/111-470---------------------ADGQGGDPLFLEPYWKRHAAASAVV-------------------------FS--GWH--
Q9M7L9_ALLCE/102-462---------------------ADATTGDAMFLEKYWLHHRVNTAML-------------------------ES--GWH--
Q8LL95_AEGTA/68-427---------------------INLD.GDPTMYEAFWREAGERAAAV-------------------------IP--GWW--
Q43366_ALLCE/93-456---------------------ADVASGDGLFLEEYWQQHKENSAVL-------------------------VS--GWH--

PF12897

Q9RU17_DEIRA/28-452-----MTSSATPDALAQAQAAYAELKARGLKLNLQRGQPADADFDL-------------------------SN--PML--
D5UN97_TSUPD/7-427-----LSQSELADVHATLTGLYETLKAQGLTLDLTRGKPAPDQLDL-------------------------SN--ALL--
Q1IZU0_DEIGD/1-422-----MTKEASRPALDLARQAYEAFKARGLNLNMQRGQPADADFDL-------------------------SN--GLL--
A9GH35_SORC5/7-425-----LSPDALASLTRELEARFAAFEARGLKLDMTRGKPSSEQLDL-------------------------AN--GML--

PF00464

GLYA_BACSU/4-380-------------LPAQDEQVFNAIKNERERQQTKIELIASENFVS-------------------------EA--VME--
GLYA_CAMJE/3-379-------------LEMFDKEIFDLTNKELERQCEGLEMIASENFTL-------------------------PE--VME--
GLYC_YEAST/17-416-------------LVDTDPEVDSIIKDEIERQKHSIDLIASENFTS-------------------------TS--VFD--
GLYM_YEAST/33-432-------------VSEGDPEMFDILQQERHRQKHSITLIPSENFTS-------------------------KA--VMD--
GLYC_NEUCR/18-417-------------LVESDPQVAEIMKKEVQRQRESIILIASENVTS-------------------------RA--VFD--
GLYC_HUMAN/26-425-------------LKDSDVEVYNIIKKESNRQRVGLELIASENFAS-------------------------RA--VLE--
GLYA_BRADU/18-395-------------LDQADPEIAAAIKGELGRQRHEVELIASENIVS-------------------------RA--VLE--
GLYM_HUMAN/49-448-------------LSDSDPEMWELLQREKDRQCRGLELIASENFCS-------------------------RA--ALE--
C9R5U6_AGGAD/8-386-------------IADYDPVLWQAIQNENRRQEEHIELIASENYAS-------------------------PR--VMQ--
N0BCL8_9RHIZ/20-397-------------VSETDPEIFSAIQKEFGRQQHEIELIASENIVS-------------------------QA--VLD--
GLYA_ECOLI/8-386-------------IADYDAELWQAMEQEKVRQEEHIELIASENYTS-------------------------PR--VMQ--
GLYM_SOLTU/57-453-------------.EVVDPEIADIIEHEKARQWKGLELIPSENFTS-------------------------VS--VMQ--

PF00282

DDC_CAEEL/377-746----------PGYLKA...LLPPKAPQKAEDIDDILEDYHKLIVPG-------------------------LS--HSSHP
DDC_BOVIN/35-414----------PGYLRP...LIPTTAPQEPETFEAIIEDIEKIIMPG-------------------------VT--HWHSP
DCHS_HUMAN/36-414----------PGYLRA...QLPESAPEDPDSWDSIFGDIERIIMPG-------------------------VV--HWQSP
DCHS_DROME/35-413----------PGYMRQ...LLPESAPIEGEPWPKIFSDVERIVMPG-------------------------IT--HWQSP
DCE1_FELCA/144-518----------PHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYG-------------------------VR--TGH.P
DCEA_ECOLI/33-383----------PLHEMR....DDVAFQIIND.ELYLDGNARQNLATF-------------------------CQ--TWDDE
DCE_DROME/64-434----------PEDMKR...LLDLDVPDRALPLQQLIEDCATTLKYQ-------------------------VK--TGH.P
DDC_DROME/70-446----------PGYLKP...LIPDAAPEKPEKWQDVMQDIERVIMPG-------------------------VT--HWHSP
B1Q3F1_SOLLC/33-381----------PENSIP....KEAAYQIIND.ELMLDGNPRLNLASF-------------------------VT--TWMEP

PF01276

DCOS_ECOLI/109-551-PPFFRALVDYVNQGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGEA-------------------------LF--RAD--
YAAO_BACSU/3-363-TPLYKALIQHARRNSHSFHVPGHHNGDVFFDD.AKSIF.....DP-------------------------LL--TID--
SPEA_BACSU/6-371-TPLYTGLKKHASRQPVQFHIPGHKKGAGMDPE.....FRQFIGEN-------------------------AL--SID--
ADIA_ECOLI/140-590-PPLFSALMKYSDIHEYSWAAPGHQGGVGFTKTPAGRFYHDYYGEN-------------------------LF--RTD--
DCOR_HAEIN/108-550-PPFFKMLSEYVEMGNIAFDCPGHQGGQYYRKHPAGRFLYDFYGEN-------------------------IF--RSD--
DCLZ_ECOLI/130-545-PPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPVGCLFYDFFGGN-------------------------TL--KAD--
DCOR_ECOLI/101-543-PPFYDTLTQYVEMGNSTFACPGHQHGAFFKKHPAGRHFYDFFGEN-------------------------VF--RAD--
LDCI_ECOLI/130-545-PPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPVGSLFYDFFGPN-------------------------TM--KSD--

PF00202

OAT_BACSU/17-398YGANNYHPLP..IVISEALGAWVK.DPEGNEYMDMLSAYSAVNQGH-------------------------RH--P----
Y2045_BACPE/19-432SMAKDHPN....LPVVKEEGCYYY.GVDGVKYLDFTSGIAVTNVGH-------------------------RH--P----
ARGD_BACSU/7-377TYGRWD......IDIKKAKGTYVE.DQNGKTYLDFIQGIAVSNLGH-------------------------CH--E----
GSA_MYCLE/40-431FSAVGGTP....LFITEARGCWLT.DADGRRYVDLVCSWGPMILGH-------------------------AH--P----
BIOA_CORGL/18-420YAAPGVRN....RLVTKTDGVFLT.LEDGSTVIDAMSSWWSAIHGH-------------------------GH--P----
BIOA_HAEIN/19-424YSSVSSDMPL..YAVERADGVMIT.LKDGRRLIDGMSSWWAALHGY-------------------------NH--P----
ARGD_YEAST/27-418TYSRPED.....LCITRGKNAKLYDDVNGKEYIDFTAGIAVTALGH-------------------------AN--P----
GABT_HUMAN/65-496IQNAEAVHFF..CNYEESRGNYLV.DVDGNRMLDLYSQISSVPIGY-------------------------SH--P----
GABT_MYCLE/29-443AVPRGVGVTL.PVFVTRAAGGVIE.DVDGNRLIDLGSGIAVTTIGN-------------------------SS--P----
ARGD_ECOLI/20-400IYAPAE......FIPVKGQGSRIW.DQQGKEYVDFAGGIAVTALGH-------------------------CH--P----
GABT_ECOLI/14-421AIPRGVGQIH.PIFADRAENCRVW.DVEGREYLDFAGGIAVLNTGH-------------------------LH--P----
GABAT_EMENI/65-495VFDVRSLNML..ADYTKSVGNYIA.DLDGNMLLDVYAQIASIPVGY-------------------------NN--P----
OAT_PLAF7/20-406YGAHNYDPIP..VVLKRGKGVFVY.DIEDRRYYDFLSAYSSVNQGH-------------------------CH--P----
X2GMN7_9BACI/23-446...MKDYEAFPPIVIKKGEGVWLY.DEQNQRYLDAVSSWWVNLFGH-------------------------AN--P----

PF05889

SPCS_METJA/57-434----------MDTDKDPN..VVQIGEREARVYTKLQRDGVFDFCHG-------------------------VG--RSG--
SPCS_METKA/53-429----------MDTDKDPK..AARIGEREARVASRLAEESVFGFCHG-------------------------VG--RSG--
SPCS_HUMAN/61-459----------MDSNNFLG..NCGVGEREGRVASALVARRHYRFIHG-------------------------IG--RSG--
SPCS_CAEEL/53-450----------HDTNNRVDMIPVGAGEREGRVLTPLVQRLHSNLTHG-------------------------IG--RSG--
SPSS1_ARCFU/33-368----------GDGYSVCDFCTTGR.......LDEIKTPPIHDFIHN-------------------------..--...--

PF02347

GCSP_SCHPO/65-504PRHIGPSKTDQQYQLESLGYKDFDSFLKDVIPDSVRTPESQLMAFGSVNPNEKNPPVNYSESEFTTLANNVAN..QNKL.
GCSP_HUMAN/65-488RRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDP............VCENEILATLHAISS..KNQI.
GCSPA_BACSU/3-443HRYLPATEKDKQEMLATIGVSSIDDLF.ADIPENVKYKKEHQIKKA............KSETELTRELTKLASKNRDTVQ
GCSP_ECOLI/16-440ERHIGPDAAQQQEMLNAVGAQSLNALTGQIVPKDIQLATPPQVGAP............ATEYAALAELKAIAS..RNKR.
GCSP_SYNY3/35-460DRHLGPGETEQRQMLQTLGFDTLGDLIDQAVPPAIRFPRSLQLPAS............QSEYGAIAQLKSIAS..KNQV.
Q21962_CAEEL/32-462DRHIGPRRLEQQQMLDFIGYKDLDDLTGTNVPNMIKAEKALELPAP............LDEYKMLKELEAIAA..QNKI.
GCSPA_AQUAE/1-439MSYIPHSEEETKEILSKLGLESLEDLF.SHIPKEL.FAKDFSFPEP............KSEEELRRIFER.AC..EDTEL
GCSP_YEAST/69-511RRHLGPSPSDVKKMLKTMGYSDLNAFIEELVPPNILKRRPLKLEAPS.........KGFCEQEMLQHLEKIAN..KNHYK
GCSP_MYCTU/9-438DRHIGLDSQAVATMLAVIGVDSLDDLAVKAVPAGILDTLTDTGAAPGLDS....LPPAASEAEALAELRALAD..ANTV.

PF01053

CYSD_EMENI/10-428---------------------AHGARLFGLKEFG.NIYS-RIMNP-------TVDVFEKRI----A-----A--------
CYS3_YEAST/10-390---------------------......SPANPIGTYEYS-RSQNP-------NRENLERAV----A-----A--------
MET17_YEAST/6-436---------------------KHGSQLFGLEVPG.YVYS-RFQNP-------TSNVLEERI----A-----A--------
O02215_CAEEL/69-449---------------------DQF...NEDNHGANFVYR-RCGNP-------TTENVEVVI----N-----E--------
METC_ECOLI/7-392---------------------EAKKHATRNRANGELFYG-RRGTL-------THFSLQQAM----C-----E--------
CGL2_CAEEL/8-386---------------------......NPGEPKG.HDYS-RAGNP-------TRDVLQKNL----A-----A--------
METC_HAEIN/8-393---------------------EDKKHATQRRAKGELFYG-RRGTL-------THFALQDLM----C-----E--------
METC_ARATH/88-460---------------------......SAIENGP.YDYT-RSGNP-------TRDALESLL----A-----K--------
CGS1_ARATH/176-561---------------------AELIDFKEKRSVS.FEYG-RYGNP-------TTVVLEDKI----S-----A--------
METI_BACSU/6-363---------------------......GIGESTG.FDYV-RTKNP-------TRQLVEDAI----A-----N--------
MCCB_BACSU/4-377---------------------......KAGQHTG.YEYS-RTANP-------TRTALEALV----T-----E--------
CGL_HUMAN/19-395---------------------......APGQHSG.FEYS-RSGNP-------TRNCLEKAV----A-----A--------
METZ_PSEAE/20-401---------------------ADAAARFAGEVPG.NVYS-RYTNP-------TVRTFEERI----A-----A--------
METC_BACSU/9-382---------------------......SFEEFGA.YDYS-RSGTP-------TRTALEETI----A-----A--------
METB_ECOLI/6-381---------------------......GFNEPRA.HDYS-RRGNP-------TRDVVQRAL----A-----E--------
STR3_YEAST/7-405---------------------......LNNEDAQNYDYS-RSGNP-------TRSVLQHQI----G-----K--------
CYSD_SCHPO/9-427---------------------DHGGRLFGLQEPG.YIYS-RMMNP-------TADVFEKRI----A-----A--------
METB_MYCLE/15-388---------------------......GVGELRGGFEYA-RTGNP-------MRAALEASL----A-----T--------
METB_HAEIN/8-366---------------------......GIGESTG.FDYT-RTKNP-------TRTVLEETI----A-----K--------
O15565_TRIVA/12-395---------------------DQGGARFGGKEAG.YMYT-RIGNP-------TNSALEGKI----A-----K--------
METB_HELPY/4-377---------------------......AIGRHKG.YEYS-RSGNP-------TRFALEELI----A-----D--------
A2FEV4_TRIVA/9-392---------------------QQGGNRFAGQESG.YIYT-RLGNP-------TVSNLEGKI----A-----F--------
B0SQZ9_LEPBP/8-432---------------------DHAARLFGLQEFG.NIYT-RLMNP-------TTDVLEKRV----A-----A--------
B2FLU7_STRMK/14-389---------------------......SPGEHQG.FEYS-RTHNP-------TRFAYERCV----A-----S--------
K7VKJ5_MAIZE/100-483---------------------QELIDFKEGRHAS.FEYG-RYGNP-------TTEALEKKM----S-----A--------
METZ_MYCTU/21-405---------------------AVAEKSFAGELDH.YVYS-RYGNP-------TVSVFEERL----R-----L--------
Q5AXC9_EMENI/40-405---------------------......SHEGGGE.YDYT-RSGNP-------TRTHLERHL----A-----K--------

PF01041

ERBS_SACEN/13-363---------------------------......G----------P-------ENEAFEAEF----A-----A--------
P72893_SYNY3/11-365---------------------------C.....Y----------E-------YIVRFEEVF----K-----K--------
P73264_SYNY3/14-373---------------------------......G----------N-------HTQEFERGF----A-----E--------
O27256_METTH/7-356---------------------------......G----------P-------RVAEFEEKF----A-----A--------
P74668_SYNY3/13-379---------------------------......G----------K-------TVADFEQAA----A-----D--------
RFBH_SALTY/40-430---------------------------T.....G----------R-------FNDAFEKKL----G-----E--------
PSEC_HELPY/9-366---------------------------......G----------K-------RSLLFEEAL----C-----E--------
Y1066_METJA/12-379---------------------------......G----------P-------KTLKFEELF----R-----N--------
ARNB_ECOLI/10-374---------------------------......G----------P-------KNQALEQAF----C-----Q--------
SPSC_BACSU/14-382---------------------------......G----------P-------KVQQFEKEF----A-----A--------
O26434_METTH/7-359---------------------------R.....G----------E-------FITKFEEKF----A-----R--------
NTDA_BACSU/78-432---------------------------......G----------P-------YLEQFEKVL----S-----T--------
A4F7N3_SACEN/33-380---------------------------G.....G----------P-------LVREFEGRV----A-----D--------
B1W368_STRGG/23-413---------------------------CAYQGRD----------S-------YERQFASAF----A-----D--------
B1W386_STRGG/12-373---------------------------G.....N----------S-------TVEEFEAAL----A-----A--------
C6W8U4_ACTMD/18-373---------------------------G.....G----------S-------EVDEFEREF----A-----E--------
F7YJG4_VIBA7/13-366---------------------------......G----------N-------EVSEFEKEF----A-----A--------
RIFK_AMYMS/15-372---------------------------G.....G----------D-------EVNSFEREF----A-----A--------
Y3402_MYCTU/52-405---------------------------F.....G----------P-------NERRFARAL----R-----D--------
Q5KV33_GEOKA/14-364---------------------------......G----------D-------YVKKLEADI----A-----A--------
Q79H47_BORPE/14-362---------------------------......G----------P-------EVKELEAAL----C-----A--------
Q7W0M1_BORPE/26-405---------------------------......G----------P-------NAREFEREF----A-----A--------
Q9ABJ3_CAUCR/28-397---------------------------......G----------P-------TVEAFETAF----A-----A--------
Q9KVA5_VIBCH/9-360---------------------------R.....G----------K-------YIDRFETEF----A-----E--------

PF01212

GLY1_ASHGO/17-304------------------------------T.IGD.A.V.YQEDI.......DTLKLEQHV----A-----K........
GLY1_YEAST/16-303------------------------------S.IGD.A.V.YGEDV.......DTVRLEQTV----A-----R........
Q7QAI2_ANOGA/21-308------------------------------V.VGD.D.V.YGEDP.......TVRQLEQRS----A-----A........
YF64_CAEEL/68-359------------------------------I.VGD.D.V.YGEDT.......TTNRLEQRC----A-----E........
Q8Y182_RALSO/3-296------------------------------NGSGH.EPA.YGDDS.......WTQRVCDRI----R-----D........
Q9RUR9_DEIRA/13-296------------------------------E.VGD.D.V.YGEDP.......NVNALQNEL----A-----H........
Q8A7N2_BACTN/47-423------------------------------M.LGD.E.S.YAGAT.......SFFKLKDTI----T-----R........
THA2_ARATH/11-300------------------------------E.VDD.D.V.LGNDP.......TALRLEKEV----A-----E........
Q8RCY7_CALS4/5-290------------------------------E.VGD.D.V.YGEDP.......TVRKLEEMA----A-----E........
Q89ID2_BRADU/23-308------------------------------E.VGD.E.Q.VGDDP.......TVNALCERV----A-----D........
Q7MUT3_PORGI/47-424------------------------------M.LGD.E.S.YAGAR.......SYYNMKNAI----H-----D........
Q9VCK6_DROME/8-304------------------------------V.VGD.D.V.YGEDP.......TVNELEART----A-----A........
LTAE_PSEAE/7-299------------------------------N.RGH.ERA.YGDDQ.......WTARASDYF----R-----Q........
TPL_PASMU/47-424------------------------------M.IGD.E.A.YAGSR.......NFMHLQDVV----R-----E........
TNAA1_SYMTH/45-421------------------------------M.LGD.E.S.YAGAS.......SYYRLKETV----T-----D........
TNAA_CALS4/50-428------------------------------M.LGD.E.S.YAGSR.......NYQHLCEVV----Q-----D........
GLY1_SCHPO/30-313------------------------------S.DGD.C.V.YEEDE.......DTRKLEVYV----A-----K........
Q9X266_THEMA/3-287------------------------------E.VGD.D.V.YGEDP.......TINELERLA----A-----E........
TNAA_PHOLL/46-432------------------------------M.MGD.E.A.YAGSR.......NYYHLCDKV----N-----E........
Q88AI0_PSESM/7-297------------------------------N.KGH.QRA.YGDDQWTARASDDFRRLFETD----C-----E........
Q89N26_BRADU/13-294------------------------------P.LGD.D.G.REGDP.......TVRALEARG----A-----A........
Q7MEV9_VIBVY/2-285------------------------------I.VGD.D.V.YGDDP.......TVNELEAFA----A-----K........
TNAA_CLOTE/60-438------------------------------M.KGD.E.A.YAGGK.......SYFKLVDAV----K-----D........
Q9A3V8_CAUCR/9-299------------------------------N.AGT.A.SGYGTDH.......VSRAAADRI----R-----A........
TNAA_HALSA/42-412------------------------------L.QGD.E.A.YAGSA.......SFEDLAVAA----E-----D........
Q7NHQ7_GLOVI/7-294------------------------------E.VGD.D.V.YGEDP.......TVNRLQERV----A-----H........
TNAA_CHRVO/47-428------------------------------M.MGD.E.A.YAGSR.......NFLRLADTV----R-----E........
TNAA_AERPE/52-428------------------------------M.TGD.E.A.YAGAR.......SWFRFRDAV----R-----D........
Q896G8_CLOTE/5-288------------------------------N.VGD.D.V.YGDDP.......TVNELEEYA----A-----N........
Q9HMP3_HALSA/22-307------------------------------P.VEH.G.E.HGDDP.......AVAAVEATA----A-----D........
Q8EC07_SHEON/3-286------------------------------E.VGD.D.V.YGDDP.......TVNSLQDMA----A-----E........
Q7NQ31_CHRVO/5-289------------------------------E.VGD.D.V.YGDDP.......TVLKLEALA----A-----D........
D5AL49_RHOCB/46-420------------------------------M.QGD.E.S.YAGSP.......SFFRFEAAV----Q-----N........
D5AV45_RHOCB/2-292------------------------------N.AGHVA.S.YGADP.......LSGAVVEHL----R-----E........
G3XD13_PSEAE/5-283------------------------------E.LGD.D.V.YGEDP.......TVNRLEAEL----A-----A........
I0DW76_PROSM/47-432------------------------------I.TGD.E.A.YAGSR.......NYYDLKNKV----K-----E........
LTAE_ECOLI/3-280------------------------------P.VGD.D.V.YGDDP.......TVNALQDYA----A-----E........
TPL_SYMTH/47-422------------------------------M.MGD.E.A.YAGAR.......SFFRLEEAV----R-----E........
Q59NC4_CANAL/14-300------------------------------T.FGD.S.V.YQEDE.......TTLRLESKM----C-----E........
Q7VW60_BORPE/3-283------------------------------P.VGD.D.V.MGDDP.......SVRRLQDEV----A-----A........
TPL_FUSNN/49-425------------------------------M.QGD.E.A.YAGSR.......NFFHLEETV----K-----E........
Q8RHQ6_FUSNN/51-505------------------------------F.LGD.E.S.YGRNK.......GYYVLLDAM----R-----DCFERGDNQ
THA1_ARATH/7-295------------------------------E.VDD.D.V.LGYDP.......TARRLEEEM----A-----K........
Q98A67_RHILO/12-297------------------------------A.SGQ.A.LPYGNDE.......LTHTVEHQL----A-----E........

PF06838

YNBB_BACSU/11-416---------------------YRKHKVSDTHFTPSTGYG--YDDI-------GRDTLESIY----A-----D--------
Q8EQP5_OCEIH/1-405---------------------FRHHRISDSHLQGTTGYG--YDDI-------GRDSLEAVY----A-----E--------
Q8Y7I1_LISMO/4-408---------------------FQENKVSDFHFHPSTGYG--YDDE-------GRDTLEHVY----A-----T--------
Q97I22_CLOAB/19-425---------------------FQEERISESHFTNSSGYG--YNDI-------GRDSLDRVY----A-----N--------
Q8XL83_CLOPE/19-425---------------------FQEERISDNHFTNSTGYG--YGDI-------GRDTLDLVY----A-----R--------
Q8DHD9_THEEB/26-430---------------------FRQHRLGVHHFSSMTGYG--HGDL-------GREVLDRVF----A-----Q--------
Q54763_SYNE7/3-407---------------------FRAERVGVHHFAGVSGYG--HDDL-------GRETLDRLY----A-----R--------
Q8RA65_CALS4/17-421---------------------FQKNKLSDIHFNGTTGYG--YGDI-------GRDVIEKIY----A-----G--------
Q9KAC8_BACHD/11-416---------------------FKRKQVSEHHFTPSTGYG--YDDL-------GRETLEAVY----A-----D--------
Q8YWL0_NOSS1/20-424---------------------FRNQRVGAHHFAGVSGYG--HDDL-------GRETLDKVF----A-----E--------
Q55407_SYNY3/3-407---------------------FRHHRVGVQHFAGVSGYG--HDDL-------GRDTLDGVF----A-----Q--------
Q895H5_CLOTE/19-425---------------------FQEERISDAHFTNTTGYG--YGDM-------GRDTLDKVY----A-----R--------
Q5HPN4_STAEQ/5-406---------------------FHHVKASESDLQGSTGYG--YDDF-------GRDHLEQIY----A-----H--------

PF03841

SELA_PSEAE/79-451---------------------EAITLAARYPLNLEFDLASGKRGD-------RDDLIAGLI----R-----E--------
SELA_CAMJE/71-423---------------------EACKDIICNYSNVEFDLENGKRGS-------RYALVLEKL----K-----M--------
SELA_PASMU/81-448---------------------HAALTSMSHNVALEYDLEEGKRSH-------RDHYISDLL----C-----Q--------
SELA_HAEIN/82-449---------------------QAALSAMQKNVSLEYDLDEGKRSH-------RDNYISELL----C-----K--------
SELA_RHIME/80-448---------------------DAAVDAMREAAALEFDLDSGGRGE-------RDSHLRELL----C-----E--------
SELA_ECOLI/83-452---------------------EAVAQAMRSPVTLEYDLDDAGRGH-------RDRALAQLL----C-----R--------
SELA_AQUAE/72-435---------------------NFISEIANGYSNLEYNLEEGKRGS-------RIAHIEKYL----N-----E--------
C7LWD8_DESBD/82-448---------------------AAVAQGCRHYSNLEMDLDTGQRGS-------RYAHVEKLL----C-----R--------
SELA_MOOTA/80-445---------------------AAALTAAGRYTNLEYDLEKGQRGN-------RYSHVTGLL----K-----E--------
W8TF72_EUBAC/86-450---------------------EDLWLIASRYSNLEYDIESGKRGS-------RYSHLEEIV----R-----K--------

PF00266

SERC_ECOLI/4-350---------------------SVMEVSHRGK----------EFIQ-------VAEEAEKDF----R-----D--------
CSD_PSEPK/23-389---------------------R..AQHLPGA----------LATQ-------AFETSRDKV----A-----A--------
CSD_CHLTR/19-388---------------------R..ALYTASH----------DITF-------AHWQVRSKV----G-----S--------
CSD_XYLFA/36-404---------------------R..AVHTLGT----------EATE-------AYEATRTAL----A-----T--------
NIFS_NOSS1/4-365---------------------S..SMHTFGG----------QLGK-------AVRTAREQV----A-----A--------
CSD_STRCO/31-406---------------------R..GVHVLAE----------EATA-------LYEGARDKV----A-----E--------
CSD_TREPA/20-390---------------------R..GSHELAV----------ESAL-------LIENTRKKT----A-----Q--------
CSD_UREPA/18-385---------------------N..TDSNFTF----------HTHE-------IMNETRANV----A-----K--------
CSD_METTH/20-389---------------------R..GAYSLVL----------RATR-------KLQEAREKV----A-----G--------
SUFS_DICD3/30-399---------------------R..GIHTLSA----------RATS-------AMEEVRAKV----A-----T--------
CSD_VIBCH/25-393---------------------R..GSHSLTA----------QATS-------QFEGAREQV----A-----Q--------
SUFS_ECOLI/25-394---------------------R..GIHTLSA----------QATE-------KMENVRKRA----S-----L--------
CSD_PSEAE/23-389---------------------R..AQHVPGE----------RATR-------AFEAARSRV----A-----H--------
CSD_AERPE/21-399---------------------R..GVHRLSM----------EASK-------AYEDAHEVV----A-----R--------
CSD_PASMU/44-409---------------------R..SQYDEKQ----------..TA-------LFEQARENV----K-----N--------
SERC_HAEIN/4-348---------------------SVMEVSHRGK----------YFME-------LVTQAEKDL----R-----E--------
SUFS_BACSU/23-391---------------------R..GVHTLGT----------RATD-------GYEGAREKV----R-----K--------
NFS1_YEAST/100-462---------------------S..NTHSYGW----------ETNT-------AVENARAHV----A-----K--------
SPYA_CALJA/45-398---------------------...MLGHMHK----------ETYQ-------IMDEIKEGI----Q-----Y--------
SUFS_WIGBR/25-395---------------------R..GIHTLSK----------NATK-------NMEDIRSKI----A-----K--------
SUFS_YERPE/25-394---------------------R..GIHSLSA----------EATQ-------QMEAVRTQV----A-----D--------
CSD_THEMA/23-400---------------------R..AVHTLAV----------RATT-------EFEETREEF----A-----E--------
SERC_RABIT/7-357---------------------SVLEMSHRSS----------DFAK-------IVNNTENLV----R-----E--------
CSD_MYCPN/25-391---------------------N..KTPDLNN----------QIIA-------IIAETRQLV----A-----D--------
CSD_MYCPA/301-670---------------------R..AAHELAA----------RATD-------AYEEARDTV----A-----E--------
CSD_HAEIN/60-425---------------------R..SQYDAAQ----------..TV-------QYEQARTQV----K-----E--------
CSD_BORBU/33-410---------------------R..SGHKFAI----------QSSI-------KIEKTRELV----K-----N--------
NIFS_BACSU/2-366---------------------S..SLHDAGG----------KAKH-------ILEYCREKI----A-----N--------
CSDA_ECOLI/21-388---------------------R..SQFAEAQ----------RLTA-------RYEAAREKV----A-----Q--------
CSD_BACHD/23-391---------------------R..GVHTLGT----------LATD-------GYEGAREKI----R-----R--------
D5ARX2_RHOCB/6-368---------------------S..SGHGFGA----------QAGL-------GLRKARLAV----A-----A--------
K9ZIC0_ANACC/6-351---------------------...PIGHRTS----------EFSN-------MMGEVTQNL----K-----W--------
CSD_MYCTU/32-403---------------------R..GAHQLME----------EATD-------AYEQGRADI----A-----L--------
Q2FZY5_STAA8/32-401---------------------R..GVHTLGS----------LATD-------GYENARETV----R-----R--------
Q8U4C4_PYRFU/18-386---------------------R..GVHRLSQ----------MATQ-------KYEESRKVV----A-----D--------

PF00155

AAT_ECOLI/26-392---------------------LLENETTKNY----------LGID-------GIPEFGRCT----Q.....E--------
HIS8_BACSU/29-356---------------------HHEIQQLALY----------PDGY-------.SAALRTRL----S.....K--------
HEM1_EMENI/192-555---------------------AGAGGTRNIS----------GHNQ-------HAVSLENTL----A.....K--------
AATC_BOVIN/31-405---------------------ANDSSINHEY----------LPIL-------GLAEFRTCA----S.....R--------
AAT_SULSO/35-391---------------------.ALDQGFTFY----------TSAF-------GIDELREKI----A.....Q--------
TYRB_ECOLI/26-393---------------------NAQPHGASLY----------LPME-------GLNCYRHAI----A.....P--------
AAT_HAEIN/26-392---------------------LFDKEKTKNY----------LTID-------GIADYNEQT----K.....A--------
HIS8_ACEPA/24-347---------------------AADNDTLRLY----------PDPE-------.ALALRKAL----G.....A--------
AAT_BACY2/32-387---------------------.SMQQGYTKY----------TPSG-------GLPALKQAI----I.....E--------
1A12_ARATH/48-432---------------------IHQFSDIANF----------QDYH-------GLKKFRQAI----A.....H--------
BIOF_MYCLE/36-373---------------------AGATGSRLVT----------GDTI-------LHHELECEL----A.....E--------
HIS8_HALVD/30-351---------------------EDAAPTVSVY----------PKTA-------.HTDLTERL----A.....D--------
1A11_CUCMA/50-431---------------------LERFKSIANF----------QDYH-------GLPEFRNGI----A.....S--------
BNA3_YEAST/54-437---------------------ALDIPMVNQY----------SPTR-------GRPSLINSL----I.....K--------
LCB2_YEAST/155-515---------------------IQSGGPRAQI----------GTTD-------LHIKAEKLV----A.....R--------
PHHC_PSEAE/28-393---------------------LVEQETTKSY----------VGGH-------GDALFAARL----A.....E--------
HEM0_CHICK/121-466---------------------LGAGGTRNIG----------GTSP-------LHGALERAL----A.....L--------
BIOF_ECOLI/39-380---------------------IGSGGSGHVS----------GYSV-------VHQALEEEL----A.....E--------
1A11_ORYSI/50-438---------------------ASVFRELALF----------QDYH-------GLPAFKNAL----A.....R--------
AATB_RHIML/41-402---------------------.AIHRGETKY----------TALD-------GTPELKKAI----R.....E--------
HIS8_SCHPO/26-373---------------------SVDGVEFNRY----------PDPR-------.QIEVKQRL----C.....D--------
ATTY_TRYCR/33-406---------------------AIDSQECNGY----------FPTV-------GSPEAREAV----ATWWRNS--------
1A1C_DIACA/49-429---------------------VNKFMDIAIF----------QDYH-------GLPEFRSAV----A.....K--------
1A14_SOLLC/53-434---------------------IESFRRIANF----------QDYH-------GLPEFTNAI----A.....K--------
ATTY_RHIME/26-386---------------------LLETQDSKAY----------IGPE-------GDLVFLDRL----W.....E--------
AATA_RHIME/31-392---------------------.AIDRGETKY----------TPVS-------GIPELREAI----A.....K--------
AATM_YEAST/44-441---------------------HLELNKNLSY----------LPIT-------GSKEFQENV----M.....K--------
E7KDT6_YEASA/27-375---------------------ELSKTNLHRY----------PDPH-------.QLEFKTAM----T.....K--------
HEM1_RHIRD/46-391---------------------AGAGGTRNIS----------GTNH-------YHVLLEQEL----A.....D--------
AAT4_ARATH/29-395---------------------.LANDLDKEY----------LPLN-------GLPEFNKLS----T.....K--------
AAT1_ARATH/57-423---------------------.LAGSTFMEY----------LPMG-------GSAKMVDLT----L.....K--------
AAT1_MEDSA/42-410---------------------LNDMSRNKEY----------IPIV-------GLADFNKLS----A.....K--------
COBC_PSEDE/23-328---------------------....RAWHRL----------PDRQ-------TVDDARSAA----A.....D--------
HIS8_LACLA/22-345---------------------RYKTKNLRLY----------PSTD-------.AKSLRKKL----A.....D--------
HIS8_ECOLI/29-351---------------------QLTQQTLNRY----------PECQ-------.PKAVIENY----A.....Q--------
AAT2_BACSU/32-384---------------------ASLNPSFHGY----------GPFR-------GYPFLKEAI----A.....A--------
1A12_CUCMA/40-424---------------------KSIFRELALF----------QDYH-------GLPAFKKAL----V.....E--------
BIOF_LYSSH/37-379---------------------TGAGGSRLTT----------GNFD-------IHEQLESEI----A.....D--------
BIOF_HAEIN/35-380---------------------FTSSSSRLLT----------GNFP-------IYTDLEELV----A.....Q--------
MALY_ECOLI/28-382---------------------.RLMHGVFGY----------SRWK-------.NDEFLAAI----A.....H--------
1A1C_SOYBN/48-431---------------------INDFRAIANF----------QDYH-------GLPEFRNAV----A.....K--------
ATTY_HUMAN/71-434---------------------ALDSGKYNGY----------APSI-------GFLSSREEI----A.....S--------
KBL_ECOLI/42-387---------------------FGMASVRFIC----------GTQD-------SHKELEQKL----A.....A--------
HIS8_STRCO/26-360---------------------REAARDLNRY----------PDRD-------.AVELRTQL----A.....R--------
AAT5_ARATH/77-445---------------------MLERGDNKEY----------LPIE-------GLAAFNKAT----A.....E--------
E7KGL9_YEASA/145-545---------------------VGACGPAGFY----------GNQD-------VHYTLEYDL----A.....Q--------
1A12_SOLLC/48-430---------------------IKSFKAIANF----------QDYH-------GLPEFRKAI----A.....K--------
AATM_BOVIN/57-425---------------------IAAKNLDKEY----------LPIA-------GLAEFCKAS----A.....E--------

PF04864

TAR2_ARATH/79-436---------------------SLSYFSDENN----------LCWF-------LEPELAKEI----V-----R--------
TAR4_ARATH/91-449---------------------RMSYIY..ED----------G.TY-------VSRELEKVI----R-----K--------
TAR1_ARATH/26-381---------------------LMSYFSDTKN----------VCWF-------LEPELEKAI----K-----A--------
Q76BK3_ALLCE/104-465---------------------RMSYYF..AP----------G.SF-------ISVVLKRHI----K-----L--------
TAA1_ARATH/25-384---------------------LMSYFSDMTN----------LCWF-------LEPELEDAI----K-----D--------
O04927_ALLTU/87-452---------------------RMSYFFPEKD----------S.DF-------MSAELKRTI----T-----E--------
Q942G4_ORYSJ/111-470---------------------RLSYIT.TD.----------G.HL-------KSVELDRQI----R-----R--------
Q9M7L9_ALLCE/102-462---------------------RMSYF...IG----------H.NF-------MSDELDRHI----R-----L--------
Q8LL95_AEGTA/68-427---------------------GVSYFSNAGG----------LCWY-------LEPELEREV----R-----R--------
Q43366_ALLCE/93-456---------------------RMSYFF.NPV----------S.NF-------ISFELEKTI----K-----E--------

PF12897

Q9RU17_DEIRA/28-452---------------------SVLGENDTRY.DGTDLRNYPGGVA-------GLPSARALF----G-----N--------
D5UN97_TSUPD/7-427---------------------ALPGEGDYRAADGTDTRNY.GGLA-------GLPELRAIF----G-----E--------
Q1IZU0_DEIGD/1-422---------------------TVLGAEDVRM.DGLDLRNYPGGVA-------GLPSARALF----A-----G--------
A9GH35_SORC5/7-425---------------------ALPGAGDLVASDGSDTRNY.GGLD-------GLPEMKAIF----A-----E--------

PF00464

GLYA_BACSU/4-380---------------------AQGSVLTNKYAEGYPGKRYYGGCE-------HVDVVEDIA----RDRAK-E--------
GLYA_CAMJE/3-379---------------------VMGSILTNKYAEGYPGKRYYGGCE-------FVDEIETLA----IERCK-K--------
GLYC_YEAST/17-416---------------------ALGTPLSNKYSEGYPGARYYGGNE-------HIDRMEILC----QQRAL-K--------
GLYM_YEAST/33-432---------------------LLGSELQNKYSEGYPGERYYGGNE-------IIDKSESLC----QARAL-E--------
GLYC_NEUCR/18-417---------------------ALGSPMSNKYSEGLPGARYYGGNQ-------HIDEIEVLC----QNRAL-E--------
GLYC_HUMAN/26-425---------------------ALGSCLNNKYSEGYPGQRYYGGTE-------FIDELETLC----QKRAL-Q--------
GLYA_BRADU/18-395---------------------AQGSVMTNKYAEGYPGARYYGGCE-------WVDVAENLA----IDRAK-K--------
GLYM_HUMAN/49-448---------------------ALGSCLNNKYSEGYPGKRYYGGAE-------VVDEIELLC----QRRAL-E--------
C9R5U6_AGGAD/8-386---------------------AQGSQFTNKYAEGYPGKRYYGGCE-------YADIVEQLA----IDRTK-E--------
N0BCL8_9RHIZ/20-397---------------------AAGSVLTNKYAEGYPGKRYYGGCQ-------FVDIAEEIA----IDRAK-K--------
GLYA_ECOLI/8-386---------------------AQGSQLTNKYAEGYPGKRYYGGCE-------YVDIVEQLA----IDRAK-E--------
GLYM_SOLTU/57-453---------------------AVGSVMTNKYSEGYPGARYYGGNE-------YIDMAETLC----QKRAL-E--------

PF00282

DDC_CAEEL/377-746NFHSFYPAGNSFHCLLADLLGGHIGDAGFYW----------TSNP-------ALTELEVLM----M-----D--------
DDC_BOVIN/35-414YFFAYFPTASSYPAMLADMLCGAIGCIGFSW----------AASP-------ACTELETVM----M-----D--------
DCHS_HUMAN/36-414HMHAYYPALTSWPSLLGDMLADAINCLGFTW----------ASSP-------ACTELEMNV----M-----D--------
DCHS_DROME/35-413HMHAYFPALNSMPSLLGDMLADAINCLGFTW----------ASSP-------ACTELEIIV----M-----N--------
DCE1_FELCA/144-518RFFNQLSTGLDIIGLAGEWLTSTANTNMFTY----------EIAP-------VFVLMEQIT----L-----K--------
DCEA_ECOLI/33-383NVHKLMD..............LSINKNWIDK----------EEYP-------QSAAIDLRC----V-----N--------
DCE_DROME/64-434HFFNQLSNGLDLISMAGEWLTATANTNMFTY----------EIAP-------VFILMENVV----L-----T--------
DDC_DROME/70-446KFHAYFPTANSYPAIVADMLSGAIACIGFTW----------IASP-------ACTELEVVM----M-----D--------
B1Q3F1_SOLLC/33-381ECDKLMM..............DSINKNYVDM----------DEYP-------VTTELQNRC----V-----N--------

PF01276

DCOS_ECOLI/109-551---------------------LCNADVAMGD--------LLIHEG-------APCIAQQHA----A-----K--------
YAAO_BACSU/3-363---------------------V.TELAGLDD--------LHHPSG-------VIKEAQELA----S-----Q--------
SPEA_BACSU/6-371---------------------L.INIEPLDD--------LHAPKG-------IIKQAQDLA----A-----E--------
ADIA_ECOLI/140-590---------------------MGIERTSLGS--------LLDHTG-------AFGESEKYA----A-----R--------
DCOR_HAEIN/108-550---------------------ICNADVKLGD--------LLIHEG-------AACDAQKYA----A-----Q--------
DCLZ_ECOLI/130-545---------------------VSISVTELGS--------LLDHTG-------PHLEAEEYI----A-----R--------
DCOR_ECOLI/101-543---------------------MCNADVKLGD--------LLIHEG-------SAKDAQKFA----A-----K--------
LDCI_ECOLI/130-545---------------------ISISVSELGS--------LLDHSG-------PHKEAEQYI----A-----R--------

PF00202

OAT_BACSU/17-398---------------------KIIQALKDQADKITLTS.RAFHND-------QLGPFYEKT....A-----K--------
Y2045_BACPE/19-432---------------------KIVQAIKEAADHLTHGPIGVIQYE-------SILKLADEL....A-----D--------
ARGD_BACSU/7-377---------------------AVTEAVKKQLDSVWHVS.NLFQNS-------LQEQAAQKL....A-----A--------
GSA_MYCLE/40-431---------------------AVVDAVATVAASG..LSFGAPTPA-------ETQLAAEII....G-----R--------
BIOA_CORGL/18-420---------------------RLKAAAQKQIDTMSHVMFGGLTHE-------PAIKLTHKL....L-----N--------
BIOA_HAEIN/19-424---------------------RLNAAAQNQLAKMSHIMFGGFTHD-------PAVELAQLL....V-----Q--------
ARGD_YEAST/27-418---------------------KVAEILHHQANKLVHSS.NLYFTK-------ECLDLSEKIV.EKT-----K--------
GABT_HUMAN/65-496---------------------ALLKLIQQPQNASMFVNRPALGIL-------PPENFVEKLRQSLL-----S--------
GABT_MYCLE/29-443---------------------RVVDAVRAQVADFTHTCFIITPYE-------EYVAVTEQL....N-----R--------
ARGD_ECOLI/20-400---------------------ALVNALKTQGETLWHIS.NVFTNE-------PALRLGRKL....I-----E--------
GABT_ECOLI/14-421---------------------KVVAAVEAQLKKLSHTCFQVLAYE-------PYLELCEIM....N-----Q--------
GABAT_EMENI/65-495---------------------HLLKVAASPEMATSLINRPALGNF-------PSADWAHILKTGIL-----K--------
OAT_PLAF7/20-406---------------------DILNAMINQAKKLTICS.RAFFSD-------SLGVCERYL....T-----N--------
X2GMN7_9BACI/23-446---------------------RISQALSEQAFTLEHTIFANFSHE-------PAIKLAQKL....V-----A--------

PF05889

SPCS_METJA/57-434---------------------NLIDPQ.PKA----------PGAS-------VMYKLTNKLLESFL-----K--------
SPCS_METKA/53-429---------------------TLVDPQ.PKA----------PGAS-------IMYALTNRLVTDFL-----R--------
SPCS_HUMAN/61-459---------------------DISAVQ.PKA----------AGSS-------LLNKITNSLVLDII-----K--------
SPCS_CAEEL/53-450---------------------NLLEIQ.PKA----------LGSS-------MLACLSNEFAKHAL-----H--------
SPSS1_ARCFU/33-368---------------------.....QLPKF----------LGCD-------V.ARVTN.......-----.--------

PF02347

GCSP_SCHPO/65-504IKSFIGMGYYNVKLPAAIQRNVLENPEWYTQYTPYQAEISQGRLE-------SMMNYQTMI----A-----D--------
GCSP_HUMAN/65-488WRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLE-------SLLNYQTMV----C-----D--------
GCSPA_BACSU/3-443YASFLGAGVYDHYQPVIVDH.VISRSEFYTAYTPYQPEISQGELQ-------AIFEFQTMI----C-----E--------
GCSP_ECOLI/16-440FTSYIGMGYTAVQLPPVILRNMLENPGWYTAYTPYQPEVSQGRLE-------ALLNFQQVT----L-----D--------
GCSP_SYNY3/35-460FRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPYQAEIAQGRLE-------ALLNFQTMV----M-----D--------
Q21962_CAEEL/32-462YRSYIGMGYYDTIVPAVISRNILQNIGWISQYTPYQAEISQGRLE-------SLLNFQTMI----A-----E--------
GCSPA_AQUAE/1-439PLYFIGAGAYDRIIPSVIWQ.ILSRGEFLTPYTPYQAEASQGTLQ-------AIFEYQSLI----C-----E--------
GCSP_YEAST/69-511VKNFIGKGYYGTILPPVIQRNLLESPEWYTSYTPYQPEISQGRLE-------ALLNFQTVV----S-----D--------
GCSP_MYCTU/9-438AVSMIGQGYYDTHTPPVLLRNIIENPAWYTAYTPYQPEISQGRLE-------ALLNFQTLV----T-----D--------

PF01053

CYSD_EMENI/10-428----------------------LEG-------------------G..V----AAV--A--------------AS-S-GQA
CYS3_YEAST/10-390----------------------LEN-------------------A..Q----YGL--A--------------FS-S-GSA
MET17_YEAST/6-436----------------------LEG-------------------G..A----AAL--A--------------VS-S-GQA
O02215_CAEEL/69-449----------------------IEG-------------------G..A----GSL--L--------------YN-S-GLA
METC_ECOLI/7-392----------------------LEG-------------------G..A----GCV--L--------------FP-C-GAA
CGL2_CAEEL/8-386----------------------LED-------------------A..K----HCQ--V--------------FS-S-GLA
METC_HAEIN/8-393----------------------MEG-------------------G..A----GCY--L--------------YP-C-GTA
METC_ARATH/88-460----------------------LDK-------------------A..D----RAF--C--------------FT-S-GMA
CGS1_ARATH/176-561----------------------LEG-------------------A..E----STL--V--------------MA-S-GMC
METI_BACSU/6-363----------------------LEN-------------------G..A----RGL--A--------------FS-S-GMA
MCCB_BACSU/4-377----------------------LES-------------------G..E----AGY--A--------------FS-S-GMA
CGL_HUMAN/19-395----------------------LDG-------------------A..K----YCL--A--------------FA-S-GLA
METZ_PSEAE/20-401----------------------LEG-------------------A..E----QAV--A--------------TA-S-GMS
METC_BACSU/9-382----------------------LEG-------------------G..T----RGF--A--------------FS-S-GMA
METB_ECOLI/6-381----------------------LEG-------------------G..A----GAV--L--------------TN-T-GMS
STR3_YEAST/7-405----------------------LYR-------------------VPQE----NVL--A--------------VS-S-GMT
CYSD_SCHPO/9-427----------------------LEH-------------------G..A----AAI--A--------------TS-S-GTS
METB_MYCLE/15-388----------------------VEE-------------------G..V----FAR--A--------------FS-S-GMA
METB_HAEIN/8-366----------------------LEN-------------------G..D----RGF--A--------------FS-S-GMA
O15565_TRIVA/12-395----------------------LEH-------------------A..E----ACA--A--------------TA-S-GMG
METB_HELPY/4-377----------------------LEG-------------------G..V----KGF--A--------------FA-S-GLA
A2FEV4_TRIVA/9-392----------------------LEK-------------------T..E----ACV--A--------------TS-S-GMG
B0SQZ9_LEPBP/8-432----------------------LEG-------------------G..V----AAL--A--------------TA-S-GQS
B2FLU7_STRMK/14-389----------------------LEG-------------------G..T----RGF--A--------------FA-S-GMA
K7VKJ5_MAIZE/100-483----------------------LEK-------------------A..E----STV--F--------------VA-S-GMY
METZ_MYCTU/21-405----------------------IEG-------------------A..P----AAF--A--------------TA-S-GMA
Q5AXC9_EMENI/40-405----------------------IMS-------------------A..Q----RAL--V--------------VS-S-GMA

PF01041

ERBS_SACEN/13-363----------------------YCE------------------.N--A----HCV--T--------------VG-S-GCD
P72893_SYNY3/11-365----------------------YLG------------------.V--E----YSI--A--------------TS-S-CTG
P73264_SYNY3/14-373----------------------FVG------------------.T--K----NAI--S--------------VN-S-GTS
O27256_METTH/7-356----------------------YVG------------------.T--E----HAV--A--------------TS-S-GTT
P74668_SYNY3/13-379----------------------YLG------------------.V--K----YAI--G--------------VN-S-GTD
RFBH_SALTY/40-430----------------------FIG------------------.V--P----HVL--T--------------TT-S-GSS
PSEC_HELPY/9-366----------------------FLG------------------.V--K----HAL--V--------------FN-S-ATS
Y1066_METJA/12-379----------------------YIG------------------.S--K----FAI--S--------------LN-S-CTA
ARNB_ECOLI/10-374----------------------LTG------------------.N--Q----HAI--A--------------VS-S-ATA
SPSC_BACSU/14-382----------------------FVG------------------.A--K----HAV--A--------------VN-S-CTA
O26434_METTH/7-359----------------------YHG------------------.M--G----FGI--S--------------TS-N-GTT
NTDA_BACSU/78-432----------------------YLH------------------.K--R----YVI--A--------------TS-S-GTD
A4F7N3_SACEN/33-380----------------------LAG------------------.V--R----HCV--A--------------TC-N-ATV
B1W368_STRGG/23-413----------------------YCG------------------.S--A----MCV--P--------------IS-T-GTA
B1W386_STRGG/12-373----------------------GQG------------------.V--E----HAV--A--------------VS-T-GTA
C6W8U4_ACTMD/18-373----------------------YHG------------------.A--G----HAL--A--------------VT-N-GTH
F7YJG4_VIBA7/13-366----------------------YCN------------------.V--E----HCL--G--------------VA-N-GLD
RIFK_AMYMS/15-372----------------------HHG------------------.A--A----HAL--A--------------VT-N-GTH
Y3402_MYCTU/52-405----------------------YLG------------------PH--L----HVA--T--------------LA-N-GTL
Q5KV33_GEOKA/14-364----------------------YSR------------------.A--R----HGI--G--------------CG-N-GSD
Q79H47_BORPE/14-362----------------------YTG------------------.A--K----HCI--T--------------VA-S-GTE
Q7W0M1_BORPE/26-405----------------------YIG------------------AD--V----EAV--A--------------VN-S-ATA
Q9ABJ3_CAUCR/28-397----------------------KVG------------------.A--D----HAI--A--------------VS-N-GTA
Q9KVA5_VIBCH/9-360----------------------FLK------------------.V--K----HAT--T--------------VS-N-GTV

PF01212

GLY1_ASHGO/17-304......................LAG-------------------M--E.---AGM..F..............CV.S.GTL
GLY1_YEAST/16-303......................MAG-------------------K--E.---AGL..F..............CV.S.GTL
Q7QAI2_ANOGA/21-308......................LFG-------------------K--E.---AAL..F..............VP.S.GTM
YF64_CAEEL/68-359......................LFG-------------------K--E.---AGL..F..............VT.S.GTM
Q8Y182_RALSO/3-296......................LFE-------------------T--DC---EVF..F..............VF.N.GTA
Q9RUR9_DEIRA/13-296......................LTG-------------------F--E.---AGL..F..............MP.S.GSM
Q8A7N2_BACTN/47-423......................ITG-------------------F--E.---YII..P..............TH.Q.GRA
THA2_ARATH/11-300......................IAG-------------------K--E.---AAM..F..............VP.S.GTM
Q8RCY7_CALS4/5-290......................MLG-------------------K--E.---AAM..L..............VT.S.GTQ
Q89ID2_BRADU/23-308......................LLG-------------------K--E.---AAV..Y..............MP.S.GTM
Q7MUT3_PORGI/47-424......................ILG-------------------F--D.---YFL..P..............TH.Q.GRA
Q9VCK6_DROME/8-304......................IFG-------------------K--E.---AGL..F..............VP.S.GTM
LTAE_PSEAE/7-299......................LFE-------------------T--D.---CEV..F..............FAFN.GTA
TPL_PASMU/47-424......................YYG-------------------F--K.---YVV..P..............TH.Q.GRG
TNAA1_SYMTH/45-421......................ITG-------------------Y--E.---YVI..P..............TH.Q.GRG
TNAA_CALS4/50-428......................IFG-------------------Y--K.---YVV..P..............TH.Q.GRG
GLY1_SCHPO/30-313......................LTG-------------------K--E.---AAL..F..............VT.S.GTQ
Q9X266_THEMA/3-287......................TFG-------------------K--E.---AAL..F..............VP.S.GTM
TNAA_PHOLL/46-432......................LIG-------------------Y--Q.---YTI..P..............TH.Q.GRG
Q88AI0_PSESM/7-297......................VF.-------------------.--..---.....F..............AF.N.GTA
Q89N26_BRADU/13-294......................LTG-------------------K--E.---AAL..F..............VP.S.GTM
Q7MEV9_VIBVY/2-285......................EAG-------------------F--E.---AAL..F..............TT.S.GTQ
TNAA_CLOTE/60-438......................IFG-------------------Y--K.---FVQ..P..............VH.Q.GRA
Q9A3V8_CAUCR/9-299......................ALD-------------------A--D.---AQV.RF..............TA.S.GTA
TNAA_HALSA/42-412......................VMG-------------------F--Q.---HII..P..............AH.Q.GRG
Q7NHQ7_GLOVI/7-294......................LLG-------------------K--E.---KGL..F..............FP.S.GTM
TNAA_CHRVO/47-428......................LFG-------------------Y--A.---HTI..P..............TH.Q.GRG
TNAA_AERPE/52-428......................VLG-------------------L--D.---LVL..P..............VH.Q.GRA
Q896G8_CLOTE/5-288......................LVG-------------------K--E.---TAL..F..............VP.S.GVF
Q9HMP3_HALSA/22-307......................AVG-------------------M--A.---AAV..F..............VP.S.RTM
Q8EC07_SHEON/3-286......................MFG-------------------F--E.---SAL..F..............TA.S.GTQ
Q7NQ31_CHRVO/5-289......................RLG-------------------K--E.---AAL..L..............VP.S.GTF
D5AL49_RHOCB/46-420......................LMP-------------------F--K.---HII..P..............TH.Q.GRA
D5AV45_RHOCB/2-292......................IFE-------------------A--P.---QAVVYL..............VA.T.GTA
G3XD13_PSEAE/5-283......................RLG-------------------F--A.---AAL..F..............VP.T.GTM
I0DW76_PROSM/47-432......................MFG-------------------Y--D.---YTI..P..............AH.Q.GRG
LTAE_ECOLI/3-280......................LSG-------------------K--E.---AAI..F..............LP.T.GTQ
TPL_SYMTH/47-422......................IYG-------------------F--K.---YVV..P..............TH.Q.GRG
Q59NC4_CANAL/14-300......................ITG-------------------K--P.---AAL..F..............CV.S.GTM
Q7VW60_BORPE/3-283......................RAG-------------------K--E.---AGL..F..............FP.S.GTQ
TPL_FUSNN/49-425......................IFG-------------------F--K.---HIV..P..............TH.Q.GRG
Q8RHQ6_FUSNN/51-505KKIINLVRTDCQDIEKMMNEMYLCE-------------------Y--E.---GGL..FNGGAAQLERPNAFLMP.Q.GRA
THA1_ARATH/7-295......................MMG-------------------K--E.---AAL..F..............VP.S.GTM
Q98A67_RHILO/12-297......................VFE-------------------H--A.---VDV..F..............LV.STGSA

PF06838

YNBB_BACSU/11-416----------------------VFG-------------------G--E----AGLVRP--------------QIIS-GTH
Q8EQP5_OCEIH/1-405----------------------VFG-------------------G--E----DALVRP--------------QLVS-GTH
Q8Y7I1_LISMO/4-408----------------------VFK-------------------T--E----AALVRP--------------QIIS-GTH
Q97I22_CLOAB/19-425----------------------IFN-------------------T--E----SAFVRP--------------HFVN-GTH
Q8XL83_CLOPE/19-425----------------------IFN-------------------A--E----KALVRP--------------HFVN-GTH
Q8DHD9_THEEB/26-430----------------------VMG-------------------A--E----AALVRV--------------QFVS-GTH
Q54763_SYNE7/3-407----------------------VFG-------------------A--E----AAAVRI--------------QFVS-GTH
Q8RA65_CALS4/17-421----------------------IFG-------------------A--E----DALVRP--------------QIVS-GTH
Q9KAC8_BACHD/11-416----------------------VFG-------------------A--E----TALVRP--------------QIIS-GTH
Q8YWL0_NOSS1/20-424----------------------VMG-------------------A--E----AAAVRV--------------QFVS-GTH
Q55407_SYNY3/3-407----------------------VMG-------------------A--E----SAAVRV--------------QFVS-GTH
Q895H5_CLOTE/19-425----------------------IFN-------------------A--E----SALVRP--------------HFVS-GTH
Q5HPN4_STAEQ/5-406----------------------TFK-------------------A--D----DALVRP--------------QIIS-GTH

PF03841

SELA_PSEAE/79-451----------------------LTG-------------------A--E----AVT--V--------------VN-N-NAA
SELA_CAMJE/71-423----------------------LFE-------------------C--E----DAL--V--------------VN-N-NAA
SELA_PASMU/81-448----------------------LTG-------------------A--E----AAC--I--------------VN-N-NAA
SELA_HAEIN/82-449----------------------LTG-------------------A--E----AAC--I--------------VN-N-NAA
SELA_RHIME/80-448----------------------LTG-------------------A--E----DAT--V--------------VN-N-NAA
SELA_ECOLI/83-452----------------------ITG-------------------A--E----DAC--I--------------VN-N-NAA
SELA_AQUAE/72-435----------------------LTG-------------------A--E----SSF--V--------------VN-N-NAG
C7LWD8_DESBD/82-448----------------------LTG-------------------A--E----AGL--V--------------VN-N-NAA
SELA_MOOTA/80-445----------------------LTG-------------------A--E----EAL--V--------------VN-N-NAA
W8TF72_EUBAC/86-450----------------------ITG-------------------A--E----DVL--V--------------VN-N-NAA

PF00266

SERC_ECOLI/4-350----------------------LLN------------------VP--SN---YKV--L--------------FC-H-GGG
CSD_PSEPK/23-389----------------------WLN------------------AA--DS---RQI--V--------------FT-H-GAT
CSD_CHLTR/19-388----------------------WIG------------------AQ--YD---QEI--I--------------FT-R-GTT
CSD_XYLFA/36-404----------------------LLN------------------AP--T.---HEL--V--------------LC-S-GTT
NIFS_NOSS1/4-365----------------------LLG------------------AD--.E---SEI--V--------------FT-S-CGT
CSD_STRCO/31-406----------------------FIN------------------AP--SR---DEV--I--------------FT-K-NAS
CSD_TREPA/20-390----------------------FIN------------------AA--PT---HDI--V--------------FT-K-SCT
CSD_UREPA/18-385----------------------FIN------------------AN--F.---DEI--I--------------FT-S-GAT
CSD_METTH/20-389----------------------FIN------------------AS--S.---DEI--V--------------FT-K-NTS
SUFS_DICD3/30-399----------------------FIH------------------AA--SA---EDI--V--------------FV-R-GTT
CSD_VIBCH/25-393----------------------FIG------------------AP--SS---KNI--I--------------WT-R-GAT
SUFS_ECOLI/25-394----------------------FIN------------------AR--SA---EEL--V--------------FV-R-GTT
CSD_PSEAE/23-389----------------------WLH------------------AG--NP---AEV--L--------------FT-R-GTT
CSD_AERPE/21-399----------------------LVG------------------GS--W.---DEV--V--------------FT-R-NTT
CSD_PASMU/44-409----------------------FIG------------------AE--SE---ETI--I--------------WT-S-GTT
SERC_HAEIN/4-348----------------------VYN------------------IP--DN---YRT--L--------------FL-Q-GGA
SUFS_BACSU/23-391----------------------FIN------------------AK--SM---AEI--I--------------FT-K-GTT
NFS1_YEAST/100-462----------------------MIN------------------AD--.P---KEI--I--------------FT-S-GAT
SPYA_CALJA/45-398----------------------VFQ------------------TR--N.---PLT--L--------------VI-S-GSG
SUFS_WIGBR/25-395----------------------FIN------------------AK--SD---SEI--I--------------FV-K-GTT
SUFS_YERPE/25-394----------------------FIH------------------AA--SA---EEI--I--------------FV-R-GTT
CSD_THEMA/23-400----------------------FLG------------------AS--P.---EEI--I--------------FT-S-GTT
SERC_RABIT/7-357----------------------LLA------------------VP--DN---YKV--I--------------FL-Q-GGG
CSD_MYCPN/25-391----------------------WFN------------------VT--A.---LEI--I--------------FT-S-SAT
CSD_MYCPA/301-670----------------------FIG------------------AP--SS---DNI--V--------------FV-R-GTT
CSD_HAEIN/60-425----------------------WVH------------------AE--DK---HAV--I--------------WT-S-GTT
CSD_BORBU/33-410----------------------FIN------------------AE--SA---KNI--I--------------FT-S-GTT
NIFS_BACSU/2-366----------------------IIG------------------GE--.A---SGI--Y--------------FT-S-GGT
CSDA_ECOLI/21-388----------------------LLN------------------AP--DD---KTI--V--------------WT-R-GTT
CSD_BACHD/23-391----------------------FIH------------------AS--ST---EEI--I--------------FT-R-GTT
D5ARX2_RHOCB/6-368----------------------LIG------------------AA--SE---QEI--L--------------FT-S-GGT
K9ZIC0_ANACC/6-351----------------------LHQ------------------TE--SD---VLM--L--------------NV-S-GTG
CSD_MYCTU/32-403----------------------FVG------------------AD--T.---DEL--V--------------FT-K-NAT
Q2FZY5_STAA8/32-401----------------------FIN------------------AK--YF---EEI--I--------------FT-R-GTT
Q8U4C4_PYRFU/18-386----------------------FIN------------------AK--F.---EEI--V--------------FT-K-NTS

PF00155

AAT_ECOLI/26-392----------------------LLFG.....KGSA.....LINDK--RA---RTA--Q--------------TP-G-GTG
HIS8_BACSU/29-356----------------------HLN...................V--SE---TSL--I--------------FG-N-GSD
HEM1_EMENI/192-555----------------------LHG....................--KE---AAL--V--------------FS-S-CFV
AATC_BOVIN/31-405----------------------LALG.....DDSP.....ALQEK--RV---GGV--Q--------------CL-G-GTG
AAT_SULSO/35-391----------------------YLN.......TRY.....GTDVK--KE---.EV--I--------------VT-P-GAK
TYRB_ECOLI/26-393----------------------LLFG.....ADHP.....VLKQQ--RV---ATI--Q--------------TL-G-GSG
AAT_HAEIN/26-392----------------------LLFG.....KDSE.....VIQSN--RA---RTV--Q--------------SL-G-GTG
HIS8_ACEPA/24-347----------------------RIG..................LG--PE---.YV--F--------------VG-N-GSD
AAT_BACY2/32-387----------------------KFK.......RDN.....QLEYK--PN---.EI--I--------------VG-V-GAK
1A12_ARATH/48-432----------------------FMGK.....ARGG.....RVTFD--PE---.RV--V--------------MS-G-GAT
BIOF_MYCLE/36-373----------------------FVG....................--AC---VGL--L--------------FS-S-GYA
HIS8_HALVD/30-351----------------------KWG..................LA--PE---.QV--W--------------VS-P-GAD
1A11_CUCMA/50-431----------------------FMGK.....VRGG.....RVQFD--PS---.RI--V--------------MG-G-GAT
BNA3_YEAST/54-437----------------------LYS.......PIY.....NTELK--AE---.NV--T--------------VT-T-GAN
LCB2_YEAST/155-515----------------------FIG....................--KE---DAL--V--------------FS-M-GYG
PHHC_PSEAE/28-393----------------------LALG.....AASP.....LLLEQ--RA---DAT--Q--------------TP-G-GTG
HEM0_CHICK/121-466----------------------LHR....................--QP---RAA--L--------------FS-S-CFA
BIOF_ECOLI/39-380----------------------WLG....................--YS---RAL--L--------------FI-S-GFA
1A11_ORYSI/50-438----------------------FMSE.....QRGY.....KVVFD--PS---.NI--V--------------LT-A-GAT
AATB_RHIML/41-402----------------------KFQ.......REN.....GLAYE--LD---.EI--T--------------VA-T-GAK
HIS8_SCHPO/26-373----------------------LRNK.....ELSI.....TKPLT--PD---.NI--C--------------MG-V-GSD
ATTY_TRYCR/33-406----------------------FVH.......KEE.....LKSTI--VK---DNV--V--------------LC-S-GGS
1A1C_DIACA/49-429----------------------FMGK.....ARDE.....KVIFN--PD---.RI--V--------------MS-G-GAS
1A14_SOLLC/53-434----------------------FMEK.....TRGG.....KVKFD--AK---.RV--V--------------MA-G-GAT
ATTY_RHIME/26-386----------------------LVG......G..D.....TIERS--HV---AGV--Q--------------TP-G-GSG
AATA_RHIME/31-392----------------------KFK.......REN.....NLDYT--AA---.QT--I--------------VG-T-GGK
AATM_YEAST/44-441----------------------FLFK.....ESCPQFGPFYLAHD--RI---SFV--Q--------------TL-S-GTG
E7KDT6_YEASA/27-375----------------------YRNKTSSYANDPE.....VKPLT--AD---.NL--C--------------LG-V-GSD
HEM1_RHIRD/46-391----------------------LHG....................--KE---SAL--I--------------FT-S-GYV
AAT4_ARATH/29-395----------------------LILG.....DDSP.....ALKEN--RV---VTT--Q--------------CL-S-GTG
AAT1_ARATH/57-423----------------------LAYG.....DNSE.....FIKDK--RI---AAV--Q--------------TL-S-GTG
AAT1_MEDSA/42-410----------------------LIFG.....ADSP.....AIQEN--RV---TTV--Q--------------GL-S-GTG
COBC_PSEDE/23-328----------------------YYR...................T--NG---VLP--L--------------PV-P-GTQ
HIS8_LACLA/22-345----------------------YHH..................LE--VE---.QV--I--------------IG-N-GSD
HIS8_ECOLI/29-351----------------------YAG..................VK--PE---.QV--L--------------VS-R-GAD
AAT2_BACSU/32-384----------------------FYK.......REY.....GVTIN--PE---TEV--A--------------LF-G-GGK
1A12_CUCMA/40-424----------------------FMAE.....IRGN.....KVSFE--AN---.NI--V--------------LT-A-GAT
BIOF_LYSSH/37-379----------------------FKK....................--TE---AAI--V--------------FS-S-GYL
BIOF_HAEIN/35-380----------------------RFQ....................--RE---SAL--L--------------FN-S-GYH
MALY_ECOLI/28-382----------------------WFS.......TQH.....YTAID--SQ---.TV--V--------------YG-P-SVI
1A1C_SOYBN/48-431----------------------FMGR.....TRGN.....RVTFD--PD---.RI--V--------------MS-G-GAT
ATTY_HUMAN/71-434----------------------YYH........CP.....EAPLE--AK---.DV--I--------------LT-S-GCS
KBL_ECOLI/42-387----------------------FLG....................--ME---DAI--L--------------YS-S-CFD
HIS8_STRCO/26-360----------------------YLT.......DTS.....GHPLD--VS---.NV--W--------------AA-N-GSN
AAT5_ARATH/77-445----------------------LLFG.....AGHP.....VIKEQ--RV---ATI--Q--------------GL-S-GTG
E7KGL9_YEASA/145-545----------------------FFG....................--TQ---GSV--L--------------YG-Q-DFC
1A12_SOLLC/48-430----------------------FMEK.....TRGG.....RVRFD--PE---.RV--V--------------MA-G-GAT
AATM_BOVIN/57-425----------------------LALG.....ENNE.....VLKSG--RY---VTV--Q--------------TI-S-GTG

PF04864

TAR2_ARATH/79-436----------------------VHK-------------VVGNAVT--QD---RFI--V--------------VG-T-GST
TAR4_ARATH/91-449----------------------LHS-------------VVGNAVT--DN---RFV--I--------------FG-S-GTT
TAR1_ARATH/26-381----------------------LHG-------------AIGNAAT--EE---RYI--V--------------VG-T-GSS
Q76BK3_ALLCE/104-465----------------------LHH-------------AVGNAKT--DG---RYI--V--------------FG-T-GVT
TAA1_ARATH/25-384----------------------LHG-------------VVGNAAT--ED---RYI--V--------------VG-T-GST
O04927_ALLTU/87-452----------------------LHE-------------IVGNAET--KG---KHI--V--------------FG-V-GVT
Q942G4_ORYSJ/111-470----------------------LHR-------------AVGNAVV--DD---KYL--V--------------FG-T-GST
Q9M7L9_ALLCE/102-462----------------------LHN-------------AVGNAKV--DD---KFL--V--------------FG-N-GVT
Q8LL95_AEGTA/68-427----------------------VHR-------------LVGNAMA--DG---YHL--V--------------VG-T-GTT
Q43366_ALLCE/93-456----------------------LHE-------------IVGNAAA--KD---RYI--V--------------FG-V-GVT

PF12897

Q9RU17_DEIRA/28-452----------------------YLD------------------LK--PE---NVL--V--------------WN-N-SSL
D5UN97_TSUPD/7-427----------------------LLG------------------IP--TA---NLY--A--------------QN-N-SSL
Q1IZU0_DEIGD/1-422----------------------YLD------------------VK--AE---NVL--V--------------WN-N-SSL
A9GH35_SORC5/7-425----------------------MLE------------------VP--SE---QVI--V--------------GG-N-SSL

PF00464

GLYA_BACSU/4-380----------------------IFG---------------AE...--.H---VNV--Q--------------PH-S-GAQ
GLYA_CAMJE/3-379----------------------LFN---------------CK...--.F---ANV--Q--------------PN-S-GSQ
GLYC_YEAST/17-416----------------------AFH---------------VTPDK--WG---VNV--Q--------------TL-S-GSP
GLYM_YEAST/33-432----------------------LYG---------------LDPAK--WG---VNV--Q--------------PL-S-GAP
GLYC_NEUCR/18-417----------------------AFH---------------LDPKQ--WG---VNV--Q--------------CL-S-GSP
GLYC_HUMAN/26-425----------------------AYK---------------LDPQC--WG---VNV--Q--------------PY-S-GSP
GLYA_BRADU/18-395----------------------LFG---------------AG...--.F---ANV--Q--------------PN-S-GSQ
GLYM_HUMAN/49-448----------------------AFD---------------LDPAQ--WG---VNV--Q--------------PY-S-GSP
C9R5U6_AGGAD/8-386----------------------LFG---------------AD...--.Y---VNV--Q--------------PH-S-GSQ
N0BCL8_9RHIZ/20-397----------------------LFN---------------CG...--.F---ANV--Q--------------PN-S-GSQ
GLYA_ECOLI/8-386----------------------LFG---------------AD...--.Y---ANV--Q--------------PH-S-GSQ
GLYM_SOLTU/57-453----------------------AFR---------------LDPAK--WG---VNV--Q--------------PL-S-GSP

PF00282

DDC_CAEEL/377-746----------------------WLG----EMMALPKEFLLFPEAS--RG---GGC--M--------------QR-S-DTE
DDC_BOVIN/35-414----------------------WLG----KMLQLPEAFLA.GEAG--EG---GGV--I--------------QG-T-ASE
DCHS_HUMAN/36-414----------------------WLA----KMLGLPEHFLHHHPSS--QG---GGV--L--------------QS-T-VSE
DCHS_DROME/35-413----------------------WLG----KMIGLPDAFLHLSSQS--QG---GGV--L--------------QT-T-ASE
DCE1_FELCA/144-518----------------------KMR----EIVGWS....SK.D..--.G---DGI--F--------------SP-G-GAI
DCEA_ECOLI/33-383----------------------MVA----DLWHAPAPKNGQ....--.A---VGT--N--------------TI-G-SSE
DCE_DROME/64-434----------------------KMR----EIIGWS....G.....--.G---DSI--L--------------AP-G-GSI
DDC_DROME/70-446----------------------WLG----KMLELPAEFLACSGG.--KG---GGV--I--------------QG-T-ASE
B1Q3F1_SOLLC/33-381----------------------MIA----HLFNAPLEDGET....--.A---VGV--G--------------TV-G-SSE

PF01276

DCOS_ECOLI/109-551----------------------VFN----------------------AD---KTY--F--------------VL-N-GTS
YAAO_BACSU/3-363----------------------LYG----------------------SA---ESF--F--------------LV-N-GTT
SPEA_BACSU/6-371----------------------AFG----------------------AD---HTF--F--------------SV-Q-GTS
ADIA_ECOLI/140-590----------------------VFG----------------------AD---RSW--S--------------VV-V-GTS
DCOR_HAEIN/108-550----------------------VFN----------------------AD---KTY--F--------------VL-N-GTS
DCLZ_ECOLI/130-545----------------------TFG----------------------AE---QSY--I--------------VT-N-GTS
DCOR_ECOLI/101-543----------------------VFH----------------------AD---KTY--F--------------VL-N-GTS
LDCI_ECOLI/130-545----------------------VFN----------------------AD---RSY--M--------------VT-N-GTS

PF00202

OAT_BACSU/17-398----------------------LTG------------------K.--.E...MIL--P--------------MN-T-GAE
Y2045_BACPE/19-432----------------------ILP------------------GD--LD...CFF--F--------------AN-S-GTE
ARGD_BACSU/7-377----------------------HSA------------------G.--.D...LVF--F--------------CN-S-GAE
GSA_MYCLE/40-431----------------------MAP------------------V.--.E...RIR--L--------------VN-S-GTE
BIOA_CORGL/18-420----------------------LTG------------------NS--FD...HVF--Y--------------SD-S-GSV
BIOA_HAEIN/19-424----------------------ILP------------------NG--LD...KIF--F--------------AD-S-GSV
ARGD_YEAST/27-418----------------------QFG------------------GQ--HDA.SRVF--L--------------CN-S-GTE
GABT_HUMAN/65-496----------------------VAP------------------KG--MS...QLI--T--------------MA-C-GSC
GABT_MYCLE/29-443----------------------ITP------------------G.--.SGEKRSV--L--------------FN-S-GAE
ARGD_ECOLI/20-400----------------------ATF------------------A.--.E...RVV--F--------------MN-S-GTE
GABT_ECOLI/14-421----------------------KVP------------------G.--.DFAKKTL--L--------------VT-T-GSE
GABAT_EMENI/65-495----------------------VAP------------------KG--LD...QVF--T--------------AM-A-GSD
OAT_PLAF7/20-406----------------------LFG------------------Y.--.D...KVL--M--------------MN-T-GAE
X2GMN7_9BACI/23-446----------------------LTP------------------QS--LQ...KVF--F--------------AD-N-GSS

PF05889

SPCS_METJA/57-434----------------------ALG------------------LK--..---VNA--I--------------AT-P-VAT
SPCS_METKA/53-429----------------------RLG------------------FR--.I---EGA--F--------------VV-P-GAT
SPCS_HUMAN/61-459----------------------LAG------------------VH--TV---ANC--F--------------VV-P-MAT
SPCS_CAEEL/53-450----------------------LLG------------------LH--AV---KSC--I--------------VV-P-LCT
SPSS1_ARCFU/33-368----------------------..G------------------AR--EA---K..--F--------------AV-.-...

PF02347

GCSP_SCHPO/65-504----------------------LTG------------------LS--IS---NAS--L--------------LD-E-GTA
GCSP_HUMAN/65-488----------------------ITG------------------LD--MA---NAS--L--------------LD-E-GTA
GCSPA_BACSU/3-443----------------------LTG------------------MD--IA---NSS--M--------------YD-G-GTA
GCSP_ECOLI/16-440----------------------LTG------------------LD--MA---SAS--L--------------LD-E-ATA
GCSP_SYNY3/35-460----------------------LTG------------------LE--IA---NAS--L--------------LD-E-GTA
Q21962_CAEEL/32-462----------------------MTG------------------LP--TT---NAS--L--------------LD-E-ATA
GCSPA_AQUAE/1-439----------------------LTG------------------MD--VA---NAS--M--------------YD-G-ASA
GCSP_YEAST/69-511----------------------LTG------------------LP--VA---NAS--L--------------LD-E-GTA
GCSP_MYCTU/9-438----------------------LTG------------------LE--IA---NAS--M--------------LD-E-GTA

PF01053

CYSD_EMENI/10-428AQFMAI----SA---LAHA-----.G--------DN----------------.....IVST-------SNLYGGTY---N
CYS3_YEAST/10-390TT.ATI----LQ---SLPQ-----.G--------SH----------------.....AVSI-------GDVYGGTH---R
MET17_YEAST/6-436AQTLAI----QG---LAHT-----.G--------DN----------------.....IVST-------SYLYGGTY---N
O02215_CAEEL/69-449AISAVF----LE---FLSS-----.G--------AH----------------.....MIVM-------NPIYSGTS---S
METC_ECOLI/7-392AVANSI----LA---FIEQ-----.G--------DH----------------.....VLMT-------NTAYEPSQ---D
CGL2_CAEEL/8-386AT.SAI----IN---LLKY-----.G--------DH----------------.....IVCS-------DDVYGGTQ---R
METC_HAEIN/8-393AVTNSI----LS---FVKT-----.G--------DH----------------.....VLMS-------GAAYEPTQ---Y
METC_ARATH/88-460AL.SAV----TH---LIKN-----.G--------EE----------------.....IVAG-------DDVYGGSD---R
CGS1_ARATH/176-561ASTVML----LA---LVPA-----.G--------GH----------------.....IVTT-------TDCYRKTR---I
METI_BACSU/6-363AI.QTI----MA---LFKS-----.G--------DE----------------.....LIVS-------SDLYGGTY---R
MCCB_BACSU/4-377AI.TAV----MM---LFNS-----.G--------DH----------------.....VVLT-------DDVYGGTY---R
CGL_HUMAN/19-395AT.VTI----TH---LLKA-----.G--------DQ----------------.....IICM-------DDVYGGTN---R
METZ_PSEAE/20-401AILALV----MS---LCSS-----.G--------DH----------------.....VLVS-------RSVFGSTI---S
METC_BACSU/9-382AI.STA----FL---LLSQ-----.G--------DH----------------.....VLVT-------EDVYGGTF---R
METB_ECOLI/6-381AIHLVT----TV---FLKP-----.G--------DL----------------.....LVAP-------HDCYGGSY---R
STR3_YEAST/7-405ALDVIL----RG---LVLL-----NG--------TD----------------NHTPTIIAG-------DDLYGGTQ---R
CYSD_SCHPO/9-427ALFMAL----TT---LAKA-----.G--------DN----------------.....IVST-------SYLYGGTY---N
METB_MYCLE/15-388ASDCAL----RV---MLRP-----.G--------DH----------------.....VIIP-------DDVYGGTF---R
METB_HAEIN/8-366AI.QVL----MT---LFTA-----.P--------DE----------------.....WIVS-------SDVYGGTY---R
O15565_TRIVA/12-395AIAASV----WT---FLKA-----.G--------DH----------------.....LISD-------DCLYGCTH---A
METB_HELPY/4-377GI.HAV----FS---LLQS-----.G--------DH----------------.....VLLG-------DDVYGGTF---R
A2FEV4_TRIVA/9-392AIAATV----LT---ILKA-----.G--------DH----------------.....LISD-------ECLYGCTH---A
B0SQZ9_LEPBP/8-432AEMLAL----LN---IVEA-----.G--------QE----------------.....IVAS-------SSLYGGTY---N
B2FLU7_STRMK/14-389AS.STV----IE---LLDA-----.G--------SH----------------.....VVAM-------DDIYGGSF---R
K7VKJ5_MAIZE/100-483AAVAML----SA---LVPA-----.G--------GH----------------.....IVTT-------TDCYRKTR---I
METZ_MYCTU/21-405AVFTSL----GA---LLGA-----.G--------DR----------------.....LVAA-------RSLFGSCF---V
Q5AXC9_EMENI/40-405AL.DVI----TR---LLRP-----.G--------DE----------------.....VVTG-------DDLYGGTN---R

PF01041

ERBS_SACEN/13-363ALELSL----LA...LGVG.....QG--------DE---------------------VIVP-------SHTFIATW---L
P72893_SYNY3/11-365ALHMGM----AA...LGIG.....PG--------DE---------------------VILA-------DTNWIATV---A
P73264_SYNY3/14-373GLEILL----RL..KQAEN.......--------TT---------------------VLVP-------TNTNFATV---A
O27256_METTH/7-356ALHLAL----LA...AGVG.....KG--------DE---------------------VITT-------PFSFAATA---N
P74668_SYNY3/13-379ALMIGL----RA...LGIG.....PG--------DE---------------------VITT-------PFSFFATA---E
RFBH_SALTY/40-430ANLLAL----TALTSPKLGERALKPG--------DE---------------------VITV-------AAGFPTTV---N
PSEC_HELPY/9-366ALLTLY----RNFSEFSAD......R--------NE---------------------IITT-------PISFVATA---N
Y1066_METJA/12-379GLHLSL----VA...LNIK.....DK--------DE---------------------VITT-------PYTFAATG---N
ARNB_ECOLI/10-374GMHITL----MA...LKIG.....KG--------DE---------------------VITP-------SLTWVSTL---N
SPSC_BACSU/14-382ALFLAL----KA...KGIG.....PG--------DE---------------------VITS-------PLTFSSTA---N
O26434_METTH/7-359ALHLAL----KS...VGIK.....KG--------DE---------------------VIVP-------SLTFAATA---N
NTDA_BACSU/78-432AIMIGL----LA...LGLN.....PG--------DE---------------------VIMP-------ANSFSATE---N
A4F7N3_SACEN/33-380ALQLVL----RA...SDVS.......--------GE---------------------VVMP-------SMTFAATA---H
B1W368_STRGG/23-413SLAIAL----EA...CGVG.....AG--------DE---------------------VIVP-------GLSWVASA---S
B1W386_STRGG/12-373AVHLAL----HA...LDVG.....PG--------DE---------------------VIVP-------THTFIGSA---S
C6W8U4_ACTMD/18-373ALELAL----QV...LDVG.....PG--------AE---------------------VIVP-------AFTFISSS---Q
F7YJG4_VIBA7/13-366ALILIL----RAYIELGVM....SKG--------DE---------------------VIVP-------SNTYIASI---L
RIFK_AMYMS/15-372ALELAL----QV...MGVG.....PG--------TE---------------------VIVP-------AFTFISSS---Q
Y3402_MYCTU/52-405ALLAAL----HV..SFGAG....TRD--------RY---------------------LLMP-------SFTFVGVA---Q
Q5KV33_GEOKA/14-364AIHIAL----QA...AGVG.....PG--------DE---------------------VITT-------AFTFFATA---G
Q79H47_BORPE/14-362ALLISL----MA...LGVK.....AG--------DE---------------------VITT-------SFTFVATA---E
Q7W0M1_BORPE/26-405GLHLAL----EA...IGVG.....PG--------DE---------------------VITT-------THTFTASA---E
Q9ABJ3_CAUCR/28-397TLHLAM----MA...LGIG.....EG--------DV---------------------CVAP-------SVTFLATA---N
Q9KVA5_VIBCH/9-360ALHLAM----SA...LGIT.....QG--------DE---------------------VIVP-------TFTYVASV---N

PF01212

GLY1_ASHGO/17-304SNQIAL....RT---HLTQ-----PP--------YS---------------------ILCDYR.....AHVYTHEA--.A
GLY1_YEAST/16-303SNQIAI....RT---HLMQ-----PP--------YS---------------------ILCDYR.....AHVYTHEA--.A
Q7QAI2_ANOGA/21-308ANLLAM....MV---HCSR-----RG--------TE---------------------AIVGDI.....AHGFLYEQ--.G
YF64_CAEEL/68-359GNLLAI....MA---HC.Q-----RG--------EE---------------------IIVGRY.....NHIHRWEQ--.G
Q8Y182_RALSO/3-296ANSLAL....SA---LC.Q-----SY--------HS---------------------VICHEL.....AHIETDEC--.G
Q9RUR9_DEIRA/13-296TNQVAI....AV---HT.R-----RG--------EE---------------------VICAEG.....SHIYEWEL--.G
Q8A7N2_BACTN/47-423AENVLF....SY---LV..-----..--------..---------------------....HEGNIVPGNSHFDTT--.K
THA2_ARATH/11-300GNLISV....LV---HCDE-----RG--------SE---------------------VILGDD.....SHIHIYEN--.G
Q8RCY7_CALS4/5-290GNQVSI....MT---HT.H-----PG--------EE---------------------IILEEN.....SHIITYEV--.G
Q89ID2_BRADU/23-308CNVTAT....LV---HC.R-----PG--------DE---------------------ILAHET.....AHIIAREG--.G
Q7MUT3_PORGI/47-424AENVLF....ST---IV..-----..--------..---------------------....KEGDVLPGNSHFDTT--.K
Q9VCK6_DROME/8-304GNLLAI....MV---HCHR-----RG--------TE---------------------ALVGDL.....SHIFLYEQ--.G
LTAE_PSEAE/7-299ANSLAL....AA---LC.Q-----SY--------HS---------------------VICSET.....AHVETDEC--.G
TPL_PASMU/47-424AENLLS....TI---MI..-----..--------..---------------------....KPGDYVPGNMYFTTT--.R
TNAA1_SYMTH/45-421AEKVAF....SQ---LI..-----..--------..---------------------...TRPGMYVLSNMFFDTT--.R
TNAA_CALS4/50-428AEKVLF....PL---LI..-----..--------..---------------------....KKGQYVLGNMHFDTT--.K
GLY1_SCHPO/30-313GNQLCI....RS---HLHQ-----PP--------HS---------------------IICDDR.....AHIYNWEA--.G
Q9X266_THEMA/3-287GNQVSI....MA---HT.Q-----RG--------DE---------------------VILEAD.....SHIFWYEV--.G
TNAA_PHOLL/46-432AEQILF....PT---LIAR-----KK--------AQ---------------------GGATHPV..FISNFHFDTT--.A
Q88AI0_PSESM/7-297ANSLAL....SS---LC.Q-----SY--------HS---------------------VICSET.....AHVETDEC--.G
Q89N26_BRADU/13-294GNLLAM....LA---HA.E-----RG--------GE---------------------VFADAG.....AHLLNSEL--.G
Q7MEV9_VIBVY/2-285ANLLGL....MA---HC.E-----RG--------DE---------------------YLCGQQ.....AHNYRYEA--.G
TNAA_CLOTE/60-438AEKVLF....GL---LL..-----..--------..---------------------...GEGKY.SISNMHFDTT--.R
Q9A3V8_CAUCR/9-299ANAFAL....TL---LA.Q-----PH--------EA---------------------VLAHEH.....AHICTDET--.G
TNAA_HALSA/42-412AENVLY....GA---VL..-----..--------..---------------------....SAGDTVLNNAHFDTT--.R
Q7NHQ7_GLOVI/7-294CNQVAI....AT---HT.R-----PG--------QE---------------------IICDRD.....CHVFNYER--.A
TNAA_CHRVO/47-428AEQILF....PE---LV.K-----R.--------..---------------------.CRGERPV.FLSNYHFDTT--.K
TNAA_AERPE/52-428AERILY....GE---LL.R-----R.--------..---------------------....RNARIVPANTHFDTG--.R
Q896G8_CLOTE/5-288GNQLSL....FT---HC.K-----RG--------DE---------------------VILGED.....CHIIMHET--.G
Q9HMP3_HALSA/22-307ANQIGA....QV---HT.A-----RG--------QS---------------------VLVERA.....SHSYRRGS--.G
Q8EC07_SHEON/3-286ANLLAL....MA---HC.E-----RG--------DE---------------------YLCGQQ.....AHNYKFEG--.G
Q7NQ31_CHRVO/5-289GNQLAL....FT---HC.R-----RG--------DE---------------------VIVEDN.....SHIVWHEA--.G
D5AL49_RHOCB/46-420AEAILF....SI---FG..-----..--------.G---------------------KGRRIP.....SNTHFDTT--.R
D5AV45_RHOCB/2-292ANALSC....AV---LT.Q-----PW--------GA---------------------IFCHRN.....AHIEEDEC--.G
G3XD13_PSEAE/5-283SNLLGL....MA---HC.E-----RG--------DE---------------------YIVGQQ.....AHTYKYEG--.G
I0DW76_PROSM/47-432AENMLF....PV---LLKA-----KQ--------QE---------------------GGAKNPV..FISNFHFDTT--.A
LTAE_ECOLI/3-280ANLVAL....LS---HC.E-----RG--------EE---------------------YIVGQA.....AHNYLFEA--.G
TPL_SYMTH/47-422AEHLIS....RI---LI.K-----PG--------D.---------------------...YIP.....GNMYFTTT--.R
Q59NC4_CANAL/14-300SNQIGL....RA---NLVQ-----PP--------YS---------------------ILCDYR.....AHVFLHEA--.G
Q7VW60_BORPE/3-283SNLAAL....MA---HC.A-----RG--------DE---------------------YLVGQQ.....AHTYKFEG--.G
TPL_FUSNN/49-425AENILS....QI---AI.K-----PG--------QY---------------------V....P.....GNMYFTTT--.R
Q8RHQ6_FUSNN/51-505AESILFEIVRKI---LA.V-----RE--------PG---------------------KVFTIP.....SNGHFDTT--EG
THA1_ARATH/7-295GNLISV....MV---HCDV-----RG--------SE---------------------VILGDN.....CHIHVYEN--.G
Q98A67_RHILO/12-297ANALAL....AA---IT.P-----PW--------GS---------------------ILSHAD.....AHINRDEC--.G

PF06838

YNBB_BACSU/11-416AISIAL---------FGVL----RPG--------DE-------------------LLYITGKPYDTLEEIVGVRGG--EN
Q8EQP5_OCEIH/1-405AITTAL---------FGVL----RPG--------DE-------------------LVYITGKPYDTMEEVIGKPGK--.Q
Q8Y7I1_LISMO/4-408AISTVL---------FGIL----RPD--------DE-------------------LLYITGQPYDTLEEIVGMRNQ--.G
Q97I22_CLOAB/19-425AIGAAL---------FGNL----RPN--------DT-------------------MMSICGMPYDTLHDIIGMDDS--KK
Q8XL83_CLOPE/19-425ALGTAL---------FGNL----RPG--------DT-------------------ILAVTGSPYDTLHSVIGISGE--EN
Q8DHD9_THEEB/26-430AIATAL---------FGVL----RPG--------DE-------------------LISLAGPPYDTLEEVIGLRGQ--.G
Q54763_SYNE7/3-407AIAAAL---------FGVL----RPG--------DE-------------------LLAIAGAPYDTLEEVIGTRGE--.G
Q8RA65_CALS4/17-421AISIVL---------FGNL----KPN--------EE-------------------LISASGKPYDTLEEVIGIKGE--.G
Q9KAC8_BACHD/11-416AIATVL---------FGLL----RPG--------DE-------------------LLYITGKPYDTLEEVIGIRGE--EG
Q8YWL0_NOSS1/20-424AIACAL---------FGVL----RPG--------DE-------------------MLAVVGSPYDTLEEVIGLRGQ--.G
Q55407_SYNY3/3-407AIACAL---------YGIL----RPG--------DE-------------------LLSAVGSPYDTLEEVIGLRGS--.C
Q895H5_CLOTE/19-425TIGAAL---------FGNL----RPG--------DT-------------------MLAVVGTPYDTIHSVIGLTEE--NN
Q5HPN4_STAEQ/5-406AITLAL---------QSTL----KNN--------DE-------------------LLYITGSPYDTLLEVIGINGN--.G

PF03841

SELA_PSEAE/79-451AVLLAL----NS---LG-------AR--------KE---------------------GIISRG-----ELIEIGGA--FR
SELA_CAMJE/71-423AVFLVL----NS---LC-------YD--------KE---------------------VISSRG-----ELVEIGGS--FR
SELA_PASMU/81-448AVLLML----AT---FA-------QG--------KE---------------------VIISRG-----ELIEIGGA--FR
SELA_HAEIN/82-449AVLLML----AT---FA-------QG--------KE---------------------VIISRG-----ELIEIGGA--FR
SELA_RHIME/80-448AVLIAL----NS---VG-------AG--------RQ---------------------AIVSRG-----ELIEIGGA--FR
SELA_ECOLI/83-452AVLLML----AA---TA-------SG--------KE---------------------VVVSRG-----ELVEIGGA--FR
SELA_AQUAE/72-435AVFLVL----NT---LA-------EG--------KE---------------------VIISRG-----ELVEIGGS--FR
C7LWD8_DESBD/82-448AVLLVL----DT---LA-------KG--------RE---------------------VVVSRG-----QLVEIGGS--FR
SELA_MOOTA/80-445AVLLAL----ST---LA-------AG--------RE---------------------TIISRG-----QLVEIGGS--FR
W8TF72_EUBAC/86-450AVMLVL----GT---MA-------QG--------KE---------------------VITSRG-----ELVEIGGS--FR

PF00266

SERC_ECOLI/4-350RGQFAAVPLNI---........LGDK--------TT---------------------ADYV-------DAGYWAAS--.A
CSD_PSEPK/23-389S.ALNLLAYGL---EHR.....LEAG--------DE---------------------IAIS-------ALEHHANL--LP
CSD_CHLTR/19-388S.SLNLLAIAA---NDS.....WLAG--------GT---------------------VVIS-------EAEHHANL--VS
CSD_XYLFA/36-404F.AINLIAYSW---ALP....RLRAG--------DV---------------------ILVS-------RMEHHANI--VP
NIFS_NOSS1/4-365E.GDNAAIRAA---LLA.....QPEK--------RH---------------------IITT-------QVEHPAVL--NV
CSD_STRCO/31-406E.SLNLVANML---GWADDPYRVDHE--------TE---------------------IVIT-------EMEHHSNI--VP
CSD_TREPA/20-390E.SLNIIAHCY---ALP....RLRAG--------DE---------------------IVLA-------ISNHHANI--VP
CSD_UREPA/18-385E.SLNLIANGL---RPH.....LKKG--------DE---------------------IILT-------YIEHASNL--LP
CSD_METTH/20-389E.AINIVAGGL---R.......FRKG--------DS---------------------VVVP-------NIEHHSNF--LP
SUFS_DICD3/30-399E.AINLVANSY---GRT....AFQPG--------DN---------------------LVIS-------EMEHHANI--VP
CSD_VIBCH/25-393E.ALNLIAQSY---ARS....TLQAG--------DE---------------------ILVS-------ETEHHANI--VP
SUFS_ECOLI/25-394E.GINLVANSW---GNS....NVRAG--------DN---------------------IIIS-------QMEHHANI--VP
CSD_PSEAE/23-389E.AINLVAYGL---ERH.....FRPG--------DE---------------------LLVS-------ALEHHANL--LP
CSD_AERPE/21-399E.AMQLAALTL---AYN....GLLRG--------GE---------------------VLVT-------AADHHSTL--LP
CSD_PASMU/44-409H.AINCVARGL---SHQ.....LHPK--------AE---------------------IIIS-------EADHHANF--VT
SERC_HAEIN/4-348RGQFATIPMNL---........IGKK--------GK---------------------ALYL-------NSGHWSAT--.A
SUFS_BACSU/23-391T.SLNMVALSY---ARA....NLKPG--------DE---------------------VVIT-------YMEHHANI--IP
NFS1_YEAST/100-462E.SNNMVLKGV---PRF....YKKTK--------KH---------------------IITT-------RTEHKCVL--EA
SPYA_CALJA/45-398HCALEAALINV---........LEPG--------DS---------------------FLVG-------VNGIWGQR--..
SUFS_WIGBR/25-395E.GINLVANTW---GET....FIKKG--------DN---------------------IVIT-------QMEHHANI--VP
SUFS_YERPE/25-394E.AINLVANSY---GRH....FLAAG--------DS---------------------IIIT-------EMEHHANI--VP
CSD_THEMA/23-400M.AINLAVVSL---LRSG...ILKED--------DL---------------------VLVS-------LLEHHANF--VP
SERC_RABIT/7-357CGQFSAVPLNL---IG......LKPG--------RC---------------------ADYV-------VTGAWSAK--.A
CSD_MYCPN/25-391E.SINLFAHGL---KPW.....IKPG--------DE---------------------IVLK-------GDEHSANV--LP
CSD_MYCPA/301-670E.AINLVAHAW---GAK....HLQPG--------DE---------------------IVIT-------HLEHHANI--VP
CSD_HAEIN/60-425H.AINLVANGL---MPQ.....LNAE--------DE---------------------ILIS-------QADHHANF--VT
CSD_BORBU/33-410D.GINTIASSF---FYSK...YFKKK--------DE---------------------IILT-------TLEHNSNL--LP
NIFS_BACSU/2-366E.SNFLAIQSL---LNG....LPKTK--------RH---------------------FITT-------AMEHQSIH--NC
CSDA_ECOLI/21-388E.SINMVAQCY---ARP....RLQPG--------DE---------------------IIVS-------VAEHHANL--VP
CSD_BACHD/23-391T.AINLVAASY---GRA....NLGEG--------DE---------------------IVIT-------PMEHHSNI--IP
D5ARX2_RHOCB/6-368E.ANTTAIRSA---LAV.....QDGR--------RE---------------------IIIS-------AVEHPAIL--ML
K9ZIC0_ANACC/6-351..AVEAGMINF---........LSPG--------DR---------------------ILVG-------SNGKFGER--..
CSD_MYCTU/32-403E.ALNLVSYVL---GDSRFERAVGPG--------DV---------------------IVTT-------ELEHHANL--IP
Q2FZY5_STAA8/32-401A.SINLVAHSY---GDA....NVEEG--------DE---------------------IVVT-------EMEHHANI--VP
Q8U4C4_PYRFU/18-386E.SLNLVALGL---EHT.....FKKG--------DK---------------------IVTT-------PYEHHSNL--LP

PF00155

AAT_ECOLI/26-392A-LRVAADFLA---K..--...NTSV--------KR---------------------.VWV-------SNPSWPNH--KS
HIS8_BACSU/29-356E-IIQIICRAF---...--...LNDK--------TN---------------------.TVT-------AAPTFPQY--KH
HEM1_EMENI/192-555A-NDATLATLG---S..--...KMPD--------CV---------------------.ILS-------DSLNHASM--IQ
AATC_BOVIN/31-405A-LRIGAEFLA---RWY--NGTNNKD--------TP---------------------.VYV-------SSPTWENH--NG
AAT_SULSO/35-391P-ALFLVFILY---...--...INPS--------DE---------------------.VIL-------PDPSFYSY--AE
TYRB_ECOLI/26-393A-LKVGADFLK---R..--...YFPE--------SG---------------------.VWV-------SDPTWENH--VA
AAT_HAEIN/26-392A-LRIAAEFIK---R..--...QTKA--------QN---------------------.VWI-------STPTWPNH--NA
HIS8_ACEPA/24-347E-VLAHAFQAF---...--...FAHG--------EP---------------------.LLF-------PDVTYSFY--KV
AAT_BACY2/32-387H-VLYTLFQVI---...--...LNEG--------DE---------------------.VII-------PIPYWVSY--PE
1A12_ARATH/48-432G-ANETIMFCL---...--...ADPG--------DV---------------------.FLI-------PSPYYAAF--DR
BIOF_MYCLE/36-373A-NLGAVVGLS---G..--.....PG--------SL---------------------.IVS-------DAYSHASL--VD
HIS8_HALVD/30-351G-SIDYLTRAV---...--...LEPD--------DR---------------------.ILE-------PAPGFSYY--SM
1A11_CUCMA/50-431G-ASETVIFCL---...--...ADPG--------DA---------------------.FLV-------PSPYYAAF--DR
BNA3_YEAST/54-437E-GILSCLMGL---...--...LNAG--------DE---------------------.VIV-------FEPFFDQY--IP
LCB2_YEAST/155-515T-NANLFNAFL---D..--.....KK--------CL---------------------.VIS-------DELNHTSI--RT
PHHC_PSEAE/28-393A-LRLAGDFIA---H..--...CLPG--------RG---------------------.IWL-------SDPTWPIH--ET
HEM0_CHICK/121-466A-NDTALDTLA---R..--...ILPG--------CQ---------------------.VYS-------DAGNHASM--IQ
BIOF_ECOLI/39-380A-NQAVIAAMM---A..--.....KE--------DR---------------------.IAA-------DRLSHASL--LE
1A11_ORYSI/50-438S-ANEALMFCL---...--...ADHG--------DA---------------------.FLI-------PTPYYPGF--DR
AATB_RHIML/41-402Q-ILFNAMMAS---...--...LDPG--------DE---------------------.VVI-------PTPYWTSY--SD
HIS8_SCHPO/26-373E-IIDSLIRIS---C..--...IPGK--------DK---------------------.ILM-------CPPSYGMY--TV
ATTY_TRYCR/33-406H-GILMAITAI---...--...CDAG--------DY---------------------.ALV-------PQPGFPHY--ET
1A1C_DIACA/49-429.-ASETLLFCL---...--...ANPG--------DA---------------------.FLI-------PSPYYPAF--NR
1A14_SOLLC/53-434G-ANETLILCL---...--...ADPG--------DA---------------------.FLV-------PTPYYPGF--NR
ATTY_RHIME/26-386A-LRLAADLIA---R..--....MGG--------RG---------------------.IWL-------GLPSWPNH--AP
AATA_RHIME/31-392Q-ILFNAFMAT---...--...LNPG--------DE---------------------.VVI-------PAPYWVSY--PE
AATM_YEAST/44-441A-LAVAAKFLA---...--...LFIS--------RD---------------------.IWI-------PDPSWANH--KN
E7KDT6_YEASA/27-375E-SIDAIIRAC---C..--...VPGK--------EK---------------------.ILV-------LPPTYSMY--SV
HEM1_RHIRD/46-391S-NWATLGTLG---Q..--...KIPG--------LI---------------------.IFS-------DALNHASM--IE
AAT4_ARATH/29-395S-LRVGAEFLA---T..--...HNKE--------SV---------------------.IFV-------PNPTWGNH--PR
AAT1_ARATH/57-423A-CRLFADFQK---R..--...FSPG--------SQ---------------------.IYI-------PVPTWSNH--HN
AAT1_MEDSA/42-410S-LRVGGEFLA---K..--...HYHQ--------RI---------------------.IYL-------PTPTWGNH--TK
COBC_PSEDE/23-328S-VIQLLPRLA---P..--...ANRH--------..---------------------.VAI-------FGPTYGEY--AR
HIS8_LACLA/22-345E-VLSLSFLTF---...--...FNSQ--------SP---------------------.LLM-------PDITYSFY--PI
HIS8_ECOLI/29-351E-GIELLIRAF---C..--...EPGK--------DA---------------------.ILY-------CPPTYGMY--SV
AAT2_BACSU/32-384A-GLYVLTQCL---...--...LNPG--------DI---------------------.ALV-------PNPGYPEY--LS
1A12_CUCMA/40-424S-ANETLMFCL---...--...AEAG--------DA---------------------.FLL-------PTPYYPGF--DR
BIOF_LYSSH/37-379A-NVGVISSVM---K..--.....AG--------DT---------------------.IFS-------DAWNHASI--ID
BIOF_HAEIN/35-380A-NIGILPALT---T..--.....TK--------SL---------------------.ILA-------DKLVHASM--ID
MALY_ECOLI/28-382Y-MVSELIRQW---...--...SETG--------EG---------------------.VVI-------HTPAYDAF--YK
1A1C_SOYBN/48-431G-AHEVTTFCL---...--...ADPG--------DA---------------------.FLV-------PIPYYPGF--DR
ATTY_HUMAN/71-434Q-AIDLCLAVL---...--...ANPG--------QN---------------------.ILV-------PRPGFSLY--KT
KBL_ECOLI/42-387A-NGGLFETLL---G..--.....AE--------DA---------------------.IIS-------DALNHASI--ID
HIS8_STRCO/26-360E-VIQQLLQTF---...--...GGPG--------RT---------------------.AIG-------FEPSYSMH--GL
AAT5_ARATH/77-445S-LRLAAALIE---R..--...YFPG--------AK---------------------.VVI-------SSPTWGNH--KN
E7KGL9_YEASA/145-545A-APSVLPAFT---K..--.....RG--------DV---------------------.IVA-------DDQVSLPV--QN
1A12_SOLLC/48-430G-ANETIIFCL---...--...ADPG--------DA---------------------.FLV-------PSPYYPAF--NR
AATM_BOVIN/57-425A-LRIGASFLQ---R..--...FFKF--------SR---------------------DVFL-------PKPTWGNH--TP

PF04864

TAR2_ARATH/79-436Q-LYQAALYAL---SPH....DDSGP--------IN----------------------VVS-------ATPYYSTY--PL
TAR4_ARATH/91-449Q-LLAAAVHAL---SLT..NSSVSSP--------AR----------------------LLT-------SIPYYAMY--KD
TAR1_ARATH/26-381Q-LCQAALFAL---SSL....SEVKP--------VS----------------------IVA-------AVPYYSTY--VE
Q76BK3_ALLCE/104-465Q-LLNGLIISL---SPNVTSDPKAPV--------KK----------------------VVA-------AVPYYPVF--RR
TAA1_ARATH/25-384Q-LCQAAVHAL---SSL....ARSQP--------VS----------------------VVA-------AAPFYSTY--VE
O04927_ALLTU/87-452Q-LLHGLVLTI---SPNISNCPTAGP--------AK----------------------VVA-------RAPYYAVF--RD
Q942G4_ORYSJ/111-470H-LINALVYAL---SPE..GNAASPP--------AS----------------------VVA-------TVPYFAMY--KS
Q9M7L9_ALLCE/102-462Q-LLNGVIISL---SPNVTATPTAPI--------KK----------------------VVA-------YVPYYPVF--KS
Q8LL95_AEGTA/68-427Q-LFQAAMYAL---APT....STDRP--------VG----------------------VVS-------PAPYYS..--..
Q43366_ALLCE/93-456Q-LIHGLVISL---SPNMTATPCAPQ--------SK----------------------VVA-------HAPYYPVF--RE

PF12897

Q9RU17_DEIRA/28-452ELQGLVLGFALLHGLRGSQGGWVHE.--------KP---------------------KMIV-------TVPGYDRH--FL
D5UN97_TSUPD/7-427EIMHRLITLAWIHGTVDGERPWGAEE--------TV---------------------KFLC-------PAPGYDRH--FA
Q1IZU0_DEIGD/1-422ELQGLVLTFALLHGVRGSTGPWLSQ.--------TP---------------------KMIV-------TVPGYDRH--FL
A9GH35_SORC5/7-425TMMHDAVVRALLHGVPDGSGPWVKQP--------KV---------------------KFLC-------PSPGYDRH--FA

PF00464

GLYA_BACSU/4-380A-NMAVYFTIL------------EQG--------DT---------------------VLGM-------NLSHGGHL--TH
GLYA_CAMJE/3-379A-NQGVYAALI------------NPG--------DK---------------------ILGM-------DLSHGGHL--TH
GLYC_YEAST/17-416A-NLQVYQAIM------------KPH--------ER---------------------LMGL-------YLPDGGHL--SH
GLYM_YEAST/33-432A-NLYVYSAIM------------NVG--------ER---------------------LMGL-------DLPDGGHL--SH
GLYC_NEUCR/18-417A-NLQVYQAIM------------PVH--------GR---------------------LMGL-------DLPHGGHL--SH
GLYC_HUMAN/26-425A-NFAVYTALV------------EPH--------GR---------------------IMGL-------DLPDGGHL--TH
GLYA_BRADU/18-395M-NQAVFLALL------------QPG--------DT---------------------FMGL-------DLAAGGHL--TH
GLYM_HUMAN/49-448A-NLAVYTALL------------QPH--------DR---------------------IMGL-------DLPDGGHL--TH
C9R5U6_AGGAD/8-386A-NAAVYMALL------------NPG--------DT---------------------ILGM-------SLAHGGHL--TH
N0BCL8_9RHIZ/20-397A-NQGVFNALA------------KPG--------DT---------------------ILGL-------SLAAGGHL--TH
GLYA_ECOLI/8-386A-NFAVYTALL------------EPG--------DT---------------------VLGM-------NLAHGGHL--TH
GLYM_SOLTU/57-453A-NFQVYTALL------------KPH--------ER---------------------IMAL-------DLPHGGHL--SH

PF00282

DDC_CAEEL/377-746SNFLVLVAART---DMIRRMKQRDKRLRSSDILARL---------------------VAYT-------SSDARRSIKMKM
DDC_BOVIN/35-414ATLVALLAART---KVTRHLQAASPELMQAAIMEKL---------------------VAYA-------SDQAHSSV..EK
DCHS_HUMAN/36-414STLIALLAARK---NKILEMKTSEPDADESCLNARL---------------------VAYA-------SDQAHSSV..EK
DCHS_DROME/35-413ATLVCLLAGRT---RAIQRFHERHPGYQDAEINARL---------------------VAYC-------SDQAHSSV..EK
DCE1_FELCA/144-518SNMYSIMAARY---KFFPEVKTKGMAAVP.....KL---------------------VLFT-------SEHSHYSI..KK
DCEA_ECOLI/33-383ACMLGGMAMKW---RWRKRMEAAGKP......TDKP---------------------NLVC-------GP.VQICW..HK
DCE_DROME/64-434SNLYAFLAARH---KMFPNYKEHG....SVGLPGTL---------------------VMFT-------SDQCHYSI..KS
DDC_DROME/70-446STLVALLGAKA---KKLKEVKELHPEWDEHTILGKL---------------------VGYC-------SDQAHSSV..ER
B1Q3F1_SOLLC/33-381AIMLAGLAFKR---KWQNKMKAQGKP......YDKP---------------------NIVT-------GANVQVCW..EK

PF01276

DCOS_ECOLI/109-551S-SNKVVLNAL-----------LTPG--------DL---------------------VLFD-------RNNHKSNH--HG
YAAO_BACSU/3-363V-GNLAMILSV-----------CEPG--------DT---------------------ILVQ-------RNCHKSVF--H.
SPEA_BACSU/6-371G-AIMTMVMAV-----------CGPG--------DK---------------------IIIP-------RNVHKSIM--T.
ADIA_ECOLI/140-590G-SNRTIMQAC-----------MTDN--------DV---------------------VVVD-------RNCHKSIE--Q.
DCOR_HAEIN/108-550S-SNKVALNAV-----------LAPG--------DL---------------------VLFD-------RNNHKSNH--HG
DCLZ_ECOLI/130-545T-SNKIVGMYA-----------APSG--------ST---------------------LLID-------RNCHKSLA--H.
DCOR_ECOLI/101-543A-ANKVVTNAL-----------LTRG--------DL---------------------VLFD-------RNNHKSNH--HG
LDCI_ECOLI/130-545T-ANKIVGMYS-----------APAG--------ST---------------------ILID-------RNCHKSLT--H.

PF00202

OAT_BACSU/17-398A-VESAVKAAR---RWAYEVKGVADN--------QA....................EIIAC-------VGNFHGRT--ML
Y2045_BACPE/19-432A-IEGALKLAK---F........VTK--------RP....................YVVSF-------TGCFHGRT--QG
ARGD_BACSU/7-377A-NEGAIKLAR---K........ATG--------KT....................KIITF-------LQSFHGRT--YA
GSA_MYCLE/40-431A-TMSAVRLAR---G........FTG--------RT....................KIIKF-------SGCYHGHV--DA
BIOA_CORGL/18-420S-VEVAIKMAL---QASKGQG..HPE--------RT....................KLLTW-------RSGYHGDT--FT
BIOA_HAEIN/19-424A-VEVAMKMAI---QYQHAKG..EVQ--------RQ....................KFATI-------RSGYHGDT--WN
ARGD_YEAST/27-418A-NEAALKFAK---KHGIMK...NPS--------KQ....................GIVAF-------ENSFHGRT--MG
GABT_HUMAN/65-496S-NENALKTIF---MWYRSKE..RGQ--------RGFSQEELETCMINQAPGCPDYSILSF-------MGAFHGRT--MG
GABT_MYCLE/29-443A-VENSIKVAR---S........YTR--------KP....................AVVAF-------DHAYHGRT--NL
ARGD_ECOLI/20-400A-NETAFKLAR---HYACVRH..SPF--------KT....................KIIAF-------HNAFHGRS--LF
GABT_ECOLI/14-421A-VENAVKIAR---A........ATK--------RS....................GTIAF-------SGAYHGRT--HY
GABAT_EMENI/65-495A-NETAYKAAF---MYYRQQQRGGPE--------KEFTEEEIQSSMLNQTPGSPQLSIMSF-------KAGFHGRL--FG
OAT_PLAF7/20-406A-SETAYKLCR---KWGYEVKKIPEN--------SA....................KIIVC-------NNNFSGRT--LG
X2GMN7_9BACI/23-446A-IEVALKMSF---QYHMQTG..KTQ--------KK....................RFLAL-------TDAYHGET--LG

PF05889

SPCS_METJA/57-434GMSLALCLSAA--------R.KKYNS--------NV---------------------VIYP-------YAAHK...SPIK
SPCS_METKA/53-429GLSIALCLSAL--------G....EG--------EE---------------------VIYP-------YAAHK...SPIK
SPCS_HUMAN/61-459GMSLTLCFLTL--------RHKRPKA--------KY---------------------IIWP-------RIDQK...SCFK
SPCS_CAEEL/53-450GMSLSLCMTSW--------RRRRPKA--------KY---------------------VVWL-------RIDQK...SSLK
SPSS1_ARCFU/33-368...........--------..MHSLA--------KK---------------------DAWV-------VMDENCHYSSYV

PF02347

GCSP_SCHPO/65-504A-GEAMVMLMA-----------NDKK--------K.-------------------RKTFLV-------DKNIYPNT--LS
GCSP_HUMAN/65-488A-AEALQLCYR-----------HNKR--------R.-------------------..KFLV-------DPRCHPQT--IA
GCSPA_BACSU/3-443L-AEAAMLASG-----------HTKK--------K.-------------------..KIVV-------SKTVHPES--RE
GCSP_ECOLI/16-440A-AEAMAMAKR-----------VSKL--------KN-------------------ANRFFV-------ASDVHPQT--LD
GCSP_SYNY3/35-460A-AEAMALSYG-----------VSKS--------K.-------------------ANAFFV-------AQDCHPQT--IE
Q21962_CAEEL/32-462S-AEAVALAAR-----------TTKR--------N.-------------------..KIVV-------DSFCHPQN--LD
GCSPA_AQUAE/1-439L-AEAVLM.AR-----------AIKG--------K.-------------------GDTVVL-------SKALNPLY--RR
GCSP_YEAST/69-511A-GEAMLLSFN-----------ISRK--------K.-------------------KLKYVI-------DKKLHQQT--KS
GCSP_MYCTU/9-438A-AEAMTLMHR-----------AARG--------P.-------------------VKRVVV-------DADVFTQT--AA

PF01053

CYSD_EMENI/10-428QFKVLF--------PR.LGITTK--F----------VQ-----------------G....DK--AEDIAA-AIDD..R--
CYS3_YEAST/10-390YFTKVA--------NA.HGVETS--F----------TN-----------------D.....L--LNDLPQ-LIKE..N--
MET17_YEAST/6-436QFKISF--------KR.FGIEAR--F----------VE-----------------G....DN--PEEFEK-VFDE..R--
O02215_CAEEL/69-449FINETL--------AR.FGVEIT--S----------VD-----------------VEKEKDF--AGAVEK-AIRP..N--
METC_ECOLI/7-392FCSKIL--------SK.LGVTTS--W----------FD-----------------P....LI--GADIVK-HLQP..N--
CGL2_CAEEL/8-386YIRRVA--------VPNHGLEVD--S----------VD-----------------L....TD--VQNLEK-AIKP..N--
METC_HAEIN/8-393FCNIVL--------KK.MQIDIT--Y----------YD-----------------P....LI--GEDIAT-LIQP..N--
METC_ARATH/88-460LLSQVV--------PR.SGVVVK--R----------VN-----------------T....TK--LDEVAA-AIGP..Q--
CGS1_ARATH/176-561FMENFL--------PK.LGITVT--V----------ID-----------------P....AD--IAGLEA-AVNE.FK--
METI_BACSU/6-363LFENEW--------KKYG.LTFH--Y----------DD-----------------F....SD--EDCLRS-KITP..N--
MCCB_BACSU/4-377VMTKVL--------NR.LGIEST--F----------VD-----------------T....SS--REEVEK-AIRP..N--
CGL_HUMAN/19-395YFRQVA--------S.EFGLKIS--F----------VD-----------------C....SK--IKLLEA-AITP..E--
METZ_PSEAE/20-401LFDKYF--------KR.FGIQVD--Y----------PP-----------------L....SD--LAAWEA-ACKP..N--
METC_BACSU/9-382MVTEVL--------TR.FGIEHT--F----------VD-----------------M....TD--RNEVAR-SIKP..N--
METB_ECOLI/6-381LFDSLA--------KR.GCYRVL--F----------VD-----------------Q....GD--EQALRA-ALAE..K--
STR3_YEAST/7-405LLNFFK--------QQ.SHAVSV--H----------VD-----------------T....SD--FEKFKT-VFQSLDK--
CYSD_SCHPO/9-427LFKVTL--------PR.LGITTK--F----------VN-----------------G....DD--PNDLAA-QIDE..N--
METB_MYCLE/15-388LIDKVF--------T.QWNVDYT--P----------VP-----------------L....SD--LDAVRA-AITS..R--
METB_HAEIN/8-366LLDFSY--------KNNNSVKPV--Y----------VN-----------------T....AS--ASAIEA-AINP..N--
O15565_TRIVA/12-395LFEHQL--------RK.FGVEVD--F----------ID-----------------M....AV--PGNIEK-HLKP..N--
METB_HELPY/4-377LFNQVL--------VK.NGLSCT--I----------ID-----------------T....SD--ISQIKK-AIKP..N--
A2FEV4_TRIVA/9-392LFEHAL--------TK.FGIQVD--F----------IN-----------------T....AI--PGEVKK-HMKP..N--
B0SQZ9_LEPBP/8-432LLHYTF--------PK.LGIKVH--F----------VD-----------------P....SN--PENFKK-ASND..K--
B2FLU7_STRMK/14-389LFERVR--------RRTAGLDFS--F----------VD-----------------L....TD--LAAFEA-AITP..K--
K7VKJ5_MAIZE/100-483YMETEL--------PK.RGISMT--V----------IR-----------------P....AD--MDALQN-ALDN.NN--
METZ_MYCTU/21-405VCSEIL--------PR.WGVQTV--F----------VD-----------------G....DD--LSQWER-ALSV..P--
Q5AXC9_EMENI/40-405LLKYLS--------TN.GGIIVH--H----------VD-----------------T....TN--PDKVKE-VLTD..K--

PF01041

ERBS_SACEN/13-363AVSRVG--------AVPVPVEPE--G----------VS-----------------H---TLD--PALVEQ-AITP--R--
P72893_SYNY3/11-365PIVHLG--------AKPVFVDIL--P----------DS-----------------W---CID--PVLAEQ-AITP--R--
P73264_SYNY3/14-373SVLRVN--------SDVQYLDMD--P----------KT-----------------F---APS--LAMVKE-AVEG--K--
O27256_METTH/7-356AALYVG--------ATPVFADID--P----------LT-----------------Y---NID--PERIEE-LITP--S--
P74668_SYNY3/13-379SISNVG--------AKPVFVDVA--I----------TD-----------------F---NLD--PDKIKA-AITP--R--
RFBH_SALTY/40-430PAIQNG--------LIPVFVDVD--I----------PT-----------------Y---NID--ASLIEA-AVTE--K--
PSEC_HELPY/9-366MLLESG--------YTPVFAGIK--.----------ND-----------------G---NID--ELALEK-LINE--R--
Y1066_METJA/12-379VIVHQR--------AKPVFVDID--K----------ET-----------------Y---NIN--VEEIEN-AITE--R--
ARNB_ECOLI/10-374MISLLG--------ATPVMVDVD--R----------DT-----------------L---MVT--PEAIES-AITP--R--
SPSC_BACSU/14-382TIIHTG--------ATPVFADID--E----------NT-----------------L---NID--PVKLEA-AVTP--R--
O26434_METTH/7-359AVIYCN--------AKPVLVDSH--P----------DY-----------------W---CID--PSRIEE-KINK--N--
NTDA_BACSU/78-432AVLASG--------GVPIYVDIN--P----------QT-----------------F---CID--PDKIEE-AITP--Y--
A4F7N3_SACEN/33-380AASWLG--------LEPVFCDVD--P----------ET-----------------G---LLD--PEHVAS-LVTP--R--
B1W368_STRGG/23-413AVLGIN--------AVPVLVDVD--P----------AT-----------------Y---CLD--PAATEA-AITE--R--
B1W386_STRGG/12-373PVTYLG--------ARPVFADVT--P----------DT-----------------H---CLD--PDSVKS-LIGE--R--
C6W8U4_ACTMD/18-373AVQRLG--------AVAVPVDVD--P----------DT-----------------Y---CLD--VAAAEA-AVTS--R--
F7YJG4_VIBA7/13-366AISEAG--------LVPVLVEPC--E----------VT-----------------F---NLD--PNLIEL-AVTT--R--
RIFK_AMYMS/15-372AAQRLG--------AVTVPVDVD--A----------AT-----------------Y---NLD--PEAVAA-AVTP--R--
Y3402_MYCTU/52-405AALWTG--------YRPWFIDID--A----------NT-----------------W---QPC--VHSARA-VIER--F--
Q5KV33_GEOKA/14-364SIARAG--------AKPVFVDID--P----------VT-----------------F---NID--PAKIEA-AVTE--K--
Q79H47_BORPE/14-362VIALLG--------AKPVFVDVE--P----------DT-----------------C---NIK--VSEIEA-KITP--R--
Q7W0M1_BORPE/26-405VARYLG--------AEPVLVDID--P----------AT-----------------L---CIS--PAAIER-AITP--R--
Q9ABJ3_CAUCR/28-397CARYVG--------AEVVFADVD--P----------DS-----------------G---LMT--PDTLAR-ALAG--A--
Q9KVA5_VIBCH/9-360TIVQCG--------ALPVFAEIE--G----------ES-----------------L---QVS--VEDVKR-KINK--K--

PF01212

GLY1_ASHGO/17-304GLAIL.--------SQAMVTPVI..P----------SNG................N---YLT--LEDIKK.HYIPDDGD.
GLY1_YEAST/16-303GLAIL.--------SQAMVVPVV..P----------SNG................D---YLT--LEDIKS.HYVPDDGD.
Q7QAI2_ANOGA/21-308GAAQIA--------.GVLLNTIK..N----------NPD................G---TFC--LNELVR.KFRG..FD.
YF64_CAEEL/68-359NYAQFA--------.GISATTLE..V----------KPD................G---TMD--LNDIEQ.AIRV..KD.
Q8Y182_RALSO/3-296GPEFFS--------NGSKLLTAE..G----------AD.................G---KLT--PDAVEA.LVTRRSD..
Q9RUR9_DEIRA/13-296MMAAF.--------SGVVPRFVP..A----------PL.................G---VPS--PEDVRL.AVRR...S.
Q8A7N2_BACTN/47-423GH..I.--------EGRHAIALDCTI----------DEAKNTQL......EIPFKG---NVD--PAKLEK.ALSE.....
THA2_ARATH/11-300GVSSL.--------GGVHPRTVK..N----------EED................G---TME--IGAIEA.AVRSPKGD.
Q8RCY7_CALS4/5-290GIGYL.--------AGVQAKTLK..G----------NK.................G---VLN--PEDVEK.AIRP..KN.
Q89ID2_BRADU/23-308AHAAI.--------GGFQVTQLK..G----------PD.................G---QFT--PETFRK.ALHPRTR..
Q7MUT3_PORGI/47-424GHIEY.--------RRAFAPDCT..I----------DEAADTQI......ELPFKG---NMD--LNKLEK.ILKETPK..
Q9VCK6_DROME/8-304GASHL.--------AGVQLATLK..N----------EQD................G---TFS--LQDLRR.RIRH..ED.
LTAE_PSEAE/7-299APEFFS--------NGSKLLLAQ..T----------EV.................G---KLT--PASIRDIALKR..QD.
TPL_PASMU/47-424AHQER.--------NGATFVDII..I----------DEAHDSQI......DLPFKG---NVD--VKKLQK.LIDEVGA..
TNAA1_SYMTH/45-421GHVQL.--------AGGRPVDLL..I----------DV.PTEE.......YHPFKG---NMD--TERLEQ.FIREHGA..
TNAA_CALS4/50-428AHIEL.--------AGGIGIDMV..I----------KEAEDTEN......YHPFKG---NFD--VEALEN.FIKEKGA..
GLY1_SCHPO/30-313AIGLF.--------TQAIVRPIS..P----------KNN................V---YIT--AEEIEN.KLIL.GND.
Q9X266_THEMA/3-287AMAVL.--------SGVMPHPVP..G----------KN.................G---AMD--PDDVRK.AIRP..RN.
TNAA_PHOLL/46-432AHVEL.--------NGAKAINVV..T----------SKAFDTTT......YYDWKG---DFD--IDELEK.TIAEHGA..
Q88AI0_PSESM/7-297APEFFS--------NGSKLLTAR..S----------PG.................G---KLT--PESIREVALKR..QD.
Q89N26_BRADU/13-294SVVTI.--------AGLVPKPMP..S----------RR.................G---AMD--EAALAD.AIRG..S..
Q7MEV9_VIBVY/2-285GAAVL.--------GSIQPQPVE..N----------NPD................G---TLP--FDKLAA.AIKP..DD.
TNAA_CLOTE/60-438AHVEL.--------SGARAIDCV..V----------PEASDPTV......RIPFKG---NMD--VEKLEK.LIKEHGA..
Q9A3V8_CAUCR/9-299APGFFG--------QGVGLIGLP..G----------AS.................G---KME--LAALEA.ALAQPDV..
TNAA_HALSA/42-412AHVAA.--------NDATPVDCP..V----------DGARDPDT......DAPFKG---NFS--VERARR.VVDDVGA..
Q7NHQ7_GLOVI/7-294GASHL.--------GGVQLHPLD..G----------RH.................G---VLS--AQQVRS.AVRP..IE.
TNAA_CHRVO/47-428AHVEL.--------AGARAVNAL..T----------PRALDTGA......AYDWKG---DFD--LARLGE.IVEA.EG..
TNAA_AERPE/52-428AVILN.--------QGGVPLDLP..S----------PQASRRE.......AYPFKG---DID--VARLER.LLKERSR..
Q896G8_CLOTE/5-288APAVI.--------AGVQLRPIK..S----------EN.................G---FMS--LDDIQS.KIRG..EN.
Q9HMP3_HALSA/22-307GLAQH.--------AGVQARAFD..G----------GET................G---CPT--AEQVAA.EITAGGG..
Q8EC07_SHEON/3-286GAAVL.--------GSIQPQPLT..N----------QLD................G---TIA--LTDVEA.AIKP..DD.
Q7NQ31_CHRVO/5-289AAAVI.--------AGAHLRTIE..G----------DN.................G---LMA--VDAIER.RIRV.GDD.
D5AL49_RHOCB/46-420GNIEA.--------SGAMGDDLV..I----------AEGKDPQS......LHPFKG---NMD--LARLEA.YLAE.....
D5AV45_RHOCB/2-292APEFYT--------GGSKLVLVD..G----------PH.................A---KMD--AAGLRA.AIAHTARAG
G3XD13_PSEAE/5-283GAAVL.--------GSIQPQPID..G----------EAD................G---SLH--LDKVAA.AIKADDF..
I0DW76_PROSM/47-432AHVEL.--------NGCKAINIV..T----------EKAYDSET......YDDWKG---NFD--IQKLKD.NIAKYGA..
LTAE_ECOLI/3-280GAAVL.--------GSIQPQPID..A----------AAD................G---TLP--LDKVAM.KIKPDDI..
TPL_SYMTH/47-422THQEL.--------QGGTFVDVI..I----------DEAHDPQA......SHPFKG---NVD--IAKFEA.LIDRVGA..
Q59NC4_CANAL/14-300GLATL.--------SQAMVHPVR..P----------SNG................N---YLT--FEDVLA.NVTYDDGD.
Q7VW60_BORPE/3-283GAAVL.--------GSIQPQPVD..H----------AAD................G---SLP--LDRLAA.ALKPGGD..
TPL_FUSNN/49-425YHQER.--------NGGIFKDII..R----------DEAHDATL......NVPFKG---DID--LNKLQK.LIDEVGA..
Q8RHQ6_FUSNN/51-505NIKQM.--------GSV.PRNLY..N----------KELLYEVPEGGRYEKNPFKG---DMD--INKLQQ.LIDAVGI..
THA1_ARATH/7-295GISTI.--------GGVHPKTVK..N----------EED................G---TMD--LEAIEA.AIRDPKGS.
Q98A67_RHILO/12-297APEFYT--------AGAKLVQLP..G----------EA.................G---KID--IDALAANAMRMVGD..

PF06838

YNBB_BACSU/11-416AGSLKD--------FQIGYNAVD--L----------TKD----------------G---KID--YDAVAA-AIN..PK--
Q8EQP5_OCEIH/1-405EGSLHD--------FNIGYREIP--L----------LAD----------------G---SVN--YKQVKE-SWT..SN--
Q8Y7I1_LISMO/4-408QGSLKD--------FHIGYSSVP--L----------LEN----------------G---DVD--FPLIAE-KMT..RK--
Q97I22_CLOAB/19-425VGSLRE--------YGVKYKMVD--L----------KD.----------------G---KVD--INTVKE-ELKKDDS--
Q8XL83_CLOPE/19-425IGSLKE--------YGVNYKQVD--L----------VD.----------------G---KIN--IEKALE-MIKEDES--
Q8DHD9_THEEB/26-430QGSLKD--------FGIHYRELP--L----------LAS----------------G---EPD--WGAIAT-CVQ..PQ--
Q54763_SYNE7/3-407QGSLKD--------FGVSYRELA--L----------TES----------------G---EVD--WQALTT-AIR..PN--
Q8RA65_CALS4/17-421RGSLRE--------CGIIYKEVP--L----------LEN----------------G---EMD--VEGIKK-AIT.S.K--
Q9KAC8_BACHD/11-416GGSLKD--------FGITYHAVP--L----------TAE----------------Q---KVD--KAAVKA-AMN..ER--
Q8YWL0_NOSS1/20-424QGSLIE--------FGIKYRQLE--L----------TSQ----------------G---SID--WQTLST-SIT..DH--
Q55407_SYNY3/3-407QGSLAD--------FNISYRQLP--L----------TAA----------------G---TVD--WQGLET-AVR..PE--
Q895H5_CLOTE/19-425IGSFKE--------YGINYRQVD--L----------KE.----------------G---KLD--FKGIEK-AIKEDPS--
Q5HPN4_STAEQ/5-406VESLKE--------YGVRYNEVE--L----------RD.----------------G---RID--IPKVIT-AIN..DN--

PF03841

SELA_PSEAE/79-451IPDIMA-------RAGVRLHEVG--T----------TN---------------------RTH--AKDYEA-AIGP--R--
SELA_CAMJE/71-423VPEVIK-------AAGVKLCEVG--T----------SN---------------------KTH--LKDYEQ-AINE--N--
SELA_PASMU/81-448IPDIMQ-------QAGCKLVEVG--T----------TN---------------------RTH--LSDYRH-AINE--N--
SELA_HAEIN/82-449IPDIME-------QAGCHLVEVG--T----------TN---------------------RTH--LKDYRN-AITE--N--
SELA_RHIME/80-448MPDIME-------RAGVDLVEVG--T----------TN---------------------RTH--AKDYVK-AIGP--E--
SELA_ECOLI/83-452IPDVMR-------QAGCTLHEVG--T----------TN---------------------RTH--ANDYRQ-AVNE--N--
SELA_AQUAE/72-435IPDIMK-------KSGAILREVG--T----------TN---------------------KTK--VSDYEG-AINQ--N--
C7LWD8_DESBD/82-448IPEVMK-------KSGAVLREVG--A----------TN---------------------RTH--LRDYSE-AIGA--D--
SELA_MOOTA/80-445IPEVMG-------QSGTRLVEVG--T----------TN---------------------KTY--IHDYER-AVGP--D--
W8TF72_EUBAC/86-450IPSVME-------QSGAKLVEVG--T----------TN---------------------KTY--ASDYEA-AITE--N--

PF00266

SERC_ECOLI/4-350IKEAKK-------YCTPNVFDA.KVT----------VD-----------------G---LRA..VKPMREWQL....S.D
CSD_PSEPK/23-389WQQLAH-------RRNLHLVVL.PLD----------AH-----------------G---RID..QDQA.LQLI....G.P
CSD_CHLTR/19-388WELACQ-------RSGATIKKV.RVD----------DE-----------------G---MVD..CSHL.EQLL....K.Q
CSD_XYLFA/36-404WQLIAE-------RTGARIQVA.DIL----------PN-----------------G---TLD..LDAL.HTLM....T.P
NIFS_NOSS1/4-365CKQLE.-------TQGYTVTYL.SVN----------SH-----------------G---QLD..LDEL.EASL....T.G
CSD_STRCO/31-406WQLLAQ-------RTGAKLRWF.GLT----------DD-----------------G---RLD..LSNI.DEVI....T.E
CSD_TREPA/20-390WQHVCR-------CTGATIQWL.YPD----------AE-----------------G---NLD..IQEA.QKKI....R.A
CSD_UREPA/18-385WYKLRD-------DLGVKI.IF.ANQ----------KN-----------------Q---FPQ..LSDF.LKVI....S.P
CSD_METTH/20-389WLRL.R-------ERGVDVRVV.KAD----------EG-----------------G---VVD..PGRI.EDAV....D.E
SUFS_DICD3/30-399WQMLAQ-------ARGLTLRVL.PIT----------DD-----------------G---ELD..MAQL.PALL....D.E
CSD_VIBCH/25-393WQMVAE-------QTGAKVVKI.PMT----------TT-----------------G---EFG..LAAF.RQLL....S.P
SUFS_ECOLI/25-394WQMLCA-------RVGAELRVI.PLN----------PD-----------------G---TLQ..LETL.PTLF....D.E
CSD_PSEAE/23-389WQQLAL-------RRGLVLRVL.PLD----------ER-----------------G---VID..LEQA.RHII....G.E
CSD_AERPE/21-399WVRAAR-------LGGGRARIL.PLD----------GR-----------------G---VPR..WDLL.EDYI....T.E
CSD_PASMU/44-409WSEIAR-------QYGATLHIL.PIN----------EQ-----------------W---LIE..EQDL.IAVL....N.T
SERC_HAEIN/4-348AKEARN-------F..AEIDEI.TIV----------EN-----------------G---EQTRITDLD.FSHI....A.D
SUFS_BACSU/23-391WQQAVK-------ATGATLKYI.PLQ----------ED-----------------G---TIS..LEDV.RETV....T.S
NFS1_YEAST/100-462ARAMM.-------KEGFEVTFL.NVD----------DQ-----------------G---LID..LKEL.EDAI....R.P
SPYA_CALJA/45-398AADIGE-------RLGARVHPM.TKD----------PG-----------------G---HYT..LQEV.EEGL....AQH
SUFS_WIGBR/25-395WQLLSM-------RKKVDIKYI.PLL----------PS-----------------G---KLD..ICKI.DDII....N.N
SUFS_YERPE/25-394WQMLAQ-------DLGVEIRVW.PLT----------AT-----------------G---ELE..ITAL.AALI....D.D
CSD_THEMA/23-400WLRLSK-------FHGYRIDFIRPSG----------RF-----------------G---TLE..MDDL.LKHR....D.K
SERC_RABIT/7-357AEEAKK-------FGTVNIVHP.KL.----------..-----------------G---SYTKIPDPS.TWNL....N.P
CSD_MYCPN/25-391WVALAK-------QTKARLVWV.EKQ----------AN-----------------Q---SLE...DTF.KSLI....N.P
CSD_MYCPA/301-670WQLISQ-------KTGAILKVA.PID----------DA-----------------G---NLL..LSEF.EGLL....G.P
CSD_HAEIN/60-425WHETAK-------KCGAKIQVL.PIL----------DN-----------------W---LID..ENAL.ISAL....S.E
CSD_BORBU/33-410WVNLAN-------LANLKIKLA.KFN----------EM-----------------G---IIT..PEEI.EKLI....T.E
NIFS_BACSU/2-366AAFLE.-------QQGYDVTVI.EPN----------EY-----------------G---LIT..EEIL.LTHI....R.P
CSDA_ECOLI/21-388WLMVAQ-------QTGAKVVKL.PLN----------AQ-----------------R---LPD..VDLL.PELI....T.P
CSD_BACHD/23-391WQQVAK-------ATGATLTYL.PLQ----------KD-----------------G---TIK..IEDV.EKTI....S.E
D5ARX2_RHOCB/6-368AADLEK-------TEGVRVHRI.PVD----------HL-----------------G---RLD..LAAY.RAAL....S.D
K9ZIC0_ANACC/6-351WVEVGQ-------AFGLNVEAI.TAE----------WG-----------------Q---PLD..PDKF.AQKLQADTN.K
CSD_MYCTU/32-403WQELAR-------RTGATLRWY.GVT----------DD-----------------G---RID..LDSL...YL....D.D
Q2FZY5_STAA8/32-401WQQLAK-------RKNATLKFI.PMT----------AD-----------------G---ELN..IEDI.KQTI....N.D
Q8U4C4_PYRFU/18-386WQRLAK-------KLGLKLEFI.EGD----------DE-----------------G---NLD..LSDA.EKKI......K

PF00155

AAT_ECOLI/26-392VFNSAG-------LE.VREYAY-YDA..........EN-----------------H---TLD--FDAL-INSL----N-E
HIS8_BACSU/29-356NAVIEG-------AE.VREIAL-R............PD-----------------G---SHD--LDAM-LEAI----D-E
HEM1_EMENI/192-555GIRHSG-------AK.KMVFK.-...............-----------------.---HND--LVDL-ETKL----A-S
AATC_BOVIN/31-405VFIAAG-------FKDIRSYHY-WDA..........AK-----------------R---GLD--LQGF-LNDL----E-K
AAT_SULSO/35-391VVKLLG-------GK.PIYANL-KWSR........EEG-----------------F---SID--VDDL-QSKI----S-K
TYRB_ECOLI/26-393IFAGAG-------FE.VSTYPW-YDE..........AT-----------------N---GVR--FNDL-LATL----K-T
AAT_HAEIN/26-392IFNAVG-------MT.IREYRY-YDA..........ER-----------------K---ALD--WEHL-LEDL----S-Q
HIS8_ACEPA/24-347YCGLYS-------LP.FRNVPL-T............DD-----------------M---QVN--VADY-AG..----.-.
AAT_BACY2/32-387QVKLAG-------GV.PVYIEA-TSE..........QN-----------------Y---KIT--AEQL-KNAI----T-D
1A12_ARATH/48-432DLRWRT-------GVEIIPVPC-SSS..........DN-----------------F---KLT--VDAA-EWAY----K-K
BIOF_MYCLE/36-373ACRLSR-------AR.VVVTP.-...............-----------------.---HCD--VDAV-DTAL----R-S
HIS8_HALVD/30-351SARYHH-------GD.AVQYEV-SKD..........DD-----------------F---EQT--ADLV-LDAY----D-.
1A11_CUCMA/50-431DLKWRT-------RAQIIRVHC-NSS..........NN-----------------F---QVT--KAAL-EIAY----K-K
BNA3_YEAST/54-437NIELCG-------GK.VVYVPI-NPPKELDQRNTRGEE-----------------W---TID--FEQF-EKAI----T-S
LCB2_YEAST/155-515GVRLSG-------AA.VRTFK.-...............-----------------.---HGD--MVGL-EKLI----R-E
PHHC_PSEAE/28-393LFAAAG-------LK.VSHYPY-VSA..........DN-----------------.---RLD--VEAM-LAGL----E-R
HEM0_CHICK/121-466GIRRRG-------VP.KFIFR.-...............-----------------.---HND--PHHL-EQLL----G-R
BIOF_ECOLI/39-380AASLSP-------SQ.LRRFA.-...............-----------------.---HND--VTHL-ARLL----A-S
1A11_ORYSI/50-438DLKWRT-------GAEIVPVHC-ASA..........NG-----------------F---RVT--RPAL-DDAY----R-R
AATB_RHIML/41-402IVQICE-------GK.PILIAC-DAS..........SG-----------------F---RLT--AQKL-EAAI----T-P
HIS8_SCHPO/26-373SAKIND-------VE.VVKVLL-E............PD-----------------F---NLN--VDAI-CETL----S-K
ATTY_TRYCR/33-406VCKAYG-------IG.MHFYNC-RPE..........ND-----------------W---EAD--LDEI-RRLK----D-D
1A1C_DIACA/49-429DLRWRT-------GVNLIPFTC-SSS..........NN-----------------F---KIT--KEAL-QSAY----E-D
1A14_SOLLC/53-434DLRWRS-------GVQLLPISC-KSC..........NN-----------------F---KIT--IEAI-EEAY----E-K
ATTY_RHIME/26-386IFKAAG-------LD.IATYDF-FDI..........PS-----------------Q---SVI--FDNL-VSAL----E-G
AATA_RHIME/31-392MVALCG-------GT.PVFVPT-RQE..........NN-----------------F---KLK--AEDL-DRAI----T-P
AATM_YEAST/44-441IFQNNG-------FENIYRYSY-Y............KD-----------------G---QID--IDGW-IEQL----K-T
E7KDT6_YEASA/27-375CANIND-------IE.VVQCPL-TVS.........DGS-----------------F---QMD--TEAV-LTIL----K-N
HEM1_RHIRD/46-391GIRYGR-------CE.RVIWK.-...............-----------------.---HND--LEDL-EAKL----K-A
AAT4_ARATH/29-395IFTLAG-------LS.VQYFRY-YDP..........KS-----------------R---GLD--FKGM-LEDL----G-A
AAT1_ARATH/57-423IWKDAQ-------VP.QKTYHY-YHP..........ET-----------------K---GLD--FSAL-MDDV----K-N
AAT1_MEDSA/42-410VFNLAG-------LT.VKTYRY-YAP..........AT-----------------R---GLD--FQGL-LEDL----G-S
COBC_PSEDE/23-328VLEAAG-------FA.VDRVA.-...............-----------------.---..D--ADAL-TA..----.-.
HIS8_LACLA/22-345YCELYR-------IP.FQKVPV-D............DD-----------------F---KVL--IKDY-CI..----.-.
HIS8_ECOLI/29-351SAETIG-------VE.CRTVPT-L............DN-----------------W---QLD--LQGI-SDKL----D-.
AAT2_BACSU/32-384GITMAR-------AE.LYEMPL-YEE..........NG-----------------Y---LPD--FEKI-DPAV----L-E
1A12_CUCMA/40-424DLKWRT-------GVEIVPIHC-TSS..........NG-----------------F---QIT--QSAL-EQAY----K-D
BIOF_LYSSH/37-379GCRLSK-------AK.TIVYE.-...............-----------------.---HAD--MVDL-ERKL----R-Q
BIOF_HAEIN/35-380GIRLSQ-------CE.FFRYR.-...............-----------------.---HND--YEHL-KNLL----E-K
MALY_ECOLI/28-382AIEGNQ-------RT.VMPVAL-EKQ.........ADG-----------------W---FCD--MGKL-EAVL----A-K
1A1C_SOYBN/48-431DLRWRT-------GIKLVPVMC-DSS..........NN-----------------F---KLT--KQAL-EDAY----E-K
ATTY_HUMAN/71-434LAESMG-------IE.VKLYNL-LPE..........KS-----------------W---EID--LKQL-EYLI----D-E
KBL_ECOLI/42-387GVRLCK-------AK.RYRYA.-...............-----------------.---NND--MQEL-EARL----K-E
HIS8_STRCO/26-360IARGTG-------TG.WISGPR-H............ED-----------------F---TID--VPAA-TRAI----D-E
AAT5_ARATH/77-445IFNDAK-------VP.WSEYRY-YDP..........KT-----------------I---GLD--FEGM-IADI----K-E
E7KGL9_YEASA/145-545ALQLSR-------ST.VYYFN.-...............-----------------.---HND--MNSL-ECLL----N-E
1A12_SOLLC/48-430DLRWRT-------GVQLIPIHC-ESS..........NN-----------------F---KIT--SKAV-KEAY----E-N
AATM_BOVIN/57-425IFRDAG-------MQ.LQSYRY-YDP..........KT-----------------C---GFD--FTGA-IEDI----S-K

PF04864

TAR2_ARATH/79-436ITDCLK-------SGLYR------------------WG-----------------G---DAKTY.....KED.----.--
TAR4_ARATH/91-449QAEFFD-------SAHLK------------------FE-----------------G---NASAWKQ.SGRNDN----I--
TAR1_ARATH/26-381EASYLQ-------STLYK------------------WE-----------------G---DARTF.....DKK.----.--
Q76BK3_ALLCE/104-465QTSFFN-------FKGYE------------------WK-----------------G---NASDYV....KTTS----P--
TAA1_ARATH/25-384ETTYVR-------SGMYK------------------WE-----------------G---DAWGF.....DKK.----.--
O04927_ALLTU/87-452QTSYFD-------NKGYE------------------WK-----------------G---NAANYV....NDPN----P--
Q942G4_ORYSJ/111-470QTVMFD-------GREYR------------------WD-----------------G---TTAAWANNNSSRNP----T--
Q9M7L9_ALLCE/102-462QTSFFN-------FKGYE------------------WK-----------------G---NASDYV....NTTN----P--
Q8LL95_AEGTA/68-427.TDLLL-------SGYYR------------------WA-----------------G---DANAF.....HGDH----G--
Q43366_ALLCE/93-456QTKYFD-------KKGYE------------------WK-----------------G---NAADYV....NTST----P--

PF12897

Q9RU17_DEIRA/28-452LLETLG-------FK-LLAVDM--------------QD-----------------D---GPD--VDAI-ERLAANDAS--
D5UN97_TSUPD/7-427ITEELG-------IE-MIVVPL--------------NP-----------------D---GPD--MAVV-KELVAKDPS--
Q1IZU0_DEIGD/1-422LLQTLG-------FE-LLTVDM--------------QS-----------------D---GPD--VDAV-ERLAGTDPS--
A9GH35_SORC5/7-425ICEHHG-------IE-MITVDL--------------RD-----------------D---GPD--MDQV-EKLVAEDAA--

PF00464

GLYA_BACSU/4-380GSPVNF......SGVQYNFVEYGVDK----------ET-----------------Q---YID--YDDVREKAL-------
GLYA_CAMJE/3-379GAKVSS......SGKMYESCFYGVE.----------LD-----------------G---RID--YEKVREIAK-------
GLYC_YEAST/17-416GYATEN.RKISAVSTYFESFPYRVNP----------ET-----------------G---IID--YDTLEKNAI-------
GLYM_YEAST/33-432GYQLKSGTPISFISKYFQSMPYHVDH----------TT-----------------G---LID--YDNLQVLAK-------
GLYC_NEUCR/18-417GYQTPQ.RKISAVSTYFETMPYRVNI----------DT-----------------G---LID--YDTLEKNAQ-------
GLYC_HUMAN/26-425GFMTDK.KKISATSIFFESMPYKVNP----------DT-----------------G---YIN--YDQLEENAR-------
GLYA_BRADU/18-395GSPVNM......SGKWFKAAHYTVRR----------ED-----------------Q---IID--MDAVQKQAE-------
GLYM_HUMAN/49-448GYMSDV.KRISATSIFFESMPYKLNP----------KT-----------------G---LID--YNQLALTAR-------
C9R5U6_AGGAD/8-386GASVSF......SGKIYHAEQYGIT.----------DE-----------------G---LID--YDALRKQAH-------
N0BCL8_9RHIZ/20-397GAPVNQ......SGKWFKAVHYMVKP----------DT-----------------H---LID--MDEVKKLAH-------
GLYA_ECOLI/8-386GSPVNF......SGKLYNIVPYGID.----------AT-----------------G---HID--YADLEKQAK-------
GLYM_SOLTU/57-453GYQTDT.KKISAVSIFFETMPYRLDE----------ST-----------------G---YID--YDQLEKSAT-------

PF00282

DDC_CAEEL/377-746AAEVAM-------VK...MRVL-PTD----------QN-----------------F---ILR--GDTL-HAAIMADIE--
DDC_BOVIN/35-414AGLIGG-------VR...LKAI-PSD----------GK-----------------F---AMR--ASAL-QEALERDKA--
DCHS_HUMAN/36-414AGLISL-------VK...MKFL-PVD----------DN-----------------F---SLR--GEAL-QKAIEEDKQ--
DCHS_DROME/35-413AALIGL-------VR...MRYI-EAD----------DD-----------------L---AMR--GKLL-REAIEDDIK--
DCE1_FELCA/144-518AGAALG-------FGTDNVILI-KCN----------ER-----------------G---KII--PADL-EAKILEAKQ--
DCEA_ECOLI/33-383FARYWD-------VE...LREI-PMR----------P.-----------------G---.QL--FMDP-KRMIEACDE--
DCE_DROME/64-434CAAVCG-------LGTDHCIVV-PSD----------EH-----------------G---KMI--TSEL-ERLILERKA--
DDC_DROME/70-446AGLLGG-------VK...LRSV-QSE----------.N-----------------H---RMR--GAAL-EKAIEQDVA--
B1Q3F1_SOLLC/33-381FARYFE-------VE...LKEV-KLT----------D.-----------------G---.YY--VMSP-EKAVEMVDE--

PF01276

DCOS_ECOLI/109-551ALLQAG-------ATPVYLETA.RNPYG--------FI-----------------G---GID--AHCFEESYL----R-E
YAAO_BACSU/3-363AVDLSG-------AEPVYLAPDVDSAMH--------VP-----------------T---HVP--L.....GTI----K-E
SPEA_BACSU/6-371AIVFSG-------AVPIFIHPEIDNELG--------IS-----------------H---GIT--L.....ESA----K-R
ADIA_ECOLI/140-590GLMLTG-------AKPVYMVPS.RNRYG--------II-----------------G---PIY--PQEMQPETL----Q-K
DCOR_HAEIN/108-550ALIQAG-------ATPIYLETA.RNPFG--------FI-----------------G---GID--SHCFEEDYL----K-S
DCLZ_ECOLI/130-545LLMMND-------VVPVWLKPT.RNALG--------IL-----------------G---GIP--RREFTRDSI----E-E
DCOR_ECOLI/101-543ALIQAG-------ATPVYLEAS.RNPFG--------FI-----------------G---GID--AHCFNEEYL----R-Q
LDCI_ECOLI/130-545LMMMSD-------VTPIYFRPT.RNAYG--------IL-----------------G---GIP--QSEFQHATI----A-K

PF00202

OAT_BACSU/17-398AVSLSS-------E.EEYKRGFGPM...LPGIKLIPYG-----------------D---.....................
Y2045_BACPE/19-432SLGVST-------SKSKYRKFLQPNG.LTYQVPYFKPS-----------------D---PRILDEEGEVVESLACELLEE
ARGD_BACSU/7-377GMAATG-------Q.DKIKTGFGPM...LGGFHYLPYN-----------------D---PSA..................
GSA_MYCLE/40-431LLADAG-------S..GVATLSLPS...SPGVTGAAAA-----------------D---TIVLPYND.............
BIOA_CORGL/18-420AMSVCD-------PENGMHSLWKGT...LPEQIFAPAP-----------------.---....PVRG.....SSPQAISE
BIOA_HAEIN/19-424AMSVCD-------PTTGMHHLFHHS...LPVQYFLPQP-----------------.---..NIPFNE.....SWNDCAIE
ARGD_YEAST/27-418ALSVTW-------N.SKYRTPFGDL...VPHVSFLNLN-----------------D---EMTK.................
GABT_HUMAN/65-496CLATTH-------SKAIHKIDIPSFDWPIAPFPRLKYP-----------------L---EEFVKENQ.....QEEARCLE
GABT_MYCLE/29-443TMALTA-------KSMPYKSGFGPF...APEIYRAPLS-----------------Y---PYRDGLLNKDLATDGKLAGAR
ARGD_ECOLI/20-400TVSVGG-------Q.PKYSDGFGPK...PADIIHVPFN-----------------D---.....................
GABT_ECOLI/14-421TLALTG-------KVNPYSAGMGLM...PGHVYRALYP-----------------C---PLHGISED.....DAIASIHR
GABAT_EMENI/65-495SLSTTR-------SKPIHKLDIPAFDWPQAPFPSLKYP-----------------L---EEHAKENA.....EEEQRCLQ
OAT_PLAF7/20-406CVSAST-------D.KKCKNNFGPF...VPNFLKVPYD-----------------D---.....................
X2GMN7_9BACI/23-446ALSVGG-------V.DLYNEVYQPL...LLDTVRAQGP-----------------D---CFRCPFKH.....HPDSCHAQ

PF05889

SPCS_METJA/57-434ATSFIG-------MRMRLVETV--------------LD-----------------G---DIVKVEVSDIEDAIRKEIN--
SPCS_METKA/53-429AVRLAG-------FGMRVVDTE--------------IE-----------------G---DRIVVDPGDVEEAL.ER..--
SPCS_HUMAN/61-459SMITAG-------FEPVVIENV--------------LE-----------------G---DELRTDLKAVEAKV.QELG--
SPCS_CAEEL/53-450SIYHAG-------FEPIIVEPI--------------RD-----------------R---DSLITDVETVNRII.EQRG--
SPSS1_ARCFU/33-368AAERAG-------LNIALVPKT--------------DY-----------------P---DYAITPENFAQTIEETKKR--

PF02347

GCSP_SCHPO/65-504VLRTRA------------------------------SG-----------------F---GIKIELDNITPELITK.....
GCSP_HUMAN/65-488VVQTRA------------------------------KY-----------------T---GVLTELKLPCEMDFSG.....
GCSPA_BACSU/3-443VLKTYA------------------------------KG-----------------Q---YIDVVEVP.AADGVTDLDAL.
GCSP_ECOLI/16-440VVRTRA------------------------------ET-----------------F---GFEVIVDD..AQKVLD.....
GCSP_SYNY3/35-460VIKTRA------------------------------NP-----------------L---GIEVIVGDHHTFSFS......
Q21962_CAEEL/32-462VIRTRS------------------------------GP-----------------L---GIDIEVSDSIEGYAFD.....
GCSPA_AQUAE/1-439TVKTYL------------------------------RG-----------------Y---EDKIVEVPYTEEGTTDLNNLE
GCSP_YEAST/69-511VLHTRA------------------------------KP-----------------F---NIEIIEVDCSDIKKAVDV...
GCSP_MYCTU/9-438VLATRA------------------------------KP-----------------L---GIEIVTADLRAGLPD......

PF01053

CYSD_EMENI/10-428T--------------KAVYVETI--GNPRYN---VP-DFEVIAKVAHEK..G..-----IPLVVDNTFGAG---------
CYS3_YEAST/10-390T--------------KLVWIETP--TNPTLK---VT-DIQKVADLIKKHAAGQD-----VILVVDNTFLSP---------
MET17_YEAST/6-436T--------------KAVYLETI--GNPKYN---VP-DFEKIVAIAHKH..G..-----IPVVVDNTFGAG---------
O02215_CAEEL/69-449T--------------KMIYFESI--ANPTMA---VP-DILGTIEVAKKY..K..-----ILTCLDATFSSP---------
METC_ECOLI/7-392T--------------KIVFLESP--GSITME---VH-DVPAIVAAVRSV..VPD-----AIIMIDNTWAAG---------
CGL2_CAEEL/8-386T--------------KMVWFESP--SNPLLK---VV-DIAAVVQTAKKA..NPE-----IVVVVDNTFMSP---------
METC_HAEIN/8-393T--------------KVLFLEAP--SSITME---IP-DIPTIVKAARKV..NPN-----IVIMIDNTWSAG---------
METC_ARATH/88-460T--------------KLVWLESP--TNPRQQ---IS-DIRKISEMAHAQ..G..-----ALVLVDNSIMSP---------
CGS1_ARATH/176-561V--------------SLFFTESP--TNPFLR---CV-DIELVSKICHKR..G..-----TLVCIDGTFATP---------
METI_BACSU/6-363T--------------KAVFVETP--TNPLMQ---EA-DIEHIARITKEH..G..-----LLLIVDNTFYTP---------
MCCB_BACSU/4-377T--------------KAIYIETP--TNPLLK---IT-DLTLMADIAKKA..G..-----VLLIVDNTFNTP---------
CGL_HUMAN/19-395T--------------KLVWIETP--TNPTQK---VI-DIEGCAHIVHKH..G.D-----IILVVDNTFMSP---------
METZ_PSEAE/20-401T--------------KLFFVESP--SNPLAE---LV-DIAALAEIAHAK....G-----ALLAVDNCFCTP---------
METC_BACSU/9-382T--------------KVIYMETP--SNPTLG---IT-DIKAVVQLAKEN..G..-----CLTFLDNTFMTP---------
METB_ECOLI/6-381P--------------KLVLVESP--SNPLLR---VV-DIAKICHLAREV..G..-----AVSVVDNTFLSP---------
STR3_YEAST/7-405V--------------DCVLLESP--TNPLCK---VV-DIPRILRFVKCI..SPD-----TTVVVDNTMMSG---------
CYSD_SCHPO/9-427T--------------KAVYVESI--GNPMYN---VP-DFERIAEVAHAA....G-----VPLMVDNTFGGG---------
METB_MYCLE/15-388T--------------RLIWVETP--TNPLLS---IA-DITSIGELGKKH..S..-----VKVLVDNTFASP---------
METB_HAEIN/8-366T--------------KAIFIETP--SNPLME---EC-DVVEIAKLAKKH..N..-----LMLIVDNTFLTP---------
O15565_TRIVA/12-395T--------------RIVYFETP--ANPTLK---VI-DIEDAVKQARKQ..K.D-----ILVIVDNTFASP---------
METB_HELPY/4-377T--------------KALYLETP--SNPLLK---IT-DLAQCASVAKDH..G..-----LLTIVDNTFATP---------
A2FEV4_TRIVA/9-392T--------------KIVYFETP--ANPTLK---II-DMERVCKDAHSQ..E.G-----VLVIADNTFCSP---------
B0SQZ9_LEPBP/8-432T--------------RAFYAETL--GNPKLD---TL-DIAAVSKVAKEV..G..-----VPLVIDNTMPSP---------
B2FLU7_STRMK/14-389T--------------KMVWIETP--TNPMLK---IV-DIAAVAAIAKRH..G..-----LIVVVDNTFASP---------
K7VKJ5_MAIZE/100-483V--------------SLFFTETP--TNPFLR---CI-DIEHVSNMCHSK..G..-----ALLCIDSTFASP---------
METZ_MYCTU/21-405T--------------QAVFFETP--SNPMQS---LV-DIAAVTELAHAA..G..-----AKVVLDNVFATP---------
Q5AXC9_EMENI/40-405T--------------AMVLLETP--TNPLIK---IV-DIPTIAAASHEA..NPN-----CLVIVDNTMMSP---------

PF01041

ERBS_SACEN/13-363T...---------..AAIL---P--VHLYGH---PA.DLDALRAIADRH--G-------LALVEDVAQAVG..-------
P72893_SYNY3/11-365T...---------..KAIV---A--THIYGN---LC.DMEALLAIEQRH--G-------IPIIEDAAEAIG..-------
P73264_SYNY3/14-373SYPK---------PLSGVF---W--VHIGGV---ISPEFPAVVDYCHGK--G-------LYVWEDTAHAHG..-------
O27256_METTH/7-356T...---------..RAII---P--VHLYGQ---PA.DMDPIMDLAADH--D-------ILVIEDAAQAHG..-------
P74668_SYNY3/13-379T...---------..KAIM---P--VHLFGQ---PA.AMAQIKALADAH--G-------LKIIEDCAQSFG..-------
RFBH_SALTY/40-430S...---------..KAIM---I--AHTLGN---AF.NLSEVRRIADKY--N-------LWLIEDCCDALG..-------
PSEC_HELPY/9-366T...---------..KAIV---S--VDYAGK---SV.EVESVQKLCKKH--S-------LSFLSDSSHALG..-------
Y1066_METJA/12-379T...---------..KAII---P--VHYAGH---PC.EMDEILKIARDY--D-------LYVIEDAAHALG..-------
ARNB_ECOLI/10-374T...---------..KAII---P--VHYAGA---PA.DIDAIRAIGERY--G-------IAVIEDAAHAVG..-------
SPSC_BACSU/14-382T...---------..KAVV---P--VHFGGQ---SC.DMDAILAVAQNH--G-------LFVLEDAAHAVY..-------
O26434_METTH/7-359T...---------..RAII---P--VHLYGH---PC.DMGWIGDIADEH--G-------LIIIEDAAEAHG..-------
NTDA_BACSU/78-432T...---------..KFIL---P--VHLYGK---HS.DMQHIRQIANRY--K-------LKVIEDACQGIG..-------
A4F7N3_SACEN/33-380T...---------..GAII---G--VHLWGR---PA.PVEALEKIAAEH--Q-------VKLFFDAAHALG..-------
B1W368_STRGG/23-413T...---------..RAIT---V--VHAYSA---VA.DLDALLDIARRH--G-------LPLIEDCAHAHG..-------
B1W386_STRGG/12-373T...---------..KAIV---V--VHINGI---AA.DMAALTAVAAEA--G-------VPVIEDAAQALG..-------
C6W8U4_ACTMD/18-373T...---------..SAIM---P--VHMAGQ---FA.DMDRLDKLSTST--G-------VPVLQDAAHAHG..-------
F7YJG4_VIBA7/13-366T...---------..KAIL---T--VHLYGQ---VS.GMDQIQKIARKH--N-------LKVIEDCAQAHG..-------
RIFK_AMYMS/15-372T...---------..KVIM---P--VHMAGL---MA.DMDALAKISADT--G-------VPLLQDAAHAHG..-------
Y3402_MYCTU/52-405RD..---------RIAGIL---L--ANVFGV---GNPQISVWEELAAEW--E-------LPIVLDSAAGFG..-------
Q5KV33_GEOKA/14-364T...---------..KAII---P--VHLYGQ---MA.DMEAIAAIAKRH--G-------LVVIEDAAQAIG..-------
Q79H47_BORPE/14-362T...---------..KAII---P--VSLYGQ---CG.DMDEVNAVAARH--G-------LPVIEDAAQSFG..-------
Q7W0M1_BORPE/26-405T...---------..RAIV---P--VHYGGL---SC.DMDSILEIARKH--G-------LKVIEDAAHALP..-------
Q9ABJ3_CAUCR/28-397RDK.---------RVKAVL---P--VHLRGD---VC.DLPALKAMASAS--G-------AVLVEDAPHALGSI-------
Q9KVA5_VIBCH/9-360T...---------..KAVM---A--VHIYGQ---AC.DIQSLRDLCDEH--G-------LYLIEDCAEAIG..-------

PF01212

GLY1_ASHGO/17-304IHGA---------PTKVISLENT--LH...GIIHPLEELVRIKAWCMEN--D.......LRLHCDGARIWNAS.......
GLY1_YEAST/16-303IHGA---------PTRLISLENT--LH...GIVYPLEELVRIKAWCMEN--G.......LKLHCDGARIWNAA.......
Q7QAI2_ANOGA/21-308VHEP---------NTVLVMVENT--HNICGGKVLPLDWLEKLAAICREK--G.......AKVHMDGARVFNAA.......
YF64_CAEEL/68-359CHMP---------ASKLICIENT--HNYTGGKALPIEWMRSVKQLAERR--D.......LKVHMDGARIYNAA.......
Q8Y182_RALSO/3-296IHYP---------KPKVVSLTQS--TEV..GTVYTVDEVRAIAAVARRR--Q.......LRVHMDGARFANAV.......
Q9RUR9_DEIRA/13-296VHQS---------PTGLISLENT--HNKAGGTVIPLAVLRQMRAVADAE--G.......LPLHLDGARVFNAA.......
Q8A7N2_BACTN/47-423.YAD---------RIPFIIVTIT--NNTAGGQPVSMQNLREVRAIANKY--N.......KPVLFDSARFAENAYFIKMRE
THA2_ARATH/11-300LHHP---------VTKLICLENT--QANCGGRCLPIEYIDKVGELAKKH--G.......LKLHIDGARIFNAS.......
Q8RCY7_CALS4/5-290IHFP---------ETSLICLENT--HNRAGGTVTPIEVMKKIYEIAQKH--G.......IPVHLDGARIFNAA.......
Q89ID2_BRADU/23-308.YQP---------PQTVVSVEQT--ANIGGGTIWKKAALDEIVEIARQH--G.......LVTHMDGARLLNAT.......
Q7MUT3_PORGI/47-424...E---------KIPCVVLTIT--NNTAGGQPVSMKNIREVSELTHRY--G.......IRLLIDSARFAENAYFIKTRE
Q9VCK6_DROME/8-304CHEP---------ITSLVVVEQT--HNICGGKVVPLAFLDELAALVRQP--GVGTGNARIALHMDGARVFNAA.......
LTAE_PSEAE/7-299IHYP---------KPRVVTLTQA--TEV..GTVYRPDELKAISATCKEL--G.......LHLHMDGARFSNAC.......
TPL_PASMU/47-424...D---------KIPYICLAVT--VNLAGGQPVSMANMREVKALCSKH--G.......IKVMFDATRCVENAYFIKERE
TNAA1_SYMTH/45-421...E---------NIACIVMTVT--NNSAGGQPVSMANIRETYQIARKY--G.......VLVLFDVARYAENCHFIRMRE
TNAA_CALS4/50-428...E---------NIAFILATVT--CNSAGGQPVSMENIKEVRRIADKY--G.......IRLFFDAARFAENAYFIKQRE
GLY1_SCHPO/30-313IHFS---------PTGLICLENT--IK...GAVVPLDEVARISGLAKAH--K.......IPLHCDGARLWDAA.......
Q9X266_THEMA/3-287IHFP---------RTSLIAIENT--HNRSGGRVVPLENIKEICTIAKEH--G.......INVHIDGARIFNAS.......
TNAA_PHOLL/46-432...D---------NVVAIITTVT--CNSSGGQPISLANMKAVYEIAKQH--D.......IPVVIDSARFCENAWFIKQRE
Q88AI0_PSESM/7-297IHYP---------KPRVVTLTQA--TEV..GGVYQPEELKAISATCKEL--G.......LHLHMDGARFSNAC.......
Q89N26_BRADU/13-294...E---------RPGLIAMETA--HNGAGGAVLPPPHMMRIHALGQSN--G.......IPVHLDGARLFNAS.......
Q7MEV9_VIBVY/2-285SHFA---------RTKLLSLENT--IN...GKVLPLSYLQEARAFVDKH--N.......LKLHLDGARVYNAA.......
TNAA_CLOTE/60-438...D---------KIGVVVMTIT--NNSAGGQPVSIENMKETAEICKKY--N.......IRLCIDAARYAENAYFIKQRE
Q9A3V8_CAUCR/9-299SYRQ---------PAAALSLTTA--TEY..GTVYSEDHLRALIAPVKAK--G.......YGVHLDGARLANAV.......
TNAA_HALSA/42-412...D---------AVPVVVLTIT--NNSMAGQPVSIENTREVAAFADDI--D.......ATFVIDACRFAENAHFVQQRE
Q7NHQ7_GLOVI/7-294LHEP---------PTGLILLENT--HNRGGGTVYPQDVIEQIAAVAGAA--G.......IPMHLDGARLLNAS.......
TNAA_CHRVO/47-428...E---------NVAAIIVTVT--CNSAGGQPVSMANIRAASALARSK--G.......IPVVIDAARFAENAWFIRERD
TNAA_AERPE/52-428....---------DVAFILLVIT--NNTAGGQPVSMDNVKTVRELADAY--G.......LPLVMDICRFAENAYLVKERD
Q896G8_CLOTE/5-288IHFP---------DTSLICVENA--HSC..GRVISLKHMEKIYNISRQH--N.......IPIHLDGARLFNAA.......
Q9HMP3_HALSA/22-307.HRP---------EVGLACVEIA--HGANGGVVAPVDAFAAAVETAHEH--D.......VPVHVDGTRVFSAA.......
Q8EC07_SHEON/3-286IHFA---------RTRLLSLENT--IG...GKVLSQAYLANAQALAFQR--G.......LKIHLDGARVANAA.......
Q7NQ31_CHRVO/5-289IHEP---------RTGLICLENA--HGN..GRVLPLSAMADTAALAREH--G.......VPVHLDGARVFNAA.......
D5AL49_RHOCB/46-420.HHA---------EVPLVMITIT--NNAGGGQPVSLANIRAVADLAHRH--G.......KPFVIDGCRFAENAWFIKTRE
D5AV45_RHOCB/2-292VHNV---------QRGMVSLTNA--TEA..GTIYTPAEVAALTAVAREY--K.......LPVHMDGARFANAL.......
G3XD13_PSEAE/5-283.HFA---------RTRLLALENT--MQ...GKVLPLDYLAAARAFTRAR--G.......LALHLDGARLYNAA.......
I0DW76_PROSM/47-432...E---------NVVAIVSTVT--CNSAGGQPVSMANLKEVYEIAKQH--N.......IFVVMDSARFCENAYFIKERD
LTAE_ECOLI/3-280.HFA---------RTKLLSLENT--HN...GKVLPREYLKEAWEFTRER--N.......LALHVDGARIFNAV.......
TPL_SYMTH/47-422...D---------KIPYINVALT--VNMAGGQPVSMANLREVRKVCDRH--G.......IRMWSDATRAVENAYFIKERE
Q59NC4_CANAL/14-300IHAA---------PTKVISLENT--LH...GIIIPIEEIRKISEFCREN--D.......IRLHLDGARLWNAS.......
Q7VW60_BORPE/3-283PHFA---------RTRLLALENT--FQ...GRVMPAGYVAQATGWAREH--G.......LSTHLDGARVFNAA.......
TPL_FUSNN/49-425...E---------NIAYVCLAVT--VNLAGGQPVSMKNMKAVRELTKKH--G.......IKVFYDATRCVENAYFIKEQE
Q8RHQ6_FUSNN/51-505...E---------NIPMIYTTVT--NNTICGQAVSMKSIRETAKIAHKY--E.......IPFMLDAARWAENCYFIKMNE
THA1_ARATH/7-295TFYP---------STRLICLENT--HANSGGRCLSVEYTEKVGEIAKRH--G.......VKLHIDGARLFNAS.......
Q98A67_RHILO/12-297IHSV---------QPSSVSITQA--TEM..GSVYALDEIKAISHICRSA--N.......LPLHMDGARFANAL.......

PF06838

YNBB_BACSU/11-416T--------------KVIGIQRS--KGYANRPSFLISEIKEMIRFVKEINEN-------LIVFVDNCYGEF---------
Q8EQP5_OCEIH/1-405T--------------KVIAIQRS--KGYDERPSYTVDQISEMIQFVKGIDPS-------VIVFVDNCYGEF---------
Q8Y7I1_LISMO/4-408T--------------KMIGIQRS--RGYADRPSFTIDKIKEMIIFVKNINPE-------VIVFVDNCYGEF---------
Q97I22_CLOAB/19-425I--------------KLIHIQRS--TGYGWRKSLRIAEIAEIIKSIREVNEN-------VIVFVDNCYGEF---------
Q8XL83_CLOPE/19-425I--------------KLIHMQRS--TGYGWRNAFQVKELGEAIKAIKELRED-------LIVFVDNCYGEF---------
Q8DHD9_THEEB/26-430T--------------RMVLIQRS--CGYTWRPSLSLEDIGKMIQLIKSQNPD-------VVCFVDNCYGEF---------
Q54763_SYNE7/3-407T--------------RLALIQRS--CGYSWRRSLSIDDIARIVALVKSQNPD-------TVCFVDNCYGEF---------
Q8RA65_CALS4/17-421T--------------KMIMIQRS--KGYDYRKSFTIAEIGEVIKEIRKVKED-------IIVFVDNCYGEF---------
Q9KAC8_BACHD/11-416T--------------KVIGIQRS--KGYADRPSFSINEIEQMVQFVKGINPN-------VIVFVDNCYGEF---------
Q8YWL0_NOSS1/20-424T--------------RLVLIQRS--CGYSWRPSLSIADIEKVVNLVKQQNPH-------TVCFVDNCYGEF---------
Q55407_SYNY3/3-407T--------------RLVLIQRS--CGYSWRPSLAIADIARIIEIVKAQNPR-------TLCFVDNCYGEF---------
Q895H5_CLOTE/19-425I--------------KIVHIQRS--TGYSWRKALLVSEIKDIVDLVKSIRKN-------IICFVDNCYGEF---------
Q5HPN4_STAEQ/5-406T--------------KVVAIQRS--KGYDQRPSITINEIEQAITSIKEVYPN-------IIIFVDNCYGEF---------

PF03841

SELA_PSEAE/79-451S--------------GLLMRVHT--SNYSVQGFTASVPTAQLAAIAHGH--G-------LPLLED--LGSGTLVDLTRWG
SELA_CAMJE/71-423T--------------ALILKTHK--SNFALMGFHSEVNIKDLHELAKEK--E-------LLSYYD--LGSGWCENLNEKL
SELA_PASMU/81-448T--------------AFLMKVHS--SNYQICGFTKSVTEAELVTLAREF--N-------LPVMTD--LGSGALVDLAQYG
SELA_HAEIN/82-449T--------------AFLMKVHS--SNYQICGFTSSVSEEELTELGQEM--N-------VPVVTD--LGSGALVDLSQYG
SELA_RHIME/80-448T--------------ALILKVHT--SNYRIEGFTAEVPGAELAAIAHER--G-------VVLLND--LGSGSLVDLSRYG
SELA_ECOLI/83-452T--------------ALLMKVHT--SNYSIQGFTKAIDEAELVALGKEL--D-------VPVVTD--LGSGSLVDLSQYG
SELA_AQUAE/72-435T--------------ALLMKVHK--SNFYMEGFVEEVKLEDLVKLGHKY--G-------IPTYYD--AGSGLLINLKEFG
C7LWD8_DESBD/82-448T--------------AMLMKVHT--SNYRIIGFHKEVELPELVALGREK--G-------LSTFED--LGSGNLFDFSPYG
SELA_MOOTA/80-445T--------------ALLLKVHP--SNYRIQGFTREVTTAELVELGRRV--G-------VPVMED--LGSGFLIDLEAYG
W8TF72_EUBAC/86-450T--------------GALLKVHT--SNFRVVGFTNTPELEELREIGDKY--D-------IPVIED--LGSGVFIDLSKYG

PF00266

SERC_ECOLI/4-350-------------NAAYMHYCPN--ETIDGIAIDETPDFG......A.----------DVVVAADFSSTILSRPIDVSRY
CSD_PSEPK/23-389-------------RTRVLAISQL--SNVLGT.WQPLPALLAHARA.Q.----------GALTVVDGAQGVVHGRQDMQQL
CSD_CHLTR/19-388-------------GVQLVSLAHV--SNVSGA.VLPLPEIAHLVHR.Y.----------EALFAVDGAQGVGKGPLNLSEW
CSD_XYLFA/36-404-------------QVKLLAITHV--SNVLGT.VNPIHDICRQARQ.R.----------GITTVVDGSQAAPHRHIDIPAI
NIFS_NOSS1/4-365-------------NTALVTIMYA--NNETGT.VFPIEEIGKRVKE.R.----------GAIFHVDAVQAVGKIPLNMKTS
CSD_STRCO/31-406-------------KTKVVSFVLV--SNILGT.QNPVEAIVRRAQE.V.----------GALVCIDASQAAPHMPLDVQAL
CSD_TREPA/20-390-------------CTKIVSFSAV--VNATGA.VNPAQELTALAHQ.V.----------GAVVVIDGAQAMVHGVPNVADL
CSD_UREPA/18-385-------------KTKVVSFASG--GNLIGN.VLDENLIIKNIKKIKP----------DVLVCVDATQSIQHRMFDVKKC
CSD_METTH/20-389-------------TTRLVTVTHI--SNALGT.VQDVKEIGRIAHD.V.----------GALYLVDAAQSIGHMEVDVRAI
SUFS_DICD3/30-399-------------RTRLVAVTQV--SNVLGT.VNPLAEIIRQAHA.C.----------GAKVLVDGAQAVMHQAVDVQAL
CSD_VIBCH/25-393-------------RCKIVALAHI--TNVTGT.RQPIEAVIQAAHQQG.----------.AIVVIDGAQGIVHETVDVRAL
SUFS_ECOLI/25-394-------------KTRLLAITHV--SNVLGT.ENPLAEMITLAHQ.H.----------GAKVLVDGAQAVMHHPVDVQAL
CSD_PSEAE/23-389-------------RTRLLAISQL--SNVLGT.WQPVVELIQLARE.R.----------GAWTLVDGAQGSVHGRHDLPGL
CSD_AERPE/21-399-------------DTRAVAVGHV--SNVTGV.VAPVEDIVKAAKK.V.----------GALVVLDSAQGVPHLPVDFRRM
CSD_PASMU/44-409-------------NTVLVALNMV--SNVTGT.EQPVANLIKLIRQHS.----------HALVLVDAAQAISHLPIDLQRL
SERC_HAEIN/4-348-------------QYDYVHYCPN--ETISGVEIFDVPNVG........----------NAVLVADMSSNILSRQIDISKF
SUFS_BACSU/23-391-------------NTKIVAVSHV--SNVLGT.VNPIKEMAKIAHD.N.----------GAVIVVDGAQSTPHMKIDVQDL
NFS1_YEAST/100-462-------------DTCLVSVMAV--NNEIGV.IQPIKEIGAICRK.N.----------KIYFHTDAAQAYGKIHIDVNEM
SPYA_CALJA/45-398-------------KPVLLFLTHG--ESSSGV.LQPLDGFGELCHR.Y.----------KCLLLVDSVASLGGAPLYMDQQ
SUFS_WIGBR/25-395-------------NTRIFCITHV--SNILGT.CNLIEKIIKKIKNNY.----------DIKVLIDGAQAIMHMKIDVQKI
SUFS_YERPE/25-394-------------TTRLLAVTQV--SNVLGT.VNPIKDIVAQAKA.A.----------GLVVLVDGAQAVMHQPVDVQAL
CSD_THEMA/23-400-------------NPKVVAITGL--SNVTGQ.RIPVEELRNVFPN...----------.SIILLDGAQLIPHEPVKPKEI
SERC_RABIT/7-357-------------DASYVYYCAN--ETVHGVEFDFVPDVK........----------GAILVCDMSSNFLSRPVDVSKF
CSD_MYCPN/25-391-------------KTKVVAITAT--SNLFGN.SIDFAQIADYLKQVNP----------KAFVAVDAVQTVQHKQIDIAKT
CSD_MYCPA/301-670-------------RTKLVAASHV--SNALGT.VMPVDKIVELGHR.Y.----------GARVLIDGAQSIQHIPIDVAEL
CSD_HAEIN/60-425-------------KTKLVALNFV--SNVTGT.EQPIKRLIQLIRKHS.----------NALVLVDAAQAISHIKIDLQDL
CSD_BORBU/33-410-------------KTKLISISGI--NNTLGT.INDLESIGKIAKK.Y.----------NICLFVDAAQMAPHIKIDVKKI
NIFS_BACSU/2-366-------------ETGLVSIQHA--NSETGI.IQPIQHLSSYLHN.K.----------GILLHCDAVQTFGKIPINTKNL
CSDA_ECOLI/21-388-------------RSRILALGQM--SNVTGG.CPDLARAITFAHS.A.----------GMVVMVDGAQGAVHFPADVQQL
CSD_BACHD/23-391-------------KTKIVAIMHV--SNVLGT.INPVKEIAEIAHR.H.----------GAIMLVDGAQSAPHMKIDVQEL
D5ARX2_RHOCB/6-368-------------RVAVASIMWA--NNETGT.IFPVPQLAAEAHA.A.----------GALFHTDAVQAVGKLPMSLADT
K9ZIC0_ANACC/6-351-------------EIKAVIITHS--ETSTGV.INDLVAINSHVKE.HG----------QALIIVDAVTSLGAYNVPVDAL
CSD_MYCTU/32-403-------------RVKVVAFTHH--SNVTGV.LTPVSELVSRAHQ.S.----------GALTVLDACQSVPHQPVDLHEL
Q2FZY5_STAA8/32-401-------------KTKIVAIAHI--SNVLGT.INDVKTIAEIAHQ.H.----------GAIISVDGAQAAPHMKLDMQEM
Q8U4C4_PYRFU/18-386-------------GAKLVAVQHV--SNALGV.IHEVEELGRMAKE.E.----------GAIFVVDAAQSVGHMEVDVKKL

PF00155

AAT_ECOLI/26-392AQAGDV..........VLFHGCC--HNPTGI-DPTLEQWQTLAQLSVE--------K.GWLPLFDFAYQGFARGLE.EDA
HIS8_BACSU/29-356.............QTQVVWICSP--NNPTGT-YTSEGELLAFLERVPS--------..RVLVVLDEAYYEYVTA.E..DY
HEM1_EMENI/192-555LPLHVP.........KIIAFESV--YSMCGS-IAPIEAICDL...ADK--------Y.GAITFLDEVHAVGMYGPH..GA
AATC_BOVIN/31-405APEFSI..........FVLHACA--HNPTGT-DPTPEQWKQIASVMKR--------R.FLFPFFDSAYQGFASGSLEKDA
AAT_SULSO/35-391.............RTKMIVFNNP--HNPTGT-LFSPNDVKKIVDISRD--------N.KIILLSDEIYDNFVYEGK..M.
TYRB_ECOLI/26-393LPARSI..........VLLHPCC--HNPTGA-DLTNDQWDAVIEILKA--------R.ELIPFLDIAYQGFGAG.MEEDA
AAT_HAEIN/26-392ASEGDV..........VLLHGCC--HNPTGI-DPTPEQWQELAALSAK--------N.GWLPLFDFAYQGLANG.LDEDA
HIS8_ACEPA/24-347.............PCSGVVVANP--NAPTGI-ALDLADVRKLLELQP.--------..NRVVLIDEAYVDFGAESA....
AAT_BACY2/32-387.............KTKAVIINSP--SNPTGM-VYTREELEDIAKIALE--------N.NILIVSDEIYEKLLYNGA..EH
1A12_ARATH/48-432AQESNK.......KVKGLILTNP--SNPLGT-MLDKDTLTNLVRFVTR--------K.NIHLVVDEIYAATVFAGG..DF
BIOF_MYCLE/36-373CHEERA..........VVVTESV--FSADGV-LAPVSELHDV...CRR--------H.GALLLVDEAHGLGVRG......
HIS8_HALVD/30-351.............GERMVYLTTP--HNPTGS-VLPREELVELAESVEE--------..HTLLVVDEAYGEFAEEPS..A.
1A11_CUCMA/50-431AQEANI.......KVKGVIITNP--SNPLGT-TYDRDTLKTLVTFVNQ--------H.DIHLICDEIYSATVFKAP..TF
BNA3_YEAST/54-437.............KTKAVIINTP--HNPIGK-VFTREELTTLGNICVK--------H.NVVIISDEVYEHLYFTD...SF
LCB2_YEAST/155-515QIVLGQPKTNRPWKKILICAEGL--FSMEGT-LCNLPKLVEL...KKK--------Y.KCYLFIDEAHSIGAMG......
PHHC_PSEAE/28-393IPQGDV..........VLLHACC--HNPTGF-DLSHDDWRRVLDVVRR--------R.ELLPLIDFAYQGFGDG.LEEDA
HEM0_CHICK/121-466SPPGVP.........KIVAFESL--HSMDGS-IAPLEELCDV...AHA--------Y.GALTFVDEVHAVGLYG......
BIOF_ECOLI/39-380PCPGQQ..........MVVTEGV--FSMDGD-SAPLAEIQQV...TQQ--------H.NGWLMVDDAHGTGVIG......
1A11_ORYSI/50-438AQKRRL.......RVKGVLITNP--SNPLGT-ASPRADLETIVDFVAA--------K.GIHLISDEIYAGTAFAEPPAGF
AATB_RHIML/41-402.............RTRWVLLNSP--SNPSGA-AYSAADYRPLLDVLLK--------HPHVWLLVDDMYEHIVYDAF..RF
HIS8_SCHPO/26-373DS...........AIKVFFACSP--GNPTAK-ALKLEDIKKILEHPTW--------..NGIVVVDEAYIDFSAPDM..SA
ATTY_TRYCR/33-406.............KTKLLIVTNP--SNPCGS-NFSRKHVEDIVRLAEE--------L.RLPLFSDEIYAGMVFKGK..DP
1A1C_DIACA/49-429ALKKNI.......KVKGIIVTNP--SNPLGT-VLDKDTLKMLLTFVNA--------K.NIHLVCDEIYATTVFNSP..SF
1A14_SOLLC/53-434GQQANV.......KIKGLILTNP--CNPLGT-ILDRDTLKKISTFTNE--------H.NIHLVCDEIYAATVFNSP..KF
ATTY_RHIME/26-386AASGDA..........VLLHASC--HNPTGG-VLSEAQWMEIAALVAE--------R.GLLPLVDLAYQGFGRG.LDQDV
AATA_RHIME/31-392.............KTKWFVFNSP--SNPSGA-AYSHEELKALTDVLMK--------HPHVWVLTDDMYEHLTYGDF..RF
AATM_YEAST/44-441FAYNNQQEN.NKNPPCIILHACC--HNPTGL-DPTKEQWEKIIDTIYE--------L.KMVPIVDMAYQGLESGNLLKDA
E7KDT6_YEASA/27-375DS...........LIKLMFVTSP--GNPTGA-KIKTSLIEKVLQNWD.--------..NGLVVVDEAYVDFCGGST....
HEM1_RHIRD/46-391ADPNAP.........KLIAFESV--YSMDGD-IAPIKEICDL...ADR--------Y.GAMTYLDEVHAVGMYG......
AAT4_ARATH/29-395APPGAI..........VVLQACA--HNPTGV-DPTFEQWEKIRRLVRS--------K.SLLPFFDSAYQGFASGSLDADA
AAT1_ARATH/57-423APEGSF..........FLLHACA--HNPTGV-DPTEEQWREISQLFKA--------K.KHFAFFDMAYQGFASGDPARDA
AAT1_MEDSA/42-410APSGSV..........VLLHACA--HNPTGV-DPTLEQWEQIRQLIRS--------K.SLLPFFDSAYQGFASGSLDADA
COBC_PSEDE/23-328.............EHGLVIVVNP--NNPTGR-ALAPAELLAIAARQKA--------S.GGLLLVDEAFGDLEP.......
HIS8_LACLA/22-345.............ENGGIVIANP--DAPTAL-ALNLKDIEEILKKNQ.--------..NSIVLINEAYIDFGGETC....
HIS8_ECOLI/29-351.............GVKVVYVCSP--NNPTGQ-LINPQDFRTLLELTRG--------..KAIVVADEAYIEFCPQAS..L.
AAT2_BACSU/32-384.............KAKLMFLNYP--NNPTGA-VADAAFYAKAAAFAKE--------H.NIHLIHDFAYGAFEFDQK..P.
1A12_CUCMA/40-424AQTRNL.......RVKGVLVTNP--SNPLGT-TMNRDELNLVFDFITS--------K.GIHLISDEIYSGTVFGSP..GF
BIOF_LYSSH/37-379SHGDGL.........KFIVTDGV--FSMDGD-IAPLPKIVEL...AKE--------Y.KAYIMIDDAHATGVLG......
BIOF_HAEIN/35-380NVGKFD........RTFIVTESV--FSMDGD-VADLKQLVQL...KKQ--------FPNTYLYVDEAHAVGVYG......
MALY_ECOLI/28-382P............ECKIMLLCSP--QNPTGK-VWTCDELEIMADLCER--------H.GVRVISDEIHMDMVWGEQPHIP
1A1C_SOYBN/48-431AKEDNI.......RVKGLLITNP--SNPLGT-VMDRNTLRTVMSFINE--------K.RIHLVSDEIYSATVFSHP..SF
ATTY_HUMAN/71-434.............KTACLIVNNP--SNPCGS-VFSKRHLQKILAVAAR--------Q.CVPILADEIYGDMVFSDC..KY
KBL_ECOLI/42-387AREAGA.......RHVLIATDGV--FSMDGV-IANLKGVCDL...ADK--------Y.DALVMVDDSHAVGFVG......
HIS8_STRCO/26-360H............RPDVVFITTP--NNPTGT-AVPAETVLALYEAAQA--------AKPSMVVVDEAYIEFSHGAS..L.
AAT5_ARATH/77-445APEGSF..........ILLHGCA--HNPTGI-DPTPEQWVKIADVIQE--------K.NHIPFFDVAYQGFASGSLDEDA
E7KGL9_YEASA/145-545LTEQEKLEKLPAIPRKFIVTEGI--FHNSGD-LAPLPELTKL...KNK--------Y.KFRLFVDETFSIGVLG......
1A12_SOLLC/48-430AQKSNI.......KVKGLILTNP--SNPLGT-TLDKDTLKSVLSFTNQ--------H.NIHLVCDEIYAATVFDTP..QF
AATM_BOVIN/57-425IPAQSV..........ILLHACA--HNPTGV-DPRPEQWKEMATVVKK--------N.NLFAFFDMAYQGFASGDGNKDA

PF04864

TAR2_ARATH/79-436-------------GPYIELVTSP--NNPDGF-------LRESVV...N--------STEGILIHDLAYYWPQYTPITSPA
TAR4_ARATH/91-449-------------TQVIEVVTSP--NNPDGK-------LKRAVL...D--------GPNVKTLHDYAYYWPHFSPITHPV
TAR1_ARATH/26-381-------------GPYIELVTSP--NNPDGI-------MREPVV..NR--------REGGKVIHDLAYYWPHYTPITRRQ
Q76BK3_ALLCE/104-465-------------ENFIELVTSP--NNPEGR-------LRHSII...K--------GSSA..IYDQVYYWPQYTAIKYAS
TAA1_ARATH/25-384-------------GPYIELVTSP--NNPDGT-------IRETVVNRPD--------DDEAKVIHDFAYYWPHYTPITRRQ
O04927_ALLTU/87-452-------------NQFIELVTSP--NNPEGN-------LRKAMI...V--------GSTA..IYDMVYYWPHFTPITYKA
Q942G4_ORYSJ/111-470-------------RGFIEFVTSP--NNPDST-------LHEPIL...A--------GSSA..IVDHAYYWPHLTHIPAPA
Q9M7L9_ALLCE/102-462-------------QDFIELVTSP--NNPDGL-------LRKSII...P--------GSLA..VYDHATYWPHYAPIKYAS
Q8LL95_AEGTA/68-427-------------GENIELVVSP--NNPDGA-------IREAVLS.SD--------SSKGKAIHDLVYYWPQYTPITSPA
Q43366_ALLCE/93-456-------------EQFIEMVTSP--NNPEGL-------LRHEVI...K--------GCKS..IYDMVYYWPHYTPIKYKA

PF12897

Q9RU17_DEIRA/28-452-------------VKGILFVPTY--SNPGGE-TISAEKARRLVGLKAA--------APDFTIFADDAYRAHHLFGEGERD
D5UN97_TSUPD/7-427-------------IKGIWAVPKF--SNPTGS-VFSEEVTRELASMPTA--------APDFRIFWDNAYAVHALVGDAPSD
Q1IZU0_DEIGD/1-422-------------VKGILFVPTY--SNPGGE-TISLEKARRLAGLQAA--------APDFTIFADDAYRVHHL.VEEDRA
A9GH35_SORC5/7-425-------------IKGMWSVPKY--SNPTGT-TYSPEVVRRLAAMKTA--------APDFRLFWDNAYAVHDLYAEGDKL

PF00464

GLYA_BACSU/4-380-------------AHKPKLIVAG--ASAYPR-TIDFKKFREIADEV------------GAYFMVDMAHIAGLVAAGLHPN
GLYA_CAMJE/3-379-------------KEKPKLIVCG--ASAYAR-VIDFAKFREIADEI------------GAYLFADIAHIAGLVVAGEHPS
GLYC_YEAST/17-416-------------LYRPKVLVAG--TSAYCR-LIDYKRMREIADKC------------GAYLMVDMAHISGLIAAGVIPS
GLYM_YEAST/33-432-------------AFRPKVIVAG--TSAYSR-LIDYARFKEISQGC------------GAYLMSDMAHISGLVAANVVPS
GLYC_NEUCR/18-417-------------LFRPKVLVAG--TSAYCR-LIDYERMRKIADSV------------GAYLVVDMAHISGLIASEVIPS
GLYC_HUMAN/26-425-------------LFHPKLIIAG--TSCYSR-NLEYARLRKIADEN------------GAYLMADMAHISGLVAAGVVPS
GLYA_BRADU/18-395-------------EIKPKLIVAG--GSAYSR-AWDFKRFREIADSV------------GAYLLVDMAHFAGLVAGGVHAS
GLYM_HUMAN/49-448-------------LFRPRLIIAG--TSAYAR-LIDYARMREVCDEV------------KAHLLADMAHISGLVAAKVIPS
C9R5U6_AGGAD/8-386-------------DVKPKMIVGG--FSAYSQ-VVDWKKMREIADEV------------GAYLFVDMAHVAGLIAAGIYPN
N0BCL8_9RHIZ/20-397-------------EHKPRIIIAG--GSAYPR-KIDFAAFRAIADEV------------GATFLVDMAHFAGLVAAGLIPS
GLYA_ECOLI/8-386-------------EHKPKMIIGG--FSAYSG-VVDWAKMREIADSI------------GAYLFVDMAHVAGLVAAGVYPN
GLYM_SOLTU/57-453-------------LFRPKLIVAG--ASAYAR-LYDYDRIRKVCNKQ------------KAILLADMAHISGLVAAGVIPS

PF00282

DDC_CAEEL/377-746-------------RGLIPFFVGA--NFGTSG-PCSFDHLHELGPVCRE.--.....H-GTWLHVDAAYAGTALIC-----
DDC_BOVIN/35-414-------------AGLIPFFVVA--TLGTTS-CCSFDNLLEVGPICHE.--.....E-GLWLHVDAAYAGSAFIC-----
DCHS_HUMAN/36-414-------------RGLVPVFVCA--TLGTTG-VCAFDCLSELGPICAR.--.....E-GLWLHIDAAYAGTAFLC-----
DCHS_DROME/35-413-------------QGLVPFWVCA--TLGTTG-SCSFDNLEEIGIVCAE.--.....H-HLWLHVDAAYAGSAFIC-----
DCE1_FELCA/144-518-------------KGYVPLYVNA--TAGTTV-YGAFDPIQEIADICEK.--.....Y-NLWLHVDAAWGGGLLMS-----
DCEA_ECOLI/33-383-------------N..TI.GVVP--TFGVTY-TGNYEFPQPLHDALDKF--QADTGI-DIDMHIDAASGG..FLA-----
DCE_DROME/64-434-------------KGDIPFFVNA--TAGTTV-LGAFDDINTIADICQK.--.....Y-NCWMHIDAAWGGGLLMS-----
DDC_DROME/70-446-------------EGLIPFYAVV--TLGTTN-SCAFDYLDECGPVGNK.--.....H-NLWIHVDAAYAGSAFIC-----
B1Q3F1_SOLLC/33-381-------------N..TI.CVAA--ILGSTL-NGEFEDVKKLNDLLIEK--NKETGW-DTPIHVDAASGG..FIA-----

PF01276

DCOS_ECOLI/109-551LIAEVAPQRAKEARPFRLAVIQL--GTYDGT-IYNARQVVDKIGHL------------CDYILFDSAWVGYEQFI.PMMA
YAAO_BACSU/3-363ALEAYPDAKG........LVLTN--PTYYGH-SADLTEIITEAHHY------------GIPVLVDEAHGAHFILGEPFPV
SPEA_BACSU/6-371ALTEHPDAKG........LLVIN--PTYFGV-AADLKSIVELAHSF------------DVPVLVDEAHGVHIHFHDELPL
ADIA_ECOLI/140-590KISESPLTKDKAGQKPSYCVVTN--CTYDGV-CYNAKEAQDLLEKT------------SDRLHFDEAWYGYARFN.PIYA
DCOR_HAEIN/108-550LIKEVAPEKLNQKRPFRLAVIQL--GTYDGT-IYNARQVVDKIGHL------------CDYILFDSAWVGYEQFI.PMMK
DCLZ_ECOLI/130-545KVAATTQAQW.....PVHAVITN--STYDGL-LYNTDWIKQTLDVP------------S..IHFDSAWVPYTHFH.PIYQ
DCOR_ECOLI/101-543QIRDVAPEKADLPRPYRLAIIQL--GTYDGT-VYNARQVIDTVGHL------------CDYILFDSAWVGYEQFI.PMMA
LDCI_ECOLI/130-545RVKETPNATW.....PVHAVITN--STYDGL-LYNTDFIKKTLDVK------------S..IHFDSAWVPYTNFS.PIYE

PF00202

OAT_BACSU/17-398.VEALR...QAITPNTAAFLFEP.IQGEAGIVIPPEGFLQEAAAICKEE---------NVLFIADEIQTGL..GRT----
Y2045_BACPE/19-432EFTNLFK.YHVSSEEVAAVILEP.VLGEGGYIIPPASWLAKVREICNRH---------DILLIFDEVQTGF..GRT----
ARGD_BACSU/7-377.FKALG.....EEGDIAAVMLET.VQGEGGVNPASAEFLSAVQSFCKEK---------QALLIIDEIQTGI..GRT----
GSA_MYCLE/40-431.IEAVRQTFARLGDQIAAVITEA.SPGNMGVVPPAPGYNAALRAITAEH---------GALLIIDEVMTGFRVSRS----
BIOA_CORGL/18-420YLRSME...LLIDETVSAIIIEPIVQGAGGMRFHDVALIEGVATLCKKH---------DRFLIVDEIATGF..GRT----
BIOA_HAEIN/19-424PLADLL...KKKGNEIAALILEPVVQGAGGMYFYSPTYLVKAQALCKQY---------GILLIFDEIATGF..GRT----
ARGD_YEAST/27-418.LQSYI...ETKKDEIAGLIVEP.IQGEGGVFPVEVEKLTGLKKICQDN---------DVIVIHDEIQCGL..GRS----
GABT_HUMAN/65-496EVEDLIVKYRKKKKTVAGIIVEP.IQSEGGDNHASDDFFRKLRDIARKH---------GCAFLVDEVQTGG..GCT----
GABT_MYCLE/29-443AINVIE..KQVGADDLAAVIIEP.IQGEGGFIVPAEGFLATLLDWCRKN---------NVMFIADEVQTGF..ART----
ARGD_ECOLI/20-400.LHAVK...AVMDDHTCAVVVEP.IQGEGGVTAATPEFLQGLRELCDQH---------QALLVFDEVQCGM..GRT----
GABT_ECOLI/14-421IFKN.....DAAPEDIAAIVIEP.VQGEGGFYASSPAFMQRLRALCDEH---------GIMLIADEVQSGA..GRT----
GABAT_EMENI/65-495EAERLI...KEWHNPVAAIIVEP.IQSEGGDNHASPAFFRGLREITKRN---------NVLFIVDEVQTGV..GAT----
OAT_PLAF7/20-406.LEALE..KELQDPNVCAFIVEP.VQGEAGVIVPSDSYFPGVASLCKKY---------NVLFVADEVQTGL..GRT----
X2GMN7_9BACI/23-446CISFVEDQLRMHHKEITAVIIEPLIQAAAGMKMYPAIYLRRLRELCTQY---------DVHLIADEIAVGF..GRT----

PF05889

SPCS_METJA/57-434-------------ENNNPVVL----STLTFFPPRKSDDIKEIAKICQDY---------DIPHIINGAYAIQNFY------
SPCS_METKA/53-429-------------SESPAAVL----STLTFFPPRSSDPLPEIAELCEEY---------GVPHVVNAAYGIQHEQ------
SPCS_HUMAN/61-459-------------PDCILCIH----STTSCFAPRVPDRLEELAVICANY---------DIPHIVNNAYGVQSSK------
SPCS_CAEEL/53-450-------------EE.ILCVM----TTTSCFAPRSPDNVEAISAICAAH---------DVPHLVNNAYGLQSEE------
SPSS1_ARCFU/33-368-------------GEVVLALI----TYPDGNYGNLPD.VKKIAKVCSEY---------DVPLLVNGAYAI....------

PF02347

GCSP_SCHPO/65-504...SA--------KHVFGIFVQY--PAADGS-IFD...YGHLAATARSF---------NMHVVAATDLLALTILKSPGEW
GCSP_HUMAN/65-488.....--------KDVSGVLFQY--PDTEGK-VED...FTELVERAHQS---------GSLACCATDLLALCILRPPGEF
GCSPA_BACSU/3-443RQTVC--------ENTAAVIVQY--PNFFGR-IEP...LKDIEPIAHQG---------KSMFIVSANPLALGLLTPPGKF
GCSP_ECOLI/16-440....H--------QDVFGVLLQQ--VGTTGE-IHD...YTALISELKSR---------KIVVSVAADIMALVLLTAPGKQ
GCSP_SYNY3/35-460.....--------TSIFGALLQY--PATDGA-VYD...YRSFIDKAHQH---------QALVTLAADPLSLTLLTPPGEL
Q21962_CAEEL/32-462.....--------DKVAAVVVQY--PNTEGR-IHQ...FDELIESAHKN---------KSLVIMVCDLLSLTILRSPGDL
GCSPA_AQUAE/1-439EVLKE--------SEVHALAVQY--PNFFGF-VEP...LKEIGELCKKY---------EVPFVVFVDPIALSILKPPAEF
GCSP_YEAST/69-511..LKN--------PDVSGCLVQY--PATDGS-ILPPDSMKQLSDALHSH---------KSLLSVASDLMALTLLKPPAHY
GCSP_MYCTU/9-438.....--------GEFFGVIAQL--PGASGR-ITD...WSALVQQAHDR---------GALVAVGADLLALTLIAPPGEI

PF01053

CYSD_EMENI/10-428-----GY---------------FV--------------------RPIEHG.----.ADIVVHSATK-----WIGGH--GT
CYS3_YEAST/10-390-----.Y---------------IS--------------------NPLNFG.----.ADIVVHSATK-----YINGH--SD
MET17_YEAST/6-436-----GY---------------FC--------------------QPIKYG.----.ADIVTHSATK-----WIGGH--GT
O02215_CAEEL/69-449-----.Y---------------NI--------------------QPLKLG.----.ADISLHSCSK-----YIGGH--TD
METC_ECOLI/7-392-----.V---------------LF--------------------KALDFG.----.IDVSIQAATK-----YLVGH--SD
CGL2_CAEEL/8-386-----.Y---------------FQ--------------------RPISLG.----.ADVVVHSITK-----YINGH--SD
METC_HAEIN/8-393-----.V---------------LF--------------------KALEHD.----.IDISIQAGTK-----YLVGH--SD
METC_ARATH/88-460-----.V---------------LS--------------------RPLELG.----.ADIVMHSATK-----FIAGH--SD
CGS1_ARATH/176-561-----.L---------------NQ--------------------KALALG.----.ADLVVHSATK-----YIGGH--ND
METI_BACSU/6-363-----.V---------------LQ--------------------RPLELG.----.ADIVIHSATK-----YLGGH--ND
MCCB_BACSU/4-377-----.Y---------------FQ--------------------QPLTLG.----.ADIVLHSATK-----YLGGH--SD
CGL_HUMAN/19-395-----.Y---------------FQ--------------------RPLALG.----.ADISMYSATK-----YMNGH--SD
METZ_PSEAE/20-401-----.A---------------LQ--------------------QPLKLG.----.ADVVIHSATK-----YIDGQ--GR
METC_BACSU/9-382-----.A---------------LQ--------------------RPLDLG.----.VDIVLHSATK-----FLSGH--SD
METB_ECOLI/6-381-----.A---------------LQ--------------------NPLALG.----.ADLVLHSCTK-----YLNGH--SD
STR3_YEAST/7-405-----.L---------------NC--------------------NPLQLNP----GCDVVYESATK-----YLNGH--HD
CYSD_SCHPO/9-427-----GY---------------LV--------------------RPIDHG.----.ADIVTHSATK-----WIGGH--GT
METB_MYCLE/15-388-----.A---------------LQ--------------------QPLMLG.----.ADVVLHSTTK-----YIGGH--SD
METB_HAEIN/8-366-----.V---------------LS--------------------RPLDLG.----.ADVVIHSGTK-----YIAGH--ND
O15565_TRIVA/12-395-----.I---------------LT--------------------NPLDLG.----.VDIVVHSATK-----YINGH--TD
METB_HELPY/4-377-----.Y---------------YQ--------------------NPLLLG.----.ADIVAHSGTK-----YLGGH--SD
A2FEV4_TRIVA/9-392-----.M---------------IT--------------------NPVDFG.----.VDVVVHSATK-----YINGH--TD
B0SQZ9_LEPBP/8-432-----.F---------------LV--------------------NPLKHG.----.ADIVVHSLTK-----FLGGH--GT
B2FLU7_STRMK/14-389-----.M---------------LQ--------------------RPLELG.----.ADLVLHSATK-----YLNGH--SD
K7VKJ5_MAIZE/100-483-----.I---------------NQ--------------------KALTLG.----.ADLVIHSATK-----YIAGH--ND
METZ_MYCTU/21-405-----.L---------------LQ--------------------QGFPLG.----.VDVVVYSGTK-----HIDGQ--GR
Q5AXC9_EMENI/40-405-----.L---------------LL--------------------SPLELG.----.ADVVYESGTK-----YLSGH--HD

PF01041

ERBS_SACEN/13-363-----AR---------------HRG...................HRVGAGS--..NAAAFSFYPGK-----NLGAL--GD
P72893_SYNY3/11-365-----SV---------------YHG...................KRAGSMG--..KFGSFSFHGTK-----TL.TT--GE
P73264_SYNY3/14-373-----SQ---------------LQG...................KQAGNLA--..DGASFSFFPTK-----VM.TT--FE
O27256_METTH/7-356-----AE---------------YHG...................RKVGSMG--..DAACFSFYPTK-----NI.TT--GE
P74668_SYNY3/13-379-----AI---------------YAGDCLGCDQGCDDQVRQALVGQYTGAMG--..DVGAFSFFPTK-----NLGAY--GD
RFBH_SALTY/40-430-----TT---------------YEG...................QMVGTFG--..DIGTVSFYPAH-----HI.TM--GE
PSEC_HELPY/9-366-----SE---------------YQN...................KKVGGFA--..LASVFSFHAIK-----PI.TT--AE
Y1066_METJA/12-379-----AE---------------YKG...................KKIGTIG--..DTTSFSFYATK-----NI.TT--GE
ARNB_ECOLI/10-374-----TY---------------YKG...................RHIGAKG--...TAIFSFHAIK-----NI.TC--AE
SPSC_BACSU/14-382-----TT---------------YKQ...................RMIGSIG--..DATAFSFYATK-----NL.AT--GE
O26434_METTH/7-359-----AE---------------YRG...................KKIGTFG--..DVSCFSFYGNK-----II.TT--GE
NTDA_BACSU/78-432-----LT---------------DLG.......................KYA--..DITTLSFNPYK-----NFGVC--GK
A4F7N3_SACEN/33-380-----CT---------------AGG...................RPVGAFG--..NAEVFSFHATK-----AV.TS--FE
B1W368_STRGG/23-413-----AG---------------FRG...................RPVGAHG--..AAGVFSMQGSK-----LL.TC--GE
B1W386_STRGG/12-373-----TE---------------IGG...................RPIGGFG--..DLACVSLFEQK-----VITSG--GE
C6W8U4_ACTMD/18-373-----AH---------------WRG...................KRVGELG--..SIATFSFQNGK-----LM.TA--GE
F7YJG4_VIBA7/13-366-----AL---------------YDSKE...............GIKKVGSIG--..DAAGFSFYPGK-----NLGAL--GD
RIFK_AMYMS/15-372-----AR---------------WQG...................KRVGELD--..SIATFSFQNGK-----LM.TA--GE
Y3402_MYCTU/52-405-----ST---------------YAD..................GERLGGRG--..ACEIFSFHATK-----PF.AV--GE
Q5KV33_GEOKA/14-364-----AK---------------YNG...................KCVGELG--..TAATYSFFPTK-----NLGAY--GD
Q79H47_BORPE/14-362-----AT---------------YKG...................RKSCNLS--..TIGCTSFFPSK-----PLGCY--GD
Q7W0M1_BORPE/26-405-----AS---------------WQG...................RRIGSLE--.SDLTVYSFYATK-----TL.AT--GE
Q9ABJ3_CAUCR/28-397-----AT---------------FDGV.................AHPVGDGA--YSSFASFSFHPVK-----TL.AT--GE
Q9KVA5_VIBCH/9-360-----TA---------------VNG...................KKVGTFG--..DVSTFSFFGNK-----TI.TS--GE

PF01212

GLY1_ASHGO/17-304.....AE---------------SG--------------------VPLKQYG..EL.FDSISICLSK--------SM--GA
GLY1_YEAST/16-303.....AQ---------------SG--------------------VPLKQYG..EI.FDSISICLSK--------SM--GA
Q7QAI2_ANOGA/21-308.....SY---------------LN--------------------LPVSRIV..RD.VDSVCFCLSK--------GL--AC
YF64_CAEEL/68-359.....VA---------------SN--------------------CSVSKIA..SF.ADTVQMCFSK--------GL--GA
Q8Y182_RALSO/3-296.....AS---------------LG--------------------VHPSEITWRAG.VDVLCFGGTK--------N.--GL
Q9RUR9_DEIRA/13-296.....VK---------------LG--------------------VDVREIT..RC.FDTVSVCLSK--------GL--GA
Q8A7N2_BACTN/47-423KGYQDKS---------------IK--------------------EITREMF..DL.ADGMTMSAKK--------DG--IV
THA2_ARATH/11-300.....VA---------------LG--------------------VPVKRIV..QA.ADSVSICLSK--------GI--GA
Q8RCY7_CALS4/5-290.....TY---------------LK--------------------VDVKEIA..KY.ADSVMFCLSK--------GL--CA
Q89ID2_BRADU/23-308.....VA---------------SG--------------------ISPRDMT..AG.WDSAWIDFSK--------GL--GA
Q7MUT3_PORGI/47-424AGYENKS---------------IK--------------------EIVKEIY..SY.ADMMTMSSKK--------DA--IV
Q9VCK6_DROME/8-304.....TA---------------LG--------------------VGVERIC..RD.FDSVSICLSK--------GL--SA
LTAE_PSEAE/7-299.....AF---------------LG--------------------CSPAELSWKAG.VDVLCFGGTK--------NG--MA
TPL_PASMU/47-424AEYKDAT---------------IK--------------------DILKEMM..SY.ADGCTMSGKK--------DC--LV
TNAA1_SYMTH/45-421EGYADKH---------------PI--------------------DIAREMF..SY.GDGLMMSAKK--------DA--LV
TNAA_CALS4/50-428KGYENKS---------------IK--------------------EIVREMF..SY.GDGFTMSAKK--------DA--LV
GLY1_SCHPO/30-313.....VA---------------SN--------------------VSIKEYC..SY.FDSVSLCLSK--------GL--AA
Q9X266_THEMA/3-287.....IA---------------SG--------------------VPVKEYA..GY.ADSVMFCLSK--------GL--CA
TNAA_PHOLL/46-432KGYENKS---------------VK--------------------QIVKEMY..QY.GDMLTMSAKK--------DP--LV
Q88AI0_PSESM/7-297.....AF---------------LD--------------------ASPAELTWKSG.VDVLCFGGTK--------NG--MA
Q89N26_BRADU/13-294.....VA---------------LG--------------------VPAARIA..EH.ADSVMVCLSK--------GL--SA
Q7MEV9_VIBVY/2-285.....TA---------------LD--------------------VPVRDIA..QY.FDSMTICLSK--------GL--GA
TNAA_CLOTE/60-438PGYENKS---------------IK--------------------EIIKEIF..SY.ADIFTMSAKK--------DA--IV
Q9A3V8_CAUCR/9-299......A---------------GG--------------------FDLKSIA..KMGVDILVMGGTK--------AG--ST
TNAA_HALSA/42-412PGYEHDS---------------VA--------------------AIAREQL..SY.ADACVMSGKK--------DG--LV
Q7NHQ7_GLOVI/7-294.....VA---------------GS--------------------HSPATLA..AP.FDSVYFCLSK--------GL--GC
TNAA_CHRVO/47-428PAYAGVA---------------IS--------------------SIVREMF..DY.GDMFTMSAKK--------DG--LV
TNAA_AERPE/52-428PRYRGWS---------------VR--------------------DIAREMI..SY.GDHFVMSAKK--------DG--LA
Q896G8_CLOTE/5-288.....AY---------------LD--------------------VGVKDIT..KY.CDSVMFSISK--------GL--CA
Q9HMP3_HALSA/22-307.....TA---------------LG--------------------VDAATLL..SP.VDSVAVCLST--------GL--GA
Q8EC07_SHEON/3-286.....VA---------------QG--------------------IAIADIA..AH.FDSVSICLSK--------GL--CA
Q7NQ31_CHRVO/5-289.....AH---------------LG--------------------CDVREVT..RH.VDSVMACLSK--------GL--AA
D5AL49_RHOCB/46-420EGQAERS---------------IP--------------------EIVRDCF..AV.ADGMTMSAKK--------DA--FG
D5AV45_RHOCB/2-292.....VS---------------LG--------------------CTPAEVTWKAG.VDVLSFGGTK--------NG--CM
G3XD13_PSEAE/5-283.....VK---------------LG--------------------VDASEIT..RH.FDSVSVCLSK--------GL--GA
I0DW76_PROSM/47-432PKYKDAT---------------IK--------------------EVIFDMY..KY.ADALTMSAKK--------DP--LL
LTAE_ECOLI/3-280.....VA---------------YG--------------------CELKEIT..QY.CDSFTICLSK--------GL--GT
TPL_SYMTH/47-422EGYQDKP---------------VR--------------------EILKEMM..SY.FDGCTMSGKK--------DC--LV
Q59NC4_CANAL/14-300.....VA---------------TG--------------------ISIKEYC..SY.FDSVSLCLSK--------SL--GA
Q7VW60_BORPE/3-283.....VA---------------SG--------------------VPVQQLC..EP.FDTVSICFSK--------GL--GA
TPL_FUSNN/49-425EGYQDKT---------------IK--------------------EIVHEMF..SY.ADGCTMSGKK--------DC--LV
Q8RHQ6_FUSNN/51-505EGYRDKS---------------IA--------------------EIAKEMF..SY.CDGFTASLKK--------DG--HA
THA1_ARATH/7-295.....IA---------------LG--------------------VPVHKLV..KA.ADSVQVCLSK--------GL--GA
Q98A67_RHILO/12-297.....VT---------------LR--------------------CSPAEMTWKAG.VDLVSFGATK--------NG--TF

PF06838

YNBB_BACSU/11-416-----VE---------------EL--------------------EPCHVG------ADLMAGSLIK-----NPGGG--LA
Q8EQP5_OCEIH/1-405-----TE---------------TK--------------------EPLHVG------ADLMAGSLIK-----NPGGG--LV
Q8Y7I1_LISMO/4-408-----AE---------------YL--------------------EPTEVG------ADIIAGSLIK-----NPGGG--LA
Q97I22_CLOAB/19-425-----VE---------------EK--------------------EPTDVG------ADIIAGSLIK-----NIGGG--IA
Q8XL83_CLOPE/19-425-----ID---------------II--------------------EPTDVG------ADLIAGSLIK-----NIGGG--IA
Q8DHD9_THEEB/26-430-----VE---------------TQ--------------------EPPHVG------ADLIAGSLIK-----NPGGT--IA
Q54763_SYNE7/3-407-----IE---------------TR--------------------EPTMVG------ADLMAGSLIK-----NPGGT--IA
Q8RA65_CALS4/17-421-----TE---------------KK--------------------EPTEVG------ADIVAGSLIK-----NIGGG--IA
Q9KAC8_BACHD/11-416-----VE---------------AK--------------------EPCHVG------VDVIAGSLIK-----NPGGG--IV
Q8YWL0_NOSS1/20-424-----IE---------------TQ--------------------EPTHVG------ADLMAGSLIK-----NPGGT--IV
Q55407_SYNY3/3-407-----IE---------------TV--------------------EPTAIG------VDLMAGSLIK-----NPGGT--IV
Q895H5_CLOTE/19-425-----ID---------------II--------------------EPTDVG------ADLIAGSLIK-----NPGGG--LA
Q5HPN4_STAEQ/5-406-----VE---------------DK--------------------EPIEVG------ADLIAGSLIK-----NPGGG--LA

PF03841

SELA_PSEAE/79-451LPK.EPT---------------VQ--------------------EALADG------ADIVTFSGDK-----LLGGP--QA
SELA_CAMJE/71-423IKN.EPK---------------IR--------------------KLVQE.------CDILSFSGDK-----LFGSV--QA
SELA_PASMU/81-448LPK.EPT---------------VQ--------------------EKWAQG------VELISFSGDK-----LLGGP--QA
SELA_HAEIN/82-449LPK.EPT---------------VQ--------------------EKIAQG------VDLVSFSGDK-----LLGGV--QA
SELA_RHIME/80-448LGR.EPT---------------VR--------------------EAVAEG------ADLVTFSGDK-----LLGGP--QA
SELA_ECOLI/83-452LPK.EPM---------------PQ--------------------ELIAAG------VSLVSFSGDK-----LLGGP--QA
SELA_AQUAE/72-435ISVDEPN---------------FR--------------------DCISLG------IDLVSGSGDK-----LLGGP--QA
C7LWD8_DESBD/82-448FMP.EPT---------------VQ--------------------QVLKSG------VDVVTFSGDK-----LLGGP--QA
SELA_MOOTA/80-445ITG.EPT---------------VQ--------------------AEINQG------VDVVTFSGDK-----LLGGP--QA
W8TF72_EUBAC/86-450LSY.EPT---------------VM--------------------DSLRKG------ADIVTFSGDK-----ILGGP--QA

PF00266

SERC_ECOLI/4-350GV.-------------------.I--------------------YAGAQK.NIGPAGLTIVIVRED-----LLGKA....
CSD_PSEPK/23-389GCD-------------------FY--------------------VFSSHK.LYGPDGVGVLYGRAQ-----ALELL..RH
CSD_CHLTR/19-388GVD-------------------FY--------------------AFSGHK.LYAPTGIGVLYGKKE-----LLESL..PP
CSD_XYLFA/36-404GCD-------------------FY--------------------AITGHK.LYGPTGTGALWARRE-----HLHIM..PP
NIFS_NOSS1/4-365TID-------------------ML--------------------TISGHK.IHAPKGIGALYVRR.-----.GVRF..RP
CSD_STRCO/31-406QAD-------------------FV--------------------AFTGHK.MCGPTGIGVLWGRQE-----LLEDL..PP
CSD_TREPA/20-390GCD-------------------FF--------------------VFSGHK.MFSLFGVGVLCAPHT-----LLESM..PP
CSD_UREPA/18-385KSD-------------------FM--------------------VFSAHK.LLGPTGIGVAYIKND-----LIKKM..QP
CSD_METTH/20-389GAD-------------------FA--------------------AFPGHKGTLGPVGTGFLYCSTD-----VQGEL..EP
SUFS_DICD3/30-399DCD-------------------FY--------------------AFSGHK.LYGPSGIGVLYGKSE-----LLQAM..PP
CSD_VIBCH/25-393DAD-------------------FY--------------------VFSGHK.LYAPAGIGVLYGKTA-----LLEAM..PP
SUFS_ECOLI/25-394DCD-------------------FY--------------------VFSGHK.LYGPTGIGILYVKEA-----LLQEM..PP
CSD_PSEAE/23-389GCD-------------------FY--------------------AFSGHK.LYGPDGIGVLWGRPQ-----ALEQL..AH
CSD_AERPE/21-399GVD-------------------MA--------------------AFSGHK.MLGPTGIGVLWARRD-----LLEEL..EP
CSD_PASMU/44-409