Sequence alignment for CL0062

PF03222

MTR_HAEIN/5-405-------------------KSPSLLGGAMI-----IA-------------------------------------------
Q9Z3A2_CHLPN/1-391-------------------MSNKVLGGSLL-----IA-------------------------------------------
TYRPA_HAEIN/3-387-------------------KT...VGSTLL-----VA-------------------------------------------
TYRP_ECOLI/4-391-------------------RT...LGSVFI-----VA-------------------------------------------
TNAB_PROVU/8-404-------------------KEPSIIVGGFV-----LG-------------------------------------------
O07675_HAEIF/5-400-------------------KTTSIFGGACI-----IA-------------------------------------------
MTR_ECOLI/9-402-------------------TSPSLLGGVVI-----IG-------------------------------------------
O22778_ARATH/12-436-------------------KGKSFWAAVSL-----II-------------------------------------------
TNAB_ECOLI/7-403-------------------KKHSAFWGVMV-----IA-------------------------------------------
A0A0E9C322_PANAN/6-404-------------------TTPGLMSGTML-----II-------------------------------------------
O84824_CHLTR/1-390-------------------MINKMLGGALL-----VA-------------------------------------------
O84825_CHLTR/3-392-------------------MRNKCVGGILI-----VA-------------------------------------------
TYRPB_HAEIN/5-393-------------------KT...FGSALI-----IA-------------------------------------------

PF01490

AAP5_ARATH/28-468-------------------RTGTVWTASAH-----II-------------------------------------------
LHT1_ARATH/34-433-------------------RNAKWWYSAFH-----NV-------------------------------------------
AAP1_ARATH/37-472-------------------RTGTWLTASAH-----II-------------------------------------------
AVT5_YEAST/1-446-------------------MPSNVRSGVLT-----LL-------------------------------------------
O62286_CAEEL/61-471-------------------TGISATSGLIN-----FI-------------------------------------------
AVT6_YEAST/1-439-------------------MVASIRSGVLT-----LL-------------------------------------------
AVT1_YEAST/206-601-------------------GQSTAPQTIFN-----SI-------------------------------------------
MTR_NEUCR/51-449-------------------HRLGWKRLTVV-----LI-------------------------------------------
AVT2_YEAST/65-467-------------------KKSSMRMAFMN-----LA-------------------------------------------
VIAAT_RAT/114-513-------------------PKITAWEAGWN-----VT-------------------------------------------
PROT1_ARATH/32-428-------------------SSDSWFQVAFV-----LT-------------------------------------------
AVT3_SCHPO/273-656-------------------GNASNGKAVLL-----LL-------------------------------------------
AUX1_ARATH/44-438-------------------HGGSVWDAWFS-----CA-------------------------------------------
UNC47_CAEEL/87-475-------------------EPISALQAAWN-----VT-------------------------------------------
AAP6_ARATH/33-470-------------------RTGTWMTGSAH-----II-------------------------------------------
AAP2_ARATH/46-481-------------------RTGTVWTASAH-----II-------------------------------------------
AVT4_YEAST/295-711-------------------GTTSTKKVFLI-----LL-------------------------------------------
AVT7_YEAST/3-477-------------------ATSSALSSTAN-----LV-------------------------------------------
Q21652_CAEEL/22-416-------------------KGIGWIIGAIF-----II-------------------------------------------
S38A3_HUMAN/64-491-------------------GKTSFGMSVFN-----LS-------------------------------------------
SKAT1_CAEEL/35-446-------------------DVITPTRAVLT-----LS-------------------------------------------
AVT3_YEAST/295-688-------------------HKSSTVKAVLL-----LL-------------------------------------------
D7LAT0_ARALL/30-429-------------------.RTSALQTLGN-----II-------------------------------------------

PF02554

Q73V96_MYCPA/49-425-------------------VNAVWFVVAAI-----CSYLIGFRFYARLIERKIVHPRDDHATPAEILDDGADYVPTDRRV
Q1IKI0_KORVE/33-409-------------------INAMWLVVAAL-----CTYAVGYRFYSKFIATKVLVLDSRRATPAERLDNGRDFVPTNKWV
W0PIG8_9BURK/37-414-------------------VNALWIVIAAV-----CVYLIAYRYYSRFIANKVFELNPQRMTPAWKYNDGLDYVPTNKHV
Q8NSL6_CORGL/37-415-------------------INSVWLVLAAV-----GSYIIAFSFYARLIEYKVVKPKDQRATPAEYVNDGKDYVPTDRRV
B3E5B6_GEOLS/1-379-------------------MNALTLVFVAL-----CVFALAYRYYGLFIANKVLNLQAERATPAVTQADGHDYVATNKYV
D3SLN0_THEAH/33-404-------------------..AIWVVLAAL-----SLYTLGYRYYSWFIAYRVLGVDDSNPTPAHRYYNGVDYVPTNRWV
Q1AYY2_RUBXD/34-410-------------------.NAGWLLFAAI-----ASYAIAYRFYARFIQTRVLETDDSRATPAERLENGRDFVPMDRRI
C5B2E8_METEA/32-408-------------------INALWVVVAAV-----CVYLIAYRYYSLFIADKVMRLDPKRETPAHRHNDGLDYVPTNKSV
R5ZHV1_9ACTN/1-390-------------------MNGVLLMVVAA-----AVLACGYLGYGRWLANK.WGVDKEALTPAKRMKDGKSFSPVSAFT
D4YZ07_SPHJU/29-402-------------------VNALWIVVAAV-----SSFLVAYRYYALYIARHVMRLDPSRPTPAIRRADGLDYVATDRTV
G8RRI7_MYCRN/67-445-------------------INAVWFVIAAI-----CTYVIGFRFYARLIEMNIVKPRDDNATPAEIFDNGTDYTPTDRRV
B5HN22_9ACTN/35-411-------------------.SAAWMVAAAL-----GSYAIGYRFYAKFIAYKVLKVDATRATPAERLDNGIDFHPTDRRV
Q5YQA1_NOCFA/54-432-------------------VNAVWIVIAAV-----CTYVIAYRLYARFIEWKITKPRDDLATPAEILENGKDFMPMDRRV
F8GFU4_NITSI/34-409-------------------..AIWIVIAAV-----CVYIIAYRFYSLFIANRVLKLDSTRMTPSYKLNDGLDHVPTNKYV
I6YY40_MELRP/1-360-------------------MSGIILVVFAI-----ILFISAYRIYGNFISNK.FSIDGNHTTPSHEMYDGVDYVPAKPPV
Q213E9_RHOPB/39-416-------------------INASWLVIAAV-----CVYFIAYRFYGLFIAEKVLGVDPKRRTPAHVHNDGLDYVPTNRYV
B1ZS08_OPITP/41-415-------------------VNALWMVVASV-----CVFAIAYRFHSAWLMAKVLTLDELRATPAVVHEDGKDFVQTNRWV
Q9HVI3_PSEAE/35-412-------------------INALWIVVAAV-----AIYLVAYRYYSLFIASKVMQLDPNRATPAVLNNDGLDYVPTNKHI
Q5L2D3_GEOKA/32-409-------------------VNAMWLIVAAV-----CTYAVAYRFYSRFIARKVFGLDDNRKTPAEVFNDGKDYVPTNKWV
Q9KBY1_BACHD/3-388-------------------..GVLLAALGM-----LVFALGYRYYSKFIAERIYRLDPNFVTPAHQFKDGKDFVPTNKFV
I4WZC7_9GAMM/39-416-------------------INAIWLVAASI-----AIFVIGYRFYGKFVEHSVLQLDPSRAPPSVLRNDGLDYVPTDKWV
F8JAH8_HYPSM/32-409-------------------INAIWLVMAAI-----CSYLLADRFYARFIADRVLRLDADRLTPAQRFNDGLDYCPTDKTV
Q8RBF1_CALS4/1-380-------------------MNGLTLVIITL-----SVYALAYRFYGAWIGAKILAFDENRTTPAYRLENGYDYVPTNKWV
R6ZB35_9ACTN/1-384-------------------MNGMVVVVVAA-----VVLAAGYLVYGRWLAKT.WGIDREALTPAKRMEDGKNFSPASCFT
D2SAU5_GEOOG/54-430-------------------.SALWILFAAL-----SSYAIAYRFYAKFIARRVLQVDDRRATPAERLHNGIDFDVTDRRV
W5Y2A8_9CORY/68-445-------------------INAMWLVLAAI-----GSYIIAYSFYARYVELRIVKPRADRATPAEYDNDGKDFMPTDRRV
F4H7H1_CELFA/61-439-------------------VNAVWFVFAAV-----CTYVIGYRFYARLVEAKVVRPRDDRATPAERYDNAKDFMPTDRRV
I4BUN1_ANAMD/1-359-------------------MSGVMLMLVTF-----VLFILAYIFYGGWLAKQ.WGLNPQGKTPAHEFYDGVDYVPAKAPV
A8FG20_BACP2/1-378-------------------MNAVTIVIASM-----CILAIAYRLYGTFMMVKVLKVTDDHPTPAHTLEDGKDYVPTNKWV
F0S490_DESTD/4-376-------------------....FLFLLSI-----SIFIIAYFTYGKFLSKKVFKLDDKNKTPAHTMKDGVDYVPAPAPV
Q7P007_CHRVO/32-409-------------------INAVWLVVAAL-----SVYAIAYRFYGRFIADKVLELDPRRLTPAEKFNDGLDYVPTNKWV
R5ZC92_9FIRM/1-380-------------------MNGLLLLGIAA-----VLFICAYVFYGRYLVKT.WGIDVNADTPAKTYEDGEDFVPSNKWK
B8DLB6_DESVM/1-381-------------------MNALTLVFAAL-----CVFAIAYRFYGLFLTRTVLGVKPGRPTPAVRMADGHDYVETNKYV
D6Z9X1_SEGRD/53-430-------------------VNAVWFVLAAI-----ASYLVAYRCYAKFIERNVVRPRDENATPAELFEDGRDFVPTDRRV
D7B6A0_NOCDD/50-427-------------------.SAAWLVFAAL-----ASYAIGYRFYARFIQYKVLITDDTRATPAERLDNGADYHPTDRRV
Q2JA57_FRASC/58-431-------------------.SAAWILLAGL-----GSFAIAYRFYARFIANRVLRVDDSRATPAERLDNGVDYEPTDRRV
R6FJL5_9FIRM/1-374-------------------MNGILMMVIAI-----VVLGGAYLLYGRYLQKK.WGIDPNAKTPAYEMEDGVDYVPADTNV
C6WTH2_METML/32-409-------------------INALWLITAAV-----CIYAIAYRFYAAWIAAKVLVIDETRATPAERLDNGRDFVPTNKWV
I4CCQ1_DESTA/1-369-------------------MNSMVVLIVGF-----VVAVIGYRFYARYIDSKVIQADSKRMTPARMYMDGVEFMPTSKNI
A8ESS3_ARCB4/29-406-------------------.SAMYLVVAAV-----CIYMIGYRFYGRFIAYKVLELDKNRATPAVVQDDGRDFVPTNKSV
C7MT52_SACVD/47-424-------------------VNAIWFIFAAL-----CSYAIAYRFYARFILTKVLKADDKRATPAERLENGADYNRTDRRV
D7WD84_9CORY/71-449-------------------INSVWLVLAAI-----GTYIIGFSLYARLVEYKVVKPRNTRATPAEYVNDGSDFVPTDRRV
W0L393_9GAMM/32-409-------------------VNALWLVVAAV-----SCYSIAYRFYSLFIAKNVFELDDRRLTPAERHNDGLDYVPTNKWV
Q1LHD0_CUPMC/33-409-------------------.SALWIVVAAL-----CIYLIAYRYYSRFIADKVMQLDPNRMTPAWRHNDGLDYVPTNKAV
G8ASJ6_AZOBR/32-409-------------------INALWLVVAAV-----CTYLVSYRYYSLFIATRVMRLDPARPTPAMRHNDGLDYVPTNQYV
E1QXU3_OLSUV/1-389-------------------MNGLAVIVVAA-----VVLVIGYIGYGRWLAKS.WGVDSGALTPATRMEDGQSFVPASRFT
A7MKY8_CROS8/32-414-------------------INALWIVVAAV-----CIYLIAYRFYGLYIAKKVLAVDPTRMTPAVRHNDGLDYVPTDKKV
C7RPJ8_ACCPU/32-409-------------------INALWIVTAAV-----SIYLVAYRYYSLFIADKVMQLDSTRATPAVRHNDGLDYVPTNKYI
B2GG33_KOCRD/69-446-------------------INAIWFVFAAV-----CSYFIAYRFYSKFIEMKLTRPDDRRATPAEYHANGKDFLPTDRRV
Q1QW04_CHRSD/1-387-------------------MNAIWIALFGA-----VCFVMGYRFYSKFIAERIYRLDADFQTPAHAYRDGVDYVPTNKWI
A0LP60_SYNFM/1-400-------------------MNAAVLMVVAF-----VLFFIAYRIYGKYISKV.FEENDANPTPACAMKDDCDYVPTKPIV
Q604D8_METCA/34-407-------------------VNSLWFVTAAV-----CVYALGYRFYSAFVATRVLLLDAGRATPAERFNDGRDFVPTHRWV
B9M2N4_GEODF/1-381-------------------MNALTLIFTSL-----CVFAIGYRFYGLFIARRVMALNDDRPTPAVTLADGHDYVKTDKYV

PF13906

B4KYY5_DROMO/548-598--------------------------------------------------------------------------------
Q9LD96_ORYSJ/520-570--------------------------------------------------------------------------------
B4IZ20_DROGR/535-589--------------------------------------------------------------------------------
A2XK04_ORYSI/515-565--------------------------------------------------------------------------------
Q16RD4_AEDAE/393-443--------------------------------------------------------------------------------
B9I635_POPTR/565-615--------------------------------------------------------------------------------
B4NQ70_DROWI/627-677--------------------------------------------------------------------------------
C3XPQ7_BRAFL/527-577--------------------------------------------------------------------------------
C5LVE9_PERM5/263-313--------------------------------------------------------------------------------
C5KQZ0_PERM5/326-376--------------------------------------------------------------------------------
O44798_CAEEL/507-557--------------------------------------------------------------------------------
A9TH89_PHYPA/537-587--------------------------------------------------------------------------------
B4HLB6_DROSE/535-585--------------------------------------------------------------------------------
CAAT3_ARATH/534-584--------------------------------------------------------------------------------
D2HFL8_AILME/627-677--------------------------------------------------------------------------------
B5DFJ0_RAT/540-590--------------------------------------------------------------------------------
B0WAU2_CULQU/428-473--------------------------------------------------------------------------------
O17069_CAEEL/508-558--------------------------------------------------------------------------------
Q337V1_ORYSJ/559-609--------------------------------------------------------------------------------
A4FEQ4_SACEN/56-106--------------------------------------------------------------------------------
B4LDP2_DROVI/508-558--------------------------------------------------------------------------------
D0NG02_PHYIT/81-131--------------------------------------------------------------------------------
B7QME9_IXOSC/429-479--------------------------------------------------------------------------------
B0WAU5_CULQU/549-599--------------------------------------------------------------------------------
CTR2_CHICK/555-605--------------------------------------------------------------------------------
CAAT4_ARATH/528-578--------------------------------------------------------------------------------
B9SAY1_RICCO/451-501--------------------------------------------------------------------------------
A4IG22_DANRE/575-625--------------------------------------------------------------------------------
B9IPU3_POPTR/568-618--------------------------------------------------------------------------------
C5WR23_SORBI/560-610--------------------------------------------------------------------------------
D7SLW7_VITVI/530-579--------------------------------------------------------------------------------
E9PWS4_MOUSE/604-654--------------------------------------------------------------------------------
F1MWA9_BOVIN/427-477--------------------------------------------------------------------------------
F6HLX0_VITVI/454-504--------------------------------------------------------------------------------
F6SWF3_XENTR/559-609--------------------------------------------------------------------------------
F6YB26_XENTR/150-200--------------------------------------------------------------------------------
F7E7U9_XENTR/599-649--------------------------------------------------------------------------------
G1MMB4_AILME/534-584--------------------------------------------------------------------------------
G1MNG0_AILME/556-606--------------------------------------------------------------------------------
H0V5U0_CAVPO/558-608--------------------------------------------------------------------------------
H3C2Q0_TETNG/530-580--------------------------------------------------------------------------------
H3CER8_TETNG/575-625--------------------------------------------------------------------------------
I1N8D3_SOYBN/561-611--------------------------------------------------------------------------------
A0A096TLT9_MAIZE/517-566--------------------------------------------------------------------------------
M0QVZ8_BOVIN/550-600--------------------------------------------------------------------------------
Q2FYJ4_STAA8/386-437--------------------------------------------------------------------------------

PF02028

A8LPK2_DINSH/19-510-------------------LFAVTGGFIAL-----FCAYAL.....FD.IEGLSALVDTSFAFSAKYFGLYWQVLLLATF
Q92WM0_RHIME/57-540-------------------VFVGSVAVIAL-----FVGIGV.....IA.PKRAESIFSGMQTAILSGFGWLYLLSVAVFL
B1YHV0_EXIS2/12-504-------------------VFIISVIFCVL-----FTIWGILPESLIG.AANLGNVTGIAQSFVSNGFGWLYLFGMSAFL
A8LQI8_DINSH/15-511-------------------TSLISAGIILL-----FVLLVL.....AF.PSRSADWIDAARTLITFYFGWWYVLLSGVFL
B9LMR4_HALLT/20-531-------------------VFAFGALLTVG-----VIAAFF.....IS.PSAVENGISSLNNQLLGAFNWAMMLIVFLIV
Q9K9K1_BACHD/6-494-------------------VFIISVAIAAI-----FIAWGL.....IA.PKNLAAVTKVIDSFILNELGWFYLLSATGFL
A8GBX6_SERP5/19-505-------------------VFFTSAGLILA-----FSLMTI.....FF.TDFSGRWITRTLNWVSTTFGWYYLLAATLYI
Q24SP9_DESHY/12-494-------------------VLYISSAIALL-----FVLWGV.....FL.PENMANVVNKVFALLTTNFGWLYLLAVAIFI
Q8P5D9_XANCP/17-505-------------------VFVLAATVVCT-----FALLVA.....LF.PLDAGRILLDAQTWASRNVGWYYLLAMTLYL
Q7VZR1_BORPE/13-496-------------------VFLTSALFILL-----LVVFTI.....AA.PATAQDFFNVIQAWILGNASWFYILTVAIIL
Q5WBX8_BACSK/16-508-------------------IVFPSILIIAI-----VSFLFA.....IY.TEESTTLLNRIFDTIVDLFAWGYMWYALLMV
Q24ME3_DESHY/23-511-------------------VFWGSAILCVA-----LYAPMM.....IF.GTELQPFVAAALKAITYRMDWLWLLFALGCV
A4RTS9_OSTLU/5-508-------------------T.......LWG-----FTIGVL.....SR.EEAAEEFFGKATLWISNNFTWFYTLTQNAWI
A1TNS1_ACIAC/32-511-------------------V...SAGMIAV-----VVLWGL.....VS.PASLGTFFGTLLSDITRNFGWLYLWVVLGLV
A1WTW7_HALHL/25-513-------------------VMVLSGGFVLA-----FIAIAA.....VD.LDWLSAAVDTTFGYATQYFGAYWQLLMLATF
A0M563_GRAFK/13-496-------------------VFLISAIILIL-----SSILIF.....VF.TNQFYNSIEELSLWVREYFGTFYLWLGLGCV
Q083A6_SHEFN/33-521-------------------VFGISAGLIAA-----FLIAIL.....IIDPATSKEFLDGLKWQIIGTFDSLFMWSANIFV
A3HUC8_9BACT/12-495-------------------VFWPATFLIFF-----FITLTL.....WV.GEPMEEIFLNIKDFITDQTGWLFILVVNLFI
Q7NQ38_CHRVO/2-486-------------------VLRLSLLFAVL-----FALWGA.....VA.PGHMTAAASEWLSFTISRFGWFYLLSVFGFL
Q73N94_TREDE/25-518-------------------ITVLPLAVIIC-----LTGLVL.....FF.PVESMKVVDALWSVFVNKLGFFYILLGLGLV
Q8FNC7_COREF/25-515-------------------IFLLSVGIIVT-----FVVATV.....IL.GDTARDGFSAMAGWLLENLGWMYVGGVSLIL
A7HWC8_PARL1/21-507-------------------VFYTSAVGIAL-----FAIWTM.....FF.IDSANFVINSVLAWISDVFGWFYFVAVVLYL
Q47TJ2_THEFY/57-547-------------------VFLTAAAFTLA-----FVAWGA.....IS.DETLAQVAENLLAGLMRYGGWAFVLVAGVFV
A7HZZ0_CAMHC/11-495-------------------VFYSSVSVLVF-----ILFFVL.....FL.PDFSLKYLKMTQEFLTAKFGWFYVLSMTIIF
A1WT60_HALHL/15-497-------------------VFLPAAALVVA-----LVVSAA.....VW.TEAVGDWIAELQTFIAVELGWVYTGVVAFLL
Q88C09_PSEPK/15-521-------------------VTIWSLLAVVA-----FVLFCA.....LF.AEHAAAVFQRASDFILQNFKWFYLISVTGVL
Q2FYT0_STAA8/17-503-------------------VFIYSAIVVAI-----VVLLGA.....FL.PEQFNYVTNNIKMWITEKLGWYYLILTTIIV
A4J208_DESRM/13-498-------------------IFWPPLLLISI-----VCALII.....KD.PVRANEISNKALTWTTDKLGWAFEWYVVILF
A3CRU5_METMJ/11-494-------------------VFLFSAGIILF-----FIGFGV.....AR.PDLLDSASSAVHAAILDNFSWLYLISVFFFL
A1WTL9_HALHL/51-540-------------------VFIVSSALILV-----FLIGTL.....IF.TAPAQEALEGVRGWATSSFDWFFLTAGNIFV
Q8ESD6_OCEIH/10-503-------------------TFIGALLILLT-----VVIPLI.....LF.PKAGSEVINSANRFVTGNFGILYLILGLSAL
A1WY53_HALHL/17-503-------------------VTAISTFLVAA-----FALAGA.....IW.PKHLEAVVTGWRESLTPFLQWYYVLVVAAFL
O83144_TREPA/10-507-------------------VSLIPLGIVIS-----CALLFI.....SF.PDISHRVIGTLLNILVNKLGFFYILTGLFFL
Q9JZ61_NEIMB/17-502-------------------VILTTLFFVCV-----LVVLVL.....TV.PDQVQMWLDRAKEVIFTEFSWFYVLTFSIFL
Q30W47_DESAG/28-510-------------------VFFGSAGLIFL-----FVGITL.....VF.QHFLGDVFQTMQSYMSTYTGWFFIATMNIVL
Q9KCW2_BACHD/16-501-------------------VFSISAVLIGL-----FVLWGA.....VS.PSSLEWAAGIGLGWMIENFGWFYMLTTAFFV
A4FCK8_SACEN/14-506-------------------VFLVSGAIAVA-----FVLWGV.....LA.PGHVSAVAGAANSFITTYFEWLYIIAGTFFL
Q6NER6_CORDI/66-556-------------------VFGASAVGIIA-----LTLWAF.....FA.REKAATALGAVTEWISTNLGWFYILTATVVI
A4XAA8_SALTO/18-503-------------------LLGLAVGGVLA-----IVVWGI.....LA.SESISAVGETGLTWVITTFGWLFVVAANTFL
A0Q2F1_CLONN/9-486-------------------IFKSSILISAC-----IFIWAL.....FF.QQGFNDIVNSALDWISDNLSWFYSGLMVSFF
Q5WHJ4_BACSK/13-493-------------------VFYWVLGILLI-----FIVVGI.....SA.PARLEAITAAAQAFIADRFGWYYLIVVTFFL
Q03DR2_PEDPA/2-485-------------------V......LFGV-----VSIILI.....TG.GPAVQQLMNALLSFVTSKYEWLYISIYVINF
A1WWT9_HALHL/15-504-------------------LTGTATLIVLA-----FLIFGA.....WD.PEYAETVFEGISGWVIETFKWYYIGVVAFFL
Q8NN75_CORGL/48-536-------------------VFGVTAALILA-----FIAWGI.....SS.PDSVSSVSSTMFSWAMTNTGWLLNFVMLIGI
Q4KIJ7_PSEF5/28-512-------------------IFWISGGFFLL-----FLVIAL.....ID.LNTLSSLIGHAFTWSTHYFGLYWQVLMLATF
GBTR_ACIAD/16-498-------------------VFVSTIMIIAI-----FLAIVI.....LA.PDAFELLTQQLKNWITESFSWFYVLSVAFFL
Q4JV07_CORJK/39-530-------------------VVAVTMVITLL-----VAIWAA.....VA.SDNFDSVVGGITGWLTESLGWLYIATVAIAL
Q1GUM7_SPHAL/19-507-------------------VFFVPLMVLLA-----TVMLSL.....WR.GEAVVTAETVINNWILRHFSPLFAGAAIAFL
Q5V5Y7_HALMA/44-539-------------------VFPVALAIIAL-----FIAITI.....LL.GDTAASAYTWLFNTIGDTFGWFYLLAVNVFI
Q4JU17_CORJK/21-505-------------------VTGSAAALILA-----VVLWGV.....FG.GDSFAAFASTALSYVVGDWGWLYVLAGTVFV
Q6ANF3_DESPS/20-505-------------------LFYTTALVTLA-----IVVFGA.....IY.PEILGKYAMAGRAYIADTFGWLYVSIMALCI
A8EUT8_ARCB4/9-492-------------------VFIPAVVFITL-----LVVFTF.....IN.PALSKDIFTTTKNFIADKFGWLYMLSVAIFT
Q1QZD1_CHRSD/9-499-------------------VFWPTFLVLLA-----AVIASY.....VD.LDAFLATASALNDAILTHFSWLFSLGSLYLL
A6VY67_MARMS/19-509-------------------MSYGSILMVGA-----FVLFSI.....LN.VDLSNAIANGINAWIQSNLSWYYIAVVCFVL
Q3IIZ4_PSEHT/14-498-------------------VFLPAVFIILL-----LVIGTS.....SN.PELAGKAFSIALTWITETFGWFYMLSVAIFL
Q5HKM4_STAEQ/12-498-------------------VYTISVLIIVV-----ITLIAG.....IF.PKAFGMYAQSVYDWITNWFGWLFLIIVFILD
Q1AY03_RUBXD/14-498-------------------VFYVSVAVAAA-----FVVWGV.....FF.TESLSAAASAALGYVISNFGWVFVLSTFGFL
Q8ESZ5_OCEIH/13-497-------------------VFYISGGFLIL-----FIILSL.....LS.KDKVGEWVNTLFTYSSDWFGAYWQILLLLNF
Q8ET62_OCEIH/7-489-------------------VFYFAVILVGI-----MVALGA.....IF.PVKFEQISQSVQAWVSSTFGWYYLLLMSVLV
Q1QZU3_CHRSD/9-494-------------------VFIVSALIVAV-----LVAIGA.....AF.PERFGSAASSALSGISHYFGWFYLFSVFGFV
A4FIK1_SACEN/20-504-------------------VFYASVTLCGL-----FVLWAT.....LF.TENLNAVTSTALNRVTGEFGWVYLVSSLGVL
Q8ESH6_OCEIH/15-502-------------------VLFLSGGALLA-----FVILAL.....IN.KEMVTDAVNTMFNWSVTYFGSIYQVLMVGTL
Q9HQN5_HALSA/21-504-------------------LFAVTMAAMLA-----LAVAGF.....RR.PTQLSTVLNGAFDWVLRYFGWWFILLGFVLL
Q6LGN5_PHOPR/6-492-------------------ILLLSLSLTGG-----IALWGI.....AD.TAGLAEFSSTVVGIMFNSRGWFIMLTACLLV
Q6ANF9_DESPS/22-508-------------------LFASTMSFIVL-----VVLCGA.....LF.PDLLYKAGITTMKYLTDRFGWVYMAGSFIYV
A5I0X2_CLOBH/10-487-------------------VFYVSIISLLF-----LLLLAF.....FN.IDAFAKSTKNILNFLLDRFSWFYILVMLSFF
E0TGG2_PARBH/42-529-------------------VFFVSAALILL-----FVSVTL.....LF.QDSASSVLLGARDWVLSTLDWFFVSTINIVL
A1U5B2_MARHV/17-501-------------------VFFSSAAIAAL-----FVALAI.....PF.DQAVASSFGQLTGWVARNLGWFYILAVSSLL
Q5V633_HALMA/130-615-------------------ILAFPVLVFAA-----FFGLQI.....AF.PARTTGAVDAAAATVLRDGGPLFLAAVFLSV
Q5LNL7_RUEPO/27-596-------------------IALFSKAIMVG-----LVLWAL.....VW.PANANGVLGSLNWRLLEDFNVFYIVIVGFFA
Q8FM43_COREF/17-511-------------------VFFSSVGIMVA-----FVIITI.....VA.GDTVSDVFGTASDWLLTNLGWFYVLGVTVFL
A6W731_KINRD/41-528-------------------TFAVAAGVVVL-----FLLVGA.....VW.PEQLQSGADAVLEVVVGDFGWAFVLGATGFV
E0TC76_PARBH/7-483-------------------LSALPYGVVIV-----IAGAAL.....VW.PAVLSRVLRQVSDGFLRNFDWFTLTLTATAL
BETT1_ACIAD/20-509-------------------VFWSSAISISI-----FGMLFV.....LF.PETSQHGLTWIQQQVNQLFGWYYMLVIILSL
Q24SQ4_DESHY/13-501-------------------VFIISALLAVG-----FLLWGV.....VD.SEGLSHVSNTILDYIIQQWGWLFIVGILFFL
A4SA86_OSTLU/1-471-------------------L.......LWG-----FIIWVL.....VD.ETGSSSEVTRWTKWITSNFTWLYVVTQDVWF
B2FT71_STRMK/40-523-------------------VFRVSIALVLL-----LVLLAG.....IA.PGPFNTVVQSMLAEVIRSVGWLYLLVVFLAL
B4EHS6_BURCJ/16-501-------------------VVLLALAVIGA-----LLVVCA.....LH.PSEAGALFSAGQQWVIARFDWFYVLAVTGFL
B7VLA5_VIBTL/13-502-------------------.FFGAIALLLT-----IVFPLI.....LF.PAQGADWIAVAKTFMTDQLGFLYLALGLAAC
B7VQN7_VIBTL/33-520-------------------VFIASVGLSLL-----FIITLL.....ALPPADAKAAIDSIKGAVLSKFDFLFMWGANIML
M1F781_9ALTE/23-507-------------------.LALSVGFIVL-----FVGFSL.....FD.LKGVADLIGTGFAWTAKVFGTYFQILLLATF
M9X2A3_MANHA/17-499-------------------IFLPSLLFVSF-----VAVFCI.....IF.PQQAQTSLDTIKNSLFQHFSWFYIFAGSIFF
Y917_MYCTU/23-509-------------------VFIPASVVIVA-----MIVVSV.....VY.SSVAENAFVRLNSAITGGVGWWYILVATGFV
Q2FW63_STAA8/9-491-------------------VFWVSLVICTI-----FVAFGA.....IF.PKQLEKLTQNITTFIALHFSWYYLLLVLVIL
Q4FTS7_PSYA2/19-509-------------------VFIGSAVISIL-----LIIWTI.....VF.PTYSGALLGAGMAWVSESFGWYYMLVVAAYS
Q6LRW5_PHOPR/30-506-------------------..ALTIGFISL-----FLLAAL.....ID.LPRFTLLIQELFSAAAGQFGFWWQWLMVANF
Q814I8_BACCR/12-494-------------------VFIISGGSLLL-----FVIAVF.....LN.KDYVESAINKSFAFSIKYFGAFWQVLLLGTF
Q81K57_BACAN/7-498-------------------TFIVSLTLCIA-----FTLWGIIPESIIG.KGSLGNVTTAIQTALVSKFGWSYIISVSIIL
Q81YS8_BACAN/8-499-------------------VFYISILLTTL-----FIIWGITPASWIQ.GYDLQSVTSSLNSFILNKFGWFYSLLMTAMI
Q87J97_VIBPA/48-525-------------------VFWLSGSFLSL-----FVLLAL.....TN.TESLTAMVNAGFGFATKYFGAYWQVLLLLNF
Q8DZH9_STRA5/9-487-------------------VFTGSLIVSLI-----LVLLGI.....IV.PRGFQSWTQILREQVSTNFGWLYLLLVTSIL
U5LC86_9BACI/7-489-------------------VFYISVLLLLV-----LVLVGI.....FA.PNQLESVTAGLQDFISNAFGWYYLILVTLLV

PF01566

NRAMB_CAEEL/63-449----------------------------IE------------------------------SD------------------
NRAM2_ORYSJ/90-453----------------------------LE------------------------------GD------------------
NRAM2_DICDI/170-526----------------------------WA------------------------------TD------------------
A5FYD3_ACICJ/37-386----------------------------II------------------------------TA------------------
Q6AKY6_DESPS/42-387----------------------------LA------------------------------SV------------------
Q882X3_PSESM/25-384----------------------------WA------------------------------TA------------------
A4XLU3_CALS8/27-379----------------------------WA------------------------------SN------------------
B2JMU6_PARP8/43-408----------------------------IA------------------------------TY------------------
Q8AA36_BACTN/43-395----------------------------WA------------------------------SN------------------
Q8ESA4_OCEIH/39-387----------------------------VT------------------------------TS------------------
Q3AF37_CARHZ/37-388----------------------------IA------------------------------TY------------------
Q7NSE8_CHRVO/64-420----------------------------FS------------------------------TY------------------
A6LBT1_PARD8/40-392----------------------------WA------------------------------TN------------------
Q8I3M7_PLAF7/268-619----------------------------LE------------------------------KD------------------
A4S7A4_OSTLU/17-379----------------------------FE------------------------------SD------------------
B2UC67_RALPJ/70-426----------------------------FG------------------------------TY------------------
Q5V6I3_HALMA/26-374----------------------------VT------------------------------TA------------------
Q1AYA4_RUBXD/47-394----------------------------FA------------------------------AD------------------
NRAM5_ARATH/90-453----------------------------IE------------------------------GD------------------
Q21Z51_RHOFT/33-398----------------------------IA------------------------------TY------------------
Q1J0H3_DEIGD/66-414----------------------------FA------------------------------TN------------------
Q2GAH9_NOVAD/42-407----------------------------IG------------------------------TY------------------
Q24C68_TETTS/50-400----------------------------LA------------------------------GD------------------
Q01SI9_SOLUE/31-396----------------------------IA------------------------------TY------------------
Q4JWM2_CORJK/25-368----------------------------VA------------------------------AN------------------
Q0S6I8_RHOJR/42-391----------------------------VA------------------------------AN------------------
Q01UU9_SOLUE/52-406----------------------------WA------------------------------TD------------------
MNTH_GRABC/58-408----------------------------FA------------------------------TN------------------
A5FLF3_FLAJ1/44-400----------------------------WA------------------------------TD------------------
A0LSF9_ACIC1/91-445----------------------------VA------------------------------TY------------------
A0LFY7_SYNFM/33-383----------------------------FA------------------------------TN------------------
A2TXR3_9FLAO/37-396----------------------------VT------------------------------SM------------------
MNTH_CHRSD/52-403----------------------------FA------------------------------TN------------------
A6M0Q0_CLOB8/54-403----------------------------FA------------------------------TN------------------
Q2L2L8_BORA1/38-396----------------------------WA------------------------------TD------------------
Q0W8Z5_METAR/41-392----------------------------IT------------------------------TY------------------
NRAM1_DICDI/94-450----------------------------LE------------------------------SD------------------
Q15PP3_PSEA6/27-386----------------------------VT------------------------------AM------------------
Q3IH27_PSEHT/19-373----------------------------IT------------------------------TA------------------
Q89BW0_BRADU/52-418----------------------------IG------------------------------TY------------------
B5E9R2_GEOBB/31-382----------------------------IT------------------------------TY------------------
B4SC14_PELPB/34-385----------------------------WA------------------------------TN------------------
A6W550_KINRD/43-391----------------------------VA------------------------------AN------------------
B0ULW7_METS4/44-412----------------------------IA------------------------------TY------------------
MNTH_CALS4/43-392----------------------------FA------------------------------TN------------------
Q97LD4_CLOAB/40-392----------------------------WA------------------------------SN------------------
Q31GI7_THICR/35-390----------------------------WA------------------------------TS------------------
Q18IT5_HALWD/34-375----------------------------MA------------------------------SL------------------
A9C0V2_DELAS/70-429----------------------------WA------------------------------TS------------------
Q97DZ1_CLOAB/30-381----------------------------IA------------------------------TY------------------
A4CKX6_ROBBH/21-369----------------------------VT------------------------------TC------------------
MNTH_ACICJ/51-400----------------------------FA------------------------------TN------------------
Q5WIT7_BACSK/38-386----------------------------VT------------------------------TA------------------
A2SEC8_METPP/40-393----------------------------WA------------------------------TD------------------
Q5V5I1_HALMA/54-394----------------------------IA------------------------------SL------------------
A5G362_GEOUR/45-396----------------------------IT------------------------------TY------------------
Q7P0J1_CHRVO/53-410----------------------------WA------------------------------TD------------------
B1YM03_EXIS2/34-380----------------------------FA------------------------------MN------------------
Q1IV65_KORVE/40-399----------------------------WA------------------------------TD------------------
Q74JG3_LACJO/54-437----------------------------WA------------------------------AS------------------
Q0SCQ4_RHOJR/43-390----------------------------LA------------------------------SA------------------
Q5FP93_GLUOX/65-424----------------------------WA------------------------------TD------------------
Q3ABN3_CARHZ/35-384----------------------------WA------------------------------AN------------------
Q6A673_PROAC/25-375----------------------------VA------------------------------AN------------------
Q8LKG7_CHLRE/112-473----------------------------WA------------------------------TD------------------
A4FCR3_SACEN/23-373----------------------------LT------------------------------SA------------------
A4XIU1_CALS8/36-387----------------------------IA------------------------------TY------------------
Q3IQM6_NATPD/26-374----------------------------VT------------------------------TA------------------
Q2LVH8_SYNAS/49-400----------------------------IT------------------------------TY------------------
MNTH_NOSS1/49-408----------------------------WA------------------------------TD------------------
B8I817_CLOCE/56-405----------------------------FA------------------------------TN------------------
Q5QVV5_IDILO/23-379----------------------------VV------------------------------TA------------------
A6LYR0_CLOB8/35-386----------------------------IT------------------------------TY------------------
A1A393_BIFAA/49-397----------------------------VA------------------------------AN------------------
A4YWA6_BRASO/74-430----------------------------WA------------------------------TS------------------
A4YYM6_BRASO/41-406----------------------------IA------------------------------TY------------------
B4EFC9_BURCJ/73-427----------------------------.G------------------------------TY------------------
C5B0F9_METEA/57-413----------------------------WA------------------------------TD------------------
C6XTY0_PEDHD/53-406----------------------------WA------------------------------TD------------------
F6HR32_VITVI/38-391----------------------------WA------------------------------AV------------------
K4CQH6_SOLLC/39-392----------------------------WA------------------------------AM------------------
MNTH_ECOLI/38-384----------------------------FA------------------------------TN------------------
MNTH_MYCTU/52-400----------------------------VA------------------------------AN------------------
NRAM1_ORYSJ/56-417----------------------------.E------------------------------TD------------------
Q2YM61_BRUA2/67-424----------------------------WA------------------------------TS------------------
Q63LP7_BURPS/56-403----------------------------FA------------------------------TN------------------
Q8RBX2_CALS4/42-393----------------------------WA------------------------------SN------------------
MNTH_RALSO/56-415----------------------------WA------------------------------TD------------------
MNTH_LISMO/61-418----------------------------WA------------------------------TS------------------
R6A200_9ACTN/11-363----------------------------WA------------------------------SN------------------
R7G054_9FIRM/36-390----------------------------WA------------------------------SN------------------
U5LI50_9BACI/48-387----------------------------..------------------------------..------------------

PF00474

YWCA_BACSU/33-434FYT--AGGGLTGVQNGLAIAGDYMSAASFL------------------------------GI------------------
PANF_ECOLI/36-432YFL--GSRSMGGIVLAMTLTATYISASSFI------------------------------GG------------------
SC5A4_PIG/58-492FFL--AGRDVTWWPMGASLFASNIGSGHFV------------------------------GL------------------
SC5A2_HUMAN/55-492YFL--AGRSMVWWPVGASLFASNIGSGHFV------------------------------GL------------------
PUTP_HAEIN/35-441YIL--GGRRLGSFVTAMSAGASDMSGWLLM------------------------------GL------------------
SC5A1_HUMAN/58-492FFL--AGRSMVWWPIGASLFASNIGSGHFV------------------------------GL------------------
PANF_HAEIN/36-432YYV--GNRSMTGFVLAMTTASTYASASSFV------------------------------GG------------------
PUTP_ECOLI/35-437YIL--GGRSLGPFVTALSAGASDMSGWLLM------------------------------GL------------------
ACTP_ECOLI/63-468YYT--AGGNITGFQNGLAIAGDYMSAASFL------------------------------GI------------------
SC5A3_CANLF/39-477YFL--AGRSMTWVAIGASLFVSNIGSEHFI------------------------------GL------------------

PF02133

YEME_SCHPO/55-506PVPK.SQRVWGPWNYVAFWLADSVNVNTWM------------------------------IA------------------
FCY22_YEAST/73-491PVTEDEKNDDSILNAATIWFSANMVIVAYS------------------------------VG------------------
ALLP_BACSU/20-456PLGQ.EKRTWKAMNFASIWMGCIHNIPTYA------------------------------TV------------------
FUR4_YEAST/103-562PVEK.ERRVWSWYNYCYFWLAECFNINTWQ------------------------------IA------------------
YXLA_BACSU/10-428YIPN.EERHGKAKDLFPVWFGANMHITTLV------------------------------TG------------------
Q9ZBQ0_STRCO/18-445QVPD.HERTARTRELFPTWVGANISVLLLT------------------------------MG------------------
CODB_ECOLI/11-398PVPQ.SARKGVLALTFVMLGLTFFSASMWT------------------------------GG------------------
ALLP_ECOLI/19-457PKTQ.SQRTWKTFNYFTLWMGSVHNVPNYV------------------------------MV------------------
O86506_STRCO/10-448TIPE.AERTSGPRDLVSILLGSNLCLGVIV------------------------------FG------------------
FUR4_SCHPO/48-499PVPP.SKRLWGPWNFISFWLADAVNINTWM------------------------------IS------------------
FCY21_YEAST/73-489PITEDEKTDDSILNAASMWFSANMVLPAYA------------------------------IG------------------
FUI1_YEAST/119-575PVEA.KRRTWTWKQYIFFWISGSFNVNTWQ------------------------------IS------------------
DAL4_YEAST/105-564PVEE.ERRCWSWFNYLYFWLADCFNINTWQ------------------------------IA------------------
O69811_STRCO/47-491PVPV.EGRTWTTYNFSALWVGMAHNTASWT------------------------------LA------------------

PF00324

BAP2_YEAST/99-567-------------------HVVMMSLGTGI-----G.-.-----TG-----------L--LV--------------ANAK
GABP_BACSU/16-456-------------------HMTMISIAGVI-----G.-.-----AG-----------L--FV--------------GSGS
S12A9_HUMAN/42-536-------------------GVVVPTVLSMF-----S.-.-----IV-----------V--FL--------------RIGF
HUTM_BACSU/19-465-------------------HLFMISLGGVI-----G.-.-----TG-----------L--FL--------------STGY
LYSP_ECOLI/21-480-------------------HLTMIAIGGSI-----G.-.-----TG-----------L--FV--------------ASGA
AGP3_YEAST/57-511-------------------HISLLALGGVI-----G.-.-----PG-----------C--LV--------------GAGN
S12A1_MOUSE/178-682-------------------GVLVRCMLNIW-----G.-.-----VM-----------L--FI--------------RLSW
CYCA_ECOLI/27-470-------------------HIQLIAIGGAI-----G.-.-----TG-----------L--FM--------------GSGK
GABP_ECOLI/18-458-------------------HVTMLSIAGVI-----G.-.-----AS-----------L--FV--------------GSSV
ISP5_SCHPO/87-545-------------------HIQMIGIGGAI-----G.-.-----TG-----------V--WV--------------GSKN
TPO5_YEAST/59-532-------------------GSIVGLGLGLM-----SP-V-----LG-----------M--CT--------------SMAI
PUT4_YEAST/114-588-------------------HVQLIALGGAI-----G.-.-----TG-----------L--LV--------------GTSS
AGP2_YEAST/92-565-------------------HVQLIAISGVI-----G.-.-----TA-----------L--FV--------------AIGK
GAP1_YEAST/94-560-------------------HLQMIAIGGAI-----G.-.-----TG-----------L--LV--------------GSGT
Q9HKE0_THEAC/16-471-------------------DLVFQGLGQIT-----P.-.-----IT-----------I--LS--------------GLIV
Q98QR4_MYCPU/13-498-------------------VALSMLLGSVV-----G.-.-----IG-----------I--FF--------------KNGS
Q9HJ13_THEAC/2-455-------------------HGIFQSMGQVA-----P.-.-----AA-----------D--IA--------------ILLV
ANSP_SALTY/34-477-------------------QVQMIAIGGAI-----G.-.-----TG-----------L--FL--------------GAGA
Q9VTW8_DROME/217-716-------------------GVLVRCLLNIW-----G.-.-----VM-----------L--FL--------------RLSW
Q97VA6_SULSO/25-513-------------------DALWFNIAL..-----..-.-----LG-----------L--LF--------------STYY
ALP1_YEAST/74-540-------------------HIGMIALGGTI-----G.-.-----TG-----------L--II--------------GIGP
AROP_ECOLI/19-457-------------------HIQLIALGGAI-----G.-.-----TG-----------L--FL--------------GSAS
F1MS08_BOVIN/282-784-------------------GVLVRCMLNIW-----G.-.-----VM-----------L--FI--------------RLSW
G9NX48_HYPAI/69-534-------------------HLHMIAIGGSI-----G.-.-----AG-----------F--FV--------------GSGG
S12A3_MOUSE/139-644-------------------GVMIRCMLNIW-----G.-.-----VI-----------L--YL--------------RLPW

PF13520

Q5AQY0_EMENI/33-501-------------------LSTLDVACLII.....NK.M.....IG...GG......I..FV...SPR......IVAHLT
Q75CJ2_ASHGO/54-501-------------------LGLFSTVVMFV.....SR.I.....VG...SG......I..FA...TPS......TMFVNC
Q03U70_LACBA/18-459-------------------ITGFQLFSMTT.....SM.V.....MT...VY......G..FA...A...........FAK
A8AGY3_CITK8/5-447-------------------LGLSALTALVL.....SS.M.....LG...AGVFSLPQN..MA...A...........VAS
A1T4X6_MYCVP/25-447-------------------LGLAALTALVV.....GS.M.....IG...SG......I..FA...LPSQ.....MAGSAA
C1DD80_LARHH/11-459-------------------LKLPALTALVV.....GS.M.....IG...GGI....FS..LP...QN.........MAAG
D6S3T3_9LACO/11-440-------------------VGLGGLTGLIV.....GG.T.....IG...SG......IFALP...ATL.......TAGAN
C9SVT9_VERA1/51-488-------------------LSWQSAYILVI.....SR.V.....IG...SG......I..FA...TPGS....IVRAVGS
B8PBB2_POSPM/39-484-------------------LGLLQNFGVSF.....SI.I.....SV...IT......G..VS...SLF......LYGLTT
Q0CXR8_ASPTN/61-493-------------------FSLWTTFCVSF.....AV.LGLLPSFA...ST......I..YY...G...........MGY
Q6CAR8_YARLI/33-481-------------------FSMLQVFGIAF.....SI.M.....GL...LP......S..IA...T...........TLS
C7N1A7_SLAHD/31-475-------------------LFWKQVVFLAL.....GA.P....ALV...LF......N..MG...G...........VSS
A1CLI4_ASPCL/51-499-------------------LNWSSAYILVI.....SR.V.....IG...SG......I..FA...TPGS....IVKSVGS
A3GHP8_PICST/45-486-------------------IGYVSATFLML.....NR.MLGAGVFS...TG......S.TIF...A..........LSGS
B2AVM0_PODAN/75-550-------------------LGTWSTAFLII.....NR.V.....VG...AG......I..FS...TPSS....IILSINS
Q6CLW2_KLULA/73-522-------------------IQVFGVAFSIM.....GL.L.....PS...IA......S..VL...S...........LAL
Q12TS7_METBU/31-468-------------------IDWKQGLAIAI.....GVPL.....LI...LP......S..IG...Y...........FAS
A8I1F7_AZOC5/21-530-------------------IDWRGAFWVAS.....GV.PAL.VLFS...IG......G..I................AGT
Q75DM0_ASHGO/48-484-------------------LGLFSSIGLIC.....NR.M.....LG...TG......I..FV...VPA.......KIFQL
A2R9I4_ASPNC/39-488-------------------YSTVQVFAIAF.....SI.M.....GL...LP......S..IA...T...........TLS
A0A0D1E072_USTMA/62-513-------------------FSTISYAFAIM.....GL.V.....SS...VA......T..TF...NS.........PFTL
C8VPT6_EMENI/44-469-------------------LGLLSTTFLIT.....NR.MIGTAIFS...TP......S..AI...AA.........SVGS
A3LTS7_PICST/18-462-------------------LDYVSAFYMVI.....QG.I.....IG...TG......I..FL...TPAS....VLNSIGS
C5MEY2_CANTT/54-503-------------------FNLWSTCAFQY.....TL.ICSSLAIG...TF......L..ST...V...........IGV
A5FG51_FLAJ1/9-423-------------------LNQLQATAICG.....ND.I.....SS...SC......L..YV...SA........LTILY
Q4DJK0_TRYCC/39-456-------------------LTTLTLLGVIY.....TA.SIS.GGYG...LE......E..SV...S...........AGG
Q4DQR3_TRYCC/175-589-------------------LGQLRATAIAG.....NE.IAS.SCIY...AT......G..IV...V...........SAA
Q73M42_TREDE/10-421-------------------LNLFNIFSLGF.....GG.A.....VG...SG......I..FV...LTG.......LGIAA
Q2UFR9_ASPOR/43-476-------------------LGLVSTTFLITNRMIGTA.I.....FS...VP......S..AI...AH.........STGS
Q023N1_SOLUE/24-483-------------------ISFWRAAAIVL.....SD.L.....AS...SA......F..YA...GG.........IAEH
B8NAK1_ASPFN/43-512-------------------FSWVGAIGLSF.....SI.ANSWLGYG..ATF......G..TP...L...........AYG
Q98PQ8_MYCPU/7-477-------------------FSYLSVIIFVV.....GS.T.....IG...AG......I..FF...KNRE.....LLRMAH
Q38YR6_LACSS/23-445-------------------LGRFKALAMLS.....SD.ALSSVAYG...TE......E..IV...V..........VLTT
B0D4Q4_LACBS/41-461-------------------LGQFTASALAG.....ND.I.....LGG.IFY......V..IP...A..........VVGV
Q6MS69_MYCMS/8-487-------------------LEFLTLFAMTI.....GS.V.....VG...AG......V..YF...KNKE....ILFDTRN
Q01XN7_SOLUE/23-483-------------------ISFWRAAAIVL.....SD.L.....AS...SA......Y..YVGGIA...........EGA
D0NVC6_PHYIT/66-486-------------------LGEWTSTSISG.....NA.I.....LS...SV......L..FS...AG........QTIAK
A0A0D1E844_USTMA/272-694-------------------LGQWKASAIAG.....NA.V.....TGS.VFY......A..LP...A..........VVAV
Q1IPP3_KORVE/22-486-------------------ISFWRAAAIVL.....SD.L.....AS...SA......Y..YV...GG.........DAEK
Q6F2A1_MESFL/11-481-------------------FEFLTLFVMVI.....GT.V.....IG...SG......I..YM...KNSE....LLNQTNN
Q8EVP3_MYCPE/28-507-------------------ISFISAILIVI.....GS.C.....IG...SG......I..FL...KSSS....ILSNTWY
Q6KI68_MYCMO/24-546-------------------IGFLSVILLTI.....GS.S.....IG...AG......I..FF...KNNEVVRNATFLN.N
Q97VA8_SULSO/20-502-------------------VSPWASFFATF.....GL.V.....TG..GIP......I..LI...VS........WLYLA
E9DET5_COCPS/69-502-------------------IGVFTATFLVF.....NR.I.....IG...TG......I..FA...TPST....ILALTGS
G8PMP4_PSEUV/13-449-------------------ITLWHLVFMTT.....AL.F.....MT...ML......N..MP...L...........MAQ
Q0JZA8_CUPNH/34-490-------------------LTWKDAFWVTS.....GV.P.....AG...VL......F..TI...GG.........VSAT
Q4AAQ0_MYCHJ/13-424-------------------...RQFIFYGL.....NY.I.....VG...FG......F..IA...TI........SNVIS
Q4WA88_ASPFU/42-486-------------------LNFFSTLAFSA.....TL.M.....ASWETVG......G..SI...AA.........GLLN
Q5ZUY4_LEGPH/12-429-------------------LSVLSLALITV.....CS.V.....DS...IR......N..LP...A...........AAL
Q6MS71_MYCMS/8-466-------------------FEFLTLFMMSV.....GT.I.....VG...SG......I..YV...KNR......DILIET

PF03845

GERBB_BACSU/7-331------------------KLTFMQTLIMIS-----ST-L-----IG---AG---------VL--------------TLPR
Q9KCW4_BACHD/8-324------------------TVPPFMVFFLIH-----SM-Q-----VG---VG---------VL--------------GFQR
Q97IW3_CLOAB/3-323------------------HLSKHQLFTLTF-----IF-Q-----IG---ST---------PL--------------FALG
GERKB_BACSU/5-326------------------RISIRQLFVMII-----IF-E-----LG---SS---------LL--------------ITPG
Q97LG4_CLOAB/8-327------------------YLSASQITFLMF-----SS-L-----IG---VG---------FT--------------YLPI
Q97E18_CLOAB/4-325------------------KICSKQMFSLIV-----LC-V-----LG---SS---------II--------------FFLN
Q9KCH3_BACHD/10-327------------------LVSTGMTFFLVH-----GM-Q-----VG---IG---------AL--------------SFQR
GERAB_BACSU/9-331------------------KLNTFQGISIVA-----NT-M-----LG---AG---------LL--------------TLPR
Q9KBD6_BACHD/8-337------------------TIDPLEISIALI-----AF-I-----IG---VG---------IL--------------TLPG
YNDE_BACSU/7-329------------------KITTAQATIIII-----NY-M-----LA---AG---------VL--------------TLPR
Q9KAU9_BACHD/3-321------------------YLSVKQTVVLIV-----MI-Q-----VG---VG---------IL--------------SLPA
Q97TS5_CLOAB/3-323------------------RLSKHQLFTLIF-----VF-E-----VG---ST---------PI--------------FALG
Q9KBJ1_BACHD/6-327------------------TISTYQFFSMIV-----LF-E-----LG---SA---------IV--------------VGVG
Q7BYC0_BACCR/8-329------------------RITTSQAVVIIV-----NY-I-----LG---TG---------IL--------------TLPR
Q816T5_BACCR/10-327------------------QISPIFVFFLIH-----GA-Q-----FG---AG---------VL--------------GFAR

PF01235

B2UL98_AKKM8/57-460ALKLYFVKDH...TDK.GDISPFSSLMVAL-----AA-N-----IG---AG------N--II--------------GVGV
C4L2J1_EXISA/48-448LL...FVKGI..KHEK.GQVSSFQAFAIGT-----AA-R-----VG---TG------N--IA--------------GVST
Q7VL62_HAEDU/56-459EM...WGGRN...TKG.ESLTPFQAFTTGL-----AS-R-----VG---VG------N--IA--------------GVAT
B7GI15_ANOFW/49-449VL...KEKSPE.GKGK.QEISSLQAFFIGA-----AT-R-----IG---TG------N--VA--------------GVAM
R6ESR6_9FIRM/49-458VI...AEPKK....DK.DSISSFQALMVST-----AS-R-----VG---TG------N--IV--------------GVTG
R7ANW3_9CLOT/47-452VV...KEPSV....DK.ESISSFQALMVST-----AS-R-----VG---TG------N--IA--------------GIST
D4G8V3_RIEPU/46-454IL...RGSNK...SNK.SGISSFQALCTTL-----AS-R-----VG---TG------N--LT--------------GVAI
F0P236_WEEVC/46-470LL...FSSQN....SK.EGITPFQAFSLAI-----SG-R-----VG---TG------N--II--------------GVAT
X5D863_9BACT/54-454....KYDDPN....EA.GQLRHYQALSTAL-----AG-T-----VG---MG------N--IS--------------GVAV
R6R064_9FIRM/47-469ALKYMVKNEE...GGS.GEVTSFGALCTAL-----SA-T-----IG---TG------N--IV--------------GVAT
Q9K9D4_BACHD/47-446LM...KESPST.SDGK.KRVSSFGAFCISA-----AS-R-----IG---TG------N--LA--------------GVAI
R5WSV7_9FIRM/52-454......TKDP...DAE.GEVSQFGALTTAL-----AS-T-----IG---TG------N--II--------------GVGT
K9TIM8_9CYAN/96-500....HYDDPA...E.A.GEVSHFQALAAAL-----SA-T-----VG---LG------N--IA--------------GVAI
R5JXV6_9CLOT/55-564......ARKK...KGT.GDVSPFSALTTAL-----AA-T-----IG---TG------N--IV--------------GVAT
W5WYR9_9CORY/49-452AV...TEKPH..TKGT.KDISAFQAFSISA-----AS-R-----VG---TG------N--IV--------------GVAI
Q65J05_BACLD/49-446IV...GQ..K..EEKG.KGVSSLQAFFISA-----AS-R-----VG---TG------N--LT--------------GVAL
W8U6M9_EUBAC/78-495YL...FGGGD....SS.SRVSSFQAFAMSV-----AG-R-----VG---TG------N--IA--------------GVAT
F2F7Q9_SOLSS/49-467LM...FKGEK....SE.AGVSSFQALSIAL-----SG-R-----VG---TG------N--IV--------------GTAT
Q9HXZ0_PSEAE/50-449VL...KGSRQ...SDD.SGISSFQALCTSL-----AA-R-----VG---TG------N--VA--------------GVAV
Q5WIK8_BACSK/48-446AV...TEKKT....KK.GEVSAFQAFCISA-----AS-R-----VG---AA------N--IS--------------GVAI
X2GW49_9BACI/46-479LM...FKGEK....SE.KGISSFQAMSIAL-----SG-R-----VG---TG------N--IA--------------GTAT
Q81XE8_BACAN/56-451.......NRK..EKKK.DSISPFQAFCLSA-----AA-R-----IG---IG------N--LA--------------GVAL
W6RX75_9CLOT/46-448LL...TEGTS..KDDK.DGISSFQAFCMST-----AS-R-----VG---TG------N--LA--------------GVAL
R5R740_9FIRM/57-453.....KEKSH....HD.DGVSSFQALMIST-----AS-R-----VG---TG------N--IA--------------GVAT
R5TDP1_9FIRM/46-451LV...MEKPQ....NE.GAVSPFHALMVST-----AS-R-----VG---TG------N--IL--------------GVST
Q7VFP4_HELHP/49-454VL...NERSH.....Q.KHISPFGALMIST-----AS-R-----VG---IG------N--IV--------------GVSI
Q082X4_SHEFN/49-451VM...KGSTQ...GDK.SGISSYQALCTGL-----SA-R-----VG---TG------N--LA--------------GVAM
Q2YKB0_BRUA2/46-452VV...FAAGR...RDE.AGISPFQALTISI-----AS-R-----VG---TG------N--IT--------------GVAV
H5XB24_9PSEU/93-523IVRGKFTRSD...E.P.GEITHFQALSSAV-----SG-T-----VG---LG------N--IA--------------GVAV
X5E8D3_9CORY/44-457QL...RQSKT....TD.GGLSSFQALALTL-----SS-R-----VG---VG------S--IA--------------GVAT
D9S9M5_FIBSS/46-477ALRFMAHSEK...DGA.GEVSSFGALCTAL-----AA-T-----IG---TG------N--IV--------------GVAT
V9XJ86_9NOCA/53-454........PERQPNGE.PGLSAFRAFSVSA-----AS-R-----VG---TG------N--VA--------------GVAI
R6W8F8_9FIRM/60-481VKSMGKNKKD...KRS.NAVSQFEAFSAAI-----SG-T-----VG---TG------N--II--------------GVTS
E6WQ83_PSEUU/46-484LT...VTGQK....SD.AGVSSFQALAISM-----AG-R-----MG---IG------N--IA--------------GVAT
S6CD23_9ACTN/53-462QL...TEKKH..VQGE.KSISSFQALMVST-----AS-R-----VG---TG------N--IA--------------GIAT
R6LRJ9_9FIRM/49-461LL...TSKED....SE.SGITPFQAFATTV-----GA-R-----VG---MG------N--IA--------------GVAS
A8ALU9_CITK8/48-455SL...KNSIH...PQP.GGLTSFQALCTSL-----AA-R-----IG---SG------N--LA--------------GVAL
Q8P616_XANCP/46-481LT...VGGQK....SD.AGVSSFQALAMSM-----AG-R-----IG---IG------N--IA--------------GVAT
C7N1V2_SLAHD/52-464QI...GEKKH..VEGE.KSVSSFQAMMIST-----AS-R-----VG---TG------N--IA--------------GVAV
E6UF74_RUMA7/48-472..KYMFKDEE...SGS.GEVSGFQALCTAL-----SA-T-----VG---TG------N--IV--------------GVAT
T2KIQ3_9FLAO/49-458VLRGKFDNPD....DP.GEISHFQALTTAL-----SA-T-----VG---MG------N--IA--------------GVAV
A4FJA3_SACEN/90-513....KYTSKD...E.P.GEINHFQALSSAL-----SG-T-----VG---LG------N--IA--------------GVGV
U5Q4A6_9BACT/51-446......TKDK...GAN.GDVSQFGALATAL-----AA-T-----IG---TG------N--IV--------------GVAT
R6QL56_9FIRM/55-463......SRKK...DGE.GDISPFSALMTAL-----AA-T-----VG---TG------N--IV--------------GVAT
A6T4E7_KLEP7/30-437SL...KKSLH...PQP.GGLTSFQALCTSL-----AA-R-----VG---SG------N--LA--------------GVTL
Q6A6W4_PROAC/89-503VMRGHFSRHT...D.P.GDVTSFQALATEL-----SG-T-----VG---LG------N--IA--------------GVAI
Q3IIL7_PSEHT/49-553QVVSGKFDKK...DTE.GDTTHFQALATAL-----SG-T-----VG---TG------N--IG--------------GVAL
K4KVJ9_SIMAS/53-454VM...KGSLR...SNK.LGISPFQALATSL-----AA-R-----VG---TG------N--LA--------------GVAV
Q62ZC8_BACLD/50-447VL...KEG....TPDK.NGISPFQAFCISM-----AA-R-----VG---TG------N--IT--------------GIAI
D4KIB6_9FIRM/53-452........DAGNKMEG.QQISSFQAFCVST-----AS-R-----VG---VG------N--IA--------------GIAI
R6GRJ8_9CLOT/56-455LL...GEGSS..SSEK.GSISSFQAFCIGT-----AS-R-----VG---TG------N--LA--------------GVAT
R5BT56_9FIRM/49-463LL...VKADP...DSK.SGITPFQAFATTV-----GS-R-----VG---MG------S--VA--------------GVAT
GLNT_BACSU/50-449VL...REGAA..SRSK.NSISPFQAFCISM-----AA-R-----VG---TG------N--IT--------------GIAI
C7NKM3_KYTSD/76-484....RFNRRT...D.P.GEITSYQALATEL-----SG-T-----VG---LG------N--VA--------------GVAV
Q65UI6_MANSM/65-468EM...WFGRE...VQG.DSLTPFQAFATGL-----AS-R-----VG---VG------N--IS--------------GVAT
Q9KPL1_VIBCH/46-453VL...KNSRK...ADN.AGISSFQALCTSL-----AA-R-----VG---TG------N--MA--------------GVAV
C4LCJ4_TOLAT/45-452VL...KHSTV...SDA.AGISSFQALCTGL-----AA-R-----VG---TG------N--LA--------------GVAV
A8F9M4_BACP2/46-444VL...KEG.T..NKQK.SGVSPFQAFAISM-----AA-R-----VG---TG------N--IT--------------GIAI
I0JJ89_HALH3/58-455......KEKK...NEK.GDISHYQALTTAL-----AA-T-----IG---TG------N--IA--------------GVAT
R7AGI4_9CLOT/50-474.....IIDKS...ESE.SGISSFASFCTTM-----AM-R-----VG---TG------N--VA--------------GVAV
B2FSE0_STRMK/46-482LT...VKGEK....SD.AGVSSFQALAMSM-----AG-R-----MG---IG------N--IA--------------GVAT
F2I8L7_AERUA/50-455VI...MEKPE....KE.DSVSSFQALMVST-----AS-R-----VG---TG------N--IV--------------GVST
H2IRW6_RAHAC/47-451TL...YKQKH....TA.RGISPWRALCLSL-----AS-R-----IG---TG------N--LT--------------GVAI
Y183_HAEIN/59-462EM...WFGRS...VEG.SSLTPFQAFTTGL-----AS-R-----VG---VG------N--IG--------------GVAT
Q87U15_PSESM/43-445VF...RDSLR...SSA.GQLSSFQALMLSL-----AG-R-----VG---AG------N--IA--------------GVGI
G4QHN1_GLANF/78-481LL...KGSSK...SDA.AGISSFQALCTSL-----SA-R-----VG---TG------N--LA--------------GVAV
V4J7M3_9DELT/49-455VL...LNKGD..NSGK.REISGRQALLLSV-----GG-R-----VG---GG------N--IA--------------GVAV
D5UBK7_CELFN/48-455QI...ASSRE...DAA.GGISSFQAFTVGL-----AS-R-----VG---TG------N--IA--------------GVAV
C1DD85_LARHH/46-459LM...VEGKA....DG.QGVSSFQALSISL-----SG-R-----VG---TG------N--IA--------------GVAA
F0RL19_DEIPM/47-463LL...RDGQS....SN.EGVSSFQALAMAL-----AG-R-----VG---TG------N--IA--------------GVAT
R5WS38_9FIRM/54-459VV...MEPKD....DE.KSISSFQALMVST-----AS-R-----VG---TG------N--IA--------------GIST
K0B2L5_CLOA9/50-448VI...TEKNT.ITDDG.ESISSFQAFCVST-----AS-R-----VG---AG------N--LA--------------GVVA
F2JU21_MARM1/46-472LL...FNSNE....SS.EGISSFQALAVSL-----SG-R-----VG---VG------N--IA--------------GVAA
D1B800_THEAS/50-454VT...LGGRK...SQE.GGISSFQALCTGL-----AA-Q-----VG---TG------N--LA--------------GVAT
R5Q6J7_9BURK/79-476.........ATAKTKK.GHISTFQAFCVST-----AS-R-----VG---VG------N--IA--------------GIAI
R6NH81_9FIRM/47-453VL...KEKAGE.ENGK.KQVSSFQALMIST-----AS-R-----VG---TG------N--IA--------------GIAT
Q81XD8_BACAN/54-450......LTGK..TRKK.GSVSSFQAFCMSS-----AA-R-----IG---IG------N--LA--------------GVAL
I3UGH4_ADVKW/46-460LL...RERKE....SA.DGISSFQAFCMAL-----SG-R-----VG---VG------N--IA--------------GVAT
D6XWG3_BACIE/52-446.....TKGDQ...VSK.GDITHFQALMTAL-----AA-T-----VG---TG------N--IA--------------GVAS
Q3AFY7_CARHZ/46-459LL...FGGQS....SE.KGVSSFQAFAMAV-----AG-R-----VG---TG------N--IA--------------GVAT
R5HBJ9_9FIRM/53-457VV...SEKPK....TK.GSISSFGALMIST-----AS-R-----VG---TG------N--IV--------------GVST
A0M410_GRAFK/284-691LAKGKFDNPD...A.P.GTITHFQAMATAV-----SA-T-----VG---LG------N--IA--------------GVAV
R6ALH3_9FIRM/50-450....IFKAQN...KGN.GDIDSFKALCTAL-----SA-T-----VG---TG------N--IV--------------GVAT
W5Y2T0_9CORY/46-478QL...VRGEK....SE.NGVSSFESLMMSL-----AG-R-----VG---VG------N--IA--------------GVAT
R5I5H2_9BACT/50-447.....VTKDK...TEH.GDVSQFGALATAL-----AA-T-----IG---TG------N--IV--------------GVAT
Q8EN00_OCEIH/57-451..........FDASGK.KGTSSFQAFAISA-----AS-R-----VG---TG------N--MA--------------GVAS
Q5P2T3_AROAE/46-460LM...FQGKS....SD.AGVSSFQALAIAL-----SG-R-----VG---TG------N--IA--------------GVAT
Q7DDS6_NEIMB/53-458EM...LGGRKQ.GDDP.HGITPFQAFVTGL-----AS-R-----VG---VG------N--IA--------------GVAI
Q0SCP0_RHOJR/50-470QL...KESSE....GE.GGLSSFQALVLAL-----AS-R-----VG---VG------S--IA--------------GVAT
R5G5T4_9FIRM/48-470SLKDMVSNDD...SGD.GEVSSFGALCISM-----AA-T-----LG---TG------K--II--------------GVAT
D1BPB8_VEIPT/50-451LV....INGAGSSTEK.NHVSSFQAFCVST-----AS-R-----VG---VG------N--IA--------------GIAI
E3GK02_EUBLK/49-466VL...K.GNG...DTS.DGITPFQAFATAL-----GA-R-----VG---VG------N--IA--------------GVAT
A8FFK0_BACP2/49-450SI...FEKAPKTKKGS.HEISSMQAFFIGA-----AT-R-----IG---TG------N--MA--------------GVAI
D3EDV3_GEOS4/50-449VI...REP.K..SKTK.GSISPFQAFAISM-----AA-R-----VG---TG------N--IT--------------GVAL
B4E614_BURCJ/50-453LV.....GSK...GEP.GSISSFQAFATGL-----AS-R-----VG---TG------N--IA--------------GVAV
Q07Z28_SHEFN/49-454VL...AISRR...PGK.HGLSSFQVFCTSM-----AA-R-----VG---AG------N--MA--------------GVAV
E3H6D6_ILYPC/48-461LM...FKGNA....SE.KGISSFQALAISI-----SG-R-----VG---TG------N--IA--------------GVAT
U5L5G5_9BACI/46-460LM...FKGKS....SD.AGVSSFQALSIAL-----SG-R-----VG---TG------N--IA--------------GTAT
F4CF94_SPHS2/46-459LL...FGSKS....SD.QGVSSFQAFAIAL-----SG-R-----VG---TG------N--IA--------------GVAT
Q15SP8_PSEA6/49-451VM...KGSNK...SDK.AGISSFQALCTSL-----SA-R-----VG---TG------N--LA--------------GVAV
R7J9J1_9FUSO/75-484......IRVK...KKK.GEVSSFQALTATI-----SA-S-----AG---IG------N--VA--------------GSAA
D3FUF0_BACPE/53-450VI...TEK....KDGN.KGISAFQAFTIST-----AS-R-----VG---TG------N--LA--------------GVAI
Q2SF65_HAHCH/43-445LV...RRSMK...ESQ.DQINSFQALSLTL-----AG-R-----VG---AG------N--IA--------------GVAI
F4HCM3_GALAU/54-452NV...........DRK.HAISPFQAFVTGL-----AS-R-----VG---VG------N--IA--------------GVSL
R6I317_9FIRM/51-457VV...SEKPK....DK.RSVSSFGALMVST-----AS-R-----VG---TG------N--II--------------GVST
Q5L341_GEOKA/47-461LV...TTGKG....SE.AGVSSFQALTMSL-----SG-R-----IG---VG------N--VA--------------GTAT
Q92P60_RHIME/46-452VL...SRGGS...KDA.AGISPFQALMVSL-----AS-R-----VG---TG------N--LA--------------GVAV
R5EKL7_9GAMM/58-457......NGEK...AGN.HGMTSFQSLATAI-----AA-Q-----VG---TG------N--LA--------------GVAT
R6TGR9_9FIRM/48-453.V...GERPE....KE.GAVSSFQALMVST-----AS-R-----VG---TG------N--IV--------------GIST
R7AEN1_9ACTN/55-464QL...FEKKV..DKNG.KAISSFQAMMVST-----GS-R-----VG---TG------N--IA--------------GIAT
R7MEC6_9CLOT/86-499VAKPTEKSED...GNC.GEVSSFQALATAL-----SG-T-----IG---IG------S--IA--------------GVAI
Q5E0L3_VIBF1/46-471LL...ISNKE....SS.KGISSFQALAVSL-----SG-R-----VG---TG------N--IA--------------GVAA
F8EJC0_RUNSL/46-459LL...FRGKA....SA.KGVSSFQAFAIAI-----SG-R-----IG---TG------N--IA--------------GVAT
B0UUP4_HISS2/57-460EM...WFGRA...VQG.QSLTPFQAFTTGL-----AS-R-----VG---VG------N--IG--------------GVAT
B2TML1_CLOBB/54-451.......VTS..ERKK.GSVSSFQAFCIST-----AS-R-----VG---TG------N--LA--------------GIAI
Q3IIM2_PSEHT/46-453VM...FLSRR...GSG.DGISSFQAFCTSL-----AA-R-----VG---TG------N--MA--------------GVAV
R7CQS6_9FIRM/53-452........TAGTKTEG.NEISPFQAFCVST-----AS-R-----VG---VG------N--IA--------------GIAI
R6YML2_9FIRM/50-472...WMVKNEE...GGE.GEISSFSALCTAL-----SA-T-----IG---TG------N--IV--------------GVAT
Q6ANS0_DESPS/50-451VL...RLGRE....RV.EGISSFQVFCTSM-----AA-R-----IG---TG------N--IA--------------GIAL
R6GE77_9CLOT/48-451SL...TEKAE.....K.GKVSSFKSLMIST-----AS-K-----IG---VG------H--IA--------------GIAS
D7AX43_NOCDD/60-469VL...KSKPETAPDGG.KAVSSIQAFMISA-----AA-R-----IG---TG------N--IV--------------GVAV
R5D3A3_9FIRM/51-467VV...SEKPK....EK.GSVSSFGALMVST-----AS-R-----VG---TG------N--II--------------GVAS
R6C274_9BACT/50-448.....VKKDK...NAT.GDVSQFRALATAL-----AA-T-----IG---TG------N--II--------------GVAT
D4M6E0_9FIRM/62-465SL...NSKKG....KE.DGLSNFQTLIVST-----AT-R-----VG---MG------N--LV--------------GVVA
YAAJ_ECOLI/46-453SL...KNSIH...PQP.GGLTSFQSLCTSL-----AA-R-----VG---SG------N--LA--------------GVAL
D5VAX7_MORCB/46-475LL...FSGNQ....SP.EGISSFQALTVSL-----SG-R-----VG---MG------N--IA--------------GVAA
E3EA98_PAEPS/47-461LV...FKGKS....SE.AGVSSFQAFTMAL-----SG-R-----VG---TG------N--IA--------------GIAL
D4LQM0_9FIRM/62-464AL...VEKKQ....DK.NSLSSFQTLIVST-----AT-R-----VG---MG------N--LV--------------GVVA
H2FXG2_OCESG/46-453VL...KHSRQ...SDA.AGISSFQALCTSL-----AA-R-----VG---TG------N--LA--------------GVAV
R5PRI2_9BACT/50-447.....IKRDK...DAS.GDVSQFGALATAL-----AA-T-----IG---TG------N--II--------------GVAT
J7L7G1_NOCAA/49-457VI...RGKAGTAPDGG.KEISPFQAFAISA-----AA-R-----VG---TG------N--IV--------------GVAT
R6VAG6_9FIRM/47-469ALKFMVKNEE...GGK.GEVSSFGALCTAM-----SA-T-----IG---TG------N--IV--------------GVAT
Q6ANS1_DESPS/56-454.....RAGRE....KV.NGISSFQVFCTSM-----AA-R-----VG---TG------N--MA--------------GVAV
K0J6Z8_AMPXN/55-453.....KKGDR...ADA.DGMSSFQALATAI-----AA-Q-----VG---TG------N--IA--------------GVAT
I3TIY8_TISMK/49-454VL...GRGAN..NADP.NAISAREALLVSV-----GG-R-----VG---GG------N--IA--------------GVAV
Q81PH5_BACAN/46-459LL...FEGKS....SE.TGISSFQAFCLAL-----SG-R-----VG---IG------N--IA--------------GVAT
Q1GL91_RUEST/49-450VL...TRGRT....DT.GQISAREALLVSV-----GG-R-----VG---GG------N--IA--------------GVAV
C4L110_EXISA/50-450LL...FKEGT..EREK.GQVSSFQAFAIGT-----AA-R-----VG---TG------N--IA--------------GVAT
G0VQI3_MEGEL/43-446ALKLIFTAKN...QGE.GDVDSFKALCTAL-----AA-T-----VG---TG------N--IV--------------GVAT
B4S4I7_PROA2/112-519....VYDAPD...QQG.GEVSHFQALTAAL-----SA-T-----VG---LG------N--IA--------------GVAV
R5EMW4_9CLOT/55-557......RTKS...RGE.GDVSPFSALTTAL-----AA-T-----IG---TG------N--IV--------------GVAT
C7RF91_ANAPD/49-453VI...KEKPK....DE.SDVSSFQALMIST-----AS-R-----VG---TG------N--IV--------------GVSS
B9E978_MACCJ/46-490LM...FQGEK....SP.TGISSFQAIALSL-----AG-R-----VG---TG------N--IV--------------GVST
D3RSW7_ALLVD/51-451....WRGRVS...QGN.GDIPPYHALMTVL-----SA-T-----VG---TG------N--IA--------------GVAT
Q481J5_COLP3/46-471LL...LSGKS....SD.QGISSFQALAVSL-----SG-R-----VG---TG------N--IA--------------GVAA
D3VIB1_XENNA/46-454VL...KNSNK...SDD.SGISSFQALCTSL-----AA-R-----VG---TG------N--LA--------------GVAI
R6C0Q9_9CLOT/49-475AIKNLVQNER...SGDTGEVSSFGALCTAL-----SA-T-----IG---TG------N--IV--------------GVAT
A1TXI6_MARHV/46-452AI...RGSRE...SDV.HGISPFQALCTSL-----AS-R-----VG---TG------N--LA--------------GVAV
R7G2T9_9FIRM/51-471.....IIDKQ...DSD.SGISAFGSFCTTM-----AM-R-----VG---TG------N--VA--------------GVAV
Q8EBH5_SHEON/47-452IM...TMSRQ...GCE.SGLSSFQVFCTSM-----AA-R-----VG---AG------N--MA--------------GVAV
Q2NVZ2_SODGM/46-454IL...KDSGT...RGG.GGISPFQALCTSL-----AA-R-----IG---CG------N--LM--------------GVAI
R6NWY5_9FIRM/53-470......ENEK...SGESGEVSSFAALCTAL-----SA-T-----IG---TG------N--IV--------------GVAT
C5DAE3_GEOSW/49-446VI...AES....PNQK.GSISSLQAFFIST-----AS-R-----VG---TG------N--LA--------------GVAL
D4MVF8_ANAHA/67-468.....NKNGK...DEK.SSLSSLQTLIVST-----AT-R-----VG---MG------N--LT--------------GVVA
S6A4B3_9SPIO/50-458MFSDIKNKTE...VPE.GRMTPFQSLTTAV-----AA-Q-----VG---TG------N--VV--------------GVST
Q8RDV2_FUSNN/55-455.....SSLKDGEKKIA.GQVTGFQAFCIAV-----AS-H-----VG---TG------N--LA--------------GVAI
H0ULL2_9BACT/54-458VT...LKGRK...SEE.GGITSFQALCTSL-----AA-Q-----VG---TG------N--VA--------------GVAT
Q5WBL9_BACSK/46-460LM...FSGKK....SD.AGVSSFQALSVAL-----AG-R-----VG---TG------N--IA--------------GVAS
K9YDV4_HALP7/46-445.........EGFNHEE.GHLSSFQALALSV-----AG-R-----VG---AG------N--IA--------------GVAV
R6RBR5_9CLOT/84-516..KSVKGHSH...HDK.ASITQFQALCTAL-----AA-T-----VG---VG------N--IA--------------GVAS
C7MLG7_CRYCD/51-476SI...TEQKY..NEGE.KTTSSFQALMIST-----AS-R-----VG---TG------N--IA--------------GVST
W5Y1T9_9CORY/60-473QL...KDSES....GD.GGLSSFQTLALTL-----SS-R-----VG---FG------S--TA--------------GVAT
R7C4U2_9BURK/46-460LM...FQRKN....DN.SGVSSFQALSMTL-----AG-R-----VG---TG------N--IA--------------GVAT
W5Y4I7_9CORY/46-477QL...RQGEK....SD.NGISSFQSLMISL-----AG-R-----VG---VG------N--IA--------------GVAT
F6AAC4_PSEF1/43-445VF...KDSIR...SSG.GQLSSFQALMLSL-----AG-R-----VG---AG------N--IA--------------GVGI
D2RNM9_ACIFV/44-448SLKLIFSAEN...QGE.GDIDSFKALCTAL-----AA-T-----VG---TG------N--IV--------------GVAT
C5C6U4_MICLC/48-455SV...TAKSQ.TGFEN.DGVSPFRAFTISA-----AS-R-----VG---TG------N--VA--------------GVAI
D4MZ66_ANAHA/54-463......RTKN...RGE.GDVSPFSALTTAL-----AA-T-----IG---TG------N--IV--------------GVAT
X2GKP6_9BACI/49-446LI...TEK....RDGE.SGVSPFQAFTISA-----AS-R-----VG---TG------N--IT--------------GVAL
R5D2D6_9FIRM/92-509.....EEGHN...DKD.TGLSPFQAFATTV-----GG-R-----VG---TG------N--IA--------------GTAT
D7BM33_ARCHD/59-464YL...LHSRQ...GAN.GGISSFQAFAMGM-----ST-R-----IG---IG------N--IT--------------GIAL
Q6LSN7_PHOPR/49-454VL...LNKNQ..TADR.NAISGREALLLSV-----GG-R-----VG---GG------N--IA--------------GVAV
Q1QSR6_CHRSD/60-472VT...FNSRG....AG.EGVSGFQAFATSL-----AA-R-----VG---TG------N--LA--------------GVAI
D4LCB5_RUMC1/46-473ALKYMWKEEE...TGH.GEVSSFAALCTAL-----SA-T-----VG---TG------N--IV--------------GVAT
G4Q7R4_ACIIR/46-452LV...MAKPT....DE.KGTSPFQALMVSS-----AA-C-----VG---TG------N--II--------------GIST
R6PKK8_9CLOT/51-453.....KAEKN...DNG.KSVSSFQALMIST-----AS-R-----VG---TG------N--IA--------------GIAT
D2RIK3_ACIFV/46-452VV...MQKPS....KE.GSVSSFQALMVST-----AS-R-----VG---TG------N--II--------------GIST
D4M9Q8_9BACT/49-459LL....IGKG....SQ.SGISSFQAFATTV-----GS-R-----VG---MG------N--IA--------------GVST
R6J437_9CLOT/52-480ALKFMVKNED...NGE.GEVTSFGALCTAL-----SA-T-----IG---TG------N--IV--------------GVAT
C4ZJ27_THASP/46-460AM...FRGKS....SA.AGVSSFQALTIAL-----SG-R-----VG---TG------N--IA--------------GVAT
E4TGP7_CALNY/48-462HL...ISGKE....SK.TGISSFQAFSMAV-----AG-R-----VG---TG------N--IA--------------GVAT
C3PIJ7_CORA7/46-477QL...KDGES....SD.SGVSSFQSLMISL-----AG-R-----VG---VG------N--IA--------------GVAT
R5FNH5_9ACTN/54-462QL...FEKKH..VPGK.KSISSFQAMMVST-----AS-R-----VG---TG------N--IA--------------GIAT
G7UNE2_PSEUP/46-460LM...FRGQS....SA.SGVSSFQALAMSL-----SG-R-----VG---TG------N--IA--------------GVAT
J9SBB2_9ACTN/60-499VM...RHGQS....SP.DGVSSFQALMISL-----AG-R-----VG---TG------N--IA--------------GVAT
A9IDQ9_BORPD/44-455LT...LHRKS....GD.DGLSSFQALALTL-----SS-R-----VG---VG------S--IA--------------GVAT
G2PM93_MURRD/278-683....KYDDPD...A.P.GQVTHFQALATAV-----SG-T-----VG---LG------N--IA--------------GVAV
M4U7B3_9GAMM/46-450ALKLVFSKDK...SNS.GDISSFAALCTAL-----SA-T-----IG---TG------N--IV--------------GVAT
A1AZT0_PARDP/75-484SI...TAAPA...ADR.QGISPFQALCTSL-----AS-R-----VG---TG------N--IA--------------GVAV
G4KZA8_OSCVS/51-471.....ILDKG...SSD.SGISTFRSFCTTM-----AA-R-----IG---TG------N--VA--------------GVAV
I0GRA8_SELRL/53-452........GIGKKTEG.GAISSFQAFCVST-----AS-R-----VG---VG------N--IA--------------GVAI
K4IFK4_PSYTT/275-681LARGKYDEPN...A.P.GRITHFQALATAV-----SA-T-----VG---LG------N--IA--------------GVAI
R7ILK1_9BURK/46-459LL...FQKKV....GE.VGISSFQALTMTL-----AG-R-----VG---TG------N--IA--------------GVAT
L0G2I0_ECHVK/46-459LL...FRGES....SE.KGVSSFQAFAIAI-----SG-R-----VG---TG------N--IA--------------GVAM
R5BRP1_9FIRM/49-450LL....GEGVGKKTEG.NRISSFQAFCVSS-----AS-R-----VG---VG------N--IA--------------GIAI
R5G1P5_9ACTN/52-470......KNEE...DGK.GEVTSFGALCTAM-----SA-T-----VG---TG------N--IV--------------GIAT
Q11EU9_CHESB/49-451VL...SSKNQ..SADP.NAISARAALLMSV-----GG-R-----VG---GG------N--IA--------------GVAV
Y883_HAEIN/48-453...YLFKKDK...GGK.GDVSSFAALCTAL-----AA-T-----IG---TG------N--IV--------------GVAT
Q2SAS2_HAHCH/49-473......SGTS....SD.KGISSFQALAVSL-----SG-R-----VG---TG------N--IA--------------GVAA
D4ZH12_SHEVD/56-454.....LKGRE....KV.DGISSFQVFCTSM-----AA-R-----VG---TG------N--MA--------------GVAV
H1Z903_MYROD/46-459LL...FTEGS....SE.KGVSPFQAFSIAI-----AG-R-----VG---VG------N--IV--------------GVAT
R5AXG7_9BACE/47-454ALKAIKARPD...SSS.GEISSLQALASVV-----AG-T-----IG---MG------N--IA--------------GVTI
D6XWR4_BACIE/59-456VI...TEK....KDGT.NGISPFQAFTIST-----AS-R-----VG---TG------N--LT--------------GVAL
R5EZS8_9GAMM/50-454VL...RHGIVGHKTKG.KEISSFQAFCIST-----AS-R-----VG---VG------N--IA--------------GIAI
Q3ICJ9_PSEHT/49-451LL...KGSSK...CKK.GDISSFQALCTGL-----CA-R-----VG---TG------N--LA--------------GVAV
I0JHI0_HALH3/58-455.....IFKKT...DKK.GTITPFQAFTSAL-----AS-T-----AG---AT------N--IV--------------GVPI
M1P0N1_9CORY/53-457....IDRSDT...DGK.GDISNYQALTTAL-----AA-T-----VG---VG------N--IV--------------GVAT
D6ZHY8_MOBCV/70-472TV...MGSRK...GSH.GGISSFQAFAVGL-----AD-R-----VG---TG------N--IA--------------GVAI
D2S4W0_GEOOG/50-455QI...ASSRS...GSE.GGISSFQAFCVGL-----AS-R-----VG---TG------N--IA--------------GVAI
E3GKE4_EUBLK/47-467LL.....GDNKGKGTD.EGVSGLRAFIMTA-----AG-R-----VG---VG------N--IA--------------GMAT
YRBD_BACSU/46-459QM...FKGKS....SE.AGVSSFQALSIAL-----SG-R-----VG---TG------N--IA--------------GVAT
A6VYN5_MARMS/44-452.....LTAKH.HEADG.KHLSSFQALILSV-----AG-R-----VG---GG------N--IA--------------GVAV
R5QXT9_9FIRM/51-456VV...AQPGS....DK.NGLSSFQALMVST-----AS-R-----VG---TG------N--IA--------------GIST
R5BSJ1_9FIRM/46-462NM...GQGAD....SS.KGLSPLRAFIFTA-----AR-T-----VG---VG------N--IS--------------GMAT
A4XPB8_PSEMY/46-459LM...FTGKT....DE.HGITSFQALTMTL-----AG-R-----VG---TG------N--IA--------------GVAT
R6Q9I8_9FIRM/48-459..QYIFEKEE....GQ.GDVSTLGSLCTAL-----AA-T-----IG---TG------S--IV--------------GVAT
E1V890_HALED/54-463LL...RHSRS....AN.GGISSFQALSTSL-----AA-R-----VG---TG------N--LA--------------GVAV
G0VMJ7_MEGEL/47-452VV...MEKPT....EA.GKVSSFQALMVST-----AS-R-----VG---TG------N--II--------------GVST
B1ZTG5_OPITP/46-460LL...FRSEA....SA.RGISSYQAFALAI-----SG-R-----VG---IG------N--IA--------------GVAT
E3PS56_CLOSD/46-460QM...LNGEA....SE.NGVSSFQGFAMAL-----GG-R-----VG---TG------N--IA--------------GVAT
B0TD76_HELMI/46-448.LRLIFTAKN...DGD.GDVNSFGALCTAL-----AA-T-----VG---TG------N--IV--------------GVAT
B8F6B8_HAEPS/56-460EM...WSGRA...AEG.ESLTPFQAFATGL-----AS-R-----VG---VG------N--IG--------------GVAT
H2G0K3_OCESG/46-460LM...FQGNS....SA.AGISSFQALALSL-----SG-R-----VG---TG------N--IA--------------GVAT
G8PS27_PSEUV/49-455VL...LKSRH...EDR.NGISPFQALCTSL-----AS-R-----VG---TG------N--IA--------------GVAV
K9TW29_9CYAN/99-504....HYDNPA...E.A.GEVTHFQALSAAL-----SA-T-----VG---LG------N--IA--------------GVAI
Q0W2J6_METAR/53-469MLHAAKSRKS...DQE.GDIPSFHALCTAL-----SA-T-----VG---TG------N--IA--------------GVAT
A7IEP7_XANP2/46-450SV...LRADA...TDK.SGITPFQALCTSL-----AS-R-----VG---TG------N--IA--------------GVAV
C0R294_BRAHW/49-448LL...FSKHE....KG.DGVSGFVSFCIST-----AS-R-----VG---TG------N--IT--------------GVMT
R7FY43_9FIRM/55-454....FSKKGT...AGK.DGMSSFQALATAI-----AA-Q-----VG---TG------N--IA--------------GAAT
I3UGJ4_ADVKW/61-451......SDGS...DDQ.GDISHFGALMTAL-----SA-T-----IG---TG------N--IA--------------GVAT
A8MKE1_ALKOO/50-456VFGGVFKKEA...NKE.GSMSSFQALATSI-----AA-Q-----IG---TG------N--VA--------------GVAT
B1YF48_EXIS2/50-454LL...FQGTD...KGK.DGVSPFQAFAIST-----AA-R-----VG---TG------N--IA--------------GVAT
D5BRV2_PUNMI/84-498LVRGDYADPD...S.A.GEVSHFQALATAV-----SG-T-----VG---IG------N--IG--------------GVAV
G0J6F2_CYCMS/46-459LL...FGGES....SD.KGVTSFQAFAIAI-----SG-R-----VG---TG------N--IA--------------GVAT
C7MHV8_BRAFD/47-482QL...KKGKT....SP.DGTSSFQSLMMSL-----AG-R-----VG---MG------N--IG--------------GVAT
ALST_BACSU/49-444IV...GEK....PEGN.KGVSSMQAFFISA-----AS-R-----VG---TG------N--LT--------------GVAL
R5RWM9_9FIRM/55-469.....FQKSE...AGE.GEITPMQAVSTAL-----AS-T-----VG---TG------N--IA--------------GVTG
D3UJ87_HELM1/57-462.......HAD..QKND.EHISPFQALMIST-----AS-R-----VG---IG------N--IA--------------GIAF
R6EEZ2_9FIRM/60-476...HVTKHTE...AGD.QSISQFQSLCTAL-----AA-T-----IG---TG------N--IV--------------GVAS
R6MFU2_9FIRM/47-452SV...MEKPD....DK.EAISSFQALMVST-----AS-R-----VG---TG------N--IV--------------GVSS
R7PRB6_9FIRM/45-450ALSLIFSAEN...KGS.GDIDSFKALCTAL-----AA-T-----VG---TG------N--IV--------------GVAT
A2SR40_METLZ/55-463VA...FTGLR.AEKGK.QTISSFQAFCVSM-----GA-R-----IG---VG------N--IA--------------GVAV
R5AJ95_9FIRM/49-458VI...AEKRE....DR.ESISSFQALMVST-----AS-R-----VG---TG------N--VV--------------GVTG
R5YUK1_9FIRM/62-468SL...LAKKE....HK.DSLSTFQTLIVST-----AT-R-----VG---MG------N--LV--------------GVVA
R5Q3U9_9BURK/59-459.....LFGDK...AGK.DGMSSFQSLATAI-----SA-Q-----VG---TG------N--LA--------------GVAT
R7PRF4_9FIRM/49-455LI....ISSAGSKTKG.NEISSFQAFCVST-----AS-R-----VG---VG------N--IA--------------GIAI
A0Q3K6_CLONN/59-455.......SSN..KEEH.HGVSSFQAFCIST-----AS-R-----VG---TG------N--LA--------------GVAI
R5NYD9_9BACT/51-452.....VQSDK...SGQ.GDVSQFGALATAL-----AA-T-----IG---TG------N--IV--------------GVAT
B5HEI9_STRPR/73-499.VRGKYDEKG...S.A.GEVNHFQALTAAV-----SG-T-----VG---LG------N--IA--------------GVAV
I3TQE6_TISMK/46-452AV...IGSGD...NDR.SGISPFQALCTSL-----AS-R-----VG---TG------N--LA--------------GVAV
F2JVC9_MARM1/46-446TV...FQAPQ...SDR.GGISPFQALCTSL-----AS-R-----VG---TG------N--LA--------------GVAV
L0FYG8_ECHVK/279-685....KYDEPD...A.P.GKISHFQAFATAT-----SA-T-----VG---LG------N--IA--------------GVAI
B2GLS0_KOCRD/53-457.........AGEEDGR.KGISSFRAFTVSA-----AA-R-----VG---TG------N--IA--------------GVAI
C7REC1_ANAPD/49-451NL...........KAS.DGVSGFAALATAV-----GG-Q-----VG---TG------S--LV--------------GVAT
B3EMZ0_CHLPB/88-501..RGVYDSPD...KQK.GEVSHFQALTAAL-----SA-T-----VG---LG------N--IA--------------GVAV
I5AXG7_EUBCE/61-477....VTAHTD...DDD.QSISQFQSLCTAL-----AA-T-----IG---TG------N--IA--------------GVAA
D2RN33_ACIFV/46-452LL...MVKPQ....DG.NGTSPFQALMVST-----AA-C-----VG---TG------N--II--------------GIST
C5C8M5_MICLC/48-478QL...REGQD....SA.DGTSSLQSLMLSL-----AG-R-----VG---MG------N--IG--------------GVAT
G4KY93_OSCVS/47-452VV...SEKPS....TA.GKISSFQALMVST-----AS-R-----VG---TG------N--IV--------------GVST
G4KWB0_OSCVS/53-452.....IFEKT...EGA.GDISPFQACCTAL-----AS-T-----LG---VG------N--IA--------------GVSV
D3Q113_STANL/44-457QL...RTGEK....SD.AGVSSFQALMLTL-----SS-R-----VG---VG------N--IA--------------GVAT
I2BD01_SHIBC/46-454NL...KKSTI...PRP.HGITAFQALCTGL-----AS-R-----VG---SG------N--LT--------------GVAL
R6R8F0_9FIRM/60-473...EVTAHTS...KED.MAISQFQSMCTAL-----AG-T-----IG---TG------N--IV--------------GVAT
R7HAX2_9FIRM/48-472.VKELFSNER...SGEDGEVSSFAALCTAL-----SA-T-----IG---TG------N--IV--------------GVAT
Q8ECR9_SHEON/46-459LM...FDGKS....TD.AGVSSFQALAMTL-----AG-R-----VG---TG------N--IA--------------GVAT
Q6NEM1_CORDI/46-477QL...RAGEK....SA.NGVSSFQSLMMSL-----AG-R-----VG---VG------N--IA--------------GVAT
A0QRB1_MYCS2/46-485LM...VKGEK....SP.SGVSSFQALTMSL-----AG-R-----VG---TG------N--IA--------------GVAT
D2NQ65_ROTMD/71-481VL...GDPVAREADGK.KSISSFRAFTVSA-----AS-R-----VG---TG------T--VA--------------GVAL
F6AHU7_PSEF1/46-452VI...LERNH...GDK.EAISSFKAFTISA-----AS-R-----VG---TG------N--IA--------------GVAT
C2X582_BACCE/50-448VL...MEG.K..SGSK.DQISPFQAFCIGM-----AA-R-----VG---TG------N--IT--------------GIAI
M4UAD5_9GAMM/46-449VM...RNSRK...SDK.EGISSFQALSTSL-----AA-R-----VG---TG------N--LA--------------GVAI
Q6FE01_ACIAD/61-482VM...KGSRKE.GEDE.HGITPFQAFVTGL-----AS-R-----VG---VG------N--IA--------------GVAI
Q5E342_VIBF1/63-467.....RSGQE....IE.NGISSYQVFCTSM-----AA-R-----VG---TG------N--MA--------------GVAV
D5V3Y8_ARCNC/47-451IL...RETAH...DKD.GHISSFQALMLSV-----AG-R-----VG---GG------N--IA--------------GVAV
F8DYI2_CORRG/49-453MV...GEKPK..SKSG.ESLSAFQAFTISA-----AS-R-----VG---TG------N--IV--------------GVAI
R5H9R9_9FIRM/51-466.IGKIFKRTH...AGE.GEITPFQAVSTAL-----AG-T-----VG---TG------N--IA--------------GITT
Q186Q3_PEPD6/63-459.......NKN..AKKE.GKISSFQAFCIST-----SS-R-----VG---TG------N--IA--------------GIAI
R5XPN0_9CLOT/54-453......MGKD..AKGD.GKVSSFQAFCIST-----AS-R-----VG---TG------N--IA--------------GISI
I4BXH1_ANAMD/47-454IL...LGSRK...AEE.KGISSFQALCTGL-----AA-Q-----VG---TG------N--IA--------------GVAT

PF02705

KUP_KLEP7/13-544---------------------TLAAIGVVY-----GD-------IG---TS------P--LY--------------TLRE
KUP_WIGBR/16-547---------------------IFSTINVLH-----GL-------IA---IS------P--IY--------------IIKE
B9SQ92_RICCO/61-632---------------------AFQCIGVVY-----GD-------LG---TS------P--LY--------------VIPG
A9SXX0_PHYPA/13-586---------------------AYQTLGVVF-----GG-------LG---TS------P--LY--------------VWPT
A9T519_PHYPA/7-581---------------------AFRTLGIVY-----GD-------LG---TS------P--LY--------------VYPS
B6QFY8_TALMQ/79-668---------------------QVNSYLLQP-----QS-------AQ---AN------P--LY--------------VFSS
A1CCX5_ASPCL/78-666---------------------SYQSLGVIY-----GD-------IG---TS------P--LY--------------VYSS
C5FQB5_ARTOC/100-671---------------------AYQSIGAIY-----GD-------IG---TS------P--LY--------------VFSA
Q6CCD6_YARLI/48-711---------------------AFQSLGAVY-----GD-------IG---TS------P--LY--------------TLNS
C4Y6H7_CLAL4/40-680---------------------AFSSLGAIY-----GD-------IG---TS------P--LY--------------VLNS
B0CVZ9_LACBS/29-630---------------------SFQTLGIIY-----SD-------IG---TS------P--LY--------------VLNG
KUP_CYTH3/20-548---------------------LLISLGIIY-----GD-------IG---TS------P--LY--------------VMKA
C6W4Q3_DYAFD/15-540---------------------LLVAFGIIY-----GD-------IG---TS------P--LY--------------VMQA
C6Y2B3_PEDHD/15-542---------------------LLVSLGIVY-----GD-------IG---TS------P--LY--------------TLKA
KUP_LEUMM/14-557---------------------ALIAIGIVF-----GD-------IG---TS------P--LY--------------TMNS
KUP_LACDA/6-548---------------------LLIAIGIVY-----GD-------IG---TS------P--LY--------------VMKS
E3D8I4_GARV3/105-645---------------------SIVALGVVY-----GD-------IG---TS------P--LY--------------TAQT
C5K5G4_PERM5/172-748---------------------SLGTLGIIY-----GD-------IG---TS------P--LY--------------TLST
B5ED26_GEOBB/13-541---------------------IVKALGLVF-----GD-------IG---TS------P--IY--------------TLTV
B8J475_DESDA/11-539---------------------VIKSLGLVF-----GD-------IG---TS------P--IY--------------TLAV
A7I822_METB6/4-532---------------------VVKSMGLVF-----GD-------IG---TS------P--IY--------------TFTA
KUP_METAC/10-538---------------------IINSMGLVF-----GD-------IG---TS------P--IY--------------TLTV
B5YHM1_THEYD/4-532---------------------VIKALGLVF-----GD-------IG---TS------P--IY--------------TLTV
B2VA86_SULSY/13-542---------------------VIRAIGTVF-----GD-------IG---TS------P--LY--------------TFAV
Q54JK9_DICDI/60-587---------------------SITAIGCIF-----GD-------IG---TS------P--LY--------------VYAS
KUP2_LEGPH/16-542---------------------SFAALGVVF-----GD-------IG---TS------P--LY--------------AFGQ
C6BY23_DESAD/14-544---------------------ALGALGVVF-----GD-------IG---TS------P--LY--------------AMKA
KUP_XANP2/18-550---------------------EIGALGVVF-----GD-------IG---TS------P--LY--------------ALKQ
KUP3_BRADU/2-536---------------------TMGALGVVY-----GD-------IG---TS------P--LY--------------ALKE
C1F3S5_ACIC5/37-570---------------------ALAVLGVVY-----GD-------IG---TS------P--IY--------------ALQQ
C1D8B5_LARHH/14-546---------------------ALAAMGVVY-----GD-------IG---TS------P--LY--------------AFKA
KUP_PROAC/31-568---------------------ALAALGIVF-----GD-------IG---TS------V--LY--------------SLQT
B1ZTC6_OPITP/46-580---------------------VLGALGVVF-----GD-------IG---TS------P--LY--------------ALKE
KUP1_CHRVO/26-559---------------------VLAALGVVY-----GD-------LG---TS------P--LY--------------ALQE
KUP_THEEB/15-546---------------------MLGALGVVY-----GD-------LG---TS------P--LY--------------AFEE
B0T401_CAUSK/36-573---------------------ALGAIGVVF-----GD-------IG---TS------P--LY--------------AMRE
KUP1_SPHWW/26-569---------------------TLGALGVVF-----GD-------IG---TS------P--IY--------------AFRE
KUP_BDEBA/51-585---------------------ALGALGVVF-----GD-------IG---TS------P--LY--------------ALKE
C1A5Q5_GEMAT/25-559---------------------TLTALGVVY-----GD-------IG---TS------P--LY--------------SIKE
KUP2_SYNFM/28-562---------------------ALGSLGVVY-----GD-------IG---TS------P--LY--------------SIRE
KUP_METCA/15-548---------------------SAGALGVVY-----GD-------IG---TS------P--LY--------------TVRE
KUP_HERAR/14-547---------------------TLAAVGIVY-----GD-------IG---TS------P--LY--------------TMKE
B2FRN5_STRMK/27-560---------------------IIGAIGVVF-----GD-------IG---TS------P--LY--------------TLKE
KUP1_RALSO/1-534---------------------MLGAIGVVF-----GD-------IG---TS------P--LY--------------ALKE
KUP_ACIF2/18-550---------------------AMAALGVVF-----GD-------IG---TS------P--LY--------------TLSA
KUP1_NOVAD/40-570---------------------AVGAIGVVF-----GD-------IG---TS------P--LY--------------ALRD
B9HJL6_POPTR/87-646---------------------.YKTLGVVF-----GG-------LV---TS------P--LY--------------VYPS
D2U9H9_XANAP/28-558---------------------...AIGVVF-----GD-------IG---TS------P--LY--------------TLKE
E3FUM0_STIAD/26-562---------------------.LGALGIVY-----GD-------IG---TS------P--LY--------------ALRE
KUP3_RHIEC/22-554---------------------.LGSVGVVY-----GD-------IG---TS------P--LY--------------AFRE
Q5AB00_CANAL/82-703---------------------.FSSLGSIY-----GD-------LG---TS------P--LY--------------VLNS
HAK6_ORYSJ/80-646---------------------.YQSLGIVY-----GD-------LG---TS------P--LY--------------VFPS
KUP3_LEGPH/22-550---------------------.LSALGIVY-----GD-------IG---TS------P--LY--------------TFKT
KUP1_LEGPH/12-539---------------------.LGALGVVF-----GD-------IG---TS------P--LY--------------ALKV
HAK19_ORYSJ/48-624---------------------AFQSIGVVY-----GD-------VG---TS------P--LY--------------VYSS
KUP1_RHOPA/12-542---------------------.VSAIGVVF-----GD-------IG---TS------P--LY--------------ALKE
HAK9_ORYSJ/24-602---------------------AYQSLGVVY-----GD-------LS---IS------P--LY--------------VYKS
KUP_CORGL/20-550---------------------.LGALGVVF-----GD-------IG---TS------P--LY--------------SLHT
KUP_STRP1/18-551---------------------.IIALGIVY-----GD-------IG---TS------P--LY--------------TIQS
KUP_XYLFA/23-555---------------------.LSAIGVVF-----GD-------IG---TS------P--LY--------------TLKE
W8UJ41_YEREN/22-548---------------------..GALGVVF-----GD-------IG---TS------P--LY--------------TLKT

PF05525

BRNQ_BACSU/6-436-----------------SASYIIIIGLMLF-----AL-F-----FG---AG------NLIFP------------------
Q9A1E1_STRP1/3-454-----------------QKNVYIVIGFMLF-----AL-F-----FG---AA------NLIYP------------------
BRAB_PSEAE/5-429-----------------KGFDLLALGFMTF-----AL-F-----LG---AG------NIIFP------------------
Q9CJW8_PASMU/1-426-----------------MNKNTFVVGFMLF-----AI-F-----FG---AG------NLIFP------------------
Q8REN9_FUSNN/3-423-----------------KTKDVLLTGFALF-----AM-L-----FG---AG------NLIFP------------------
Q9KU61_VIBCH/6-428-----------------KLADILALGFMLF-----AF-F-----LG---AG------NIIFP------------------
BRNQ_CORGL/2-412-----------------SKKSVLITSLMLF-----SM-F-----FG---AG------NLIFP------------------
BRAZ_PSEAE/5-429-----------------KGRDILALGFMTF-----AL-F-----VG---AG------NIIFP------------------
Q8RH58_FUSNN/3-424-----------------NMIDVITAGFALF-----AM-L-----FG---AG------NLIFP------------------
O83289_TREPA/2-440-----------------IHTHTLSLSFMLF-----SF-F-----FG---AG------NLILP------------------
BRAB_BACSU/6-435-----------------PVKDTIIIGFMLF-----AL-F-----FG---AG------NMIYP------------------
BRNQ_HAEIN/3-431-----------------SRKDIIVLGMMIF-----AL-F-----LG---AG------NIIFP------------------
Q97IN0_CLOAB/5-435-----------------SKKNTFFVGLLLF-----SM-F-----FG---AG------NLIFP------------------
Q8XND4_CLOPE/5-434-----------------SRKDLLLVSLMLF-----SL-F-----FG---AG------NLIFP------------------
BRNQ_SALTY/7-429-----------------.SRDIIALGFMTF-----AL-F-----VG---AG------NIIFP------------------
Q1GBE3_LACDA/7-439-----------------.HAESLTISSMLF-----GL-F-----FG---AG------NLIFP------------------
Q2G1H2_STAA8/8-443-----------------..KENMFIGSMLF-----GL-F-----FG---AG------NLIFP------------------
Q8DQQ3_STRR6/8-437-----------------..KKGTLTGLLLF-----GI-F-----FG---AG------NLIFP------------------

PF00209

S6A11_MOUSE/45-571---------------RGHWNNKVEFVLSVA-----GE-I-----IG---LG------N--VW--------------RFPY
SC6A9_MOUSE/86-621---------------RGNWGNQIEFVLTSV-----GY-A-----VG---LG------N--VW--------------RFPY
SC6A2_HUMAN/56-580---------------RETWGKKIDFLLSVV-----GF-A-----VD---LA------N--VW--------------RFPY
SC6A7_RAT/37-561---------------RGNWTGKLDFLLSCI-----GY-C-----VG---LG------N--VW--------------RFPY
SC6A3_BOVIN/60-580---------------RETWSKKADFLLSVI-----GF-A-----VD---LA------N--VW--------------RFPY
SC6A6_CANLF/41-568---------------REKWSSKIDFVLSVA-----GG-F-----VG---LG------N--VW--------------RFPY
Y736_HAEIN/11-497---------------RETFSGRRAFILAAI-----GS-A-----VG---LG------N--IW--------------RFPY
S6A15_RAT/61-644---------------RPAWNSKLQYILAQV-----GF-S-----VG---LG------N--VW--------------RFPY
SC6A4_RAT/79-600---------------RETWGKKMDFLLSVI-----GY-A-----VD---LG------N--IW--------------RFPY
S6A17_RAT/60-643---------------RPAWNSKLQYILAQI-----GF-S-----VG---LG------N--IW--------------RFPY
SC6A1_HUMAN/44-559---------------RDTWKGRFDFLMSCV-----GY-A-----IG---LG------N--VW--------------RFPY
S6A13_MOUSE/32-556---------------REHWNNKMEFVLSVA-----GE-I-----IG---LG------N--VW--------------RFPY
SC6A8_RAT/52-583---------------RETWTRQMDFIMSCV-----GF-A-----VG---LG------N--VW--------------RFPY
NTDO_CAEEL/40-576---------------REQWSGKLDFLLSVV-----GF-A-----VD---LG------N--IW--------------RFPY
S6A12_CANLF/36-561---------------RGQWTNKMEFVLSVA-----GE-I-----IG---LG------N--VW--------------RFPY

PF00916

S26A3_HUMAN/73-475-----------LLSDIVSGISTGIVAVLQG------------------------------LA------------------
Q55814_SYNY3/20-386-----------LRGDIFGGITAAIVALPLA------------------------------LA------------------
SUT31_ARATH/82-463-----------FKSDLIAGITIASLAIPQG------------------------------IS------------------
SULP3_CAEEL/60-496-----------FFGDLSGGLTMAVFSVPQG------------------------------IA------------------
YVDB_BACSU/15-379-----------FQKDLIAGIVVGVVAIPLG------------------------------MA------------------
CYS14_NEUCR/77-468-----------LLGDFIAGVTVGFVVVPQG------------------------------MA------------------
SUL2_YEAST/137-544-----------FTADLIAGITIGCVLVPQS------------------------------MS------------------
S26A1_RAT/69-481-----------LAGDVMSGLVIGIILVPQA------------------------------IA------------------
SULX_YEAST/119-513-----------LWGDVIAGISVASFQIPLA------------------------------LS------------------
O17951_CAEEL/89-486-----------LTSDVVGGITVGVLQIPQG------------------------------IA------------------
SUT21_ARATH/115-497-----------FKNDLMAGLTLASLCIPQS------------------------------IG------------------
SUT11_ARATH/85-467-----------FRGDLIAGLTIASLCIPQD------------------------------IG------------------
S26A2_HUMAN/108-518-----------ILGDVMSGLIVGILLVPQS------------------------------IA------------------
SUT32_ARATH/73-454-----------LKSDVISGITIASLAIPQG------------------------------IS------------------
Q55415_SYNY3/12-379-----------LQGDLFGGVTAAVIALPMA------------------------------LA------------------
SUT41_ARATH/95-468-----------FKLDLMAGITVGIMLVPQA------------------------------MS------------------
YG35_YEAST/206-606-----------FAHYLPAAVLGLLLNILDA------------------------------LS------------------
P72770_SYNY3/20-387-----------LKADVVAGLTLAAYAIPVA------------------------------LA------------------
P96878_MYCTU/31-398-----------LRHDVPASLVVFLVALPLS------------------------------LG------------------
YA7B_SCHPO/157-558-----------FILNIPAVIIGLLLNILDA------------------------------LS------------------
SUT22_ARATH/107-489-----------FKKDLMAGLTLASLCIPQS------------------------------IG------------------
M0W733_HORVD/97-477-----------FKGDLVAGLTIASLCIPQD------------------------------IG------------------
Y1739_MYCTU/25-392-----------LRGDVLAGLTVAAYLIPQA------------------------------MA------------------

PF00860

YWDJ_BACSU/1-392------------MKLVLGALQWTAFIIAAA------------------------------IV------------------
PYRP_BACSU/17-396------------FSWVSFSLQHLFAMFGST------------------------------IL------------------
PUCJ_BACSU/6-391------------FKVFTLSLQHVLAMYAGA------------------------------IL------------------
O18061_CAEEL/19-439------------SAIFFFGLQQMLVCISAL------------------------------LV------------------
UACT_ECOLI/28-412------------GKLIILGLQHVLVMYAGA------------------------------VA------------------
Q18771_CAEEL/30-454------------GIALLYGLQQVMVCVSAL------------------------------LT------------------
PBUX_BACSU/6-386------------GKTLSLGIQHVLAMYAGA------------------------------IV------------------
YBBY_ECOLI/8-396------------RESLLSGFQWFFFIFCNT------------------------------VV------------------
PBUO_BACSU/12-396------------KQEIIAGLTTFFTMVYIV------------------------------VV------------------
RUTG_ECOLI/30-404------------AQTAVMGVQHAVAMFGAT------------------------------VL------------------
GHXP_ECOLI/26-410------------RQEVVAGLTTFLAMVYSV------------------------------IV------------------
URAA_ECOLI/15-385------------LQTIPLSLQHLFAMFGAT------------------------------VL------------------
S23A3_MOUSE/80-476------------GGLSYPPAQLLASSFFSC------------------------------GL------------------
O18057_CAEEL/15-435------------PSIMLFGLQQMMICLSSL------------------------------LV------------------
URAA_HAEIN/16-385------------LKQSFVGLQMLFVAFGAL------------------------------VL------------------
PUCK_BACSU/8-388------------LQLMMLGLQHMLAMYAGA------------------------------IL------------------
Y125_HAEIN/18-399------------RQEIIAGLTTFLAMVYSV------------------------------IV------------------
XANP_ECOLI/34-427------------.QTLFAACQHLLAMFVAV------------------------------IT------------------
XANQ_ECOLI/22-416------------HQALVGAITHLLAIFVPM------------------------------VT------------------
Q5L0U7_GEOKA/15-387------------GQWITLSLQHLFAMFGAT------------------------------IL------------------

PF16983

B0SMW7_LEPBP/208-328--------------------------------------------------------------------------------
C7YTB3_NECH7/228-348--------------------------------------------------------------------------------
C8WZ82_DESRD/10-124--------------------------------------------------------------------------------
Q0W422_METAR/202-317--------------------------------------------------------------------------------
C4JWX0_UNCRE/221-341--------------------------------------------------------------------------------
E3QBP2_COLGM/24-140--------------------------------------------------------------------------------
G1X8D7_ARTOA/35-149--------------------------------------------------------------------------------
Q3A6S2_PELCD/200-319--------------------------------------------------------------------------------
B9H9E8_POPTR/284-403--------------------------------------------------------------------------------
A9RP81_PHYPA/282-400--------------------------------------------------------------------------------
C8WZ82_DESRD/229-350--------------------------------------------------------------------------------
W8TP38_EUBAC/8-124--------------------------------------------------------------------------------
G4N1B8_MAGO7/224-344--------------------------------------------------------------------------------
Q5V2K5_HALMA/204-318--------------------------------------------------------------------------------
C1EA77_MICCC/19-134--------------------------------------------------------------------------------
D8J5J0_HALJB/205-320--------------------------------------------------------------------------------
E8RHN9_DESPD/246-369--------------------------------------------------------------------------------
B8LD85_THAPS/40-161--------------------------------------------------------------------------------
F4P234_BATDJ/2-116--------------------------------------------------------------------------------
Q30XE6_DESAG/11-125--------------------------------------------------------------------------------
S3D9L6_OPHP1/273-402--------------------------------------------------------------------------------
A9RP81_PHYPA/35-151--------------------------------------------------------------------------------
Q010H7_OSTTA/293-412--------------------------------------------------------------------------------
Q0B011_SYNWW/202-323--------------------------------------------------------------------------------
Q0B011_SYNWW/11-125--------------------------------------------------------------------------------
D0NZ41_PHYIT/248-371--------------------------------------------------------------------------------
A7IAA3_METB6/14-128--------------------------------------------------------------------------------
A1CFF9_ASPCL/23-137--------------------------------------------------------------------------------
F9X8H4_ZYMTI/24-138--------------------------------------------------------------------------------
U1HZT8_ENDPU/227-347--------------------------------------------------------------------------------
L0JYW8_9EURY/205-320--------------------------------------------------------------------------------
C6BZQ7_DESAD/227-348--------------------------------------------------------------------------------
N1PTW8_DOTSN/227-348--------------------------------------------------------------------------------
S2K5A9_MUCC1/18-132--------------------------------------------------------------------------------
A0A0D2VV61_CAPO3/29-143--------------------------------------------------------------------------------
J1L1I3_9EURY/21-135--------------------------------------------------------------------------------
H6C2T1_EXODN/22-136--------------------------------------------------------------------------------
C6BZQ7_DESAD/8-122--------------------------------------------------------------------------------
Q8DJ71_THEEB/11-125--------------------------------------------------------------------------------
B0SMW7_LEPBP/12-126--------------------------------------------------------------------------------
K3WVQ2_PYTUL/71-190--------------------------------------------------------------------------------
C0Q8U9_DESAH/10-124--------------------------------------------------------------------------------
F4P234_BATDJ/206-328--------------------------------------------------------------------------------
Q2FLF7_METHJ/209-325--------------------------------------------------------------------------------
M1W0F8_CLAP2/229-349--------------------------------------------------------------------------------
G7XJI7_ASPKW/223-346--------------------------------------------------------------------------------
K2RWJ8_MACPH/24-138--------------------------------------------------------------------------------
A5D5U5_PELTS/185-304--------------------------------------------------------------------------------
A1SAH7_SHEAM/199-320--------------------------------------------------------------------------------
A1SAH7_SHEAM/10-124--------------------------------------------------------------------------------
C1GWZ1_PARBA/233-353--------------------------------------------------------------------------------
A0LEX0_SYNFM/33-147--------------------------------------------------------------------------------
B8GHN7_METPE/12-126--------------------------------------------------------------------------------
F0XEP8_GROCL/230-351--------------------------------------------------------------------------------
C5KXR7_PERM5/27-141--------------------------------------------------------------------------------
Q2FLF7_METHJ/16-130--------------------------------------------------------------------------------
D5SS31_PLAL2/33-147--------------------------------------------------------------------------------
K2RWJ8_MACPH/225-345--------------------------------------------------------------------------------
H1XTW9_9BACT/228-347--------------------------------------------------------------------------------
S3CUC5_GLAL2/223-343--------------------------------------------------------------------------------
A7IAA3_METB6/206-322--------------------------------------------------------------------------------
D5GPI6_TUBMM/21-135--------------------------------------------------------------------------------
B7G755_PHATC/68-182--------------------------------------------------------------------------------
V5FLJ3_BYSSN/224-344--------------------------------------------------------------------------------
D8J5J0_HALJB/18-132--------------------------------------------------------------------------------
G7WKS6_METH6/187-303--------------------------------------------------------------------------------
D5SS31_PLAL2/231-350--------------------------------------------------------------------------------
M2SLX2_COCSN/227-353--------------------------------------------------------------------------------
A3CWQ9_METMJ/210-327--------------------------------------------------------------------------------
C0Q8U9_DESAH/229-350--------------------------------------------------------------------------------
MOT1_CHLRE/24-141--------------------------------------------------------------------------------
C5KXR7_PERM5/251-372--------------------------------------------------------------------------------
A9TVM2_PHYPA/8-124--------------------------------------------------------------------------------
M1XQX9_NATM8/204-317--------------------------------------------------------------------------------
C5G018_ARTOC/223-343--------------------------------------------------------------------------------
M1WRV9_DESPC/45-159--------------------------------------------------------------------------------
F0Y3U5_AURAN/2-116--------------------------------------------------------------------------------
Q2LW72_SYNAS/200-319--------------------------------------------------------------------------------
B8GHN7_METPE/204-320--------------------------------------------------------------------------------
A3QA82_SHELP/206-331--------------------------------------------------------------------------------
U9TPL4_RHIID/133-254--------------------------------------------------------------------------------
B6HEF2_PENRW/224-344--------------------------------------------------------------------------------
A3CWQ9_METMJ/17-132--------------------------------------------------------------------------------
W8TP38_EUBAC/204-323--------------------------------------------------------------------------------
W8FD76_9BACT/214-333--------------------------------------------------------------------------------
G4N1B8_MAGO7/23-137--------------------------------------------------------------------------------
W1PZ30_AMBTC/46-162--------------------------------------------------------------------------------
A4S3I2_OSTLU/65-180--------------------------------------------------------------------------------
I0IS14_LEPFC/147-266--------------------------------------------------------------------------------
M0SI65_MUSAM/80-195--------------------------------------------------------------------------------
Q1QWY5_CHRSD/209-330--------------------------------------------------------------------------------
E8QZC6_ISOPI/30-144--------------------------------------------------------------------------------
M1WRV9_DESPC/264-385--------------------------------------------------------------------------------
E4NMR6_HALBP/205-319--------------------------------------------------------------------------------
Q0W422_METAR/9-123--------------------------------------------------------------------------------
U1HZT8_ENDPU/24-138--------------------------------------------------------------------------------
C7NK89_KYTSD/232-353--------------------------------------------------------------------------------
C7NK89_KYTSD/30-144--------------------------------------------------------------------------------
H1UW53_COLHI/231-351--------------------------------------------------------------------------------
G4UG89_NEUT9/335-449--------------------------------------------------------------------------------
R0J520_SETT2/28-142--------------------------------------------------------------------------------
B7G755_PHATC/291-424--------------------------------------------------------------------------------
E9D7G2_COCPS/20-134--------------------------------------------------------------------------------
M7SFI7_EUTLA/228-348--------------------------------------------------------------------------------
E8RHN9_DESPD/37-153--------------------------------------------------------------------------------
F0JE74_DESDE/227-348--------------------------------------------------------------------------------
K9RS45_SYNP3/11-125--------------------------------------------------------------------------------
D8TXM6_VOLCA/16-126--------------------------------------------------------------------------------
Q3INK2_NATPD/26-140--------------------------------------------------------------------------------
K0NIZ2_DESTT/233-354--------------------------------------------------------------------------------
Q6ARK8_DESPS/229-350--------------------------------------------------------------------------------
J1L1I3_9EURY/213-329--------------------------------------------------------------------------------
Q1QWY5_CHRSD/18-132--------------------------------------------------------------------------------
E1ZN91_CHLVA/25-148--------------------------------------------------------------------------------
C5G018_ARTOC/20-134--------------------------------------------------------------------------------
E5A9K7_LEPMJ/232-358--------------------------------------------------------------------------------
Q5V2K5_HALMA/16-130--------------------------------------------------------------------------------
K9RS45_SYNP3/207-326--------------------------------------------------------------------------------
MOT1_CHLRE/327-452--------------------------------------------------------------------------------
E4NMR6_HALBP/18-132--------------------------------------------------------------------------------
D5GPI6_TUBMM/223-344--------------------------------------------------------------------------------
V4IRC3_9DELT/65-186--------------------------------------------------------------------------------
Q2LW72_SYNAS/11-125--------------------------------------------------------------------------------
L8FSY4_PSED2/223-343--------------------------------------------------------------------------------
W8FD76_9BACT/18-132--------------------------------------------------------------------------------
A9TVM2_PHYPA/255-374--------------------------------------------------------------------------------
H3H4D1_PHYRM/60-179--------------------------------------------------------------------------------
C5GRE7_AJEDR/28-142--------------------------------------------------------------------------------
E4RMT7_HALHG/13-127--------------------------------------------------------------------------------
S8AUN3_DACHA/229-349--------------------------------------------------------------------------------
C1EA77_MICCC/255-375--------------------------------------------------------------------------------
J3P3C4_GAGT3/224-344--------------------------------------------------------------------------------
A4G1K6_HERAR/22-141--------------------------------------------------------------------------------
M3AZE9_PSEFD/24-138--------------------------------------------------------------------------------
D4GWH9_HALVD/18-132--------------------------------------------------------------------------------
T5AD00_OPHSC/25-141--------------------------------------------------------------------------------
Q30XE6_DESAG/224-345--------------------------------------------------------------------------------
A0A0D2VV61_CAPO3/225-344--------------------------------------------------------------------------------
E4RMT7_HALHG/201-317--------------------------------------------------------------------------------
I4B3W7_TURPD/204-323--------------------------------------------------------------------------------
Q6ARK8_DESPS/10-124--------------------------------------------------------------------------------
E8QZC6_ISOPI/228-347--------------------------------------------------------------------------------
V4JAT2_9DELT/9-123--------------------------------------------------------------------------------
F9X8H4_ZYMTI/221-342--------------------------------------------------------------------------------
I1HDP4_BRADI/267-387--------------------------------------------------------------------------------
W5BW83_WHEAT/33-150--------------------------------------------------------------------------------
K0NIZ2_DESTT/10-124--------------------------------------------------------------------------------
D8S3I3_SELML/19-136--------------------------------------------------------------------------------
F6H3G7_VITVI/37-153--------------------------------------------------------------------------------
G3JR94_CORMM/229-349--------------------------------------------------------------------------------
F0JE74_DESDE/8-122--------------------------------------------------------------------------------
G2QB28_MYCTT/26-140--------------------------------------------------------------------------------
A1AQI2_PELPD/205-325--------------------------------------------------------------------------------
F7W0P3_SORMK/32-150--------------------------------------------------------------------------------
A4G1K6_HERAR/222-341--------------------------------------------------------------------------------
H1YXZ5_9EURY/13-127--------------------------------------------------------------------------------
D3SSD4_NATMM/18-132--------------------------------------------------------------------------------
H1XTW9_9BACT/25-139--------------------------------------------------------------------------------
D8TXM6_VOLCA/417-540--------------------------------------------------------------------------------
Q3A6S2_PELCD/11-125--------------------------------------------------------------------------------
Q8DJ71_THEEB/207-326--------------------------------------------------------------------------------
B8LD85_THAPS/362-493--------------------------------------------------------------------------------
B9RUY1_RICCO/273-392--------------------------------------------------------------------------------
A1AQI2_PELPD/14-128--------------------------------------------------------------------------------
E1ZN91_CHLVA/385-504--------------------------------------------------------------------------------
K1WL11_MARBU/23-137--------------------------------------------------------------------------------
G0SDL2_CHATD/45-159--------------------------------------------------------------------------------
H1YXZ5_9EURY/205-321--------------------------------------------------------------------------------
M2LEF6_BAUCO/225-346--------------------------------------------------------------------------------
I1C5D7_RHIO9/194-313--------------------------------------------------------------------------------
U4KZA9_PYROM/286-406--------------------------------------------------------------------------------
M7SFI7_EUTLA/25-139--------------------------------------------------------------------------------
K4LLE1_THEPS/26-140--------------------------------------------------------------------------------
U4KZA9_PYROM/83-197--------------------------------------------------------------------------------
M2LEF6_BAUCO/24-138--------------------------------------------------------------------------------
D8S3I3_SELML/264-385--------------------------------------------------------------------------------
B9RUY1_RICCO/33-149--------------------------------------------------------------------------------
G3JR94_CORMM/25-141--------------------------------------------------------------------------------
I4B3W7_TURPD/8-122--------------------------------------------------------------------------------

PF03594

Q9RUP7_DEIRA/156-540-------------APAQPCTVGGGRVPAPY------------------------------FP------------------
Q98CP3_RHILO/1-376-------------MTMRLSIPISA.FVAAI------------------------------VG------------------
Q9KQM8_VIBCH/4-381-------------GFFNLSHLSAG.FTTVL------------------------------VG------------------
YDCO_ECOLI/5-381-------------S.IPPPTLLAG.FLAVL------------------------------IG------------------
Q9RY94_DEIRA/39-426-------------QDTHPSAVLAG.LIAVV------------------------------IG------------------
BENE_ACIAD/10-387-------------QDWSLSATIAG.FLAVL------------------------------IS------------------
Q9I374_PSEAE/15-392-------------ADSSPAAVVAG.FVAML------------------------------TG------------------
G8ML28_9BURK/13-389-------------.DWSVSAVSAG.LLAVI------------------------------IS------------------
Q88I34_PSEPK/31-401-------------.DCSVSAIVAG.SIATT------------------------------IS------------------

PF00955

U3K110_FICAL/463-982LQRTGRFCG.GLIKDIKRKAPFFASDFYDA-----...........--------------LN------------------
G6DAI9_DANPL/622-1112LSKSGRLFG.GVIRDIKRRYPHYISDFRDA-----...........--------------LN------------------
G3U5F4_LOXAF/1-539.....RIFG.GLILDIKRKAPYFWSDFRDA-----...........--------------FS------------------
G3WTC3_SARHA/356-874LQRTGRLFG.GLVQDIRRKAPWYLSDFLDA-----...........--------------LD------------------
G4VMR3_SCHMA/554-1100LNRTGRIFG.GLWQDIKRRAPHYVSDFTDA-----...........--------------IH------------------
Q17LT4_AEDAE/585-1093LEKTHRLWG.GLINDIKRRYPMYKSDIKDG-----...........--------------LN------------------
W5KDH9_ASTMX/559-1064LQRTGRVFG.GLVNDVKRKAPFYWSDIVDG-----...........--------------LS------------------
I3J2E3_ORENI/296-803CIYFFRFGK.GVYDDLRRRLPLYPSDFTDG-----...........--------------II------------------
T1FZS5_HELRO/163-669LAKTNKLFG.GLTKDIKRKSAFYVSDITDG-----...........--------------LS------------------
K1QX42_CRAGI/478-979LTRTGRICG.GLFDDVRRKIPWYLSDFKDC-----...........--------------LH------------------
J9JYF8_ACYPI/711-1209LRRTKKPWG.GLVKDIKRRLPYYKSDFIQG-----...........--------------LN------------------
E9GEI4_DAPPU/148-646IWKFGQ.FGQGIREDLCRRLPHYISDYVDG-----...........--------------VV------------------
F6ZGG3_HORSE/451-964LQRTGRLFG.GLILDIKRKAPFFLSDFKDA-----...........--------------LS------------------
W4YSB4_STRPU/661-1179LKRTGKIFG.GLINDVRRRYPHYWSDIRDG-----...........--------------IN------------------
H2RXB2_TAKRU/366-894LKRSGIIFG.GLIHDIRRRYPHYVSDLKDA-----...........--------------LD------------------
T1IXC2_STRMM/521-1019LKRTGRLFG.GLINDIKRKAPWYWSDFKDA-----...........--------------MA------------------
K1R554_CRAGI/397-923LVRTGRLFG.GLVADIKRKIPWYASDFKDC-----...........--------------LH------------------
A0A068XV00_ECHMU/291-835LMRTGRLFG.GLINDIKRRAPSYLSDYTDA-----...........--------------LH------------------
T1EE80_HELRO/210-707.KLFEHWMGSGLMEDWKKRAPHYLADYTDG-----...........--------------FC------------------
E4WWD6_OIKDI/171-686LRRTGRLFG.GLMNDIRRKAPWYLSDWTDG-----...........--------------FN------------------
Q1A708_STRPU/512-1011LERTGKIFG.GLIQDCKRRFPFYLSDFKDA-----...........--------------FH------------------
A0A0I9N9J1_BRUMA/477-989LKRTGHLFG.GLILDIKRKYPWYLSDFTDS-----...........--------------LN------------------
B3RRA8_TRIAD/486-976LKRTGRLFG.GFINECKKRYPYYVSDFKDG-----...........--------------LN------------------
Q16S12_AEDAE/483-981LSRTGRLFG.GLVNDLKRKKPFYLSDFKDG-----...........--------------LS------------------
F6XSL8_XENTR/350-843LRRTGKIFG.GLARDIRRRYPKYLSDITDA-----...........--------------LN------------------
H3DNL1_TETNG/273-761LSRTGRPFG.GMIRDIRRRYQHYRSDITDA-----...........--------------LN------------------
H2MRC5_ORYLA/485-998LQRTGRIFG.GLVNDVRRKVPFLWSDVKDA-----...........--------------VS------------------
T1FWY0_HELRO/373-877LIRTGKIFG.GLVNDVKRKAPWYLSDFTDA-----...........--------------LH------------------
G3RVR2_GORGO/665-1151LLRTGSVFG.GLVRDVRRRYPHYPSDLRDA-----...........--------------LH------------------
G5EC65_CAEEL/395-911LKRTGKLFG.GLILDIKRKAPHFVSDFTDA-----...........--------------FN------------------
T1K5U3_TETUR/262-744DEPKCRIAQ.GLCEDLRRRLSHYISDYIDG-----...........--------------VV------------------
K1QN40_CRAGI/465-966LVRTGRLFG.GMLEDIKRKAPFYVSDFKDA-----...........--------------LH------------------
T1IXB9_STRMM/349-847LVRTGRLFG.GLIDDVKRKLPWYWSDFKDA-----...........--------------MA------------------
T1INN8_STRMM/610-1148LKRTGRLFG.GLRREVMNRFPLYWSDILDA-----...........--------------LN------------------
U1NFS4_ASCSU/397-897IVRTGRLFG.GLCEDIRRKAPFFISDFTDF-----...........--------------FR------------------
Q7PT77_ANOGA/414-924LEKTNRLWG.GVINDIKRRYPMYKSDIMDG-----...........--------------LN------------------
T1I017_RHOPR/525-1044LRRTGLPWG.GLINDFKRRYPFYCSDFFDG-----...........--------------FN------------------
E0VCN3_PEDHC/463-965KYRTGRLFG.GLINDVKRKVPWYWSDFKDA-----...........--------------LA------------------
E2A0M0_CAMFO/532-1032LSRSGKLFG.GLINDIKRKAPFYLSDFKDA-----...........--------------LA------------------
K1R242_CRAGI/460-990LVMSKIPFK.GLIDDIRRKVPFYLSDFKDS-----...........--------------LH------------------
W5JZ21_ASTMX/640-1129LQRTGRPFG.GMIRDIRRRYPKYLSDFKDA-----...........--------------LN------------------
H3ECJ2_PRIPA/195-740LKRTGKLFG.GLMLDVKRKAPHYLSDFTDA-----...........--------------LN------------------
H2ZCT2_CIOSA/335-843LRRSGHLFG.GFIHDVKNRYPKYLSDITDA-----...........--------------LN------------------
W5KXY6_ASTMX/228-714LVRTGVLFG.GMVRDFKRRYQHYKSDITDA-----...........--------------MN------------------
L5L573_PTEAL/490-1009LIWTGRFFG.GLCLDVKRKLPWFLSDFYDG-----...........--------------FH------------------
F6TCT1_CIOIN/372-882LQRTGRFFG.GLIEDVKRKAPFYFSDFKDC-----...........--------------LS------------------
G3PTK2_GASAC/431-946LQRTRKFCG.GLVLDIKRKLPFFASDFCDA-----...........--------------LH------------------
F6XL93_CIOIN/511-1008LKRSGRPFG.GFIKDVKNRYPKYLSDITDA-----...........--------------IN------------------
G3P556_GASAC/263-750LARTGYPFG.GMVKDLKRRYRHYISDYTDA-----...........--------------LN------------------
S4A11_MOUSE/305-806.CKDFFPFGKGIWMDIMRRFPVYPMDFTDG-----...........--------------II------------------
K1PAY0_CRAGI/344-832SSFRCSLFR.GIREDLRRRIPVYVSDFKDG-----...........--------------VV------------------
F6S1R5_MONDO/358-890LCPWNRFFR.ELRLDIKRKLPWFASDFYEG-----...........--------------FH------------------
F1LR96_RAT/349-861LQRTGRLFG.GLVQDVRRKACWYPSDFLDA-----...........--------------LH------------------
K1QYU5_CRAGI/280-802LERTGRLFG.GLIQDVKRKWKWYISDFTDA-----...........--------------IH------------------
A8XC73_CAEBR/454-938VTGSRPYFL.GMRQDIKNRSKYFWSDYTDG-----...........--------------LN------------------
B4HY43_DROSE/565-1057LSRTGRLFG.GLINDIKRKAPWYISDYKDA-----...........--------------LS------------------
G5AMT1_HETGA/940-1417LRRTGRPFG.GLIRDVKRRYPHYLSDFRDA-----...........--------------LD------------------
U1NNI1_ASCSU/440-926RERKFQYFG.GMVDDISKRLPYYWTDFTDS-----...........--------------LR------------------
T1KG21_TETUR/497-995LKRTGRLFG.GLINDVKRKAPWYLSDFKDA-----...........--------------LA------------------
V8P944_OPHHA/511-1024LQRTGKLFG.GLVLDIKRKVPFFLSDFTDA-----...........--------------FS------------------
E5SIY8_TRISP/317-820TVENCRLFG.GLVEDIKRRWPYYVSDFKDV-----...........--------------FT------------------
G1KLH8_ANOCA/545-1057LQRTGRLFG.GLILDVKRKIPWYWSDFKDG-----...........--------------LS------------------
E9G2T9_DAPPU/505-1004LYRTGRLFG.GLINDVKRKLPWYWSDYKDA-----...........--------------MS------------------
G7YII3_CLOSI/369-869.LKNDVCFGKGLYQDLRNRLPHYWSDYSEG-----...........--------------IL------------------
G1KNW1_ANOCA/379-896LKRTGRLFG.GLLKDIQRKAPWYCSDFYDA-----...........--------------LN------------------
G7YU35_CLOSI/538-1089LQRTGIIFG.GLARDIRRRAPHYLSDFTDA-----...........--------------LH------------------
F6V6Y3_XENTR/366-886LKRTGRIFG.GLIKDVKRKAPWYWSDFYDG-----...........--------------LN------------------
T1G1Z8_HELRO/234-724SRRKLTFCK.GIKKDFLLRVPSYVSDFTDA-----...........--------------FR------------------
K1P9X1_CRAGI/723-1226IKRTGRLFG.GLVNDVKRRYPQYLSDFKDA-----...........--------------LH------------------
E3LRC0_CAERE/411-923GPEAWYPFR.GLKDEFKRRLAIYPSDYLDG-----...........--------------IR------------------
H3A8G0_LATCH/535-1050LQRTGRLFG.GLILDIKRKVPFYLSDFKDA-----...........--------------IS------------------
T1G603_HELRO/157-655LERTGKICG.GLIQDIKNRYKFYLSDITDA-----...........--------------LA------------------
U3J6V8_ANAPL/323-833LERTGRLFG.GLVRDIRRKAPWYRSDFSDA-----...........--------------LH------------------
B3RRA7_TRIAD/391-881LMYT.KECGSGLLRDMRRRYAHYLSDYTDA-----...........--------------FN------------------
Q8IQD4_DROME/591-1092LEKTGRLWG.GLRNDLKRRMPMYKSDILDG-----...........--------------LN------------------
G3PNB5_GASAC/438-957LKKTGRFCG.GLLLDIKRKAPFFVSDFTDA-----...........--------------FH------------------
T1G3A7_HELRO/327-843KNPEYRLFG.GLVADVKRRFRYFLSDIRDG-----...........--------------LH------------------
E9FTI0_DAPPU/254-751GEKLCR.FGQGIREDLSRRLPHYISDYKDG-----...........--------------LT------------------
I3KGD1_ORENI/467-975LAFTGRFCG.GLYLDIKRKLPWFPSDFYEG-----...........--------------FH------------------
I1FHS7_AMPQE/469-998VTFSKIPFK.GLYDDAKRRYRNYLTDFRDA-----AWDTHRNKCSI--------------LA------------------
E9G2T7_DAPPU/358-867LVRTGRFFG.GLIDDVKRKLPFYKSDFTDA-----...........--------------FA------------------
T1KJ99_TETUR/219-715DKFKFTFCK.GIAENIVRRVKYYPSDFVDG-----...........--------------LK------------------
E0W1T8_PEDHC/651-1159LRRTKKPFG.GMIRDVRRRFPHYKSDITDG-----...........--------------MN------------------
I1FKL2_AMPQE/436-928IKFSCKPCG.GLFHDVKNLVKRYPSDFKDV-----...........--------------LH------------------
S4A8_MOUSE/443-956LERTGRLFG.GLVLDVKRKAPWYWSDYRDA-----...........--------------LS------------------
W4ZBI6_STRPU/468-975LARTGRLFG.GLINDIKKKAPFYWSEYYHA-----...........--------------LN------------------
G3NFQ8_GASAC/566-1072LQRTGRICG.GLVLDVKRKLPFYWSDIRDS-----...........--------------LS------------------
H2MQQ8_ORYLA/460-973LQRTGRLFG.GLILDIKRKVPHYLSDYTDA-----...........--------------IN------------------

PF03222

MTR_HAEIN/5-405------GTAIGAGMLANPTS-TA-GVWFIGSILALIYTWFCMTTSGLMILEANLHYPT----------------------
Q9Z3A2_CHLPN/1-391------GSAIGAGVLAVPVL-TA-KGGFFPATFLYIVSWLFSMASGLCLLEVMTWMKE----------------------
TYRPA_HAEIN/3-387------GTMIGAGMLAMPLT-SA-GIGFGFTLVLLLGLWALLTFSALLFVELYQTAES----------------------
TYRP_ECOLI/4-391------GTTIGAGMLAMPLA-AA-GVGFSVTLILLIGLWALMCYTALLLLEVYQHVPA----------------------
TNAB_PROVU/8-404------GAMIGAGMFSLPTI-MS-GAWFINSLFILFIVCFFMFHSGIYILECISKYGA----------------------
O07675_HAEIF/5-400------SVCVGAGMLGLPTS-GA-GAWTIWSALAICLTMIIMTLSGWLLLEAYSTYDL----------------------
MTR_ECOLI/9-402------GTIIGAGMFSLPVV-MS-GAWFFWSMAALIFTWFCMLHSGLMILEANLNYRI----------------------
O22778_ARATH/12-436------GTAVGPGMLGLPAA-TI-RSGSIPSTIALLCSWVYVISSILLVAELSFAAME----------------------
TNAB_ECOLI/7-403------GTVIGGGMFALPVD-LA-GAWFFWGAFILIIAWFSMLHSGLLLLEANLNYPV----------------------
A0A0E9C322_PANAN/6-404------ATVIGGGMFSLPIA-MA-GIWFPGASIILTLIAIMMLLTGLMLVEVNLHYGG----------------------
O84824_CHLTR/1-390------GTTIGAGVLAVPVS-TS-EGGFLPTTLLYIVSWFIAVASGYCFLEVLTWTHS----------------------
O84825_CHLTR/3-392------GTVIGAGVLAVPIL-TA-VEGFFPAVVLYVLAWLVSLASGYGYLEVLTWCKG----------------------
TYRPB_HAEIN/5-393------GTTIGAGMLAMPLT-SA-GMGFGYTLLLLVGLWALLVYSGLLFVEVYQTADQ----------------------

PF01490

AAP5_ARATH/28-468------TAVIGSGVLSLAWA.VA-QIGWIGGPVAMLLFSFVTFYTSTLLCSCYRSGDS.------------------...
LHT1_ARATH/34-433------TAMVGAGVLGLPYA.MS-QLGWGPGIAVLVLSWVITLYTLWQMVEMHEMVP..------------------...
AAP1_ARATH/37-472------TAVIGSGVLSLAWA.IA-QLGWIAGTSILLIFSFITYFTSTMLADCYRAPDP.------------------...
AVT5_YEAST/1-446------HTACGAGVLAMPFA.FK-PFGLMPGLITLTFCGICSLCGLLLQTRIAKYVPK.------------------...
O62286_CAEEL/61-471------CGMIGPGCFSLAVS.FK-QAGLWGGLALVFIVGFLSLYSMHKIVNCSQYLAK.------------------...
AVT6_YEAST/1-439------HTACGAGILAMPYA.FK-PFGLIPGVIMIVLCGACAMQSLFIQARVAKYVP..------------------...
AVT1_YEAST/206-601------NVLIGIGLLALPLG.LK-YAGWVIGLTMLAIFALATFCTAELLSRCLD.....------------------...
MTR_NEUCR/51-449------VEAIALGSLSLPGA.FA-TLGMVPGVILSVGMGLICIYTAHVIGQTKL.....------------------...
AVT2_YEAST/65-467------NSILGAGIITQPFA.IK-NAGILGGLLSYVALGFIVDWTLRLIVINLTL....------------------...
VIAAT_RAT/114-513------NAIQGMFVLGLPYA.IL-HGGYL.GLFLIIFAAVVCCYTGKILIACLYEENED------------------..G
PROT1_ARATH/32-428------TGINSAYVLGYSGTIMV-PLGWIGGVVGLLIATAISLYANTLIAKLHEF....------------------...
AVT3_SCHPO/273-656------KSFVGTGVLFLPKA.FK-LGGLVFSSATLLIVGVLSHICFLLLIQTRM.....------------------...
AUX1_ARATH/44-438------SNQVAQVLLTLPYS.FS-QLGMLSGIVLQIFYGLLGSWTAYLISVLYVEYRA.------------------...
UNC47_CAEEL/87-475------NAIQGMFIVGLPIA.VK-VGGWW.SIGAMVGVAYVCYWTGVLLIECLYENG..------------------...
AAP6_ARATH/33-470------TAVIGSGVLSLAWA.IA-QLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDP.------------------...
AAP2_ARATH/46-481------TAVIGSGVLSLAWA.IA-QLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDA.------------------...
AVT4_YEAST/295-711------KSFIGTGVLFLPNA.FH-NGGLFFSVSMLAFFGIYSYWCYYILVQAK......------------------...
AVT7_YEAST/3-477------KTIVGAGTLAIPYS.FK-SDGVLVGVILTLLAAVTSGLGLFVLSKCSKTLI..------------------...
Q21652_CAEEL/22-416------GETAGGGMIALSYA.LT-SMGLIPGLILLSLCSIFSLYTALELCWTWKIMQNR------------------WPE
S38A3_HUMAN/64-491------NAIMGSGILGLAYA.MA-NTGIILFLFLLTAVALLSSYSIHLLLKSSGVV...------------------...
SKAT1_CAEEL/35-446------KSMFNAGCFSLPYA.WK-LGGLWVSFVMSFVIAGLNWYGNHILVRASQHLAK.------------------...
AVT3_YEAST/295-688------KSFVGTGVLFLPKA.FH-NGGWGFSALCLLSCALISYGCFVSLITTKDKV...------------------...
D7LAT0_ARALL/30-429------VSIVGTGVLGLPYA.FR-VAGWFAGSLGVIIVGFATYYCMLLLIQCRDKLES.------------------..E

PF02554

Q73V96_MYCPA/49-425LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPCTIWIVAGAVFAGAVQDYLVLWISTRRR----------------------
Q1IKI0_KORVE/33-409VFGHHFAAIAGPGPLVGPVL-AA.QFGYLPGTLWILVGAVLGGCVQDFVTLVFSVRRD----------------------
W0PIG8_9BURK/37-414LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGMLWILAGVVFAGAVQDFIVLFISTRRD----------------------
Q8NSL6_CORGL/37-415LFGHHFAAIAGAGPLVGPVM-AA.QMGYLPGTLWIILGVIFAGAVQDYLVLWVSTRRR----------------------
B3E5B6_GEOLS/1-379LFGHHFAAIAAAGPLLGPVL-AA.QFGFLPGALWIIIGAVVAGAVHDMIVLFASVRHR----------------------
D3SLN0_THEAH/33-404LFGHHFASISGAGPLVGPVL-AA.QMGYLPSVLWIPIGAVIAGAVQDMTVLFVSTRMK----------------------
Q1AYY2_RUBXD/34-410LFGHHFAAIAGAGPLVGPVL-AA.QMGFLPGTIWIIFGVILAGAVQDMTTLFFSMRRD----------------------
C5B2E8_METEA/32-408LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGMLWILAGVVLAGAVQDFMILFISMRRD----------------------
R5ZHV1_9ACTN/1-390AFSHQFSSICGAGPVTGTIV-AM.AFGWLPVVLWVLVGGIFFGAVHDFGALYASMKNN----------------------
D4YZ07_SPHJU/29-402LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTLWIIAGVVLAGAVQDFMVLFISMRRD----------------------
G8RRI7_MYCRN/67-445LFGHHFAAIAGAGPLVGPVL-AM.QMGYLPGTIWIIIGAVFAGCVQDYLVLSISTRRR----------------------
B5HN22_9ACTN/35-411LLGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTVWIIAGVIFAGAVQDMVVLFFSTRRD----------------------
Q5YQA1_NOCFA/54-432LYGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTIWIVVGVCLAGAVQDYLVLWASTKRR----------------------
F8GFU4_NITSI/34-409LFGHHFAAIAGAGPLVGPIL-AA.QMGYLPGMLWLLAGVVFAGAVQDFIVLFVSTRRD----------------------
I6YY40_MELRP/1-360LLGHHFASIAGAGPIVGPII-AA.SFGWAPVYAWILIGSTFIGGVHDYTALIASIRHK----------------------
Q213E9_RHOPB/39-416LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTLWILAGVVFAGAVQDFTVLFLSTRRD----------------------
B1ZS08_OPITP/41-415VFGHHFAAIAGPGPLVGPVL-AA.QFGFLPGMLWILIGATLGGAVHDSVILFCSVRRG----------------------
Q9HVI3_PSEAE/35-412LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTLWLIAGVVLAGAVQDFMVLFISSRRN----------------------
Q5L2D3_GEOKA/32-409LFGHHFAAIAGAGPLVGPIL-AA.QMGYLPGTLWIVIGVVLGGAVQDFVILFASMRRN----------------------
Q9KBY1_BACHD/3-388LWGHHFTSVAGAAPIVGPAI-AI.YWGWLPAILWVTLGTVFAAGVHDFGALVLSVRNK----------------------
I4WZC7_9GAMM/39-416VFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTLWILFGVVFAGAVQDFMILGLSLRRD----------------------
F8JAH8_HYPSM/32-409LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTLWLIAGAVFAGAVQDFIMFWASVRRD----------------------
Q8RBF1_CALS4/1-380LFGHHFAAIAGAGPLVGPVL-AA.QFGYLPGALWILIGAVLAGAVHDMVILFASVRYD----------------------
R6ZB35_9ACTN/1-384AFSHQFSSICGAGPVTGTIA-AM.MFGWLPVLLWVLVGGIFFGAVHDFGALYASVKNN----------------------
D2SAU5_GEOOG/54-430LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTIWIIVGVIFAGAVQDMTVLFFSMRRN----------------------
W5Y2A8_9CORY/68-445LFGHHFAAIAGAGPLVGPIL-AA.QMGYLPSTLWIIIGVIFAGAIQDYLTLWISTRRR----------------------
F4H7H1_CELFA/61-439LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTVWIIVGCVLGGAVQDYLVLTLSVRRR----------------------
I4BUN1_ANAMD/1-359LLGHHFASIAGAGPINGPVL-AA.VFGWLPVTLWIVVGNIFMGAPHDFGSLMASIRHK----------------------
A8FG20_BACP2/1-378TFGHHFAAIAAAGPLVGPIL-AA.QFGYLPGLLWLLIGAVIGGAVHDLVVLFASMRKK----------------------
F0S490_DESTD/4-376LLGHHFSSIAGAGPIVGPIT-AASSWGWLPAFLWVLIGNVFIGGVHDMSSLVASIRNK----------------------
Q7P007_CHRVO/32-409VFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTLWILVGVMLAGAVQDFLTLFLSMRRD----------------------
R5ZC92_9FIRM/1-380VFAHQFSSIAGAGPVTGPVM-AL.MFGWLPAVLWIVIGGIFFGAVHDFGALYASVKSK----------------------
B8DLB6_DESVM/1-381LFGHHFAAIAAAGPLLGPVL-AA.QFGYLPGTLWILVGCVVAGAVHDTVVLFASVRHK----------------------
D6Z9X1_SEGRD/53-430LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPCTLWIVIGVVFAGAVQDYLVLAFSARRR----------------------
D7B6A0_NOCDD/50-427LFGHHFAAIAGAGPLVGPVL-AA.QMGFLPGTIWIIVGVIFAGAVQDMVVLFFSTRRN----------------------
Q2JA57_FRASC/58-431LFGHHFAAIAGAGPLVGPVL-AV.QMGYLPGTIWIIAGVIFAGAVQDMVTLFFSMRRD----------------------
R6FJL5_9FIRM/1-374VFGHQFASIAGAGPINGPIQ-AA.IFGWLPVLLWILIGGVFFGAVQDFASMYASVKNK----------------------
C6WTH2_METML/32-409VFGHHFAAIAGPGPLIGPTL-AA.QFGYLPGTLWILIGAVLGGAVQDMVTLFFSTRRN----------------------
I4CCQ1_DESTA/1-369LYGYQFKSIAGAGPIIGPII-AI.QWGWLPALIWILAGTFFIGWVHDYSSAVIAMRND----------------------
A8ESS3_ARCB4/29-406LFGHHFAAIAGAGPLVGPIL-AA.QMGYLPSMLWILVGGVFAGAVHDFIVLFISTRRN----------------------
C7MT52_SACVD/47-424LYGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTIWIIVGVIFAGAVQDMVVLFFSMRRN----------------------
D7WD84_9CORY/71-449LFGHHFAAIAGAGPLVGPVM-AA.QMGYLPSTLWIIIGVVLAGAVQDYLVLAVSQRRR----------------------
W0L393_9GAMM/32-409LFGHHFAAIAGAGPLVGPIL-AA.QMGFLPGTIWILVGVMLAGAVQDFLILFISTRRD----------------------
Q1LHD0_CUPMC/33-409LFGHHFAAIAGAGPLVGPVL-AA.QMGYMPGMLWILAGVVFAGAVQDFMILFISTRRD----------------------
G8ASJ6_AZOBR/32-409LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGMLWILAGVVVAGAVQDFMILFVSMRRD----------------------
E1QXU3_OLSUV/1-389VFAHQFSSICGAGPVTGTIV-AM.MFGWLPVLLWVLVGGIFFGAVHDFGALYASVKNN----------------------
A7MKY8_CROS8/32-414LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGMIWILAGVVLAGAVQDFMVLFVSTRRD----------------------
C7RPJ8_ACCPU/32-409LFGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTLWIIVGVVLAGAVQDFMVLFVSTRRD----------------------
B2GG33_KOCRD/69-446LYGHHFAAIAGAGPLVGPVL-AA.QMGYLPGTIWIIVGVILAGAVQDYLVLFFSMRRG----------------------
Q1QW04_CHRSD/1-387LWGHHFTSVAGAAPIVGPAI-AI.YWGWLPAILWVVLGTVFAAGVHDFGAVVLSNRHK----------------------
A0LP60_SYNFM/1-400LFGHHFASIAGGGPIIGPTV-AM.LFGFIPVWLWAVFGSIFVGAVHDMTTLFASVREK----------------------
Q604D8_METCA/34-407VFGHHFAAIAGPGPLIGPTL-AA.QFGYLPGTLWILIGAVFGGCVQDFVVLVCSIRRD----------------------
B9M2N4_GEODF/1-381LFGHHFAAIAAAGPLLGPVL-AA.QFGFLPGALWIIIGAVVAGAVHDSIVLFASIRHK----------------------

PF13906

B4KYY5_DROMO/548-598--------------------------------------------------------------------------------
Q9LD96_ORYSJ/520-570--------------------------------------------------------------------------------
B4IZ20_DROGR/535-589--------------------------------------------------------------------------------
A2XK04_ORYSI/515-565--------------------------------------------------------------------------------
Q16RD4_AEDAE/393-443--------------------------------------------------------------------------------
B9I635_POPTR/565-615--------------------------------------------------------------------------------
B4NQ70_DROWI/627-677--------------------------------------------------------------------------------
C3XPQ7_BRAFL/527-577--------------------------------------------------------------------------------
C5LVE9_PERM5/263-313--------------------------------------------------------------------------------
C5KQZ0_PERM5/326-376--------------------------------------------------------------------------------
O44798_CAEEL/507-557--------------------------------------------------------------------------------
A9TH89_PHYPA/537-587--------------------------------------------------------------------------------
B4HLB6_DROSE/535-585--------------------------------------------------------------------------------
CAAT3_ARATH/534-584--------------------------------------------------------------------------------
D2HFL8_AILME/627-677--------------------------------------------------------------------------------
B5DFJ0_RAT/540-590--------------------------------------------------------------------------------
B0WAU2_CULQU/428-473--------------------------------------------------------------------------------
O17069_CAEEL/508-558--------------------------------------------------------------------------------
Q337V1_ORYSJ/559-609--------------------------------------------------------------------------------
A4FEQ4_SACEN/56-106--------------------------------------------------------------------------------
B4LDP2_DROVI/508-558--------------------------------------------------------------------------------
D0NG02_PHYIT/81-131--------------------------------------------------------------------------------
B7QME9_IXOSC/429-479--------------------------------------------------------------------------------
B0WAU5_CULQU/549-599--------------------------------------------------------------------------------
CTR2_CHICK/555-605--------------------------------------------------------------------------------
CAAT4_ARATH/528-578--------------------------------------------------------------------------------
B9SAY1_RICCO/451-501--------------------------------------------------------------------------------
A4IG22_DANRE/575-625--------------------------------------------------------------------------------
B9IPU3_POPTR/568-618--------------------------------------------------------------------------------
C5WR23_SORBI/560-610--------------------------------------------------------------------------------
D7SLW7_VITVI/530-579--------------------------------------------------------------------------------
E9PWS4_MOUSE/604-654--------------------------------------------------------------------------------
F1MWA9_BOVIN/427-477--------------------------------------------------------------------------------
F6HLX0_VITVI/454-504--------------------------------------------------------------------------------
F6SWF3_XENTR/559-609--------------------------------------------------------------------------------
F6YB26_XENTR/150-200--------------------------------------------------------------------------------
F7E7U9_XENTR/599-649--------------------------------------------------------------------------------
G1MMB4_AILME/534-584--------------------------------------------------------------------------------
G1MNG0_AILME/556-606--------------------------------------------------------------------------------
H0V5U0_CAVPO/558-608--------------------------------------------------------------------------------
H3C2Q0_TETNG/530-580--------------------------------------------------------------------------------
H3CER8_TETNG/575-625--------------------------------------------------------------------------------
I1N8D3_SOYBN/561-611--------------------------------------------------------------------------------
A0A096TLT9_MAIZE/517-566--------------------------------------------------------------------------------
M0QVZ8_BOVIN/550-600--------------------------------------------------------------------------------
Q2FYJ4_STAA8/386-437--------------------------------------------------------------------------------

PF02028

A8LPK2_DINSH/19-510LIGLVLCFLP.GSRTLMGG.LSTPEFGTFSWAAMIMCTLLAGGGVFWAAGEPIAHFLST..............P...PVF
Q92WM0_RHIME/57-540FSMLFLAFSR.YGELKLGPDDSEPEFRYLSWIAMLFAAGMGIGLMYFAVGEPMTHFAS...............P...PEA
B1YHV0_EXIS2/12-504LIAIFLIFSR.FGSIRLGKDSDRPEYGLISWFAMLFSAGMGIGLVFWGVSEPLTHFHTP..............P...VAT
A8LQI8_DINSH/15-511VFLIAIAFSK.YGAIRLGDADERPKYSYFTWFAMLYAAGQGIGIIFWSIAEPMFHYSGG.............TP...FAD
B9LMR4_HALLT/20-531LFLLFLIVGP.WGGIKFG..DEPPEYSFLSFFAMLYSAGFAAGVVFWGPTEALFYYNNP..............S...PLF
Q9K9K1_BACHD/6-494AFAIFLIFSK.YGNIRLGKQEEKPEYSYLTWFAFLFTAGMGIGLVFWGVAEPVYHYFD...............P...PIA
A8GBX6_SERP5/19-505VFVVFIAASR.FGSIKLGPEQSKPEFSLMSWAAMLFAAGIGIDLMFFSVAEPVTQYMM...............P...PEG
Q24SP9_DESHY/12-494IFVFGIAISR.YGKIKLGADDDKPEFSNFQWFAMLFGGGMGIGLVFWSVAEPIMHFNSP..............P...FG.
Q8P5D9_XANCP/17-505VFVLGVALSS.YGNIKLGADHDEPEFSYLSWAGMLFAAGISITLFFFCVSEPLTHYLQ...............P...PQG
Q7VZR1_BORPE/13-496LAVIFVAVSR.YGNIKLGPDHSEPDYRDITWFAMLFSTGMGIGLMFFGVAEPVMHFID...............P...PVG
Q5WBX8_BACSK/16-508VTGIWLAYSK.YGQVVLGDPSEKPRYTLFEYASILVAMGVGATLMRTGMVQWSEVAVDP..............P...FGL
Q24ME3_DESHY/23-511IFSLWLAFGR.YGNVKLGGPDDKPQFSNFSWISMMFTGGVGAGLVYWTMAEPIFYLKWP..............P...YWG
A4RTS9_OSTLU/5-508FVVIFVLFRKRYANIKLGQPDDRPDYSDLVWFTLIFTTGLGTGIFYFGVSEPMYYYRDDSKLLGTATNYIAKIP...FMN
A1TNS1_ACIAC/32-511GLALFLALSR.YGDLKLGDEDEEPEFSAATWFAMLFAAGMGIGLVFWGVAEPISHYGLP..............P...PGI
A1WTW7_HALHL/25-513LIALVMAFSP.LGRLRVGN..DKPDYSNFSWLSMIMATLLAGGGVFWAAAEPIAHFMDP..............A...PLF
A0M563_GRAFK/13-496IFLLIIAFSK.FGRIRLGT..SAPEFDRLSWIAMLYSAGMGAGILLRAVQEPVFMFLNN..............P...IQT
Q083A6_SHEFN/33-521IFCLALIVSP.FGKIRLGGDDAKADYSRLSWIAMLFAAGMGIGLMFWGVAEPLAYYTGWY...........ETP...LNV
A3HUC8_9BACT/12-495LFCIYVGFSK.YGKIRLGGKDAKPEFSTSAWFAMLFSAGMGIGLLFWGVAEPVSHYAN...............S...PTS
Q7NQ38_CHRVO/2-486LFALYLAFGR.FGHIRLGKEDEEPEFSRLSWFSMLFSAGMGIGLVFWGVAEPLSHFATP..............A...SAA
Q73N94_TREDE/25-518FTAIGLAFSR.FGTVKLGN.LEKPRYGNFTWGAMIFTSTMAADILYWSLIEWAYYFGES..............P...FGL
Q8FNC7_COREF/25-515VFLIGIFASR.YGRVKLGDDDDEPEHRLLVWFAMLFAGGVGAVLMFWGVAEPINHAFNV..............P...MVN
A7HWC8_PARL1/21-507VFVIGIGLSR.FGKVRLGPDHARPEFNAITWAAMLFAAGIGIDLLFFCVSEPVTQFLA...............P...PEG
Q47TJ2_THEFY/57-547VFALWLAFSK.YGQIPLGREGEEPQYTTVSWVAMMFATGMGIGLVFYGVAEPLAHYVTP..............P...PGT
A7HZZ0_CAMHC/11-495FSVLYLAFSR.FGNIKLGPDHSVPEYSNISWFAMLFAAGMGIGLMFFGVSEPLMHFLS...............P...PSG
A1WT60_HALHL/15-497GFVLVVLLRPDFRRLRLGPPDSYPEYSYLSWFAMLFSAGMGIGLLFYSVAEPLMHYAE...............P...PRA
Q88C09_PSEPK/15-521GLLIYLMCSK.FGSMKLGRDDDKPEFSFGSWIAMLFSGGMGIGLIFWSVAEPMWHYAGN..............P...FA.
Q2FYT0_STAA8/17-503FFCIFLIFSP.IGKLKLGKPNDKPEFNTISWFAMLFSAGMGIGLVFYGAAEPMAHFAT...............P...PTA
A4J208_DESRM/13-498VISMYLIFGK.YKDKKFG..EGEPDFKTSTWLGMIFTSTSSAALIYWATIEWYYYMQTP..............P...FGA
A3CRU5_METMJ/11-494VFALALALSR.YGTIKLGYDAERPQYGFFGWIAMLFAAGMGIGLLFWGVSEPLVHFLQP..............P...PFI
A1WTL9_HALHL/51-540LFCLLLIVLP.LGSIRIGGQDAKPDFSRLSWFTMLFAAGMGIGLMFWAVAEPVGYYTEWF...........GSP...FNI
Q8ESD6_OCEIH/10-503IFILFVAFSR.NGRIKLGGRDVKKEFGTFSWAAMLFSAGIGSSILYWAMIEWAFYYQGP..............P...FGI
A1WY53_HALHL/17-503LLVIWLGTGR.FKNVRLGQDHEVPEFRTFSWLTMLFAAGMGVGLIFWAVAEPISHFDSN..............P...FTV
O83144_TREPA/10-507GTTLTIAFSR.YGAVYLGT.TRTARYSNFTWGSMIFTSTMAADILYWSLIEWAHYFTQA..............P...FIA
Q9JZ61_NEIMB/17-502GFLLILSVSS.LGNIRLGRDEDVPEFGFLSWLAMLFAAGMGVGLMFFGVAEPLMHYFS...............D...ITA
Q30W47_DESAG/28-510LFVLLLTVSR.YGDIRLGGPDAEPEFSTMAWFAMLFSAGMGIGLLFYGVAEPMFHYVA...............N...PLT
Q9KCW2_BACHD/16-501IFSIVIAISP.YGRLRLGKQNDRPEYSWYSWIGMLFAAGIGVGFVFWGVAEPVLYYLDT..............P...VGY
A4FCK8_SACEN/14-506VFVVVLMVSR.YGAVKLGPPDSTPEYSNLAWFAMLFTAGMGIGLVFYAVSEPVTHFLT...............P...PTG
Q6NER6_CORDI/66-556VFVIGVAVTR.TGSIRLGPDHSRPQFKLFSWSAMLFAAGIGVDLMFFSVAEPVAQYYG...............P...PVG
A4XAA8_SALTO/18-503VLTFVLAFSR.LGTIRLGADTERPEFSNLAWIAMMFSAGMGIGLVFFAVAEPIQHYASP..............P...PAT
A0Q2F1_CLONN/9-486VFCIWLFFSK.FRNIKLGDDDSKPEFSNISWFAMLFSAGIGIGLVFWGVSEPLMHYLN...............P...LGM
Q5WHJ4_BACSK/13-493LVCLFFIFSP.YGKIRLGKDEDRPEYSYLTWFAFLFSAGLGVGLLFFGAAEPIAHYAVS..............S...PTV
Q03DR2_PEDPA/2-485MFFIVLIFSK.YGKIRFGKADPAKDYSGFQWGSMVFATAIDASILMLSATDPLQYLQHP..............A...FGA
A1WWT9_HALHL/15-504LFALFLMFSR.FGDLKLGDDDRPPEFSYFAWFSMLFGAGMGIGLLFWSIAEPVWHFQGN..............P...FID
Q8NN75_CORGL/48-536GTMLYIAFSR.YGRIKLGTDEDEPEFSRFSWIAMMFGAGIGVGIFFFGPSEPLWHYLSP..............P...PHT
Q4KIJ7_PSEF5/28-512GASLYIGFTR.LGRVRLGGVGHTPSISTFNWVSMIMCALLAGGGAFWAAAEPMMHFIAP..............P...PYF
GBTR_ACIAD/16-498IVLGYIACSS.SGKIKLGPDHSQPDYSNSSWFAMLFTAGMGIGLMFFGIAEPIMHYVS...............P...PSG
Q4JV07_CORJK/39-530IFMIWIALSK.AGAIRLGPDHSKPQYSLFSWSAMLFAAGIGIGVMFYSVAEPLAQYST...............P...PVG
Q1GUM7_SPHAL/19-507VLLLLVALSP.LGGRIIGGTMATPLLTRWRWFAVTLCTTIATGILFWGAAEPLFHLNDP..............PA.MLGI
Q5V5Y7_HALMA/44-539ITLLYFAFSK.YGNIRIGGVEAEKEFSDFSWMAMLFSAGMGIGLMFFSVSEPLYYFQNP..............PS.FFGA
Q4JU17_CORJK/21-505GFILFIAFSK.FGHIRLGKDNEPPEFNSISWVAMMFAAGMGIGLMFYGVTEPLTYYRDG..............V...PGV
Q6ANF3_DESPS/20-505IVGFGVAISK.YGNLTLGQAGDEPEFSTTTWIAMLFSCGIGVGYVLWGAAEPMFHFMNT..............P...YGA
A8EUT8_ARCB4/9-492IFALFLAFSP.FGKFKLGPDQSKPDYSNFSWFSMLFSAGMGIGIMFWGVAEPIVHYTN...............P...PVG
Q1QZD1_CHRSD/9-499VMAVIVYFSP.LGHVRIGGRDATPLLSRLRWFSITLCTTLAVGVLFWTTAEPLYHFMAP..............PE.SLGL
A6VY67_MARMS/19-509FFSIWVAFSR.YGNIRLGKDDEKPEFGFTAWFSMLFSCAIGTGLLFWSIAEPITYLQGN..............PF.IEME
Q3IIZ4_PSEHT/14-498VFIVSVAASS.WGNIKLGPDHSEPQYSFAEWFAMLFSAGYGVALLYFGVAEPVLHYAS...............P...PSG
Q5HKM4_STAEQ/12-498VFLIFLAFSR.YGRFKLGSDEEEPEFSMLSWIGMLFSAGLGVGIVFWGVAEPLTHYLHS..............P...FPG
Q1AY03_RUBXD/14-498VFVLFLAFSR.YGRIRLGREGEEPEFSTPSWVAMMFSVGMGIGLMFYGVAEPISHLTAP..............P...HGL
Q8ESZ5_OCEIH/13-497LIGLGLAVSK.YGKVRLGK.MDKPKYSYFGWVSMILVTLLASGGVFWAAAEPMYHYMDT..............P...PLF
Q8ET62_OCEIH/7-489AVALFIAVSP.YGNIRLGKDSDRPDFSNISWVAMLFAAGIGIGLVFYGASEPLAHFMID..............A...PLS
Q1QZU3_CHRSD/9-494VFLLTLACSK.YGKIRLGPQDSSPSYSFFSWVSMLLAAGFGVGLVFYGMAEPMTHFLEP..............P...YGD
A4FIK1_SACEN/20-504VFLIVLAAGR.FGRIRLGADTDRPEFGTVSWLAMILAAVMGIGLVSYGVSEPISHFAEP..............P...HGL
Q8ESH6_OCEIH/15-502IIALILGYSK.FGKIRLGK.LEKPEIGTFKWISIIMCTLLAAGGVFWAAAEPLSHFLTV..............P...PHF
Q9HQN5_HALSA/21-504VLVLGVTWSR.YGRLRIGGPDAEPEFDTFSWLSMVFTVGFGASILIWGVGEPVSIVQQP..............P...PEP
Q6LGN5_PHOPR/6-492YLCIWLAFSK.YGSIRLGKDDDRPEFSTVSWLTMLFAAGMGVGLLYFGSAEPLFHYKSF.............LP......
Q6ANF9_DESPS/22-508MVMFFFAFSK.YGNIKLGPDDATPDFSTFSWMGMLFSAGMGTVMLYWGVAEPVYHYIHP..............L...ATT
A5I0X2_CLOBH/10-487IFCMWAAFSK.YGKLKLGKDNEDPEYSLISWFTMLFSAGMGIGLIFWGVAEPLNHYIH...............P...FNL
E0TGG2_PARBH/42-529LLAIAIGLSP.LGKIRLGGEEAQPEFSLLSWLAMLFSAGMGIGMVFYGAAEPLAYYTDWS...........GTP...YDV
A1U5B2_MARHV/17-501IFLLGLALSR.YGSIRLGADDSRPDYSNLTWFTMLFAAGIGTILMFWGVAEPVSHFAN...............P...PFD
Q5V633_HALMA/130-615CYCLFLLLGP.WGEIKLGGPDTEPSYTYPTYFTLVFTAGIAAGLVFWGPTEALFHYDQP..............PP.YIGA
Q5LNL7_RUEPO/27-596VFLFVLAALPQTGKRIMGRPGEGTEFSNFSWFSMMFGAGLGVGLMVFATAEPLGLWGSN..............PV.VVSG
Q8FM43_COREF/17-511IFLVLIAVSR.FGHVRLGADDERPEYSTPVWFSMLFAAGIGTILMFWGVAEPISHFAN...............P...PIG
A6W731_KINRD/41-528VLALVLAFSR.FGRIRLGRDEDRPEHSRASWIAMMFSAGMGIGLMFYGVTEPVTHLMTV..............P...QND
E0TC76_PARBH/7-483VFCALAALHPKLAHRRLGGPAAVPEFRLVTWFAMLFAAGMGAGLVFWGAAEPLIFTKAP..............P...PGG
BETT1_ACIAD/20-509GFVAWLAFSQ.VGNIPLGKAQDKPEFGYLVWTSMLFSAGIGIALLYYGVAEPVDHFLR...............P...PEG
Q24SQ4_DESHY/13-501LFCLYLAFSR.YGDIKLGGQDTLPEYSTFSWFAMLFGCGMGVGLVFWSIAEPINHFLNP..............P...AYV
A4SA86_OSTLU/1-471IFILYLLGTK.YKDVKLGRDDEEPAFDYYEWFSMMFACGIGVGLYTFSVMEPISYYRGVVS..........KLP...IVN
B2FT71_STRMK/40-523VFLMYLAFGR.FGNLRIGGEDAEPEFSRASWMSMLFAAGMGIGLVFWGAAEPISHFSKP..............P...EGL
B4EHS6_BURCJ/16-501VFLVLIAASD.FGNIRLGPDDAEPEFSFVSWTAMLFAAGMGIGLMYFGVGEPMQHFLK...............P...PTV
B7VLA5_VIBTL/13-502AFMVYVVFSD.MGQIKLGEADEEPEFKTASWAAMLFCGGIGASILYWGCIEWAYYYQSP..............P...FQL
B7VQN7_VIBTL/33-520AFAVVLAFSP.LGKIRLGGEDATADYSMSSWIAMLFAAGMGIGLIFWGVAEPTAFFTNWF...........GTP...LDA
M1F781_9ALTE/23-507FIAIGVACSP.AGRAKIGN.LDRPEMSTFRWLSIIMCTLLAGGGVFFAAGEPIYHFVVT..............P...PAF
M9X2A3_MANHA/17-499LFLIFLSFSR.LGDIKLGADTDEPEFGFGSWIAMLFAAGMGIGLMYFGVAEPILHYLK...............P...VQQ
Y917_MYCTU/23-509VFALYCGISR.IGTIRLGRDDELPEFSFWAWLAMLFSAGMGIGLVFYGVAEPLSHYLRP..............P...RSR
Q2FW63_STAA8/9-491FVCVYILFSR.YANITLGEEGEDPEFSLPSWFAMLFSAGMGIGLVFWTTAEPISHAFKL..............T...PIH
Q4FTS7_PSYA2/19-509IFALFVGFSK.YGDIKLGQDHEKAQFPFLAWAAMLFSAGIGIDLLFFGASEPLMHYLTP..............H...AGL
Q6LRW5_PHOPR/30-506AIALCIAVSR.YGKTRMG.VETKPTIGTFRWLAMIMCTLLAGGGVFWSAAEPIYHFITP..............SPSYPGI
Q814I8_BACCR/12-494IVAMCMAFSK.YGRVKLGG.LEKPEISTAKWLAIIMSTLLAGGGVFWAAAEPMYHLMTV..............P...PIH
Q81K57_BACAN/7-498GVSIFLIVSK.YGSIRLGKDDDEPDYSYMTWFAMLFSAGMGIGLVFWGVAEPLNHLYAP..............P...FG.
Q81YS8_BACAN/8-499ILATYLAFSK.YGSIRLGKDGEKPKYSYPSWLSMLFGAGMGIGLLFYGIAEPISHFTD...............P...LTG
Q87J97_VIBPA/48-525LIGLALAFGR.TGYVRLGG.LAKPDIDTFKWLSIVLCTLLAGGGVFWAAAEPIAHFVTA..............P...PLY
Q8DZH9_STRA5/9-487ALCVFFIMSP.LGQIRLGQPHSRPEYSTVSWIAMMFSAGMGIGLVFYGAAEPLSHFAIS..............T...PGA
U5LC86_9BACI/7-489IVCLYFLISP.IGRLKLGKPEDKPEFSRVTWLAMLFSAGMGIGLVFWGAAEPLSHYAVS..............S...PTG

PF01566

NRAMB_CAEEL/63-449-----------------LQAGAQAEYKLLW---VLLVSHIVGMLLQRMS-ARLGV------VSGKHMAEIAYDYY.....
NRAM2_ORYSJ/90-453-----------------LQAGAAAGYQLLW---LLLWATVMGALVQLLS-ARLGV------ATGKHLAELCREEY.....
NRAM2_DICDI/170-526-----------------LEGGSRFGYQLMW---VLLFSNIMALFLQTLV-IKLAL------VTKNDLAQQCRKEY.....
A5FYD3_ACICJ/37-386-----------------SQSGVAWGYRLLL---LQFILIPILFVVQELT-VRLGI------FTGKGHGELIRDTF.....
Q6AKY6_DESPS/42-387-----------------AIAGATYGYKMLW---VVILSAVFGTTTQYLA-ARVGV------LEGMGIIAATEKHL.....
Q882X3_PSESM/25-384-----------------IEAGSRFGYSLLF---VVVLASLSGMVLQNLC-SRLGI------ATGRDLAQLSAARY.....
A4XLU3_CALS8/27-379-----------------VAAGSQFGLKLLW---VVLLSTIILIVLQHNA-AHLGI------ATGLCLAEATSIYL.....
B2JMU6_PARP8/43-408-----------------TQAGAQFGFGLLW---TMLLTYPLMVAIQSVS-ARLGR------VTGRGLATNLRRRY.....
Q8AA36_BACTN/43-395-----------------FAAGSEFGYSLLW---VVTLSTIMLIVLQHNV-AHLGI------VTGLCLSEAATKYT.....
Q8ESA4_OCEIH/39-387-----------------TQAGASFGYALIW---AVLFSILATIVLQEMS-ARLGI------ISKKGLAEAARDQFNHPAI
Q3AF37_CARHZ/37-388-----------------AAVGALYGYRMLW---GLLLITFSLAVIQEMN-ARMAV------VTGKGLSDLIRENF.....
Q7NSE8_CHRVO/64-420-----------------AQAGQNYGTSLLW---TLILLIPVLYVNQEMV-LRLGA------VTGVGHARLILERF.....
A6LBT1_PARD8/40-392-----------------LAAGSEFGYALLW---VVTFSSVMLIIIQHNV-AHLGI------VTGLCLSEATNKYM.....
Q8I3M7_PLAF7/268-619-----------------YS.....GYYLLW---IMVYGHMLGFIFQVLS-MRLGH------VTGLDLASLCSKEF.....
A4S7A4_OSTLU/17-379-----------------LQAGTLFGYKLLW---VLLWATLGGWYIQGLT-IRLAL------ATGWDLARCMREEY.....
B2UC67_RALPJ/70-426-----------------TQAGQNYGTTLLW---TLLLLIPVLYVNQEMV-LRLGA------VTRVGHARLIFARF.....
Q5V6I3_HALMA/26-374-----------------SVTGAEFGYALLW---TMVFSIVATIVLQEMS-ARLGL------VSGEGLGEALRERFDNQIV
Q1AYA4_RUBXD/47-394-----------------MEGGARYGYLLLW---VVACADLVAVLVQSMS-ARLGI------ATGRNLAELCREAF.....
NRAM5_ARATH/90-453-----------------LQAGAVAGYSLLW---LLLWATLMGLLMQLLS-ARIGV------ATGRHLAEICRSEY.....
Q21Z51_RHOFT/33-398-----------------SQAGAQFGFSMLW---TMVLTLPLMVAIQIVS-ARIGY------VTGHGLVANIKARF.....
Q1J0H3_DEIGD/66-414-----------------IEGGAQFGYTLLW---VILAANLMAMLIQNLS-AKLGI------ATGKNLPEVIRERW.....
Q2GAH9_NOVAD/42-407-----------------SQVGAQFGYTLSW---ALLFSLPLMAAIQEIC-ARVGA------STGVGIAQNLKEHY.....
Q24C68_TETTS/50-400-----------------MDAGLNGKYHLLW---VLFLATALGFVFQNRA-MMIGL------VSGKDMAKLCRYYY.....
Q01SI9_SOLUE/31-396-----------------SVSGAGFGYSPLW---TALFCFPLMVAVQMMC-ARLGM------VSGRGLAAVVRRRY.....
Q4JWM2_CORJK/25-368-----------------ISAGSHYGYLLVW---VLVVANLMAMFIQYHS-AKLGL------VTHRSLPEIMGERL.....
Q0S6I8_RHOJR/42-391-----------------LTAGAKYGYLLVW---VLVLANAMAVLVQYLS-AKLGL------VTGKSLPEMLGTRL.....
Q01UU9_SOLUE/52-406-----------------LEGGARFGYKLLW---VLVMSNLMAVLLQTLS-ARLGI------VRGRDLAQACRETY.....
MNTH_GRABC/58-408-----------------IQAGSRYGYTLLW---VVAAANLIAMLFQALS-AKLGI------ATGRNLPELCRDHF.....
A5FLF3_FLAJ1/44-400-----------------IAGGSQFGYTLVW---VLLMSNLMALLLQSLS-ARLGI------VTQRDLAQASRETY.....
A0LSF9_ACIC1/91-445-----------------AQAGQDYGYSLLW---VLLLLIPVLIVNQEMV-VRLGA------VTGVGHARLIVERF.....
A0LFY7_SYNFM/33-383-----------------IQSGARFGYALLW---VVIASNAMAILIQVLS-AKLGI------ASGFNLAEVSRERL.....
A2TXR3_9FLAO/37-396-----------------IVAGSKFNMQLLW---VLFLSCLFSGVLMFAY-GNFAL------ITGETALYGFKKHL.....
MNTH_CHRSD/52-403-----------------IEAGSRYGYTLLW---VVLAANLMAMLIQTLS-ARLGL------ATGQNLPQVIRARY.....
A6M0Q0_CLOB8/54-403-----------------ISGGSEFGYALIW---VILFSNLMAIFLQIMS-AKLGI------ATGHNLPEMCAKVF.....
Q2L2L8_BORA1/38-396-----------------IAGGAGFGYGLLM---VVLAAAVLAMGFQILV-ARLAL------ATGEDLAALTARHF.....
Q0W8Z5_METAR/41-392-----------------TLAGAHFGYSLLW---TLIPIAIVLVIVQEMS-ARMGV------VTGKGLSDLIRENF.....
NRAM1_DICDI/94-450-----------------IQAGAMAGYQLLW---VLFWSTVIGFWLQMLA-SRLGV------VTGKHLAEHCREQY.....
Q15PP3_PSEA6/27-386-----------------IVAGSTFGMQLLW---VLLLSCLFSGVLIYAY-GNFAL------VTGETALYSFKKHL.....
Q3IH27_PSEHT/19-373-----------------SVAGANFGFALIW---TLLFSVIATILLQSMA-ARLGV------ATGKDLAQALRAHIHTPVL
Q89BW0_BRADU/52-418-----------------SQAGAQLGFGIGW---TMLLSYPLMAAIQEIS-GRIGR------VTGHGIAGNVCRNF.....
B5E9R2_GEOBB/31-382-----------------SVAGAQFGYSLLW---TLIPITVALVVVQEMV-ARMGV------VTGKTLADLIRERF.....
B4SC14_PELPB/34-385-----------------IEGGSKFGYELLW---VVTLGTLMLVLIQHMA-AKLGI------ATGKSLAVNIRDHF.....
A6W550_KINRD/43-391-----------------LTAGAGYGYLLLW---VLVLANAMAVLVQYLS-AKLSV------VTDRTLPEVLRDRL.....
B0ULW7_METS4/44-412-----------------AQAGAAYGYGFGW---TLLYSYPLMAAVQMIS-ARIGR------TTGHGIAGVLQRHA.....
MNTH_CALS4/43-392-----------------ISGGSLFDYHLIW---VILWSNVIAIFLQIQS-AKLGI------ATGYNLPEMCSIIF.....
Q97LD4_CLOAB/40-392-----------------VSAGSDYGYSLLW---IVTLSTIMLIILQHNA-AHLGI------VTGDCLSEAVSKKF.....
Q31GI7_THICR/35-390-----------------IEAGSRYGYDLLW---VITLASLVAILMQLLS-AKLGI------ATGKNLAQMIRVQH.....
Q18IT5_HALWD/34-375-----------------LSGGANFGYALLW---VVVISAIFGALAQYLA-TKLAL------ETNEGLIKTVERRL.....
A9C0V2_DELAS/70-429-----------------IAGGSQFGYSLLA---VIFASNLMAMLFQAAA-VRLGL------ASGRDLAQACRAQF.....
Q97DZ1_CLOAB/30-381-----------------ATVGASYGYKMLW---GLLLITFSLAIIQEMN-ARMAV------VTGKGLSDLIRENY.....
A4CKX6_ROBBH/21-369-----------------LRAGVEMGYALLW---ALLLSVVATIVLQEMA-GRLGL------VTRRGLPSLIRKRVTLPWL
MNTH_ACICJ/51-400-----------------IQAGARYGYDLLW---VVLLASLIAMLFQGLS-ARLGI------VTGRNLAELCRDTL.....
Q5WIT7_BACSK/38-386-----------------TRAGASFGFALLW---AVIFSIIATIILQEMC-ARLGI------ITQKGLGAAIREHFTHPLL
A2SEC8_METPP/40-393-----------------LEGGARFGYQLLW---VLLASNIIAVLLQSLA-ARLGI------VGRLDLAQACRAGY.....
Q5V5I1_HALMA/54-394-----------------VTAGGAFGYSLLW---VVVLSAGAGALAQYLA-MRLGL------LTERGIVAVVEDHL.....
A5G362_GEOUR/45-396-----------------SLAGARYGYGLLW---VMIPTTIALVVIQEMC-ARMGA------VTGKGLSDLIRESF.....
Q7P0J1_CHRVO/53-410-----------------IEAGSRFGYQLLW---VVMLSGIAAMMLQMLA-ARLGL------VTGMDLAQASAARY.....
B1YM03_EXIS2/34-380-----------------MTAGAQYGFLLLW---VIVAANLMAVMIQTLS-AKLGL------VSNTSLAEVIRDEL.....
Q1IV65_KORVE/40-399-----------------LAAGSQFNYALLS---VVLISSLMAILLQSLS-LKLGI------VVERDLAQACRDAY.....
Q74JG3_LACJO/54-437-----------------INGGQSFNYLLIS---TILISSLMAMLLQYMA-AKLGI------VTQMDLAQAIRART.....
Q0SCQ4_RHOJR/43-390-----------------VQAGSEYSYSLIW---VIAVSTIFMLVYADMS-VRLGI------RTPASMISSVKDIL.....
Q5FP93_GLUOX/65-424-----------------LQGGSRYGYTLLC---VIMLSNLMAILLQALS-ARLGI------ATGRDLAQACRDHF.....
Q3ABN3_CARHZ/35-384-----------------FAGGSRYGSIMLI---TVLLCNFLAILFQSLV-AYLTL------KTGKSLAENIVEKL.....
Q6A673_PROAC/25-375-----------------LAAGAGYGYLLVW---VLVVANVVAMLVQYLS-AKLGL------VTGHSLPELVGGAL.....
Q8LKG7_CHLRE/112-473-----------------LAAGSSFGYTLLF---VVLCSSLCAMFLQYLS-LKLGI------ASDRDLAQACRDAY.....
A4FCR3_SACEN/23-373-----------------VQAGSRFGYSLIW---VIAVSTVLMLVYADMS-IRIAL------VSRGSVVETIKEQL.....
A4XIU1_CALS8/36-387-----------------AMVGAMFGYKMLW---GLFLITISLAVIQEMA-ARMGV------VTGKGLSDLIREHF.....
Q3IQM6_NATPD/26-374-----------------SVIGAEYAYLLVW---TIAFSILATMVLQEMS-ARLGL------ITRDGLGEALRNEFSNPLA
Q2LVH8_SYNAS/49-400-----------------SLAGAEYGLSLLW---LLIPITGALIIIQEMG-ARMGV------VSGKGLSDLIRERF.....
MNTH_NOSS1/49-408-----------------IAGGSKFGYTLLT---VILLSNLMAILLQSLC-VRLGV------ATGRDLAQACRDYF.....
B8I817_CLOCE/56-405-----------------ISGGSKFNYNLVW---VILWSNIMAIFLQSLS-AKLGI------ATGYNLPQMCGRVF.....
Q5QVV5_IDILO/23-379-----------------SLAGANFGYALLW---ALLFSVVACVILQEMS-ARIGL------VTQAGLGENIRNNLTSGWL
A6LYR0_CLOB8/35-386-----------------ASVGASYGYKMLW---GLLLITFSLAVIQEMN-ARMAV------VTGKGLSDLIREKF.....
A1A393_BIFAA/49-397-----------------ITSGARYGYLLVW---VLVLANCMSVLIQYQS-AKLGI------VTGKSLPEILGERL.....
A4YWA6_BRASO/74-430-----------------LAGGSKFGYVLLS---VALLSNLMAIVLQSLC-TRLGV------ATGRDLAQACRDST.....
A4YYM6_BRASO/41-406-----------------SQAGAQFGYGLLW---TVFLTTPFMIAIQLVS-ARIGR------VTGKGLAANITAVA.....
B4EFC9_BURCJ/73-427-----------------TQAGQNYGTTLLW---TLLLLVPVLYVNQEMV-LRLGA------VTGVGHARLIFERF.....
C5B0F9_METEA/57-413-----------------IAGGAQFGYTLLS---VILLSNLMAIVLQALA-ARLGI------ATGLDLAQACRERT.....
C6XTY0_PEDHD/53-406-----------------LAGGSKFGYQLIW---VLLMSNLIALLLQSLS-ARLGI------VRGLDLAQASRNAY.....
F6HR32_VITVI/38-391-----------------VEGGARFGFDLVA---LMLVFNFAAVLCQCLA-ARIGV------VTGRDLAQICSDEY.....
K4CQH6_SOLLC/39-392-----------------VDGGARFGFDLVM---LVLLFNFAAILCQYLS-ACIAL------VTDRDLAQICSEEY.....
MNTH_ECOLI/38-384-----------------IQAGASFGYQLLW---VVVWANLMAMLIQILS-AKLGI------ATGKNLAEQIRDHY.....
MNTH_MYCTU/52-400-----------------VSSGAQFGYLLLW---VIVAANVMAALVQYLS-AKLGL------VTGRSLPEAIGKRM.....
NRAM1_ORYSJ/56-417-----------------LQAGANHKYELLW---VILIGLIFALIIQSLS-ANLGV------VTGRHLAELCKTEY.....
Q2YM61_BRUA2/67-424-----------------LAGGSRFGYALLS---VVLLSNLMAVLLQALC-TRLAV------ATGRDLAQACRDAY.....
Q63LP7_BURPS/56-403-----------------IQAGAAYGYELLW---VVLAANVIAMVFQAMS-AKLGI------VTGRNLAELCREHF.....
Q8RBX2_CALS4/42-393-----------------VAAGSSYGYKLLW---MVTLSTIMLIILQHNA-AHLGI------VTGYCMSEAATKFL.....
MNTH_RALSO/56-415-----------------IEAGSRYGYSLLF---VVLLSSLAAMVLQCLS-ARLGI------VTGKDLARLSRERY.....
MNTH_LISMO/61-418-----------------IAGGSEFGYTLLS---VILISNILAVLLQSLA-SKLGI------VTGRDLAQASSDHF.....
R6A200_9ACTN/11-363-----------------MAAGSQFGYALLW---IVTLSTIMLIVLQHNA-AHLGI------ATGACLAEATTRFL.....
R7G054_9FIRM/36-390-----------------IAAGSGFGYELLW---MVTLSTVMLIVLQHNA-AHLGI------ATGLCLSEAASRYM.....
U5LI50_9BACI/48-387-----------------..IGAIYGMQLIW---ALVIVVIFMMIFTEMS-TRIGL------AANESFIQVMKKKW.....

PF00474

YWCA_BACSU/33-434-----------------AGMIALYGFDGFF---YSIGFLVAYLVVLYIV-AEPLR.....NLGKYTMADMIAARF-----
PANF_ECOLI/36-432-----------------PGAAYKYGLGWVL---LAMIQLPAVWLSLGIL-GKKFAIL.ARRYNAVTLNDMLFARY-----
SC5A4_PIG/58-492-----------------AGTGAASGIAIAA---FEWNALLLLLVLGWFF-VPIYI.....KAGVMTMPEYLRKRF-----
SC5A2_HUMAN/55-492-----------------AGTGAASGLAVAG---FEWNALFVVLLLGWLF-APVYL.....TAGVITMPQYLRKRF-----
PUTP_HAEIN/35-441-----------------PGAVYLSGLVEGW---IAIGLTIGAYFNWLLV-AGRLRVYTELNNNALTLPEYFHNRF-----
SC5A1_HUMAN/58-492-----------------AGTGAASGIAIGG---FEWNALVLVVVLGWLF-VPIYI.....KAGVVTMPEYLRKRF-----
PANF_HAEIN/36-432-----------------PGAAYKYGLGWVL---LAMIQVPVVWLALGAL-GKKFALL.SRETNALTINDLFFYRY-----
PUTP_ECOLI/35-437-----------------PGAVFLSGISESW---IAIGLTLGAWINWKLV-AGRLRVHTEYNNNALTLPDYFTGRF-----
ACTP_ECOLI/63-468-----------------SALVFTSGYDGLI---YSLGFLVGWPIILFLI-AERLR.....NLGRYTFADVASYRL-----
SC5A3_CANLF/39-477-----------------AGSGAASGFAVGA---WEFNALLLLQLLGWVF-IPIYI.....RSGVYTMPEYLSKRF-----

PF02133

YEME_SCHPO/55-506-----------------GTA.VESGLSWWEAWITVWVGYTIAAFILTIA-GRAGA------VYHISFPVLSRSSF-----
FCY22_YEAST/73-491-----------------ALGPLVFGLNFGQSVLVIIFFNILGLIPVALF-SLFGV------ELGLRQMILSRYLA-----
ALLP_BACSU/20-456-----------------GGL.IAIGLSPWQVLAIIITASLILFGALALN-GHAGT------KYGLPFPVIIRASY-----
FUR4_YEAST/103-562-----------------ATG.LQLGLNWWQCWITIWIGYGFVGAFVVLA-SRVGS------AYHLSFPISSRASF-----
YXLA_BACSU/10-428-----------------TIP.VAMGLNLFWSVAAIICGTLIGAIFMASH-SAQGP------QLGIPQMIQSRAQF-----
Q9ZBQ0_STRCO/18-445-----------------ASLVVAYRLNFWQALVVAGAAPVVSYGLVGLI-GIAGK------RGGAPGMALSRAVF-----
CODB_ECOLI/11-398-----------------TLG..TG.LSYHDFFLAVLIGNLLLGIYTSFL-GYIGA------KTGLTTHLLARFSF-----
ALLP_ECOLI/19-457-----------------GGF.FILGLSTFSIMLAIILSAFFIAAVMVLN-GAAGS------KYGVPFAMILRASY-----
O86506_STRCO/10-448-----------------WLP.PSFGLGWWASVSSVVAGTVVGTVFTAPL-ALISL------RTGTNLSTSSGAQF-----
FUR4_SCHPO/48-499-----------------ATA.IELGLNWWEAWICVWVGYLICGILVATT-GRPGA------VYHISFPVLSRSSF-----
FCY21_YEAST/73-489-----------------ALGPMVFDLNFGQSVFVIIFFNLLGLVSVAFF-SVFGA------ELGLRQMILSRYLV-----
FUI1_YEAST/119-575-----------------ATG.LQLGLNWWQTWICIWVGYTFVAFFLILG-SKVGN------NYHISFPISSRVSF-----
DAL4_YEAST/105-564-----------------GTG.LQLGLNWWQCWLTVWIGYTFAGIFVVLN-SRFGS------AYHLSFPITVRASF-----
O69811_STRCO/47-491-----------------SGL.IAVGMDWKQAVFTIALANLIVLAPMLLT-GHAGP------KYGIPFPVFARASF-----

PF00324

BAP2_YEAST/99-567GL---------------HYGGP-A--AL..II-GYILVSFVTYFMIQAA-GEMAVT------------------Y-----
GABP_BACSU/16-456VI---------------HSTGP-.--GA..VV-SYALAGLLVIFIMRML-GEMSAV------------------N-----
S12A9_HUMAN/42-536VV---------------GHAGL-L--QA..LA-MLLVAYFILALTVLSV-CAIATN------------------G-----
HUTM_BACSU/19-465TL---------------HQAGP-G--GT..IL-AYVIGGLMMYLVMQCL-GELSVA------------------M-----
LYSP_ECOLI/21-480TI---------------SQAGP-G--GA..LL-SYMLIGLMVYFLMTSL-GELAAY------------------M-----
AGP3_YEAST/57-511AL---------------NKGGP-L--AL..LL-GFSIIGIIAFSVMESI-GEMITL------------------Y-----
S12A1_MOUSE/178-682IV---------------GEAGI-G--LG..VL-IILLSTMVTSITGLST-SAIATN------------------G-----
CYCA_ECOLI/27-470TI---------------SLAGP-.--SI..IF-VYMIIGFMLFFVMRAM-GELLLS------------------N-----
GABP_ECOLI/18-458AI---------------AEAGP-.--AV..LL-AYLFAGLLVVMIMRML-AEMAVA------------------T-----
ISP5_SCHPO/87-545TL---------------REGGA-A--SV..LI-CYSLVGSMVLMTVYSL-GELAVA------------------F-----
TPO5_YEAST/59-532GL---------------INGGP-L--TI..ML-GFLISGVCIWFSSLSL-GEIVSK------------------F-----
PUT4_YEAST/114-588TL---------------HTCGP-A--GL..FI-SYIIISAVIYPIMCAL-GEMVCF------------------L-----
AGP2_YEAST/92-565AL---------------YRGGP-A--SL..LL-AFALWCVPILCITVST-AEMVCF------------------F-----
GAP1_YEAST/94-560AL---------------RTGGP-A--SL..LI-GWGSTGTMIYAMVMAL-GELAVI------------------F-----
Q9HKE0_THEAC/16-471SI---------------VGLSG-I--NA..PL-AMLISFVAVVLAANTI-YQFSGI------------------I-----
Q98QR4_MYCPU/13-498VG---------------RAVEH-N--GTSWLL-AWVFGGIISLAAAINF-SEISFL------------------K-----
Q9HJ13_THEAC/2-455AT---------------FSIAG-S--RT..IL-SVIFGWLVYAIFMVTP-YQFSKY------------------K-----
ANSP_SALTY/34-477RL---------------QMAGP-A--LA...L-VYLICGIFSFFILRAL-GELVLH------------------R-----
Q9VTW8_DROME/217-716VV---------------GQAGV-I--EG..FV-LILTTTAVTTITALSM-SAISTN------------------G-----
Q97VA6_SULSO/25-513VA---------------STGPL-V--GGNPLL-GLLLPIVGFFLVGIIF-SYVGSK------------------V-----
ALP1_YEAST/74-540PL---------------AHAGP-V--GA..LI-SYLFMGTVIYSVTQSL-GEMVTF------------------I-----
AROP_ECOLI/19-457VI---------------QSAGP-.--GI..IL-GYAIAGFIAFLIMRQL-GEMVVE------------------E-----
F1MS08_BOVIN/282-784IV---------------GQAGI-G--LS..VI-VIAMATVVTTITGLST-SAIATN------------------G-----
G9NX48_HYPAI/69-534AL---------------AKGGP-G--SL..FV-DFLIIGIMMFNVVYAL-GELAIM------------------Y-----
S12A3_MOUSE/139-644IT---------------AQAGI-V--LT..WL-IILLSVMVTSITGLSI-SAISTN------------------G-----

PF13520

Q5AQY0_EMENI/33-501..---------------..GNK.L..IALSLW.IFGGVYS..FCSIYIY.LEY..G..LA.--------.----W-----
Q75CJ2_ASHGO/54-501..---------------..GGN.A.LLFVTVW.IVAMLAA..FSGLYLY.LEF..G..CL.--------.----L-----
Q03U70_LACBA/18-459..---------------..QGP.T..AFFYLF.LAGILWF..LPVTRTS.GEM..A..SI.--------D----G-----
A8AGY3_CITK8/5-447..---------------..PAA.L..LIGWAI.TGVGIL....LLAFAM.LIL..T..RV.--------R----P-----
A1T4X6_MYCVP/25-447..---------------..PGP.L..LIGWVV.TGVGM....LMLAFVF.QTL..A..TR.--------K----P-----
C1DD80_LARHH/11-459..---------------..AGA.G..AILIGW.GITFVGM..LMLAFVF.QTL..A..NR.--------K----P-----
D6S3T3_9LACO/11-440..---------------..PEG.I..LIGWTI.VAIGMFS..LAGVYRN.LTL..Q..Q..--------.----P-----
C9SVT9_VERA1/51-488..---------------..PGL.A..LLLWVV.GAAVAAC....GLAVS.LEF..G..SM.--------.----L-----
B8PBB2_POSPM/39-484..---------------..GGP.A..VMVWGW.IVVGKSQ..TSYG......R..A..H..--------.----.-----
Q0CXR8_ASPTN/61-493..---------------..AGT.A..GMVWGW.IIAMVF...IHGGLYY.A..........--------.----.-----
Q6CAR8_YARLI/33-481YT---------------LPAGP.Y..GMVWGW.FVASGCI..MTVGLAM.AEL.GS..A..--------.----L-----
C7N1A7_SLAHD/31-475..---------------.VMGA.A..APLAWA.LSVIIG...VVQCVAY.VEI..A.GMH.--------.----P-----
A1CLI4_ASPCL/51-499..---------------..VGL.S..LLVWLV.GTILAAC....GLAVS.MEF..G..CM.--------.----F-----
A3GHP8_PICST/45-486..---------------..VGT.A..LMMWFA.GTIIA....LSGLLVY.MEL.GS..A..--------.----L-----
B2AVM0_PODAN/75-550..---------------..VGM.T..LLFWVL.GGIMTF.....CLFVY.LEY..G..TA.--------.----L-----
Q6CLW2_KLULA/73-522..---------------..PGG.S.VSLVWGW.GIAGAFV..LTNGLAM.SEL..A..SA.--------.----I-----
Q12TS7_METBU/31-468Y.---------------.LWSF.A..IIVWGL.S.VFQG...FMQNLAY.GEL..A..TT.--------.----F-----
A8I1F7_AZOC5/21-530..---------------..TGK.V..AFLVWF.VSMVMGF...IQSFTY.AEI..A..GL.--------F----P-----
Q75DM0_ASHGO/48-484..---------------..TGS.VYFALGLWV.LGALIA...LAGLYVY.MEF..G..TA.--------.----I-----
A2R9I4_ASPNC/39-488YS---------------IPAGP.V..GMVWVW.LHMHAGS..TYMGFV..ANL.TS..A..--------.----M-----
A0A0D1E072_USTMA/62-513..---------------..GGP.A..STVWTW.FIGSCLN..MTLGLSI.AELVSA..Y..--------.----.-----
C8VPT6_EMENI/44-469..---------------..AGA.A..LALWVV.GLILA....YCGLFIW.IEL..G..SL.--------.----M-----
A3LTS7_PICST/18-462..---------------..VGA.S..YVL..W.VAGFIIA..LFEVFVY.IEF..A..TY.--------F----R-----
C5MEY2_CANTT/54-503..---------------..GGS.P..VLIYGF.ILAIIFD..LIICYCL.AEL..A..SA.--------.----Y-----
A5FG51_FLAJ1/9-423..---------------..AGQ.Y..AWISLL.IVAVVLF..L.FRKIY.GEV.VG..A..--------.----I-----
Q4DJK0_TRYCC/39-456..---------------..PLL.T..II.FLC.LIPFLWG..IPVSLCV.AEL..S.CA..--------.----I-----
Q4DQR3_TRYCC/175-589..---------------..GRL.A..CFSSLL.VSVVLY...I.FRWIY.TEM.FG..P..--------.----Q-----
Q73M42_TREDE/10-421..---------------..TGK.S..IVVSIM.AGCI.FM..LLAYFYN.VLL..S..SM.--------.----F-----
Q2UFR9_ASPOR/43-476..---------------..AGA.S..LVVWVA.GYFLA....FCGFFIY.LEL..G..SL.--------.----L-----
Q023N1_SOLUE/24-483..---------------..AIG.K..SAPWFI.LGVMLFS..FAVRSVY.MES..S..G..--------.----M-----
B8NAK1_ASPFN/43-512..---------------..GGP.T..VLFGVM.IAAVAQ...WIVLLGL.AEL.CS..A..--------.----L-----
Q98PQ8_MYCPU/7-477..---------------..GEL.A..FVLSAW.FVSLIGI..IAMGLAI.VEL.FS..A..--------.----Q-----
Q38YR6_LACSS/23-445..---------------..LSA.A..AIWYSIPIAAFVLVLLISLTLSY.RQVIHA..Y..--------.----.-----
B0D4Q4_LACBS/41-461..---------------..GGI.Y..SPISQF.IATLILF..L.WRPIM.EEL..A..SA.--------.----L-----
Q6MS69_MYCMS/8-487..---------------..PII.A..IILWII.VGSVCV....SMVYLF.LEI..A..SST--------K----K-----
Q01XN7_SOLUE/23-483..---------------..IGK....AAPWFI.LAIMLFS..YAVRAIY.IES..C..S..--------.----M-----
D0NVC6_PHYIT/66-486..---------------..AGKLA..PVTQLF.VITVVY....CLRWVF.EEV.MS..A..--------.----V-----
A0A0D1E844_USTMA/272-694..---------------..SSV.L..SPISIL.IACLLL...YPFRPII.CEL..A..SA.--------L----S-----
Q1IPP3_KORVE/22-486..---------------..VIG.K..SAPWFV.LAVMLFS..YAVRAIY.IES..S..S..--------.----M-----
Q6F2A1_MESFL/11-481..---------------..PII.A..LILWSF.VGVICIM....SMIVF.IEI..SSSTK.--------.----H-----
Q8EVP3_MYCPE/28-507..---------------..SLP.L..SITTWV.VSAIAV...IAMSLAL.IEI..T..SV.--------.----K-----
Q6KI68_MYCMO/24-546..---------------.PTGT.ITLTILSWV.IASISV...IAMALAL.LEI.VS..A..--------.----Q-----
Q97VA8_SULSO/20-502..---------------..PGA.N..WTLSYL.ISLLPTL..GMAFLFYLASV..S..T..--------.----.-----
E9DET5_COCPS/69-502..---------------..VGM.S..LTVWFV.GMIITM....AGTAVY.LEF..G..TA.--------.----I-----
G8PMP4_PSEUV/13-449..---------------..TGM.K..ILFFNS.AVILCYI..LPVALIS.AEL..A..T..--------.----G-----
Q0JZA8_CUPNH/34-490..---------------..IGN.P..AWVIWI.LAILVG...FAQCFVY.AEI..S..GL.--------Y----P-----
Q4AAQ0_MYCHJ/13-424..---------------..QGV.W..GILVFI.LTSLIT...LAVIFAF.ARA..G..NK.--------Y----Q-----
Q4WA88_ASPFU/42-486..---------------..GGP.S..AIVYGM.VFSTIGS..VAVAASL.AEL..A..SE.--------.----S-----
Q5ZUY4_LEGPH/12-429..---------------..AGN.Q..LFYYFA.LALLFFL..LPCAIVA.VWF..S..R..--------.----.-----
Q6MS71_MYCMS/8-466..---------------..HNP.I..IAIVLW.TTVGISC..IAVVYLF.LEI..S..S..--------.----S-----

PF03845

GERBB_BACSU/7-331SA---------------AETG.----SPSGWL-MILLQGVIFIIIVLLF-LPFLQK------------------N-----
Q9KCW4_BACHD/8-324VI---------------AKSG.----GYQSWI-AVLFTGLLIHLVVYFM-YKILD.------------------.-----
Q97IW3_CLOAB/3-323IE---------------AEQD.----...AWI-VILLALLIGLLMAWIS-TELFYI------------------F-----
GERKB_BACSU/5-326SM---------------AGRD.----...AWI-AVLLGCAIGLFLFYLY-QGIYQC------------------Y-----
Q97LG4_CLOAB/8-327SV---------------IKQAS----Q.DGWI-ACIIGAIYPLLLVLMA-SYICKK------------------S-----
Q97E18_CLOAB/4-325PE---------------AEQN.----...AWI-GVLMCIIPALIFQSTY-IYLWQN------------------H-----
Q9KCH3_BACHD/10-327AI---------------VKIS.----GYDGWI-SIIIAGIVVQIIIALM-YALLNR------------------.-----
GERAB_BACSU/9-331AL---------------TTKAN----TPDGWI-TLILEGFIFIFFIYLN-TLIQKK------------------H-----
Q9KBD6_BACHD/8-337SL---------------ADTLN----TADGWI-TIIVGGSIICALVYVT-VRLQKE------------------F-----
YNDE_BACSU/7-329TV---------------TEQTQ----SPDGWI-SVLLGGVLAVIAGMII-AKLSQQ------------------Y-----
Q9KAU9_BACHD/3-321SV---------------AAEAN----N.LGWV-SVLLAGVIVQLAAVLY-HISLKN------------------I-----
Q97TS5_CLOAB/3-323IE---------------AEQN.----...AWI-VVLLALLIGLFILWSY-LELQKA------------------F-----
Q9KBJ1_BACHD/6-327LD---------------AGQD.----...AWM-TVLIAMLAGLVLYCVL-YYLHSH------------------F-----
Q7BYC0_BACCR/8-329AS---------------VEKVK----TPDVWL-SVILGGILAMVSGVIM-VKLSQQ------------------F-----
Q816T5_BACCR/10-327II---------------AKAA.----GYDGWM-GVIITGIFIHILIWMM-YVLLKE------------------.-----

PF01235

B2UL98_AKKM8/57-460AI---------------AAGGP-G--AVFWCW-LTGVLGMATRYSEGLL-AIKYRVE.NKD......G.N....M-----
C4L2J1_EXISA/48-448AI---------------ALGGP-G--AVFWMW-LIALIGAASAFVESTL-AQVYKVH.DGK........A....W-----
Q7VL62_HAEDU/56-459AI---------------ALGGP-G--AVFWMW-VTALMGMSSAFVESSL-AQLYKTR.D.H.N....G.M....F-----
B7GI15_ANOFW/49-449AL---------------AIGGP-G--AVFWMW-LVAILGGASAFVESTL-AQIFKVK.SDV........G....F-----
R6ESR6_9FIRM/49-458AI---------------IAGGP-G--AVFWMW-LIALLGGASAFVESTL-AQIYKKK.G.A.E....G......S-----
R7ANW3_9CLOT/47-452AI---------------CIGGA-G--AMFWMW-LVAILGSASAFIESTL-AQIYKRK.A.A.D....G.S....S-----
D4G8V3_RIEPU/46-454AL---------------NLGGV-G--SIFWMW-VAAIIGMATSFSESIL-AQLYKTI.D.K.K....G.R....Y-----
F0P236_WEEVC/46-470AI---------------AMGGP-G--AIFWMW-IIAFIGSTSAFVEATL-GQVYKQE.V.D......G.Q....Y-----
X5D863_9BACT/54-454AI---------------TMGGP-G--AIFWMW-ISALLGISTKFFTCSL-AVMFRGK.DDA......G.E....I-----
R6R064_9FIRM/47-469AL---------------CAGGP-G--ALFWMI-LAAFFGMATKYAEGLL-AIKYRTI.DEK......G.H....V-----
Q9K9D4_BACHD/47-446AI---------------TLGGP-G--AIFWMW-VVAIFGSVLSFIESTL-AQVYKVK.DKN........G....F-----
R5WSV7_9FIRM/52-454AV---------------ALGGP-G--AVFWCW-ITGVFGIATKYSESLI-AVKYRVK.TKD......G.R....M-----
K9TIM8_9CYAN/96-500AI---------------SIGGP-G--AMFWMT-VAALFGMTSKFVECTL-AQKYRVV.LPD......G.R....I-----
R5JXV6_9CLOT/55-564AM---------------VSGGP-G--ALVWMW-ISACFGLTSKFSECML-AIKYREV.NEK......G.E....M-----
W5WYR9_9CORY/49-452AL---------------TLGGP-G--AVFWMW-MIAIVGGATAFVESTL-AQLWKAR.D.K.D....G......Y-----
Q65J05_BACLD/49-446AV---------------ATGGP-G--AVFWMW-VVALVGMASSFVESTL-AQVYKVK.DGD........H....F-----
W8U6M9_EUBAC/78-495AI---------------AMGGP-G--ALFWMW-AIAFLGAGSSFIECAL-GQVYKEE.I.N......G.E....Y-----
F2F7Q9_SOLSS/49-467AI---------------AFGGP-G--AVFWMW-VTAFIGASTAYMESTL-AQIYKEK.K.D......G.Q....Y-----
Q9HXZ0_PSEAE/50-449AI---------------TLGGP-G--AVFWMW-AIALVGMATGFVEATL-AQLFKIR.D.D.K....G.Q....F-----
Q5WIK8_BACSK/48-446AI---------------TTGGP-G--AIFWMW-VIATIGMATGFVESML-AQVYKER.RDG........Q....F-----
X2GW49_9BACI/46-479AI---------------AMGGP-G--AIFWMW-AIAFIGAATAYVESTL-AQIYKEE.K.E......T.E....Y-----
Q81XE8_BACAN/56-451AI---------------SMGGP-G--AVFWMW-FIAILGAATSFVECTL-AQIYKVK.DGS........R....F-----
W6RX75_9CLOT/46-448AI---------------SIGGA-G--AIFWMW-LLAIIGGASSFIESTL-AQIYKVK.DGD........T....Y-----
R5R740_9FIRM/57-453AL---------------AAGGA-G--SIFWMW-IIALIGGASAFIESTL-AQVYKEK.D.G.D......S....F-----
R5TDP1_9FIRM/46-451AI---------------CLGGP-G--SVFWMW-VIAVIGGASAFIESTL-AQVYKRR.D.S.K....G.D....S-----
Q7VFP4_HELHP/49-454AI---------------VSGGV-G--ALFWMW-VTALVGGASAFIESTL-AQVYKRK.D.G.E....H.R....Y-----
Q082X4_SHEFN/49-451AI---------------SLGGS-G--AVFWMW-VIALLGMATGFAESIL-GQLYKVR.D.D.H....K.E....Y-----
Q2YKB0_BRUA2/46-452AL---------------YLGGP-G--AIFWMW-IVALVGLATAYSESAL-AQLYKIR.N.Q.D....G.Q....Y-----
H5XB24_9PSEU/93-523AV---------------TIGGA-G--ATFWMI-VAGLLGMCTKFVECTL-GVKYRET.HED......G.T....V-----
X5E8D3_9CORY/44-457AI---------------AMGGP-G--SLIWIM-VTGFLGSTCAYAEAVL-AQVFKRR.I.H......G.E....D-----
D9S9M5_FIBSS/46-477AI---------------GTGGP-G--ALFWME-VAAFLGMATKYAEGLL-AVKYRTV.DKD......G.K....V-----
V9XJ86_9NOCA/53-454AI---------------SLGGP-G--AVFWMW-AMALVGAATAFLESTL-AQLYKVR.D.E.D....G.S....F-----
R6W8F8_9FIRM/60-481AI---------------LTGGP-G--AVFWMW-VSAFFGMITNYAENVL-GLYFRQK.DKM......G.N....F-----
E6WQ83_PSEUU/46-484AI---------------AYGGP-G--AVFWMW-VMGFLGASTSYVESTL-AQIYKEK.DAE......G.R....Y-----
S6CD23_9ACTN/53-462AV---------------ATGGP-G--AIFWMW-LMALIGAASAFIESTL-AQIYKIR.G.K.E....G.E....F-----
R6LRJ9_9FIRM/49-461AI---------------FYGGP-G--SVFWMW-MIAVIGAASAFVESAL-AQAYKVK.SPD......G.E....F-----
A8ALU9_CITK8/48-455AI---------------AAGGP-G--AVFWMW-VSALIGMATSFAECSL-AQLYKER.D.S.T....G.Q....Y-----
Q8P616_XANCP/46-481AI---------------AFGGP-G--AIFWMW-VMGFLGASTSYVESTL-AQIYKIK.DAD......G.R....Y-----
C7N1V2_SLAHD/52-464AI---------------AAGGP-G--AVFWMW-LMALLGSATAFVESTL-AQIWKVR.G.D.E....G.E....F-----
E6UF74_RUMA7/48-472AL---------------CAGGP-G--ALLWME-IAAFLGMATKYAEGLL-AIKYRRK.DKN......G.N....I-----
T2KIQ3_9FLAO/49-458AI---------------AIGGP-G--AVFWMW-VSAIIGMATKFFTSSL-AVMYRGT.DSE......G.R....L-----
A4FJA3_SACEN/90-513AV---------------TIGGP-G--ATFWMI-MCGLLGMATKFVECTL-GVKYREI.DAD......G.T....V-----
U5Q4A6_9BACT/51-446AV---------------ALGGP-G--AVLWCW-LTGVFGIATKYSEGLL-AIKYRVR.TSD......G.T....M-----
R6QL56_9FIRM/55-463AM---------------VLGGP-G--ALVWMW-ISAAFGISTKYAECAL-AGKYRRV.NEK......G.E....M-----
A6T4E7_KLEP7/30-437AI---------------AAGGP-G--AVFWMW-VSALLGMASSFAECSL-AQLYKER.D.S.R....G.Q....F-----
Q6A6W4_PROAC/89-503AI---------------ATGGP-G--ASFWIA-VAGLVGMSVKMAEATL-GVKFRVI.NED......G.T....T-----
Q3IIL7_PSEHT/49-553AI---------------SIGGP-A--ALFWMW-MTAFFGMTTKFVEVTL-SHKYREK.TED......G.T....M-----
K4KVJ9_SIMAS/53-454AI---------------TLGGP-G--AVFWMW-VIALMGMATGFAESTL-GQFYKVK.D.A.N....G.E....Y-----
Q62ZC8_BACLD/50-447AI---------------ALGGP-G--AIFWMW-IIAIIGSASSFVESTL-AQIYKIK.DKD........G....F-----
D4KIB6_9FIRM/53-452AV---------------VLGGP-G--AIFWMW-IIAILGSATGFVESTL-AQIYKVP.RTD......S.NG...Y-----
R6GRJ8_9CLOT/56-455AI---------------AVGGP-G--AVFWMW-LISLIGSASAFIESTL-AQIYKEK.DGD........S....F-----
R5BT56_9FIRM/49-463GI---------------YFGGP-G--AVFWMW-VLGLLGAATALMESTL-AQAYKTK.I.N......G.E....Y-----
GLNT_BACSU/50-449AI---------------ALGGP-G--AIFWMW-IIAIIGSASSFVESTL-AQIYKVK.DVN........G....F-----
C7NKM3_KYTSD/76-484AI---------------TVGGP-G--ATLWII-LAGFLGMSIKAAEATL-GAKYRRI.NDD......G.T....V-----
Q65UI6_MANSM/65-468AI---------------ALGGP-G--AVFWMW-LTALIGMSSAFAESSL-AQLFKIK.E.A.D....G.S....F-----
Q9KPL1_VIBCH/46-453AL---------------TAGGP-G--AIFWMW-LIAMLGMATSFAESTL-AQLYKTR.D.K.D....G.N....Y-----
C4LCJ4_TOLAT/45-452AI---------------YLGGP-G--AIFWMW-LIAMIGMASAFVESTL-AQLYKVK.D.D.N....G.S....Y-----
A8F9M4_BACP2/46-444AI---------------AMGGP-G--AIFWMW-ILAIIGSASSFVESTL-AQVYKVK.DAS........G....F-----
I0JJ89_HALH3/58-455AV---------------FLGGP-G--AVFWMW-ITAVFGMATKYAEAVL-AVKYRIT.DQN......G.N....M-----
R7AGI4_9CLOT/50-474AL---------------YMGGP-G--ALFWMV-LAGMTNSAVCFTECTL-SVLYKNR.I.D......G.Q....Y-----
B2FSE0_STRMK/46-482AI---------------AFGGP-G--AIFWMW-VMGFLGASTSYVECTL-AQIYKTK.DAE......G.R....Y-----
F2I8L7_AERUA/50-455AI---------------CLGGY-G--AVFWMW-LVAIIGGSSAFIESTL-AQIYKKK.T.P.T....G.D....S-----
H2IRW6_RAHAC/47-451AI---------------TIGGP-G--AIFWMW-IIAVFNMATAMIENTL-AQVYK............GNAAHEKF-----
Y183_HAEIN/59-462AI---------------ALGGE-G--AVFWMW-VTAFIGMSSAFAESTL-AQLFKIQ.D.K.D....G.S....F-----
Q87U15_PSESM/43-445AV---------------TLGGP-G--AVFWMW-VTALVGMSSSFIECSL-AQLYKRK.DSE......G.Q....F-----
G4QHN1_GLANF/78-481AI---------------SLGGA-G--AIFWMW-VIALLGMATGYAESVL-GQVYKIK.D.E.N....G.E....Y-----
V4J7M3_9DELT/49-455AI---------------TLGGP-G--AVFWMW-MIALIGMATSLVECSL-AQLFKRS.NGD......G.T....Y-----
D5UBK7_CELFN/48-455AL---------------TLGGP-G--AVFWMW-VVAAVGMATALVEATL-AQVFKVR.V.D.D....G.S....Y-----
C1DD85_LARHH/46-459AI---------------TFGGP-G--AVFWMW-VVAFLGASSAFVESTL-AQIYKER...E......GNQ....Y-----
F0RL19_DEIPM/47-463AI---------------TFGGP-G--ALFWMW-MVAFLGASTAYIESVL-GQIYKEK.DSG......G.H....F-----
R5WS38_9FIRM/54-459AL---------------CIGGA-G--AMFWMW-LIALLGSASAFIESTL-AQIYKRK.A.A.D....G.S....S-----
K0B2L5_CLOA9/50-448AI---------------SIGGS-G--SIFWMW-IVALVGSSSAFIESTL-AQIYKEK.DPET.....G.E....Y-----
F2JU21_MARM1/46-472AI---------------GFGGP-G--AVFWMW-VVAFLGASTAYAESTL-GQLYKVN.D.G......G.Q....Y-----
D1B800_THEAS/50-454AL---------------VSGGP-G--AIFWMW-LTAVLGMATICGEAIL-AQLFRVK.D.Q.D....G.T....Y-----
R5Q6J7_9BURK/79-476AV---------------VVGGP-G--AVFWMW-VIALLGAATGFVESTL-AQIYKVP.RRG......G..G...F-----
R6NH81_9FIRM/47-453AI---------------AAGGA-G--AVFWMW-LMAVIGGASAFIESTL-AQVYKVK.D.K.E......E....F-----
Q81XD8_BACAN/54-450AI---------------SMGGP-G--AVFWMW-VIAIIGASSSFVESTL-AQIYKIK.DGS........G....F-----
I3UGH4_ADVKW/46-460AI---------------AAGGP-G--AVFWMI-VMALLGGASAFIESTL-AQVYKER.A.D......D.Q....Y-----
D6XWG3_BACIE/52-446AV---------------AVGGP-G--AVLWMW-ITAFVGMATKYGEAIL-GVKYRVQ.NER......G.E....M-----
Q3AFY7_CARHZ/46-459AI---------------AMGGP-G--AVFWMW-VTAFLGAGSAFVEAVL-AQIYKEE.H.E......G.E....Y-----
R5HBJ9_9FIRM/53-457AI---------------CLGGY-G--AVFWMW-VTAILGGASAFVESTL-AQIYKRK.N.K.D....G.S....S-----
A0M410_GRAFK/284-691AI---------------SLGGA-G--ATFWMF-CAGFFAMSLKFTECTL-GVKYREI.KED......G.R....I-----
R6ALH3_9FIRM/50-450AI---------------AAGGP-G--AIFWMW-MAAFFGMATKYAEGLL-AVKYREV.DSK......G.E....I-----
W5Y2T0_9CORY/46-478AI---------------AFGGP-G--AVFWMW-TVALLGSATSFVECTL-AQIYKEQ.DKD.T....G.E....Y-----
R5I5H2_9BACT/50-447AI---------------TLGGP-G--AVLWCW-LTGVFGMATKYSEALL-AVKYRVRIKKD......G.H....I-----
Q8EN00_OCEIH/57-451AV---------------ALGGP-G--ALFWMW-LIALLGAASGFVESTL-AQLYKEK.DSN........Q....Y-----
Q5P2T3_AROAE/46-460AI---------------TFGGP-G--AVFWMW-MVAFLGASTAYVESTL-AQIYKEK.DDN......G.Q....Y-----
Q7DDS6_NEIMB/53-458AI---------------KVGGP-G--AVFWMW-VTALIGMSSAFVESSL-AQLFKVR.D.Y.D....NHH....F-----
Q0SCP0_RHOJR/50-470AV---------------GGGGP-G--ALLWMA-VTGLVGCTVGYAEATL-AQVFKRQ.V.E......D.E....D-----
R5G5T4_9FIRM/48-470AI---------------SIGGP-G--ALFWMI-FAAIFGMATKYAEGFL-AVRFRKR.EKD......G.T....I-----
D1BPB8_VEIPT/50-451AV---------------VLGGP-G--AIFWMW-VIALIGAATGFIESTL-AQIYKEP.VAK......G..G...F-----
E3GK02_EUBLK/49-466AI---------------YFGGP-G--ALFWIW-AFGFFATCTALSEAVL-GQAYKIK.T.G......N.E....Y-----
A8FFK0_BACP2/49-450AI---------------TVGGP-G--AIFWMW-FAAVLGGASAFVESTL-AQIYKVR.TND........G....F-----
D3EDV3_GEOS4/50-449AI---------------SLGGP-G--AVFWMW-IIAIIGSASSFIESTL-AQIYKVK.DGA......G.G....F-----
B4E614_BURCJ/50-453AL---------------TVGGP-G--AIFWMW-MTALVGMSSAFVEATL-AQIFKVS.H.P.D....G.S....Y-----
Q07Z28_SHEFN/49-454AI---------------GTAGP-G--AVFWMW-AIAVLGMATAMIESTL-AQVYKVK.D.G.D....G.Q....Y-----
E3H6D6_ILYPC/48-461AI---------------ALGGP-G--ALFWMW-AIAFLGASSAFVESAL-GQIYKVE.K.D......G.Q....Y-----
U5L5G5_9BACI/46-460AI---------------AMGGP-G--AVFWMW-AIAFIGAGSAFVESTL-AQIYKVK.Q.D......G.L....Y-----
F4CF94_SPHS2/46-459AI---------------AMGGP-G--AIFWMW-AIAFLGSASAYIEATL-GQLYKRE.I.D......G.Q....Y-----
Q15SP8_PSEA6/49-451AI---------------SLGGA-G--AVFWMW-VIALLGMATGFAESVL-GQLYKVR.D.D.N....G.E....Y-----
R7J9J1_9FUSO/75-484AV---------------SIGGP-G--VIFWMI-LAGFFSMALKFAEVLL-GLKFRKI.NPD......G.T....I-----
D3FUF0_BACPE/53-450AI---------------ALGGP-G--AIFWMW-VVALIGMATAFIESTL-AQVYKVR.DGE........Q....F-----
Q2SF65_HAHCH/43-445AI---------------ALGGP-G--AVFWMW-LIGLIGMGLSFFECSL-AQLFKRR.DSD......G.S....F-----
F4HCM3_GALAU/54-452AI---------------TYGGP-G--AVFWMW-VTALLGMSSAFAESSL-AQLFKVK.D.L.A....G.H....F-----
R6I317_9FIRM/51-457AI---------------CLGGF-G--AIFWMW-ITAILGGASAFIESTL-AQIYKHK.D.S.D....G.T....Y-----
Q5L341_GEOKA/47-461GI---------------AYGGP-G--AVFWMW-VITFIGAATAYVESTL-AQIYKEE.Q.D......G.Q....Y-----
Q92P60_RHIME/46-452AL---------------YLGGP-G--ATFWMW-IVAFVGMATAYAESAL-AQLYKIR.N.E.D....G.Q....Y-----
R5EKL7_9GAMM/58-457AM---------------AMGGP-G--AIFWMW-LAAFFGMATIFSEAIL-AQLYRSK.DSE......G.H....I-----
R6TGR9_9FIRM/48-453AV---------------CLGGY-G--AVFWMW-LIAIIGGASAFIESTL-AQIYKRR.NPE.T....G.E....C-----
R7AEN1_9ACTN/55-464AL---------------AMGGP-G--ALFWMW-VMALIGGASAFIESTL-AQIFKIR.G.K.D....G.Q....F-----
R7MEC6_9CLOT/86-499SI---------------SIGGP-G--AAFWIF-VGAILGMSIKFVEATL-AVKYRRF.NLD......G.S....V-----
Q5E0L3_VIBF1/46-471AI---------------GFGGP-G--AVFWMW-VVAFLGAATAYAESTL-AQIYKEE.D.E......G.Q....F-----
F8EJC0_RUNSL/46-459AI---------------AMGGP-G--AVFWMW-AIAFLGASSAFIEATL-GQIYKQV.K.D......G.Q....Y-----
B0UUP4_HISS2/57-460AI---------------ALGGE-G--AVFWMW-VTALIGMSSAFAESSL-AQLFKVK.D.K.N....G.L....F-----
B2TML1_CLOBB/54-451AI---------------SIGGP-G--AIFWMW-IIALIGAGSSFVESTL-AQIYKTK.DKN........GA...F-----
Q3IIM2_PSEHT/46-453AL---------------YLGGA-G--AIFWMW-LIALIGMATSFAESTL-AQAYKTR.D.E.Q....G.N....F-----
R7CQS6_9FIRM/53-452AI---------------VSGGP-G--AIFWMW-FIAVIGSATGFVESTL-AQIYKVP.REG......G.NG...F-----
R6YML2_9FIRM/50-472AV---------------GTGGP-G--ALFWMV-ITAFFGMSTKFAEGLL-AVKYRVV.GKD......G.H....S-----
Q6ANS0_DESPS/50-451AI---------------TVGGP-G--AIFWMW-IMAIFGMATSFVESTL-AQLYKVR.G.VED....D.V....Y-----
R6GE77_9CLOT/48-451GI---------------IIGGP-G--AVFWMW-FMAVLGSASAFIESTL-AQIYKVK.D.E.N....G.G....F-----
D7AX43_NOCDD/60-469AI---------------SLGGP-G--AVFWMW-TMAIVVCAASFVESTL-AQLYKVR.D.S.T....G......Y-----
R5D3A3_9FIRM/51-467AI---------------VLGGP-G--AIFWMW-ITAILGGASAFIESTL-AQIYKRK.D.K.D....G.T....S-----
R6C274_9BACT/50-448AI---------------ALGGP-G--AVLWCW-LTGVFGISTKYAEGLL-AVKYRVK.TKR......G.T....M-----
D4M6E0_9FIRM/62-465AI---------------SAGGA-G--AVFWMW-VTALIGSSTAFVEATL-AQLHKEK.DPLYG....G......Y-----
YAAJ_ECOLI/46-453AI---------------TAGGP-G--AVFWMW-VAAFIGMATSFAECSL-AQLYKER.D.V.N....G.Q....F-----
D5VAX7_MORCB/46-475AI---------------GFGGP-G--AVFWMW-VVAFLGAATAYTESTL-AQIYKEN.D.R......G.Q....Y-----
E3EA98_PAEPS/47-461AV---------------GMGGP-G--AIFWMW-VMAFIGSATAFVESTL-AQIYKVK.R.D......G.Q....Y-----
D4LQM0_9FIRM/62-464AI---------------SAGGA-G--AVFWMW-VTAIIGSSTAFIEATL-AQLYKEK.DPLYG....G......Y-----
H2FXG2_OCESG/46-453AL---------------YLGGP-G--AIFWMW-LIALIGMATAFAESAL-AQLYKVK.D.D.D....G.N....Y-----
R5PRI2_9BACT/50-447AI---------------ALGGP-G--AVFWCW-ITGVFGIATKYAEGLL-AIKYRVQ.TPT......G.K....M-----
J7L7G1_NOCAA/49-457AI---------------MLGGP-G--AVFWMW-LMATVVSGAAFVESTL-AQLYKVR.T.D.T....G......F-----
R6VAG6_9FIRM/47-469AL---------------AAGGP-G--ALFWMV-VAAFFGMATKYSEGVL-AIKYRTI.DKE......G.H....V-----
Q6ANS1_DESPS/56-454AI---------------TVGGA-G--SIFWMW-LIALLGMATAFVESTL-AQLYKIR.G.V.D....G.T....Y-----
K0J6Z8_AMPXN/55-453AV---------------ASGGP-G--AVFWMW-ISGFFGMGTIFAEAIL-AQLHTER..KD......G.E....V-----
I3TIY8_TISMK/49-454AI---------------TLGGP-G--AVFWMW-AIALCGMATSLIECTL-AQLYKTR.DGE......G.G....F-----
Q81PH5_BACAN/46-459AI---------------AFGGP-G--AVFWMW-VMALLGAASAFVESTL-SQIYKSK.V.E......N.E....Y-----
Q1GL91_RUEST/49-450AI---------------TLGGP-G--AVFWMW-AIALVGMATSLVECSL-AQLFKRA...DPLT...G.Q....Y-----
C4L110_EXISA/50-450AI---------------ALGGP-G--AVFWMW-LIALIGAASAFVESTL-AQVYKIR.DGR........T....W-----
G0VQI3_MEGEL/43-446AV---------------HAGGP-G--AIFWMW-MAAFVGMATKYAEGCL-AVKYRTV.DKN......G.D....I-----
B4S4I7_PROA2/112-519AI---------------TLGGP-G--ATFWMI-MGGLFGMSSKFVECTL-GVKYRKI.NSN......G.S....V-----
R5EMW4_9CLOT/55-557AM---------------VSGGP-G--ALVWMW-ISACFGLTSKFSECML-AIKYREV.NEK......G.E....M-----
C7RF91_ANAPD/49-453AI---------------CLGGY-G--AVFWMW-LVAIIGSASAFAESTL-AQIYKKK.G...K....H.S....S-----
B9E978_MACCJ/46-490AI---------------YIGGP-G--AVFWMW-MTAFLGASSAFIESTL-AQIYKRE.I.N......G.E....Y-----
D3RSW7_ALLVD/51-451AI---------------FLGGP-G--ALFWMW-CTALVGMATKYAEAVL-ALHYREI.DGK......G.R....H-----
Q481J5_COLP3/46-471AI---------------GFGGP-G--AVFWMW-IVAFFGAATAYIESTN-AQIYKEE.E.D......G.V....Y-----
D3VIB1_XENNA/46-454AI---------------TAGGP-G--AIFWMW-VVAFIGMATSFVESTL-AQLYKTK.D.D.K....G.N....Y-----
R6C0Q9_9CLOT/49-475AI---------------AAGGP-G--ALFWMW-MAALVGTATKYSECLL-AVKYRQV.AED......G.H....I-----
A1TXI6_MARHV/46-452AL---------------YLGGA-G--AIFWMW-MVALVGMATGYAESTL-AQLYKVR.D.G.K....G.Q....Y-----
R7G2T9_9FIRM/51-471AI---------------YMGGP-G--ALFWMI-LAGMTNSAVCFAECTL-AVLYKTR.I.D......G.Q....Y-----
Q8EBH5_SHEON/47-452AI---------------GAAGP-G--AVFWMW-LIAMLGMATAMVESTL-AQVYKVR.D.A.N....G.Q....F-----
Q2NVZ2_SODGM/46-454AL---------------ILGGP-G--AIFWMW-LAALIGMATAFAESTL-AQLYKIR.D.D.R....G.N....A-----
R6NWY5_9FIRM/53-470AL---------------VEGGP-G--ALFWMW-IAALVGTATKYSECLL-AIKYRVV.AED......G.H....I-----
C5DAE3_GEOSW/49-446AI---------------SLGGP-G--AVFWMW-LIALIGGASSFVESTL-AQIYKVK.DGS........N....Y-----
D4MVF8_ANAHA/67-468AI---------------SAGGA-G--AVFWMW-ITALLGSSTAFIEATL-AQLHKEK.DPLYG....G......Y-----
S6A4B3_9SPIO/50-458AI---------------AAGGP-G--AAFWML-FSAFFGMSTIFVEAVL-AQIFRET..KN......G.E....L-----
Q8RDV2_FUSNN/55-455AV---------------VVGGP-G--ALFWMW-IIALLGAATSLIENTL-AQTYKVK.DGK......G.G....F-----
H0ULL2_9BACT/54-458AI---------------VSGGP-G--AVFWMW-VTALVGMATIYGEAIL-GQVYRVK.G.T.D....G.L....Y-----
Q5WBL9_BACSK/46-460AI---------------YFGGP-G--AVFWMW-AIAFLGASSAFIESTL-AQIYKDK.Q.N......G.Q....Y-----
K9YDV4_HALP7/46-445AI---------------TLGGP-G--AIFWMW-LIGLIGMATSFFECTL-SQVFKRA.EPD......G.T....Y-----
R6RBR5_9CLOT/84-516AI---------------VSGGP-G--AVFWMW-IAAIVGMMTSYSENVL-GIYYRKK.NAD......G.E....W-----
C7MLG7_CRYCD/51-476AI---------------AFGGP-G--ALFWMW-IMATVGSASAFIESTL-AQIFKVK.N.E.D....G.S....F-----
W5Y1T9_9CORY/60-473AI---------------AMGGP-G--SIMWMA-VTGLLGSTCAYVEAVV-AQLYKRR.V.H......G.E....D-----
R7C4U2_9BURK/46-460AI---------------CFGGP-G--ALFWMW-VVAFLGASSAFVESTL-GQIYKER.I.N......G.E....C-----
W5Y4I7_9CORY/46-477AI---------------AFGGP-G--AVFWMW-AVALLGSATSFIECTL-AQVYKEK.DRD.T....G.E....Y-----
F6AAC4_PSEF1/43-445AV---------------TLGGP-G--AVFWMW-VTALVGMSSSFFECTL-AQVYKRS.DGD......G.L....Y-----
D2RNM9_ACIFV/44-448AI---------------KAGGP-G--AILWMW-IAAFFGMATKYAEGCL-AVKYRTV.DDK......G.Q....I-----
C5C6U4_MICLC/48-455AI---------------VIGGP-G--AVFWMW-LLAILGGATAFVESTL-AQLYKQK.G.A.D....G......Y-----
D4MZ66_ANAHA/54-463AM---------------VSGGA-G--ALVWMW-ISACFGLSSKFSECML-AIKYREV.NEK......G.E....M-----
X2GKP6_9BACI/49-446AI---------------GVGGP-G--AVFWMW-IIAILGMATAFIESTL-AQVYKVK.DGD........T....F-----
R5D2D6_9FIRM/92-509AI---------------FMGGP-G--ALFWMW-ITAILGASTGMVECML-GQAYKTR...N.L....G.E....L-----
D7BM33_ARCHD/59-464AM---------------VLGGP-G--SLFWMW-VVALVGMATGFAEATL-AQIFKFR.H.R.D....G.T....F-----
Q6LSN7_PHOPR/49-454AI---------------SLGGP-G--AVFWMW-AIALVGMATSLVECSL-AQLYKRK.EGD......A......F-----
Q1QSR6_CHRSD/60-472AL---------------WVGGP-G--AIFWMW-VTALVGFATSFVESTL-AQVYKKR.H.E.D....G.V....F-----
D4LCB5_RUMC1/46-473AI---------------AAGGP-G--ALLWME-VAAFFGMATKYAEGLL-AIKYRVT.DSR......G.N....I-----
G4Q7R4_ACIIR/46-452AI---------------CLGGP-G--AVFWMT-VMALIGAASSFVECTL-AQIYKRK.N.S.D....G.T....S-----
R6PKK8_9CLOT/51-453AI---------------VAGGP-G--AVFWMW-VMAIVGGASAFVESTL-AQVYKVK.D.G.K......E....F-----
D2RIK3_ACIFV/46-452AL---------------CLGGF-G--SVFWMW-AIAIIGGATAFIESTL-AQVYKRR.D.A.N....G.D....S-----
D4M9Q8_9BACT/49-459AI---------------YFGGP-G--AIFWMW-LISILGAAAAFAESAL-AQAYKVK.V.N......N.Q....Y-----
R6J437_9CLOT/52-480AI---------------CLGGP-G--ALLWML-LAAFFGMATKYSEGFL-AIKYREK.KDD......S.H....Y-----
C4ZJ27_THASP/46-460AI---------------GFGGP-G--AVFWMW-MVAFLGAATAYVESAL-GQIYKTE.H.H......G.L....Y-----
E4TGP7_CALNY/48-462AI---------------AMGGP-G--AIFWMW-VIAFFGAGSAFVEAVL-AQIYKEE.R.D......G.Q....Y-----
C3PIJ7_CORA7/46-477AI---------------AFGGP-G--AVFWMW-AVALLGSATSFVECTL-AQVYKEK.DQD.T....G.E....Y-----
R5FNH5_9ACTN/54-462AV---------------ALGGP-G--AIFWMW-LMALFGAASAFVESTL-AQIWKVR.G.K.N....G.E....F-----
G7UNE2_PSEUP/46-460AI---------------AFGGP-G--AVFWMW-VVAFLGASTAYVESTL-GQIYKER.DPS......G.Q....Y-----
J9SBB2_9ACTN/60-499AI---------------AFGGP-G--ALFWMW-AMAFLGASTSFVECTL-GQIYKTR.DPL.T....D.E....Y-----
A9IDQ9_BORPD/44-455AI---------------SAGGP-G--SLFWMA-VMALLGAAAAFLESTL-AQIYKSR.V.D......G.V....Y-----
G2PM93_MURRD/278-683AV---------------SLGGA-G--ATFWMI-ICGLLGMSSKFVECTL-GVKYRDI.LPD......G.R....V-----
M4U7B3_9GAMM/46-450AI---------------KLGGP-G--ALFWMW-LAAVFGMATKYAECLL-AVKYRQT.DSK......G.E....I-----
A1AZT0_PARDP/75-484AL---------------VLGGP-G--AIFWMW-MVALVGMATAYAESTL-AQLYKVK.D.S.R.EPDG.V....Y-----
G4KZA8_OSCVS/51-471AI---------------YLGGP-G--ALFWMW-VVGITNSAMCFVECTL-GQLYKIR.I.D......G.E....Y-----
I0GRA8_SELRL/53-452AI---------------VTGGP-G--AVFWMW-VIAFIGSATGFVESTL-AQIYKIQ.RPD......G.S....F-----
K4IFK4_PSYTT/275-681AV---------------SLGGA-G--ATFWMV-LAGFLGMSSKFVECTL-GVKYRFI.NKE......G.R....I-----
R7ILK1_9BURK/46-459AI---------------CFGGP-G--ALFWMW-VVAFLGASSAFVESTL-GQVFKVN.I.D......G.E....Y-----
L0G2I0_ECHVK/46-459AI---------------AMGGP-G--AIFWMW-VIAFLGGASAFVESTL-GQVYKEV.N.E......G.Q....Y-----
R5BRP1_9FIRM/49-450AV---------------VLGGP-G--AIFWMW-FIALLGAATGFVESTL-AQIYKVP.SSK......G..G...F-----
R5G1P5_9ACTN/52-470AV---------------VAGGP-G--ALFWMW-LAAIFGMATKFSEGLL-AVKFRTM.DKK......G.H....V-----
Q11EU9_CHESB/49-451AI---------------TLGGP-G--AVFWMW-AIALVGMGTSLVESSL-AQLFKRS.VGD......G.T....Y-----
Y883_HAEIN/48-453AV---------------QAGGP-G--AIFWMW-LVALLGMATKYAECLL-AVKYRVR.DKN......G.F....M-----
Q2SAS2_HAHCH/49-473AI---------------GFGGP-G--AVFWMW-MVAFLGAATAYIESTL-AQIYKEE.D.E......G.Q....Y-----
D4ZH12_SHEVD/56-454AI---------------TVGGA-G--AIFWMW-LIALLGMATAFVESTL-AQVYKVK.D.S.E....G.Q....F-----
H1Z903_MYROD/46-459AI---------------AYGGP-G--AIFWMW-MIAFLGSASAFVESTL-AQIYKEE.K.N......G.H....Y-----
R5AXG7_9BACE/47-454AI---------------AMGGP-G--AVFWMW-VSAIVGMCTKYHEGVL-AIMYRST.DSN......G.V....H-----
D6XWR4_BACIE/59-456AI---------------SIGGP-G--AVFWMW-MVAIIGMATAFIESTL-AQVYKVR.DGD........Q....F-----
R5EZS8_9GAMM/50-454AV---------------TLGGP-G--AIFWMW-VIALIGSATGFVESTL-AQIYKVP.FRE......G..G...Y-----
Q3ICJ9_PSEHT/49-451AI---------------SLGGS-G--AIFWMW-VIAILGMATGFAESVL-GQVYKVR.D.S.Q....G.E....F-----
I0JHI0_HALH3/58-455AI---------------SLGGP-G--ALFWMW-IIALIGMATKYSEILL-GMKYREK.NEK......N.V....W-----
M1P0N1_9CORY/53-457AL---------------AVGGP-G--ALFWIW-VTGLVGMASKYTEAFL-GVRFRTT.DAK......G.E....Q-----
D6ZHY8_MOBCV/70-472AI---------------TLGGA-G--SIFWMW-IVALVGMASAFVEATL-AQMFKVR.N.P.D....G.T....F-----
D2S4W0_GEOOG/50-455AL---------------TLGGP-G--AIFWMW-VVALVGMATALIEATL-AQIFKIP.A.G.D....G.S....F-----
E3GKE4_EUBLK/47-467AI---------------ALGGP-G--AIFWLW-VVALFGTAIALIESTL-AQAYKIT.V.N......G.E....F-----
YRBD_BACSU/46-459AI---------------AFGGP-G--AVFWMW-AIAFIGAASAFVESTL-AQIYKVK.Q.D......G.Q....Y-----
A6VYN5_MARMS/44-452AI---------------TIGGP-G--AIFWMW-VVGLMGMATSFVECML-AQTYKAA.EKD......G.T....Y-----
R5QXT9_9FIRM/51-456AI---------------CLGGS-G--AVFWMW-LTAILGSASAFIESTL-AQIYKHK.A.K.D....G.S....S-----
R5BSJ1_9FIRM/46-462AI---------------FFGGP-G--AVFWFW-ILALIGSAVALIEAIL-SQTYRQT.I.N......G.E....Y-----
A4XPB8_PSEMY/46-459AI---------------TFGGP-G--AVFWMW-MVAFLGASSAFVESTL-GQVYKEK.L.N......G.E....Y-----
R6Q9I8_9FIRM/48-459AL---------------RAGGP-G--SLFWMW-LSAFFGMATKYAECVL-AVKYRSK.DQN......G.Q....V-----
E1V890_HALED/54-463AI---------------YFGGP-G--AIFWMW-MTALVGMATSFVESTL-AQAYKTD.H.G.D....G.T....F-----
G0VMJ7_MEGEL/47-452AI---------------CLGGP-G--AVFWMW-LLAIIGGATAFIESTL-AQIYKRR.N.P.L....G.H....S-----
B1ZTG5_OPITP/46-460AI---------------AMGGP-G--AIFWMW-AIAFLGAGSAFVEATL-AQIYKEE.I.N......G.Q....Y-----
E3PS56_CLOSD/46-460AI---------------GTGGP-G--AVFWMW-AIAFLGAGSAYIESAL-AQVYKEE.V.D......G.E....Y-----
B0TD76_HELMI/46-448AI---------------KAGGP-G--ALFWMW-VAAFFGMATKYAEGLL-AVKYRSV.DAN......G.Q....I-----
B8F6B8_HAEPS/56-460AI---------------ALGGP-G--AVFWMW-ITALIGMSSAFAESSL-AQVYKVR.D.P.N....G.M....F-----
H2G0K3_OCESG/46-460AI---------------TFGGP-G--AVFWMW-VVAFLGAGTAYIESAL-AQIYKEK.DDN......G.L....Y-----
G8PS27_PSEUV/49-455AL---------------TLGGP-G--AIFWMW-MVALVGMATAYAESAL-AQLYKVE.D.D.E....G.Q....F-----
K9TW29_9CYAN/99-504AI---------------QLGGP-G--AMFWMT-VAGLLGMSSKFVECTL-GQKYRIV.KPD......G.S....V-----
Q0W2J6_METAR/53-469AI---------------VLGGP-G--ALFWMW-VTALVGMVTKYSEAVL-AVKYRTK.NAD......G.T....M-----
A7IEP7_XANP2/46-450AL---------------TLGGP-G--AIFWMW-VVAALGMATAFAESTL-AQLYKVK.D.D.E....G.R....Y-----
C0R294_BRAHW/49-448AV---------------SAGGP-G--ALFWMW-IMAILGGSLAFSESTL-AQLYKEK.DSQ......G.K....F-----
R7FY43_9FIRM/55-454AL---------------AIGGP-G--AIFWMW-IAAFLGMATIFGEAIM-AQKYKHV.GKD......G.H....V-----
I3UGJ4_ADVKW/61-451AV---------------VLGGP-G--AVFWMW-ITAIFGMATKFGEGVL-AVKYRIV.NER......G.E....M-----
A8MKE1_ALKOO/50-456AI---------------ALGGP-G--AILWMW-VSAFFGMSTIFVEATL-ALKYRER.TED......G.Q....L-----
B1YF48_EXIS2/50-454AI---------------ALGGP-G--AVFWMW-LIALIGSASAFVESTL-AQIYKVR.DEK........A....W-----
D5BRV2_PUNMI/84-498AV---------------TVGGP-G--ATFWLI-VAGFLGMSTKFVECTL-GVKYRSE.NPD......G.S....V-----
G0J6F2_CYCMS/46-459AI---------------AMGGP-G--AIFWMW-IIAFLGSASAFIEATL-GQMFKEV.K.D......G.Q....Y-----
C7MHV8_BRAFD/47-482AI---------------AFGGP-G--AVFWMW-ASAFLGASTSFIECTL-GQIYKEK.DPD.T....G.E....Y-----
ALST_BACSU/49-444AI---------------ATGGP-G--AVFWMW-VVAAVGMASSFVESTL-AQLYKVR.DGE........D....F-----
R5RWM9_9FIRM/55-469AI---------------ILGGP-G--AVFWMW-ISALFGMVTKFAEVTL-AVKYRER.NEK......G.D....W-----
D3UJ87_HELM1/57-462AI---------------TVGGQ-G--AVFWMW-VTAFFGGASAFAESTL-AQVYKTR.D.G......N.G....F-----
R6EEZ2_9FIRM/60-476AL---------------VAGGP-G--AIFWMW-VVAFFGMMTNYSENVL-GIYYRRR.NSK......G.E....W-----
R6MFU2_9FIRM/47-452AI---------------CIGGF-G--SVFWMW-VIAIIGSASALIESTL-AQIYKKK.G.E.D....G.K....C-----
R7PRB6_9FIRM/45-450AI---------------KAGGP-G--AIFWMW-IAAFFGMATKYAEGCL-AVKYREV.DSN......G.E....I-----
A2SR40_METLZ/55-463AI---------------VMGGP-G--AVFWMW-IFALIGAATSFVETTV-GQIYKEK.K.D.D....G.H....F-----
R5AJ95_9FIRM/49-458AI---------------IAGGA-G--AVFWMW-LIAIIGSASAFIESTL-AQIYKKK.G.E.H....G......S-----
R5YUK1_9FIRM/62-468AI---------------SAGGA-G--AVFWMW-VTALIGSSTAFIEATL-AQLHKEK.DPLYG....G......Y-----
R5Q3U9_9BURK/59-459AI---------------AMGGP-G--AIFWMW-LAAFFGMATIFAEATL-AQVFRAR.DAH......G.Q....I-----
R7PRF4_9FIRM/49-455AI---------------TTGGP-G--SIFWMW-FIAVIGAATGFVESTL-AQIYKVP.SKG......K.HGETIF-----
A0Q3K6_CLONN/59-455AI---------------STGGP-G--AVFWMW-IIALIGAGSSFVESTL-AQVYKTK.DKH........G....F-----
R5NYD9_9BACT/51-452AI---------------TLGGP-G--AVFWCW-LTGVLGISTKYAEGLL-AVKYRIR.TPQ......G.K....M-----
B5HEI9_STRPR/73-499AV---------------SIGGP-G--ATFWMI-LCGLLGMATKFVEVTL-GVKYREV.HAD......G.T....V-----
I3TQE6_TISMK/46-452AL---------------YLGGP-G--AIFWMW-VVAAIGMATAYAESSL-AQLYKVR.D.G.H....R.Q....Y-----
F2JVC9_MARM1/46-446AI---------------ALGGP-G--AIFWMW-VVALIGMATSYAESTL-AQLYKIR.D.E.N....G.Q....L-----
L0FYG8_ECHVK/279-685AI---------------SLGGP-G--ATFWII-IAGFLGMSSKFTECTL-GLKYRHI.AKD......G.K....I-----
B2GLS0_KOCRD/53-457AI---------------TLGGP-G--AVFWMW-IIAAIGAASAFVESLL-GQLYKVK.T.S.D....G......Y-----
C7REC1_ANAPD/49-451AI---------------SLGGP-G--AVFWMW-ITALLGMVITFAETVL-GQIYRVK.IED......G.S....Y-----
B3EMZ0_CHLPB/88-501AI---------------TLGGP-G--ATFWMI-LGGLFGMSSKFVECTL-GVKYRKI.RED......G.A....V-----
I5AXG7_EUBCE/61-477AI---------------VSGGP-G--AIFWMW-IVAFFGMMTNFSENVL-GIYYRRK.NSK......D.E....W-----
D2RN33_ACIFV/46-452AI---------------CLGGP-G--AAFWMT-VMAIIGAASSFTECTL-AQIFKRR.K.E.D....G.S....A-----
C5C8M5_MICLC/48-478AI---------------AFGGP-G--AVFWMW-VMALLGAATSFIESTL-GQIYKER.DPD.T....G.E....Y-----
G4KY93_OSCVS/47-452AV---------------CLGGY-G--AVFWMW-LIAIIGSASAFVESTL-AQVYKRR.D.K.N....G.D....S-----
G4KWB0_OSCVS/53-452AI---------------ATGGP-G--AIFWMW-FVALLGFIVKFSEITL-GLAYRERDPET......G.L....W-----
D3Q113_STANL/44-457AI---------------TVGGP-G--ALFWMG-VTGFLGAASAFVESTL-AQIYKSK.T.D......G.K....F-----
I2BD01_SHIBC/46-454AI---------------SAGGP-G--AVFWMW-VAALIGMATCFAECAL-AQVYKVK.D.E.H....G.R....Y-----
R6R8F0_9FIRM/60-473AI---------------VSGGP-G--AIFWMW-VMAILGMMTSFSENVL-GVYYRRK.NEK......G.E....W-----
R7HAX2_9FIRM/48-472AM---------------VAGGP-G--ALFWMW-IAAIVGTVTKYSECLL-AVKYRVV.NED......G.H....I-----
Q8ECR9_SHEON/46-459AI---------------TFGGP-G--ALFWMW-MVAFLGASSAFVESTL-GQVYKEK.I.N......G.E....Y-----
Q6NEM1_CORDI/46-477AI---------------AFGGP-G--AVFWMW-AVAFLGAATSFIECTL-AQIYKER.DQD.T....G.E....Y-----
A0QRB1_MYCS2/46-485AI---------------AFGGP-G--AMFWMW-AVAFLGASTSFVECTL-GQIYKAR.DQL.T....G.E....Y-----
D2NQ65_ROTMD/71-481AI---------------AMGGP-G--AVFWMW-VIAAVGAASAFAESLL-GQLYKER.G.K.D....S......Y-----
F6AHU7_PSEF1/46-452AI---------------AVGGP-G--AVFWMW-MVALVGGATSFVESTL-GQLYKSD.K.Q.Y....R......Y-----
C2X582_BACCE/50-448AI---------------ALGGP-G--AVFWMW-IISIISSASSFVESTL-AQIYKVK.DKT........G....F-----
M4UAD5_9GAMM/46-449AI---------------TVGGP-G--AIFWMW-VIAIIGMATSFAESTL-AQAYKVH.D.D.D....G.N....F-----
Q6FE01_ACIAD/61-482AI---------------ALGGP-G--AVFWMW-VTALLGMSSAFTESTL-AQLFKVR.D.S.E....TKQ....F-----
Q5E342_VIBF1/63-467AL---------------TVGGP-G--AIFWMW-LIALFGMATAFIESTL-AQVYKVK.D.V.D....G.Q....Y-----
D5V3Y8_ARCNC/47-451AI---------------TLGGA-G--SVFWMW-VIGLVGMATSFFECSL-AQLYKEK.D.GLDS...G.V....Y-----
F8DYI2_CORRG/49-453AI---------------TVGGP-G--AVFWMW-MIALVGGATAFVESTL-AQLFKSR.DGK.G....G......Y-----
R5H9R9_9FIRM/51-466AV---------------TLGGP-G--TLFWLW-VTALIGMATKYSEVLL-AVKFRER.NKY......G.D....W-----
Q186Q3_PEPD6/63-459AV---------------VAGGP-G--AVFWMW-LIALIGSASSFVESTL-AQIYKVK.DGQ........A....F-----
R5XPN0_9CLOT/54-453AI---------------VGGGP-G--AIFWMW-VVALIGSASSFVESTL-AQIYKVR.DGA........A....F-----
I4BXH1_ANAMD/47-454AL---------------VSGGP-G--AVFWMW-MTALVGMATISAEAVL-AQLFRVK.N.E.D....G.T....Y-----

PF02705

KUP_KLEP7/13-544CL.............SGQFGFGVERDAVFGFLSLIFWLLIFTVSIKYIT-FVMRADNAGE.-------------------
KUP_WIGBR/16-547SF.............VNNLGFKIDKLAIFGILSIIFWTLFFIIFLKYLI-LIVSINNSGE.-------------------
B9SQ92_RICCO/61-632VF................PDGIKEKDDLIGVLSLIIYSIIFISFIKYVI-VVLAANDNGD.-------------------
A9SXX0_PHYPA/13-586IQ.................ISNPGETEFLGVLSLIFWTLTLVALIKYGL-IVINADDHGEA-------------------
A9T519_PHYPA/7-581II................SAETPNEDDYLGILSCIFWTLTLIGVIKYTL-IVLWADDHGEA-------------------
B6QFY8_TALMQ/79-668TF.................SDDPSQEDVLGATSLIIWSLTIMVTVKYAL-IVLNADDEGE.-------------------
A1CCX5_ASPCL/78-666TF.................SSEPSYEDVLGAVSLIIWALTITVTIKYVC-IVLNADDEGE.-------------------
C5FQB5_ARTOC/100-671TF.................STQPVLIDLIGALSLIIWALLLIATVKYVG-IVLCANDNGE.-------------------
Q6CCD6_YARLI/48-711VF.................ATTPSEEDIMGACSCIFWGLTLVVLIKYCI-IVFIFGPNGGE-------------------
C4Y6H7_CLAL4/40-680IK...............YPHATPTEEDIFGGISIIFYLFIIIVLAKYAF-VVLTYGPNEGE-------------------
B0CVZ9_LACBS/29-630IW..............PASGPLPSEEDIIGGISAIIWSLTLLPLLKYVF-VSLYFGTQEGE-------------------
KUP_CYTH3/20-548IA................GGNVISENLILGGLSCVFWTITLQTTIKYVI-ITLRADNKGE.-------------------
C6W4Q3_DYAFD/15-540II................MNEPITEEIIYGAISCIFWTLTLQTTVKYVI-LILRADNRGE.-------------------
C6Y2B3_PEDHD/15-542IFN...........SVVGGGQEVTSDLVLGALSCIIWTLTLQTTIKYVV-ITLRADNKGE.-------------------
KUP_LEUMM/14-557IL.............NSAKSAHNLDTFVIGSVSLVFWTLMLITTIKYVI-IALQADNHGE.-------------------
KUP_LACDA/6-548VIA............GNGGINTVGRDLIIGTISLILWTVTLLTTVQTVI-IALRATNHGE.-------------------
E3D8I4_GARV3/105-645FLA............GQGGLQNISREAVYGMLSLVFWSITLITTVKYVF-VAMRTDNKGE.-------------------
C5K5G4_PERM5/172-748ILGCNTDAPSKYQCVVVDGVTPDVAEDIKSVLSVIVWALLFIVCIKYVG-VAFRFDYHGE.-------------------
B5ED26_GEOBB/13-541VF................TLTKPTHANVYGILCLVFWTMTILVTAEYAW-LAMSLGKKGQ.-------------------
B8J475_DESDA/11-539IF................MMTERTEANFIGILSLIIWTLLLLVTVEYAW-LAMSLSKAGE.-------------------
A7I822_METB6/4-532IF................LLIPPTPQNVMGILSLIFWTLTILVTVQYTF-LAMHMGKKGE.-------------------
KUP_METAC/10-538IF................LLTRPTEVHVIGVLSLIIWTLITLVTVEYAW-LAMSLGKKGE.-------------------
B5YHM1_THEYD/4-532AF................LILEPTYENVLGVLSLIFWTLIILPTIQYNF-LAMNLSIRGE.-------------------
B2VA86_SULSY/13-542IV................LVTKPKPDEILGIASLIIWTLILIPTVQYAW-FAMNLSLRGE.-------------------
Q54JK9_DICDI/60-587MF.................KGPPGEKEVIGSLSLILWALIMVVTVKYVV-FILNADNNGE.-------------------
KUP2_LEGPH/16-542VI................KYFPINDHNIYGILSLIFWSLIIIVSIKYLV-IVFRADNDGE.-------------------
C6BY23_DESAD/14-544CF.............SGHHAIALNPANVLGVLSLIIWALLIVICLKYVT-FVMAADNEGE.-------------------
KUP_XANP2/18-550GV.............LAVGGTNFLGGDVLGLLSLITWSIILSVTVKYVM-LVLRADNDGE.-------------------
KUP3_BRADU/2-536AAK............AAAHGATVTPDAVLGVASLILWALLLIISLKYAL-LILRADNRGE.-------------------
C1F3S5_ACIC5/37-570CF.............IGDHPLPVSQGNVLGILSLVFWTLVMVISIKYMV-YVLCNDNKGE.-------------------
C1D8B5_LARHH/14-546AF.............AGHNGFVPDQLHVLAALSMLFWSVLIIISLKYML-LVLRFDNNGE.-------------------
KUP_PROAC/31-568VFS............MENHAVRPTHGDVMGIISMIFWSILLVVCVKYVI-FVMRADNDGE.-------------------
B1ZTC6_OPITP/46-580CM.............ANLPAGVSIEAGVLGAVSLVFWALVLIVCVKYVT-FICRADNRGE.-------------------
KUP1_CHRVO/26-559AF.............NGDHGVRPTPDNVVGVVSLFLWSLILMVSVKYVM-VLMRADNKGE.-------------------
KUP_THEEB/15-546TF.............NPLHVLAVTPANIYGILSLILWGLVLIPTLKYAT-FALRADNDGE.-------------------
B0T401_CAUSK/36-573AL.............AHSRSTTATEHAVLGVVSLVLWTLTLFVTIKYVI-FFMRADNKGE.-------------------
KUP1_SPHWW/26-569AL.............GQAAEDGIVAGEILGVLSLALWALILVVTCKYVL-FLMRADNNGE.-------------------
KUP_BDEBA/51-585CF..............GHYGLAPTPENVIGILSLIFWTLVLAICIKYMA-FVLRADNKGE.-------------------
C1A5Q5_GEMAT/25-559CF.............SPLYGLEPTRENVFGILSMIVWALTLVVTVKYVG-YVLRADNRGE.-------------------
KUP2_SYNFM/28-562CF.............HGTHAIALNEPNIFGVLSLVFWSMTMVICVKYVV-FVMRADNHGM.-------------------
KUP_METCA/15-548IF.............GGAYAIQLTQENILGALSLIFWALFIIVAVKYVV-FVMHADNHGE.-------------------
KUP_HERAR/14-547VF.............SKEHGLDLTPENLLGVVSLIVWGLIIIVSLKYVT-LVLRANNRGE.-------------------
B2FRN5_STRMK/27-560AF.............SPHYGLNSDHDTVLGVLSLAFWALNLVVTLKYVT-IIMRADNDGE.-------------------
KUP1_RALSO/1-534CF.............NPEHGVPFSTQTVYGVLSMLFWSMTLVVSIKYVV-FVMRADNNGE.-------------------
KUP_ACIF2/18-550CL..............SAMSLQPTAVNLQGILSLIFWTLVLVVSVKYAW-VIMRASNQGE.-------------------
KUP1_NOVAD/40-570TF.............AGHHKLPLDLLHIYGIISLMFWSMMIIVTFKYVS-VIMRADNKGE.-------------------
B9HJL6_POPTR/87-646MP.................LKSPTEQDYLGIYSIMFWTLTLIGVVKYTS-IALKADDQGE.-------------------
D2U9H9_XANAP/28-558AF.............SPHYGLSPDHNTVLGILSLVFWALMLVVTLKYVT-VIMRADNDGE.-------------------
E3FUM0_STIAD/26-562CF.............SGPHSIAPTPENVMGVLSLIFWSLFVLISMKYLL-FVTRADNRGE.-------------------
KUP3_RHIEC/22-554AL.............KPIAHDGLTRFEVISLISLMIWALTIIVTIKYVL-FLLRADNEGE.-------------------
Q5AB00_CANAL/82-703IK...............YSSYPPNKEDIYGAVSIIFYIFTIIVIFKYVL-IVLFIGVNCNH-------------------
HAK6_ORYSJ/80-646VV.................LPDADATDFLGILSLIIWTLTLMSLVKYAL-IVLKADDHGE.-------------------
KUP3_LEGPH/22-550VI.............LLAGGGTPAVNTIMGSVSLIIWTLIIIASVKYIH-FALRIDNDGE.-------------------
KUP1_LEGPH/12-539TL................SGIPINQFNILGVLSLIFWSLIIIVSFKYLM-IIFRADNDGE.-------------------
HAK19_ORYSJ/48-624TF................PNGIKHPDDLVGVLSLILYTLILIPMVKYVF-IVLYANDNGD.-------------------
KUP1_RHOPA/12-542TF.............AGHHPIPVTPDNIFGVLSLVFWTVMLLVTVKYVI-VIMRADNHGE.-------------------
HAK9_ORYSJ/24-602TF.............AEDITHSESNEEIFGVLSFVFWTLTLIPLIKYVS-IVLRADDNGE.-------------------
KUP_CORGL/20-550AFS............MQHNKVEVTQENVYGIISMVLWTITLIVTVKYVM-LVTRADNQGQ.-------------------
KUP_STRP1/18-551LVE............NQGGVNQVSESFILGSISLIIWTLTLITTIKYVL-IALKADNHHE.-------------------
KUP_XYLFA/23-555AF.............SPNYGLTPNHDTVLGILSLIFWAMMLVVTIKYVA-VIMRVDNDGE.-------------------
W8UJ41_YEREN/22-548VL..............LLSGNNPTPMVILGLLSLIIWTLILVTSIKYTI-FAMRIDNNGE.-------------------

PF05525

BRNQ_BACSU/6-436-----------------PMLGQLA--GKNVWVANAGFLVTGVGLPLLAI-TAFVFS------------------------
Q9A1E1_STRP1/3-454-----------------AFLGIYS--GHQILWSIIGFCLTGVSLPLLGV-IAVAKS------------------------
BRAB_PSEAE/5-429-----------------PSAGMAA--GEHVWSAAFGFLLTGVGLPLLTV-VALARV------------------------
Q9CJW8_PASMU/1-426-----------------PKLGFES--GVGFWPAILGFVTTGVGLPLLGI-LVATRY------------------------
Q8REN9_FUSNN/3-423-----------------PMLGYET--SSSWTLTMLAFIITGV