Sequence alignment for CL0062

PF02705

KUP_KLEP7/13-544-----TLAAIGVVYGD-IGTSPLYTLRECL.............SGQFGFGVERDAVFG-----FL-------SLIFWLLI
KUP_WIGBR/16-547-----IFSTINVLHGL-IAISPIYIIKESF.............VNNLGFKIDKLAIFG-----IL-------SIIFWTLF
B9SQ92_RICCO/61-632-----AFQCIGVVYGD-LGTSPLYVIPGVF................PDGIKEKDDLIG-----VL-------SLIIYSII
A9SXX0_PHYPA/13-586-----AYQTLGVVFGG-LGTSPLYVWPTIQ.................ISNPGETEFLG-----VL-------SLIFWTLT
A9T519_PHYPA/7-581-----AFRTLGIVYGD-LGTSPLYVYPSII................SAETPNEDDYLG-----IL-------SCIFWTLT
B6QFY8_PENMQ/79-668-----QVNSYLLQPQS-AQANPLYVFSSTF.................SDDPSQEDVLG-----AT-------SLIIWSLT
A1CCX5_ASPCL/78-666-----SYQSLGVIYGD-IGTSPLYVYSSTF.................SSEPSYEDVLG-----AV-------SLIIWALT
C5FQB5_ARTOC/100-671-----AYQSIGAIYGD-IGTSPLYVFSATF.................STQPVLIDLIG-----AL-------SLIIWALL
Q6CCD6_YARLI/48-711-----AFQSLGAVYGD-IGTSPLYTLNSVF.................ATTPSEEDIMG-----AC-------SCIFWGLT
C4Y6H7_CLAL4/40-680-----AFSSLGAIYGD-IGTSPLYVLNSIK...............YPHATPTEEDIFG-----GI-------SIIFYLFI
B0CVZ9_LACBS/29-630-----SFQTLGIIYSD-IGTSPLYVLNGIW..............PASGPLPSEEDIIG-----GI-------SAIIWSLT
KUP_CYTH3/20-548-----LLISLGIIYGD-IGTSPLYVMKAIA................GGNVISENLILG-----GL-------SCVFWTIT
C6W4Q3_DYAFD/15-540-----LLVAFGIIYGD-IGTSPLYVMQAII................MNEPITEEIIYG-----AI-------SCIFWTLT
C6Y2B3_PEDHD/15-542-----LLVSLGIVYGD-IGTSPLYTLKAIFN...........SVVGGGQEVTSDLVLG-----AL-------SCIIWTLT
KUP_LEUMM/14-557-----ALIAIGIVFGD-IGTSPLYTMNSIL.............NSAKSAHNLDTFVIG-----SV-------SLVFWTLM
KUP_LACDA/6-548-----LLIAIGIVYGD-IGTSPLYVMKSVIA............GNGGINTVGRDLIIG-----TI-------SLILWTVT
E3D8I4_GARV3/105-645-----SIVALGVVYGD-IGTSPLYTAQTFLA............GQGGLQNISREAVYG-----ML-------SLVFWSIT
C5K5G4_PERM5/172-748-----SLGTLGIIYGD-IGTSPLYTLSTILGCNTDAPSKYQCVVVDGVTPDVAEDIKS-----VL-------SVIVWALL
B5ED26_GEOBB/13-541-----IVKALGLVFGD-IGTSPIYTLTVVF................TLTKPTHANVYG-----IL-------CLVFWTMT
B8J475_DESDA/11-539-----VIKSLGLVFGD-IGTSPIYTLAVIF................MMTERTEANFIG-----IL-------SLIIWTLL
A7I822_METB6/4-532-----VVKSMGLVFGD-IGTSPIYTFTAIF................LLIPPTPQNVMG-----IL-------SLIFWTLT
KUP_METAC/10-538-----IINSMGLVFGD-IGTSPIYTLTVIF................LLTRPTEVHVIG-----VL-------SLIIWTLI
B5YHM1_THEYD/4-532-----VIKALGLVFGD-IGTSPIYTLTVAF................LILEPTYENVLG-----VL-------SLIFWTLI
B2VA86_SULSY/13-542-----VIRAIGTVFGD-IGTSPLYTFAVIV................LVTKPKPDEILG-----IA-------SLIIWTLI
Q54JK9_DICDI/60-587-----SITAIGCIFGD-IGTSPLYVYASMF.................KGPPGEKEVIG-----SL-------SLILWALI
KUP2_LEGPH/16-542-----SFAALGVVFGD-IGTSPLYAFGQVI................KYFPINDHNIYG-----IL-------SLIFWSLI
C6BY23_DESAD/14-544-----ALGALGVVFGD-IGTSPLYAMKACF.............SGHHAIALNPANVLG-----VL-------SLIIWALL
KUP_XANP2/18-550-----EIGALGVVFGD-IGTSPLYALKQGV.............LAVGGTNFLGGDVLG-----LL-------SLITWSII
KUP3_BRADU/2-536-----TMGALGVVYGD-IGTSPLYALKEAAK............AAAHGATVTPDAVLG-----VA-------SLILWALL
C1F3S5_ACIC5/37-570-----ALAVLGVVYGD-IGTSPIYALQQCF.............IGDHPLPVSQGNVLG-----IL-------SLVFWTLV
C1D8B5_LARHH/14-546-----ALAAMGVVYGD-IGTSPLYAFKAAF.............AGHNGFVPDQLHVLA-----AL-------SMLFWSVL
KUP_PROAC/31-568-----ALAALGIVFGD-IGTSVLYSLQTVFS............MENHAVRPTHGDVMG-----II-------SMIFWSIL
B1ZTC6_OPITP/46-580-----VLGALGVVFGD-IGTSPLYALKECM.............ANLPAGVSIEAGVLG-----AV-------SLVFWALV
KUP1_CHRVO/26-559-----VLAALGVVYGD-LGTSPLYALQEAF.............NGDHGVRPTPDNVVG-----VV-------SLFLWSLI
KUP_THEEB/15-546-----MLGALGVVYGD-LGTSPLYAFEETF.............NPLHVLAVTPANIYG-----IL-------SLILWGLV
B0T401_CAUSK/36-573-----ALGAIGVVFGD-IGTSPLYAMREAL.............AHSRSTTATEHAVLG-----VV-------SLVLWTLT
KUP1_SPHWW/26-569-----TLGALGVVFGD-IGTSPIYAFREAL.............GQAAEDGIVAGEILG-----VL-------SLALWALI
KUP_BDEBA/51-585-----ALGALGVVFGD-IGTSPLYALKECF..............GHYGLAPTPENVIG-----IL-------SLIFWTLV
C1A5Q5_GEMAT/25-559-----TLTALGVVYGD-IGTSPLYSIKECF.............SPLYGLEPTRENVFG-----IL-------SMIVWALT
KUP2_SYNFM/28-562-----ALGSLGVVYGD-IGTSPLYSIRECF.............HGTHAIALNEPNIFG-----VL-------SLVFWSMT
KUP_METCA/15-548-----SAGALGVVYGD-IGTSPLYTVREIF.............GGAYAIQLTQENILG-----AL-------SLIFWALF
KUP_HERAR/14-547-----TLAAVGIVYGD-IGTSPLYTMKEVF.............SKEHGLDLTPENLLG-----VV-------SLIVWGLI
B2FRN5_STRMK/27-560-----IIGAIGVVFGD-IGTSPLYTLKEAF.............SPHYGLNSDHDTVLG-----VL-------SLAFWALN
KUP1_RALSO/1-534-----MLGAIGVVFGD-IGTSPLYALKECF.............NPEHGVPFSTQTVYG-----VL-------SMLFWSMT
KUP_ACIF2/18-550-----AMAALGVVFGD-IGTSPLYTLSACL..............SAMSLQPTAVNLQG-----IL-------SLIFWTLV
KUP1_NOVAD/40-570-----AVGAIGVVFGD-IGTSPLYALRDTF.............AGHHKLPLDLLHIYG-----II-------SLMFWSMM
B9HJL6_POPTR/87-646-----.YKTLGVVFGG-LVTSPLYVYPSMP.................LKSPTEQDYLG-----IY-------SIMFWTLT
D2U9H9_XANAP/28-558-----...AIGVVFGD-IGTSPLYTLKEAF.............SPHYGLSPDHNTVLG-----IL-------SLVFWALM
E3FUM0_STIAD/26-562-----.LGALGIVYGD-IGTSPLYALRECF.............SGPHSIAPTPENVMG-----VL-------SLIFWSLF
KUP3_RHIEC/22-554-----.LGSVGVVYGD-IGTSPLYAFREAL.............KPIAHDGLTRFEVIS-----LI-------SLMIWALT
Q5AB00_CANAL/82-703-----.FSSLGSIYGD-LGTSPLYVLNSIK...............YSSYPPNKEDIYG-----AV-------SIIFYIFT
HAK6_ORYSJ/80-646-----.YQSLGIVYGD-LGTSPLYVFPSVV.................LPDADATDFLG-----IL-------SLIIWTLT
KUP3_LEGPH/22-550-----.LSALGIVYGD-IGTSPLYTFKTVI.............LLAGGGTPAVNTIMG-----SV-------SLIIWTLI
KUP1_LEGPH/12-539-----.LGALGVVFGD-IGTSPLYALKVTL................SGIPINQFNILG-----VL-------SLIFWSLI
HAK19_ORYSJ/48-624-----AFQSIGVVYGD-VGTSPLYVYSSTF................PNGIKHPDDLVG-----VL-------SLILYTLI
KUP1_RHOPA/12-542-----.VSAIGVVFGD-IGTSPLYALKETF.............AGHHPIPVTPDNIFG-----VL-------SLVFWTVM
HAK9_ORYSJ/24-602-----AYQSLGVVYGD-LSISPLYVYKSTF.............AEDITHSESNEEIFG-----VL-------SFVFWTLT
KUP_CORGL/20-550-----.LGALGVVFGD-IGTSPLYSLHTAFS............MQHNKVEVTQENVYG-----II-------SMVLWTIT
KUP_STRP1/18-551-----.IIALGIVYGD-IGTSPLYTIQSLVE............NQGGVNQVSESFILG-----SI-------SLIIWTLT
KUP_XYLFA/23-555-----.LSAIGVVFGD-IGTSPLYTLKEAF.............SPNYGLTPNHDTVLG-----IL-------SLIFWAMM
W8UJ41_YEREN/22-548-----..GALGVVFGD-IGTSPLYTLKTVL..............LLSGNNPTPMVILG-----LL-------SLIIWTLI

PF03845

GERBB_BACSU/7-331---------------K-LTFMQTLIMISST-------------------------LIG----------------------
Q9KCW4_BACHD/8-324---------------T-VPPFMVFFLIHSM-------------------------QVG----------------------
Q97IW3_CLOAB/3-323---------------H-LSKHQLFTLTFIF-------------------------QIG----------------------
GERKB_BACSU/5-326---------------R-ISIRQLFVMIIIF-------------------------ELG----------------------
Q97LG4_CLOAB/8-327---------------Y-LSASQITFLMFSS-------------------------LIG----------------------
Q97E18_CLOAB/4-325---------------K-ICSKQMFSLIVLC-------------------------VLG----------------------
Q9KCH3_BACHD/10-327---------------L-VSTGMTFFLVHGM-------------------------QVG----------------------
GERAB_BACSU/9-331---------------K-LNTFQGISIVANT-------------------------MLG----------------------
Q9KBD6_BACHD/8-337---------------T-IDPLEISIALIAF-------------------------IIG----------------------
YNDE_BACSU/7-329---------------K-ITTAQATIIIINY-------------------------MLA----------------------
Q9KAU9_BACHD/3-321---------------Y-LSVKQTVVLIVMI-------------------------QVG----------------------
Q97TS5_CLOAB/3-323---------------R-LSKHQLFTLIFVF-------------------------EVG----------------------
Q9KBJ1_BACHD/6-327---------------T-ISTYQFFSMIVLF-------------------------ELG----------------------
Q7BYC0_BACCR/8-329---------------R-ITTSQAVVIIVNY-------------------------ILG----------------------
Q816T5_BACCR/10-327---------------Q-ISPIFVFFLIHGA-------------------------QFG----------------------

PF01235

B2UL98_AKKM8/57-460ALKLYFVKDH...TDK.GDISPFSSLMVAL-----------------------AANIG-----A----------------
C4L2J1_EXISA/48-448LL...FVKGI..KHEK.GQVSSFQAFAIGT-----------------------AARVG-----T----------------
Q7VL62_HAEDU/56-459EM...WGGRN...TKG.ESLTPFQAFTTGL-----------------------ASRVG-----V----------------
B7GI15_ANOFW/49-449VL...KEKSPE.GKGK.QEISSLQAFFIGA-----------------------ATRIG-----T----------------
R6ESR6_9FIRM/49-458VI...AEPKK....DK.DSISSFQALMVST-----------------------ASRVG-----T----------------
R7ANW3_9CLOT/47-452VV...KEPSV....DK.ESISSFQALMVST-----------------------ASRVG-----T----------------
W6RLP3_9RHIZ/46-455VV...TARDT..RGDK.EGISPVQALCTSL-----------------------ASRVG-----T----------------
D4G8V3_RIEPU/46-454IL...RGSNK...SNK.SGISSFQALCTTL-----------------------ASRVG-----T----------------
F0P236_WEEVC/46-470LL...FSSQN....SK.EGITPFQAFSLAI-----------------------SGRVG-----T----------------
X5D863_9BACT/54-454....KYDDPN....EA.GQLRHYQALSTAL-----------------------AGTVG-----M----------------
C7RC29_KANKD/57-559.....QYAKK...DSP.GDTSHFQALTTAL-----------------------SGTVG-----T----------------
R6R064_9FIRM/47-469ALKYMVKNEE...GGS.GEVTSFGALCTAL-----------------------SATIG-----T----------------
Q9K9D4_BACHD/47-446LM...KESPST.SDGK.KRVSSFGAFCISA-----------------------ASRIG-----T----------------
R5WSV7_9FIRM/52-454......TKDP...DAE.GEVSQFGALTTAL-----------------------ASTIG-----T----------------
K9TIM8_9CYAN/96-500....HYDDPA...E.A.GEVSHFQALAAAL-----------------------SATVG-----L----------------
R5JXV6_9CLOT/55-564......ARKK...KGT.GDVSPFSALTTAL-----------------------AATIG-----T----------------
W5WYR9_9CORY/49-452AV...TEKPH..TKGT.KDISAFQAFSISA-----------------------ASRVG-----T----------------
R9VS99_9ENTR/46-453SL...KSSRV...AQP.GALSSYQALCLSL-----------------------ATRLG-----S----------------
Q65J05_BACLD/49-446IV...GQ..K..EEKG.KGVSSLQAFFISA-----------------------ASRVG-----T----------------
W8U6M9_EUBAC/78-495YL...FGGGD....SS.SRVSSFQAFAMSV-----------------------AGRVG-----T----------------
F2F7Q9_SOLSS/49-467LM...FKGEK....SE.AGVSSFQALSIAL-----------------------SGRVG-----T----------------
Q9HXZ0_PSEAE/50-449VL...KGSRQ...SDD.SGISSFQALCTSL-----------------------AARVG-----T----------------
Q5WIK8_BACSK/48-446AV...TEKKT....KK.GEVSAFQAFCISA-----------------------ASRVG-----A----------------
X2GW49_9BACI/46-479LM...FKGEK....SE.KGISSFQAMSIAL-----------------------SGRVG-----T----------------
Q81XE8_BACAN/56-451.......NRK..EKKK.DSISPFQAFCLSA-----------------------AARIG-----I----------------
W6RX75_9CLOT/46-448LL...TEGTS..KDDK.DGISSFQAFCMST-----------------------ASRVG-----T----------------
R5R740_9FIRM/57-453.....KEKSH....HD.DGVSSFQALMIST-----------------------ASRVG-----T----------------
R5TDP1_9FIRM/46-451LV...MEKPQ....NE.GAVSPFHALMVST-----------------------ASRVG-----T----------------
Q7VFP4_HELHP/49-454VL...NERSH.....Q.KHISPFGALMIST-----------------------ASRVG-----I----------------
Q082X4_SHEFN/49-451VM...KGSTQ...GDK.SGISSYQALCTGL-----------------------SARVG-----T----------------
Q2YKB0_BRUA2/46-452VV...FAAGR...RDE.AGISPFQALTISI-----------------------ASRVG-----T----------------
H5XB24_9PSEU/93-523IVRGKFTRSD...E.P.GEITHFQALSSAV-----------------------SGTVG-----L----------------
X5E8D3_9CORY/44-457QL...RQSKT....TD.GGLSSFQALALTL-----------------------SSRVG-----V----------------
D9S9M5_FIBSS/46-477ALRFMAHSEK...DGA.GEVSSFGALCTAL-----------------------AATIG-----T----------------
V9XJ86_9NOCA/53-454........PERQPNGE.PGLSAFRAFSVSA-----------------------ASRVG-----T----------------
R6W8F8_9FIRM/60-481VKSMGKNKKD...KRS.NAVSQFEAFSAAI-----------------------SGTVG-----T----------------
E6WQ83_PSEUU/46-484LT...VTGQK....SD.AGVSSFQALAISM-----------------------AGRMG-----I----------------
S6CD23_9ACTN/53-462QL...TEKKH..VQGE.KSISSFQALMVST-----------------------ASRVG-----T----------------
R6LRJ9_9FIRM/49-461LL...TSKED....SE.SGITPFQAFATTV-----------------------GARVG-----M----------------
A8ALU9_CITK8/48-455SL...KNSIH...PQP.GGLTSFQALCTSL-----------------------AARIG-----S----------------
Q8P616_XANCP/46-481LT...VGGQK....SD.AGVSSFQALAMSM-----------------------AGRIG-----I----------------
B1HSY7_LYSSC/46-460LL...RERKE....SK.EGISSFQAFCMAL-----------------------SGRVG-----V----------------
C7N1V2_SLAHD/52-464QI...GEKKH..VEGE.KSVSSFQAMMIST-----------------------ASRVG-----T----------------
E6UF74_RUMA7/48-472..KYMFKDEE...SGS.GEVSGFQALCTAL-----------------------SATVG-----T----------------
T2KIQ3_9FLAO/49-458VLRGKFDNPD....DP.GEISHFQALTTAL-----------------------SATVG-----M----------------
A4FJA3_SACEN/90-513....KYTSKD...E.P.GEINHFQALSSAL-----------------------SGTVG-----L----------------
U5Q4A6_9BACT/51-446......TKDK...GAN.GDVSQFGALATAL-----------------------AATIG-----T----------------
R6QL56_9FIRM/55-463......SRKK...DGE.GDISPFSALMTAL-----------------------AATVG-----T----------------
A6T4E7_KLEP7/30-437SL...KKSLH...PQP.GGLTSFQALCTSL-----------------------AARVG-----S----------------
Q6A6W4_PROAC/89-503VMRGHFSRHT...D.P.GDVTSFQALATEL-----------------------SGTVG-----L----------------
Q3IIL7_PSEHT/49-553QVVSGKFDKK...DTE.GDTTHFQALATAL-----------------------SGTVG-----T----------------
K4KVJ9_SIMAS/53-454VM...KGSLR...SNK.LGISPFQALATSL-----------------------AARVG-----T----------------
Q62ZC8_BACLD/50-447VL...KEG....TPDK.NGISPFQAFCISM-----------------------AARVG-----T----------------
D4KIB6_9FIRM/53-452........DAGNKMEG.QQISSFQAFCVST-----------------------ASRVG-----V----------------
R6GRJ8_9CLOT/56-455LL...GEGSS..SSEK.GSISSFQAFCIGT-----------------------ASRVG-----T----------------
R5BT56_9FIRM/49-463LL...VKADP...DSK.SGITPFQAFATTV-----------------------GSRVG-----M----------------
GLNT_BACSU/50-449VL...REGAA..SRSK.NSISPFQAFCISM-----------------------AARVG-----T----------------
C7NKM3_KYTSD/76-484....RFNRRT...D.P.GEITSYQALATEL-----------------------SGTVG-----L----------------
Q65UI6_MANSM/65-468EM...WFGRE...VQG.DSLTPFQAFATGL-----------------------ASRVG-----V----------------
Q9KPL1_VIBCH/46-453VL...KNSRK...ADN.AGISSFQALCTSL-----------------------AARVG-----T----------------
C4LCJ4_TOLAT/45-452VL...KHSTV...SDA.AGISSFQALCTGL-----------------------AARVG-----T----------------
A8F9M4_BACP2/46-444VL...KEG.T..NKQK.SGVSPFQAFAISM-----------------------AARVG-----T----------------
I0JJ89_HALH3/58-455......KEKK...NEK.GDISHYQALTTAL-----------------------AATIG-----T----------------
R7AGI4_9CLOT/50-474.....IIDKS...ESE.SGISSFASFCTTM-----------------------AMRVG-----T----------------
B2FSE0_STRMK/46-482LT...VKGEK....SD.AGVSSFQALAMSM-----------------------AGRMG-----I----------------
F2I8L7_AERUA/50-455VI...MEKPE....KE.DSVSSFQALMVST-----------------------ASRVG-----T----------------
H2IRW6_RAHAC/47-451TL...YKQKH....TA.RGISPWRALCLSL-----------------------ASRIG-----T----------------
Y183_HAEIN/59-462EM...WFGRS...VEG.SSLTPFQAFTTGL-----------------------ASRVG-----V----------------
Q87U15_PSESM/43-445VF...RDSLR...SSA.GQLSSFQALMLSL-----------------------AGRVG-----A----------------
G4QHN1_GLANF/78-481LL...KGSSK...SDA.AGISSFQALCTSL-----------------------SARVG-----T----------------
V4J7M3_9DELT/49-455VL...LNKGD..NSGK.REISGRQALLLSV-----------------------GGRVG-----G----------------
D5UBK7_CELFN/48-455QI...ASSRE...DAA.GGISSFQAFTVGL-----------------------ASRVG-----T----------------
A7ZDT9_CAMC1/54-470VL...VEKKD..KYNK.HHLTPFQALMIST-----------------------ASRVG-----I----------------
C1DD85_LARHH/46-459LM...VEGKA....DG.QGVSSFQALSISL-----------------------SGRVG-----T----------------
F0RL19_DEIPM/47-463LL...RDGQS....SN.EGVSSFQALAMAL-----------------------AGRVG-----T----------------
R5WS38_9FIRM/54-459VV...MEPKD....DE.KSISSFQALMVST-----------------------ASRVG-----T----------------
K0B2L5_CLOA9/50-448VI...TEKNT.ITDDG.ESISSFQAFCVST-----------------------ASRVG-----A----------------
F2JU21_MARM1/46-472LL...FNSNE....SS.EGISSFQALAVSL-----------------------SGRVG-----V----------------
D1B800_THEAS/50-454VT...LGGRK...SQE.GGISSFQALCTGL-----------------------AAQVG-----T----------------
R5Q6J7_9BURK/79-476.........ATAKTKK.GHISTFQAFCVST-----------------------ASRVG-----V----------------
R6NH81_9FIRM/47-453VL...KEKAGE.ENGK.KQVSSFQALMIST-----------------------ASRVG-----T----------------
Q81XD8_BACAN/54-450......LTGK..TRKK.GSVSSFQAFCMSS-----------------------AARIG-----I----------------
I3UGH4_ADVKW/46-460LL...RERKE....SA.DGISSFQAFCMAL-----------------------SGRVG-----V----------------
D6XWG3_BACIE/52-446.....TKGDQ...VSK.GDITHFQALMTAL-----------------------AATVG-----T----------------
Q3AFY7_CARHZ/46-459LL...FGGQS....SE.KGVSSFQAFAMAV-----------------------AGRVG-----T----------------
R5HBJ9_9FIRM/53-457VV...SEKPK....TK.GSISSFGALMIST-----------------------ASRVG-----T----------------
A0M410_GRAFK/284-691LAKGKFDNPD...A.P.GTITHFQAMATAV-----------------------SATVG-----L----------------
R6ALH3_9FIRM/50-450....IFKAQN...KGN.GDIDSFKALCTAL-----------------------SATVG-----T----------------
W5Y2T0_9CORY/46-478QL...VRGEK....SE.NGVSSFESLMMSL-----------------------AGRVG-----V----------------
R5I5H2_9BACT/50-447.....VTKDK...TEH.GDVSQFGALATAL-----------------------AATIG-----T----------------
Q8EN00_OCEIH/57-451..........FDASGK.KGTSSFQAFAISA-----------------------ASRVG-----T----------------
Q5P2T3_AROAE/46-460LM...FQGKS....SD.AGVSSFQALAIAL-----------------------SGRVG-----T----------------
Q7DDS6_NEIMB/53-458EM...LGGRKQ.GDDP.HGITPFQAFVTGL-----------------------ASRVG-----V----------------
Q0SCP0_RHOSR/50-470QL...KESSE....GE.GGLSSFQALVLAL-----------------------ASRVG-----V----------------
R5G5T4_9FIRM/48-470SLKDMVSNDD...SGD.GEVSSFGALCISM-----------------------AATLG-----T----------------
Q73GB3_WOLPM/82-486ILCGKYDTNH....HD.GHITHFQAFMTAL-----------------------SSTVG-----L----------------
D1BPB8_VEIPT/50-451LV....INGAGSSTEK.NHVSSFQAFCVST-----------------------ASRVG-----V----------------
E3GK02_EUBLK/49-466VL...K.GNG...DTS.DGITPFQAFATAL-----------------------GARVG-----V----------------
A8FFK0_BACP2/49-450SI...FEKAPKTKKGS.HEISSMQAFFIGA-----------------------ATRIG-----T----------------
D3EDV3_GEOS4/50-449VI...REP.K..SKTK.GSISPFQAFAISM-----------------------AARVG-----T----------------
B4E614_BURCJ/50-453LV.....GSK...GEP.GSISSFQAFATGL-----------------------ASRVG-----T----------------
Q07Z28_SHEFN/49-454VL...AISRR...PGK.HGLSSFQVFCTSM-----------------------AARVG-----A----------------
E3H6D6_ILYPC/48-461LM...FKGNA....SE.KGISSFQALAISI-----------------------SGRVG-----T----------------
U5L5G5_9BACI/46-460LM...FKGKS....SD.AGVSSFQALSIAL-----------------------SGRVG-----T----------------
F4CF94_SPHS2/46-459LL...FGSKS....SD.QGVSSFQAFAIAL-----------------------SGRVG-----T----------------
Q15SP8_PSEA6/49-451VM...KGSNK...SDK.AGISSFQALCTSL-----------------------SARVG-----T----------------
R7J9J1_9FUSO/75-484......IRVK...KKK.GEVSSFQALTATI-----------------------SASAG-----I----------------
D3FUF0_BACPE/53-450VI...TEK....KDGN.KGISAFQAFTIST-----------------------ASRVG-----T----------------
Q2SF65_HAHCH/43-445LV...RRSMK...ESQ.DQINSFQALSLTL-----------------------AGRVG-----A----------------
F4HCM3_GALAU/54-452NV...........DRK.HAISPFQAFVTGL-----------------------ASRVG-----V----------------
R6I317_9FIRM/51-457VV...SEKPK....DK.RSVSSFGALMVST-----------------------ASRVG-----T----------------
Q5L341_GEOKA/47-461LV...TTGKG....SE.AGVSSFQALTMSL-----------------------SGRIG-----V----------------
Q92P60_RHIME/46-452VL...SRGGS...KDA.AGISPFQALMVSL-----------------------ASRVG-----T----------------
R5EKL7_9GAMM/58-457......NGEK...AGN.HGMTSFQSLATAI-----------------------AAQVG-----T----------------
R6TGR9_9FIRM/48-453.V...GERPE....KE.GAVSSFQALMVST-----------------------ASRVG-----T----------------
R7AEN1_9ACTN/55-464QL...FEKKV..DKNG.KAISSFQAMMVST-----------------------GSRVG-----T----------------
R7MEC6_9CLOT/86-499VAKPTEKSED...GNC.GEVSSFQALATAL-----------------------SGTIG-----I----------------
Q5E0L3_VIBF1/46-471LL...ISNKE....SS.KGISSFQALAVSL-----------------------SGRVG-----T----------------
F8EJC0_RUNSL/46-459LL...FRGKA....SA.KGVSSFQAFAIAI-----------------------SGRIG-----T----------------
B0UUP4_HISS2/57-460EM...WFGRA...VQG.QSLTPFQAFTTGL-----------------------ASRVG-----V----------------
B2TML1_CLOBB/54-451.......VTS..ERKK.GSVSSFQAFCIST-----------------------ASRVG-----T----------------
Q3IIM2_PSEHT/46-453VM...FLSRR...GSG.DGISSFQAFCTSL-----------------------AARVG-----T----------------
R7CQS6_9FIRM/53-452........TAGTKTEG.NEISPFQAFCVST-----------------------ASRVG-----V----------------
R6YML2_9FIRM/50-472...WMVKNEE...GGE.GEISSFSALCTAL-----------------------SATIG-----T----------------
Q6ANS0_DESPS/50-451VL...RLGRE....RV.EGISSFQVFCTSM-----------------------AARIG-----T----------------
I0DZP7_PROSM/46-460LL...KENKS....SK.EGISSFQAFCLAL-----------------------SGRVG-----V----------------
R6GE77_9CLOT/48-451SL...TEKAE.....K.GKVSSFKSLMIST-----------------------ASKIG-----V----------------
D7AX43_NOCDD/60-469VL...KSKPETAPDGG.KAVSSIQAFMISA-----------------------AARIG-----T----------------
R5D3A3_9FIRM/51-467VV...SEKPK....EK.GSVSSFGALMVST-----------------------ASRVG-----T----------------
R6C274_9BACT/50-448.....VKKDK...NAT.GDVSQFRALATAL-----------------------AATIG-----T----------------
D4M6E0_9FIRM/62-465SL...NSKKG....KE.DGLSNFQTLIVST-----------------------ATRVG-----M----------------
YAAJ_ECOLI/46-453SL...KNSIH...PQP.GGLTSFQSLCTSL-----------------------AARVG-----S----------------
D5VAX7_MORCR/46-475LL...FSGNQ....SP.EGISSFQALTVSL-----------------------SGRVG-----M----------------
E3EA98_PAEPS/47-461LV...FKGKS....SE.AGVSSFQAFTMAL-----------------------SGRVG-----T----------------
D4LQM0_9FIRM/62-464AL...VEKKQ....DK.NSLSSFQTLIVST-----------------------ATRVG-----M----------------
H2FXG2_OCESG/46-453VL...KHSRQ...SDA.AGISSFQALCTSL-----------------------AARVG-----T----------------
R5PRI2_9BACT/50-447.....IKRDK...DAS.GDVSQFGALATAL-----------------------AATIG-----T----------------
J7L7G1_NOCAA/49-457VI...RGKAGTAPDGG.KEISPFQAFAISA-----------------------AARVG-----T----------------
R6VAG6_9FIRM/47-469ALKFMVKNEE...GGK.GEVSSFGALCTAM-----------------------SATIG-----T----------------
Q6ANS1_DESPS/56-454.....RAGRE....KV.NGISSFQVFCTSM-----------------------AARVG-----T----------------
K0J6Z8_AMPXN/55-453.....KKGDR...ADA.DGMSSFQALATAI-----------------------AAQVG-----T----------------
I3TIY8_TISMK/49-454VL...GRGAN..NADP.NAISAREALLVSV-----------------------GGRVG-----G----------------
Q81PH5_BACAN/46-459LL...FEGKS....SE.TGISSFQAFCLAL-----------------------SGRVG-----I----------------
Q1GL91_RUEST/49-450VL...TRGRT....DT.GQISAREALLVSV-----------------------GGRVG-----G----------------
C4L110_EXISA/50-450LL...FKEGT..EREK.GQVSSFQAFAIGT-----------------------AARVG-----T----------------
G0VQI3_MEGEL/43-446ALKLIFTAKN...QGE.GDVDSFKALCTAL-----------------------AATVG-----T----------------
B4S4I7_PROA2/112-519....VYDAPD...QQG.GEVSHFQALTAAL-----------------------SATVG-----L----------------
R5EMW4_9CLOT/55-557......RTKS...RGE.GDVSPFSALTTAL-----------------------AATIG-----T----------------
C7RF91_ANAPD/49-453VI...KEKPK....DE.SDVSSFQALMIST-----------------------ASRVG-----T----------------
B9E978_MACCJ/46-490LM...FQGEK....SP.TGISSFQAIALSL-----------------------AGRVG-----T----------------
D3RSW7_ALLVD/51-451....WRGRVS...QGN.GDIPPYHALMTVL-----------------------SATVG-----T----------------
Q481J5_COLP3/46-471LL...LSGKS....SD.QGISSFQALAVSL-----------------------SGRVG-----T----------------
D3VIB1_XENNA/46-454VL...KNSNK...SDD.SGISSFQALCTSL-----------------------AARVG-----T----------------
R6C0Q9_9CLOT/49-475AIKNLVQNER...SGDTGEVSSFGALCTAL-----------------------SATIG-----T----------------
A1TXI6_MARAV/46-452AI...RGSRE...SDV.HGISPFQALCTSL-----------------------ASRVG-----T----------------
R7G2T9_9FIRM/51-471.....IIDKQ...DSD.SGISAFGSFCTTM-----------------------AMRVG-----T----------------
Q8EBH5_SHEON/47-452IM...TMSRQ...GCE.SGLSSFQVFCTSM-----------------------AARVG-----A----------------
Q2NVZ2_SODGM/46-454IL...KDSGT...RGG.GGISPFQALCTSL-----------------------AARIG-----C----------------
R6NWY5_9FIRM/53-470......ENEK...SGESGEVSSFAALCTAL-----------------------SATIG-----T----------------
C5DAE3_GEOSW/49-446VI...AES....PNQK.GSISSLQAFFIST-----------------------ASRVG-----T----------------
D4MVF8_9FIRM/67-468.....NKNGK...DEK.SSLSSLQTLIVST-----------------------ATRVG-----M----------------
S6A4B3_9SPIO/50-458MFSDIKNKTE...VPE.GRMTPFQSLTTAV-----------------------AAQVG-----T----------------
Q8RDV2_FUSNN/55-455.....SSLKDGEKKIA.GQVTGFQAFCIAV-----------------------ASHVG-----T----------------
H0ULL2_9BACT/54-458VT...LKGRK...SEE.GGITSFQALCTSL-----------------------AAQVG-----T----------------
Q5WBL9_BACSK/46-460LM...FSGKK....SD.AGVSSFQALSVAL-----------------------AGRVG-----T----------------
D5D9I4_BACMD/46-459LM...FQGKS....SE.AGVSSFQALSLAL-----------------------SGRVG-----T----------------
K9YDV4_HALP7/46-445.........EGFNHEE.GHLSSFQALALSV-----------------------AGRVG-----A----------------
R6RBR5_9CLOT/84-516..KSVKGHSH...HDK.ASITQFQALCTAL-----------------------AATVG-----V----------------
C7MLG7_CRYCD/51-476SI...TEQKY..NEGE.KTTSSFQALMIST-----------------------ASRVG-----T----------------
W5Y1T9_9CORY/60-473QL...KDSES....GD.GGLSSFQTLALTL-----------------------SSRVG-----F----------------
R7C4U2_9BURK/46-460LM...FQRKN....DN.SGVSSFQALSMTL-----------------------AGRVG-----T----------------
W5Y4I7_9CORY/46-477QL...RQGEK....SD.NGISSFQSLMISL-----------------------AGRVG-----V----------------
F6AAC4_PSEF1/43-445VF...KDSIR...SSG.GQLSSFQALMLSL-----------------------AGRVG-----A----------------
D2RNM9_ACIFV/44-448SLKLIFSAEN...QGE.GDIDSFKALCTAL-----------------------AATVG-----T----------------
C5C6U4_MICLC/48-455SV...TAKSQ.TGFEN.DGVSPFRAFTISA-----------------------ASRVG-----T----------------
D4MZ66_9FIRM/54-463......RTKN...RGE.GDVSPFSALTTAL-----------------------AATIG-----T----------------
X2GKP6_9BACI/49-446LI...TEK....RDGE.SGVSPFQAFTISA-----------------------ASRVG-----T----------------
R5D2D6_9FIRM/92-509.....EEGHN...DKD.TGLSPFQAFATTV-----------------------GGRVG-----T----------------
D7BM33_ARCHD/59-464YL...LHSRQ...GAN.GGISSFQAFAMGM-----------------------STRIG-----I----------------
Q6LSN7_PHOPR/49-454VL...LNKNQ..TADR.NAISGREALLLSV-----------------------GGRVG-----G----------------
Q1QSR6_CHRSD/60-472VT...FNSRG....AG.EGVSGFQAFATSL-----------------------AARVG-----T----------------
D4LCB5_RUMC1/46-473ALKYMWKEEE...TGH.GEVSSFAALCTAL-----------------------SATVG-----T----------------
G4Q7R4_ACIIR/46-452LV...MAKPT....DE.KGTSPFQALMVSS-----------------------AACVG-----T----------------
R6PKK8_9CLOT/51-453.....KAEKN...DNG.KSVSSFQALMIST-----------------------ASRVG-----T----------------
D5CH05_ENTCC/46-453SL...KNSVT...PQP.GGLTSFQALCTSL-----------------------AARLG-----S----------------
D2RIK3_ACIFV/46-452VV...MQKPS....KE.GSVSSFQALMVST-----------------------ASRVG-----T----------------
D4M9Q8_9BACT/49-459LL....IGKG....SQ.SGISSFQAFATTV-----------------------GSRVG-----M----------------
R6J437_9CLOT/52-480ALKFMVKNED...NGE.GEVTSFGALCTAL-----------------------SATIG-----T----------------
C4ZJ27_THASP/46-460AM...FRGKS....SA.AGVSSFQALTIAL-----------------------SGRVG-----T----------------
E4TGP7_CALNY/48-462HL...ISGKE....SK.TGISSFQAFSMAV-----------------------AGRVG-----T----------------
C3PIJ7_CORA7/46-477QL...KDGES....SD.SGVSSFQSLMISL-----------------------AGRVG-----V----------------
R5FNH5_9ACTN/54-462QL...FEKKH..VPGK.KSISSFQAMMVST-----------------------ASRVG-----T----------------
G7UNE2_PSEUP/46-460LM...FRGQS....SA.SGVSSFQALAMSL-----------------------SGRVG-----T----------------
J9SBB2_9ACTO/60-499VM...RHGQS....SP.DGVSSFQALMISL-----------------------AGRVG-----T----------------
A9IDQ9_BORPD/44-455LT...LHRKS....GD.DGLSSFQALALTL-----------------------SSRVG-----V----------------
G2PM93_MURRD/278-683....KYDDPD...A.P.GQVTHFQALATAV-----------------------SGTVG-----L----------------
M4U7B3_9GAMM/46-450ALKLVFSKDK...SNS.GDISSFAALCTAL-----------------------SATIG-----T----------------
A1AZT0_PARDP/75-484SI...TAAPA...ADR.QGISPFQALCTSL-----------------------ASRVG-----T----------------
G4KZA8_OSCVS/51-471.....ILDKG...SSD.SGISTFRSFCTTM-----------------------AARIG-----T----------------
I0GRA8_SELRL/53-452........GIGKKTEG.GAISSFQAFCVST-----------------------ASRVG-----V----------------
K4IFK4_PSYTT/275-681LARGKYDEPN...A.P.GRITHFQALATAV-----------------------SATVG-----L----------------
R7ILK1_9BURK/46-459LL...FQKKV....GE.VGISSFQALTMTL-----------------------AGRVG-----T----------------
L0G2I0_ECHVK/46-459LL...FRGES....SE.KGVSSFQAFAIAI-----------------------SGRVG-----T----------------
R5BRP1_9FIRM/49-450LL....GEGVGKKTEG.NRISSFQAFCVSS-----------------------ASRVG-----V----------------
R5G1P5_9ACTN/52-470......KNEE...DGK.GEVTSFGALCTAM-----------------------SATVG-----T----------------
Q11EU9_CHESB/49-451VL...SSKNQ..SADP.NAISARAALLMSV-----------------------GGRVG-----G----------------
Y883_HAEIN/48-453...YLFKKDK...GGK.GDVSSFAALCTAL-----------------------AATIG-----T----------------
Q2SAS2_HAHCH/49-473......SGTS....SD.KGISSFQALAVSL-----------------------SGRVG-----T----------------
D4ZH12_SHEVD/56-454.....LKGRE....KV.DGISSFQVFCTSM-----------------------AARVG-----T----------------
H1Z903_MYROD/46-459LL...FTEGS....SE.KGVSPFQAFSIAI-----------------------AGRVG-----V----------------
R5AXG7_9BACE/47-454ALKAIKARPD...SSS.GEISSLQALASVV-----------------------AGTIG-----M----------------
D6XWR4_BACIE/59-456VI...TEK....KDGT.NGISPFQAFTIST-----------------------ASRVG-----T----------------
R5EZS8_9GAMM/50-454VL...RHGIVGHKTKG.KEISSFQAFCIST-----------------------ASRVG-----V----------------
Q3ICJ9_PSEHT/49-451LL...KGSSK...CKK.GDISSFQALCTGL-----------------------CARVG-----T----------------
I0JHI0_HALH3/58-455.....IFKKT...DKK.GTITPFQAFTSAL-----------------------ASTAG-----A----------------
M1P0N1_9CORY/53-457....IDRSDT...DGK.GDISNYQALTTAL-----------------------AATVG-----V----------------
D6ZHY8_MOBCV/70-472TV...MGSRK...GSH.GGISSFQAFAVGL-----------------------ADRVG-----T----------------
D2S4W0_GEOOG/50-455QI...ASSRS...GSE.GGISSFQAFCVGL-----------------------ASRVG-----T----------------
E3GKE4_EUBLK/47-467LL.....GDNKGKGTD.EGVSGLRAFIMTA-----------------------AGRVG-----V----------------
YRBD_BACSU/46-459QM...FKGKS....SE.AGVSSFQALSIAL-----------------------SGRVG-----T----------------
A6VYN5_MARMS/44-452.....LTAKH.HEADG.KHLSSFQALILSV-----------------------AGRVG-----G----------------
R5QXT9_9FIRM/51-456VV...AQPGS....DK.NGLSSFQALMVST-----------------------ASRVG-----T----------------
R5BSJ1_9FIRM/46-462NM...GQGAD....SS.KGLSPLRAFIFTA-----------------------ARTVG-----V----------------
A4XPB8_PSEMY/46-459LM...FTGKT....DE.HGITSFQALTMTL-----------------------AGRVG-----T----------------
R6Q9I8_9FIRM/48-459..QYIFEKEE....GQ.GDVSTLGSLCTAL-----------------------AATIG-----T----------------
E1V890_HALED/54-463LL...RHSRS....AN.GGISSFQALSTSL-----------------------AARVG-----T----------------
G0VMJ7_MEGEL/47-452VV...MEKPT....EA.GKVSSFQALMVST-----------------------ASRVG-----T----------------
B1ZTG5_OPITP/46-460LL...FRSEA....SA.RGISSYQAFALAI-----------------------SGRVG-----I----------------
E3PS56_CLOSD/46-460QM...LNGEA....SE.NGVSSFQGFAMAL-----------------------GGRVG-----T----------------
B0TD76_HELMI/46-448.LRLIFTAKN...DGD.GDVNSFGALCTAL-----------------------AATVG-----T----------------
B8F6B8_HAEPS/56-460EM...WSGRA...AEG.ESLTPFQAFATGL-----------------------ASRVG-----V----------------
H2G0K3_OCESG/46-460LM...FQGNS....SA.AGISSFQALALSL-----------------------SGRVG-----T----------------
G8PS27_PSEUV/49-455VL...LKSRH...EDR.NGISPFQALCTSL-----------------------ASRVG-----T----------------
K9TW29_9CYAN/99-504....HYDNPA...E.A.GEVTHFQALSAAL-----------------------SATVG-----L----------------
D5DB16_BACMD/43-440VL...KEG.R..AAKG.GGVSPFQAFCISM-----------------------AARVG-----T----------------
Q0W2J6_UNCMA/53-469MLHAAKSRKS...DQE.GDIPSFHALCTAL-----------------------SATVG-----T----------------
C3AHI8_BACMY/53-467LT...FQGEK....SE.AGVSSFQALALSL-----------------------SGRVG-----T----------------
A7IEP7_XANP2/46-450SV...LRADA...TDK.SGITPFQALCTSL-----------------------ASRVG-----T----------------
C0R294_BRAHW/49-448LL...FSKHE....KG.DGVSGFVSFCIST-----------------------ASRVG-----T----------------
R7FY43_9FIRM/55-454....FSKKGT...AGK.DGMSSFQALATAI-----------------------AAQVG-----T----------------
I3UGJ4_ADVKW/61-451......SDGS...DDQ.GDISHFGALMTAL-----------------------SATIG-----T----------------
A8MKE1_ALKOO/50-456VFGGVFKKEA...NKE.GSMSSFQALATSI-----------------------AAQIG-----T----------------
B1YF48_EXIS2/50-454LL...FQGTD...KGK.DGVSPFQAFAIST-----------------------AARVG-----T----------------
D5BRV2_PUNMI/84-498LVRGDYADPD...S.A.GEVSHFQALATAV-----------------------SGTVG-----I----------------
G0J6F2_CYCMS/46-459LL...FGGES....SD.KGVTSFQAFAIAI-----------------------SGRVG-----T----------------
C7MHV8_BRAFD/47-482QL...KKGKT....SP.DGTSSFQSLMMSL-----------------------AGRVG-----M----------------
ALST_BACSU/49-444IV...GEK....PEGN.KGVSSMQAFFISA-----------------------ASRVG-----T----------------
R5RWM9_9FIRM/55-469.....FQKSE...AGE.GEITPMQAVSTAL-----------------------ASTVG-----T----------------
D3UJ87_HELM1/57-462.......HAD..QKND.EHISPFQALMIST-----------------------ASRVG-----I----------------
R6EEZ2_9FIRM/60-476...HVTKHTE...AGD.QSISQFQSLCTAL-----------------------AATIG-----T----------------
R6MFU2_9FIRM/47-452SV...MEKPD....DK.EAISSFQALMVST-----------------------ASRVG-----T----------------
R7PRB6_9FIRM/45-450ALSLIFSAEN...KGS.GDIDSFKALCTAL-----------------------AATVG-----T----------------
A2SR40_METLZ/55-463VA...FTGLR.AEKGK.QTISSFQAFCVSM-----------------------GARIG-----V----------------
D5DJA6_BACMD/50-450VL...KEGAD..SSSK.DGISPFQAFCISM-----------------------AARVG-----T----------------
R5AJ95_9FIRM/49-458VI...AEKRE....DR.ESISSFQALMVST-----------------------ASRVG-----T----------------
R5YUK1_9FIRM/62-468SL...LAKKE....HK.DSLSTFQTLIVST-----------------------ATRVG-----M----------------
R5Q3U9_9BURK/59-459.....LFGDK...AGK.DGMSSFQSLATAI-----------------------SAQVG-----T----------------
R7PRF4_9FIRM/49-455LI....ISSAGSKTKG.NEISSFQAFCVST-----------------------ASRVG-----V----------------
A0Q3K6_CLONN/59-455.......SSN..KEEH.HGVSSFQAFCIST-----------------------ASRVG-----T----------------
R5NYD9_9BACT/51-452.....VQSDK...SGQ.GDVSQFGALATAL-----------------------AATIG-----T----------------
B5HEI9_STRPR/73-499.VRGKYDEKG...S.A.GEVNHFQALTAAV-----------------------SGTVG-----L----------------
I3TQE6_TISMK/46-452AV...IGSGD...NDR.SGISPFQALCTSL-----------------------ASRVG-----T----------------
F2JVC9_MARM1/46-446TV...FQAPQ...SDR.GGISPFQALCTSL-----------------------ASRVG-----T----------------
L0FYG8_ECHVK/279-685....KYDEPD...A.P.GKISHFQAFATAT-----------------------SATVG-----L----------------
B2GLS0_KOCRD/53-457.........AGEEDGR.KGISSFRAFTVSA-----------------------AARVG-----T----------------
C7REC1_ANAPD/49-451NL...........KAS.DGVSGFAALATAV-----------------------GGQVG-----T----------------
B3EMZ0_CHLPB/88-501..RGVYDSPD...KQK.GEVSHFQALTAAL-----------------------SATVG-----L----------------
I5AXG7_EUBCE/61-477....VTAHTD...DDD.QSISQFQSLCTAL-----------------------AATIG-----T----------------
D2RN33_ACIFV/46-452LL...MVKPQ....DG.NGTSPFQALMVST-----------------------AACVG-----T----------------
C5C8M5_MICLC/48-478QL...REGQD....SA.DGTSSLQSLMLSL-----------------------AGRVG-----M----------------
G4KY93_OSCVS/47-452VV...SEKPS....TA.GKISSFQALMVST-----------------------ASRVG-----T----------------
G4KWB0_OSCVS/53-452.....IFEKT...EGA.GDISPFQACCTAL-----------------------ASTLG-----V----------------
D3Q113_STANL/44-457QL...RTGEK....SD.AGVSSFQALMLTL-----------------------SSRVG-----V----------------
I2BD01_SHIBC/46-454NL...KKSTI...PRP.HGITAFQALCTGL-----------------------ASRVG-----S----------------
R6R8F0_9FIRM/60-473...EVTAHTS...KED.MAISQFQSMCTAL-----------------------AGTIG-----T----------------
R7HAX2_9FIRM/48-472.VKELFSNER...SGEDGEVSSFAALCTAL-----------------------SATIG-----T----------------
Q8ECR9_SHEON/46-459LM...FDGKS....TD.AGVSSFQALAMTL-----------------------AGRVG-----T----------------
Q6NEM1_CORDI/46-477QL...RAGEK....SA.NGVSSFQSLMMSL-----------------------AGRVG-----V----------------
A0QRB1_MYCS2/46-485LM...VKGEK....SP.SGVSSFQALTMSL-----------------------AGRVG-----T----------------
D2NQ65_ROTMD/71-481VL...GDPVAREADGK.KSISSFRAFTVSA-----------------------ASRVG-----T----------------
F6AHU7_PSEF1/46-452VI...LERNH...GDK.EAISSFKAFTISA-----------------------ASRVG-----T----------------
C2X582_BACCE/50-448VL...MEG.K..SGSK.DQISPFQAFCIGM-----------------------AARVG-----T----------------
M4UAD5_9GAMM/46-449VM...RNSRK...SDK.EGISSFQALSTSL-----------------------AARVG-----T----------------
Q6FE01_ACIAD/61-482VM...KGSRKE.GEDE.HGITPFQAFVTGL-----------------------ASRVG-----V----------------
Q5E342_VIBF1/63-467.....RSGQE....IE.NGISSYQVFCTSM-----------------------AARVG-----T----------------
D5V3Y8_ARCNC/47-451IL...RETAH...DKD.GHISSFQALMLSV-----------------------AGRVG-----G----------------
F8DYI2_CORRG/49-453MV...GEKPK..SKSG.ESLSAFQAFTISA-----------------------ASRVG-----T----------------
R5H9R9_9FIRM/51-466.IGKIFKRTH...AGE.GEITPFQAVSTAL-----------------------AGTVG-----T----------------
Q186Q3_PEPD6/63-459.......NKN..AKKE.GKISSFQAFCIST-----------------------SSRVG-----T----------------
R5XPN0_9CLOT/54-453......MGKD..AKGD.GKVSSFQAFCIST-----------------------ASRVG-----T----------------
I4BXH1_ANAMD/47-454IL...LGSRK...AEE.KGISSFQALCTGL-----------------------AAQVG-----T----------------

PF05525

BRNQ_BACSU/6-436--------------------SASYIIIIG-------------------------LMLF-----AL-F-----FG---AG-
Q9A1E1_STRP1/3-454--------------------QKNVYIVIG-------------------------FMLF-----AL-F-----FG---AA-
BRAB_PSEAE/5-429--------------------KGFDLLALG-------------------------FMTF-----AL-F-----LG---AG-
Q9CJW8_PASMU/1-426--------------------MNKNTFVVG-------------------------FMLF-----AI-F-----FG---AG-
Q8REN9_FUSNN/3-423--------------------KTKDVLLTG-------------------------FALF-----AM-L-----FG---AG-
Q9KU61_VIBCH/6-428--------------------KLADILALG-------------------------FMLF-----AF-F-----LG---AG-
BRNQ_CORGL/2-412--------------------SKKSVLITS-------------------------LMLF-----SM-F-----FG---AG-
BRAZ_PSEAE/5-429--------------------KGRDILALG-------------------------FMTF-----AL-F-----VG---AG-
Q8RH58_FUSNN/3-424--------------------NMIDVITAG-------------------------FALF-----AM-L-----FG---AG-
O83289_TREPA/2-440--------------------IHTHTLSLS-------------------------FMLF-----SF-F-----FG---AG-
BRAB_BACSU/6-435--------------------PVKDTIIIG-------------------------FMLF-----AL-F-----FG---AG-
BRNQ_HAEIN/3-431--------------------SRKDIIVLG-------------------------MMIF-----AL-F-----LG---AG-
Q97IN0_CLOAB/5-435--------------------SKKNTFFVG-------------------------LLLF-----SM-F-----FG---AG-
Q8XND4_CLOPE/5-434--------------------SRKDLLLVS-------------------------LMLF-----SL-F-----FG---AG-
BRNQ_SALTY/7-429--------------------.SRDIIALG-------------------------FMTF-----AL-F-----VG---AG-
Q1GBE3_LACDA/7-439--------------------.HAESLTIS-------------------------SMLF-----GL-F-----FG---AG-
Q2G1H2_STAA8/8-443--------------------..KENMFIG-------------------------SMLF-----GL-F-----FG---AG-
Q8DQQ3_STRR6/8-437--------------------..KKGTLTG-------------------------LLLF-----GI-F-----FG---AG-

PF13520

Q5AQY0_EMENI/33-501----------------------LSTLDVA-------------------------CLII.....NK.M.....IG...GG.
Q75CJ2_ASHGO/54-501----------------------LGLFSTV-------------------------VMFV.....SR.I.....VG...SG.
Q03U70_LACBA/18-459----------------------ITGFQLF-------------------------SMTT.....SM.V.....MT...VY.
A8AGY3_CITK8/5-447----------------------LGLSALT-------------------------ALVL.....SS.M.....LG...AGV
A1T4X6_MYCVP/25-447----------------------LGLAALT-------------------------ALVV.....GS.M.....IG...SG.
C1DD80_LARHH/11-459----------------------LKLPALT-------------------------ALVV.....GS.M.....IG...GGI
D6S3T3_9LACO/11-440----------------------VGLGGLT-------------------------GLIV.....GG.T.....IG...SG.
C9SVT9_VERA1/51-488----------------------LSWQSAY-------------------------ILVI.....SR.V.....IG...SG.
B8PBB2_POSPM/39-484----------------------LGLLQNF-------------------------GVSF.....SI.I.....SV...IT.
Q0CXR8_ASPTN/61-493----------------------FSLWTTF-------------------------CVSF.....AV.LGLLPSFA...ST.
Q6CAR8_YARLI/33-481----------------------FSMLQVF-------------------------GIAF.....SI.M.....GL...LP.
C7N1A7_SLAHD/31-475----------------------LFWKQVV-------------------------FLAL.....GA.P....ALV...LF.
A1CLI4_ASPCL/51-499----------------------LNWSSAY-------------------------ILVI.....SR.V.....IG...SG.
A3GHP8_PICST/45-486----------------------IGYVSAT-------------------------FLML.....NR.MLGAGVFS...TG.
B2AVM0_PODAN/75-550----------------------LGTWSTA-------------------------FLII.....NR.V.....VG...AG.
Q6CLW2_KLULA/73-522----------------------IQVFGVA-------------------------FSIM.....GL.L.....PS...IA.
Q12TS7_METBU/31-468----------------------IDWKQGL-------------------------AIAI.....GVPL.....LI...LP.
A8I1F7_AZOC5/21-530----------------------IDWRGAF-------------------------WVAS.....GV.PAL.VLFS...IG.
Q75DM0_ASHGO/48-484----------------------LGLFSSI-------------------------GLIC.....NR.M.....LG...TG.
A2R9I4_ASPNC/39-488----------------------YSTVQVF-------------------------AIAF.....SI.M.....GL...LP.
Q4PCK9_USTMA/62-513----------------------FSTISYA-------------------------FAIM.....GL.V.....SS...VA.
C8VPT6_EMENI/44-469----------------------LGLLSTT-------------------------FLIT.....NR.MIGTAIFS...TP.
A3LTS7_PICST/18-462----------------------LDYVSAF-------------------------YMVI.....QG.I.....IG...TG.
C5MEY2_CANTT/54-503----------------------FNLWSTC-------------------------AFQY.....TL.ICSSLAIG...TF.
A5FG51_FLAJ1/9-423----------------------LNQLQAT-------------------------AICG.....ND.I.....SS...SC.
Q4DJK0_TRYCC/39-456----------------------LTTLTLL-------------------------GVIY.....TA.SIS.GGYG...LE.
Q4DQR3_TRYCC/175-589----------------------LGQLRAT-------------------------AIAG.....NE.IAS.SCIY...AT.
Q73M42_TREDE/10-421----------------------LNLFNIF-------------------------SLGF.....GG.A.....VG...SG.
Q2UFR9_ASPOR/43-476----------------------LGLVSTT-------------------------FLITNRMIGTA.I.....FS...VP.
Q023N1_SOLUE/24-483----------------------ISFWRAA-------------------------AIVL.....SD.L.....AS...SA.
B8NAK1_ASPFN/43-512----------------------FSWVGAI-------------------------GLSF.....SI.ANSWLGYG..ATF.
Q98PQ8_MYCPU/7-477----------------------FSYLSVI-------------------------IFVV.....GS.T.....IG...AG.
Q38YR6_LACSS/23-445----------------------LGRFKAL-------------------------AMLS.....SD.ALSSVAYG...TE.
B0D4Q4_LACBS/41-461----------------------LGQFTAS-------------------------ALAG.....ND.I.....LGG.IFY.
Q6MS69_MYCMS/8-487----------------------LEFLTLF-------------------------AMTI.....GS.V.....VG...AG.
Q01XN7_SOLUE/23-483----------------------ISFWRAA-------------------------AIVL.....SD.L.....AS...SA.
D0NVC6_PHYIT/66-486----------------------LGEWTST-------------------------SISG.....NA.I.....LS...SV.
Q4PIJ5_USTMA/272-694----------------------LGQWKAS-------------------------AIAG.....NA.V.....TGS.VFY.
Q1IPP3_KORVE/22-486----------------------ISFWRAA-------------------------AIVL.....SD.L.....AS...SA.
Q6F2A1_MESFL/11-481----------------------FEFLTLF-------------------------VMVI.....GT.V.....IG...SG.
Q8EVP3_MYCPE/28-507----------------------ISFISAI-------------------------LIVI.....GS.C.....IG...SG.
Q6KI68_MYCMO/24-546----------------------IGFLSVI-------------------------LLTI.....GS.S.....IG...AG.
Q97VA8_SULSO/20-502----------------------VSPWASF-------------------------FATF.....GL.V.....TG..GIP.
E9DET5_COCPS/69-502----------------------IGVFTAT-------------------------FLVF.....NR.I.....IG...TG.
G8PMP4_PSEUV/13-449----------------------ITLWHLV-------------------------FMTT.....AL.F.....MT...ML.
Q0JZA8_CUPNH/34-490----------------------LTWKDAF-------------------------WVTS.....GV.P.....AG...VL.
Q4AAQ0_MYCHJ/13-424----------------------...RQFI-------------------------FYGL.....NY.I.....VG...FG.
Q4WA88_ASPFU/42-486----------------------LNFFSTL-------------------------AFSA.....TL.M.....ASWETVG.
Q5ZUY4_LEGPH/12-429----------------------LSVLSLA-------------------------LITV.....CS.V.....DS...IR.
Q6MS71_MYCMS/8-466----------------------FEFLTLF-------------------------MMSV.....GT.I.....VG...SG.

PF00209

S6A11_MOUSE/45-571---------------------RGHWNNKV-------------------------EFVL-----SV-------AG------
SC6A9_MOUSE/86-621---------------------RGNWGNQI-------------------------EFVL-----TS-------VG------
SC6A2_HUMAN/56-580---------------------RETWGKKI-------------------------DFLL-----SV-------VG------
SC6A7_RAT/37-561---------------------RGNWTGKL-------------------------DFLL-----SC-------IG------
SC6A3_BOVIN/60-580---------------------RETWSKKA-------------------------DFLL-----SV-------IG------
SC6A6_CANFA/41-568---------------------REKWSSKI-------------------------DFVL-----SV-------AG------
Y736_HAEIN/11-497---------------------RETFSGRR-------------------------AFIL-----AA-------IG------
S6A15_RAT/61-644---------------------RPAWNSKL-------------------------QYIL-----AQ-------VG------
SC6A4_RAT/79-600---------------------RETWGKKM-------------------------DFLL-----SV-------IG------
S6A17_RAT/60-643---------------------RPAWNSKL-------------------------QYIL-----AQ-------IG------
SC6A1_HUMAN/44-559---------------------RDTWKGRF-------------------------DFLM-----SC-------VG------
S6A13_MOUSE/32-556---------------------REHWNNKM-------------------------EFVL-----SV-------AG------
SC6A8_RAT/52-583---------------------RETWTRQM-------------------------DFIM-----SC-------VG------
NTDO_CAEEL/40-576---------------------REQWSGKL-------------------------DFLL-----SV-------VG------
S6A12_CANFA/36-561---------------------RGQWTNKM-------------------------EFVL-----SV-------AG------

PF02028

A8LPK2_DINSH/19-510-----------------------LFAVTG-------------------------GFIA-----LF-------CA------
Q92WM0_RHIME/57-540-----------------------VFVGSV-------------------------AVIA-----LF-------VG------
B1YHV0_EXIS2/12-504-----------------------VFIISV-------------------------IFCV-----LF-------TI------
A8LQI8_DINSH/15-511-----------------------TSLISA-------------------------GIIL-----LF-------VL------
B9LMR4_HALLT/20-531-----------------------VFAFGA-------------------------LLTV-----GV-------IA------
Q9K9K1_BACHD/6-494-----------------------VFIISV-------------------------AIAA-----IF-------IA------
A8GBX6_SERP5/19-505-----------------------VFFTSA-------------------------GLIL-----AF-------SL------
Q24SP9_DESHY/12-494-----------------------VLYISS-------------------------AIAL-----LF-------VL------
Q8P5D9_XANCP/17-505-----------------------VFVLAA-------------------------TVVC-----TF-------AL------
Q7VZR1_BORPE/13-496-----------------------VFLTSA-------------------------LFIL-----LL-------VV------
Q5WBX8_BACSK/16-508-----------------------IVFPSI-------------------------LIIA-----IV-------SF------
Q24ME3_DESHY/23-511-----------------------VFWGSA-------------------------ILCV-----AL-------YA------
A4RTS9_OSTLU/5-508-----------------------T.....-------------------------..LW-----GF-------TI------
A1TNS1_ACIAC/32-511-----------------------V...SA-------------------------GMIA-----VV-------VL------
A1WTW7_HALHL/25-513-----------------------VMVLSG-------------------------GFVL-----AF-------IA------
A0M563_GRAFK/13-496-----------------------VFLISA-------------------------IILI-----LS-------SI------
Q083A6_SHEFN/33-521-----------------------VFGISA-------------------------GLIA-----AF-------LI------
A3HUC8_9BACT/12-495-----------------------VFWPAT-------------------------FLIF-----FF-------IT------
Q7NQ38_CHRVO/2-486-----------------------VLRLSL-------------------------LFAV-----LF-------AL------
Q73N94_TREDE/25-518-----------------------ITVLPL-------------------------AVII-----CL-------TG------
Q8FNC7_COREF/25-515-----------------------IFLLSV-------------------------GIIV-----TF-------VV------
A7HWC8_PARL1/21-507-----------------------VFYTSA-------------------------VGIA-----LF-------AI------
Q47TJ2_THEFY/57-547-----------------------VFLTAA-------------------------AFTL-----AF-------VA------
A7HZZ0_CAMHC/11-495-----------------------VFYSSV-------------------------SVLV-----FI-------LF------
A1WT60_HALHL/15-497-----------------------VFLPAA-------------------------ALVV-----AL-------VV------
Q88C09_PSEPK/15-521-----------------------VTIWSL-------------------------LAVV-----AF-------VL------
Q2FYT0_STAA8/17-503-----------------------VFIYSA-------------------------IVVA-----IV-------VL------
A4J208_DESRM/13-498-----------------------IFWPPL-------------------------LLIS-----IV-------CA------
A3CRU5_METMJ/11-494-----------------------VFLFSA-------------------------GIIL-----FF-------IG------
A1WTL9_HALHL/51-540-----------------------VFIVSS-------------------------ALIL-----VF-------LI------
Q8ESD6_OCEIH/10-503-----------------------TFIGAL-------------------------LILL-----TV-------VI------
A1WY53_HALHL/17-503-----------------------VTAIST-------------------------FLVA-----AF-------AL------
O83144_TREPA/10-507-----------------------VSLIPL-------------------------GIVI-----SC-------AL------
Q9JZ61_NEIMB/17-502-----------------------VILTTL-------------------------FFVC-----VL-------VV------
Q30W47_DESAG/28-510-----------------------VFFGSA-------------------------GLIF-----LF-------VG------
Q9KCW2_BACHD/16-501-----------------------VFSISA-------------------------VLIG-----LF-------VL------
A4FCK8_SACEN/14-506-----------------------VFLVSG-------------------------AIAV-----AF-------VL------
Q6NER6_CORDI/66-556-----------------------VFGASA-------------------------VGII-----AL-------TL------
A4XAA8_SALTO/18-503-----------------------LLGLAV-------------------------GGVL-----AI-------VV------
A0Q2F1_CLONN/9-486-----------------------IFKSSI-------------------------LISA-----CI-------FI------
Q5WHJ4_BACSK/13-493-----------------------VFYWVL-------------------------GILL-----IF-------IV------
Q03DR2_PEDPA/2-485-----------------------V.....-------------------------.LFG-----VV-------SI------
A1WWT9_HALHL/15-504-----------------------LTGTAT-------------------------LIVL-----AF-------LI------
Q8NN75_CORGL/48-536-----------------------VFGVTA-------------------------ALIL-----AF-------IA------
Q4KIJ7_PSEF5/28-512-----------------------IFWISG-------------------------GFFL-----LF-------LV------
Q6F754_ACIAD/16-498-----------------------VFVSTI-------------------------MIIA-----IF-------LA------
Q4JV07_CORJK/39-530-----------------------VVAVTM-------------------------VITL-----LV-------AI------
Q1GUM7_SPHAL/19-507-----------------------VFFVPL-------------------------MVLL-----AT-------VM------
Q5V5Y7_HALMA/44-539-----------------------VFPVAL-------------------------AIIA-----LF-------IA------
Q4JU17_CORJK/21-505-----------------------VTGSAA-------------------------ALIL-----AV-------VL------
Q6ANF3_DESPS/20-505-----------------------LFYTTA-------------------------LVTL-----AI-------VV------
A8EUT8_ARCB4/9-492-----------------------VFIPAV-------------------------VFIT-----LL-------VV------
Q1QZD1_CHRSD/9-499-----------------------VFWPTF-------------------------LVLL-----AA-------VI------
A6VY67_MARMS/19-509-----------------------MSYGSI-------------------------LMVG-----AF-------VL------
Q3IIZ4_PSEHT/14-498-----------------------VFLPAV-------------------------FIIL-----LL-------VI------
Q5HKM4_STAEQ/12-498-----------------------VYTISV-------------------------LIIV-----VI-------TL------
Q1AY03_RUBXD/14-498-----------------------VFYVSV-------------------------AVAA-----AF-------VV------
Q8ESZ5_OCEIH/13-497-----------------------VFYISG-------------------------GFLI-----LF-------II------
Q8ET62_OCEIH/7-489-----------------------VFYFAV-------------------------ILVG-----IM-------VA------
Q1QZU3_CHRSD/9-494-----------------------VFIVSA-------------------------LIVA-----VL-------VA------
A4FIK1_SACEN/20-504-----------------------VFYASV-------------------------TLCG-----LF-------VL------
Q8ESH6_OCEIH/15-502-----------------------VLFLSG-------------------------GALL-----AF-------VI------
Q9HQN5_HALSA/21-504-----------------------LFAVTM-------------------------AAML-----AL-------AV------
Q6LGN5_PHOPR/6-492-----------------------ILLLSL-------------------------SLTG-----GI-------AL------
Q6ANF9_DESPS/22-508-----------------------LFASTM-------------------------SFIV-----LV-------VL------
A5I0X2_CLOBH/10-487-----------------------VFYVSI-------------------------ISLL-----FL-------LL------
E0TGG2_PARBH/42-529-----------------------VFFVSA-------------------------ALIL-----LF-------VS------
A1U5B2_MARAV/17-501-----------------------VFFSSA-------------------------AIAA-----LF-------VA------
Q5V633_HALMA/130-615-----------------------ILAFPV-------------------------LVFA-----AF-------FG------
Q5LNL7_RUEPO/27-596-----------------------IALFSK-------------------------AIMV-----GL-------VL------
Q8FM43_COREF/17-511-----------------------VFFSSV-------------------------GIMV-----AF-------VI------
A6W731_KINRD/41-528-----------------------TFAVAA-------------------------GVVV-----LF-------LL------
E0TC76_PARBH/7-483-----------------------LSALPY-------------------------GVVI-----VI-------AG------
Q6FDF6_ACIAD/20-509-----------------------VFWSSA-------------------------ISIS-----IF-------GM------
Q24SQ4_DESHY/13-501-----------------------VFIISA-------------------------LLAV-----GF-------LL------
A4SA86_OSTLU/1-471-----------------------L.....-------------------------..LW-----GF-------II------
B1HZN6_LYSSC/11-493-----------------------VFIISS-------------------------GAIL-----FL-------VI------
B2FT71_STRMK/40-523-----------------------VFRVSI-------------------------ALVL-----LL-------VL------
B4EHS6_BURCJ/16-501-----------------------VVLLAL-------------------------AVIG-----AL-------LV------
B7VLA5_VIBSL/13-502-----------------------.FFGAI-------------------------ALLL-----TI-------VF------
B7VQN7_VIBSL/33-520-----------------------VFIASV-------------------------GLSL-----LF-------II------
B8CV80_SHEPW/23-508-----------------------IFFPSL-------------------------IAVI-----IL-------SY------
M1F781_9ALTE/23-507-----------------------.LALSV-------------------------GFIV-----LF-------VG------
M9X2A3_PASHA/17-499-----------------------IFLPSL-------------------------LFVS-----FV-------AV------
Y917_MYCTU/23-509-----------------------VFIPAS-------------------------VVIV-----AM-------IV------
Q2FW63_STAA8/9-491-----------------------VFWVSL-------------------------VICT-----IF-------VA------
Q4FTS7_PSYA2/19-509-----------------------VFIGSA-------------------------VISI-----LL-------II------
Q6LRW5_PHOPR/30-506-----------------------..ALTI-------------------------GFIS-----LF-------LL------
Q814I8_BACCR/12-494-----------------------VFIISG-------------------------GSLL-----LF-------VI------
Q81K57_BACAN/7-498-----------------------TFIVSL-------------------------TLCI-----AF-------TL------
Q81YS8_BACAN/8-499-----------------------VFYISI-------------------------LLTT-----LF-------II------
Q87J97_VIBPA/48-525-----------------------VFWLSG-------------------------SFLS-----LF-------VL------
Q8DZH9_STRA5/9-487-----------------------VFTGSL-------------------------IVSL-----IL-------VL------
U5LC86_9BACI/7-489-----------------------VFYISV-------------------------LLLL-----VL-------VL------

PF13906

B4KYY5_DROMO/548-598--------------------------------------------------------------------------------
Q9LD96_ORYSJ/520-570--------------------------------------------------------------------------------
B4IZ20_DROGR/535-589--------------------------------------------------------------------------------
Q0DQ28_ORYSJ/515-565--------------------------------------------------------------------------------
Q16RD4_AEDAE/393-443--------------------------------------------------------------------------------
B9I635_POPTR/565-615--------------------------------------------------------------------------------
B4NQ70_DROWI/627-677--------------------------------------------------------------------------------
C3XPQ7_BRAFL/527-577--------------------------------------------------------------------------------
C5LVE9_PERM5/263-313--------------------------------------------------------------------------------
C5KQZ0_PERM5/326-376--------------------------------------------------------------------------------
O44798_CAEEL/507-557--------------------------------------------------------------------------------
A9TH89_PHYPA/537-587--------------------------------------------------------------------------------
B4HLB6_DROSE/535-585--------------------------------------------------------------------------------
CAAT3_ARATH/534-584--------------------------------------------------------------------------------
D2HFL8_AILME/627-677--------------------------------------------------------------------------------
B5DFJ0_RAT/540-590--------------------------------------------------------------------------------
B0WAU2_CULQU/428-473--------------------------------------------------------------------------------
O17069_CAEEL/508-558--------------------------------------------------------------------------------
Q337V1_ORYSJ/559-609--------------------------------------------------------------------------------
A4FEQ4_SACEN/56-106--------------------------------------------------------------------------------
B4LDP2_DROVI/508-558--------------------------------------------------------------------------------
D0NG02_PHYIT/81-131--------------------------------------------------------------------------------
B7QME9_IXOSC/429-479--------------------------------------------------------------------------------
B0WAU5_CULQU/549-599--------------------------------------------------------------------------------
C5X0K3_SORBI/540-590--------------------------------------------------------------------------------
CTR2_CHICK/555-605--------------------------------------------------------------------------------
CAAT4_ARATH/528-578--------------------------------------------------------------------------------
B9SAY1_RICCO/451-501--------------------------------------------------------------------------------
A4IG22_DANRE/575-625--------------------------------------------------------------------------------
B9IPU3_POPTR/568-618--------------------------------------------------------------------------------
C5WR23_SORBI/560-610--------------------------------------------------------------------------------
D7SLW7_VITVI/530-579--------------------------------------------------------------------------------
E9PWS4_MOUSE/604-654--------------------------------------------------------------------------------
F1MWA9_BOVIN/427-477--------------------------------------------------------------------------------
F6HLX0_VITVI/454-504--------------------------------------------------------------------------------
F6SWF3_XENTR/559-609--------------------------------------------------------------------------------
F6YB26_XENTR/150-200--------------------------------------------------------------------------------
F7E7U9_XENTR/599-649--------------------------------------------------------------------------------
G1MMB4_AILME/534-584--------------------------------------------------------------------------------
G1MNG0_AILME/556-606--------------------------------------------------------------------------------
H0V5U0_CAVPO/558-608--------------------------------------------------------------------------------
H3C2Q0_TETNG/530-580--------------------------------------------------------------------------------
H3CER8_TETNG/575-625--------------------------------------------------------------------------------
I1N8D3_SOYBN/561-611--------------------------------------------------------------------------------
K7V036_MAIZE/517-566--------------------------------------------------------------------------------
M0QVZ8_BOVIN/550-600--------------------------------------------------------------------------------
Q2FYJ4_STAA8/386-437--------------------------------------------------------------------------------

PF00860

YWDJ_BACSU/1-392--------------------MKLVLGALQ-------------------------WTAF-----II-------AA------
PYRP_BACSU/17-396--------------------FSWVSFSLQ-------------------------HLFA-----MF-------GS------
PUCJ_BACSU/6-391--------------------FKVFTLSLQ-------------------------HVLA-----MY-------AG------
O18061_CAEEL/19-439--------------------SAIFFFGLQ-------------------------QMLV-----CI-------SA------
UACT_ECOLI/28-412--------------------GKLIILGLQ-------------------------HVLV-----MY-------AG------
Q18771_CAEEL/30-454--------------------GIALLYGLQ-------------------------QVMV-----CV-------SA------
PBUX_BACSU/6-386--------------------GKTLSLGIQ-------------------------HVLA-----MY-------AG------
YBBY_ECOLI/8-396--------------------RESLLSGFQ-------------------------WFFF-----IF-------CN------
PBUO_BACSU/12-396--------------------KQEIIAGLT-------------------------TFFT-----MV-------YI------
RUTG_ECOLI/30-404--------------------AQTAVMGVQ-------------------------HAVA-----MF-------GA------
GHXP_ECOLI/26-410--------------------RQEVVAGLT-------------------------TFLA-----MV-------YS------
URAA_ECOLI/15-385--------------------LQTIPLSLQ-------------------------HLFA-----MF-------GA------
S23A3_MOUSE/80-476--------------------GGLSYPPAQ-------------------------LLAS-----SF-------FS------
O18057_CAEEL/15-435--------------------PSIMLFGLQ-------------------------QMMI-----CL-------SS------
URAA_HAEIN/16-385--------------------LKQSFVGLQ-------------------------MLFV-----AF-------GA------
PUCK_BACSU/8-388--------------------LQLMMLGLQ-------------------------HMLA-----MY-------AG------
Y125_HAEIN/18-399--------------------RQEIIAGLT-------------------------TFLA-----MV-------YS------
XANP_ECOLI/34-427--------------------.QTLFAACQ-------------------------HLLA-----MF-------VA------
XANQ_ECOLI/22-416--------------------HQALVGAIT-------------------------HLLA-----IF-------VP------
Q5L0U7_GEOKA/15-387--------------------GQWITLSLQ-------------------------HLFA-----MF-------GA------

PF00324

BAP2_YEAST/99-567---------------------HVVMMSLG-------------------------TGIG-----..-------TG------
GABP_BACSU/16-456---------------------HMTMISIA-------------------------GVIG-----..-------AG------
S12A9_HUMAN/42-536---------------------GVVVPTVL-------------------------SMFS-----..-------IV------
HUTM_BACSU/19-465---------------------HLFMISLG-------------------------GVIG-----..-------TG------
LYSP_ECOLI/21-480---------------------HLTMIAIG-------------------------GSIG-----..-------TG------
AGP3_YEAST/57-511---------------------HISLLALG-------------------------GVIG-----..-------PG------
S12A1_MOUSE/178-682---------------------GVLVRCML-------------------------NIWG-----..-------VM------
CYCA_ECOLI/27-470---------------------HIQLIAIG-------------------------GAIG-----..-------TG------
GABP_ECOLI/18-458---------------------HVTMLSIA-------------------------GVIG-----..-------AS------
ISP5_SCHPO/87-545---------------------HIQMIGIG-------------------------GAIG-----..-------TG------
TPO5_YEAST/59-532---------------------GSIVGLGL-------------------------GLMS-----PV-------LG------
PUT4_YEAST/114-588---------------------HVQLIALG-------------------------GAIG-----..-------TG------
AGP2_YEAST/92-565---------------------HVQLIAIS-------------------------GVIG-----..-------TA------
GAP1_YEAST/94-560---------------------HLQMIAIG-------------------------GAIG-----..-------TG------
Q9HKE0_THEAC/16-471---------------------DLVFQGLG-------------------------QITP-----..-------IT------
Q98QR4_MYCPU/13-498---------------------VALSMLLG-------------------------SVVG-----..-------IG------
Q9HJ13_THEAC/2-455---------------------HGIFQSMG-------------------------QVAP-----..-------AA------
ANSP_SALTY/34-477---------------------QVQMIAIG-------------------------GAIG-----..-------TG------
Q9VTW8_DROME/217-716---------------------GVLVRCLL-------------------------NIWG-----..-------VM------
Q97VA6_SULSO/25-513---------------------DALWFNIA-------------------------L...-----..-------LG------
ALP1_YEAST/74-540---------------------HIGMIALG-------------------------GTIG-----..-------TG------
AROP_ECOLI/19-457---------------------HIQLIALG-------------------------GAIG-----..-------TG------
F1MS08_BOVIN/282-784---------------------GVLVRCML-------------------------NIWG-----..-------VM------
G9NX48_HYPAI/69-534---------------------HLHMIAIG-------------------------GSIG-----..-------AG------
S12A3_MOUSE/139-644---------------------GVMIRCML-------------------------NIWG-----..-------VI------

PF02554

Q73V96_MYCPA/49-425--------------------VNAVWFVVA-------------------------AICS-----YL-------IG------
Q1IKI0_KORVE/33-409--------------------INAMWLVVA-------------------------ALCT-----YA-------VG------
W0PIG8_9BURK/37-414--------------------VNALWIVIA-------------------------AVCV-----YL-------IA------
Q8NSL6_CORGL/37-415--------------------INSVWLVLA-------------------------AVGS-----YI-------IA------
B3E5B6_GEOLS/1-379--------------------MNALTLVFV-------------------------ALCV-----FA-------LA------
D3SLN0_THEAH/33-404--------------------..AIWVVLA-------------------------ALSL-----YT-------LG------
Q1AYY2_RUBXD/34-410--------------------.NAGWLLFA-------------------------AIAS-----YA-------IA------
C5B2E8_METEA/32-408--------------------INALWVVVA-------------------------AVCV-----YL-------IA------
R5ZHV1_9ACTN/1-390--------------------MNGVLLMVV-------------------------AAAV-----LA-------CG------
D4YZ07_SPHJU/29-402--------------------VNALWIVVA-------------------------AVSS-----FL-------VA------
G8RRI7_MYCRN/67-445--------------------INAVWFVIA-------------------------AICT-----YV-------IG------
B5HN22_9ACTO/35-411--------------------.SAAWMVAA-------------------------ALGS-----YA-------IG------
Q5YQA1_NOCFA/54-432--------------------VNAVWIVIA-------------------------AVCT-----YV-------IA------
F8GFU4_NITSI/34-409--------------------..AIWIVIA-------------------------AVCV-----YI-------IA------
I6YY40_MELRP/1-360--------------------MSGIILVVF-------------------------AIIL-----FI-------SA------
Q213E9_RHOPB/39-416--------------------INASWLVIA-------------------------AVCV-----YF-------IA------
B1ZS08_OPITP/41-415--------------------VNALWMVVA-------------------------SVCV-----FA-------IA------
Q9HVI3_PSEAE/35-412--------------------INALWIVVA-------------------------AVAI-----YL-------VA------
Q5L2D3_GEOKA/32-409--------------------VNAMWLIVA-------------------------AVCT-----YA-------VA------
Q9KBY1_BACHD/3-388--------------------..GVLLAAL-------------------------GMLV-----FA-------LG------
I4WZC7_9GAMM/39-416--------------------INAIWLVAA-------------------------SIAI-----FV-------IG------
F8JAH8_HYPSM/32-409--------------------INAIWLVMA-------------------------AICS-----YL-------LA------
Q8RBF1_THETN/1-380--------------------MNGLTLVII-------------------------TLSV-----YA-------LA------
R6ZB35_9ACTN/1-384--------------------MNGMVVVVV-------------------------AAVV-----LA-------AG------
D2SAU5_GEOOG/54-430--------------------.SALWILFA-------------------------ALSS-----YA-------IA------
W5Y2A8_9CORY/68-445--------------------INAMWLVLA-------------------------AIGS-----YI-------IA------
F4H7H1_CELFA/61-439--------------------VNAVWFVFA-------------------------AVCT-----YV-------IG------
I4BUN1_ANAMD/1-359--------------------MSGVMLMLV-------------------------TFVL-----FI-------LA------
A8FG20_BACP2/1-378--------------------MNAVTIVIA-------------------------SMCI-----LA-------IA------
L0B638_9PROT/36-414--------------------INALWILVA-------------------------SICV-----YL-------IA------
F0S490_DESTD/4-376--------------------....FLFLL-------------------------SISI-----FI-------IA------
Q7P007_CHRVO/32-409--------------------INAVWLVVA-------------------------ALSV-----YA-------IA------
R5ZC92_9FIRM/1-380--------------------MNGLLLLGI-------------------------AAVL-----FI-------CA------
B8DLB6_DESVM/1-381--------------------MNALTLVFA-------------------------ALCV-----FA-------IA------
D6Z9X1_SEGRD/53-430--------------------VNAVWFVLA-------------------------AIAS-----YL-------VA------
D7B6A0_NOCDD/50-427--------------------.SAAWLVFA-------------------------ALAS-----YA-------IG------
Q2JA57_FRASC/58-431--------------------.SAAWILLA-------------------------GLGS-----FA-------IA------
R6FJL5_9FIRM/1-374--------------------MNGILMMVI-------------------------AIVV-----LG-------GA------
C6WTH2_METML/32-409--------------------INALWLITA-------------------------AVCI-----YA-------IA------
I4CCQ1_DESTA/1-369--------------------MNSMVVLIV-------------------------GFVV-----AV-------IG------
A8ESS3_ARCB4/29-406--------------------.SAMYLVVA-------------------------AVCI-----YM-------IG------
C7MT52_SACVD/47-424--------------------VNAIWFIFA-------------------------ALCS-----YA-------IA------
D7WD84_9CORY/71-449--------------------INSVWLVLA-------------------------AIGT-----YI-------IG------
W0L393_SERFO/32-409--------------------VNALWLVVA-------------------------AVSC-----YS-------IA------
Q1LHD0_RALME/33-409--------------------.SALWIVVA-------------------------ALCI-----YL-------IA------
G8ASJ6_AZOBR/32-409--------------------INALWLVVA-------------------------AVCT-----YL-------VS------
E1QXU3_OLSUV/1-389--------------------MNGLAVIVV-------------------------AAVV-----LV-------IG------
A7MKY8_CROS8/32-414--------------------INALWIVVA-------------------------AVCI-----YL-------IA------
C7RPJ8_ACCPU/32-409--------------------INALWIVTA-------------------------AVSI-----YL-------VA------
B2GG33_KOCRD/69-446--------------------INAIWFVFA-------------------------AVCS-----YF-------IA------
Q1QW04_CHRSD/1-387--------------------MNAIWIALF-------------------------GAVC-----FV-------MG------
A0LP60_SYNFM/1-400--------------------MNAAVLMVV-------------------------AFVL-----FF-------IA------
Q604D8_METCA/34-407--------------------VNSLWFVTA-------------------------AVCV-----YA-------LG------
B9M2N4_GEODF/1-381--------------------MNALTLIFT-------------------------SLCV-----FA-------IG------

PF01566

Q21433_CAEEL/63-449---------------------IESDLQAG-------------------------AQAE-----YK-------LL------
NRAM2_ORYSJ/90-453---------------------LEGDLQAG-------------------------AAAG-----YQ-------LL------
NRAM2_DICDI/170-526---------------------WATDLEGG-------------------------SRFG-----YQ-------LM------
A5FYD3_ACICJ/37-386---------------------IITASQSG-------------------------VAWG-----YR-------LL------
Q6AKY6_DESPS/42-387---------------------LASVAIAG-------------------------ATYG-----YK-------ML------
Q882X3_PSESM/25-384---------------------WATAIEAG-------------------------SRFG-----YS-------LL------
A4XLU3_CALS8/27-379---------------------WASNVAAG-------------------------SQFG-----LK-------LL------
B2JMU6_BURP8/43-408---------------------IATYTQAG-------------------------AQFG-----FG-------LL------
Q8AA36_BACTN/43-395---------------------WASNFAAG-------------------------SEFG-----YS-------LL------
Q8ESA4_OCEIH/39-387---------------------VTTSTQAG-------------------------ASFG-----YA-------LI------
Q3AF37_CARHZ/37-388---------------------IATYAAVG-------------------------ALYG-----YR-------ML------
Q7NSE8_CHRVO/64-420---------------------FSTYAQAG-------------------------QNYG-----TS-------LL------
A6LBT1_PARD8/40-392---------------------WATNLAAG-------------------------SEFG-----YA-------LL------
Q8I3M7_PLAF7/268-619---------------------LEKDYS..-------------------------...G-----YY-------LL------
A4S7A4_OSTLU/17-379---------------------FESDLQAG-------------------------TLFG-----YK-------LL------
B2UC67_RALPJ/70-426---------------------FGTYTQAG-------------------------QNYG-----TT-------LL------
Q5V6I3_HALMA/26-374---------------------VTTASVTG-------------------------AEFG-----YA-------LL------
Q1AYA4_RUBXD/47-394---------------------FAADMEGG-------------------------ARYG-----YL-------LL------
NRAM5_ARATH/90-453---------------------IEGDLQAG-------------------------AVAG-----YS-------LL------
Q21Z51_ALBFT/33-398---------------------IATYSQAG-------------------------AQFG-----FS-------ML------
Q1J0H3_DEIGD/66-414---------------------FATNIEGG-------------------------AQFG-----YT-------LL------
Q2GAH9_NOVAD/42-407---------------------IGTYSQVG-------------------------AQFG-----YT-------LS------
Q24C68_TETTS/50-400---------------------LAGDMDAG-------------------------LNGK-----YH-------LL------
Q01SI9_SOLUE/31-396---------------------IATYSVSG-------------------------AGFG-----YS-------PL------
Q4JWM2_CORJK/25-368---------------------VAANISAG-------------------------SHYG-----YL-------LV------
Q0S6I8_RHOSR/42-391---------------------VAANLTAG-------------------------AKYG-----YL-------LV------
Q01UU9_SOLUE/52-406---------------------WATDLEGG-------------------------ARFG-----YK-------LL------
MNTH_GRABC/58-408---------------------FATNIQAG-------------------------SRYG-----YT-------LL------
A5FLF3_FLAJ1/44-400---------------------WATDIAGG-------------------------SQFG-----YT-------LV------
A0LSF9_ACIC1/91-445---------------------VATYAQAG-------------------------QDYG-----YS-------LL------
F2G2M1_ALTMD/20-372---------------------VTTASLAG-------------------------ANFG-----FH-------LV------
A0LFY7_SYNFM/33-383---------------------FATNIQSG-------------------------ARFG-----YA-------LL------
A2TXR3_9FLAO/37-396---------------------VTSMIVAG-------------------------SKFN-----MQ-------LL------
MNTH_CHRSD/52-403---------------------FATNIEAG-------------------------SRYG-----YT-------LL------
A6M0Q0_CLOB8/54-403---------------------FATNISGG-------------------------SEFG-----YA-------LI------
Q2L2L8_BORA1/38-396---------------------WATDIAGG-------------------------AGFG-----YG-------LL------
Q0W8Z5_UNCMA/41-392---------------------ITTYTLAG-------------------------AHFG-----YS-------LL------
NRAM1_DICDI/94-450---------------------LESDIQAG-------------------------AMAG-----YQ-------LL------
Q15PP3_PSEA6/27-386---------------------VTAMIVAG-------------------------STFG-----MQ-------LL------
Q3IH27_PSEHT/19-373---------------------ITTASVAG-------------------------ANFG-----FA-------LI------
Q89BW0_BRADU/52-418---------------------IGTYSQAG-------------------------AQLG-----FG-------IG------
B5E9R2_GEOBB/31-382---------------------ITTYSVAG-------------------------AQFG-----YS-------LL------
B4SC14_PELPB/34-385---------------------WATNIEGG-------------------------SKFG-----YE-------LL------
A6W550_KINRD/43-391---------------------VAANLTAG-------------------------AGYG-----YL-------LL------
B0ULW7_METS4/44-412---------------------IATYAQAG-------------------------AAYG-----YG-------FG------
MNTH_THETN/43-392---------------------FATNISGG-------------------------SLFD-----YH-------LI------
Q97LD4_CLOAB/40-392---------------------WASNVSAG-------------------------SDYG-----YS-------LL------
Q31GI7_THICR/35-390---------------------WATSIEAG-------------------------SRYG-----YD-------LL------
Q18IT5_HALWD/34-375---------------------MASLLSGG-------------------------ANFG-----YA-------LL------
A9C0V2_DELAS/70-429---------------------WATSIAGG-------------------------SQFG-----YS-------LL------
Q97DZ1_CLOAB/30-381---------------------IATYATVG-------------------------ASYG-----YK-------ML------
A4CKX6_ROBBH/21-369---------------------VTTCLRAG-------------------------VEMG-----YA-------LL------
MNTH_ACICJ/51-400---------------------FATNIQAG-------------------------ARYG-----YD-------LL------
Q5WIT7_BACSK/38-386---------------------VTTATRAG-------------------------ASFG-----FA-------LL------
A2SEC8_METPP/40-393---------------------WATDLEGG-------------------------ARFG-----YQ-------LL------
Q5V5I1_HALMA/54-394---------------------IASLVTAG-------------------------GAFG-----YS-------LL------
A5G362_GEOUR/45-396---------------------ITTYSLAG-------------------------ARYG-----YG-------LL------
Q7P0J1_CHRVO/53-410---------------------WATDIEAG-------------------------SRFG-----YQ-------LL------
B1YM03_EXIS2/34-380---------------------FAMNMTAG-------------------------AQYG-----FL-------LL------
Q1IV65_KORVE/40-399---------------------WATDLAAG-------------------------SQFN-----YA-------LL------
Q74JG3_LACJO/54-437---------------------WAASINGG-------------------------QSFN-----YL-------LI------
Q0SCQ4_RHOSR/43-390---------------------LASAVQAG-------------------------SEYS-----YS-------LI------
Q5FP93_GLUOX/65-424---------------------WATDLQGG-------------------------SRYG-----YT-------LL------
Q3ABN3_CARHZ/35-384---------------------WAANFAGG-------------------------SRYG-----SI-------ML------
Q6A673_PROAC/25-375---------------------VAANLAAG-------------------------AGYG-----YL-------LV------
Q8LKG7_CHLRE/112-473---------------------WATDLAAG-------------------------SSFG-----YT-------LL------
A4FCR3_SACEN/23-373---------------------LTSAVQAG-------------------------SRFG-----YS-------LI------
A4XIU1_CALS8/36-387---------------------IATYAMVG-------------------------AMFG-----YK-------ML------
Q3IQM6_NATPD/26-374---------------------VTTASVIG-------------------------AEYA-----YL-------LV------
Q2LVH8_SYNAS/49-400---------------------ITTYSLAG-------------------------AEYG-----LS-------LL------
MNTH_NOSS1/49-408---------------------WATDIAGG-------------------------SKFG-----YT-------LL------
B8I817_CLOCE/56-405---------------------FATNISGG-------------------------SKFN-----YN-------LV------
Q5QVV5_IDILO/23-379---------------------VVTASLAG-------------------------ANFG-----YA-------LL------
A6LYR0_CLOB8/35-386---------------------ITTYASVG-------------------------ASYG-----YK-------ML------
A1A393_BIFAA/49-397---------------------VAANITSG-------------------------ARYG-----YL-------LV------
A4YWA6_BRASO/74-430---------------------WATSLAGG-------------------------SKFG-----YV-------LL------
A4YYM6_BRASO/41-406---------------------IATYSQAG-------------------------AQFG-----YG-------LL------
B4EFC9_BURCJ/73-427---------------------.GTYTQAG-------------------------QNYG-----TT-------LL------
C3AU46_BACMY/55-403---------------------FATNIAAG-------------------------SQYG-----YL-------LL------
C5B0F9_METEA/57-413---------------------WATDIAGG-------------------------AQFG-----YT-------LL------
C6XTY0_PEDHD/53-406---------------------WATDLAGG-------------------------SKFG-----YQ-------LI------
F6HR32_VITVI/38-391---------------------WAAVVEGG-------------------------ARFG-----FD-------LV------
K4CQH6_SOLLC/39-392---------------------WAAMVDGG-------------------------ARFG-----FD-------LV------
MNTH_ECOLI/38-384---------------------FATNIQAG-------------------------ASFG-----YQ-------LL------
MNTH_MYCTU/52-400---------------------VAANVSSG-------------------------AQFG-----YL-------LL------
NRAM1_ORYSJ/56-417---------------------.ETDLQAG-------------------------ANHK-----YE-------LL------
Q2YM61_BRUA2/67-424---------------------WATSLAGG-------------------------SRFG-----YA-------LL------
Q63LP7_BURPS/56-403---------------------FATNIQAG-------------------------AAYG-----YE-------LL------
Q8RBX2_THETN/42-393---------------------WASNVAAG-------------------------SSYG-----YK-------LL------
MNTH_RALSO/56-415---------------------WATDIEAG-------------------------SRYG-----YS-------LL------
MNTH_LISMO/61-418---------------------WATSIAGG-------------------------SEFG-----YT-------LL------
R6A200_9ACTN/11-363---------------------WASNMAAG-------------------------SQFG-----YA-------LL------
R7G054_9FIRM/36-390---------------------WASNIAAG-------------------------SGFG-----YE-------LL------
U5LI50_9BACI/48-387---------------------......IG-------------------------AIYG-----MQ-------LI------

PF16983

H1XTW9_9BACT/228-347---------------------ALIFLIIP-------------------------QLPL-----TL-------GN------
R1D8E1_EMIHU/206-332---------------------ALVRAALP-------------------------QLPV-----TL-------LN------
D0NZ41_PHYIT/248-371---------------------AFVYLALP-------------------------QLPL-----TL-------LN------
E9CCE9_CAPO3/225-344---------------------GFTSMALP-------------------------QIPL-----TT-------LN------
L1IN17_GUITH/365-490---------------------GILEGAIP-------------------------QVPT-----TL-------LN------
Q1K6N8_NEUCR/339-455---------------------SSLSSAPP-------------------------QTPS-----AE-------TP------
B7G755_PHATC/291-424---------------------GFWQGALP-------------------------QLPL-----TT-------LN------
B8LD85_THAPS/362-493---------------------GFLQGTLP-------------------------QLPL-----TT-------LN------
C5KXR7_PERM5/251-372---------------------GILNGGLP-------------------------QLPL-----TL-------LN------
F4P234_BATDJ/206-328---------------------GILKAGIG-------------------------QLPL-----TL-------LN------
B2VWE0_PYRTR/184-310---------------------ATTTASLG-------------------------QLPL-----TL-------LN------
G1X8D7_ARTOA/231-351---------------------GFWFAGLG-------------------------QLPL-----TI-------LN------
F9X8H4_MYCGM/221-342---------------------GVLDAAIP-------------------------QLPL-----TT-------LN------
M2LEF6_BAUCO/225-346---------------------GAIDAAIP-------------------------QLPL-----TT-------LN------
N1PTW8_MYCP1/227-348---------------------GAIDAAIP-------------------------QLPL-----TT-------LN------
D5GPI6_TUBMM/223-344---------------------GFGTAGVG-------------------------QIAL-----TI-------LN------
F0XEP8_GROCL/230-351---------------------EAWGMAVA-------------------------QLPL-----TM-------LN------
G4N1B8_MAGO7/224-344---------------------VAISMAVA-------------------------QLPL-----TT-------LN------
J3P3C4_GAGT3/224-344---------------------PAWSMAAG-------------------------QLPL-----TT-------LN------
M7SFI7_EUTLA/228-348---------------------DAIGMGIA-------------------------QLPL-----TT-------LN------
C9SGN6_VERA1/226-346---------------------EAMAMALG-------------------------QLPL-----TT-------LN------
G3JR94_CORMM/229-349---------------------SPIYMAIG-------------------------QLPL-----TT-------LN------
L2GB72_COLGN/231-351---------------------KPITMAIG-------------------------QLPL-----TT-------LN------
M1W0F8_CLAP2/229-349---------------------PALWMAIG-------------------------QLPL-----TT-------LN------
C7YTB3_NECH7/228-348---------------------PALWMAIG-------------------------QLPL-----TT-------LN------
K2RWJ8_MACPH/225-345---------------------TFVTASLG-------------------------QLPL-----TT-------LN------
A7EI36_SCLS1/226-346---------------------GALDAGLG-------------------------QIPL-----TT-------LN------
L8FSY4_PSED2/223-343---------------------GAIDAGLG-------------------------QLPL-----TT-------LN------
C4JWX0_UNCRE/221-341---------------------GIMEAGIG-------------------------QIPL-----TT-------LN------
C5G018_ARTOC/223-343---------------------GILDAGVG-------------------------QVPL-----TT-------LN------
Q5B485_EMENI/264-384---------------------GAVDAGLG-------------------------QLPL-----TT-------LN------
C1GWZ1_PARBA/233-353---------------------GIIDAGIG-------------------------QLPL-----TT-------LN------
A1CFF9_ASPCL/224-344---------------------GALDAGIG-------------------------QIPL-----TT-------LN------
G3XPK6_ASPNA/221-344---------------------GILDAGIG-------------------------QIPL-----TT-------LN------
A2WT67_ORYSI/265-385---------------------GFWEGAVP-------------------------QLPL-----SV-------LN------
D7KX71_ARALL/272-390---------------------GFVRAAIP-------------------------QIPL-----SV-------LN------
A2YQB0_ORYSI/268-387---------------------GFIKGALP-------------------------QIPL-----SV-------LN------
A7X2T1_POPCN/223-342---------------------GFVKGTIP-------------------------QLPL-----SV-------LN------
D8S3I3_SELML/264-385---------------------GFVRGAIP-------------------------QLPL-----TI-------LN------
A9TVM2_PHYPA/255-374---------------------GFMRAAIP-------------------------QLPL-----SI-------LN------
A9RP81_PHYPA/282-400---------------------GFVRGTIP-------------------------QLPL-----SV-------LN------
I1C5D7_RHIO9/194-313---------------------GFLNAGLG-------------------------QLPL-----TA-------LN------
C1EA77_MICSR/255-375---------------------GVLRAGLP-------------------------QLPL-----TT-------LN------
E1ZN91_CHLVA/385-504---------------------GILQAGLP-------------------------QLAL-----TG-------LN------
I0YTY0_9CHLO/213-332---------------------GIVKAGLA-------------------------QLPL-----TT-------LN------
A4S3I2_OSTLU/293-412---------------------GIVNAGVP-------------------------QLPL-----TT-------LN------
K8EA24_9CHLO/301-420---------------------GIVRAGIP-------------------------QLPL-----TM-------LN------
A1HMS1_9FIRM/215-336---------------------AFWLLVLP-------------------------QIPL-----SL-------GN------
B0SEN7_LEPBA/208-328---------------------GFVLLSLP-------------------------QIPL-----SI-------GN------
N1W836_9LEPT/208-328---------------------GFVLLAIP-------------------------QIPL-----SL-------GN------
A4G1K6_HERAR/222-341---------------------GAVLLALP-------------------------QIPL-----TL-------GN------
A0LEX0_SYNFM/228-347---------------------GTLLFTIP-------------------------QIPL-----TL-------GN------
A5D5U5_PELTS/185-304---------------------GTLILGIP-------------------------QVPL-----TL-------GN------
A1AQI2_PELPD/205-325---------------------GTLGVGLP-------------------------QLSL-----TL-------VN------
C8WZ82_DESRD/229-350---------------------ALLALVLP-------------------------QLPM-----TL-------GN------
F0JE74_DESDE/227-348---------------------ALVALVAP-------------------------QIPM-----TM-------GN------
C6BZQ7_DESAD/227-348---------------------ALLALVLP-------------------------QIPM-----TL-------GN------
C0Q8U9_DESAH/229-350---------------------VLIALVLP-------------------------QLPM-----TI-------GN------
D6SS96_9DELT/229-350---------------------ALLVLVLP-------------------------QLPM-----TL-------GN------
A3QA82_SHELP/206-331---------------------AALLLVLP-------------------------QLAL-----TL-------TN------
A0L1J1_SHESA/213-334---------------------AAILLVLP-------------------------QLAL-----TL-------TN------
A8GZZ5_SHEPA/206-328---------------------AAGLLVLP-------------------------QLAL-----TL-------TN------
A1SAH7_SHEAM/199-320---------------------AATLLVLP-------------------------QLAL-----TL-------TN------
A8G0P2_SHESH/218-339---------------------AAVLLVLP-------------------------QLAL-----TL-------TN------
A6EYX6_9ALTE/202-321---------------------AMSMLVFP-------------------------QLAL-----TI-------TN------
C9D2W7_9RHOB/203-324---------------------AVTDMALP-------------------------QLAL-----TL-------TN------
B8GHN7_METPE/204-320---------------------AAGSMVVP-------------------------QMIQ-----TL-------TN------
M0NEN9_9EURY/134-249---------------------STLDGIVA-------------------------QLAV-----TL-------GN------
D8J5J0_HALJB/205-320---------------------GVVDGIVA-------------------------QFAM-----TI-------GN------
M0DC06_9EURY/172-287---------------------ATFDGVAA-------------------------QLAM-----TI-------GN------
M0C8X0_9EURY/203-317---------------------GAVEGAIG-------------------------QLAM-----TV-------GN------
G0HUQ5_HALHT/204-318---------------------QTAEAVLA-------------------------QIAV-----TV-------GN------
D4GWH9_HALVD/206-320---------------------AVVEAAVA-------------------------QLAM-----TV-------GN------
D2RYU1_HALTV/205-320---------------------AALEGTVA-------------------------QLGM-----TV-------GN------
E4NMR6_HALBP/205-319---------------------SALEGTAA-------------------------QLAM-----TV-------GN------
E7QRP7_9EURY/202-316---------------------TTLSATLG-------------------------QLAM-----TV-------GN------
M1XQX9_NATM8/204-317---------------------GAAEGVLA-------------------------QLAM-----TV-------GN------
J2ZYZ3_9EURY/205-318---------------------GAAEASLG-------------------------QLAM-----TV-------GN------
Q0W422_UNCMA/202-317---------------------GAYKAGIA-------------------------QLPL-----TL-------TN------
Q2FLF7_METHJ/209-325---------------------ATIHFVPP-------------------------QLPL-----TL-------TN------
G7WKS6_METH6/187-303---------------------AGWHLVLP-------------------------QIPL-----TL-------TN------
A7IAA3_METB6/206-322---------------------ALSTLVLP-------------------------QIVL-----TI-------AN------
H1YXZ5_9EURY/205-321---------------------SSWNLVIP-------------------------QIPL-----TL-------TN------
A3CWQ9_METMJ/210-327---------------------GTWDLALP-------------------------QIPL-----TL-------TN------
J1L1I3_9EURY/213-329---------------------AGLYLVPP-------------------------QFPL-----TL-------TN------
B0SEN7_LEPBA/12-120---------------------NEIAGAFG-------------------------DIG.-----TD-------FP------
N1W836_9LEPT/12-120---------------------REFAGAFG-------------------------DIG.-----TD-------LP------
H1XTW9_9BACT/25-133---------------------SEFSGSVG-------------------------DLG.-----TL-------LP------
D4GWH9_HALVD/18-126---------------------HEFTGAVG-------------------------DSV.-----TV-------LP------
G0HUQ5_HALHT/16-124---------------------NELTGAVG-------------------------DSA.-----TV-------LP------
M0C8X0_9EURY/15-123---------------------NEVTGAIG-------------------------DSV.-----TV-------LP------
M1XQX9_NATM8/18-126---------------------GEATGAIG-------------------------DSI.-----TV-------LP------
Q3INK2_NATPD/26-134---------------------GEVTGAIG-------------------------DSV.-----TV-------LP------
D8J5J0_HALJB/18-126---------------------DEVTGAVG-------------------------DSL.-----TV-------LP------
M0E3F5_9EURY/17-125---------------------GALTGAIG-------------------------DSI.-----TV-------IP------
D2RYU1_HALTV/18-126---------------------GELTGALG-------------------------DSV.-----TV-------LP------
J2ZYZ3_9EURY/18-126---------------------GELTGALG-------------------------DSV.-----TV-------LP------
E7QRP7_9EURY/17-125---------------------SDVTGAVG-------------------------DSI.-----TV-------LP------
E4NMR6_HALBP/18-126---------------------GAFTGAIG-------------------------DSV.-----TV-------LP------
R1D8E1_EMIHU/5-115---------------------GEVSGALG-------------------------DLG.-----TF-------LP------
F4P234_BATDJ/2-110---------------------AEISGSFG-------------------------DMA.-----TL-------LP------
F0Y3U5_AURAN/2-110---------------------QECSGMLG-------------------------DLG.-----TL-------LP------
B7G755_PHATC/68-176---------------------AEVSGSCG-------------------------DLG.-----TF-------IP------
B8LD85_THAPS/40-155---------------------TEISGSLG-------------------------DLG.-----TF-------IP------
C5KXR7_PERM5/27-135---------------------AEFSGSLG-------------------------DLG.-----TF-------IP------
D0NZ41_PHYIT/57-170---------------------QELSGAFG-------------------------DIG.-----LF-------LP------
K3WVQ2_PYTUL/71-184---------------------QEVSGAFG-------------------------DIG.-----LF-------LP------
E9CCE9_CAPO3/29-137---------------------GEYSGAFG-------------------------DVG.-----TF-------IP------
A2YQB0_ORYSI/40-149---------------------GEVNGAMG-------------------------DLG.-----TY-------IP------
B9H9E8_POPTR/42-152---------------------AELNGAMG-------------------------DLG.-----TY-------IP------
M0SI65_MUSAM/80-189---------------------AEVNGALG-------------------------DLG.-----TY-------IP------
F6HSS9_VITVI/69-178---------------------VELGGFVG-------------------------NLG.-----TY-------IP------
B9RUY1_RICCO/33-143---------------------SELSGAVG-------------------------DLG.-----TF-------IP------
A2WT67_ORYSI/34-143---------------------SELGGAVG-------------------------DLG.-----TY-------IP------
M5WS88_PRUPE/34-144---------------------AELSGAVG-------------------------DLG.-----TY-------IP------
D8S3I3_SELML/19-130---------------------QEASGALG-------------------------DLG.-----TF-------VP------
A9RP81_PHYPA/35-145---------------------EEVNGCLG-------------------------DLG.-----TF-------VP------
A9TVM2_PHYPA/8-118---------------------EELGGSVG-------------------------DLG.-----TF-------VP------
I0YTY0_9CHLO/1-110---------------------TEISGAFG-------------------------DIG.-----TF-------VP------
MOT1_CHLRE/24-135---------------------SEVSGSLG-------------------------DLG.-----TF-------LP------
D8TXM6_VOLCA/16-120---------------------AEVSGSLG-------------------------DLG.-----TF-------LP------
K8EA24_9CHLO/79-188---------------------REANGSLG-------------------------DLG.-----TF-------LP------
E1ZN91_CHLVA/25-142---------------------AEASGAMG-------------------------DLG.-----TL-------LP------
A4S3I2_OSTLU/65-174---------------------REASGALG-------------------------DLG.-----TF-------LP------
C1EA77_MICSR/19-128---------------------REAGGSLG-------------------------DLG.-----TF-------IP------
I1C5D7_RHIO9/3-96---------------------KSISGSLG-------------------------DLG.-----TL-------LP------
G0SDL2_CHATD/45-153---------------------GEISGALG-------------------------DLG.-----TL-------LP------
G1X8D7_ARTOA/35-143---------------------GEVAGSLG-------------------------DLG.-----TL-------LP------
D5GPI6_TUBMM/21-129---------------------GEIAGSLG-------------------------DLG.-----TL-------LP------
F7W0P3_SORMK/32-144---------------------SEISGSLG-------------------------DLG.-----TL-------LP------
E3RMZ4_PYRTT/28-136---------------------AELSGSLG-------------------------DLG.-----TL-------LP------
K2RWJ8_MACPH/24-132---------------------SELSGSLG-------------------------DLG.-----TL-------LP------
H6C2T1_EXODN/22-130---------------------AEISGSLG-------------------------DLG.-----TF-------LP------
A1CFF9_ASPCL/23-131---------------------SEISGCLG-------------------------DLG.-----TF-------LP------
C5G018_ARTOC/20-128---------------------AEISGAVG-------------------------DLG.-----TF-------LP------
A6RGU3_AJECN/28-136---------------------AELSGALG-------------------------DLG.-----TF-------LP------
C4JWX0_UNCRE/19-127---------------------AEISGALG-------------------------DLG.-----TF-------LP------
M7SFI7_EUTLA/25-133---------------------AEVSGAFG-------------------------DLG.-----TL-------LP------
J3P3C4_GAGT3/23-131---------------------AEVSGALG-------------------------DLG.-----TL-------LP------
F0XEP8_GROCL/22-130---------------------AEISGALG-------------------------DLG.-----TL-------LP------
G4N1B8_MAGO7/23-131---------------------SEISGALG-------------------------DLG.-----TL-------LP------
G2QB28_THIHA/26-134---------------------AEISGALG-------------------------DLG.-----TL-------LP------
C9SGN6_VERA1/27-136---------------------AEISGALG-------------------------DLG.-----TL-------LP------
E3QBP2_COLGM/24-134---------------------AEISGALG-------------------------DLG.-----TL-------LP------
G3JR94_CORMM/25-135---------------------AEISGSLG-------------------------DLG.-----TL-------LP------
G0RSK5_HYPJQ/26-136---------------------AEISGSLG-------------------------DLG.-----TL-------LP------
C7YTB3_NECH7/26-134---------------------AEISGSLG-------------------------DLG.-----TL-------LP------
A7EI36_SCLS1/26-134---------------------AEISGAFG-------------------------DLG.-----TL-------LP------
M2LEF6_BAUCO/24-132---------------------TELSGAMG-------------------------DLG.-----TL-------LP------
F9X8H4_MYCGM/24-132---------------------AELSGALG-------------------------DLG.-----TL-------LP------
M3AZE9_MYCFI/24-132---------------------AELSGALG-------------------------DLG.-----TL-------LP------
Q0W422_UNCMA/9-117---------------------PEFTGSLA-------------------------DLG.-----TI-------IP------
Q2FLF7_METHJ/16-124---------------------SELAGSAG-------------------------NFG.-----TV-------LP------
B8GHN7_METPE/12-120---------------------SEISGSLG-------------------------DFG.-----TI-------LP------
A7IAA3_METB6/14-122---------------------SEFAGSLG-------------------------DFG.-----TI-------IP------
H1YXZ5_9EURY/13-121---------------------NEAAGSVG-------------------------DFG.-----TI-------LP------
A3CWQ9_METMJ/17-126---------------------EEIAGAVG-------------------------DFG.-----TI-------FP------
J1L1I3_9EURY/21-129---------------------GEAAGSVG-------------------------DFG.-----TI-------LP------
A4G1K6_HERAR/22-135---------------------MEWAGAFG-------------------------DLG.-----TL-------IP------
A0LEX0_SYNFM/33-141---------------------MEWAGAFG-------------------------DVG.-----TL-------IP------
C4XRG0_DESMR/37-145---------------------MEWAGAFG-------------------------DIG.-----TL-------IP------
A0L1J1_SHESA/20-128---------------------GETSGAFA-------------------------DLG.-----TF-------LP------
A1AQI2_PELPD/14-122---------------------HELSGALG-------------------------DLG.-----TF-------LP------
A3Z2Y8_9SYNE/17-125---------------------HELSGALG-------------------------DIG.-----TL-------LP------
C9D2W7_9RHOB/16-124---------------------REANGALG-------------------------DIG.-----TL-------LP------
F0JE74_DESDE/8-116---------------------MEWAGSMG-------------------------DLG.-----TL-------LP------
C6BZQ7_DESAD/8-116---------------------MEWAGAVG-------------------------DLG.-----AL-------LP------
L0RIV6_9DELT/8-116---------------------MEWAGSVG-------------------------DLG.-----AL-------LP------
C8WZ82_DESRD/10-118---------------------MEVAGSLG-------------------------DLG.-----TL-------LP------
D6SS96_9DELT/10-118---------------------QELAGSLG-------------------------DLG.-----VV-------LP------
C0Q8U9_DESAH/10-118---------------------MELAGSFG-------------------------DLG.-----TI-------LP------
A1HMS1_9FIRM/6-114---------------------FELAGSLA-------------------------DIG.-----VL-------LP------
C7NK89_KYTSD/30-138---------------------RELAGAVA-------------------------DLG.-----VL-------VP------

PF01490

AAP5_ARATH/28-468--------------------RTGTVWTAS-------------------------AHII-----TA-------VI------
LHT1_ARATH/34-433--------------------RNAKWWYSA-------------------------FHNV-----TA-------MV------
AAP1_ARATH/37-472--------------------RTGTWLTAS-------------------------AHII-----TA-------VI------
AVT5_YEAST/1-446--------------------MPSNVRSGV-------------------------LTLL-----HT-------AC------
O62286_CAEEL/61-471--------------------TGISATSGL-------------------------INFI-----CG-------MI------
AVT6_YEAST/1-439--------------------MVASIRSGV-------------------------LTLL-----HT-------AC------
AVT1_YEAST/206-601--------------------GQSTAPQTI-------------------------FNSI-----NV-------LI------
MTR_NEUCR/51-449--------------------HRLGWKRLT-------------------------VVLI-----VE-------AI------
AVT2_YEAST/65-467--------------------KKSSMRMAF-------------------------MNLA-----NS-------IL------
VIAAT_RAT/114-513--------------------PKITAWEAG-------------------------WNVT-----NA-------IQ------
PROT1_ARATH/32-428--------------------SSDSWFQVA-------------------------FVLT-----TG-------IN------
AVT3_SCHPO/273-656--------------------GNASNGKAV-------------------------LLLL-----KS-------FV------
AUX1_ARATH/44-438--------------------HGGSVWDAW-------------------------FSCA-----SN-------QV------
UNC47_CAEEL/87-475--------------------EPISALQAA-------------------------WNVT-----NA-------IQ------
AAP6_ARATH/33-470--------------------RTGTWMTGS-------------------------AHII-----TA-------VI------
AAP2_ARATH/46-481--------------------RTGTVWTAS-------------------------AHII-----TA-------VI------
AVT4_YEAST/295-711--------------------GTTSTKKVF-------------------------LILL-----KS-------FI------
AVT7_YEAST/3-477--------------------ATSSALSST-------------------------ANLV-----KT-------IV------
Q21652_CAEEL/22-416--------------------KGIGWIIGA-------------------------IFII-----GE-------TA------
S38A3_HUMAN/64-491--------------------GKTSFGMSV-------------------------FNLS-----NA-------IM------
YMJ2_CAEEL/35-446--------------------DVITPTRAV-------------------------LTLS-----KS-------MF------
AVT3_YEAST/295-688--------------------HKSSTVKAV-------------------------LLLL-----KS-------FV------
D7LAT0_ARALL/30-429--------------------.RTSALQTL-------------------------GNII-----VS-------IV------

PF03222

C9MI78_HAEIF/5-405--------------------KSPSLLGGA-------------------------MIIA-----GT-------AI------
Q9Z3A2_CHLPN/1-391--------------------MSNKVLGGS-------------------------LLIA-----GS-------AI------
C9MH58_HAEIF/3-387--------------------KT...VGST-------------------------LLVA-----GT-------MI------
A0A025Z1Q5_ECOLX/4-391--------------------RT...LGSV-------------------------FIVA-----GT-------TI------
TNAB_PROVU/8-404--------------------KEPSIIVGG-------------------------FVLG-----GA-------MI------
O07675_HAEIF/5-400--------------------KTTSIFGGA-------------------------CIIA-----SV-------CV------
A0A017I5M1_ECOLX/9-402--------------------TSPSLLGGV-------------------------VIIG-----GT-------II------
O22778_ARATH/12-436--------------------KGKSFWAAV-------------------------SLII-----GT-------AV------
A0A017JC56_ECOLX/7-403--------------------KKHSAFWGV-------------------------MVIA-----GT-------VI------
F2EZP4_PANAA/6-404--------------------TTPGLMSGT-------------------------MLII-----AT-------VI------
C4PQK7_CHLTJ/1-390--------------------MINKMLGGA-------------------------LLVA-----GT-------TI------
D6YJI0_CHLT0/3-392--------------------MRNKCVGGI-------------------------LIVA-----GT-------VI------
TYRPB_HAEIN/5-393--------------------KT...FGSA-------------------------LIIA-----GT-------TI------

PF00474

YWCA_BACSU/33-434-----------------------FYTAGG-------------------------GLTG-----VQ-------NG------
PANF_ECOLI/36-432-----------------------YFLGSR-------------------------SMGG-----IV-------LA------
SC5A4_PIG/58-492-----------------------FFLAGR-------------------------DVTW-----WP-------MG------
SC5A2_HUMAN/55-492-----------------------YFLAGR-------------------------SMVW-----WP-------VG------
PUTP_HAEIN/35-441-----------------------YILGGR-------------------------RLGS-----FV-------TA------
SC5A1_HUMAN/58-492-----------------------FFLAGR-------------------------SMVW-----WP-------IG------
PANF_HAEIN/36-432-----------------------YYVGNR-------------------------SMTG-----FV-------LA------
PUTP_ECOLI/35-437-----------------------YILGGR-------------------------SLGP-----FV-------TA------
ACTP_ECOLI/63-468-----------------------YYTAGG-------------------------NITG-----FQ-------NG------
SC5A3_CANFA/39-477-----------------------YFLAGR-------------------------SMTW-----VA-------IG------

PF00955

V8P944_OPHHA/511-1024LQRTGKLFGGLVLDIKRKVPFFLSDFTDA.------..........FS......LQCL-----AS-------FL------
G3U5F4_LOXAF/1-539.....RIFGGLILDIKRKAPYFWSDFRDA.------..........FS......LQCL-----AS-------FL------
T1EE80_HELRO/218-706........SGLMEDWKKRAPHYLADYTDG.------..........FCGQ.NTLHKTL-----ST-------TF------
T1I017_RHOPR/525-1044LRRTGLPWGGLINDFKRRYPFYCSDFFDG.------..........FN......GQCI-----AA-------AI------
G4VMR3_SCHMA/554-1100LNRTGRIFGGLWQDIKRRAPHYVSDFTDA.------..........IH......VQCC-----AS-------FI------
S4A11_MOUSE/312-804.......GKGIWMDIMRRFPVYPMDFTDG.------..........IIGKSKSVGKYV-----TT-------TL------
A8XC73_CAEBR/460-937......YFLGMRQDIKNRSKYFWSDYTDG.------..........LN......WSMI-----TV-------VA------
W5KDH9_ASTMX/559-1064LQRTGRVFGGLVNDVKRKAPFYWSDIVDG.------..........LS......LQCV-----AS-------VL------
T1FZS5_HELRO/163-669LAKTNKLFGGLTKDIKRKSAFYVSDITDG.------..........LS......VQCL-----AS-------II------
A8Q5C3_BRUMA/525-1015......LFRGLSNDFLRRIKYYSSDYLDG.------..........LRGS.KTIQKLF-----SS-------IV------
K1QX42_CRAGI/478-979LTRTGRICGGLFDDVRRKIPWYLSDFKDC.------..........LH......IQCF-----AS-------FV------
T1KJ99_TETUR/226-715.......CKGIAENIVRRVKYYPSDFVDG.------..........LKGP.NTFRKTL-----AT-------IL------
B3RRA8_TRIAD/486-976LKRTGRLFGGFINECKKRYPYYVSDFKDG.------..........LN......FQTL-----AA-------FI------
I3J2E3_ORENI/304-801........KGVYDDLRRRLPLYPSDFTDG.------..........IIGNDRSLLKYT-----TT-------AI------
U3J6V8_ANAPL/323-833LERTGRLFGGLVRDIRRKAPWYRSDFSDA.------..........LH......IQCL-----SA-------VL------
T1IXC2_STRMM/521-1019LKRTGRLFGGLINDIKRKAPWYWSDFKDA.------..........MA......IQCL-----AS-------FI------
E4WWD6_OIKDI/171-686LRRTGRLFGGLMNDIRRKAPWYLSDWTDG.------..........FN......TSCI-----AT-------IL------
Q1A708_STRPU/512-1011LERTGKIFGGLIQDCKRRFPFYLSDFKDA.------..........FH......LQCL-----AS-------FI------
G3NFQ8_GASAC/566-1072LQRTGRICGGLVLDVKRKLPFYWSDIRDS.------..........LS......LQCL-----AS-------VL------
T1K5U3_TETUR/267-743.....RIAQGLCEDLRRRLSHYISDYIDG.------..........VVGH.QTIHKTI-----ST-------IF------
Q8IQD4_DROME/591-1092LEKTGRLWGGLRNDLKRRMPMYKSDILDG.------..........LN......TETL-----AA-------TI------
Q16S12_AEDAE/483-981LSRTGRLFGGLVNDLKRKKPFYLSDFKDG.------..........LS......LQCV-----AS-------WI------
E0W1T8_PEDHC/651-1159LRRTKKPFGGMIRDVRRRFPHYKSDITDG.------..........MN......LQCL-----AA-------AI------
E0VCN3_PEDHC/465-965..RTGRLFGGLINDVKRKVPWYWSDFKDA.------..........LA......MQCI-----AS-------WI------
G3WTC3_SARHA/356-874LQRTGRLFGGLVQDIRRKAPWYLSDFLDA.------..........LD......AQSF-----SA-------IL------
F1LR96_RAT/349-861LQRTGRLFGGLVQDVRRKACWYPSDFLDA.------..........LH......PQCF-----SA-------VL------
W5KXY6_ASTMX/228-714LVRTGVLFGGMVRDFKRRYQHYKSDITDA.------..........MN......AQVL-----AA-------VI------
U6HGB0_ECHMU/291-835LMRTGRLFGGLINDIKRRAPSYLSDYTDA.------..........LH......IQCF-----AS-------FF------
T1FWY0_HELRO/373-877LIRTGKIFGGLVNDVKRKAPWYLSDFTDA.------..........LH......IQCV-----AA-------FF------
U3K110_FICAL/463-981LQRTGRFCGGLIKDIKRKAPFFASDFYDA.------..........LN......IQAL-----SA-------IL------
W5JZ21_ASTMX/640-1128LQRTGRPFGGMIRDIRRRYPKYLSDFKDA.------..........LN......PQCM-----AA-------VI------
G3PNB5_GASAC/438-957LKKTGRFCGGLLLDIKRKAPFFVSDFTDA.------..........FH......IQAL-----SA-------IL------
Q7PT77_ANOGA/414-924LEKTNRLWGGVINDIKRRYPMYKSDIMDG.------..........LN......TEAL-----AA-------TI------
T1G1Z8_HELRO/240-723......FCKGIKKDFLLRVPSYVSDFTDA.------..........FRSR.HSIRKVI-----ST-------TF------
K1QN40_CRAGI/465-966LVRTGRLFGGMLEDIKRKAPFYVSDFKDA.------..........LH......VQCL-----AS-------FI------
T1IXB9_STRMM/349-847LVRTGRLFGGLIDDVKRKLPWYWSDFKDA.------..........MA......IQSV-----AA-------IL------
G7YII3_CLOSI/375-869......FGKGLYQDLRNRLPHYWSDYSEG.------..........ILGK.NTLRKTI-----SG-------TL------
H3A8G0_LATCH/535-1050LQRTGRLFGGLILDIKRKVPFYLSDFKDA.------..........IS......LQCL-----AS-------IL------
E5SIY8_TRISP/321-820....CRLFGGLVEDIKRRWPYYVSDFKDV.------..........FTSW.RGFTQCL-----AA-------SV------
L5L573_PTEAL/490-1009LIWTGRFFGGLCLDVKRKLPWFLSDFYDG.------..........FH......IQSI-----SA-------IL------
K1R242_CRAGI/463-990...SKIPFKGLIDDIRRKVPFYLSDFKDS.------..........LH......VQCL-----GS-------FV------
G3P556_GASAC/263-750LARTGYPFGGMVKDLKRRYRHYISDYTDA.------..........LN......PQVL-----AA-------VI------
E2A0M0_CAMFO/532-1032LSRSGKLFGGLINDIKRKAPFYLSDFKDA.------..........LA......LQCV-----AS-------FI------
A8QB45_BRUMA/477-988LKRTGHLFGGLILDIKRKYPWYLSDFTDS.------..........LN......LQCV-----AT-------FC------
G3PTK2_GASAC/431-946LQRTRKFCGGLVLDIKRKLPFFASDFCDA.------..........LH......IQSL-----SA-------IL------
H2RXB2_TAKRU/366-893LKRSGIIFGGLIHDIRRRYPHYVSDLKDA.------..........LD......TQCI-----AA-------VI------
H2ZCT2_CIOSA/335-843LRRSGHLFGGFIHDVKNRYPKYLSDITDA.------..........LN......LQCL-----AS-------II------
G1KLH8_ANOCA/545-1057LQRTGRLFGGLILDVKRKIPWYWSDFKDG.------..........LS......FQCL-----AS-------FL------
K1R554_CRAGI/397-922LVRTGRLFGGLVADIKRKIPWYASDFKDC.------..........LH......IQCV-----AS-------TL------
H2MRC5_ORYLA/485-998LQRTGRIFGGLVNDVRRKVPFLWSDVKDA.------..........VS......LQCV-----AS-------VL------
S4A8_MOUSE/443-956LERTGRLFGGLVLDVKRKAPWYWSDYRDA.------..........LS......LQCL-----AS-------FL------
E3LRC0_CAERE/417-922......PFRGLKDEFKRRLAIYPSDYLDG.------..........IRGH.KTVQKLF-----ST-------VV------
H2MQQ8_ORYLA/460-973LQRTGRLFGGLILDIKRKVPHYLSDYTDA.------..........IN......LQCI-----AS-------FL------
F6ZGG3_HORSE/451-964LQRTGRLFGGLILDIKRKAPFFLSDFKDA.------..........LS......LQCL-----AS-------IL------
F6XSL8_XENTR/350-843LRRTGKIFGGLARDIRRRYPKYLSDITDA.------..........LN......PQCL-----AA-------VI------
I1FHS7_AMPQE/474-998.....IPFKGLYDDAKRRYRNYLTDFRDAA------WDTHRNKCSILA.....LLTTI-----AS-------II------
E9FTI0_DAPPU/260-749......FGQGIREDLSRRLPHYISDYKDG.------..........LTGV.KTPQKVL-----ST-------TL------
F6TCT1_CIOIN/372-881LQRTGRFFGGLIEDVKRKAPFYFSDFKDC.------..........LS......IQCL-----AS-------FI------
G5AMT1_HETGA/940-1416LRRTGRPFGGLIRDVKRRYPHYLSDFRDA.------..........LD......PQCL-----AA-------VI------
B4HY43_DROSE/565-1057LSRTGRLFGGLINDIKRKAPWYISDYKDA.------..........LS......MQCV-----AS-------WI------
T1G603_HELRO/157-654LERTGKICGGLIQDIKNRYKFYLSDITDA.------..........LA......LQSI-----AS-------TI------
K1QYU5_CRAGI/280-801LERTGRLFGGLIQDVKRKWKWYISDFTDA.------..........IH......VQCF-----AS-------FV------
G5EC65_CAEEL/395-910LKRTGKLFGGLILDIKRKAPHFVSDFTDA.------..........FN......LQCL-----AS-------IC------
E9G2T9_DAPPU/505-1004LYRTGRLFGGLINDVKRKLPWYWSDYKDA.------..........MS......IQCL-----AA-------FT------
U1NFS4_ASCSU/397-896IVRTGRLFGGLCEDIRRKAPFFISDFTDF.------..........FRG...RLSQSL-----AA-------AI------
G7YU35_CLOSI/538-1089LQRTGIIFGGLARDIRRRAPHYLSDFTDA.------..........LH......VQCC-----AS-------FI------
U1NNI1_ASCSU/442-926..RKFQYFGGMVDDISKRLPYYWTDFTDS.------..........LR......FQCL-----TS-------IV------
E9GEI4_DAPPU/152-644....GQFGQGIREDLCRRLPHYISDYVDG.------..........VVGK.KTPQKVL-----ST-------TF------
I1FKL2_AMPQE/440-927....CKPCGGLFHDVKNLVKRYPSDFKDV.------..........LH......IQPL-----LA-------IL------
F6XL93_CIOIN/511-1008LKRSGRPFGGFIKDVKNRYPKYLSDITDA.------..........IN......LQCL-----AS-------II------
K1PAY0_CRAGI/349-831.....SLFRGIREDLRRRIPVYVSDFKDG.------..........VVGN.KSIQKTI-----ST-------TF------
T1G3A7_HELRO/332-843.....RLFGGLVADVKRRFRYFLSDIRDG.------..........LH......VQCI-----AS-------II------
K1P9X1_CRAGI/723-1226IKRTGRLFGGLVNDVKRRYPQYLSDFKDA.------..........LH......FQCV-----TS-------FI------
W4WGG8_ATTCE/196-700LRRTKRPFGGLINDIKRRYPFYLSDFKDG.------..........LS......SSCV-----AA-------AI------
J9JYF8_ACYPI/711-1209LRRTKKPWGGLVKDIKRRLPYYKSDFIQG.------..........LN......LQCI-----AS-------AI------
H3ECJ2_PRIPA/195-739LKRTGKLFGGLMLDVKRKAPHYLSDFTDA.------..........LN......LQCV-----AT-------IC------
B3RRA7_TRIAD/391-881LMYTKECGSGLLRDMRRRYAHYLSDYTDA.------..........FN......LQCL-----TA-------SV------
H3DNL1_TETNG/273-761LSRTGRPFGGMIRDIRRRYQHYRSDITDA.------..........LN......AQVL-----AA-------VI------
U6INZ2_HYMMI/387-907.....KFMSGLIADLRRRVPLYASDFADG.------..........FRGA.HTMRKVT-----SS-------VF------
T1INN8_STRMM/610-1148LKRTGRLFGGLRREVMNRFPLYWSDILDA.------..........LN......PQCL-----AS-------VV------
W4ZBI6_STRPU/468-975LARTGRLFGGLINDIKKKAPFYWSEYYHA.------..........LN......IQCL-----AS-------FV------
F6V6Y3_XENTR/366-886LKRTGRIFGGLIKDVKRKAPWYWSDFYDG.------..........LN......MQCL-----SS-------IL------
T1KG21_TETUR/488-986LKRTGRLFGGLINDVKRKAPWYLSDFKDA.------..........LA......LQSI-----AS-------VI------
F6S1R5_MONDO/362-890....NRFFRELRLDIKRKLPWFASDFYEG.------..........FH......IQSI-----SA-------IL------
E9G2T7_DAPPU/358-867LVRTGRFFGGLIDDVKRKLPFYKSDFTDA.------..........FA......VQSI-----AS-------IT------
D6WFQ1_TRICA/611-1120LERTRRPFGGLINDLKRRYPYFKSDVTDG.------..........IN......AQCF-----AA-------AI------
G3RVR2_GORGO/665-1151LLRTGSVFGGLVRDVRRRYPHYPSDLRDA.------..........LH......SQCV-----AA-------VL------
Q17LT4_AEDAE/585-1093LEKTHRLWGGLINDIKRRYPMYKSDIKDG.------..........LN......TETL-----AA-------TV------
I3KGD1_ORENI/467-975LAFTGRFCGGLYLDIKRKLPWFPSDFYEG.------..........FH......IQSI-----SA-------VL------
W4YSB4_STRPU/661-1179LKRTGKIFGGLINDVRRRYPHYWSDIRDG.------..........IN......FQCV-----AA-------FF------
G6DAI9_DANPL/622-1112LSKSGRLFGGVIRDIKRRYPHYISDFRDA.------..........LN......GQCA-----AA-------TI------
G1KNW1_ANOCA/379-896LKRTGRLFGGLLKDIQRKAPWYCSDFYDA.------..........LN......IQCF-----SA-------IL------

PF02133

YEME_SCHPO/55-506----------PVPK.SQRV-WGPWNYVAF-------------------------WLAD-----SV-------NV------
FCY22_YEAST/73-491----------PVTEDEKND-DSILNAATI-------------------------WFSA-----NM-------VI------
ALLP_BACSU/20-456----------PLGQ.EKRT-WKAMNFASI-------------------------WMGC-----IH-------NI------
FUR4_YEAST/103-562----------PVEK.ERRV-WSWYNYCYF-------------------------WLAE-----CF-------NI------
YXLA_BACSU/10-428----------YIPN.EERH-GKAKDLFPV-------------------------WFGA-----NM-------HI------
Q9ZBQ0_STRCO/18-445----------QVPD.HERT-ARTRELFPT-------------------------WVGA-----NI-------SV------
CODB_ECOLI/11-398----------PVPQ.SARK-GVLALTFVM-------------------------LGLT-----FF-------SA------
ALLP_ECOLI/19-457----------PKTQ.SQRT-WKTFNYFTL-------------------------WMGS-----VH-------NV------
O86506_STRCO/10-448----------TIPE.AERT-SGPRDLVSI-------------------------LLGS-----NL-------CL------
FUR4_SCHPO/48-499----------PVPP.SKRL-WGPWNFISF-------------------------WLAD-----AV-------NI------
FCY21_YEAST/73-489----------PITEDEKTD-DSILNAASM-------------------------WFSA-----NM-------VL------
FUI1_YEAST/119-575----------PVEA.KRRT-WTWKQYIFF-------------------------WISG-----SF-------NV------
DAL4_YEAST/105-564----------PVEE.ERRC-WSWFNYLYF-------------------------WLAD-----CF-------NI------
O69811_STRCO/47-491----------PVPV.EGRT-WTTYNFSAL-------------------------WVGM-----AH-------NT------

PF03594

Q9RUP7_DEIRA/156-540------------------APAQPCTVGGG---------------------------RV-----PA-------PY------
Q98CP3_RHILO/1-376------------------MTMRLSIPISA---------------------------.F-----VA-------AI------
Q9KQM8_VIBCH/4-381------------------GFFNLSHLSAG---------------------------.F-----TT-------VL------
YDCO_ECOLI/5-381------------------S.IPPPTLLAG---------------------------.F-----LA-------VL------
Q9RY94_DEIRA/39-426------------------QDTHPSAVLAG---------------------------.L-----IA-------VV------
BENE_ACIAD/10-387------------------QDWSLSATIAG---------------------------.F-----LA-------VL------
Q9I374_PSEAE/15-392------------------ADSSPAAVVAG---------------------------.F-----VA-------ML------
G8ML28_9BURK/13-389------------------.DWSVSAVSAG---------------------------.L-----LA-------VI------
Q88I34_PSEPK/31-401------------------.DCSVSAIVAG---------------------------.S-----IA-------TT------

PF00916

S26A3_HUMAN/73-475---------------------LLSDIVSG----------------------------I-----ST-------GI------
Q55814_SYNY3/20-386---------------------LRGDIFGG----------------------------I-----TA-------AI------
SUT31_ARATH/82-463---------------------FKSDLIAG----------------------------I-----TI-------AS------
SULP3_CAEEL/60-496---------------------FFGDLSGG----------------------------L-----TM-------AV------
YVDB_BACSU/15-379---------------------FQKDLIAG----------------------------I-----VV-------GV------
CYS14_NEUCR/77-468---------------------LLGDFIAG----------------------------V-----TV-------GF------
SUL2_YEAST/137-544---------------------FTADLIAG----------------------------I-----TI-------GC------
S26A1_RAT/69-481---------------------LAGDVMSG----------------------------L-----VI-------GI------
SULX_YEAST/119-513---------------------LWGDVIAG----------------------------I-----SV-------AS------
O17951_CAEEL/89-486---------------------LTSDVVGG----------------------------I-----TV-------GV------
SUT21_ARATH/115-497---------------------FKNDLMAG----------------------------L-----TL-------AS------
SUT11_ARATH/85-467---------------------FRGDLIAG----------------------------L-----TI-------AS------
S26A2_HUMAN/108-518---------------------ILGDVMSG----------------------------L-----IV-------GI------
SUT32_ARATH/73-454---------------------LKSDVISG----------------------------I-----TI-------AS------
Q55415_SYNY3/12-379---------------------LQGDLFGG----------------------------V-----TA-------AV------
SUT41_ARATH/95-468---------------------FKLDLMAG----------------------------I-----TV-------GI------
YG35_YEAST/206-606---------------------FAHYLPAA----------------------------V-----LG-------LL------
P72770_SYNY3/20-387---------------------LKADVVAG----------------------------L-----TL-------AA------
P96878_MYCTU/31-398---------------------LRHDVPAS----------------------------L-----VV-------FL------
YA7B_SCHPO/157-558---------------------FILNIPAV----------------------------I-----IG-------LL------
SUT22_ARATH/107-489---------------------FKKDLMAG----------------------------L-----TL-------AS------
M0W733_HORVD/97-477---------------------FKGDLVAG----------------------------L-----TI-------AS------
Y1739_MYCTU/25-392---------------------LRGDVLAG----------------------------L-----TV-------AA------

PF02705

KUP_KLEP7/13-544FTVSIKYITF---VMRADNAGE.GGILTLMSLAG..........................................RNTS
KUP_WIGBR/16-547FIIFLKYLIL---IVSINNSGE.GGILTLMSITA..........................................KKIN
B9SQ92_RICCO/61-632FISFIKYVIV---VLAANDNGD.GGTFALYSLICRHAKVNLIPNQQVEDKELS..NYKLEVPDRRAKMASAIKSLLEKSC
A9SXX0_PHYPA/13-586LVALIKYGLI---VINADDHGEAGGTFAVYSILCRNANFGQNIADPSVYILAGANMNKETRAKESESTLAKKLRHFIERH
A9T519_PHYPA/7-581LIGVIKYTLI---VLWADDHGEAGGTFAMYSLICQHTDVGGQTRKISKF..........SANADSQLSHFHNGLEDKEHS
B6QFY8_PENMQ/79-668IMVTVKYALI---VLNADDEGE.GGTFALYSLICRYANLIQRDPRQ...............RQLVRMERYQDQDMPKLNL
A1CCX5_ASPCL/78-666ITVTIKYVCI---VLNADDEGE.GGTFALYSLISRYANLVRRDPRHSNMVR......MQRHDTDDLQKPNLMARNMIERS
C5FQB5_ARTOC/100-671LIATVKYVGI---VLCANDNGE.GGSFALLSIIRKHVQLDWRDS....................KAKVEDKWKGGKGFNA
Q6CCD6_YARLI/48-711LVVLIKYCII---VFIFGPNGGEGGIVAIYAKLARELNIAPVG......................VDFDQDSLDMLSKSE
C4Y6H7_CLAL4/40-680IIVLAKYAFV---VLTYGPNEGEGGQIAIYAKIARHLHFGPKGVIIPGS.........PQRSDLELLKRVETTNSFMSSK
B0CVZ9_LACBS/29-630LLPLLKYVFV---SLYFGTQEGEGGSFALYQGLYPPADKNHDEDR.................TLTGDTTLGPEKPAHTLK
KUP_CYTH3/20-548LQTTIKYVII---TLRADNKGE.GGIFSLFALIR..............................................
C6W4Q3_DYAFD/15-540LQTTVKYVIL---ILRADNRGE.GGIFALYALVR..............................................
C6Y2B3_PEDHD/15-542LQTTIKYVVI---TLRADNKGE.GGIFSLYSLVR..............................................
KUP_LEUMM/14-557LITTIKYVII---ALQADNHGE.GGIFALYSRVK.............................................K
KUP_LACDA/6-548LLTTVQTVII---ALRATNHGE.GGIFALYALIR..............................................
E3D8I4_GARV3/105-645LITTVKYVFV---AMRTDNKGE.GGIFALYSLIR..............................................
C5K5G4_PERM5/172-748FIVCIKYVGV---AFRFDYHGE.GGIFSLLLKIVH......................................ESIHKVG
B5ED26_GEOBB/13-541ILVTAEYAWL---AMSLGKKGQ.GGEIVLREIII........................................KLFKQG
B8J475_DESDA/11-539LLVTVEYAWL---AMSLSKAGE.GGTIVLLSILR........................................PMLQSG
A7I822_METB6/4-532ILVTVQYTFL---AMHMGKKGE.GGTIVLKEILL........................................PMLKSG
KUP_METAC/10-538TLVTVEYAWL---AMSLGKKGE.GGTIVLKELLV........................................PLIKSG
B5YHM1_THEYD/4-532ILPTIQYNFL---AMNLSIRGE.GGTIVLSEIFK........................................SLSKSN
B2VA86_SULSY/13-542LIPTVQYAWF---AMNLSLRGE.GSIIVLGEIAQ.........................................SITKN
Q54JK9_DICDI/60-587MVVTVKYVVF---ILNADNNGE.GGIIALVSLIP..........................................KQTN
KUP2_LEGPH/16-542IIVSIKYLVI---VFRADNDGE.GGIIALAGLIR..........................................QKIK
C6BY23_DESAD/14-544IVICLKYVTF---VMAADNEGE.GGIFALYELVS..........................................HEGQ
KUP_XANP2/18-550LSVTVKYVML---VLRADNDGE.GGILALVTLLD.........................................LHRSA
KUP3_BRADU/2-536LIISLKYALL---ILRADNRGE.GGIVALLALLH..........................................ARNA
C1F3S5_ACIC5/37-570MVISIKYMVY---VLCNDNKGE.GGIFALLALLR........................................PNKGQS
C1D8B5_LARHH/14-546IIISLKYMLL---VLRFDNNGE.GGALALAARVQ........................................QLAGRH
KUP_PROAC/31-568LVVCVKYVIF---VMRADNDGE.GGILALMALVR........................................RLMASH
B1ZTC6_OPITP/46-580LIVCVKYVTF---ICRADNRGE.GGVFALMALLH..........................................AGKD
KUP1_CHRVO/26-559LMVSVKYVMV---LMRADNKGE.GGILALLAQITG.....................................GRSGDGRR
KUP_THEEB/15-546LIPTLKYATF---ALRADNDGE.GGIFPLMALVL..........................................SRIR
B0T401_CAUSK/36-573LFVTIKYVIF---FMRADNKGE.GGTLALMALAQ.......................................KALGKVG
KUP1_SPHWW/26-569LVVTCKYVLF---LMRADNNGE.GGVLALMTLAQ...........................................RST
KUP_BDEBA/51-585LAICIKYMAF---VLRADNKGE.GGILSLMALAVR......................................SQQSKDV
C1A5Q5_GEMAT/25-559LVVTVKYVGY---VLRADNRGE.GGTFALLALIF.......................................PRGTPQS
KUP2_SYNFM/28-562MVICVKYVVF---VMRADNHGM.GGIFALLALIPG......................................DSGRISP
KUP_METCA/15-548IIVAVKYVVF---VMHADNHGE.GGIMALTALAL........................................RQRHRR
KUP_HERAR/14-547IIVSLKYVTL---VLRANNRGE.GGIMALMALAL..........................................SSVT
B2FRN5_STRMK/27-560LVVTLKYVTI---IMRADNDGE.GGIMALMALTQ........................................RTLRNG
KUP1_RALSO/1-534LVVSIKYVVF---VMRADNNGE.GGILALTALAM........................................RASSGG
KUP_ACIF2/18-550LVVSVKYAWV---IMRASNQGE.GGAMALTALAS.......................................HATGHSN
KUP1_NOVAD/40-570IIVTFKYVSV---IMRADNKGE.GGSLALLALIN...........................................QHT
B9HJL6_POPTR/87-646LIGVVKYTSI---ALKADDQGE.GGTFALYSLLCRNMNIGILSSKQV..............QTNSSFSHSVLHEG.....
D2U9H9_XANAP/28-558LVVTLKYVTV---IMRADNDGE.GGIMALTALAQ........................................RTLPAG
E3FUM0_STIAD/26-562VLISMKYLLF---VTRADNRGE.GGILALMALVLQ.....................................RPKGIRAP
KUP3_RHIEC/22-554IIVTIKYVLF---LLRADNEGE.GGTLSLLALLM...........................................KTA
Q5AB00_CANAL/82-703IIVIFKYVLI---VLFIGVNCNHGGQVAIFAKIARHLGIGPRGVSLPGAPEAS.DMQLLTRQDTTTSSIKSTQTR.....
HAK6_ORYSJ/80-646LMSLVKYALI---VLKADDHGE.GGTFALYSLLRQHVNFKGNIPVPLTRLES....DVHLKFHSKRRSRPSRLQLFLENS
KUP3_LEGPH/22-550IIASVKYIHF---ALRIDNDGE.GGILALMSLLS...........................................LKL
KUP1_LEGPH/12-539IIVSFKYLMI---IFRADNDGE.GGILALLALMK..........................................HKST
HAK19_ORYSJ/48-624LIPMVKYVFI---VLYANDNGD.GGTFALYSLISRHAKIRMIPNDQTEDANV...SNYSIEAPSSQLRRAEWVKQKLESS
KUP1_RHOPA/12-542LLVTVKYVIV---IMRADNHGE.GGSLALLALVT........................................EL.TRG
HAK9_ORYSJ/24-602LIPLIKYVSI---VLRADDNGE.GGTFALYSLICRHANVSLLPNRQV.............ADEELSTYKLEYPPEVANRS
KUP_CORGL/20-550LIVTVKYVML---VTRADNQGQ.GGILALVALLK...........................................NRG
KUP_STRP1/18-551LITTIKYVLI---ALKADNHHE.GGIFSLFTLVR..............................................
KUP_XYLFA/23-555LVVTIKYVAV---IMRVDNDGE.GGIMALTALTQ........................................RTMPFG
W8UJ41_YEREN/22-548LVTSIKYTIF---AMRIDNNGE.GGIMALMSLLV...........................................LKG

PF03845

GERBB_BACSU/7-331-----------------------AGVLTLPRSAA------------------------------------------ETG.
Q9KCW4_BACHD/8-324-----------------------VGVLGFQRVIA------------------------------------------KSG.
Q97IW3_CLOAB/3-323-----------------------STPLFALGIEA------------------------------------------EQD.
GERKB_BACSU/5-326-----------------------SSLLITPGSMA------------------------------------------GRD.
Q97LG4_CLOAB/8-327-----------------------VGFTYLPISVI------------------------------------------KQAS
Q97E18_CLOAB/4-325-----------------------SSIIFFLNPEA------------------------------------------EQN.
Q9KCH3_BACHD/10-327-----------------------IGALSFQRAIV------------------------------------------KIS.
GERAB_BACSU/9-331-----------------------AGLLTLPRALT------------------------------------------TKAN
Q9KBD6_BACHD/8-337-----------------------VGILTLPGSLA------------------------------------------DTLN
YNDE_BACSU/7-329-----------------------AGVLTLPRTVT------------------------------------------EQTQ
Q9KAU9_BACHD/3-321-----------------------VGILSLPASVA------------------------------------------AEAN
Q97TS5_CLOAB/3-323-----------------------STPIFALGIEA------------------------------------------EQN.
Q9KBJ1_BACHD/6-327-----------------------SAIVVGVGLDA------------------------------------------GQD.
Q7BYC0_BACCR/8-329-----------------------TGILTLPRASV------------------------------------------EKVK
Q816T5_BACCR/10-327-----------------------AGVLGFARIIA------------------------------------------KAA.

PF01235

B2UL98_AKKM8/57-460-----------------------GNIIGVGVAIA------------------------------------------AGGP
C4L2J1_EXISA/48-448-----------------------GNIAGVSTAIA------------------------------------------LGGP
Q7VL62_HAEDU/56-459-----------------------GNIAGVATAIA------------------------------------------LGGP
B7GI15_ANOFW/49-449-----------------------GNVAGVAMALA------------------------------------------IGGP
R6ESR6_9FIRM/49-458-----------------------GNIVGVTGAII------------------------------------------AGGP
R7ANW3_9CLOT/47-452-----------------------GNIAGISTAIC------------------------------------------IGGA
W6RLP3_9RHIZ/46-455-----------------------GNIAGVAVALT------------------------------------------LGGP
D4G8V3_RIEPU/46-454-----------------------GNLTGVAIALN------------------------------------------LGGV
F0P236_WEEVC/46-470-----------------------GNIIGVATAIA------------------------------------------MGGP
X5D863_9BACT/54-454-----------------------GNISGVAVAIT------------------------------------------MGGP
C7RC29_KANKD/57-559-----------------------GNIGGVALAIF------------------------------------------IGGP
R6R064_9FIRM/47-469-----------------------GNIVGVATALC------------------------------------------AGGP
Q9K9D4_BACHD/47-446-----------------------GNLAGVAIAIT------------------------------------------LGGP
R5WSV7_9FIRM/52-454-----------------------GNIIGVGTAVA------------------------------------------LGGP
K9TIM8_9CYAN/96-500-----------------------GNIAGVAIAIS------------------------------------------IGGP
R5JXV6_9CLOT/55-564-----------------------GNIVGVATAMV------------------------------------------SGGP
W5WYR9_9CORY/49-452-----------------------GNIVGVAIALT------------------------------------------LGGP
R9VS99_9ENTR/46-453-----------------------GNLAGVAFALT------------------------------------------TGGP
Q65J05_BACLD/49-446-----------------------GNLTGVALAVA------------------------------------------TGGP
W8U6M9_EUBAC/78-495-----------------------GNIAGVATAIA------------------------------------------MGGP
F2F7Q9_SOLSS/49-467-----------------------GNIVGTATAIA------------------------------------------FGGP
Q9HXZ0_PSEAE/50-449-----------------------GNVAGVAVAIT------------------------------------------LGGP
Q5WIK8_BACSK/48-446-----------------------ANISGVAIAIT------------------------------------------TGGP
X2GW49_9BACI/46-479-----------------------GNIAGTATAIA------------------------------------------MGGP
Q81XE8_BACAN/56-451-----------------------GNLAGVALAIS------------------------------------------MGGP
W6RX75_9CLOT/46-448-----------------------GNLAGVALAIS------------------------------------------IGGA
R5R740_9FIRM/57-453-----------------------GNIAGVATALA------------------------------------------AGGA
R5TDP1_9FIRM/46-451-----------------------GNILGVSTAIC------------------------------------------LGGP
Q7VFP4_HELHP/49-454-----------------------GNIVGVSIAIV------------------------------------------SGGV
Q082X4_SHEFN/49-451-----------------------GNLAGVAMAIS------------------------------------------LGGS
Q2YKB0_BRUA2/46-452-----------------------GNITGVAVALY------------------------------------------LGGP
H5XB24_9PSEU/93-523-----------------------GNIAGVAVAVT------------------------------------------IGGA
X5E8D3_9CORY/44-457-----------------------GSIAGVATAIA------------------------------------------MGGP
D9S9M5_FIBSS/46-477-----------------------GNIVGVATAIG------------------------------------------TGGP
V9XJ86_9NOCA/53-454-----------------------GNVAGVAIAIS------------------------------------------LGGP
R6W8F8_9FIRM/60-481-----------------------GNIIGVTSAIL------------------------------------------TGGP
E6WQ83_PSEUU/46-484-----------------------GNIAGVATAIA------------------------------------------YGGP
S6CD23_9ACTN/53-462-----------------------GNIAGIATAVA------------------------------------------TGGP
R6LRJ9_9FIRM/49-461-----------------------GNIAGVASAIF------------------------------------------YGGP
A8ALU9_CITK8/48-455-----------------------GNLAGVALAIA------------------------------------------AGGP
Q8P616_XANCP/46-481-----------------------GNIAGVATAIA------------------------------------------FGGP
B1HSY7_LYSSC/46-460-----------------------GNIAGVATAIA------------------------------------------AGGP
C7N1V2_SLAHD/52-464-----------------------GNIAGVAVAIA------------------------------------------AGGP
E6UF74_RUMA7/48-472-----------------------GNIVGVATALC------------------------------------------AGGP
T2KIQ3_9FLAO/49-458-----------------------GNIAGVAVAIA------------------------------------------IGGP
A4FJA3_SACEN/90-513-----------------------GNIAGVGVAVT------------------------------------------IGGP
U5Q4A6_9BACT/51-446-----------------------GNIVGVATAVA------------------------------------------LGGP
R6QL56_9FIRM/55-463-----------------------GNIVGVATAMV------------------------------------------LGGP
A6T4E7_KLEP7/30-437-----------------------GNLAGVTLAIA------------------------------------------AGGP
Q6A6W4_PROAC/89-503-----------------------GNIAGVAIAIA------------------------------------------TGGP
Q3IIL7_PSEHT/49-553-----------------------GNIGGVALAIS------------------------------------------IGGP
K4KVJ9_SIMAS/53-454-----------------------GNLAGVAVAIT------------------------------------------LGGP
Q62ZC8_BACLD/50-447-----------------------GNITGIAIAIA------------------------------------------LGGP
D4KIB6_9FIRM/53-452-----------------------GNIAGIAIAVV------------------------------------------LGGP
R6GRJ8_9CLOT/56-455-----------------------GNLAGVATAIA------------------------------------------VGGP
R5BT56_9FIRM/49-463-----------------------GSVAGVATGIY------------------------------------------FGGP
GLNT_BACSU/50-449-----------------------GNITGIAIAIA------------------------------------------LGGP
C7NKM3_KYTSD/76-484-----------------------GNVAGVAVAIT------------------------------------------VGGP
Q65UI6_MANSM/65-468-----------------------GNISGVATAIA------------------------------------------LGGP
Q9KPL1_VIBCH/46-453-----------------------GNMAGVAVALT------------------------------------------AGGP
C4LCJ4_TOLAT/45-452-----------------------GNLAGVAVAIY------------------------------------------LGGP
A8F9M4_BACP2/46-444-----------------------GNITGIAIAIA------------------------------------------MGGP
I0JJ89_HALH3/58-455-----------------------GNIAGVATAVF------------------------------------------LGGP
R7AGI4_9CLOT/50-474-----------------------GNVAGVAVALY------------------------------------------MGGP
B2FSE0_STRMK/46-482-----------------------GNIAGVATAIA------------------------------------------FGGP
F2I8L7_AERUA/50-455-----------------------GNIVGVSTAIC------------------------------------------LGGY
H2IRW6_RAHAC/47-451-----------------------GNLTGVAIAIT------------------------------------------IGGP
Y183_HAEIN/59-462-----------------------GNIGGVATAIA------------------------------------------LGGE
Q87U15_PSESM/43-445-----------------------GNIAGVGIAVT------------------------------------------LGGP
G4QHN1_GLANF/78-481-----------------------GNLAGVAVAIS------------------------------------------LGGA
V4J7M3_9DELT/49-455-----------------------GNIAGVAVAIT------------------------------------------LGGP
D5UBK7_CELFN/48-455-----------------------GNIAGVAVALT------------------------------------------LGGP
A7ZDT9_CAMC1/54-470-----------------------GNIAGISAAIV------------------------------------------AGGP
C1DD85_LARHH/46-459-----------------------GNIAGVAAAIT------------------------------------------FGGP
F0RL19_DEIPM/47-463-----------------------GNIAGVATAIT------------------------------------------FGGP
R5WS38_9FIRM/54-459-----------------------GNIAGISTALC------------------------------------------IGGA
K0B2L5_CLOA9/50-448-----------------------GNLAGVVAAIS------------------------------------------IGGS
F2JU21_MARM1/46-472-----------------------GNIAGVAAAIG------------------------------------------FGGP
D1B800_THEAS/50-454-----------------------GNLAGVATALV------------------------------------------SGGP
R5Q6J7_9BURK/79-476-----------------------GNIAGIAIAVV------------------------------------------VGGP
R6NH81_9FIRM/47-453-----------------------GNIAGIATAIA------------------------------------------AGGA
Q81XD8_BACAN/54-450-----------------------GNLAGVALAIS------------------------------------------MGGP
I3UGH4_ADVKW/46-460-----------------------GNIAGVATAIA------------------------------------------AGGP
D6XWG3_BACIE/52-446-----------------------GNIAGVASAVA------------------------------------------VGGP
Q3AFY7_CARHZ/46-459-----------------------GNIAGVATAIA------------------------------------------MGGP
R5HBJ9_9FIRM/53-457-----------------------GNIVGVSTAIC------------------------------------------LGGY
A0M410_GRAFK/284-691-----------------------GNIAGVAVAIS------------------------------------------LGGA
R6ALH3_9FIRM/50-450-----------------------GNIVGVATAIA------------------------------------------AGGP
W5Y2T0_9CORY/46-478-----------------------GNIAGVATAIA------------------------------------------FGGP
R5I5H2_9BACT/50-447-----------------------GNIVGVATAIT------------------------------------------LGGP
Q8EN00_OCEIH/57-451-----------------------GNMAGVASAVA------------------------------------------LGGP
Q5P2T3_AROAE/46-460-----------------------GNIAGVATAIT------------------------------------------FGGP
Q7DDS6_NEIMB/53-458-----------------------GNIAGVAIAIK------------------------------------------VGGP
Q0SCP0_RHOSR/50-470-----------------------GSIAGVATAVG------------------------------------------GGGP
R5G5T4_9FIRM/48-470-----------------------GKIIGVATAIS------------------------------------------IGGP
Q73GB3_WOLPM/82-486-----------------------GTVAGVAIAVS------------------------------------------MGGP
D1BPB8_VEIPT/50-451-----------------------GNIAGIAIAVV------------------------------------------LGGP
E3GK02_EUBLK/49-466-----------------------GNIAGVATAIY------------------------------------------FGGP
A8FFK0_BACP2/49-450-----------------------GNMAGVAIAIT------------------------------------------VGGP
D3EDV3_GEOS4/50-449-----------------------GNITGVALAIS------------------------------------------LGGP
B4E614_BURCJ/50-453-----------------------GNIAGVAVALT------------------------------------------VGGP
Q07Z28_SHEFN/49-454-----------------------GNMAGVAVAIG------------------------------------------TAGP
E3H6D6_ILYPC/48-461-----------------------GNIAGVATAIA------------------------------------------LGGP
U5L5G5_9BACI/46-460-----------------------GNIAGTATAIA------------------------------------------MGGP
F4CF94_SPHS2/46-459-----------------------GNIAGVATAIA------------------------------------------MGGP
Q15SP8_PSEA6/49-451-----------------------GNLAGVAVAIS------------------------------------------LGGA
R7J9J1_9FUSO/75-484-----------------------GNVAGSAAAVS------------------------------------------IGGP
D3FUF0_BACPE/53-450-----------------------GNLAGVAIAIA------------------------------------------LGGP
Q2SF65_HAHCH/43-445-----------------------GNIAGVAIAIA------------------------------------------LGGP
F4HCM3_GALAU/54-452-----------------------GNIAGVSLAIT------------------------------------------YGGP
R6I317_9FIRM/51-457-----------------------GNIIGVSTAIC------------------------------------------LGGF
Q5L341_GEOKA/47-461-----------------------GNVAGTATGIA------------------------------------------YGGP
Q92P60_RHIME/46-452-----------------------GNLAGVAVALY------------------------------------------LGGP
R5EKL7_9GAMM/58-457-----------------------GNLAGVATAMA------------------------------------------MGGP
R6TGR9_9FIRM/48-453-----------------------GNIVGISTAVC------------------------------------------LGGY
R7AEN1_9ACTN/55-464-----------------------GNIAGIATALA------------------------------------------MGGP
R7MEC6_9CLOT/86-499-----------------------GSIAGVAISIS------------------------------------------IGGP
Q5E0L3_VIBF1/46-471-----------------------GNIAGVAAAIG------------------------------------------FGGP
F8EJC0_RUNSL/46-459-----------------------GNIAGVATAIA------------------------------------------MGGP
B0UUP4_HISS2/57-460-----------------------GNIGGVATAIA------------------------------------------LGGE
B2TML1_CLOBB/54-451-----------------------GNLAGIAIAIS------------------------------------------IGGP
Q3IIM2_PSEHT/46-453-----------------------GNMAGVAVALY------------------------------------------LGGA
R7CQS6_9FIRM/53-452-----------------------GNIAGIAIAIV------------------------------------------SGGP
R6YML2_9FIRM/50-472-----------------------GNIVGVATAVG------------------------------------------TGGP
Q6ANS0_DESPS/50-451-----------------------GNIAGIALAIT------------------------------------------VGGP
I0DZP7_PROSM/46-460-----------------------GNIAGVATAIA------------------------------------------AGGP
R6GE77_9CLOT/48-451-----------------------GHIAGIASGII------------------------------------------IGGP
D7AX43_NOCDD/60-469-----------------------GNIVGVAVAIS------------------------------------------LGGP
R5D3A3_9FIRM/51-467-----------------------GNIIGVASAIV------------------------------------------LGGP
R6C274_9BACT/50-448-----------------------GNIIGVATAIA------------------------------------------LGGP
D4M6E0_9FIRM/62-465-----------------------GNLVGVVAAIS------------------------------------------AGGA
YAAJ_ECOLI/46-453-----------------------GNLAGVALAIT------------------------------------------AGGP
D5VAX7_MORCR/46-475-----------------------GNIAGVAAAIG------------------------------------------FGGP
E3EA98_PAEPS/47-461-----------------------GNIAGIALAVG------------------------------------------MGGP
D4LQM0_9FIRM/62-464-----------------------GNLVGVVAAIS------------------------------------------AGGA
H2FXG2_OCESG/46-453-----------------------GNLAGVAVALY------------------------------------------LGGP
R5PRI2_9BACT/50-447-----------------------GNIIGVATAIA------------------------------------------LGGP
J7L7G1_NOCAA/49-457-----------------------GNIVGVATAIM------------------------------------------LGGP
R6VAG6_9FIRM/47-469-----------------------GNIVGVATALA------------------------------------------AGGP
Q6ANS1_DESPS/56-454-----------------------GNMAGVAVAIT------------------------------------------VGGA
K0J6Z8_AMPXN/55-453-----------------------GNIAGVATAVA------------------------------------------SGGP
I3TIY8_TISMK/49-454-----------------------GNIAGVAVAIT------------------------------------------LGGP
Q81PH5_BACAN/46-459-----------------------GNIAGVATAIA------------------------------------------FGGP
Q1GL91_RUEST/49-450-----------------------GNIAGVAVAIT------------------------------------------LGGP
C4L110_EXISA/50-450-----------------------GNIAGVATAIA------------------------------------------LGGP
G0VQI3_MEGEL/43-446-----------------------GNIVGVATAVH------------------------------------------AGGP
B4S4I7_PROA2/112-519-----------------------GNIAGVAVAIT------------------------------------------LGGP
R5EMW4_9CLOT/55-557-----------------------GNIVGVATAMV------------------------------------------SGGP
C7RF91_ANAPD/49-453-----------------------GNIVGVSSAIC------------------------------------------LGGY
B9E978_MACCJ/46-490-----------------------GNIVGVSTAIY------------------------------------------IGGP
D3RSW7_ALLVD/51-451-----------------------GNIAGVATAIF------------------------------------------LGGP
Q481J5_COLP3/46-471-----------------------GNIAGVAAAIG------------------------------------------FGGP
D3VIB1_XENNA/46-454-----------------------GNLAGVAIAIT------------------------------------------AGGP
R6C0Q9_9CLOT/49-475-----------------------GNIVGVATAIA------------------------------------------AGGP
A1TXI6_MARAV/46-452-----------------------GNLAGVAVALY------------------------------------------LGGA
R7G2T9_9FIRM/51-471-----------------------GNVAGVAVAIY------------------------------------------MGGP
Q8EBH5_SHEON/47-452-----------------------GNMAGVAVAIG------------------------------------------AAGP
Q2NVZ2_SODGM/46-454-----------------------GNLMGVAIALI------------------------------------------LGGP
R6NWY5_9FIRM/53-470-----------------------GNIVGVATALV------------------------------------------EGGP
C5DAE3_GEOSW/49-446-----------------------GNLAGVALAIS------------------------------------------LGGP
D4MVF8_9FIRM/67-468-----------------------GNLTGVVAAIS------------------------------------------AGGA
S6A4B3_9SPIO/50-458-----------------------GNVVGVSTAIA------------------------------------------AGGP
Q8RDV2_FUSNN/55-455-----------------------GNLAGVAIAVV------------------------------------------VGGP
H0ULL2_9BACT/54-458-----------------------GNVAGVATAIV------------------------------------------SGGP
Q5WBL9_BACSK/46-460-----------------------GNIAGVASAIY------------------------------------------FGGP
D5D9I4_BACMD/46-459-----------------------GNIAGVATAIA------------------------------------------FGGP
K9YDV4_HALP7/46-445-----------------------GNIAGVAVAIT------------------------------------------LGGP
R6RBR5_9CLOT/84-516-----------------------GNIAGVASAIV------------------------------------------SGGP
C7MLG7_CRYCD/51-476-----------------------GNIAGVSTAIA------------------------------------------FGGP
W5Y1T9_9CORY/60-473-----------------------GSTAGVATAIA------------------------------------------MGGP
R7C4U2_9BURK/46-460-----------------------GNIAGVATAIC------------------------------------------FGGP
W5Y4I7_9CORY/46-477-----------------------GNIAGVATAIA------------------------------------------FGGP
F6AAC4_PSEF1/43-445-----------------------GNIAGVGIAVT------------------------------------------LGGP
D2RNM9_ACIFV/44-448-----------------------GNIVGVATAIK------------------------------------------AGGP
C5C6U4_MICLC/48-455-----------------------GNVAGVAIAIV------------------------------------------IGGP
D4MZ66_9FIRM/54-463-----------------------GNIVGVATAMV------------------------------------------SGGA
X2GKP6_9BACI/49-446-----------------------GNITGVALAIG------------------------------------------VGGP
R5D2D6_9FIRM/92-509-----------------------GNIAGTATAIF------------------------------------------MGGP
D7BM33_ARCHD/59-464-----------------------GNITGIALAMV------------------------------------------LGGP
Q6LSN7_PHOPR/49-454-----------------------GNIAGVAVAIS------------------------------------------LGGP
Q1QSR6_CHRSD/60-472-----------------------GNLAGVAIALW------------------------------------------VGGP
D4LCB5_RUMC1/46-473-----------------------GNIVGVATAIA------------------------------------------AGGP
G4Q7R4_ACIIR/46-452-----------------------GNIIGISTAIC------------------------------------------LGGP
R6PKK8_9CLOT/51-453-----------------------GNIAGIATAIV------------------------------------------AGGP
D5CH05_ENTCC/46-453-----------------------GNLAGVALAIS------------------------------------------AGGP
D2RIK3_ACIFV/46-452-----------------------GNIIGISTALC------------------------------------------LGGF
D4M9Q8_9BACT/49-459-----------------------GNIAGVSTAIY------------------------------------------FGGP
R6J437_9CLOT/52-480-----------------------GNIVGVATAIC------------------------------------------LGGP
C4ZJ27_THASP/46-460-----------------------GNIAGVATAIG------------------------------------------FGGP
E4TGP7_CALNY/48-462-----------------------GNIAGVATAIA------------------------------------------MGGP
C3PIJ7_CORA7/46-477-----------------------GNIAGVATAIA------------------------------------------FGGP
R5FNH5_9ACTN/54-462-----------------------GNIAGIATAVA------------------------------------------LGGP
G7UNE2_PSEUP/46-460-----------------------GNIAGVATAIA------------------------------------------FGGP
J9SBB2_9ACTO/60-499-----------------------GNIAGVATAIA------------------------------------------FGGP
A9IDQ9_BORPD/44-455-----------------------GSIAGVATAIS------------------------------------------AGGP
G2PM93_MURRD/278-683-----------------------GNIAGVAVAVS------------------------------------------LGGA
M4U7B3_9GAMM/46-450-----------------------GNIVGVATAIK------------------------------------------LGGP
A1AZT0_PARDP/75-484-----------------------GNIAGVAVALV------------------------------------------LGGP
G4KZA8_OSCVS/51-471-----------------------GNVAGVAVAIY------------------------------------------LGGP
I0GRA8_SELRL/53-452-----------------------GNIAGVAIAIV------------------------------------------TGGP
K4IFK4_PSYTT/275-681-----------------------GNIAGVAIAVS------------------------------------------LGGA
R7ILK1_9BURK/46-459-----------------------GNIAGVATAIC------------------------------------------FGGP
L0G2I0_ECHVK/46-459-----------------------GNIAGVAMAIA------------------------------------------MGGP
R5BRP1_9FIRM/49-450-----------------------GNIAGIAIAVV------------------------------------------LGGP
R5G1P5_9ACTN/52-470-----------------------GNIVGIATAVV------------------------------------------AGGP
Q11EU9_CHESB/49-451-----------------------GNIAGVAVAIT------------------------------------------LGGP
Y883_HAEIN/48-453-----------------------GNIVGVATAVQ------------------------------------------AGGP
Q2SAS2_HAHCH/49-473-----------------------GNIAGVAAAIG------------------------------------------FGGP
D4ZH12_SHEVD/56-454-----------------------GNMAGVAVAIT------------------------------------------VGGA
H1Z903_MYROD/46-459-----------------------GNIVGVATAIA------------------------------------------YGGP
R5AXG7_9BACE/47-454-----------------------GNIAGVTIAIA------------------------------------------MGGP
D6XWR4_BACIE/59-456-----------------------GNLTGVALAIS------------------------------------------IGGP
R5EZS8_9GAMM/50-454-----------------------GNIAGIAIAVT------------------------------------------LGGP
Q3ICJ9_PSEHT/49-451-----------------------GNLAGVAVAIS------------------------------------------LGGS
I0JHI0_HALH3/58-455-----------------------TNIVGVPIAIS------------------------------------------LGGP
M1P0N1_9CORY/53-457-----------------------GNIVGVATALA------------------------------------------VGGP
D6ZHY8_MOBCV/70-472-----------------------GNIAGVAIAIT------------------------------------------LGGA
D2S4W0_GEOOG/50-455-----------------------GNIAGVAIALT------------------------------------------LGGP
E3GKE4_EUBLK/47-467-----------------------GNIAGMATAIA------------------------------------------LGGP
YRBD_BACSU/46-459-----------------------GNIAGVATAIA------------------------------------------FGGP
A6VYN5_MARMS/44-452-----------------------GNIAGVAVAIT------------------------------------------IGGP
R5QXT9_9FIRM/51-456-----------------------GNIAGISTAIC------------------------------------------LGGS
R5BSJ1_9FIRM/46-462-----------------------GNISGMATAIF------------------------------------------FGGP
A4XPB8_PSEMY/46-459-----------------------GNIAGVATAIT------------------------------------------FGGP
R6Q9I8_9FIRM/48-459-----------------------GSIVGVATALR------------------------------------------AGGP
E1V890_HALED/54-463-----------------------GNLAGVAVAIY------------------------------------------FGGP
G0VMJ7_MEGEL/47-452-----------------------GNIIGVSTAIC------------------------------------------LGGP
B1ZTG5_OPITP/46-460-----------------------GNIAGVATAIA------------------------------------------MGGP
E3PS56_CLOSD/46-460-----------------------GNIAGVATAIG------------------------------------------TGGP
B0TD76_HELMI/46-448-----------------------GNIVGVATAIK------------------------------------------AGGP
B8F6B8_HAEPS/56-460-----------------------GNIGGVATAIA------------------------------------------LGGP
H2G0K3_OCESG/46-460-----------------------GNIAGVATAIT------------------------------------------FGGP
G8PS27_PSEUV/49-455-----------------------GNIAGVAVALT------------------------------------------LGGP
K9TW29_9CYAN/99-504-----------------------GNIAGVAIAIQ------------------------------------------LGGP
D5DB16_BACMD/43-440-----------------------GNITGIAIAIA------------------------------------------LGGP
Q0W2J6_UNCMA/53-469-----------------------GNIAGVATAIV------------------------------------------LGGP
C3AHI8_BACMY/53-467-----------------------GNIAGVATAVA------------------------------------------FGGP
A7IEP7_XANP2/46-450-----------------------GNIAGVAVALT------------------------------------------LGGP
C0R294_BRAHW/49-448-----------------------GNITGVMTAVS------------------------------------------AGGP
R7FY43_9FIRM/55-454-----------------------GNIAGAATALA------------------------------------------IGGP
I3UGJ4_ADVKW/61-451-----------------------GNIAGVATAVV------------------------------------------LGGP
A8MKE1_ALKOO/50-456-----------------------GNVAGVATAIA------------------------------------------LGGP
B1YF48_EXIS2/50-454-----------------------GNIAGVATAIA------------------------------------------LGGP
D5BRV2_PUNMI/84-498-----------------------GNIGGVAVAVT------------------------------------------VGGP
G0J6F2_CYCMS/46-459-----------------------GNIAGVATAIA------------------------------------------MGGP
C7MHV8_BRAFD/47-482-----------------------GNIGGVATAIA------------------------------------------FGGP
ALST_BACSU/49-444-----------------------GNLTGVALAIA------------------------------------------TGGP
R5RWM9_9FIRM/55-469-----------------------GNIAGVTGAII------------------------------------------LGGP
D3UJ87_HELM1/57-462-----------------------GNIAGIAFAIT------------------------------------------VGGQ
R6EEZ2_9FIRM/60-476-----------------------GNIVGVASALV------------------------------------------AGGP
R6MFU2_9FIRM/47-452-----------------------GNIVGVSSAIC------------------------------------------IGGF
R7PRB6_9FIRM/45-450-----------------------GNIVGVATAIK------------------------------------------AGGP
A2SR40_METLZ/55-463-----------------------GNIAGVAVAIV------------------------------------------MGGP
D5DJA6_BACMD/50-450-----------------------GNITGIAIAIA------------------------------------------LGGP
R5AJ95_9FIRM/49-458-----------------------GNVVGVTGAII------------------------------------------AGGA
R5YUK1_9FIRM/62-468-----------------------GNLVGVVAAIS------------------------------------------AGGA
R5Q3U9_9BURK/59-459-----------------------GNLAGVATAIA------------------------------------------MGGP
R7PRF4_9FIRM/49-455-----------------------GNIAGIAIAIT------------------------------------------TGGP
A0Q3K6_CLONN/59-455-----------------------GNLAGVAIAIS------------------------------------------TGGP
R5NYD9_9BACT/51-452-----------------------GNIVGVATAIT------------------------------------------LGGP
B5HEI9_STRPR/73-499-----------------------GNIAGVAVAVS------------------------------------------IGGP
I3TQE6_TISMK/46-452-----------------------GNLAGVAVALY------------------------------------------LGGP
F2JVC9_MARM1/46-446-----------------------GNLAGVAVAIA------------------------------------------LGGP
L0FYG8_ECHVK/279-685-----------------------GNIAGVAIAIS------------------------------------------LGGP
B2GLS0_KOCRD/53-457-----------------------GNIAGVAIAIT------------------------------------------LGGP
C7REC1_ANAPD/49-451-----------------------GSLVGVATAIS------------------------------------------LGGP
B3EMZ0_CHLPB/88-501-----------------------GNIAGVAVAIT------------------------------------------LGGP
I5AXG7_EUBCE/61-477-----------------------GNIAGVAAAIV------------------------------------------SGGP
D2RN33_ACIFV/46-452-----------------------GNIIGISTAIC------------------------------------------LGGP
C5C8M5_MICLC/48-478-----------------------GNIGGVATAIA------------------------------------------FGGP
G4KY93_OSCVS/47-452-----------------------GNIVGVSTAVC------------------------------------------LGGY
G4KWB0_OSCVS/53-452-----------------------GNIAGVSVAIA------------------------------------------TGGP
D3Q113_STANL/44-457-----------------------GNIAGVATAIT------------------------------------------VGGP
I2BD01_SHIBC/46-454-----------------------GNLTGVALAIS------------------------------------------AGGP
R6R8F0_9FIRM/60-473-----------------------GNIVGVATAIV------------------------------------------SGGP
R7HAX2_9FIRM/48-472-----------------------GNIVGVATAMV------------------------------------------AGGP
Q8ECR9_SHEON/46-459-----------------------GNIAGVATAIT------------------------------------------FGGP
Q6NEM1_CORDI/46-477-----------------------GNIAGVATAIA------------------------------------------FGGP
A0QRB1_MYCS2/46-485-----------------------GNIAGVATAIA------------------------------------------FGGP
D2NQ65_ROTMD/71-481-----------------------GTVAGVALAIA------------------------------------------MGGP
F6AHU7_PSEF1/46-452-----------------------GNIAGVATAIA------------------------------------------VGGP
C2X582_BACCE/50-448-----------------------GNITGIAIAIA------------------------------------------LGGP
M4UAD5_9GAMM/46-449-----------------------GNLAGVAIAIT------------------------------------------VGGP
Q6FE01_ACIAD/61-482-----------------------GNIAGVAIAIA------------------------------------------LGGP
Q5E342_VIBF1/63-467-----------------------GNMAGVAVALT------------------------------------------VGGP
D5V3Y8_ARCNC/47-451-----------------------GNIAGVAVAIT------------------------------------------LGGA
F8DYI2_CORRG/49-453-----------------------GNIVGVAIAIT------------------------------------------VGGP
R5H9R9_9FIRM/51-466-----------------------GNIAGITTAVT------------------------------------------LGGP
Q186Q3_PEPD6/63-459-----------------------GNIAGIAIAVV------------------------------------------AGGP
R5XPN0_9CLOT/54-453-----------------------GNIAGISIAIV------------------------------------------GGGP
I4BXH1_ANAMD/47-454-----------------------GNIAGVATALV------------------------------------------SGGP

PF05525

BRNQ_BACSU/6-436-----NLIFP---PM-----------------LG------------------------------------------QLA-
Q9A1E1_STRP1/3-454-----NLIYP---AF-----------------LG------------------------------------------IYS-
BRAB_PSEAE/5-429-----NIIFP---PS-----------------AG------------------------------------------MAA-
Q9CJW8_PASMU/1-426-----NLIFP---PK-----------------LG------------------------------------------FES-
Q8REN9_FUSNN/3-423-----NLIFP---PM-----------------LG------------------------------------------YET-
Q9KU61_VIBCH/6-428-----NIIFP---PL-----------------AG------------------------------------------QLA-
BRNQ_CORGL/2-412-----NLIFP---PM-----------------LG------------------------------------------LSA-
BRAZ_PSEAE/5-429-----NIIFP---PI-----------------VG------------------------------------------LQS-
Q8RH58_FUSNN/3-424-----NLIFP---PM-----------------LG------------------------------------------YEL-
O83289_TREPA/2-440-----NLILP---PL-----------------LG------------------------------------------KHA-
BRAB_BACSU/6-435-----NMIYP---PE-----------------LG------------------------------------------QAA-
BRNQ_HAEIN/3-431-----NIIFP---PM-----------------EG------------------------------------------FSS-
Q97IN0_CLOAB/5-435-----NLIFP---PF-----------------LG------------------------------------------QLS-
Q8XND4_CLOPE/5-434-----NLIFP---PF-----------------LG------------------------------------------QAA-
BRNQ_SALTY/7-429-----NIIFP---PM-----------------VG------------------------------------------LQA-
Q1GBE3_LACDA/7-439-----NLIFP---AY-----------------LG------------------------------------------EAS-
Q2G1H2_STAA8/8-443-----NLIFP---IH-----------------LG------------------------------------------QAA-
Q8DQQ3_STRR6/8-437-----NLIFP---PS-----------------LG------------------------------------------ALS-

PF13520

Q5AQY0_EMENI/33-501.....I..FV...SPR......IVAHLT....GN------------------------------------------K.L.
Q75CJ2_ASHGO/54-501.....I..FA...TPS......TMFVNC....GG------------------------------------------N.A.
Q03U70_LACBA/18-459.....G..FA...A...........FAK....QG------------------------------------------P.T.
A8AGY3_CITK8/5-447FSLPQN..MA...A...........VAS....PA------------------------------------------A.L.
A1T4X6_MYCVP/25-447.....I..FA...LPSQ.....MAGSAA....PG------------------------------------------P.L.
C1DD80_LARHH/11-459....FS..LP...QN.........MAAG....AG------------------------------------------A.G.
D6S3T3_9LACO/11-440.....IFALP...ATL.......TAGAN....PE------------------------------------------G.I.
C9SVT9_VERA1/51-488.....I..FA...TPGS....IVRAVGS....PG------------------------------------------L.A.
B8PBB2_POSPM/39-484.....G..VS...SLF......LYGLTT....GG------------------------------------------P.A.
Q0CXR8_ASPTN/61-493.....I..YY...G...........MGY....AG------------------------------------------T.A.
Q6CAR8_YARLI/33-481.....S..IA...T...........TLSYTLPAG------------------------------------------P.Y.
C7N1A7_SLAHD/31-475.....N..MG...G...........VSS...VMG------------------------------------------A.A.
A1CLI4_ASPCL/51-499.....I..FA...TPGS....IVKSVGS....VG------------------------------------------L.S.
A3GHP8_PICST/45-486.....S.TIF...A..........LSGS....VG------------------------------------------T.A.
B2AVM0_PODAN/75-550.....I..FS...TPSS....IILSINS....VG------------------------------------------M.T.
Q6CLW2_KLULA/73-522.....S..VL...S...........LAL....PG------------------------------------------G.S.
Q12TS7_METBU/31-468.....S..IG...Y...........FASY..LWS------------------------------------------F.A.
A8I1F7_AZOC5/21-530.....G..I................AGT....TG------------------------------------------K.V.
Q75DM0_ASHGO/48-484.....I..FV...VPA.......KIFQL....TG------------------------------------------S.VY
A2R9I4_ASPNC/39-488.....S..IA...T...........TLSYSIPAG------------------------------------------P.V.
Q4PCK9_USTMA/62-513.....T..TF...NS.........PFTL....GG------------------------------------------P.A.
C8VPT6_EMENI/44-469.....S..AI...AA.........SVGS....AG------------------------------------------A.A.
A3LTS7_PICST/18-462.....I..FL...TPAS....VLNSIGS....VG------------------------------------------A.S.
C5MEY2_CANTT/54-503.....L..ST...V...........IGV....GG------------------------------------------S.P.
A5FG51_FLAJ1/9-423.....L..YV...SA........LTILY....AG------------------------------------------Q.Y.
Q4DJK0_TRYCC/39-456.....E..SV...S...........AGG....PL------------------------------------------L.T.
Q4DQR3_TRYCC/175-589.....G..IV...V...........SAA....GR------------------------------------------L.A.
Q73M42_TREDE/10-421.....I..FV...LTG.......LGIAA....TG------------------------------------------K.S.
Q2UFR9_ASPOR/43-476.....S..AI...AH.........STGS....AG------------------------------------------A.S.
Q023N1_SOLUE/24-483.....F..YA...GG.........IAEH....AI------------------------------------------G.K.
B8NAK1_ASPFN/43-512.....G..TP...L...........AYG....GG------------------------------------------P.T.
Q98PQ8_MYCPU/7-477.....I..FF...KNRE.....LLRMAH....GE------------------------------------------L.A.
Q38YR6_LACSS/23-445.....E..IV...V..........VLTT....LS------------------------------------------A.A.
B0D4Q4_LACBS/41-461.....V..IP...A..........VVGV....GG------------------------------------------I.Y.
Q6MS69_MYCMS/8-487.....V..YF...KNKE....ILFDTRN....PI------------------------------------------I.A.
Q01XN7_SOLUE/23-483.....Y..YVGGIA...........EGA....IG------------------------------------------K...
D0NVC6_PHYIT/66-486.....L..FS...AG........QTIAK....AG------------------------------------------KLA.
Q4PIJ5_USTMA/272-694.....A..LP...A..........VVAV....SS------------------------------------------V.L.
Q1IPP3_KORVE/22-486.....Y..YV...GG.........DAEK....VI------------------------------------------G.K.
Q6F2A1_MESFL/11-481.....I..YM...KNSE....LLNQTNN....PI------------------------------------------I.A.
Q8EVP3_MYCPE/28-507.....I..FL...KSSS....ILSNTWY....SL------------------------------------------P.L.
Q6KI68_MYCMO/24-546.....I..FF...KNNEVVRNATFLN.N...PTG------------------------------------------T.IT
Q97VA8_SULSO/20-502.....I..LI...VS........WLYLA....PG------------------------------------------A.N.
E9DET5_COCPS/69-502.....I..FA...TPST....ILALTGS....VG------------------------------------------M.S.
G8PMP4_PSEUV/13-449.....N..MP...L...........MAQ....TG------------------------------------------M.K.
Q0JZA8_CUPNH/34-490.....F..TI...GG.........VSAT....IG------------------------------------------N.P.
Q4AAQ0_MYCHJ/13-424.....F..IA...TI........SNVIS....QG------------------------------------------V.W.
Q4WA88_ASPFU/42-486.....G..SI...AA.........GLLN....GG------------------------------------------P.S.
Q5ZUY4_LEGPH/12-429.....N..LP...A...........AAL....AG------------------------------------------N.Q.
Q6MS71_MYCMS/8-466.....I..YV...KNR......DILIET....HN------------------------------------------P.I.

PF00209

S6A11_MOUSE/45-571--------EI---IGLGN-VW-RFPYLCYKNGGG------------------------------------------AFLI
SC6A9_MOUSE/86-621--------YA---VGLGN-VW-RFPYLCYRNGGG------------------------------------------AFMF
SC6A2_HUMAN/56-580--------FA---VDLAN-VW-RFPYLCYKNGGG------------------------------------------AFLI
SC6A7_RAT/37-561--------YC---VGLGN-VW-RFPYRAYTNGGG------------------------------------------AFLV
SC6A3_BOVIN/60-580--------FA---VDLAN-VW-RFPYLCYKNGGG------------------------------------------AFLV
SC6A6_CANFA/41-568--------GF---VGLGN-VW-RFPYLCYKNGGG------------------------------------------AFLI
Y736_HAEIN/11-497--------SA---VGLGN-IW-RFPYTTYENGGG------------------------------------------AFII
S6A15_RAT/61-644--------FS---VGLGN-VW-RFPYLCQKNGGG------------------------------------------AYLL
SC6A4_RAT/79-600--------YA---VDLGN-IW-RFPYICYQNGGG------------------------------------------AFLL
S6A17_RAT/60-643--------FS---VGLGN-IW-RFPYLCQKNGGG------------------------------------------AYLV
SC6A1_HUMAN/44-559--------YA---IGLGN-VW-RFPYLCGKNGGG------------------------------------------AFLI
S6A13_MOUSE/32-556--------EI---IGLGN-VW-RFPYLCYKNGGG------------------------------------------AFFI
SC6A8_RAT/52-583--------FA---VGLGN-VW-RFPYLCYKNGGG------------------------------------------VFLI
NTDO_CAEEL/40-576--------FA---VDLGN-IW-RFPYLCFKNGGG------------------------------------------VFLI
S6A12_CANFA/36-561--------EI---IGLGN-VW-RFPYLCYKNGGG------------------------------------------AFFI

PF02028

A8LPK2_DINSH/19-510--------YA---L.....FD.IEGLSALVDTSF------------------------------------------AFSA
Q92WM0_RHIME/57-540--------IG---V.....IA.PKRAESIFSGMQ------------------------------------------TAIL
B1YHV0_EXIS2/12-504--------WG---ILPESLIG.AANLGNVTGIAQ------------------------------------------SFVS
A8LQI8_DINSH/15-511--------LV---L.....AF.PSRSADWIDAAR------------------------------------------TLIT
B9LMR4_HALLT/20-531--------AF---F.....IS.PSAVENGISSLN------------------------------------------NQLL
Q9K9K1_BACHD/6-494--------WG---L.....IA.PKNLAAVTKVID------------------------------------------SFIL
A8GBX6_SERP5/19-505--------MT---I.....FF.TDFSGRWITRTL------------------------------------------NWVS
Q24SP9_DESHY/12-494--------WG---V.....FL.PENMANVVNKVF------------------------------------------ALLT
Q8P5D9_XANCP/17-505--------LV---A.....LF.PLDAGRILLDAQ------------------------------------------TWAS
Q7VZR1_BORPE/13-496--------FT---I.....AA.PATAQDFFNVIQ------------------------------------------AWIL
Q5WBX8_BACSK/16-508--------LF---A.....IY.TEESTTLLNRIF------------------------------------------DTIV
Q24ME3_DESHY/23-511--------PM---M.....IF.GTELQPFVAAAL------------------------------------------KAIT
A4RTS9_OSTLU/5-508--------GV---L.....SR.EEAAEEFFGKAT------------------------------------------LWIS
A1TNS1_ACIAC/32-511--------WG---L.....VS.PASLGTFFGTLL------------------------------------------SDIT
A1WTW7_HALHL/25-513--------IA---A.....VD.LDWLSAAVDTTF------------------------------------------GYAT
A0M563_GRAFK/13-496--------LI---F.....VF.TNQFYNSIEELS------------------------------------------LWVR
Q083A6_SHEFN/33-521--------AI---L.....IIDPATSKEFLDGLK------------------------------------------WQII
A3HUC8_9BACT/12-495--------LT---L.....WV.GEPMEEIFLNIK------------------------------------------DFIT
Q7NQ38_CHRVO/2-486--------WG---A.....VA.PGHMTAAASEWL------------------------------------------SFTI
Q73N94_TREDE/25-518--------LV---L.....FF.PVESMKVVDALW------------------------------------------SVFV
Q8FNC7_COREF/25-515--------AT---V.....IL.GDTARDGFSAMA------------------------------------------GWLL
A7HWC8_PARL1/21-507--------WT---M.....FF.IDSANFVINSVL------------------------------------------AWIS
Q47TJ2_THEFY/57-547--------WG---A.....IS.DETLAQVAENLL------------------------------------------AGLM
A7HZZ0_CAMHC/11-495--------FV---L.....FL.PDFSLKYLKMTQ------------------------------------------EFLT
A1WT60_HALHL/15-497--------SA---A.....VW.TEAVGDWIAELQ------------------------------------------TFIA
Q88C09_PSEPK/15-521--------FC---A.....LF.AEHAAAVFQRAS------------------------------------------DFIL
Q2FYT0_STAA8/17-503--------LG---A.....FL.PEQFNYVTNNIK------------------------------------------MWIT
A4J208_DESRM/13-498--------LI---I.....KD.PVRANEISNKAL------------------------------------------TWTT
A3CRU5_METMJ/11-494--------FG---V.....AR.PDLLDSASSAVH------------------------------------------AAIL
A1WTL9_HALHL/51-540--------GT---L.....IF.TAPAQEALEGVR------------------------------------------GWAT
Q8ESD6_OCEIH/10-503--------PL---I.....LF.PKAGSEVINSAN------------------------------------------RFVT
A1WY53_HALHL/17-503--------AG---A.....IW.PKHLEAVVTGWR------------------------------------------ESLT
O83144_TREPA/10-507--------LF---I.....SF.PDISHRVIGTLL------------------------------------------NILV
Q9JZ61_NEIMB/17-502--------LV---L.....TV.PDQVQMWLDRAK------------------------------------------EVIF
Q30W47_DESAG/28-510--------IT---L.....VF.QHFLGDVFQTMQ------------------------------------------SYMS
Q9KCW2_BACHD/16-501--------WG---A.....VS.PSSLEWAAGIGL------------------------------------------GWMI
A4FCK8_SACEN/14-506--------WG---V.....LA.PGHVSAVAGAAN------------------------------------------SFIT
Q6NER6_CORDI/66-556--------WA---F.....FA.REKAATALGAVT------------------------------------------EWIS
A4XAA8_SALTO/18-503--------WG---I.....LA.SESISAVGETGL------------------------------------------TWVI
A0Q2F1_CLONN/9-486--------WA---L.....FF.QQGFNDIVNSAL------------------------------------------DWIS
Q5WHJ4_BACSK/13-493--------VG---I.....SA.PARLEAITAAAQ------------------------------------------AFIA
Q03DR2_PEDPA/2-485--------IL---I.....TG.GPAVQQLMNALL------------------------------------------SFVT
A1WWT9_HALHL/15-504--------FG---A.....WD.PEYAETVFEGIS------------------------------------------GWVI
Q8NN75_CORGL/48-536--------WG---I.....SS.PDSVSSVSSTMF------------------------------------------SWAM
Q4KIJ7_PSEF5/28-512--------IA---L.....ID.LNTLSSLIGHAF------------------------------------------TWST
Q6F754_ACIAD/16-498--------IV---I.....LA.PDAFELLTQQLK------------------------------------------NWIT
Q4JV07_CORJK/39-530--------WA---A.....VA.SDNFDSVVGGIT------------------------------------------GWLT
Q1GUM7_SPHAL/19-507--------LS---L.....WR.GEAVVTAETVIN------------------------------------------NWIL
Q5V5Y7_HALMA/44-539--------IT---I.....LL.GDTAASAYTWLF------------------------------------------NTIG
Q4JU17_CORJK/21-505--------WG---V.....FG.GDSFAAFASTAL------------------------------------------SYVV
Q6ANF3_DESPS/20-505--------FG---A.....IY.PEILGKYAMAGR------------------------------------------AYIA
A8EUT8_ARCB4/9-492--------FT---F.....IN.PALSKDIFTTTK------------------------------------------NFIA
Q1QZD1_CHRSD/9-499--------AS---Y.....VD.LDAFLATASALN------------------------------------------DAIL
A6VY67_MARMS/19-509--------FS---I.....LN.VDLSNAIANGIN------------------------------------------AWIQ
Q3IIZ4_PSEHT/14-498--------GT---S.....SN.PELAGKAFSIAL------------------------------------------TWIT
Q5HKM4_STAEQ/12-498--------IA---G.....IF.PKAFGMYAQSVY------------------------------------------DWIT
Q1AY03_RUBXD/14-498--------WG---V.....FF.TESLSAAASAAL------------------------------------------GYVI
Q8ESZ5_OCEIH/13-497--------LS---L.....LS.KDKVGEWVNTLF------------------------------------------TYSS
Q8ET62_OCEIH/7-489--------LG---A.....IF.PVKFEQISQSVQ------------------------------------------AWVS
Q1QZU3_CHRSD/9-494--------IG---A.....AF.PERFGSAASSAL------------------------------------------SGIS
A4FIK1_SACEN/20-504--------WA---T.....LF.TENLNAVTSTAL------------------------------------------NRVT
Q8ESH6_OCEIH/15-502--------LA---L.....IN.KEMVTDAVNTMF------------------------------------------NWSV
Q9HQN5_HALSA/21-504--------AG---F.....RR.PTQLSTVLNGAF------------------------------------------DWVL
Q6LGN5_PHOPR/6-492--------WG---I.....AD.TAGLAEFSSTVV------------------------------------------GIMF
Q6ANF9_DESPS/22-508--------CG---A.....LF.PDLLYKAGITTM------------------------------------------KYLT
A5I0X2_CLOBH/10-487--------LA---F.....FN.IDAFAKSTKNIL------------------------------------------NFLL
E0TGG2_PARBH/42-529--------VT---L.....LF.QDSASSVLLGAR------------------------------------------DWVL
A1U5B2_MARAV/17-501--------LA---I.....PF.DQAVASSFGQLT------------------------------------------GWVA
Q5V633_HALMA/130-615--------LQ---I.....AF.PARTTGAVDAAA------------------------------------------ATVL
Q5LNL7_RUEPO/27-596--------WA---L.....VW.PANANGVLGSLN------------------------------------------WRLL
Q8FM43_COREF/17-511--------IT---I.....VA.GDTVSDVFGTAS------------------------------------------DWLL
A6W731_KINRD/41-528--------VG---A.....VW.PEQLQSGADAVL------------------------------------------EVVV
E0TC76_PARBH/7-483--------AA---L.....VW.PAVLSRVLRQVS------------------------------------------DGFL
Q6FDF6_ACIAD/20-509--------LF---V.....LF.PETSQHGLTWIQ------------------------------------------QQVN
Q24SQ4_DESHY/13-501--------WG---V.....VD.SEGLSHVSNTIL------------------------------------------DYII
A4SA86_OSTLU/1-471--------WV---L.....VD.ETGSSSEVTRWT------------------------------------------KWIT
B1HZN6_LYSSC/11-493--------IG---A.....II.PEQFKNGANSVF------------------------------------------HMTT
B2FT71_STRMK/40-523--------LA---G.....IA.PGPFNTVVQSML------------------------------------------AEVI
B4EHS6_BURCJ/16-501--------VC---A.....LH.PSEAGALFSAGQ------------------------------------------QWVI
B7VLA5_VIBSL/13-502--------PL---I.....LF.PAQGADWIAVAK------------------------------------------TFMT
B7VQN7_VIBSL/33-520--------TL---L.....ALPPADAKAAIDSIK------------------------------------------GAVL
B8CV80_SHEPW/23-508--------FT---V.....KD.LDAANLVIKEVF------------------------------------------HYLT
M1F781_9ALTE/23-507--------FS---L.....FD.LKGVADLIGTGF------------------------------------------AWTA
M9X2A3_PASHA/17-499--------FC---I.....IF.PQQAQTSLDTIK------------------------------------------NSLF
Y917_MYCTU/23-509--------VS---V.....VY.SSVAENAFVRLN------------------------------------------SAIT
Q2FW63_STAA8/9-491--------FG---A.....IF.PKQLEKLTQNIT------------------------------------------TFIA
Q4FTS7_PSYA2/19-509--------WT---I.....VF.PTYSGALLGAGM------------------------------------------AWVS
Q6LRW5_PHOPR/30-506--------AA---L.....ID.LPRFTLLIQELF------------------------------------------SAAA
Q814I8_BACCR/12-494--------AV---F.....LN.KDYVESAINKSF------------------------------------------AFSI
Q81K57_BACAN/7-498--------WG---IIPESIIG.KGSLGNVTTAIQ------------------------------------------TALV
Q81YS8_BACAN/8-499--------WG---ITPASWIQ.GYDLQSVTSSLN------------------------------------------SFIL
Q87J97_VIBPA/48-525--------LA---L.....TN.TESLTAMVNAGF------------------------------------------GFAT
Q8DZH9_STRA5/9-487--------LG---I.....IV.PRGFQSWTQILR------------------------------------------EQVS
U5LC86_9BACI/7-489--------VG---I.....FA.PNQLESVTAGLQ------------------------------------------DFIS

PF13906

B4KYY5_DROMO/548-598--------------------------------------------------------------------------------
Q9LD96_ORYSJ/520-570--------------------------------------------------------------------------------
B4IZ20_DROGR/535-589--------------------------------------------------------------------------------
Q0DQ28_ORYSJ/515-565--------------------------------------------------------------------------------
Q16RD4_AEDAE/393-443--------------------------------------------------------------------------------
B9I635_POPTR/565-615--------------------------------------------------------------------------------
B4NQ70_DROWI/627-677--------------------------------------------------------------------------------
C3XPQ7_BRAFL/527-577--------------------------------------------------------------------------------
C5LVE9_PERM5/263-313--------------------------------------------------------------------------------
C5KQZ0_PERM5/326-376--------------------------------------------------------------------------------
O44798_CAEEL/507-557--------------------------------------------------------------------------------
A9TH89_PHYPA/537-587--------------------------------------------------------------------------------
B4HLB6_DROSE/535-585--------------------------------------------------------------------------------
CAAT3_ARATH/534-584--------------------------------------------------------------------------------
D2HFL8_AILME/627-677--------------------------------------------------------------------------------
B5DFJ0_RAT/540-590--------------------------------------------------------------------------------
B0WAU2_CULQU/428-473--------------------------------------------------------------------------------
O17069_CAEEL/508-558--------------------------------------------------------------------------------
Q337V1_ORYSJ/559-609--------------------------------------------------------------------------------
A4FEQ4_SACEN/56-106--------------------------------------------------------------------------------
B4LDP2_DROVI/508-558--------------------------------------------------------------------------------
D0NG02_PHYIT/81-131--------------------------------------------------------------------------------
B7QME9_IXOSC/429-479--------------------------------------------------------------------------------
B0WAU5_CULQU/549-599--------------------------------------------------------------------------------
C5X0K3_SORBI/540-590--------------------------------------------------------------------------------
CTR2_CHICK/555-605--------------------------------------------------------------------------------
CAAT4_ARATH/528-578--------------------------------------------------------------------------------
B9SAY1_RICCO/451-501--------------------------------------------------------------------------------
A4IG22_DANRE/575-625--------------------------------------------------------------------------------
B9IPU3_POPTR/568-618--------------------------------------------------------------------------------
C5WR23_SORBI/560-610--------------------------------------------------------------------------------
D7SLW7_VITVI/530-579--------------------------------------------------------------------------------
E9PWS4_MOUSE/604-654--------------------------------------------------------------------------------
F1MWA9_BOVIN/427-477--------------------------------------------------------------------------------
F6HLX0_VITVI/454-504--------------------------------------------------------------------------------
F6SWF3_XENTR/559-609--------------------------------------------------------------------------------
F6YB26_XENTR/150-200--------------------------------------------------------------------------------
F7E7U9_XENTR/599-649--------------------------------------------------------------------------------
G1MMB4_AILME/534-584--------------------------------------------------------------------------------
G1MNG0_AILME/556-606--------------------------------------------------------------------------------
H0V5U0_CAVPO/558-608--------------------------------------------------------------------------------
H3C2Q0_TETNG/530-580--------------------------------------------------------------------------------
H3CER8_TETNG/575-625--------------------------------------------------------------------------------
I1N8D3_SOYBN/561-611--------------------------------------------------------------------------------
K7V036_MAIZE/517-566--------------------------------------------------------------------------------
M0QVZ8_BOVIN/550-600--------------------------------------------------------------------------------
Q2FYJ4_STAA8/386-437--------------------------------------------------------------------------------

PF00860

YWDJ_BACSU/1-392--------AI---V--------VPVAVAQ-S...------------------------------------------FHL-
PYRP_BACSU/17-396--------TI---L--------VPKLVGM-S...------------------------------------------...-
PUCJ_BACSU/6-391--------AI---L--------VPLLVGR-A..L------------------------------------------NVT-
O18061_CAEEL/19-439--------LL---V--------TPYFVSN-LLCA------------------------------------------GAE-
UACT_ECOLI/28-412--------AV---A--------VPLMIGD-R..L------------------------------------------GLS-
Q18771_CAEEL/30-454--------LL---T--------VPLIMAD-SMCP------------------------------------------GSS-
PBUX_BACSU/6-386--------AI---V--------VPLIVGK-A..M------------------------------------------GLT-
YBBY_ECOLI/8-396--------TV---V--------VPPTLLS-AFQL------------------------------------------P..-
PBUO_BACSU/12-396--------VV---V--------NPVILAN-A...------------------------------------------.G.-
RUTG_ECOLI/30-404--------TV---L--------MPILMGL-D...------------------------------------------...-
GHXP_ECOLI/26-410--------VI---V--------VPGMLGK-A...------------------------------------------.G.-
URAA_ECOLI/15-385--------TV---L--------VPVLFHI-N...------------------------------------------...-
S23A3_MOUSE/80-476--------CG---L--------STVLQTW-M..G------------------------------------------...-
O18057_CAEEL/15-435--------LL---V--------IPYVVSD-MLCA------------------------------------------GDQ-
URAA_HAEIN/16-385--------LV---L--------VPLITGL-D...------------------------------------------...-
PUCK_BACSU/8-388--------AI---L--------VPLIVGA-A..I------------------------------------------GLN-
Y125_HAEIN/18-399--------VI---V--------VPNMLGA-A...------------------------------------------.G.-
XANP_ECOLI/34-427--------VI---T--------PALLICQ-A..L------------------------------------------GLP-
XANQ_ECOLI/22-416--------MV---T--------PALIVGA-A..L------------------------------------------QLS-
Q5L0U7_GEOKA/15-387--------TI---L--------VPYLVGL-D...------------------------------------------...-

PF00324

BAP2_YEAST/99-567--------LL---V--------ANAKGLH-YGGP------------------------------------------AAL.
GABP_BACSU/16-456--------LF---V--------GSGSVIH-STGP------------------------------------------.GA.
S12A9_HUMAN/42-536--------VF---L--------RIGFVVG-HAGL------------------------------------------LQA.
HUTM_BACSU/19-465--------LF---L--------STGYTLH-QAGP------------------------------------------GGT.
LYSP_ECOLI/21-480--------LF---V--------ASGATIS-QAGP------------------------------------------GGA.
AGP3_YEAST/57-511--------CL---V--------GAGNALN-KGGP------------------------------------------LAL.
S12A1_MOUSE/178-682--------LF---I--------RLSWIVG-EAGI------------------------------------------GLG.
CYCA_ECOLI/27-470--------LF---M--------GSGKTIS-LAGP------------------------------------------.SI.
GABP_ECOLI/18-458--------LF---V--------GSSVAIA-EAGP------------------------------------------.AV.
ISP5_SCHPO/87-545--------VW---V--------GSKNTLR-EGGA------------------------------------------ASV.
TPO5_YEAST/59-532--------MC---T--------SMAIGLI-NGGP------------------------------------------LTI.
PUT4_YEAST/114-588--------LL---V--------GTSSTLH-TCGP------------------------------------------AGL.
AGP2_YEAST/92-565--------LF---V--------AIGKALY-RGGP------------------------------------------ASL.
GAP1_YEAST/94-560--------LL---V--------GSGTALR-TGGP------------------------------------------ASL.
Q9HKE0_THEAC/16-471--------IL---S--------GLIVSIV-GLSG------------------------------------------INA.
Q98QR4_MYCPU/13-498--------IF---F--------KNGSVGR-AVEH------------------------------------------NGTS
Q9HJ13_THEAC/2-455--------DI---A--------ILLVATF-SIAG------------------------------------------SRT.
ANSP_SALTY/34-477--------LF---L--------GAGARLQ-MAGP------------------------------------------ALA.
Q9VTW8_DROME/217-716--------LF---L--------RLSWVVG-QAGV------------------------------------------IEG.
Q97VA6_SULSO/25-513--------LL---F--------STYYVAS-TGPL------------------------------------------VGGN
ALP1_YEAST/74-540--------LI---I--------GIGPPLA-HAGP------------------------------------------VGA.
AROP_ECOLI/19-457--------LF---L--------GSASVIQ-SAGP------------------------------------------.GI.
F1MS08_BOVIN/282-784--------LF---I--------RLSWIVG-QAGI------------------------------------------GLS.
G9NX48_HYPAI/69-534--------FF---V--------GSGGALA-KGGP------------------------------------------GSL.
S12A3_MOUSE/139-644--------LY---L--------RLPWITA-QAGI------------------------------------------VLT.

PF02554

Q73V96_MYCPA/49-425--------FR---F--------YARLIER-KIVH------------------------------------------PRDD
Q1IKI0_KORVE/33-409--------YR---F--------YSKFIAT-KVLV------------------------------------------LDSR
W0PIG8_9BURK/37-414--------YR---Y--------YSRFIAN-KVFE------------------------------------------LNPQ
Q8NSL6_CORGL/37-415--------FS---F--------YARLIEY-KVVK------------------------------------------PKDQ
B3E5B6_GEOLS/1-379--------YR---Y--------YGLFIAN-KVLN------------------------------------------LQAE
D3SLN0_THEAH/33-404--------YR---Y--------YSWFIAY-RVLG------------------------------------------VDDS
Q1AYY2_RUBXD/34-410--------YR---F--------YARFIQT-RVLE------------------------------------------TDDS
C5B2E8_METEA/32-408--------YR---Y--------YSLFIAD-KVMR------------------------------------------LDPK
R5ZHV1_9ACTN/1-390--------YL---G--------YGRWLAN-K.WG------------------------------------------VDKE
D4YZ07_SPHJU/29-402--------YR---Y--------YALYIAR-HVMR------------------------------------------LDPS
G8RRI7_MYCRN/67-445--------FR---F--------YARLIEM-NIVK------------------------------------------PRDD
B5HN22_9ACTO/35-411--------YR---F--------YAKFIAY-KVLK------------------------------------------VDAT
Q5YQA1_NOCFA/54-432--------YR---L--------YARFIEW-KITK------------------------------------------PRDD
F8GFU4_NITSI/34-409--------YR---F--------YSLFIAN-RVLK------------------------------------------LDST
I6YY40_MELRP/1-360--------YR---I--------YGNFISN-K.FS------------------------------------------IDGN
Q213E9_RHOPB/39-416--------YR---F--------YGLFIAE-KVLG------------------------------------------VDPK
B1ZS08_OPITP/41-415--------YR---F--------HSAWLMA-KVLT------------------------------------------LDEL
Q9HVI3_PSEAE/35-412--------YR---Y--------YSLFIAS-KVMQ------------------------------------------LDPN
Q5L2D3_GEOKA/32-409--------YR---F--------YSRFIAR-KVFG------------------------------------------LDDN
Q9KBY1_BACHD/3-388--------YR---Y--------YSKFIAE-RIYR------------------------------------------LDPN
I4WZC7_9GAMM/39-416--------YR---F--------YGKFVEH-SVLQ------------------------------------------LDPS
F8JAH8_HYPSM/32-409--------DR---F--------YARFIAD-RVLR------------------------------------------LDAD
Q8RBF1_THETN/1-380--------YR---F--------YGAWIGA-KILA------------------------------------------FDEN
R6ZB35_9ACTN/1-384--------YL---V--------YGRWLAK-T.WG------------------------------------------IDRE
D2SAU5_GEOOG/54-430--------YR---F--------YAKFIAR-RVLQ------------------------------------------VDDR
W5Y2A8_9CORY/68-445--------YS---F--------YARYVEL-RIVK------------------------------------------PRAD
F4H7H1_CELFA/61-439--------YR---F--------YARLVEA-KVVR------------------------------------------PRDD
I4BUN1_ANAMD/1-359--------YI---F--------YGGWLAK-Q.WG------------------------------------------LNPQ
A8FG20_BACP2/1-378--------YR---L--------YGTFMMV-KVLK------------------------------------------VTDD
L0B638_9PROT/36-414--------YR---Y--------YSRFIAH-KVFQ------------------------------------------LNAK
F0S490_DESTD/4-376--------YF---T--------YGKFLSK-KVFK------------------------------------------LDDK
Q7P007_CHRVO/32-409--------YR---F--------YGRFIAD-KVLE------------------------------------------LDPR
R5ZC92_9FIRM/1-380--------YV---F--------YGRYLVK-T.WG------------------------------------------IDVN
B8DLB6_DESVM/1-381--------YR---F--------YGLFLTR-TVLG------------------------------------------VKPG
D6Z9X1_SEGRD/53-430--------YR---C--------YAKFIER-NVVR------------------------------------------PRDE
D7B6A0_NOCDD/50-427--------YR---F--------YARFIQY-KVLI------------------------------------------TDDT
Q2JA57_FRASC/58-431--------YR---F--------YARFIAN-RVLR------------------------------------------VDDS
R6FJL5_9FIRM/1-374--------YL---L--------YGRYLQK-K.WG------------------------------------------IDPN
C6WTH2_METML/32-409--------YR---F--------YAAWIAA-KVLV------------------------------------------IDET
I4CCQ1_DESTA/1-369--------YR---F--------YARYIDS-KVIQ------------------------------------------ADSK
A8ESS3_ARCB4/29-406--------YR---F--------YGRFIAY-KVLE------------------------------------------LDKN
C7MT52_SACVD/47-424--------YR---F--------YARFILT-KVLK------------------------------------------ADDK
D7WD84_9CORY/71-449--------FS---L--------YARLVEY-KVVK------------------------------------------PRNT
W0L393_SERFO/32-409--------YR---F--------YSLFIAK-NVFE------------------------------------------LDDR
Q1LHD0_RALME/33-409--------YR---Y--------YSRFIAD-KVMQ------------------------------------------LDPN
G8ASJ6_AZOBR/32-409--------YR---Y--------YSLFIAT-RVMR------------------------------------------LDPA
E1QXU3_OLSUV/1-389--------YI---G--------YGRWLAK-S.WG------------------------------------------VDSG
A7MKY8_CROS8/32-414--------YR---F--------YGLYIAK-KVLA------------------------------------------VDPT
C7RPJ8_ACCPU/32-409--------YR---Y--------YSLFIAD-KVMQ------------------------------------------LDST
B2GG33_KOCRD/69-446--------YR---F--------YSKFIEM-KLTR------------------------------------------PDDR
Q1QW04_CHRSD/1-387--------YR---F--------YSKFIAE-RIYR------------------------------------------LDAD
A0LP60_SYNFM/1-400--------YR---I--------YGKYISK-V.FE------------------------------------------ENDA
Q604D8_METCA/34-407--------YR---F--------YSAFVAT-RVLL------------------------------------------LDAG
B9M2N4_GEODF/1-381--------YR---F--------YGLFIAR-RVMA------------------------------------------LNDD

PF01566

Q21433_CAEEL/63-449--------WV---L--------LVSHIVG-M-------------------------------------------------
NRAM2_ORYSJ/90-453--------WL---L--------LWATVMG-A-------------------------------------------------
NRAM2_DICDI/170-526--------WV---L--------LFSNIMA-L-------------------------------------------------
A5FYD3_ACICJ/37-386--------LL---Q--------FILIPIL-F-------------------------------------------------
Q6AKY6_DESPS/42-387--------WV---V--------ILSAVFG-T-------------------------------------------------
Q882X3_PSESM/25-384--------FV---V--------VLASLSG-M-------------------------------------------------
A4XLU3_CALS8/27-379--------WV---V--------LLSTIIL-I-------------------------------------------------
B2JMU6_BURP8/43-408--------WT---M--------LLTYPLM-V-------------------------------------------------
Q8AA36_BACTN/43-395--------WV---V--------TLSTIML-I-------------------------------------------------
Q8ESA4_OCEIH/39-387--------WA---V--------LFSILAT-I-------------------------------------------------
Q3AF37_CARHZ/37-388--------WG---L--------LLITFSL-A-------------------------------------------------
Q7NSE8_CHRVO/64-420--------WT---L--------ILLIPVL-Y-------------------------------------------------
A6LBT1_PARD8/40-392--------WV---V--------TFSSVML-I-------------------------------------------------
Q8I3M7_PLAF7/268-619--------WI---M--------VYGHMLG-F-------------------------------------------------
A4S7A4_OSTLU/17-379--------WV---L--------LWATLGG-W-------------------------------------------------
B2UC67_RALPJ/70-426--------WT---L--------LLLIPVL-Y-------------------------------------------------
Q5V6I3_HALMA/26-374--------WT---M--------VFSIVAT-I-------------------------------------------------
Q1AYA4_RUBXD/47-394--------WV---V--------ACADLVA-V-------------------------------------------------
NRAM5_ARATH/90-453--------WL---L--------LWATLMG-L-------------------------------------------------
Q21Z51_ALBFT/33-398--------WT---M--------VLTLPLM-V-------------------------------------------------
Q1J0H3_DEIGD/66-414--------WV---I--------LAANLMA-M-------------------------------------------------
Q2GAH9_NOVAD/42-407--------WA---L--------LFSLPLM-A-------------------------------------------------
Q24C68_TETTS/50-400--------WV---L--------FLATALG-F-------------------------------------------------
Q01SI9_SOLUE/31-396--------WT---A--------LFCFPLM-V-------------------------------------------------
Q4JWM2_CORJK/25-368--------WV---L--------VVANLMA-M-------------------------------------------------
Q0S6I8_RHOSR/42-391--------WV---L--------VLANAMA-V-------------------------------------------------
Q01UU9_SOLUE/52-406--------WV---L--------VMSNLMA-V-------------------------------------------------
MNTH_GRABC/58-408--------WV---V--------AAANLIA-M-------------------------------------------------
A5FLF3_FLAJ1/44-400--------WV---L--------LMSNLMA-L-------------------------------------------------
A0LSF9_ACIC1/91-445--------WV---L--------LLLIPVL-I-------------------------------------------------
F2G2M1_ALTMD/20-372--------WA---L--------LFSIFAT-I-------------------------------------------------
A0LFY7_SYNFM/33-383--------WV---V--------IASNAMA-I-------------------------------------------------
A2TXR3_9FLAO/37-396--------WV---L--------FLSCLFS-G-------------------------------------------------
MNTH_CHRSD/52-403--------WV---V--------LAANLMA-M-------------------------------------------------
A6M0Q0_CLOB8/54-403--------WV---I--------LFSNLMA-I-------------------------------------------------
Q2L2L8_BORA1/38-396--------MV---V--------LAAAVLA-M-------------------------------------------------
Q0W8Z5_UNCMA/41-392--------WT---L--------IPIAIVL-V-------------------------------------------------
NRAM1_DICDI/94-450--------WV---L--------FWSTVIG-F-------------------------------------------------
Q15PP3_PSEA6/27-386--------WV---L--------LLSCLFS-G-------------------------------------------------
Q3IH27_PSEHT/19-373--------WT---L--------LFSVIAT-I-------------------------------------------------
Q89BW0_BRADU/52-418--------WT---M--------LLSYPLM-A-------------------------------------------------
B5E9R2_GEOBB/31-382--------WT---L--------IPITVAL-V-------------------------------------------------
B4SC14_PELPB/34-385--------WV---V--------TLGTLML-V-------------------------------------------------
A6W550_KINRD/43-391--------WV---L--------VLANAMA-V-------------------------------------------------
B0ULW7_METS4/44-412--------WT---L--------LYSYPLM-A-------------------------------------------------
MNTH_THETN/43-392--------WV---I--------LWSNVIA-I-------------------------------------------------
Q97LD4_CLOAB/40-392--------WI---V--------TLSTIML-I-------------------------------------------------
Q31GI7_THICR/35-390--------WV---I--------TLASLVA-I-------------------------------------------------
Q18IT5_HALWD/34-375--------WV---V--------VISAIFG-A-------------------------------------------------
A9C0V2_DELAS/70-429--------AV---I--------FASNLMA-M-------------------------------------------------
Q97DZ1_CLOAB/30-381--------WG---L--------LLITFSL-A-------------------------------------------------
A4CKX6_ROBBH/21-369--------WA---L--------LLSVVAT-I-------------------------------------------------
MNTH_ACICJ/51-400--------WV---V--------LLASLIA-M-------------------------------------------------
Q5WIT7_BACSK/38-386--------WA---V--------IFSIIAT-I-------------------------------------------------
A2SEC8_METPP/40-393--------WV---L--------LASNIIA-V-------------------------------------------------
Q5V5I1_HALMA/54-394--------WV---V--------VLSAGAG-A-------------------------------------------------
A5G362_GEOUR/45-396--------WV---M--------IPTTIAL-V-------------------------------------------------
Q7P0J1_CHRVO/53-410--------WV---V--------MLSGIAA-M-------------------------------------------------
B1YM03_EXIS2/34-380--------WV---I--------VAANLMA-V-------------------------------------------------
Q1IV65_KORVE/40-399--------SV---V--------LISSLMA-I-------------------------------------------------
Q74JG3_LACJO/54-437--------ST---I--------LISSLMA-M-------------------------------------------------
Q0SCQ4_RHOSR/43-390--------WV---I--------AVSTIFM-L-------------------------------------------------
Q5FP93_GLUOX/65-424--------CV---I--------MLSNLMA-I-------------------------------------------------
Q3ABN3_CARHZ/35-384--------IT---V--------LLCNFLA-I-------------------------------------------------
Q6A673_PROAC/25-375--------WV---L--------VVANVVA-M-------------------------------------------------
Q8LKG7_CHLRE/112-473--------FV---V--------LCSSLCA-M-------------------------------------------------
A4FCR3_SACEN/23-373--------WV---I--------AVSTVLM-L-------------------------------------------------
A4XIU1_CALS8/36-387--------WG---L--------FLITISL-A-------------------------------------------------
Q3IQM6_NATPD/26-374--------WT---I--------AFSILAT-M-------------------------------------------------
Q2LVH8_SYNAS/49-400--------WL---L--------IPITGAL-I-------------------------------------------------
MNTH_NOSS1/49-408--------TV---I--------LLSNLMA-I-------------------------------------------------
B8I817_CLOCE/56-405--------WV---I--------LWSNIMA-I-------------------------------------------------
Q5QVV5_IDILO/23-379--------WA---L--------LFSVVAC-V-------------------------------------------------
A6LYR0_CLOB8/35-386--------WG---L--------LLITFSL-A-------------------------------------------------
A1A393_BIFAA/49-397--------WV---L--------VLANCMS-V-------------------------------------------------
A4YWA6_BRASO/74-430--------SV---A--------LLSNLMA-I-------------------------------------------------
A4YYM6_BRASO/41-406--------WT---V--------FLTTPFM-I-------------------------------------------------
B4EFC9_BURCJ/73-427--------WT---L--------LLLVPVL-Y-------------------------------------------------
C3AU46_BACMY/55-403--------WV---I--------LASNLMA-V-------------------------------------------------
C5B0F9_METEA/57-413--------SV---I--------LLSNLMA-I-------------------------------------------------
C6XTY0_PEDHD/53-406--------WV---L--------LMSNLIA-L-------------------------------------------------
F6HR32_VITVI/38-391--------AL---M--------LVFNFAA-V-------------------------------------------------
K4CQH6_SOLLC/39-392--------ML---V--------LLFNFAA-I-------------------------------------------------
MNTH_ECOLI/38-384--------WV---V--------VWANLMA-M-------------------------------------------------
MNTH_MYCTU/52-400--------WV---I--------VAANVMA-A-------------------------------------------------
NRAM1_ORYSJ/56-417--------WV---I--------LIGLIFA-L-------------------------------------------------
Q2YM61_BRUA2/67-424--------SV---V--------LLSNLMA-V-------------------------------------------------
Q63LP7_BURPS/56-403--------WV---V--------LAANVIA-M-------------------------------------------------
Q8RBX2_THETN/42-393--------WM---V--------TLSTIML-I-------------------------------------------------
MNTH_RALSO/56-415--------FV---V--------LLSSLAA-M-------------------------------------------------
MNTH_LISMO/61-418--------SV---I--------LISNILA-V-------------------------------------------------
R6A200_9ACTN/11-363--------WI---V--------TLSTIML-I-------------------------------------------------
R7G054_9FIRM/36-390--------WM---V--------TLSTVML-I-------------------------------------------------
U5LI50_9BACI/48-387--------WA---L--------VIVVIFM-M-------------------------------------------------

PF16983

H1XTW9_9BACT/228-347--------AV---Y--------AANDSCH-TLWG------------------------------------------....
R1D8E1_EMIHU/206-332--------AV---V--------ATAKLAE-DRSP------------------------------------------RLPL
D0NZ41_PHYIT/248-371--------SV---V--------ALESLAV-ELFP------------------------------------------....
E9CCE9_CAPO3/225-344--------SV---I--------AVCSLSN-SLFP------------------------------------------....
L1IN17_GUITH/365-490--------SC---I--------AVCQLAE-DLYP------------------------------------------....
Q1K6N8_NEUCR/339-455--------KP---L--------SSPTSAE-EG..------------------------------------------....
B7G755_PHATC/291-424--------SV---I--------SLCCLAS-TLYV------------------------------------------PDSL
B8LD85_THAPS/362-493--------SV---I--------SVCCLAH-NLYP------------------------------------------EKRQ
C5KXR7_PERM5/251-372--------SV---I--------SVCALAR-ELFG------------------------------------------....
F4P234_BATDJ/206-328--------SV---I--------AVSKLAD-DLYP------------------------------------------....
B2VWE0_PYRTR/184-310--------SV---I--------AASALAS-DLLP------------------------------------------SPPH
G1X8D7_ARTOA/231-351--------SV---V--------AVTYLSA-DLLP------------------------------------------....
F9X8H4_MYCGM/221-342--------SV---L--------AVVSLAE-SLFP------------------------------------------....
M2LEF6_BAUCO/225-346--------SI---L--------AVVSLAS-SLFP------------------------------------------....
N1PTW8_MYCP1/227-348--------SI---L--------AVTSLSA-SLFP------------------------------------------....
D5GPI6_TUBMM/223-344--------SV---I--------AVRYLCE-DLMP------------------------------------------....
F0XEP8_GROCL/230-351--------SV---V--------AVSALAS-DLLG------------------------------------------....
G4N1B8_MAGO7/224-344--------SV---I--------AVSALSA-DLLP------------------------------------------....
J3P3C4_GAGT3/224-344--------SV---V--------AASALAA-DLFP------------------------------------------....
M7SFI7_EUTLA/228-348--------SV---I--------AASALAS-DLLP------------------------------------------....
C9SGN6_VERA1/226-346--------SV---I--------AVSALAT-DLLP------------------------------------------....
G3JR94_CORMM/229-349--------SV---I--------AVTALAA-DLLP------------------------------------------....
L2GB72_COLGN/231-351--------SV---I--------AVSALAA-DLLP------------------------------------------....
M1W0F8_CLAP2/229-349--------SV---L--------AVNALAA-DLLP------------------------------------------....
C7YTB3_NECH7/228-348--------SI---I--------AVSALSQ-DLLP------------------------------------------....
K2RWJ8_MACPH/225-345--------SI---I--------AVTHLSA-DLLP------------------------------------------....
A7EI36_SCLS1/226-346--------SI---I--------AVNFLAA-DLLP------------------------------------------....
L8FSY4_PSED2/223-343--------SV---I--------AVSFLSA-DLLP------------------------------------------....
C4JWX0_UNCRE/221-341--------SI---I--------AVVHLAG-DLLP------------------------------------------....
C5G018_ARTOC/223-343--------SV---I--------AVVHLAA-DLLP------------------------------------------....
Q5B485_EMENI/264-384--------SV---V--------AVVHLAA-DLLP------------------------------------------....
C1GWZ1_PARBA/233-353--------SI---V--------AVVYLAA-DLLP------------------------------------------....
A1CFF9_ASPCL/224-344--------SI---V--------AVVHLAG-DLLP------------------------------------------....
G3XPK6_ASPNA/221-344--------SI---V--------AVVHLAH-DLLP------------------------------------------....
A2WT67_ORYSI/265-385--------SV---I--------AVCKLSS-DLFP------------------------------------------ERA.
D7KX71_ARALL/272-390--------SV---I--------AVCKLSN-DLFD------------------------------------------K...
A2YQB0_ORYSI/268-387--------SV---V--------AVCKLTR-DLFP------------------------------------------....
A7X2T1_POPCN/223-342--------SV---I--------AVCNLSS-DLFP------------------------------------------GK..
D8S3I3_SELML/264-385--------SV---V--------AVCKLSK-DLFP------------------------------------------....
A9TVM2_PHYPA/255-374--------SV---I--------AVCKLSN-DLFP------------------------------------------SK..
A9RP81_PHYPA/282-400--------SV---I--------AVCKLSN-DLFP------------------------------------------....
I1C5D7_RHIO9/194-313--------SV---I--------ALCALID-DLFP------------------------------------------EK..
C1EA77_MICSR/255-375--------SV---V--------ATCALAK-DLFP------------------------------------------....
E1ZN91_CHLVA/385-504--------SV---V--------GVCQLAG-QLFP------------------------------------------....
I0YTY0_9CHLO/213-332--------SV---V--------AVCQLSG-DLFP------------------------------------------....
A4S3I2_OSTLU/293-412--------SV---I--------SVCALSK-ELFP------------------------------------------....
K8EA24_9CHLO/301-420--------SV---I--------SVCAVSR-ELFP------------------------------------------....
A1HMS1_9FIRM/215-336--------AI---I--------ATENTLK-TYFA------------------------------------------....
B0SEN7_LEPBA/208-328--------SI---L--------ATKQISD-DLFP------------------------------------------....
N1W836_9LEPT/208-328--------SI---L--------ATKQVSD-DLFP------------------------------------------....
A4G1K6_HERAR/222-341--------AV---I--------AIKEENN-RLFP------------------------------------------....
A0LEX0_SYNFM/228-347--------AV---I--------AITAENN-ELFP------------------------------------------....
A5D5U5_PELTS/185-304--------AV---I--------AITAENN-MLFP------------------------------------------....
A1AQI2_PELPD/205-325--------AV---I--------VTASLAK-RLFP------------------------------------------....
C8WZ82_DESRD/229-350--------AC---L--------AYTDLAE-HYFE------------------------------------------....
F0JE74_DESDE/227-348--------AV---I--------ASRDLSF-EYFG------------------------------------------....
C6BZQ7_DESAD/227-348--------AV---I--------ANRDLSH-EYFG------------------------------------------....
C0Q8U9_DESAH/229-350--------AV---V--------ANADLSR-DYFG------------------------------------------....
D6SS96_9DELT/229-350--------AV---I--------ANVDLSR-QYFG------------------------------------------....
A3QA82_SHELP/206-331--------AV---I--------ATSAMAG-EKFP------------------------------------------....
A0L1J1_SHESA/213-334--------AV---I--------ATSAMAQ-EKFP------------------------------------------....
A8GZZ5_SHEPA/206-328--------AV---I--------ATSAMAK-QKFP------------------------------------------EDGA
A1SAH7_SHEAM/199-320--------AV---I--------ATSVMAK-DKFP------------------------------------------....
A8G0P2_SHESH/218-339--------AV---I--------ATSAMAK-EKFP------------------------------------------....
A6EYX6_9ALTE/202-321--------AV---V--------LTALVAG-DYFG------------------------------------------....
C9D2W7_9RHOB/203-324--------AV---F--------LTSLVAG-DLFG------------------------------------------....
B8GHN7_METPE/204-320--------SI---A--------AVVLITG-DLFK------------------------------------------T...
M0NEN9_9EURY/134-249--------AA---I--------ATSLLIA-DLFD------------------------------------------Q...
D8J5J0_HALJB/205-320--------AA---L--------ATSLLFS-DLFD------------------------------------------R...
M0DC06_9EURY/172-287--------AA---L--------ATSLLFS-DLLD------------------------------------------A...
M0C8X0_9EURY/203-317--------AA---L--------VASVLLN-DYFD------------------------------------------R...
G0HUQ5_HALHT/204-318--------AA---L--------ATSVLLA-DYFD------------------------------------------R...
D4GWH9_HALVD/206-320--------AA---L--------ATSVLLA-DYFD------------------------------------------R...
D2RYU1_HALTV/205-320--------AA---I--------ATALLCG-DLYD------------------------------------------R...
E4NMR6_HALBP/205-319--------AA---V--------ATSLLLS-DYYD------------------------------------------A...
E7QRP7_9EURY/202-316--------AA---V--------ATSLLLA-DLFD------------------------------------------A...
M1XQX9_NATM8/204-317--------AA---I--------ATSLLLS-DLYD------------------------------------------A...
J2ZYZ3_9EURY/205-318--------AA---V--------ATSLLCA-DLFD------------------------------------------A...
Q0W422_UNCMA/202-317--------AV---L--------ATSLLAS-DLFK------------------------------------------E...
Q2FLF7_METHJ/209-325--------AI---L--------ATSLLAH-DLFK------------------------------------------R...
G7WKS6_METH6/187-303--------AT---V--------ATALIAE-DLFK------------------------------------------K...
A7IAA3_METB6/206-322--------AI---L--------ATSLLTK-DLFG------------------------------------------K...
H1YXZ5_9EURY/205-321--------AI---L--------ATSLLAH-DLFK------------------------------------------K...
A3CWQ9_METMJ/210-327--------AI---L--------ATSLLTY-DLFP------------------------------------------KK..
J1L1I3_9EURY/213-329--------AI---L--------ATSLLTL-DLFK------------------------------------------R...
B0SEN7_LEPBA/12-120--------IL---V--------AMVLAS.-....------------------------------------------....
N1W836_9LEPT/12-120--------LL---V--------AMILAA.-....------------------------------------------....
H1XTW9_9BACT/25-133--------LA---F--------ALIVFN.-....------------------------------------------....
D4GWH9_HALVD/18-126--------IV---V--------AVARLT.-....------------------------------------------....
G0HUQ5_HALHT/16-124--------VV---V--------AVAVLT.-....------------------------------------------....
M0C8X0_9EURY/15-123--------IV---V--------AVAVLT.-....------------------------------------------....
M1XQX9_NATM8/18-126--------LV---V--------ALGLLT.-....------------------------------------------....
Q3INK2_NATPD/26-134--------LV---V--------ALGLLT.-....------------------------------------------....
D8J5J0_HALJB/18-126--------IV---V--------ALALLT.-....------------------------------------------....
M0E3F5_9EURY/17-125--------LV---V--------ALALLT.-....------------------------------------------....
D2RYU1_HALTV/18-126--------LV---V--------ALAATT.-....------------------------------------------....
J2ZYZ3_9EURY/18-126--------LV---V--------ALGALT.-....------------------------------------------....
E7QRP7_9EURY/17-125--------IV---V--------AVAALT.-....------------------------------------------....
E4NMR6_HALBP/18-126--------VV---V--------AIAALT.-....------------------------------------------....
R1D8E1_EMIHU/5-115--------DV---V--------ALSSVMG-SALP------------------------------------------....
F4P234_BATDJ/2-110--------IL---L--------SLGKAG.-....------------------------------------------....
F0Y3U5_AURAN/2-110--------LV---L--------AMAERG.-....------------------------------------------....
B7G755_PHATC/68-176--------LF---V--------ALAQQR.-....------------------------------------------....
B8LD85_THAPS/40-155--------LT---V--------ALARER.-....------------------------------------------....
C5KXR7_PERM5/27-135--------LA---V--------GMSITA.-....------------------------------------------....
D0NZ41_PHYIT/57-170--------LL---T--------ALAIGRV-HGAP------------------------------------------....
K3WVQ2_PYTUL/71-184--------LL---T--------ALAIGRV-DGVP------------------------------------------....
E9CCE9_CAPO3/29-137--------LL---L--------GLVVTC.-....------------------------------------------....
A2YQB0_ORYSI/40-149--------IV---L--------SLALSR.-....------------------------------------------....
B9H9E8_POPTR/42-152--------IV---L--------ALTLSV.-....------------------------------------------....
M0SI65_MUSAM/80-189--------II---M--------ALALAK.-....------------------------------------------....
F6HSS9_VITVI/69-178--------IV---L--------TLTLVN.-....------------------------------------------....
B9RUY1_RICCO/33-143--------IV---L--------TLTLVS.-....------------------------------------------....
A2WT67_ORYSI/34-143--------IV---L--------ALSLAS.-....------------------------------------------....
M5WS88_PRUPE/34-144--------II---L--------ALTLVS.-....------------------------------------------....
D8S3I3_SELML/19-130--------IV---V--------ALTLVR.-....------------------------------------------....
A9RP81_PHYPA/35-145--------IV---I--------ALTLVN.-....------------------------------------------....
A9TVM2_PHYPA/8-118--------IV---L--------ALVLVN.-....------------------------------------------....
I0YTY0_9CHLO/1-110--------LL---V--------ALVRVV.-....------------------------------------------....
MOT1_CHLRE/24-135--------LL---I--------GLVQKV.-....------------------------------------------....
D8TXM6_VOLCA/16-120--------LL---I--------ALVQKV.-....------------------------------------------....
K8EA24_9CHLO/79-188--------LL---L--------GLSITQ.-....------------------------------------------....
E1ZN91_CHLVA/25-142--------LL---V--------GLVKDA.-....------------------------------------------....
A4S3I2_OSTLU/65-174--------LL---V--------GMSIEC.-....------------------------------------------....
C1EA77_MICSR/19-128--------LL---V--------GLTAEC.-....------------------------------------------....
I1C5D7_RHIO9/3-96--------IM---I--------SLAVAN.-....------------------------------------------....
G0SDL2_CHATD/45-153--------IM---I--------AMTLQG.-....------------------------------------------....
G1X8D7_ARTOA/35-143--------LI---T--------AMAAAG.-....------------------------------------------....
D5GPI6_TUBMM/21-129--------LM---T--------ALAAGK.-....------------------------------------------....
F7W0P3_SORMK/32-144--------LL---L--------ALSLQG.-....------------------------------------------....
E3RMZ4_PYRTT/28-136--------LM---T--------ALVLTN.-....------------------------------------------....
K2RWJ8_MACPH/24-132--------LL---V--------ALTLSH.-....------------------------------------------....
H6C2T1_EXODN/22-130--------IV---I--------ALTEGH.-....------------------------------------------....
A1CFF9_ASPCL/23-131--------IA---I--------ALAVNG.-....------------------------------------------....
C5G018_ARTOC/20-128--------IL---I--------ALTING.-....------------------------------------------....
A6RGU3_AJECN/28-136--------LL---T--------ALTINH.-....------------------------------------------....
C4JWX0_UNCRE/19-127--------IL---I--------ALAVNG.-....------------------------------------------....
M7SFI7_EUTLA/25-133--------LM---M--------TLAVNG.-....------------------------------------------....
J3P3C4_GAGT3/23-131--------LM---I--------ALALQR.-....------------------------------------------....
F0XEP8_GROCL/22-130--------LM---T--------ALAVQH.-....------------------------------------------....
G4N1B8_MAGO7/23-131--------LM---I--------ALALQS.-....------------------------------------------....
G2QB28_THIHA/26-134--------LM---I--------ALALQG.-....------------------------------------------....
C9SGN6_VERA1/27-136--------LM---I--------ALAIQE.-....------------------------------------------....
E3QBP2_COLGM/24-134--------LM---I--------ALALQG.-....------------------------------------------....
G3JR94_CORMM/25-135--------LM---I--------ALAIQG.-....------------------------------------------....
G0RSK5_HYPJQ/26-136--------LM---I--------ALAAKG.-....------------------------------------------....
C7YTB3_NECH7/26-134--------LM---I--------ALAAQG.-....------------------------------------------....
A7EI36_SCLS1/26-134--------LM---I--------ALAVNN.-....------------------------------------------....
M2LEF6_BAUCO/24-132--------LM---I--------ALALNG.-....------------------------------------------....
F9X8H4_MYCGM/24-132--------LM---I--------AMTLNN.-....------------------------------------------....
M3AZE9_MYCFI/24-132--------LM---I--------AMTLKG.-....------------------------------------------....
Q0W422_UNCMA/9-117--------FI---L--------IAVSVT.-....------------------------------------------....
Q2FLF7_METHJ/16-124--------LL---F--------AVSVSC.-....------------------------------------------....
B8GHN7_METPE/12-120--------LT---F--------GMILAT.-....------------------------------------------....
A7IAA3_METB6/14-122--------LI---L--------AIALVS.-....------------------------------------------....
H1YXZ5_9EURY/13-121--------II---F--------GVAVVT.-....------------------------------------------....
A3CWQ9_METMJ/17-126--------IL---L--------GVAIVC.-...P------------------------------------------....
J1L1I3_9EURY/21-129--------IV---L--------GVALVC.-....------------------------------------------....
A4G1K6_HERAR/22-135--------FV---A--------AYIGVL.-....------------------------------------------....
A0LEX0_SYNFM/33-141--------FV---V--------AYITIV.-....------------------------------------------....
C4XRG0_DESMR/37-145--------FV---V--------AYITIL.-....------------------------------------------....
A0L1J1_SHESA/20-128--------LV---L--------GLIALN.-....------------------------------------------....
A1AQI2_PELPD/14-122--------LV---L--------GVLAVA.-....------------------------------------------....
A3Z2Y8_9SYNE/17-125--------LS---L--------GAIGVA.-....------------------------------------------....
C9D2W7_9RHOB/16-124--------LG---L--------GAIALA.-....------------------------------------------....
F0JE74_DESDE/8-116--------LS---F--------GMIMIN.-....------------------------------------------....
C6BZQ7_DESAD/8-116--------LA---F--------AMIMVN.-....------------------------------------------....
L0RIV6_9DELT/8-116--------LA---F--------AMIMIN.-....------------------------------------------....
C8WZ82_DESRD/10-118--------IA---M--------AMILIN.-....------------------------------------------....
D6SS96_9DELT/10-118--------LG---I--------AMILVN.-....------------------------------------------....
C0Q8U9_DESAH/10-118--------LA---I--------GMIMVN.-....------------------------------------------....
A1HMS1_9FIRM/6-114--------LV---V--------ALAATS.-....------------------------------------------....
C7NK89_KYTSD/30-138--------IA---V--------ALVLVN.-....------------------------------------------....

PF01490

AAP5_ARATH/28-468--------GS---G--------VLSLAWA.VAQI------------------------------------------GWIG
LHT1_ARATH/34-433--------GA---G--------VLGLPYA.MSQL------------------------------------------GWGP
AAP1_ARATH/37-472--------GS---G--------VLSLAWA.IAQL------------------------------------------GWIA
AVT5_YEAST/1-446--------GA---G--------VLAMPFA.FKPF------------------------------------------GLMP
O62286_CAEEL/61-471--------GP---G--------CFSLAVS.FKQA------------------------------------------GLWG
AVT6_YEAST/1-439--------GA---G--------ILAMPYA.FKPF------------------------------------------GLIP
AVT1_YEAST/206-601--------GI---G--------LLALPLG.LKYA------------------------------------------GWVI
MTR_NEUCR/51-449--------AL---G--------SLSLPGA.FATL------------------------------------------GMVP
AVT2_YEAST/65-467--------GA---G--------IITQPFA.IKNA------------------------------------------GILG
VIAAT_RAT/114-513--------GM---F--------VLGLPYA.ILHG------------------------------------------GYL.
PROT1_ARATH/32-428--------SA---Y--------VLGYSGTIMVPL------------------------------------------GWIG
AVT3_SCHPO/273-656--------GT---G--------VLFLPKA.FKLG------------------------------------------GLVF
AUX1_ARATH/44-438--------AQ---V--------LLTLPYS.FSQL------------------------------------------GMLS
UNC47_CAEEL/87-475--------GM---F--------IVGLPIA.VKVG------------------------------------------GWW.
AAP6_ARATH/33-470--------GS---G--------VLSLAWA.IAQL------------------------------------------GWVA
AAP2_ARATH/46-481--------GS---G--------VLSLAWA.IAQL------------------------------------------GWIA
AVT4_YEAST/295-711--------GT---G--------VLFLPNA.FHNG------------------------------------------GLFF
AVT7_YEAST/3-477--------GA---G--------TLAIPYS.FKSD------------------------------------------GVLV
Q21652_CAEEL/22-416--------GG---G--------MIALSYA.LTSM------------------------------------------GLIP
S38A3_HUMAN/64-491--------GS---G--------ILGLAYA.MANT------------------------------------------GIIL
YMJ2_CAEEL/35-446--------NA---G--------CFSLPYA.WKLG------------------------------------------GLWV
AVT3_YEAST/295-688--------GT---G--------VLFLPKA.FHNG------------------------------------------GWGF
D7LAT0_ARALL/30-429--------GT---G--------VLGLPYA.FRVA------------------------------------------GWFA

PF03222

C9MI78_HAEIF/5-405--------GA---G--------MLANPTS-TAGV------------------------------------------WFIG
Q9Z3A2_CHLPN/1-391--------GA---G--------VLAVPVL-TAKG------------------------------------------GFFP
C9MH58_HAEIF/3-387--------GA---G--------MLAMPLT-SAGI------------------------------------------GFGF
A0A025Z1Q5_ECOLX/4-391--------GA---G--------MLAMPLA-AAGV------------------------------------------GFSV
TNAB_PROVU/8-404--------GA---G--------MFSLPTI-MSGA------------------------------------------WFIN
O07675_HAEIF/5-400--------GA---G--------MLGLPTS-GAGA------------------------------------------WTIW
A0A017I5M1_ECOLX/9-402--------GA---G--------MFSLPVV-MSGA------------------------------------------WFFW
O22778_ARATH/12-436--------GP---G--------MLGLPAA-TIRS------------------------------------------GSIP
A0A017JC56_ECOLX/7-403--------GG---G--------MFALPVD-LAGA------------------------------------------WFFW
F2EZP4_PANAA/6-404--------GG---G--------MFSLPIA-MAGI------------------------------------------WFPG
C4PQK7_CHLTJ/1-390--------GA---G--------VLAVPVS-TSEG------------------------------------------GFLP
D6YJI0_CHLT0/3-392--------GA---G--------VLAVPIL-TAVE------------------------------------------GFFP
TYRPB_HAEIN/5-393--------GA---G--------MLAMPLT-SAGM------------------------------------------GFGY

PF00474

YWCA_BACSU/33-434--------LA---I--------AGDYMSA-ASFL------------------------------------------GIAG
PANF_ECOLI/36-432--------MT---L--------TATYISA-SSFI------------------------------------------GGPG
SC5A4_PIG/58-492--------AS---L--------FASNIGS-GHFV------------------------------------------GLAG
SC5A2_HUMAN/55-492--------AS---L--------FASNIGS-GHFV------------------------------------------GLAG
PUTP_HAEIN/35-441--------MS---A--------GASDMSG-WLLM------------------------------------------GLPG
SC5A1_HUMAN/58-492--------AS---L--------FASNIGS-GHFV------------------------------------------GLAG
PANF_HAEIN/36-432--------MT---T--------ASTYASA-SSFV------------------------------------------GGPG
PUTP_ECOLI/35-437--------LS---A--------GASDMSG-WLLM------------------------------------------GLPG
ACTP_ECOLI/63-468--------LA---I--------AGDYMSA-ASFL------------------------------------------GISA
SC5A3_CANFA/39-477--------AS---L--------FVSNIGS-EHFI------------------------------------------GLAG

PF00955

V8P944_OPHHA/511-1024--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
G3U5F4_LOXAF/1-539--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
T1EE80_HELRO/218-706--------FL---Y--------FACILPAIALGV------------------------------------------LY.Y
T1I017_RHOPR/525-1044--------FM---Y--------FAALSGAITFGG------------------------------------------LM.A
G4VMR3_SCHMA/554-1100--------FL---Y--------FACLTPIITFGG------------------------------------------LL.A
S4A11_MOUSE/312-804--------FL---Y--------FACLLPTIAFGS------------------------------------------LN.D
A8XC73_CAEBR/460-937--------YM---F--------AVTVVPTLTFGA------------------------------------------IL.E
W5KDH9_ASTMX/559-1064--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
T1FZS5_HELRO/163-669--------FL---Y--------FACITPIVTFGG------------------------------------------LM.A
A8Q5C3_BRUMA/525-1015--------FL---Y--------FACLLPAIAFGV------------------------------------------LN.D
K1QX42_CRAGI/478-979--------FL---Y--------FASLTPIITFGT------------------------------------------FL.A
T1KJ99_TETUR/226-715--------FL---Y--------FACILPCVAFGV------------------------------------------LV.D
B3RRA8_TRIAD/486-976--------FI---Y--------FACISPAITFGG------------------------------------------LI.S
I3J2E3_ORENI/304-801--------FL---Y--------IAILLPAIAFGS------------------------------------------LN.D
U3J6V8_ANAPL/323-833--------YI---Y--------LATVTNAITFGG------------------------------------------ML.G
T1IXC2_STRMM/521-1019--------FL---Y--------FACLTPIITFGG------------------------------------------LL.G
E4WWD6_OIKDI/171-686--------FL---Y--------FAVITPIITFGG------------------------------------------LL.A
Q1A708_STRPU/512-1011--------FM---Y--------FACITPVITFGG------------------------------------------LL.G
G3NFQ8_GASAC/566-1072--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
T1K5U3_TETUR/267-743--------FL---Y--------FACLLPTIAFGV------------------------------------------LN.D
Q8IQD4_DROME/591-1092--------FM---Y--------FACLSTAITFGG------------------------------------------LV.S
Q16S12_AEDAE/483-981--------FL---Y--------FACLSPIITFGG------------------------------------------LL.G
E0W1T8_PEDHC/651-1159--------FM---Y--------FAALSGAITFGG------------------------------------------LM.G
E0VCN3_PEDHC/465-965--------FL---Y--------FACLSPIITFGG------------------------------------------LL.G
G3WTC3_SARHA/356-874--------YI---Y--------LATIANAITFGG------------------------------------------LL.G
F1LR96_RAT/349-861--------YI---Y--------LATVTNAITFGG------------------------------------------LL.G
W5KXY6_ASTMX/228-714--------FI---Y--------FAALSPAITFGG------------------------------------------LL.A
U6HGB0_ECHMU/291-835--------FL---Y--------FACLTPIITFGG------------------------------------------LL.S
T1FWY0_HELRO/373-877--------FM---Y--------FASLTPIITFGG------------------------------------------LL.G
U3K110_FICAL/463-981--------FI---Y--------LATVTNAITFGG------------------------------------------LL.G
W5JZ21_ASTMX/640-1128--------FI---Y--------FAALSPAITFGG------------------------------------------LL.G
G3PNB5_GASAC/438-957--------FI---Y--------LGTVTNAITFGG------------------------------------------LL.G
Q7PT77_ANOGA/414-924--------FM---Y--------FAALSTAITFGG------------------------------------------LC.S
T1G1Z8_HELRO/240-723--------FL---Y--------FVCLFPAIALSA------------------------------------------VN.Y
K1QN40_CRAGI/465-966--------FL---Y--------FACLTPVITFGG------------------------------------------LL.N
T1IXB9_STRMM/349-847--------FL---F--------FATLSPIITFGG------------------------------------------LL.D
G7YII3_CLOSI/375-869--------FL---Y--------FACLLPTIAFGV------------------------------------------LN.F
H3A8G0_LATCH/535-1050--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
E5SIY8_TRISP/321-820--------FL---F--------FANLTNLIAFGG------------------------------------------MM.G
L5L573_PTEAL/490-1009--------FI---Y--------LGCITNAITFGG------------------------------------------LL.G
K1R242_CRAGI/463-990--------YV---F--------LGTLTPNVTFGG------------------------------------------LL.G
G3P556_GASAC/263-750--------FI---Y--------FAALSPAITFGG------------------------------------------LL.A
E2A0M0_CAMFO/532-1032--------FL---Y--------FACLSPIITFGG------------------------------------------LL.G
A8QB45_BRUMA/477-988--------FM---Y--------FALLAPIVTFGG------------------------------------------LL.E
G3PTK2_GASAC/431-946--------FI---Y--------LGTVTNAITFGG------------------------------------------LL.G
H2RXB2_TAKRU/366-893--------FI---Y--------FAALSPTITFGG------------------------------------------LLEG
H2ZCT2_CIOSA/335-843--------FI---Y--------FAALSPAITFGG------------------------------------------LL.G
G1KLH8_ANOCA/545-1057--------FL---Y--------CASMSPVITFGG------------------------------------------LL.G
K1R554_CRAGI/397-922--------YL---Y--------LATLTPNVTFGG------------------------------------------LL.G
H2MRC5_ORYLA/485-998--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
S4A8_MOUSE/443-956--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
E3LRC0_CAERE/417-922--------FL---Y--------FACLLPAIAFGV------------------------------------------LN.D
H2MQQ8_ORYLA/460-973--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
F6ZGG3_HORSE/451-964--------FL---Y--------CACMSPVITFGG------------------------------------------LL.G
F6XSL8_XENTR/350-843--------FI---Y--------FAALSPAITFGG------------------------------------------LM.S
I1FHS7_AMPQE/474-998--------FI---Y--------FANIAPAITFGQ------------------------------------------VL.S
E9FTI0_DAPPU/260-749--------FL---Y--------FACILPAIAFGV------------------------------------------LN.D
F6TCT1_CIOIN/372-881--------FL---Y--------FAILTPIVTFGG------------------------------------------LL.G
G5AMT1_HETGA/940-1416--------FI---Y--------FAALSPAITFGG------------------------------------------LL.G
B4HY43_DROSE/565-1057--------FL---Y--------FACLSPIITFGG------------------------------------------LL.A
T1G603_HELRO/157-654--------FL---F--------FACITPIVTFGG------------------------------------------LM.G
K1QYU5_CRAGI/280-801--------YL---F--------LATLTPNVTFGG------------------------------------------LL.G
G5EC65_CAEEL/395-910--------FM---Y--------FGLLAPIVTFGG------------------------------------------LL.E
E9G2T9_DAPPU/505-1004--------FL---Y--------FACLTPLITFGG------------------------------------------LL.G
U1NFS4_ASCSU/397-896--------FL---F--------FANVTSIITFGA------------------------------------------VM.E
G7YU35_CLOSI/538-1089--------FL---Y--------FACLTPIITFGG------------------------------------------LL.S
U1NNI1_ASCSU/442-926--------FM---F--------FASFAPAITFGG------------------------------------------LL.G
E9GEI4_DAPPU/152-644--------FL---Y--------FACLLPAIAFGV------------------------------------------LN.D
I1FKL2_AMPQE/440-927--------FV---Y--------ISCVAPAIAFGG------------------------------------------LM.G
F6XL93_CIOIN/511-1008--------FI---Y--------FAALSPAITFGG------------------------------------------LL.G
K1PAY0_CRAGI/349-831--------FL---Y--------FACLMPSIAFGV------------------------------------------LN.A
T1G3A7_HELRO/332-843--------FL---Y--------FACITPIVTFGG------------------------------------------LM.G
K1P9X1_CRAGI/723-1226--------FI---F--------FACLSPTIAFGG------------------------------------------LL.G
W4WGG8_ATTCE/196-700--------FM---Y--------FAALCGAITFGG------------------------------------------LM.S
J9JYF8_ACYPI/711-1209--------FI---Y--------FAALSAAITFGG------------------------------------------LM.A
H3ECJ2_PRIPA/195-739--------FM---Y--------FALLAPIVTFGG------------------------------------------LL.E
B3RRA7_TRIAD/391-881--------FI---F--------FACMAPAITFGA------------------------------------------IL.G
H3DNL1_TETNG/273-761--------FI---Y--------FAALSPAITFGG------------------------------------------LL.A
U6INZ2_HYMMI/387-907--------FL---Y--------FACLLPSIAFGV------------------------------------------LN.Y
T1INN8_STRMM/610-1148--------FI---Y--------FAALSGAISFGG------------------------------------------LL.G
W4ZBI6_STRPU/468-975--------FM---Y--------IACITPIITFGG------------------------------------------LL.G
F6V6Y3_XENTR/366-886--------FI---Y--------LVTVTNSITFGG------------------------------------------ML.G
T1KG21_TETUR/488-986--------FL---Y--------FACLAPIITFGG------------------------------------------LL.G
F6S1R5_MONDO/362-890--------FI---Y--------LGCITNAITFGG------------------------------------------LL.G
E9G2T7_DAPPU/358-867--------FL---Y--------FASLSPIITFGG------------------------------------------LL.G
D6WFQ1_TRICA/611-1120--------FM---Y--------FAAVSGAIAFGG------------------------------------------LL.G
G3RVR2_GORGO/665-1151--------FI---Y--------FAALSPAITFGG------------------------------------------LL.G
Q17LT4_AEDAE/585-1093--------FM---Y--------FAALSTAITFGG------------------------------------------LA.S
I3KGD1_ORENI/467-975--------FI---Y--------LGCITNAITFGG------------------------------------------LL.G
W4YSB4_STRPU/661-1179--------FI---F--------FAALSPAITFGG------------------------------------------LL.A
G6DAI9_DANPL/622-1112--------FM---Y--------FAALSSAITFGG------------------------------------------LL.A
G1KNW1_ANOCA/379-896--------YI---Y--------LATVTNAITFGG------------------------------------------ML.G

PF02133

YEME_SCHPO/55-506--------NT---W--------MIAGTA.VESG-----------------------------------------------
FCY22_YEAST/73-491--------VA---Y--------SVGALGPLVFG-----------------------------------------------
ALLP_BACSU/20-456--------PT---Y--------ATVGGL.IAIG-----------------------------------------------
FUR4_YEAST/103-562--------NT---W--------QIAATG.LQLG-----------------------------------------------
YXLA_BACSU/10-428--------TT---L--------VTGTIP.VAMG-----------------------------------------------
Q9ZBQ0_STRCO/18-445--------LL---L--------TMGASLVVAYR-----------------------------------------------
CODB_ECOLI/11-398--------SM---W--------TGGTLG..TG.-----------------------------------------------
ALLP_ECOLI/19-457--------PN---Y--------VMVGGF.FILG-----------------------------------------------
O86506_STRCO/10-448--------GV---I--------VFGWLP.PSFG-----------------------------------------------
FUR4_SCHPO/48-499--------NT---W--------MISATA.IELG-----------------------------------------------
FCY21_YEAST/73-489--------PA---Y--------AIGALGPMVFD-----------------------------------------------
FUI1_YEAST/119-575--------NT---W--------QISATG.LQLG-----------------------------------------------
DAL4_YEAST/105-564--------NT---W--------QIAGTG.LQLG-----------------------------------------------
O69811_STRCO/47-491--------AS---W--------TLASGL.IAVG-----------------------------------------------

PF03594

Q9RUP7_DEIRA/156-540--------FP---R--------AARRGLSDWGAG------------------------------------------G--F
Q98CP3_RHILO/1-376--------VG---F--------GGTLAIVIAAA.------------------------------------------.--.
Q9KQM8_VIBCH/4-381--------VG---Y--------TSSVVIVIQAA.------------------------------------------.--.
YDCO_ECOLI/5-381--------IG---Y--------ASSAAIIWQAA.------------------------------------------.--.
Q9RY94_DEIRA/39-426--------IG---W--------AGPNVLIYSVQ.------------------------------------------.--.
BENE_ACIAD/10-387--------IS---Y--------SGPLIIFFQAA.------------------------------------------.--.
Q9I374_PSEAE/15-392--------TG---Y--------TSSLVLMFQAG.------------------------------------------.--.
G8ML28_9BURK/13-389--------IS---Y--------AGPLAIFFQAA.------------------------------------------.--.
Q88I34_PSEPK/31-401--------IS---Y--------AGPLVIIFHAA.------------------------------------------.--.

PF00916

S26A3_HUMAN/73-475--------VA---V--------LQGLAFAL.LVD------------------------------------------I..P
Q55814_SYNY3/20-386--------VA---L--------PLALAFGV.ASG------------------------------------------A..G
SUT31_ARATH/82-463--------LA---I--------PQGISYAK.LAN------------------------------------------L..P
SULP3_CAEEL/60-496--------FS---V--------PQGIALAS.ITG------------------------------------------V..P
YVDB_BACSU/15-379--------VA---I--------PLGMAFAI.ASG------------------------------------------V..E
CYS14_NEUCR/77-468--------VV---V--------PQGMAYAK.LAN------------------------------------------L..A
SUL2_YEAST/137-544--------VL---V--------PQSMSYAQ.VAT------------------------------------------L..P
S26A1_RAT/69-481--------IL---V--------PQAIAYSL.LAG------------------------------------------L..Q
SULX_YEAST/119-513--------FQ---I--------PLALSYTTSIAH------------------------------------------V..P
O17951_CAEEL/89-486--------LQ---I--------PQGIAYAI.LSR------------------------------------------Q..D
SUT21_ARATH/115-497--------LC---I--------PQSIGYAT.LAK------------------------------------------L..D
SUT11_ARATH/85-467--------LC---I--------PQDIGYAK.LAN------------------------------------------V..D
S26A2_HUMAN/108-518--------LL---V--------PQSIAYSL.LAG------------------------------------------Q..E
SUT32_ARATH/73-454--------LA---I--------PQGISYAQ.LAN------------------------------------------L..P
Q55415_SYNY3/12-379--------IA---L--------PMALAFGI.ASG------------------------------------------A..G
SUT41_ARATH/95-468--------ML---V--------PQAMSYAK.LAG------------------------------------------L..P
YG35_YEAST/206-606--------LN---I--------LDALSYGMIIFP------------------------------------------ITEP
P72770_SYNY3/20-387--------YA---I--------PVALAYGS.LAG------------------------------------------L..P
P96878_MYCTU/31-398--------VA---L--------PLSLGIAI.ASG------------------------------------------A..P
YA7B_SCHPO/157-558--------LN---I--------LDALSYGLILFP------------------------------------------ISDP
SUT22_ARATH/107-489--------LC---I--------PQSIGYAN.LAG------------------------------------------L..D
M0W733_HORVD/97-477--------LC---I--------PQDIGYAK.LAN------------------------------------------L..Q
Y1739_MYCTU/25-392--------YL---I--------PQAMAYAT.VAG------------------------------------------L..P

PF02705

KUP_KLEP7/13-544ARM-----------------------------TSV.......................LVILGLIGGSFFYGEVVITPAI
KUP_WIGBR/16-547SKS-----------------------------TFV.......................IVILGLISMCLFFGDIIIIPSI
B9SQ92_RICCO/61-632VMK-----------------------------YFM.......................SF.LSMLGVSMVLGDGILTPCM
A9SXX0_PHYPA/13-586ERA-----------------------------KFV.......................LFVMVMLGTGLVIGDGILTPAI
A9T519_PHYPA/7-581KVR-----------------------------EWLERNK..............CAQEVLLFVVMLGTCMLIGDGILTPAI
B6QFY8_PENMQ/79-668LIR-----------------------------SWMEKSA..............TMGVIFKVVGVFGVALLLADGILTPAQ
A1CCX5_ASPCL/78-666TFM-----------------------------KWA.......................FKVLGVFGVSLLLADGVLTPAQ
C5FQB5_ARTOC/100-671YVK-----------------------------RWLMNSP..............AAKRMITILAVLGVCMVMSDSVLTPAQ
Q6CCD6_YARLI/48-711TQA-----------------------------SWMNNRHNRDNYGWFKKTAWNLFKYLPIICCLCGSAFLMSDGMLTPVQ
C4Y6H7_CLAL4/40-680SQG-----------------------------GWKKKPSVI...........KFISAFTLIVCFLGCALVISDGLLTPTT
B0CVZ9_LACBS/29-630EKA-----------------------------RWP.......................LLIWCLFGTSLTMADGIFTPAV
KUP_CYTH3/20-548RRN-----------------------------PNL........................VWPAMIGGAAMLADGIITPPI
C6W4Q3_DYAFD/15-540KHA-----------------------------KWL........................TVPAVIGGSTLLADGVITPPI
C6Y2B3_PEDHD/15-542KNA-----------------------------KWL........................VIPAVVGGCALLADGIITPSI
KUP_LEUMM/14-557PNK-----------------------------KWL........................LLPALIGGAALLADGTLTPAV
KUP_LACDA/6-548KKA-----------------------------AWL........................VWPALIGGAAILADGTLTPAV
E3D8I4_GARV3/105-645RKG-----------------------------AWL........................AIPAMIGGAAFLADSVLTPAV
C5K5G4_PERM5/172-748TKT-----------------------------LIL.......................CTVLATTGAAMMCGDGLITPAL
B5ED26_GEOBB/13-541RVL-----------------------------AFA........................GFLSFLGVSLLLGDGVITPAI
B8J475_DESDA/11-539KKI-----------------------------GVA........................SVLAFIGVSLLVGDGVITPAI
A7I822_METB6/4-532NQI-----------------------------AFV........................SLLSIIGISLFIGDGVITPAI
KUP_METAC/10-538RNA-----------------------------AFI........................TLLAYIGVSFLVGDGVITPAI
B5YHM1_THEYD/4-532KTK-----------------------------AFV........................TFLALIGVSFLIGDGVITPAI
B2VA86_SULSY/13-542PKI-----------------------------RLI.......................HRALTIVGIGFLLGDGIITPAI
Q54JK9_DICDI/60-587QKL-----------------------------KSA.......................LTILALCGSSFILGDGVITPAV
KUP2_LEGPH/16-542KPG-----------------------------GWL.......................LF.ITLVGIGLIIGDGILTPAI
C6BY23_DESAD/14-544RRS-----------------------------ASF.......................MLFAAMIGGALLYGDGVITPAI
KUP_XANP2/18-550LGM-----------------------------RWY.......................LLAAGLLGAAMLIGDGVLTPAM
KUP3_BRADU/2-536QPG-----------------------------TWRS.....................HLLVVGLVGAALLYGDGAITPAI
C1F3S5_ACIC5/37-570RWS-----------------------------RRM.......................LILIGVVGAATLYGDSMITPAI
C1D8B5_LARHH/14-546RHL-----------------------------AAL.......................GLGLGILGATLFFGDAMITPAI
KUP_PROAC/31-568KGT-----------------------------GMT.......................ALLLGIVGAGLFYGDSFITPAI
B1ZTC6_OPITP/46-580TGV-----------------------------RRLG.....................PVVVMLLAGAALLYGDGVITPAI
KUP1_CHRVO/26-559VAV-----------------------------GWV.........................LLGLAGAAMLYGDGVITPAV
KUP_THEEB/15-546LSS-----------------------------HWRR.....................RVIIFGLVGAAMFYGDSTITPAI
B0T401_CAUSK/36-573NKR-----------------------------STA.......................VFFLGVIGAALFYGDGIITPAI
KUP1_SPHWW/26-569RRR-----------------------------RTL.......................VMALGAIGAALFYGDGVITPAL
KUP_BDEBA/51-585SRR-----------------------------RWT.......................MTIIGLFGAALLYGDGIITPAI
C1A5Q5_GEMAT/25-559FAK-----------------------------GGI.......................FVALALFGTALLYGDGIITPAM
KUP2_SYNFM/28-562RLH-----------------------------GVV.......................AF.AATLGASLLYGDGVITPAI
KUP_METCA/15-548KHR-----------------------------AWI........................ISLGLFGTALFYGDGMITPAI
KUP_HERAR/14-547KNS-----------------------------RWYF.....................PLMVMGLFGATLFYGDSVITPAI
B2FRN5_STRMK/27-560SRS-----------------------------AYV.......................VGILGIFGASLFFGDGVITPAM
KUP1_RALSO/1-534ART-----------------------------IRT.......................LMLLGLLGASMFYGDAVITPAI
KUP_ACIF2/18-550RLR-----------------------------WWI.......................LS.IGLLGAALFYGDGVITPAI
KUP1_NOVAD/40-570DGK-----------------------------RWGR.....................GIILLGVFATALFYGDSMITPAV
B9HJL6_POPTR/87-646...-----------------------------..TENKSRLGIF....FERSIVARRALLFIAMLGTCMLIGDGILTPAI
D2U9H9_XANAP/28-558SRS-----------------------------MYV.......................VGILGIFGASLFFGDGVITPAI
E3FUM0_STIAD/26-562HPA-----------------------------RPV.......................LVALGLFGAALLYGDGIITPAM
KUP3_RHIEC/22-554NGH-----------------------------TAI.......................LMLLGLMGAALFLGDAMITPAL
Q5AB00_CANAL/82-703...-----------------------------..VEKIKENPI.......LLSFLQYFILGACFLGSALVMSDGLLTPTT
HAK6_ORYSJ/80-646PKA-----------------------------QLA.......................ITIIVLIGTCMLIGDGALTPAI
KUP3_LEGPH/22-550KQR-----------------------------PFI........................IAVGLMGAALIYGDGTITPAI
KUP1_LEGPH/12-539KY.-----------------------------QPL.......................FYIVAIFGAGLLLGDGMLTPAI
HAK19_ORYSJ/48-624NAA-----------------------------KIA.......................LFTITILGTSMVMGDGTLTPAI
KUP1_RHOPA/12-542RRV-----------------------------HYP.......................LMMLGVIAAALFYGDSMITPAI
HAK9_ORYSJ/24-602RIK-----------------------------EWLEKHK..............TLQTALLIMVMIGTCMVIGDGVLTPAI
KUP_CORGL/20-550HWG-----------------------------KFV........................AVAGMLGAALFYGDVVITPAI
KUP_STRP1/18-551KMS-----------------------------PWL........................IIPAMIGGATLLSDGALTPAV
KUP_XYLFA/23-555SRS-----------------------------IYI.......................VGILGIFGTSLFFGDGVITPAI
W8UJ41_YEREN/22-548KGQ-----------------------------RWV........................IFSALLGAALIYGDGAITPAI

PF03845

GERBB_BACSU/7-331SPS-----------------------------GWL----------------------MILLQGVIFIIIVLLFLPFL---
Q9KCW4_BACHD/8-324GYQ-----------------------------SWI----------------------AVLFTGLLIHLVVYFMYKIL---
Q97IW3_CLOAB/3-323...-----------------------------AWI----------------------VILLALLIGLLMAWISTELF---
GERKB_BACSU/5-326...-----------------------------AWI----------------------AVLLGCAIGLFLFYLYQGIY---
Q97LG4_CLOAB/8-327Q.D-----------------------------GWI----------------------ACIIGAIYPLLLVLMASYIC---
Q97E18_CLOAB/4-325...-----------------------------AWI----------------------GVLMCIIPALIFQSTYIYLW---
Q9KCH3_BACHD/10-327GYD-----------------------------GWI----------------------SIIIAGIVVQIIIALMYALL---
GERAB_BACSU/9-331TPD-----------------------------GWI----------------------TLILEGFIFIFFIYLNTLIQ---
Q9KBD6_BACHD/8-337TAD-----------------------------GWI----------------------TIIVGGSIICALVYVTVRLQ---
YNDE_BACSU/7-329SPD-----------------------------GWI----------------------SVLLGGVLAVIAGMIIAKLS---
Q9KAU9_BACHD/3-321N.L-----------------------------GWV----------------------SVLLAGVIVQLAAVLYHISL---
Q97TS5_CLOAB/3-323...-----------------------------AWI----------------------VVLLALLIGLFILWSYLELQ---
Q9KBJ1_BACHD/6-327...-----------------------------AWM----------------------TVLIAMLAGLVLYCVLYYLH---
Q7BYC0_BACCR/8-329TPD-----------------------------VWL----------------------SVILGGILAMVSGVIMVKLS---
Q816T5_BACCR/10-327GYD-----------------------------GWM----------------------GVIITGIFIHILIWMMYVLL---

PF01235

B2UL98_AKKM8/57-460GAV-----------------------------FWC------------------------WLTGVLGMATRYSEGLLAIKY
C4L2J1_EXISA/48-448GAV-----------------------------FWM------------------------WLIALIGAASAFVESTLAQVY
Q7VL62_HAEDU/56-459GAV-----------------------------FWM------------------------WVTALMGMSSAFVESSLAQLY
B7GI15_ANOFW/49-449GAV-----------------------------FWM------------------------WLVAILGGASAFVESTLAQIF
R6ESR6_9FIRM/49-458GAV-----------------------------FWM------------------------WLIALLGGASAFVESTLAQIY
R7ANW3_9CLOT/47-452GAM-----------------------------FWM------------------------WLVAILGSASAFIESTLAQIY
W6RLP3_9RHIZ/46-455GAI-----------------------------FWM------------------------WMVALVGMATSYSESTLAQLY
D4G8V3_RIEPU/46-454GSI-----------------------------FWM------------------------WVAAIIGMATSFSESILAQLY
F0P236_WEEVC/46-470GAI-----------------------------FWM------------------------WIIAFIGSTSAFVEATLGQVY
X5D863_9BACT/54-454GAI-----------------------------FWM------------------------WISALLGISTKFFTCSLAVMF
C7RC29_KANKD/57-559AAL-----------------------------FWM------------------------WVTAFFGMTTKFVEVTLSHKY
R6R064_9FIRM/47-469GAL-----------------------------FWM------------------------ILAAFFGMATKYAEGLLAIKY
Q9K9D4_BACHD/47-446GAI-----------------------------FWM------------------------WVVAIFGSVLSFIESTLAQVY
R5WSV7_9FIRM/52-454GAV-----------------------------FWC------------------------WITGVFGIATKYSESLIAVKY
K9TIM8_9CYAN/96-500GAM-----------------------------FWM------------------------TVAALFGMTSKFVECTLAQKY
R5JXV6_9CLOT/55-564GAL-----------------------------VWM------------------------WISACFGLTSKFSECMLAIKY
W5WYR9_9CORY/49-452GAV-----------------------------FWM------------------------WMIAIVGGATAFVESTLAQLW
R9VS99_9ENTR/46-453GAI-----------------------------FWM------------------------WISAIIGMVISFAECSLAQLY
Q65J05_BACLD/49-446GAV-----------------------------FWM------------------------WVVALVGMASSFVESTLAQVY
W8U6M9_EUBAC/78-495GAL-----------------------------FWM------------------------WAIAFLGAGSSFIECALGQVY
F2F7Q9_SOLSS/49-467GAV-----------------------------FWM------------------------WVTAFIGASTAYMESTLAQIY
Q9HXZ0_PSEAE/50-449GAV-----------------------------FWM------------------------WAIALVGMATGFVEATLAQLF
Q5WIK8_BACSK/48-446GAI-----------------------------FWM------------------------WVIATIGMATGFVESMLAQVY
X2GW49_9BACI/46-479GAI-----------------------------FWM------------------------WAIAFIGAATAYVESTLAQIY
Q81XE8_BACAN/56-451GAV-----------------------------FWM------------------------WFIAILGAATSFVECTLAQIY
W6RX75_9CLOT/46-448GAI-----------------------------FWM------------------------WLLAIIGGASSFIESTLAQIY
R5R740_9FIRM/57-453GSI-----------------------------FWM------------------------WIIALIGGASAFIESTLAQVY
R5TDP1_9FIRM/46-451GSV-----------------------------FWM------------------------WVIAVIGGASAFIESTLAQVY
Q7VFP4_HELHP/49-454GAL-----------------------------FWM------------------------WVTALVGGASAFIESTLAQVY
Q082X4_SHEFN/49-451GAV-----------------------------FWM------------------------WVIALLGMATGFAESILGQLY
Q2YKB0_BRUA2/46-452GAI-----------------------------FWM------------------------WIVALVGLATAYSESALAQLY
H5XB24_9PSEU/93-523GAT-----------------------------FWM------------------------IVAGLLGMCTKFVECTLGVKY
X5E8D3_9CORY/44-457GSL-----------------------------IWI------------------------MVTGFLGSTCAYAEAVLAQVF
D9S9M5_FIBSS/46-477GAL-----------------------------FWM------------------------EVAAFLGMATKYAEGLLAVKY
V9XJ86_9NOCA/53-454GAV-----------------------------FWM------------------------WAMALVGAATAFLESTLAQLY
R6W8F8_9FIRM/60-481GAV-----------------------------FWM------------------------WVSAFFGMITNYAENVLGLYF
E6WQ83_PSEUU/46-484GAV-----------------------------FWM------------------------WVMGFLGASTSYVESTLAQIY
S6CD23_9ACTN/53-462GAI-----------------------------FWM------------------------WLMALIGAASAFIESTLAQIY
R6LRJ9_9FIRM/49-461GSV-----------------------------FWM------------------------WMIAVIGAASAFVESALAQAY
A8ALU9_CITK8/48-455GAV-----------------------------FWM------------------------WVSALIGMATSFAECSLAQLY
Q8P616_XANCP/46-481GAI-----------------------------FWM------------------------WVMGFLGASTSYVESTLAQIY
B1HSY7_LYSSC/46-460GAV-----------------------------FWM------------------------GIMAFLGGASAFIESTLAQLY
C7N1V2_SLAHD/52-464GAV-----------------------------FWM------------------------WLMALLGSATAFVESTLAQIW
E6UF74_RUMA7/48-472GAL-----------------------------LWM------------------------EIAAFLGMATKYAEGLLAIKY
T2KIQ3_9FLAO/49-458GAV-----------------------------FWM------------------------WVSAIIGMATKFFTSSLAVMY
A4FJA3_SACEN/90-513GAT-----------------------------FWM------------------------IMCGLLGMATKFVECTLGVKY
U5Q4A6_9BACT/51-446GAV-----------------------------LWC------------------------WLTGVFGIATKYSEGLLAIKY
R6QL56_9FIRM/55-463GAL-----------------------------VWM------------------------WISAAFGISTKYAECALAGKY
A6T4E7_KLEP7/30-437GAV-----------------------------FWM------------------------WVSALLGMASSFAECSLAQLY
Q6A6W4_PROAC/89-503GAS-----------------------------FWI------------------------AVAGLVGMSVKMAEATLGVKF
Q3IIL7_PSEHT/49-553AAL-----------------------------FWM------------------------WMTAFFGMTTKFVEVTLSHKY
K4KVJ9_SIMAS/53-454GAV-----------------------------FWM------------------------WVIALMGMATGFAESTLGQFY
Q62ZC8_BACLD/50-447GAI-----------------------------FWM------------------------WIIAIIGSASSFVESTLAQIY
D4KIB6_9FIRM/53-452GAI-----------------------------FWM------------------------WIIAILGSATGFVESTLAQIY
R6GRJ8_9CLOT/56-455GAV-----------------------------FWM------------------------WLISLIGSASAFIESTLAQIY
R5BT56_9FIRM/49-463GAV-----------------------------FWM------------------------WVLGLLGAATALMESTLAQAY
GLNT_BACSU/50-449GAI-----------------------------FWM------------------------WIIAIIGSASSFVESTLAQIY
C7NKM3_KYTSD/76-484GAT-----------------------------LWI------------------------ILAGFLGMSIKAAEATLGAKY
Q65UI6_MANSM/65-468GAV-----------------------------FWM------------------------WLTALIGMSSAFAESSLAQLF
Q9KPL1_VIBCH/46-453GAI-----------------------------FWM------------------------WLIAMLGMATSFAESTLAQLY
C4LCJ4_TOLAT/45-452GAI-----------------------------FWM------------------------WLIAMIGMASAFVESTLAQLY
A8F9M4_BACP2/46-444GAI-----------------------------FWM------------------------WILAIIGSASSFVESTLAQVY
I0JJ89_HALH3/58-455GAV-----------------------------FWM------------------------WITAVFGMATKYAEAVLAVKY
R7AGI4_9CLOT/50-474GAL-----------------------------FWM------------------------VLAGMTNSAVCFTECTLSVLY
B2FSE0_STRMK/46-482GAI-----------------------------FWM------------------------WVMGFLGASTSYVECTLAQIY
F2I8L7_AERUA/50-455GAV-----------------------------FWM------------------------WLVAIIGGSSAFIESTLAQIY
H2IRW6_RAHAC/47-451GAI-----------------------------FWM------------------------WIIAVFNMATAMIENTLAQVY
Y183_HAEIN/59-462GAV-----------------------------FWM------------------------WVTAFIGMSSAFAESTLAQLF
Q87U15_PSESM/43-445GAV-----------------------------FWM------------------------WVTALVGMSSSFIECSLAQLY
G4QHN1_GLANF/78-481GAI-----------------------------FWM------------------------WVIALLGMATGYAESVLGQVY
V4J7M3_9DELT/49-455GAV-----------------------------FWM------------------------WMIALIGMATSLVECSLAQLF
D5UBK7_CELFN/48-455GAV-----------------------------FWM------------------------WVVAAVGMATALVEATLAQVF
A7ZDT9_CAMC1/54-470GAL-----------------------------FWM------------------------CLMAFLGSASAFIESTLAQIY
C1DD85_LARHH/46-459GAV-----------------------------FWM------------------------WVVAFLGASSAFVESTLAQIY
F0RL19_DEIPM/47-463GAL-----------------------------FWM------------------------WMVAFLGASTAYIESVLGQIY
R5WS38_9FIRM/54-459GAM-----------------------------FWM------------------------WLIALLGSASAFIESTLAQIY
K0B2L5_CLOA9/50-448GSI-----------------------------FWM------------------------WIVALVGSSSAFIESTLAQIY
F2JU21_MARM1/46-472GAV-----------------------------FWM------------------------WVVAFLGASTAYAESTLGQLY
D1B800_THEAS/50-454GAI-----------------------------FWM------------------------WLTAVLGMATICGEAILAQLF
R5Q6J7_9BURK/79-476GAV-----------------------------FWM------------------------WVIALLGAATGFVESTLAQIY
R6NH81_9FIRM/47-453GAV-----------------------------FWM------------------------WLMAVIGGASAFIESTLAQVY
Q81XD8_BACAN/54-450GAV-----------------------------FWM------------------------WVIAIIGASSSFVESTLAQIY
I3UGH4_ADVKW/46-460GAV-----------------------------FWM------------------------IVMALLGGASAFIESTLAQVY
D6XWG3_BACIE/52-446GAV-----------------------------LWM------------------------WITAFVGMATKYGEAILGVKY
Q3AFY7_CARHZ/46-459GAV-----------------------------FWM------------------------WVTAFLGAGSAFVEAVLAQIY
R5HBJ9_9FIRM/53-457GAV-----------------------------FWM------------------------WVTAILGGASAFVESTLAQIY
A0M410_GRAFK/284-691GAT-----------------------------FWM------------------------FCAGFFAMSLKFTECTLGVKY
R6ALH3_9FIRM/50-450GAI-----------------------------FWM------------------------WMAAFFGMATKYAEGLLAVKY
W5Y2T0_9CORY/46-478GAV-----------------------------FWM------------------------WTVALLGSATSFVECTLAQIY
R5I5H2_9BACT/50-447GAV-----------------------------LWC------------------------WLTGVFGMATKYSEALLAVKY
Q8EN00_OCEIH/57-451GAL-----------------------------FWM------------------------WLIALLGAASG