Sequence alignment for CL0064

PF13593

C5DGV7_LACTC/27-386-----------------------QWFFITLAVFIVLAHF-FPN..F........ARHGGTIRAE.YTIGYG---------
Q6CIF6_KLULA/49-408-----------------------QWFFIGLAIFIVLARF-FPN..F........ARSGGLIRGQ.YSIGYG---------
B3LLT3_YEAS1/23-385-----------------------QWFFICLAILIVIARF-APN..F........ARDGGLIKGQ.YSIGYG---------
Q6BPS9_DEBHA/26-388-----------------------QWFFLFLGAFVAIAHS-YPE..F........AKQGGTIRAE.YSIQYG---------
B9WFB0_CANDC/25-387-----------------------QWFFIFLGVFIALAHS-YPE..F........AKQGGTIRAE.YSIGYG---------
B7NPU5_ECO7I/8-316-----------------------DPFTLTLITVVLLASF-FPA..R........GDFVPFFE...NLTTAA---------
A5DK55_PICGU/24-387-----------------------QWFLVLLGVFVALAHS-YPE..F........AKQGGTIKAQ.YSIQYG---------
A5E3X9_LODEL/29-391-----------------------QWFFCLLGVFVALAYE-YPE..F........AKQGGMIRAE.YSIGYG---------
A7MML9_CROS8/10-319-----------------------DTFLLIMIGVVIVASL-FPC..E........GRVKTVFE...YLTTAA---------
C2M6P1_CAPGI/9-321-----------------------NNFLFVLVGMILLARI-LPY..R........DEYNSTFNLN.RFIDWG---------
A0KES2_AERHH/4-313-----------------------DPFTSVLIVVVALASF-FPC..E........GQVAVWFGL...LTKLA---------
B6Q6N8_PENMQ/44-391-----------------------QWLIIGMGIACLLAYL-FPN..V........AKHGGIIKSQ.GSILYG---------
Q4ZYQ4_PSEU2/13-325-----------------------DWFLWGMVLATVLAYF-FPR..F........GATGGSMHAE.YVIKVG---------
C4UDI4_YERAL/10-319-----------------------DKFLLVLILVVMIASL-FPC..E........GEVKVWF..E.HLTTAA---------
Q0KE25_CUPNH/16-328-----------------------DRFVLVMLTAIAIALA-APE..I........GAGDGPLHLG.VVTSLG---------
Q6FU65_CANGA/32-393-----------------------QWFFYVLAIFIVIARF-APN..F........ARDGGLIKGE.YSIGYG---------
D0Z7X4_EDWTE/10-319-----------------------DPFLLVLILVVLLASL-FPC..R........GEAKTLF..G.HLTTAA---------
A3RYL9_RALSL/10-322-----------------------DGFIRAMLAMVLLALL-FPS..L........GASAGPLHLD.VVTVVG---------
B2Q2V9_PROST/10-320-----------------------DPFLLIMIGVVVIASL-FPC..E........GEIKVGF..Q.YLTTAA---------
Q7N4G4_PHOLL/10-320-----------------------DSFLMILVTVVVIATF-FPC..E........GEIKVWF..Q.RLTTAA---------
C8NCW5_9GAMM/45-353-----------------------DPFLVMILLMVLAATI-VPA..Q........GIG..KTFFK.HLTTAA---------
C9Y8T0_9BURK/9-319-----------------------DDFTLVLIGVVTLASL-FPA..Q........GAVAQAFEW...ITTAA---------
C5DX01_ZYGRC/23-385-----------------------KWFFYILAIFILLAHF-FPN..F........AGDDGIIRGQ.YSIGYG---------
A9IQT5_BORPD/10-319-----------------------DRFTLFLVITVLIASV-LPA..H........GKGIAAFT...WITNIG---------
Q988D7_RHILO/21-330-----------------------DTFLILLLCTVALASL-APA..T........GTFAGWFAI...ATNLA---------
Q2K4B0_RHIEC/7-316-----------------------DTFTILLACTVILASL-FPA..S........GSFADYFGI...ATDIA---------
Q2NSZ3_SODGM/10-322-----------------------DKFLLVLICVVAQASF-FPC..R........GIARVIF..E.NLTTAA---------
B9JA81_AGRRK/7-318-----------------------DTFTMLLVLTVLTASF-FPV..Q........GASAHYFSI...ATNFA---------
A6UD14_SINMW/7-316-----------------------DTFTILLLLTVALAAV-LPI..D........GAAGDWFAV...ATKIG---------
B0VBX5_ACIBY/10-320-----------------------DRFTILLVGMVLLATF-FPV..S........GQAAQYF..N.TLTTVA---------
C6W4P5_DYAFD/14-325-----------------------DGFMLALLSMILLAWL-WPA..P........GMQDSPLHLS.TVSTYA---------
A5VE28_SPHWW/9-318-----------------------DPYVGLMMLVIALAAV-LPV..H........GRGAAIA..A.TTADVA---------
B4WAZ9_9CAUL/9-317-----------------------DPYLLMLIGTVVLAAL-APA..R........GAGANVAEG...AATAA---------
D2TZF8_9ENTR/10-320-----------------------DYFLLFMLMTIMLASF-FPC..Q........GKVKIV..FQ.HLTTIA---------
D0J170_COMT2/9-318-----------------------DNFTLALIATVIFASF-LPA..S........GQVAKYVEL...TTTGI---------
B2IHJ5_BEII9/11-319-----------------------DPFLIGLLIAVGLAIV-LPA..K........GEAISLLD...ALVYAA---------
A3XPQ3_LEEBM/6-318-----------------------DKFVLAILVAIVVAYF-FPQ..W........GIATSPIPLD.TISAVG---------
A3I1U6_9BACT/15-326-----------------------NGFLLGIFLAIFLGYL-LPE..L........GSNESSIPWK.PIINVG---------
B5JCP6_9BACT/12-331-----------------------QSFTLALIGAVLTAIF-LPE..L........GVKGGPLKTE.ITTKIA---------
B4WXN7_9GAMM/9-320-----------------------DGFTLLLLTVIFAATV-WPA..G........GGLAAGL..S.QLSTLA---------
C0XTF9_9CORY/7-316-----------------------DPLIQGIILASVLAFL-LPA..I........GTFADVFD...VVTKLA---------
Q0V4P5_PHANO/88-416-----------------------QWFLLAMAAVILLASQ-VQV..P........ASRQHTKR...TVVTYL---------
A3SE09_9RHOB/10-318-----------------------DAYMILLLATVIAGIV-LPA..T........GVAAEGLR...GVTFWA---------
B2WB77_PYRTR/69-400-----------------------QWFLLAMSFVILLSSQ-IQV..P........RSRQHTK..R.TSITYL---------
D0WMS3_9ACTO/21-327-----------------------DPFVAGIVSAMALGLA-LPV..P........AKGREILS...TVADLS---------
B7G617_PHATC/64-378-----------------------QEFLLLVIAAILLARA-YPP..L........GATYLAPDI..TATWLA---------
A9USA8_MONBE/8-323-----------------------HWFLIGLVAVIFLAHA-VPW..L........GATGGPLMPE.YSIKYG---------
A5P8F8_9SPHN/9-317-----------------------DPMLRLLVGAVVLAAF-LPI..P........SAQADVA..Q.TVANVG---------
A4S2B1_OSTLU/55-379-----------------------ENFFFAGVGAAACASA-SPE..FRDVVESFGGAAGGSWGSG.GLEKYA---------
C5BV46_BEUC1/9-317-----------------------DPFVLALVATLLIGLF-VPT..T........AQVRSVVDV...TGDIA---------
C1MQW6_MICPC/113-439-----------------------NYFVFGLLTSIALASV-APH..I........GCTGGPLRPELTVNAIG---------
B7G616_PHATC/92-406-----------------------NQFPVHIVLSIGLAKA-YPP..L........GAK..YLQPDITATWIA---------
Q2NAY2_ERYLH/10-318-----------------------DPMIAVLLLATLLAIV-LPA..T........GDAREPIRA...VSNAA---------
Q1GQQ6_SPHAL/56-363-----------------------DRFVPVLFATILLASL-LPV..R........GAAVPVAEA...VSTAA---------
B8LLL0_PICSI/96-415-----------------------NFLPLALITGVTIGLV-NPV..P........GCLAQKYSLS.NW...S---------
A7RRB9_NEMVE/42-385-----------------------NYLPLALITLVFFGIL-VPV..P........GVAFSKISFH.Y...VC---------
E6VTY4_DESAO/16-319-----------------------NLLLLGILGAIWLSMH-HPV..P........ESILGAFD....VNAPL---------
C0Q8Q9_DESAH/8-317-----------------------QWFLVGIVLIFALVIL-DQSASL........ARAGIFLKNH.QGPRFM---------
Q4DG32_TRYCC/64-405-----------------------QWLLGLLILSIGMAYY-HPV..S........AG....IAAS.AWTRIL---------

PF01758

ARSB_BACSU/49-246-----------------------------------------AI--G----------------------------------
O49665_ARATH/179-364-----------------------------------------PL--E----------------------------------
O29775_ARCFU/75-273-----------------------------------------AI--G----------------------------------
ARR3_YEAST/78-276-----------------------------------------TV--G----------------------------------
O81017_ARATH/71-248-----------------------------------------TL--G----------------------------------
NTCP2_CRIGR/39-220-----------------------------------------TI--L----------------------------------
P71942_MYCTU/62-259-----------------------------------------AL--G----------------------------------
Y944_SYNY3/61-268-----------------------------------------AI--C----------------------------------
O58554_PYRHO/48-238-----------------------------------------ML--V----------------------------------
O86662_STRCO/51-247-----------------------------------------PL--L----------------------------------
O26986_METTH/62-259-----------------------------------------AI--G----------------------------------
YOCS_BACSU/41-221-----------------------------------------TI--F----------------------------------
P73938_SYNY3/12-198-----------------------------------------PL--A----------------------------------
P3_HUMAN/197-381-----------------------------------------LP--L----------------------------------
O58645_PYRHO/46-238-----------------------------------------PI--A----------------------------------
NTCP_HUMAN/32-214-----------------------------------------VF--M----------------------------------
O67889_AQUAE/32-212-----------------------------------------LP--L----------------------------------

PF03547

Q98L58_RHILO/3-308-----------------------PLTETVLFVFSLVALG.YLA-----------GLT.GYLRPA-SGEGIS---------
O67397_AQUAE/2-289-----------------------FIYEKVFFILLIIAFA.YTL-----------KRG.GIFKEE-HALPFI---------
ECM3_YEAST/12-596-----------------------ASVRPIIKIYLIIGVG.FGL-----------CKM.NILTVQ-ATRSIS---------
PIN1_ORYSJ/9-590-----------------------HVMTAMVPLYVAMILA.YGS-----------VKWWRIFTPD-QCSGIN---------
Y1382_METTH/5-299-----------------------GSTETVLSVLVLVLLG.YIL-----------KVL.GVLGEE-DASTLN---------
PIN5_ARATH/9-362-----------------------HVVSATVPLYVSMTLG.FLS-----------ARHLKLFSPE-QCAGIN---------
Q97M34_CLOAB/2-296-----------------------YVFEQIVILFLIMGIG.YYA-----------AKS.KIIDDD-TTSHLS---------
YFDV_SHIFL/4-307-----------------------FFIGDLLPIIVIMLLG.YFS-----------GRR.ETFSED-QARAFN---------
PIN6_ARATH/9-565-----------------------TVMCAMAPLYFAMFVA.YGS-----------VKWCKIFTPA-QCSGIN---------
YWKB_BACSU/5-315-----------------------DILILLAPIFFVIVLG.WFA-----------GHF.GSYDAK-SAKGVS---------
Q9FVF6_9ROSI/9-609-----------------------HVMTAMVPLYVAMILA.YGS-----------VKWWKIFTPD-QCSGIN---------
Y1031_METJA/2-303-----------------------IPMDVVLIVLILVLVG.YFS-----------KIF.GILKEE-HAKILN---------
PINI_ARATH/9-617-----------------------HVMTAMVPLYVAMILA.YGS-----------VKWWKIFTPD-QCSGIN---------
YB8B_YEAST/13-413-----------------------LVFESVLQVVIIALAG.FWS-----------ASS.GLLPKQ-SQKIIS---------
Q9C999_ARATH/18-441-----------------------SGVVPLLKLICLTVIGLLLA-----------HPKTQLVPRA-TFRLLS---------
Q9WYQ5_THEMA/4-288-----------------------TTFSAIIPSFLIILIG.YTV-----------G...KIFSEE-TMGLAS---------
Q9C9K4_ARATH/9-407-----------------------ASSKPVVETLLITSVGFYLA-----------LDTVNLLGHD-ARKHLN---------
Q48797_OENOE/6-311-----------------------TSVESVVEIVLVIALG.YVL-----------RRS.GKLADS-FKGNIS---------
PIN7_ARATH/9-614-----------------------TVLTAVIPLYVAMILA.YGS-----------VRWWKIFSPD-QCSGIN---------
Q9LZN2_ARATH/30-423-----------------------IAVMPIAKVFTMCFLGLLMA-----------SKYVNILPPS-GRKLLN---------
Q9SHL8_ARATH/9-388-----------------------VASMPVIQVLFMSLVGAFMA-----------SDRCKLFPVE-ARNSMN---------
PIN4_ARATH/9-611-----------------------TVLTAVVPLYVAMILA.YGS-----------VQWWKIFSPD-QCSGIN---------
YDQ4_SCHPO/18-440-----------------------PIIESDLEVIVIALGG.YVL-----------AKK.GFLPRD-AQKVIS---------
P71425_KLEPN/4-313-----------------------VIIHALAPIFVIMLLG.FWA-----------GKA.GMVDNK-NVSLLN---------
Q9FKY4_ARATH/9-387-----------------------VASMPIVQVLLISVLGAFLA-----------TDYCSLLSAD-TRRSVN---------

PF03977

Q9KUH0_VIBCH/17-376ELG....................QIIMILVGCTLLFLAIRKGFEPLLLLPIGFGAVLANIPNAGFT....E.........
O59022_PYRHO/20-400TIG....................NIVMILVGLTLVYLAIRYKMEPLLLLPIGISAVLVNLPLSHIADWPLAPQLPPDVQG
O28195_ARCFU/1-354MLG....................SLVMIGVGLLLVYLGIVKKMEPLLLVPIGIGAILVNIPGGGLAE..........EG.
OADB_PASMU/17-431ELG....................QALMMLISLVLLWLAIARKFEPLLLLPIGFGGLLSNIPEAGLAMSALESLLHQGSAE
OADB_VIBCH/17-432QWG....................QGIMILVGLVLLYLAIVKRFEPLLLVPIGFGGILSNLPDAGLAMSAIENAVYAAKPE
O83096_TREPA/89-468FHGVTQVPDLANPQRTHSVFGYQQALLLVVGLLIIYLGAAKGFEPLLLIPIGFGTVFVNIPGAGMY....S.........
Q99ZL5_STRP1/18-376TVN....................NLIMICLASFFLYLGIKKEYEPYLMVPIAFGILLVNLPMAGLMDHPANGNP......
Q99ZL0_STRP1/12-373TIP....................QIVMMVIGALLMYLGIKKEYEPTLLVPMGLGTILVNFPGSGVLTQVVNGVEQ.....
Q9WZY2_THEMA/30-384TFG....................NIAMFAVAIALLYVAIVKHSEPLLLIPIAFGIILANIP....VETTGILNE......

PF06965

NHAA1_PSEPK/11-387--------------------------FTRFFQLEAASGL------------------LLIAAAVLALIINN---------
NHAA_BRUSU/14-384--------------------------MRRFLDSEAAGGI------------------TLMAAAALALIVAN---------
NHAA_CAUCR/11-381--------------------------LRELLESGAAGGL------------------LLMACAVLALFVAN---------
NHAA2_PSESM/16-384--------------------------LTRFLASESAGGI------------------VLMAAALAALIVAN---------
NHAA_HELPY/14-427--------------------------LKNFIKSESFGGI------------------FLFLNAVLAMVVAN---------
NHAA_SHEON/5-380--------------------------IRNFLSQESAGGI------------------LLLIAVAFAMLMAN---------
NHAA1_PSESM/17-385--------------------------IKRFFAAEAAGGL------------------ILMAAALAALIVAN---------
NHAA2_VIBVU/27-435--------------------------IYRFIHIESAAGI------------------VLFISTLLAVLLAN---------
NHAA_HAEIN/17-393--------------------------IQRFFKLESAGGI------------------LLLFSAVVAMLLAN---------
NHAA_RHILO/12-384--------------------------FREFLDSEAAGGI------------------ILMVAAALALIVAN---------
NHAA_WIGBR/8-385--------------------------KSKFFKNPTFSGL------------------LLILFCFLAIFISN---------
NHAA2_STRCO/26-428--------------------------WRTFVRTETSSAV------------------FLLAAVAAALVWAN---------
NHAA_VIBCH/5-373--------------------------IRDFFKMESAGGI------------------LLVIAAAIAMVIAN---------
NHAA_RHIME/20-428--------------------------FMRFLRIEATAGI------------------ILLLSTLLALGLAN---------
NHAA_ECOLI/4-380--------------------------LHRFFSSDASGGI------------------ILIIAAILAMIMAN---------
NHAA_STRAT/25-401--------------------------VADALRTETVGGV------------------LLLVATVTALVWAN---------
Q93DN6_9BACT/17-388--------------------------LERFIQTESSGGV------------------IMIIFAALAMIAAN---------

PF00999

YDO6_SCHPO/39-445--------------------------LVLLIGALLTSYY------------------..VQSKKIR..AIH---------
KEA4_ARATH/173-543--------------------------LVVVIVSATCGGI------------------..A.FACAG...QP---------
KEA5_ARATH/158-528--------------------------LVVIIVFAAIGGI------------------..V.FSCLG...QP---------
KEA3_ARATH/109-496--------------------------LTFLMVTVIIVPA------------------....FRILK...AS---------
SL9A3_HUMAN/58-462--------------------------IALWILVASLAKI------------------GFHLSHKVTS.VVP---------
Q83E71_COXBU/27-390--------------------------IFLIFAGAAVLST------------------..F.ALMTR...QS---------
Q9Y959_AERPE/11-361--------------------------VIVLVAFYILAAT------------------..RIAHVIG...LP---------
Q8XPZ0_RALSO/11-388--------------------------IIGGIVLAFVLGT------------------..I.AQRLR...LP---------
CVRA_ECOLI/10-389--------------------------FILGSILVTSSIL------------------LSSFSSRLG...IP---------
Q93N84_STRLA/15-400--------------------------ALIVVA.SWLLGA------------------..L.ARRLG...QP---------
Q8XLS1_CLOPE/11-387--------------------------LILSVV.AFFTPF------------------..L.VSRLKRVNIP---------
O25795_HELPY/9-377--------------------------ALIMLL.IVMAPY------------------..M.SRISR...LP---------
NAH1_METJA/7-393--------------------------IGYLGLALVLGSL------------------VAKIAEKLK...IP---------
CHX14_ARATH/58-442--------------------------SVIIITSRLLYRL------------------....LKPLK...QG---------
Q45308_BACME/8-377--------------------------ALILFA.TKIAGH------------------..L.SVRLG...QP---------
NHX3_CAEEL/44-444--------------------------ITTWLLVASLAKI------------------LFNLMKPLSK.WLP---------
P74393_SYNY3/33-411--------------------------VENLIILLLVATL------------------VALVARWLK...IP---------
YJCE_ECOLI/3-422--------------------------IFFTILIMTLVVS------------------LSGVVTRVMPFQIP---------
O66731_AQUAE/13-381--------------------------LIIVFLSAFLAPL------------------..F.SRILR...MP---------
Q98GP4_RHILO/11-397--------------------------IVAGLGLAFVFGA------------------..L.ANRFR...IP---------
SL9A6_HUMAN/78-503--------------------------ILLLTLTILTIWL------------------FKHRRARF....LH---------
Q8S5V1_ORYSJ/176-496--------------------------LVVIIVSATAGGI------------------..I.FSCLG...QP---------
Q99V81_STAAM/7-388--------------------------VIVVLA.AFLTPI------------------..I.VNRLNINFLP---------
Q9Z9H1_PSEAI/31-448--------------------------TVYTVLTLLLVVG------------------ATRLAAQLL..PLP---------
Q9XBC3_AMYOR/14-390--------------------------AVIVVL.ARLLGA------------------..V.ARRLD...QP---------
SL9A7_HUMAN/114-534--------------------------VILRYGTPATSGR------------------DKSLSCTQED.RAF---------
CHX13_ARATH/60-447--------------------------SVIIVTSRLIFRV------------------....LQPLK...QG---------
Q894B2_CLOTE/11-387--------------------------LIISLL.AFVTPI------------------..I.VSSFKRVKIP---------
O29023_ARCFU/4-337--------------------------AVIVFA.AAIAAI------------------..I.SRMLR...IT---------
Q8PQR8_XANAC/12-399--------------------------AVILGA.ARLCGA------------------..L.LQRIG...QP---------
O30022_ARCFU/11-366--------------------------ALISLT.AFISPL------------------..I.ADKLR...VP---------
Q81V05_BACAN/11-386--------------------------MVVVAI.AFFVPL------------------..L.LQRFKLKALP---------
NHEB_ONCMY/73-472--------------------------IALWILLALLMKL------------------GFHLIPRLSA.VVP---------
Q87RG9_VIBPA/2-353--------------------------EIILITTAFLAGF------------------..I.ALKCN...LP---------
Q8EIY2_SHEON/2-355--------------------------EPAILIITLICGM------------------..L.VSRIG...LP---------
Q9RV80_DEIRA/10-368--------------------------GTVILALALVGRA------------------....AGRLG...IT---------
NAH1_YEAST/17-440--------------------------ACVGVFSSIFSLV------------------SLYVKEKLY...IG---------
O58040_PYRHO/8-379--------------------------AIILVV.AKLFGY------------------..L.MVKLG...FP---------
SL9A1_HUMAN/105-505--------------------------ISLWILLACLMKI------------------GFHVIPTISS.IVP---------
O29412_ARCFU/6-377--------------------------LVEFIEILMLATA------------------VAVTVKFIR...LP---------
Q9L191_STRCO/11-375--------------------------GGAFVAAAFLARL------------------....GGRIG...LP---------
NAH2_SCHPO/16-437--------------------------AIIGGFTSLFMLC------------------SLIIKEKLF...LG---------
NHX7_ARATH/37-450--------------------------VLFVGMSLVLGIA------------------SRHLLRGTR...VP---------
YJBQ_BACSU/10-389--------------------------VVVLIV.AFLTPI------------------..L.LHRFKL.SIP---------
NAPA_ENTHR/8-379--------------------------CLILVA.TTIGSH------------------..I.SRRFG...IP---------
Q48731_9LACT/8-376--------------------------TIVLIA.SLIATL------------------..A.SRRLK...IP---------
Q93JF3_STRCO/15-406--------------------------ALILVA.AHSGGW------------------..L.ARRLG...QP---------
TMCO3_MOUSE/274-662--------------------------IVTIGMLSLPCGW------------------..L.CTAIG...LP---------
Q09432_CAEEL/35-439--------------------------ICLWLIGASIAKI------------------IFNLIPHLNE.LFP---------
NAH_SCHPO/16-434--------------------------IVAGGFITFFCYF------------------SEVFRKKLL...VG---------
Q9KTB1_VIBCH/2-353--------------------------DLILLSAAFLAGF------------------..I.ALKCH...LP---------
Q23706_CARMA/81-483--------------------------IGLWIFLACLGKI------------------GFHMTPKISH.VFP---------
Q9X8F2_STRCO/12-382--------------------------AAAVLAPLLVHAT------------------....GRRVR...VP---------
NAH2_METJA/7-395--------------------------LGYLSILFAGGAI------------------IAKIAKKIG...IP---------
Q8PYD4_METMA/9-374--------------------------VDVILGFAVVILT------------------..I.FYRFE...FP---------
SL9A2_RAT/85-486--------------------------ITLWILLASLAKI------------------GFHLYHKLPT.IVP---------
O67072_AQUAE/23-407--------------------------AILLFS.AKLFGS------------------..I.FRKLG...IP---------
Q8KHN6_NOCAE/16-400--------------------------GVIVAV.CHLGGL------------------..L.CHRIR...QP---------
Y2309_MYCBO/17-417--------------------------VVIVALVAAVVVG------------------TVL.GHRYR...VG---------
O82871_PSEAI/9-410--------------------------IALTTLLTYVN..------------------....YRFIR...LP---------
P73863_SYNY3/19-406--------------------------LIVLSVSLSIATL------------------SKTVPILRK...IP---------
O58682_PYRHO/8-388--------------------------SILLVV.AKSLEW------------------..L.LKKKG...IH---------
Q8PVQ3_METMA/9-375--------------------------VDVILGFAILILT------------------..I.FSKFE...VP---------
CHX23_ARATH/59-444--------------------------FVANLS.YRVLYY------------------..L.TRPLY...LP---------
Q55736_SYNY3/17-390--------------------------TILLLV.TLILPP------------------..I.FERLK...LP---------
KEFX_HAEIN/13-387--------------------------VILLASSVTIVPL------------------....FKRLG...LG---------
Q97BQ9_THEVO/10-379--------------------------LILLFV.SMLLGV------------------..L.FSKFK...IP---------
O26854_METTH/5-391--------------------------AFSVAVIILLGLL------------------FNRVFTRAR...LP---------
Q8KLM5_STRTO/6-396--------------------------AVTFAV.AFVFAR------------------..L.AKRIR...QP---------
NAH1_ZYGRO/16-438--------------------------SCLGIFSSIFSLV------------------SLFVKERLY...IG---------
NHAK_BACSU/3-415--------------------------IFLVVLVLLTIIA------------------ISNIVNRFIP.FIP---------
Q55190_SYNY3/65-446--------------------------GVLVGV.SALKLL------------------..L.FPEGG...LA---------
Q55388_SYNY3/8-396--------------------------TLQIILTVLFGIG------------------AQVLAGFLK...LP---------
NAH3_METJA/8-380--------------------------FFIILSIIFIVPN------------------..L.LKKFN...IP---------
Q93KW8_STRVR/66-455--------------------------AVVVAV.ARACGA------------------..LVGRHLG...QP---------
Q8GRF9_9PROT/12-375--------------------------AIVGLA.AVLCGG------------------..M.MTRLK...QP---------
SL9A4_RAT/73-477--------------------------VTLWILLASLAKI------------------GFHLYHRLPH.LMP---------
Q815T7_BACCR/11-379--------------------------ALVLVAIAAVIAG------------------......KFK...FS---------
Q9PBK4_XYLFA/11-395--------------------------IAVGLSLAFVLGA------------------..L.AQRLK...LS---------
SL9A5_RAT/52-457--------------------------VALWILVASLAKI------------------VFHLSRKVTS.LVP---------

PF03956

Q8U272_PYRFU/7-192--------------------------------------------------------------------------------
Q5JE53_PYRKO/7-192--------------------------------------------------------------------------------
Q0W307_UNCMA/5-198--------------------------------------------------------------------------------
Q3A9X2_CARHZ/110-301--------------------------------------------------------------------------------
Q6D3T3_ERWCT/111-299--------------------------------------------------------------------------------
Q65TG5_MANSM/110-298--------------------------------------------------------------------------------
A0Q670_FRATN/117-306--------------------------------------------------------------------------------
Q8ZX41_PYRAE/114-291--------------------------------------------------------------------------------
Q5LD53_BACFN/7-205--------------------------------------------------------------------------------
Q0I3G0_HAES1/111-299--------------------------------------------------------------------------------
Q30YZ4_DESDG/7-199--------------------------------------------------------------------------------
A7HMA4_FERNB/6-189--------------------------------------------------------------------------------
Q1MPD6_LAWIP/7-198--------------------------------------------------------------------------------
Q9CNG6_PASMU/111-299--------------------------------------------------------------------------------
Q7P6I1_FUSNV/4-194--------------------------------------------------------------------------------
A1EJA4_VIBCL/110-298--------------------------------------------------------------------------------
A9KSU8_CLOPH/5-197--------------------------------------------------------------------------------
A1ISW6_NEIMA/109-298--------------------------------------------------------------------------------
A4YEP1_METS5/91-281--------------------------------------------------------------------------------
Q9UYY3_PYRAB/7-192--------------------------------------------------------------------------------
B8G2D2_DESHD/116-308--------------------------------------------------------------------------------
A0KIW8_AERHH/111-299--------------------------------------------------------------------------------
Y1452_HAEIN/4-192--------------------------------------------------------------------------------
A1RUU6_PYRIL/96-273--------------------------------------------------------------------------------
A1VEH4_DESVV/7-199--------------------------------------------------------------------------------
Q64PG3_BACFR/7-199--------------------------------------------------------------------------------
A4J6Y5_DESRM/5-197--------------------------------------------------------------------------------
A4FXI0_METM5/7-192--------------------------------------------------------------------------------
Q1QZ23_CHRSD/114-307--------------------------------------------------------------------------------
Q7MLI3_VIBVY/110-298--------------------------------------------------------------------------------
O58406_PYRHO/12-197--------------------------------------------------------------------------------
Q1QD72_PSYCK/112-301--------------------------------------------------------------------------------
Q1Z0Y8_PHOPR/110-298--------------------------------------------------------------------------------
A1U6W6_MARAV/112-300--------------------------------------------------------------------------------
Q96XQ5_SULTO/108-295--------------------------------------------------------------------------------
Q9YBX3_AERPE/117-302--------------------------------------------------------------------------------
A6VPB6_ACTSZ/111-299--------------------------------------------------------------------------------
A1RZA2_THEPD/99-286--------------------------------------------------------------------------------
A6VTK0_MARMS/114-302--------------------------------------------------------------------------------
Q2NU01_SODGM/130-310--------------------------------------------------------------------------------
A5WGW5_PSYWF/135-324--------------------------------------------------------------------------------
A8MGH5_ALKOO/5-196--------------------------------------------------------------------------------
A4W8P2_ENT38/111-299--------------------------------------------------------------------------------

PF06826

Y1229_BACTN/19-182------------------------VLSLISAIGLGLGRV------------------HF......WGVSLG---------
O52005_HALSA/14-174------------------------VMFLAVVVGMAFGRI------------------NFG.....RGIKFG---------
O52005_HALSA/209-380------------------------GFALVLATGTVLGSI------------------PIPLGP.IGVITLG---------
Y590_CORGL/12-174------------------------ALVVILAVGLAIGQI------------------RV......FGLSLG---------
Y2211_CORGL/11-179------------------------ALVVIMTVGLLLGRI------------------KI......FGFRLG---------
YBJL_ECOLI/16-183------------------------LLFVVLALGLCLGKL------------------RL......GSIQLG---------
Y3475_BRAJA/16-184------------------------ALFLVIAAGYWIGSF------------------KI......GAFSLG---------
Y2102_COREF/11-180------------------------ALVAIMGIGLLLGRI------------------RF......FGFRLG---------
Y595_COREF/356-528------------------------PFAIGLSLGLLLGAI------------------PVPLPG.DTTMYLG---------
Y3476_BRAJA/394-564------------------------FIGAAIAIGALVGAI------------------VYKIGS..VPLTLS---------
Y736_BACTN/15-179------------------------AIFLTLFAGFWLGRF------------------KI......GKFSLG---------
YBJL_ECOLI/385-555------------------------AFCAFFVIGLMIGMI------------------TFQFST..FSFGMG---------
Y4083_YERPE/10-180------------------------MLALVAVLGLWIGNW------------------KI......YGVGLG---------
Y035_HAEIN/372-546------------------------PVFIGIGLGVLVGSI------------------PFYIPGFPVALKLG---------
Y2102_COREF/367-539------------------------PLVVGLSLGVLVGMM------------------EFPLPG.GSALSLG---------
Y3471_BRAJA/387-557------------------------FLAAGIAAGLLAGLV------------------SFKVGG..IALTLG---------
Y595_COREF/12-171------------------------ALAVILAVGLAIGRI------------------SL......FGVSLG---------
Y2092_BACTN/378-551------------------------TIFVGIFLGILLGSL------------------PIAFPGMPTPLKLG---------
Y736_BACTN/392-562------------------------FVGLGILLGGLVGAL------------------AIHLGG..IPISLS---------
ASPT_TETHA/367-540------------------------WFALGIALSAALGIV------------------GTKVSG..VPIALG---------
Y3476_BRAJA/20-187------------------------AIFLSLALGYYFGSF------------------TY......KGLGLG---------
Y035_HAEIN/10-179------------------------LLALVAVIGLWIGHW------------------KI......RGVGLG---------
Q8RDQ8_FUSNN/294-465------------------------GFSIAVFLGYFLGSI------------------KISMGP.LGTFSLG---------
Y2092_BACTN/20-185------------------------LYAFVVAAGVYLGKI------------------KI......FGVSLG---------
Y2143_SHEON/15-183------------------------AVFLSLAIGYWVGNK------------------TF......KGFSLG---------
Y500_BACTN/12-166------------------------SLFLIVALGFMLGRI------------------KI......KGLSLD---------
YIDE_SHIFL/10-180------------------------ILALVAVVGLFIGNV------------------KF......RGIGLG---------
Y1229_BACTN/378-551------------------------VIFIGIVLGLALGAI------------------PFSIPGISTPVKLG---------
Y1232_VIBPA/388-558------------------------AFCSFFILGIMFGLV------------------TMTFGQ..VSFSLG---------
Y500_BACTN/358-529------------------------PIAMGIVLGVLFGKL------------------NISFSD.TLSFSPG---------
ASPT_TETHA/15-183------------------------TIFICLALGYLLGKL------------------KI......GSFTLG---------
Y3471_BRAJA/15-183------------------------FLLLAVAIGTMLGRL------------------KI......HGFAIG---------
YIDE_SHIFL/373-547------------------------PVFIGIGLGVLLGSI------------------PVFVPGFPAALKLG---------
Y2143_SHEON/389-559------------------------FWAFAIVIGALLGSL------------------VFKIGN..LPLTLS---------

PF05982

Q8EAY3_SHEON/4-319--------------------------------------------------------------------------------
Q9K663_BACHD/12-337--------------------------------------------------------------------------------
Q8YV47_NOSS1/18-370--------------------------------------------------------------------------------
P71757_MYCTU/16-407--------------------------------------------------------------------------------
Q8YY66_NOSS1/13-322--------------------------------------------------------------------------------
Q9A2P7_CAUCR/49-365--------------------------------------------------------------------------------
P73953_SYNY3/18-374--------------------------------------------------------------------------------

PF03812

KDGT_BACSU/1-314-------------------------MKIKATIERVPGGM-----------------------------------------
KDGT_SHIFL/1-314-------------------------MQIKRSIEKIPGGM-----------------------------------------
KDGT_PECCC/1-314-------------------------MKIKQAIDKIPGGL-----------------------------------------

PF05684

Q9FLW1_ARATH/79-442------------------------AALFAAGAFGVWS..------------------..EKTKIG..SMVS---------
YJCL_BACSU/15-395------------------------GFIAVWAAVSIGL..------------------.EQRFKWA..SAVS---------
Q9LTG3_ARATH/95-460------------------------TALFATGALGLWS..------------------..EKTKVG..AAMS---------
Q8P790_XANCP/17-412------------------------GLIAATLGAVFWTSA------------------RERGPWQRFYAVVP---------
Q9K8K1_BACHD/10-388------------------------SILIGMTALIVWA..------------------.EYKIGGKFFKYVP---------
Q8RIK4_FUSNN/11-392------------------------AFLMCLAGCLLLL..------------------.EKYSKWKIFNVVP---------

PF03601

Y2225_RHILO/7-307------------------------PGLVLVAMITAVAFS....-----------...AHNVS...GFALFS---------
YDHF_LACLA/5-311------------------------PGFLLSFAIAIVSYL....-----------...LNR....FIFHSLG---------
Y5383_PSEAE/21-335------------------------PGLLLSAALAGVAIL....-----------...LGRSQ.WLQHNGIS---------
Y1621_ARCFU/22-308------------------------QMLLLLLLCGAAAYI....-----------...INLAD.....PALE---------
Y2119_MYCPA/67-384------------------------PGILLLIGVGVLGKYAQIW-----------WNALAKHE.HWTVPDIE---------
Y1056_STRP1/9-318------------------------PGLLLCLLLALPAWC....-----------...LGR.....LFPIIG---------
Y425_CAUCR/147-446------------------------PGLLAGLLMAVLAKL....-----------...LSQS......LHAP---------
Y1461_PASMU/8-314------------------------LGLVFIGILTFLVNL....-----------...LAKTP.FALNANLS---------
Y034_STRPN/9-315------------------------AGILACLLISILSWY....-----------...LGG.....FFPVVG---------
Y341_STAAM/11-311------------------------IGLSLTFIVALFSFL....-----------...AAKLP...ILDKVG---------
Y1643_HAEIN/8-316------------------------FGLIFIAIIAVLANY....-----------...LGSTD.FSHHYHIS---------
YEIH_SHIFL/18-326------------------------PGLALSAVITGVALW....-----------...GGSIP.AVAGAGFS---------
Y999_CAMJE/18-342------------------------KGLLFTACIVIFAMY....-----------...LSSVQSIKDTTHLA---------

PF03616

Q9HZ58_PSEAE/4-371------------------LHLDALSTTALALLLLALGSQ------------------LKKRSRWLTRLCVP---------
O26036_HELPY/4-373------------------IKLDIYATLVCMVLVLLLGRY------------------VISKVKFLRDYDIP---------
Q9KNC4_VIBCH/5-376------------------ISIGALESFLIAISVLFLGHF------------------INAKLPILTKFNIP---------
Q9S458_SALTM/1-366------------------MILDASYTLLVACIALLIGMF------------------VVKFTPFLQKNHIP---------
GLTS_HAEIN/3-369------------------YTFSTYETLALASLVLLLGYF------------------LVKRINVLKTFNIP---------
GLTS_SHIFL/2-366------------------FHLDTLATLVAATLTLLLGRK------------------LVHSVSFLKKYTIP---------
Q99RS8_STAAM/2-370------------------IELNAITTLCLACILYLLGTA------------------IVNHVNFLKRICIP---------
P73275_SYNY3/4-370------------------IQFNIRQTIIVAILVLYIGKY------------------LTKKIKFLQSFNIP---------

PF13593

C5DGV7_LACTC/27-386------------------------------------------------------AV--------AAIFLQSGLSMKTQKL
Q6CIF6_KLULA/49-408------------------------------------------------------AV--------IVIFLQSGLSMSTKKL
B3LLT3_YEAS1/23-385------------------------------------------------------CV--------AWIFLQSGLGMKSRSL
Q6BPS9_DEBHA/26-388------------------------------------------------------AV--------AVIFLISGLSMSTASL
B9WFB0_CANDC/25-387------------------------------------------------------AV--------AVIFLISGLSMSTKQL
B7NPU5_ECO7I/8-316------------------------------------------------------.I--------ALLFFMHGAKLSREAI
A5DK55_PICGU/24-387------------------------------------------------------AV--------AVIFLISGLSMGTKDL
A5E3X9_LODEL/29-391------------------------------------------------------AV--------AVIFLISGLSMSSKAL
A7MML9_CROS8/10-319------------------------------------------------------.I--------ALLFFMHGAKLSREAI
C2M6P1_CAPGI/9-321------------------------------------------------------.I--------CIIFLLYGLKLNIKEV
A0KES2_AERHH/4-313------------------------------------------------------.V--------ALLFFMHGAKLSRQNL
B6Q6N8_PENMQ/44-391------------------------------------------------------AV--------GLVFLISGLSIPRSKL
Q4ZYQ4_PSEU2/13-325------------------------------------------------------.V--------FVVFFLHGVNLSSEQI
C4UDI4_YERAL/10-319------------------------------------------------------.I--------ALLFFMHGAKLSRAAI
Q0KE25_CUPNH/16-328------------------------------------------------------.V--------ALVFFLHGAALSRDKL
Q6FU65_CANGA/32-393------------------------------------------------------AV--------AWIFLQSGLSMKTSRL
D0Z7X4_EDWTE/10-319------------------------------------------------------.I--------ALLFFMHGAKLSREAI
A3RYL9_RALSL/10-322------------------------------------------------------.V--------SLVFFLHGAALSREKI
B2Q2V9_PROST/10-320------------------------------------------------------.I--------ALLFFMHGAKLSRESI
Q7N4G4_PHOLL/10-320------------------------------------------------------.I--------ALLFFMHGAKLSRQAI
C8NCW5_9GAMM/45-353------------------------------------------------------.I--------ALLFFMHGAKLSREAV
C9Y8T0_9BURK/9-319------------------------------------------------------.I--------ALLFFMHGAKLSRANV
C5DX01_ZYGRC/23-385------------------------------------------------------AV--------ACIFLNSGLNNKTKRL
A9IQT5_BORPD/10-319------------------------------------------------------.I--------ALLFFLHGARLSREAI
Q988D7_RHILO/21-330------------------------------------------------------.V--------ALLFFLHGARLSRDVV
Q2K4B0_RHIEC/7-316------------------------------------------------------.I--------AALFFLHGARLSRDVV
Q2NSZ3_SODGM/10-322------------------------------------------------------.I--------ALLFFMHGAKLSREAV
B9JA81_AGRRK/7-318------------------------------------------------------.I--------GLLFFLHGARLSRDVV
A6UD14_SINMW/7-316------------------------------------------------------.V--------GLIFFLHGARLSRDVV
B0VBX5_ACIBY/10-320------------------------------------------------------.I--------AILFFLHGAKLSREAV
C6W4P5_DYAFD/14-325------------------------------------------------------.V--------SLIFFFYGLRLSPEKL
A5VE28_SPHWW/9-318------------------------------------------------------.I--------AFLFFLYGTRLSPRAA
B4WAZ9_9CAUL/9-317------------------------------------------------------.I--------GLLFFLYGARLSPGAV
D2TZF8_9ENTR/10-320------------------------------------------------------.I--------ALLFFLHGAKLSRQAI
D0J170_COMT2/9-318------------------------------------------------------.V--------SLLFFLHGAKLSRQAI
B2IHJ5_BEII9/11-319------------------------------------------------------.I--------FALFFLYGARLKPEAV
A3XPQ3_LEEBM/6-318------------------------------------------------------.I--------ALIFFLYGLKLSPQKL
A3I1U6_9BACT/15-326------------------------------------------------------.I--------GLVFFFYGVKLDPVKL
B5JCP6_9BACT/12-331------------------------------------------------------.V--------ALTFVIQGLSLPTRHI
B4WXN7_9GAMM/9-320------------------------------------------------------.V--------AVLFFVHGAALSRKQV
C0XTF9_9CORY/7-316------------------------------------------------------.I--------AFLFFLYGARLSTAEA
Q0V4P5_PHANO/88-416------------------------------------------------------SV--------SVIFFINGCTLETSIL
A3SE09_9RHOB/10-318------------------------------------------------------.V--------SLLFFLYGAKLDPSAV
B2WB77_PYRTR/69-400------------------------------------------------------AV--------SIIFFINGCTLDTALL
D0WMS3_9ACTO/21-327------------------------------------------------------.V--------CLVFLVYGMRLRTSEV
B7G617_PHATC/64-378------------------------------------------------------.V--------CFIFVMAGLGLKTEEF
A9USA8_MONBE/8-323------------------------------------------------------AV--------FMIFFNSGLTLRTEDL
A5P8F8_9SPHN/9-317------------------------------------------------------.I--------FALFLLNGMRVSRGEI
A4S2B1_OSTLU/55-379------------------------------------------------------.I--------AALFFIAGVGLPVRAL
C5BV46_BEUC1/9-317------------------------------------------------------.V--------TVLFLVYGMRLATREV
C1MQW6_MICPC/113-439------------------------------------------------------.V--------RAMFLIAGMNLPTSEL
B7G616_PHATC/92-406------------------------------------------------------.V--------MIIFVLAGMGLRTEEL
Q2NAY2_ERYLH/10-318------------------------------------------------------.I--------FVLFLVNGMRIARGDI
Q1GQQ6_SPHAL/56-363------------------------------------------------------.I--------VLLFFLNGVRLPRDEV
B8LLL0_PICSI/96-415------------------------------------------------------.T--------FGIFLVSGLTLRSGEM
A7RRB9_NEMVE/42-385------------------------------------------------------.I--------VGLFLHSGIKLRTGEI
E6VTY4_DESAO/16-319------------------------------------------------------.V--------ALIFAIQGLHMSFKGC
C0Q8Q9_DESAH/8-317------------------------------------------------------.I--------FIIFLFSGLIIEPDQI
Q4DG32_TRYCC/64-405------------------------------------------------------.V--------FISFALSGASFPDIDR

PF01758

ARSB_BACSU/49-246-------------------------------------------------------L--------VLMMYPPLAKVRYEEI
O49665_ARATH/179-364-------------------------------------------------------Q--------GFLMFAVGINSNEKDF
O29775_ARCFU/75-273-------------------------------------------------------L--------ILMMYPPLAKVRYEEM
ARR3_YEAST/78-276-------------------------------------------------------M--------IVMMIPPICKVSWESI
O81017_ARATH/71-248-------------------------------------------------------L--------GFLMLSMGLTLTFEDF
NTCP2_CRIGR/39-220-------------------------------------------------------L--------ALVMFSMGCNVELHKF
P71942_MYCTU/62-259-------------------------------------------------------L--------LIMMYPVLAKVRYDRL
Y944_SYNY3/61-268-------------------------------------------------------L--------FFMMYPIMVKIDFSQA
O58554_PYRHO/48-238-------------------------------------------------------V--------ISMIYPMMINLRVEEL
O86662_STRCO/51-247-------------------------------------------------------L--------SLVLFSAGLQVPVRAL
O26986_METTH/62-259-------------------------------------------------------L--------ILMMYPPLAKVHYEDL
YOCS_BACSU/41-221-------------------------------------------------------L--------GIIMFGMGLTLQADDF
P73938_SYNY3/12-198-------------------------------------------------------L--------FLIMFGMGLGLTIKDF
P3_HUMAN/197-381-------------------------------------------------------I--------FVNKCSFGCKVELEVL
O58645_PYRHO/46-238-------------------------------------------------------L--------FMMLFQPMVFMDIKKA
NTCP_HUMAN/32-214-------------------------------------------------------L--------FFIMLSLGCTMEFSKI
O67889_AQUAE/32-212-------------------------------------------------------L--------IVIMLSMGLTLTPEDF

PF03547

Q98L58_RHILO/3-308------------------------------------------------------DF--------AVSVAMPLLLFQTMVK
O67397_AQUAE/2-289------------------------------------------------------NY--------VIYFALPFTIFKNLRF
ECM3_YEAST/12-596------------------------------------------------------DI--------VLTILLPCLSFNKIVA
PIN1_ORYSJ/9-590------------------------------------------------------RF--------VALFAVPLLSFHFIST
Y1382_METTH/5-299------------------------------------------------------RV--------VINVAIPSLIFTSLYR
PIN5_ARATH/9-362------------------------------------------------------KF--------VAKFSIPLLSFQIISE
Q97M34_CLOAB/2-296------------------------------------------------------NF--------IVSITLPLMILTSFNV
YFDV_SHIFL/4-307------------------------------------------------------KL--------VLNYALPAALFVSITR
PIN6_ARATH/9-565------------------------------------------------------RF--------VSVFAVPVLSFHFISQ
YWKB_BACSU/5-315------------------------------------------------------TL--------VTKYALPAHFIAGILT
Q9FVF6_9ROSI/9-609------------------------------------------------------RF--------VALFAVPLLSFHFIST
Y1031_METJA/2-303------------------------------------------------------NI--------VIYIAMPSTIFLTISK
PINI_ARATH/9-617------------------------------------------------------RF--------VALFAVPLLSFHFIAA
YB8B_YEAST/13-413------------------------------------------------------LL--------NVDLFTPCLIFSKLAK
Q9C999_ARATH/18-441------------------------------------------------------KL--------VFALFLPCLIFTELGE
Q9WYQ5_THEMA/4-288------------------------------------------------------KV--------AIWVMVPTVTFTFINE
Q9C9K4_ARATH/9-407------------------------------------------------------NI--------VFYVFSPSLIGSRLAD
Q48797_OENOE/6-311------------------------------------------------------YL--------IMNIALPLSIFVSVLT
PIN7_ARATH/9-614------------------------------------------------------RF--------VAIFAVPLLSFHFISS
Q9LZN2_ARATH/30-423------------------------------------------------------GL--------VFSLLLPCLIFSQLGQ
Q9SHL8_ARATH/9-388------------------------------------------------------KV--------VFVLFAPALMFANLAQ
PIN4_ARATH/9-611------------------------------------------------------RF--------VAIFAVPLLSFHFIST
YDQ4_SCHPO/18-440------------------------------------------------------SL--------NVYFFTPCLVFEKVGN
P71425_KLEPN/4-313------------------------------------------------------IF--------VMDFALPATLFSATVQ
Q9FKY4_ARATH/9-387------------------------------------------------------KL--------VFVVFTPCIMFANLAE

PF03977

Q9KUH0_VIBCH/17-376...........................P................GGLLYYVYHIGI--------ESGVFPLLIFMGVGAM
O59022_PYRHO/20-400NIFATLSYLN.............KQYGP................PGLFDLIYYLLI--------KTEVVPLLIFFGLGAM
O28195_ARCFU/1-354.............................................SIFDLFLKYLI--------HTEIVPLLIFLGLGAL
OADB_PASMU/17-431QIAIIAAKLN.TVADPVAIKEALANAVPSVQNQLEVMAGDMGYNAGVLALFYKVAI--------GYGVAPLIIFMGVGAM
OADB_VIBCH/17-432VMTAFSEVLQLSSYMPADIKQALSSATPLQMTTLHLLAEQYQYSDGMLYLFYSIAI--------ASGAGPLIIFMGVGAM
O83096_TREPA/89-468...........................................EHGMLKLIYDAGV--------GNEFFPMLIFMGIGAL
Q99ZL5_STRP1/18-376.............................................GGLLYYLYKGT--------SLGIYPPLIFLCLGAS
Q99ZL0_STRP1/12-373............................................EGVFEALFNFGI--------GTELFPLLIFIGIGAM
Q9WZY2_THEMA/30-384.............................................GGFLYYIKKGL--------DLGIYPPLIFLGIGAL

PF06965

NHAA1_PSEPK/11-387-------------------------------------------------------S.PLSYLYGGLLEVPVAVQVGALNI
NHAA_BRUSU/14-384-------------------------------------------------------S.PFAQTYFDALHLYIG........
NHAA_CAUCR/11-381-------------------------------------------------------S.PLAEGYFHALHVPFA........
NHAA2_PSESM/16-384-------------------------------------------------------S.PLSAGYFSTLHS........VWL
NHAA_HELPY/14-427-------------------------------------------------------S.FLKESYFALWHTPFGFQIGDFFI
NHAA_SHEON/5-380-------------------------------------------------------S.PLAGFYQGFLGTEVQVRVGALDL
NHAA1_PSESM/17-385-------------------------------------------------------S.PLADSYFAALHT........VLA
NHAA2_VIBVU/27-435-------------------------------------------------------S.HLSEEFARFWQISLGMTVGDLVF
NHAA_HAEIN/17-393-------------------------------------------------------S.PLSNQYNDFLNLPVSLQIGSFSI
NHAA_RHILO/12-384-------------------------------------------------------S.PLAETYFSVLHAYLG........
NHAA_WIGBR/8-385-------------------------------------------------------T.NFWKTYNYIINYPL.IKINTHDK
NHAA2_STRCO/26-428-------------------------------------------------------VGP..HSYEAVWQARFTVGFDTRRL
NHAA_VIBCH/5-373-------------------------------------------------------S.AMGEGYQAFLHT........YVF
NHAA_RHIME/20-428-------------------------------------------------------T.AWSSSFLAFWEMPAGVRLGDIGI
NHAA_ECOLI/4-380-------------------------------------------------------SGATSGWYHDFLETPVQLRVGSLEI
NHAA_STRAT/25-401-------------------------------------------------------IPALQHSYEAVSH..FHFGPSALGL
Q93DN6_9BACT/17-388-------------------------------------------------------S.ALAGWYGAFVDAPITLG....SI

PF00999

YDO6_SCHPO/39-445-------------------------------------------------------E........TVISVFVGMVVGLIIR
KEA4_ARATH/173-543-------------------------------------------------------V........ITGYLLAGSIIGPGGL
KEA5_ARATH/158-528-------------------------------------------------------V........IVGYLLAGSIIGPGGL
KEA3_ARATH/109-496-------------------------------------------------------P........ILGFFFAGVVLNQFGL
SL9A3_HUMAN/58-462-------------------------------------------------------E........SALLIVLGLVLGGIVW
Q83E71_COXBU/27-390-------------------------------------------------------M........LVAYMLLGILLGPWGL
Q9Y959_AERPE/11-361-------------------------------------------------------P........GVVEIIMGAMLAFWGV
Q8XPZ0_RALSO/11-388-------------------------------------------------------P........LVGYLCAGVMAGPFTP
CVRA_ECOLI/10-389-------------------------------------------------------I........LVIFLAIGMLAGVDGV
Q93N84_STRLA/15-400-------------------------------------------------------T........VIGQIVAGIALGPTLL
Q8XLS1_CLOPE/11-387-------------------------------------------------------Y........QVGEIFIGILLGKSFL
O25795_HELPY/9-377-------------------------------------------------------I........TVVEILFGSVGAYVGF
NAH1_METJA/7-393-------------------------------------------------------D........IPLLLLLGLIIGPFLQ
CHX14_ARATH/58-442-------------------------------------------------------M........ISAQVLAGIILGPSLF
Q45308_BACME/8-377-------------------------------------------------------S........VLGKLLIGIILGPAVL
NHX3_CAEEL/44-444-------------------------------------------------------D........SSLLIIVGLGLGYFLN
P74393_SYNY3/33-411-------------------------------------------------------Y........VIGLVLAGLAIPRGLS
YJCE_ECOLI/3-422-------------------------------------------------------L........PLMQIAIGALLAWPTF
O66731_AQUAE/13-381-------------------------------------------------------V........PVGELIFGILIGNFFV
Q98GP4_RHILO/11-397-------------------------------------------------------P........LVGYLVAGVLVGPNTP
SL9A6_HUMAN/78-503-------------------------------------------------------E........TGLAMIYGLLVGLVLR
Q8S5V1_ORYSJ/176-496-------------------------------------------------------V........IVGYLLAGSLVGPGGL
Q99V81_STAAM/7-388-------------------------------------------------------V........VVAEILMGIVIGNSFL
Q9Z9H1_PSEAI/31-448-------------------------------------------------------L........PLIQIAAGALLALPSL
Q9XBC3_AMYOR/14-390-------------------------------------------------------P........VIGELLAGILLGPTLF
SL9A7_HUMAN/114-534-------------------------------------------------------S........TLLVNVSGKFFEYTLK
CHX13_ARATH/60-447-------------------------------------------------------M........ISAQVLTGVVLGPSFL
Q894B2_CLOTE/11-387-------------------------------------------------------Y........VVGEILVGIVVGKSLF
O29023_ARCFU/4-337-------------------------------------------------------P........IPAYILVGMALGKAGW
Q8PQR8_XANAC/12-399-------------------------------------------------------P........VIGEMAAGLLLGPIAF
O30022_ARCFU/11-366-------------------------------------------------------V........VVLEIVLGMIFGVSFL
Q81V05_BACAN/11-386-------------------------------------------------------V........VVAEIIAGIFVGKSGF
NHEB_ONCMY/73-472-------------------------------------------------------E........SCLLIVVGLLVGGLIK
Q87RG9_VIBPA/2-353-------------------------------------------------------P........LVGFLLAGFGLHAFGY
Q8EIY2_SHEON/2-355-------------------------------------------------------P........LIGYLVAGFVLFVMGI
Q9RV80_DEIRA/10-368-------------------------------------------------------P........IPLYLMAGIGLGTF..
NAH1_YEAST/17-440-------------------------------------------------------E........STVAGIFGLIVGPVCL
O58040_PYRHO/8-379-------------------------------------------------------A........ALGQLIGGIIIGPSLL
SL9A1_HUMAN/105-505-------------------------------------------------------E........SCLLIVVGLLVGGLIK
O29412_ARCFU/6-377-------------------------------------------------------Y........TIALVLAGLFVGLAGL
Q9L191_STRCO/11-375-------------------------------------------------------T........IPLFMLAGILLGPHTP
NAH2_SCHPO/16-437-------------------------------------------------------E........ATMATATGLIFGPYVA
NHX7_ARATH/37-450-------------------------------------------------------Y........TVALLVIGIALGSLEY
YJBQ_BACSU/10-389-------------------------------------------------------V........VVAEIIMGLIIGKSGL
NAPA_ENTHR/8-379-------------------------------------------------------A........VIGQLLVGVLLGQAGL
Q48731_9LACT/8-376-------------------------------------------------------A........VIGQMLVGILIAPSVL
Q93JF3_STRCO/15-406-------------------------------------------------------Y........IVGQLATGIALGPSLL
TMCO3_MOUSE/274-662-------------------------------------------------------T........MFGYIICGVLLGPSGL
Q09432_CAEEL/35-439-------------------------------------------------------D........SALLIMIGLIIGIIFK
NAH_SCHPO/16-434-------------------------------------------------------E........AVLGSITGLIFGPHAA
Q9KTB1_VIBCH/2-353-------------------------------------------------------P........LVGFLIAGFALNAYGF
Q23706_CARMA/81-483-------------------------------------------------------E........SCMLIVLGVLIGLLLI
Q9X8F2_STRCO/12-382-------------------------------------------------------L........VIFEISLGIVMGPDVL
NAH2_METJA/7-395-------------------------------------------------------D........IPLLLIFGLILSILNV
Q8PYD4_METMA/9-374-------------------------------------------------------P........ILGFLVTGMLIGPYGL
SL9A2_RAT/85-486-------------------------------------------------------E........SCLLIMVGLLLGGIIF
O67072_AQUAE/23-407-------------------------------------------------------P........VLGEVTAGVILGQSVL
Q8KHN6_NOCAE/16-400-------------------------------------------------------P........VIGEIAAGLLLGPTLL
Y2309_MYCBO/17-417-------------------------------------------------------P........PVLLILSGSLLGLIPR
O82871_PSEAI/9-410-------------------------------------------------------P........TIGVMATALVFSLIVQ
P73863_SYNY3/19-406-------------------------------------------------------Y........TLLLVIVGMALAFVDV
O58682_PYRHO/8-388-------------------------------------------------------P........IIAHILTGIILGPFGL
Q8PVQ3_METMA/9-375-------------------------------------------------------P........VLGFLVTGVLIGPHGL
CHX23_ARATH/59-444-------------------------------------------------------P........FVAQILCGLLFSPSVL
Q55736_SYNY3/17-390-------------------------------------------------------G........LVGLLFAGIVLGKSGL
KEFX_HAEIN/13-387-------------------------------------------------------S........VLGYLVAGCLIGPSVF
Q97BQ9_THEVO/10-379-------------------------------------------------------D........VVAYILTGVLVGNGFL
O26854_METTH/5-391-------------------------------------------------------G........ILGMLILGILIGPHGL
Q8KLM5_STRTO/6-396-------------------------------------------------------R........VMGEIIAGLALGPSLL
NAH1_ZYGRO/16-438-------------------------------------------------------E........SMVASVFGLIVGPHCL
NHAK_BACSU/3-415-------------------------------------------------------V........PLIQVALGILAASFPQ
Q55190_SYNY3/65-446-------------------------------------------------------PEDSLVIQLLMGSADLSPEAAQSVF
Q55388_SYNY3/8-396-------------------------------------------------------S........IVFLLIFGVILGNSGL
NAH3_METJA/8-380-------------------------------------------------------A........ITSIMIAGIIIGPYGL
Q93KW8_STRVR/66-455-------------------------------------------------------R........VVGEMISGIVLGPSVL
Q8GRF9_9PROT/12-375-------------------------------------------------------A........VVGYILAGVVLGPSGF
SL9A4_RAT/73-477-------------------------------------------------------E........SCLLIIVGALVGSIIF
Q815T7_BACCR/11-379-------------------------------------------------------V........IPFLIVLGMLVGPHAP
Q9PBK4_XYLFA/11-395-------------------------------------------------------P........LVGYLVAGICVGPFTP
SL9A5_RAT/52-457-------------------------------------------------------E........SCLLILLGLALGGIVL

PF03956

Q8U272_PYRFU/7-192----------------------------------------------------------------SLISFTMGWIGGKVGI
Q5JE53_PYRKO/7-192----------------------------------------------------------------VLGSLVLGLLVGHFFS
Q0W307_UNCMA/5-198----------------------------------------------------------------IIAALALGITLAVFGL
Q3A9X2_CARHZ/110-301----------------------------------------------------------------LVLTVVLGGVGGAYLL
Q6D3T3_ERWCT/111-299----------------------------------------------------------------LCGVVFAGFLLGLTQW
Q65TG5_MANSM/110-298----------------------------------------------------------------LCSMVIFGFLFGLCTK
A0Q670_FRATN/117-306----------------------------------------------------------------YLIYLVLGYILGEIIN
Q8ZX41_PYRAE/114-291----------------------------------------------------------------ALSALIAGLITGHFVR
Q5LD53_BACFN/7-205----------------------------------------------------------------VVAFFCIGCLVGIFND
Q0I3G0_HAES1/111-299----------------------------------------------------------------LCAMVLLGFVIGLSVK
Q30YZ4_DESDG/7-199----------------------------------------------------------------ILAFFIAGALLGYSGI
A7HMA4_FERNB/6-189----------------------------------------------------------------LILSVISGLFIGRLTH
Q1MPD6_LAWIP/7-198----------------------------------------------------------------VLACFLLGIIIGHIEL
Q9CNG6_PASMU/111-299----------------------------------------------------------------LCAMVLLGAFIGYVIK
Q7P6I1_FUSNV/4-194----------------------------------------------------------------VSCAVIVGIFLGYFTK
A1EJA4_VIBCL/110-298----------------------------------------------------------------LILVVGAGLVAGVLLN
A9KSU8_CLOPH/5-197----------------------------------------------------------------TVIALLIGIVYGLSGI
A1ISW6_NEIMA/109-298----------------------------------------------------------------QLGCVLLGFASGKLMR
A4YEP1_METS5/91-281----------------------------------------------------------------YGVPLVLGLSLGFLVK
Q9UYY3_PYRAB/7-192----------------------------------------------------------------ILLALSLGFILGKLGF
B8G2D2_DESHD/116-308----------------------------------------------------------------IIGAFIAGVFGGMIFF
A0KIW8_AERHH/111-299----------------------------------------------------------------LCFVVLGGVLLGLLVD
Y1452_HAEIN/4-192----------------------------------------------------------------LLSAVIIGIVLGWLCK
A1RUU6_PYRIL/96-273----------------------------------------------------------------VSIALAAGFITGIFIK
A1VEH4_DESVV/7-199----------------------------------------------------------------ILCFFLAGVLVGRLDI
Q64PG3_BACFR/7-199----------------------------------------------------------------IVSFFIVGTLCGLFQL
A4J6Y5_DESRM/5-197----------------------------------------------------------------ILGAVVLGIALGHWVI
A4FXI0_METM5/7-192----------------------------------------------------------------VLIALILGFIVGKIFG
Q1QZ23_CHRSD/114-307----------------------------------------------------------------LAGVVVLGILFGAAAR
Q7MLI3_VIBVY/110-298----------------------------------------------------------------LIFVVGGGLLIGLMLP
O58406_PYRHO/12-197----------------------------------------------------------------VLISLSIGFILGKLGI
Q1QD72_PSYCK/112-301----------------------------------------------------------------QVICVAIGFVIGYFLP
Q1Z0Y8_PHOPR/110-298----------------------------------------------------------------LVLVVAGGLIVGITLG
A1U6W6_MARAV/112-300----------------------------------------------------------------PLLSVLVGALLGYFLF
Q96XQ5_SULTO/108-295----------------------------------------------------------------YILPLILGLLLGFFIK
Q9YBX3_AERPE/117-302----------------------------------------------------------------ILAFFLAGLASGWLTG
A6VPB6_ACTSZ/111-299----------------------------------------------------------------LCTMVVIGFITGFFGQ
A1RZA2_THEPD/99-286----------------------------------------------------------------LLALIAVGWASGLSAG
A6VTK0_MARMS/114-302----------------------------------------------------------------TIAWVIGGVIVGIFAK
Q2NU01_SODGM/130-310----------------------------------------------------------------LCAVLLAGFVLGLIHW
A5WGW5_PSYWF/135-324----------------------------------------------------------------QVSCVLIGFVIGQFLP
A8MGH5_ALKOO/5-196----------------------------------------------------------------ILLAVGAGIISGLFLF
A4W8P2_ENT38/111-299----------------------------------------------------------------LCGVVLLGFLLGLTGI

PF06826

Y1229_BACTN/19-182-------------------------------------------------------V--------T.FVFFAGILAGHFGL
O52005_HALSA/14-174-------------------------------------------------------V--------A.GPLFAGLVLGHF..
O52005_HALSA/209-380-------------------------------------------------------T--------TGGVLITALVLGYLGK
Y590_CORGL/12-174-------------------------------------------------------A--------A.AVLFVALVVSTAN.
Y2211_CORGL/11-179-------------------------------------------------------V--------A.AVLFVGLALSTIE.
YBJL_ECOLI/16-183-------------------------------------------------------N--------SIGVLVVSLLLGQQ..
Y3475_BRAJA/16-184-------------------------------------------------------P--------VTGALFAGLVVGDF..
Y2102_COREF/11-180-------------------------------------------------------V--------A.AVLFVGLAFSTIE.
Y595_COREF/356-528-------------------------------------------------------F--------GGGPIVAGLILGALNR
Y3476_BRAJA/394-564-------------------------------------------------------T--------SGGALISGLFFGWLRS
Y736_BACTN/15-179-------------------------------------------------------T--------VTSVLLVGVLVGQL..
YBJL_ECOLI/385-555-------------------------------------------------------N--------AAGLLFAGIMLGFMRA
Y4083_YERPE/10-180-------------------------------------------------------I--------G.GVLFGGIIVGHFAQ
Y035_HAEIN/372-546-------------------------------------------------------L--------AGGPLVVALILARIGT
Y2102_COREF/367-539-------------------------------------------------------N--------AGGPLLIALLLGAMGR
Y3471_BRAJA/387-557-------------------------------------------------------G--------GGGALIAGLLCGWLRS
Y595_COREF/12-171-------------------------------------------------------A--------A.AVLIVALVVSTLN.
Y2092_BACTN/378-551-------------------------------------------------------L--------AGGPLVVAILIGRFGH
Y736_BACTN/392-562-------------------------------------------------------T--------SGGALIAGLVFGWLRS
ASPT_TETHA/367-540-------------------------------------------------------G--------GTASLIVGLVQSIYRD
Y3476_BRAJA/20-187-------------------------------------------------------A--------VTATLIAAVIIGQI..
Y035_HAEIN/10-179-------------------------------------------------------I--------G.GVLFGGIIVAHFTN
Q8RDQ8_FUSNN/294-465-------------------------------------------------------S--------IGGAIIVALILGFIGK
Y2092_BACTN/20-185-------------------------------------------------------V--------T.FVLFAGILMGHFGF
Y2143_SHEON/15-183-------------------------------------------------------A--------VTATLLAAVVIGQF..
Y500_BACTN/12-166-------------------------------------------------------V--------S.AVIFIALLFGHF..
YIDE_SHIFL/10-180-------------------------------------------------------I--------G.GVLFGGIIVGHFVS
Y1229_BACTN/378-551-------------------------------------------------------L--------AGGPIIVGILLGTFGP
Y1232_VIBPA/388-558-------------------------------------------------------N--------AVGLLLSGITLGFLRA
Y500_BACTN/358-529-------------------------------------------------------L--------TGGVLMVALVLSAVGK
ASPT_TETHA/15-183-------------------------------------------------------A--------TVGVLIVALLIGQL..
Y3471_BRAJA/15-183-------------------------------------------------------T--------TACILIVSVLIGQL..
YIDE_SHIFL/373-547-------------------------------------------------------L--------AGGPLIMALILGRIGS
Y2143_SHEON/389-559-------------------------------------------------------T--------AGGVLIAGLIFSWVRS

PF05982

Q8EAY3_SHEON/4-319-------------------------------------------------------I--------VIAFFALGLLAGLVKS
Q9K663_BACHD/12-337-------------------------------------------------------P--------VVLFFLLGIIAATFKS
Q8YV47_NOSS1/18-370-------------------------------------------------------P--------TLGFLIGGMVIAALGS
P71757_MYCTU/16-407-------------------------------------------------------P--------LLLFFYFGFLIPIFKV
Q8YY66_NOSS1/13-322-------------------------------------------------------P--------PVLFFFLGMLAVFVKS
Q9A2P7_CAUCR/49-365-------------------------------------------------------P--------AVLFFALGLIAAMARS
P73953_SYNY3/18-374-------------------------------------------------------P--------TLAFLIGGMVIAALGT

PF03812

KDGT_BACSU/1-314----------------------------------------------------------------MIIPLFLGAALNTFAP
KDGT_SHIFL/1-314----------------------------------------------------------------MLVPLFLGALCHTFSP
KDGT_PECCC/1-314----------------------------------------------------------------MLVPLFLGALCNTFTP

PF05684

Q9FLW1_ARATH/79-442-------------------------------------------------------G--------ALTSTLLGLAASNLRL
YJCL_BACSU/15-395-------------------------------------------------------G--------AIIALAGAMVFTNVGV
Q9LTG3_ARATH/95-460-------------------------------------------------------G--------ALVSTLVGLAASNLGI
Q8P790_XANCP/17-412-------------------------------------------------------A--------LLLCYLLPGIYNTVGL
Q9K8K1_BACHD/10-388-------------------------------------------------------A--------IVLIYLGAAFMNTFGL
Q8RIK4_FUSNN/11-392-------------------------------------------------------A--------LVFIYILNMFFCTMGL

PF03601

Y2225_RHILO/7-307-------------------------------------------------------P--------MILAVVAGMVYSN..V
YDHF_LACLA/5-311-------------------------------------------------------S--------ATIAILLGIILGN..L
Y5383_PSEAE/21-335-------------------------------------------------------A--------LTLAIVLGILVGNTLY
Y1621_ARCFU/22-308-------------------------------------------------------P--------LFLALVFGIVAGN...
Y2119_MYCPA/67-384-------------------------------------------------------Y--------VLWAIVIGLVITN..T
Y1056_STRP1/9-318-------------------------------------------------------A--------PVFAILLGMLLA..LF
Y425_CAUCR/147-446-------------------------------------------------------A--------PLLAVVLGMMLG...A
Y1461_PASMU/8-314-------------------------------------------------------A--------LTIAILLGILFGNTFY
Y034_STRPN/9-315-------------------------------------------------------A--------PVFAIFIGMLLH..PF
Y341_STAAM/11-311-------------------------------------------------------A--------LTIAILIAILYR..HF
Y1643_HAEIN/8-316-------------------------------------------------------A--------LIIAILLGMAIGNTIY
YEIH_SHIFL/18-326-------------------------------------------------------A--------LTLAILLGMVLGNTIY
Y999_CAMJE/18-342-------------------------------------------------------A--------TAFAIIIGVLLS.PWF

PF03616

Q9HZ58_PSEAE/4-371-------------------------------------------------------S--------PVIAGFGFAFLVWLLR
O26036_HELPY/4-373-------------------------------------------------------E--------PVVGGVLVAFAIMLAR
Q9KNC4_VIBCH/5-376-------------------------------------------------------E--------PIVGGLIVACVITALH
Q9S458_SALTM/1-366-------------------------------------------------------E--------AVVGGFIVAIVLLIID
GLTS_HAEIN/3-369-------------------------------------------------------E--------PVVGGFIVAIGLLIWH
GLTS_SHIFL/2-366-------------------------------------------------------E--------PVAGGLLVALALLVLK
Q99RS8_STAAM/2-370-------------------------------------------------------A--------PVIGGLIFAILVAALD
P73275_SYNY3/4-370-------------------------------------------------------D--------AVSGGVLASLFFGLIY

PF13593

C5DGV7_LACTC/27-386C----------------------------------YNLGN---WRAHLSVLTISFLVTSSIMF.GL-----CS-------
Q6CIF6_KLULA/49-408L----------------------------------VNMGN---WRAHLVVLVISFLVTSSIMY.GL-----CC-------
B3LLT3_YEAS1/23-385M----------------------------------ANMLN---WRAHATILVLSFLITSSIVY.GF-----CC-------
Q6BPS9_DEBHA/26-388R----------------------------------VNLLN---WRAHFTVLSTSFLITSSIIY.GI-----AC-------
B9WFB0_CANDC/25-387L----------------------------------VNVAN---WRAHFTVLSMSFLITSAIIF.GI-----AS-------
B7NPU5_ECO7I/8-316I----------------------------------AGGGH---WRLHLWVMCSTFVLFPILGV.LF-----AW-------
A5DK55_PICGU/24-387M----------------------------------VNMSH---WRAHFTVLSMSFLVTSAIIY.GF-----AC-------
A5E3X9_LODEL/29-391L----------------------------------INALN---WRAHFTVLTMSFLITSSIIY.GI-----VS-------
A7MML9_CROS8/10-319L----------------------------------AGMGH---WRLHLMVFLSTFVLFPLIGL.AM-----KF-------
C2M6P1_CAPGI/9-321F----------------------------------RDIKN---WKLHLLVQLGTFVLFPLLVA.LF-----YP-------
A0KES2_AERHH/4-313L----------------------------------AGLGH---WRLHLVVMASTFVLFPLLGL.LL-----TP-------
B6Q6N8_PENMQ/44-391Y----------------------------------THMFN---WRLHALVQVTSFLFVPAVVL.AV-----VH-------
Q4ZYQ4_PSEU2/13-325K----------------------------------KGLTN---WRLHVMIQVFTFVVFPLIWL.AC-----NK-------
C4UDI4_YERAL/10-319V----------------------------------TGMGH---WKLHLVVFLSTFALFPLLGL.GM-----NA-------
Q0KE25_CUPNH/16-328V----------------------------------SGAKH---WRLHVFVQTFTYVVFPVVGV.LL-----ML-------
Q6FU65_CANGA/32-393M----------------------------------ANMTN---WRAHLTILVLSFLVTSSIVY.GI-----CC-------
D0Z7X4_EDWTE/10-319G----------------------------------AGIGH---WRLHLVVFLSTFALFPLLGV.GL-----GT-------
A3RYL9_RALSL/10-322V----------------------------------EGARN---WRLHLFVQSCTFVLFPLVGA.AI-----LI-------
B2Q2V9_PROST/10-320M----------------------------------AGIGH---WRLHLLVFSSTFILFPIIGL.AL-----HF-------
Q7N4G4_PHOLL/10-320I----------------------------------AGMAH---WRLHLVVFLSTFVLFPIIGL.GL-----NL-------
C8NCW5_9GAMM/45-353L----------------------------------AGVGH---WRLHLLVLSTTFVLFPLLGL.AL-----RP-------
C9Y8T0_9BURK/9-319V----------------------------------AGLSH---WRLHLLVLGFTFGLFPLVGL.LL-----KP-------
C5DX01_ZYGRC/23-385I----------------------------------AEISN---WRAHITVILLSFFITSSIVF.AF-----CC-------
A9IQT5_BORPD/10-319I----------------------------------AGFTH---WRLHLTIFSATFIMFPVLGV.AL-----KP-------
Q988D7_RHILO/21-330V----------------------------------AGLMH---WRLHLVILLTTFGLFPLLGL.AL-----GY-------
Q2K4B0_RHIEC/7-316I----------------------------------AGLLH---WRLHLIILLTTFGVFPLLGL.GL-----GF-------
Q2NSZ3_SODGM/10-322L----------------------------------GGIGH---WKLHVVVFLSTFALFPLLGL.AM-----KV-------
B9JA81_AGRRK/7-318I----------------------------------AGMLH---WRLHLVILLTTFGIFPLLVL.GI-----GQ-------
A6UD14_SINMW/7-316I----------------------------------AGFLH---WRLHLAILLSTFALFPLLGL.LI-----GF-------
B0VBX5_ACIBY/10-320I----------------------------------EGILH---WKMHLLVFAITFFIFPAIGL.LA-----KP-------
C6W4P5_DYAFD/14-325K----------------------------------AGLVN---WRLHVMVHLSTFVLFPVLAL.AF-----RP-------
A5VE28_SPHWW/9-318L----------------------------------AGLVH---WRLHLAILLCTFALFPALGL.GV-----SH-------
B4WAZ9_9CAUL/9-317W----------------------------------AGLSH---WRLQGMVLSSTFLLFPLMGL.AV-----FW-------
D2TZF8_9ENTR/10-320L----------------------------------AGVGH---WRLHLLIFTSTFILFPLIGL.AL-----KP-------
D0J170_COMT2/9-318L----------------------------------AGIGH---WRLHIWIFIATFVLFPVLGL.AL-----RP-------
B2IHJ5_BEII9/11-319L----------------------------------AGITH---WRLQLMVLASTFVLFPLLGI.GL-----VH-------
A3XPQ3_LEEBM/6-318K----------------------------------AGLGN---YKLHLLVQACTFLVFPLVVL.LF-----RP-------
A3I1U6_9BACT/15-326K----------------------------------EGLVN---WKLHVLIQSATYIIFPGLIL.LL-----LS-------
B5JCP6_9BACT/12-331A----------------------------------ASAAK---FRLHAFCQVAIFVLSPALML.GF-----LA-------
B4WXN7_9GAMM/9-320L----------------------------------AGAMH---WRLHLFISSLTFLVFPLAVL.PV-----SL-------
C0XTF9_9CORY/7-316L----------------------------------RGLTH---WRLHLMILCFTFVVYPLIGL.AV-----RP-------
Q0V4P5_PHANO/88-416L----------------------------------ENSMR---WKLHAFVQLQCYLVCSAATF.AI-----VS-------
A3SE09_9RHOB/10-318K----------------------------------AGITN---WRLQGMTFGATYVLFPLIGL.LL-----AT-------
B2WB77_PYRTR/69-400L----------------------------------ANYKR---WKLHLFVQLQCYLVCSAATF.AI-----VS-------
D0WMS3_9ACTO/21-327L----------------------------------AGLTN---VKLQLSVLLATYVAFPAFGF.LM-----YK-------
B7G617_PHATC/64-378S----------------------------------KALQR---VYFNGFVQMFNFGVVSSIIY.GL-----SR-------
A9USA8_MONBE/8-323A----------------------------------AAALQ---YRVHAMIQGFTLILVPLCVA.IF-----VH-------
A5P8F8_9SPHN/9-317G----------------------------------RGLLN---WRFILPLVLWVFGAMALAGL.GL-----SK-------
A4S2B1_OSTLU/55-379K----------------------------------EAASD---VSLNAFTQAFIFVFPTIVIA.AA-----AP-------
C5BV46_BEUC1/9-317V----------------------------------AGLRD---ARLQGAMLAATFVLFPALGL.LL-----SS-------
C1MQW6_MICPC/113-439A----------------------------------RAATN---ARANLFVQFFIFGFAGVVVARVL-----AP-------
B7G616_PHATC/92-406S----------------------------------RAFQR---VYFNTFVQVFNFGLVSLVVF.GA-----SR-------
Q2NAY2_ERYLH/10-318A----------------------------------RGLTN---WRFFLPLGLWVFGIMALAGL.GF-----SK-------
Q1GQQ6_SPHAL/56-363L----------------------------------HGIRN---WKLQGAALLFCFGAMALLGL.AA-----QA-------
B8LLL0_PICSI/96-415S----------------------------------AAIEA---WPAGAFGLVSILLFTPFISR.LV-----LQ-------
A7RRB9_NEMVE/42-385K----------------------------------ESLRA---WKSLILNFIIIMLLTPIIAA.KL-----TS-------
E6VTY4_DESAO/16-319G----------------------------------RIRDY---AAMIGVAALVSVVCYPLLAA.GL-----SA-------
C0Q8Q9_DESAH/8-317R----------------------------------AGIRD---VKATAGAIWVILIVAPLVAG.IF-----LM-------
Q4DG32_TRYCC/64-405S----------------------------------ATLRF---MGPTITMFAMSFILSPILGA.AI-----YV-------

PF01758

ARSB_BACSU/49-246G----------------------------------RVFKD...IKVLILSLVQNWIIGPTLMF-IL-----AI-------
O49665_ARATH/179-364L----------------------------------EAFKR...PKAILLGYVGQYLVKPVLGF-IF-----GL-------
O29775_ARCFU/75-273G----------------------------------KVFSN...LKLLAFSLTQNWIVGPVVMF-LL-----AI-------
ARR3_YEAST/78-276H----------------------------------KYFYRSYIRKQLALSLFLNWVIGPLLMT-AL-----AW-------
O81017_ARATH/71-248R----------------------------------RCLRN...PWTVGVGFLAQYMIKPILGF-LI-----AM-------
NTCP2_CRIGR/39-220L----------------------------------GHLRR...PWGIVVGFLCQFGIMPLTGF-VL-----S.-------
P71942_MYCTU/62-259D----------------------------------TVTGD...RKLLLSSLLLNWVLGPALMF-AL-----AW-------
Y944_SYNY3/61-268R----------------------------------QAVKA...PKPVILTLVVNWVIKPFTMV-IF-----AQ-------
O58554_PYRHO/48-238K----------------------------------NTVKL...GKQLVVALAMGLIISPLIMY-GA-----IW-------
O86662_STRCO/51-247G----------------------------------ALLRR...PKALLAGLVLHLAIPLAVVP-FV-----AF-------
O26986_METTH/62-259P----------------------------------DVFRN...FRILGLSLLQNWIIGPVLMF-IL-----AI-------
YOCS_BACSU/41-221K----------------------------------ELVRK...PWQVIIGVIAQYTIMPLVAF-GL-----A.-------
P73938_SYNY3/12-198N----------------------------------RIWLE...PKAVAIGLIAQLVMLPMVGF-GL-----S.-------
P3_HUMAN/197-381K----------------------------------GLMQS...PQPMLLGLLGQFLVMPLYAF-LM-----A.-------
O58645_PYRHO/46-238F----------------------------------TTRTRV.KTKYLILLTFFYTLLFPVLTW-IF-----LK-------
NTCP_HUMAN/32-214K----------------------------------AHLWK...PKGLAIALVAQYGIMPLTAF-VL-----G.-------
O67889_AQUAE/32-212K----------------------------------EIARK...PFIVFYGALLQYTVMPLSGY-LL-----S.-------

PF03547

Q98L58_RHILO/3-308A----------------------------------DFHG..VAPWPLWGAYFTAVAITWAAGH-LV.....TTR------
O67397_AQUAE/2-289.----------------------------------..LEIGKEVLGVVLIAWGAIFLSILFAF-LF.....GK.------
ECM3_YEAST/12-596N----------------------------------IEDNDIKDVGIICLTSVILFATGLGFAF-IV.....RS.------
PIN1_ORYSJ/9-590N----------------------------------NPYTMNLRFIAADTLQKLMVLAMLTAWS-HL.....SR.------
Y1382_METTH/5-299A----------------------------------D.LSGISDLVLIPVICMITGTLSGTIAY-LW.....AR.------
PIN5_ARATH/9-362N----------------------------------NPFKMSPKLILSDILQKFLVVVVLAMVL-RFWHPTGGR.------
Q97M34_CLOAB/2-296E----------------------------------YSRKTVITIINLLVFSVAAFIISIVIGK-II........------
YFDV_SHIFL/4-307A----------------------------------NREMIFADTRLTLVSLVVIVGCFFFSWF-GC.....YK.------
PIN6_ARATH/9-565N----------------------------------NPYKMDTMFILADTLSKIFVFVLLSLWA-VF.....FK.------
YWKB_BACSU/5-315T----------------------------------SRSEFLSQVPLMISLIIGIVGFYIIILL-VC.....RF.------
Q9FVF6_9ROSI/9-609N----------------------------------DPYNMNLRFITADSLQKVIVLVVLALWT-KL.....SK.------
Y1031_METJA/2-303N----------------------------------VSSSQILEFLKLPVVIFLCCLFVGILAY-LL.....GKH------
PINI_ARATH/9-617N----------------------------------NPYAMNLRFLAADSLQKVIVLSLLFLWC-KL.....SR.------
YB8B_YEAST/13-413S----------------------------------LSMAKIFEIAIIPIFFGLTTGISFISGK-IM.....SR.------
Q9C999_ARATH/18-441S----------------------------------ITLDNIVQWWFIPVNVLLSAVVGSLIGY-LV.....VL.------
Q9WYQ5_THEMA/4-288.----------------------------------.....YTPSFSTLGEFGLGVAIIFVIFY-LY.....SR.------
Q9C9K4_ARATH/9-407S----------------------------------VTYESLVKMWFMPVNVLLTFMIGSLLGW-IV.....IV.------
Q48797_OENOE/6-311Y----------------------------------LTRDKLVSLSGGLVFAAASFAVSYVLAY-LI.....TK.------
PIN7_ARATH/9-614N----------------------------------NPYAMNLRFIAADTLQKLIMLTLLIIWA-NF.....TR.------
Q9LZN2_ARATH/30-423A----------------------------------VTLQKMLQWWFIPVNVVLGTISGSIIGF-IV.....AS.------
Q9SHL8_ARATH/9-388T----------------------------------VTLEDIISWWFMPVNMGLTFLIGGLLGW-LV.....VK.------
PIN4_ARATH/9-611N----------------------------------DPYAMNFRFVAADTLQKIIMLVLLALWA-NL.....TK.------
YDQ4_SCHPO/18-440G----------------------------------LNLKMLIDLSLLPVFYVIISAASILISF-LL.....AK.------
P71425_KLEPN/4-313T----------------------------------PWAGIVAQSPLVLVLTGAMWITYAAIYF-LA.....TS.------
Q9FKY4_ARATH/9-387T----------------------------------VTLQDIISWWFMPINVGITFLVGGILGW-LV.....VK.------

PF03977

Q9KUH0_VIBCH/17-376T----------------------------------DFGALIANPKTLWLGAAAQLGIFATLFGAILLNFVPGM-------
O59022_PYRHO/20-400T----------------------------------DFGPMIADPKTALLGAAAQIGVFVAMLVALAL....G.-------
O28195_ARCFU/1-354T----------------------------------DFSPLLANPKTFLLGAAAQIGIFAALIAALFL....G.-------
OADB_PASMU/17-431T----------------------------------DFGPLLANPRTLLLGAAAQFGIFATIIGALLLNWTGII-------
OADB_VIBCH/17-432T----------------------------------DFGPLLANPKTLLLGAAAQFGIFTTVLGALALSSLGVM-------
O83096_TREPA/89-468T----------------------------------DFGPLIANPKMAVLGAAAQLGVFLTLFGVAALNFVPGI-------
Q99ZL5_STRP1/18-376T----------------------------------DFGPLIANPKTILLGGAAQVGIFLAFFLAIML....G.-------
Q99ZL0_STRP1/12-373I----------------------------------DFGPLLQNPFMLLFGDAAQFGIFFVVVVAVLA....G.-------
Q9WZY2_THEMA/30-384T----------------------------------DFSFMLSYPITIFLGAAAQMGIFFTFFVAKVL....G.-------

PF06965

NHAA1_PSEPK/11-387A-----------------------------------------KPLLLWINDGLMALFFLLIGLEVK-----REV-VD---
NHAA_BRUSU/14-384P-----------------------------------------LSLAHWINDALMAIFFLLVGLEIK-----REM-LD---
NHAA_CAUCR/11-381G-----------------------------------------LDLLHWINDGLMAIFFLFVGLEIK-----REF-LD---
NHAA2_PSESM/16-384G-----------------------------------------LSVELWINDGLMAIFFLMVGLEIK-----REV-LA---
NHAA_HELPY/14-427G-----------------------------------------FSLHNWIDDVLMALFFLMIGLEIK-----REL-LF---
NHAA_SHEON/5-380H-----------------------------------------KPLLLWINDGLMALFFLLIGLEVK-----REL-LE---
NHAA1_PSESM/17-385G-----------------------------------------MSVEHWINDGLMAIFFMLVGLEIK-----REM-LA---
NHAA2_VIBVU/27-435E-----------------------------------------RSLHKWVNDAGMTLFFFLIALELK-----REL-VL---
NHAA_HAEIN/17-393N-----------------------------------------KTLIHWINDGFMAVFFVLVGMEVK-----KEL-FE---
NHAA_RHILO/12-384P-----------------------------------------LSVSHWVNDGLMAVFFLLVGLEIK-----REM-LD---
NHAA_WIGBR/8-385N-----------------------------------------FSLTNIVNDILMTFFFLEIGIEIK-----HEM-LV---
NHAA2_STRCO/26-428S-----------------------------------------LTVHEWINSGLMSLFFFVVGLEAR-----RDF-DM---
NHAA_VIBCH/5-373G-----------------------------------------MSVSHWINDGLMAVFFLLIGLEVK-----REL-LE---
NHAA_RHIME/20-428Y-----------------------------------------RSLKHWINDGLMTFFFFVIALELK-----REL-VL---
NHAA_ECOLI/4-380N-----------------------------------------KNMLLWINDALMAVFFLLVGLEVK-----REL-MQ---
NHAA_STRAT/25-401N-----------------------------------------LSVAHWAADGLLAVFFFVAGIELK-----REL-VA---
Q93DN6_9BACT/17-388T-----------------------------------------EPVNGWVKDVLMVLFFLTVGMELK-----REM-AE---

PF00999

YDO6_SCHPO/39-445VSP.....GLI.IQNMV.........................SFHSTYFFNVLLPPIILNSGYELH-----QSN.FF---
KEA4_ARATH/173-543S.........F.VSEM...........................VQVETVAQFGVIFLLFALGLEFS-----AAK.LR---
KEA5_ARATH/158-528K.........F.ISEM...........................VQVETVAQFGVVFLLFALGLEFS-----MTK.LK---
KEA3_ARATH/109-496I............RNL...........................TDVKVLSEWGILFLLFEMGLELS-----LAR.LK---
SL9A3_HUMAN/58-462AA......DHI.ASFT...........................LTPTVFFFYLLPPIVLDAGYFMP-----NRL.FF---
Q83E71_COXBU/27-390K.........L.IANI...........................DMLRTVSDVGIVFLLFLLGLNLP-----PQK.LI---
Q9Y959_AERPE/11-361K.............ST...........................EVLTLLAAIGANLLLFMAGSEID-----LAL.LR---
Q8XPZ0_RALSO/11-388G.........F.VADQ...........................SLAPQLAELGVILLMFGVGLHFS-----MKE.LL---
CVRA_ECOLI/10-389G...............GIP....................FDNYPFAYMVSNLALAIILLDGGMRTQ-----ASS.FR---
Q93N84_STRLA/15-400G.........R.LPGDPTKTL................FPPEVLPFLTVLSQVAVVIFMFLAGYEIN-----YRQ.LR---
Q8XLS1_CLOPE/11-387N.........I.IKPD...........................IWILFLSNLGLAYLMFLSGLAID-----FDE.LK---
O25795_HELPY/9-377............IEPT...........................KGFEIMSEIGFLFLMFLCGLEVE-----IYL.FK---
NAH1_METJA/7-393I...............IPS....................DSAMEIFEYAGPIGLIFILLGGAFTMR-----ISL.LK---
CHX14_ARATH/58-442GQSSAYMQMFLPISGK...........................ITLQTLSNLGFFIHLFLLGLRID-----ASI.IR---
Q45308_BACME/8-377G.........W.IHND...........................QFVHYFSEIGVLLLMFLAGLETD-----LEQ.LK---
NHX3_CAEEL/44-444Q...............TTL....................SGVHLDSHAFFLYLLPPIIFDAGYFMP-----NRA.LF---
P74393_SYNY3/33-411V.........................................GLNPELILNFFLPILIFEAAINTD-----ISR.LR---
YJCE_ECOLI/3-422G...............LH.......................VEFDPELFLVLFIPPLLFADGWKTP-----TRE.FL---
O66731_AQUAE/13-381G...........IQVP...........................EILNFLSDFGFLLLMFLAGLELD-----FNL.IE---
Q98GP4_RHILO/11-397G.........F.VADA...........................GLANELAEIGVILLMFGVGLHFS-----LKD.LL---
SL9A6_HUMAN/78-503Y...............GIHVPSDVNNVTLSCEVQSSPTTLLVTFDPEVFFNILLPPIIFYAGYSLK-----RRH.FF---
Q8S5V1_ORYSJ/176-496N.........F.ISEM...........................VQVETFAQFGVVFLLFALGLEFS-----LTK.LK---
Q99V81_STAAM/7-388N.........I.VERD...........................SILNILSTLGFIFLMFLSGLEID-----FKA.F.---
Q9Z9H1_PSEAI/31-448G...............LH.......................IALDPELFLFLFIPPLLFVDGWRIP-----KRE.VW---
Q9XBC3_AMYOR/14-390G.............EGFAAAL................FPTDVRPFLAALANVGVAMFMFMVGLELE-----QTL.LR---
SL9A7_HUMAN/114-534G...............EISPGKINSV.......EQNDMLRKVTFDPEVFFNILLPPIIFHAGYSLK-----KRH.FF---
CHX13_ARATH/60-447GHNVIYMNMFLPAGGK...........................IIIQTLSNVGFVIHLFLLGLKID-----GSI.IR---
Q894B2_CLOTE/11-387N.........I.VQDD...........................IWIIFLSNLGLAYLMFLSGLEVE-----VED.LK---
O29023_ARCFU/4-337H........L.................................SEVEFLGKLGIVFLLFYVGLKIP-----PST.IK---
Q8PQR8_XANAC/12-399G.........A.WLPDLHTAL................FAAKTLPPLSGLATMGVVLFMFVVGVELR-----APEGTK---
O30022_ARCFU/11-366N.........V.IYAS...........................EWLSFLSLFGLIFLMFLAGLEID-----ADVVLK---
Q81V05_BACAN/11-386N.........I.IEPD...........................MWLQVLSTLGFIFLMFLSGLEID-----FSI.FK---
NHEB_ONCMY/73-472V...............IGE....................EPPVLDSQLFFLCLLPPIILDAGYFLP-----IRP.FT---
Q87RG9_VIBPA/2-353Q.............SN...........................DVIVTLADLGVTLLLFTIGLKLD-----VKTLLS---
Q8EIY2_SHEON/2-355E...........KESM...........................PLLQELANLGVTLLLFAIGLKLD-----IRSLFK---
Q9RV80_DEIRA/10-368..........MHLDDTA.........................EKFIHTGAEIGAILLLFILGLEYT-----SDE.LR---
NAH1_YEAST/17-440N.........W.FNPLKWG.....................NSDSITLEITRIVLCLQIFAVAVELP-----RKY.ML---
O58040_PYRHO/8-379N.........I.VEYS...........................QEVRFLAELGVIILLFLAGLETD-----VEE.FK---
SL9A1_HUMAN/105-505G...............VGE....................TPPFLQSDVFFLFLLPPIILDAGYFLP-----LRQ.FT---
O29412_ARCFU/6-377L...............PE.......................VPLSREIVFFIFLPPLLFEAAMNMD-----LKE.LR---
Q9L191_STRCO/11-375G........FVLVEDA...........................HDFEMLSALGLVLLLFYLGLEFH-----LDD.LR---
NAH2_SCHPO/16-437K.........L.FVPTSWG.....................NTDYITEELARVLLVVEVFAAGAELP-----RAY.ML---
NHX7_ARATH/37-450G...........AKHNLGKIGH..............GIRIWNEIDPELLLAVFLPALLFESSFSME-----VHQ.IK---
YJBQ_BACSU/10-389N........LV.VEGD...........................TWLQTLSMLGFIFLMFLSGLEID-----FSS.F.---
NAPA_ENTHR/8-379G.........W.VHPN...........................ILVHDFSEIGVILLMFLAGLESD-----LSL.LK---
Q48731_9LACT/8-376G.........L.VHSG...........................HVLEVMSEIGVILLMFLAGLESD-----LTV.LK---
Q93JF3_STRCO/15-406G.........S.MAPDAYAAL................FPAAIGPALTGLAQFSLVVFLFAVGYELD-----LKM.LG---
TMCO3_MOUSE/274-662N..........SIKSI...........................VQVETLGEFGVFFTLFLVGLEFS-----PEK.LR---
Q09432_CAEEL/35-439L...............IGVN..................KNAFFLESEVFMLYLLPPLVFDAGYFMP-----ARQ.FF---
NAH_SCHPO/16-434K.........L.VDPFSWG....................DHGDYLTVEICRIVLDVRVFASAIELP-----GAY.FQ---
Q9KTB1_VIBCH/2-353T.............SN...........................DTLSLLADLGVTLLLFTIGLKLE-----VKTLLA---
Q23706_CARMA/81-483Y...............TQAA...................TVSPLTADVFFLYLLPPIILDAVYFMP-----NRL.FF---
Q9X8F2_STRCO/12-382G.........W.ARPD...........................DVVDTLADLGLSMLIFLAGYEID-----FAA.VR---
NAH2_METJA/7-395I...............PKN.....................IVESSFDFIGNFGLIILLFIGSFEME-----WNI.MK---
Q8PYD4_METMA/9-374G...........ILSG...........................GEIDMTSELGVVFLLFTIGVDLS-----LND.LW---
SL9A2_RAT/85-486G...............VDEK...................SPPAMKTDVFFLYLLPPIVLDAGYFMP-----TRP.FF---
O67072_AQUAE/23-407G.........L.IPLS...........................EAIKVLAELGVILLLFEVGLEAD-----INM.LM---
Q8KHN6_NOCAE/16-400G.........A.VAPSLQRAL................FPEEVLQAVGMAAQLGLVTFMFLLGSELR-----VDH.VR---
Y2309_MYCBO/17-417F...............GD.......................VQIDGEVVLLLFLPAILYWESMNTS-----FRE.IR---
O82871_PSEAI/9-410G...............LSELGYPILE.......VEMQEIIRRIDFSEVLMTWFLPALLFAGALHVD-----LSD.LR---
P73863_SYNY3/19-406K...............L........................INLSPELIMEIFLPPLLFEAAWNLQ-----WRN.LK---
O58682_PYRHO/8-388S.........I.VLPT...........................SELKVLGEFGLIMMMLYMGLTSN-----FSA.IS---
Q8PVQ3_METMA/9-375G.........I.MDSG...........................QNMEINAELGVIFLLFTIGVDLS-----LKD.LW---
CHX23_ARATH/59-444GNT.....RFI.IAHVFPY.....................RFTMVLETFANLALVYNIFLLGLGMD-----LRM.VR---
Q55736_SYNY3/17-390G........VL.NEDS...........................ESIKLFTDIGKIYLMFVAGLEID-----MVD.FR---
KEFX_HAEIN/13-387G.........I.VQEP...........................TAVVHLAELGVVMFLFIIGLEMY-----PER.LW---
Q97BQ9_THEVO/10-379K.........I.VSPS...........................VPISDIESVSLFFIILAIGVEAN-----TEY.IY---
O26854_METTH/5-391N.........L.ISKSI.........................MDISPDLRVIALIIILLRAGFGIN-----LES.LR---
Q8KLM5_STRTO/6-396G.........L.LPGDPVEAL................FPADARPVLQALSQLGLVLFMFGIGYELD-----FAL.LR---
NAH1_ZYGRO/16-438N.........W.FNPLSWG.....................NTDSITLEISRILLCLQVFAVSVELP-----RKY.MQ---
NHAK_BACSU/3-415G...............LH.......................FELNTELFFVLFIAPLLFNDGKRTP-----RAE.LW---
Q55190_SYNY3/65-446S............AQS...........................EVISVISELGVIILLFEIGLESN-----LKE.LI---
Q55388_SYNY3/8-396H...............WIQP...................ANFGDGLEVIVSLSVAIILFEGGLNLG-----LRE.LG---
NAH3_METJA/8-380N.........I.LQVD...........................ETLKILADFGAIMLMFLAGLEVD-----NET.LK---
Q93KW8_STRVR/66-455G.........L.VAPGVHDAL................FPAALHSYLDLVAQIGLALFMFLIGMEFG-----DTH.HE---
Q8GRF9_9PROT/12-375G.........L.VSNR...........................DAVATLAEFGVLMLLFVIGMKLD-----IIR.FL---
SL9A4_RAT/73-477G...............THHK...................SPPVMDSSIYFLYLLPPIVLESGYFMP-----TRP.FF---
Q815T7_BACCR/11-379TIGV...IDLKFIESA...........................SVISFLGRIGVLFLLFYLGLEFS-----MKK.LI---
Q9PBK4_XYLFA/11-395G.........F.VADQ...........................QIANQLSELGVMLLMFGVGLHFS-----LED.LL---
SL9A5_RAT/52-457A...............VAKK...................AEYQLEPGTFFLFLLPPIVLDSGYFMP-----SRL.FF---

PF03956

Q8U272_PYRFU/7-192K----------------------------------A..........GNLYEWALYVLIFVIGLEIG-----LNG------
Q5JE53_PYRKO/7-192P----------------------------------D.....F....GNAYEVMLDLLILLIGVDLG-----MS.------
Q0W307_UNCMA/5-198I----------------------------------P...DAVSASLDTILTAMLCLLLFFIGLDLS-----QNR------
Q3A9X2_CARHZ/110-301P----------------------------------E...KFLNLS.DRIITFALAFLYLGTGVSFG-----GDR------
Q6D3T3_ERWCT/111-299S----------------------------------G.....FTHA.SKGSEYALIFLLFLVGVQLR-----NSG------
Q65TG5_MANSM/110-298G----------------------------------G.....FDLP.LHASTYVLVALIFFVGIQLR-----NNG------
A0Q670_FRATN/117-306I----------------------------------N.....ITSIIDHIVFILLLALMLIIGALLK-----LEN------
Q8ZX41_PYRAE/114-291L----------------------------------N.....YSVA....VDPLLLFLLLVAGADM.-----...------
Q5LD53_BACFN/7-205F----------------------------------Q.....FDMH..NLSMYILYALMLQVGISIG-----SNK------
Q0I3G0_HAES1/111-299S----------------------------------W.....FMLK.FGASTYILITLIFFVGLQLR-----NNG------
Q30YZ4_DESDG/7-199T----------------------------------P.....EVLSSDTVSAYALYFLLFIVGVGIG-----FDT------
A7HMA4_FERNB/6-189.----------------------------------......FELH.GKAVEIILYALVFLVGLDLS-----KEK------
Q1MPD6_LAWIP/7-198V----------------------------------P.....KELIYEGLATCIVYFMLFTVGMTIG-----INS------
Q9CNG6_PASMU/111-299G----------------------------------K.....FSLP.EHASTYVLVCLIFSVGIQLR-----NNG------
Q7P6I1_FUSNV/4-194S----------------------------------Y.....INFDISLLIQFGLYLLLFFIGIDIG-----KNN------
A1EJA4_VIBCL/110-298Q----------------------------------D.....LHWV.ESASGWILFLLLFFIGIQLR-----NSG------
A9KSU8_CLOPH/5-197D----------------------------------I...TIINFV.TEHTHYILYLLMFLVAISIG-----LNR------
A1ISW6_NEIMA/109-298D----------------------------------I.....WMPS.ENAGMYCLMLLVLLIGVQLK-----SSG------
A4YEP1_METS5/91-281P----------------------------------S.....LDY..SEIIVYELYILALVIGFNIG-----SE.------
Q9UYY3_PYRAB/7-192D----------------------------------P..........GNSYELALYALIFVIGLDLG-----ANA------
B8G2D2_DESHD/116-308P----------------------------------Q....VWTVYLPTITTLALDFTLVMVGIDLG-----LNR------
A0KIW8_AERHH/111-299L----------------------------------R.....ALPI.DKWSEWALMLLLFLIGVQMR-----NSG------
Y1452_HAEIN/4-192D----------------------------------W.....LHFP.NGSNLYVLITLIFFVGIQLR-----NNG------
A1RUU6_PYRIL/96-273I----------------------------------P.....YVLA....IDPLLLVLLFTAGMDMA-----NVG------
A1VEH4_DESVV/7-199V----------------------------------P.....DAIARGDLASWALYLLLFVVGMGIG-----FDT------
Q64PG3_BACFR/7-199I----------------------------------P.....YDFSQSKLSFYALCGLMFCVGISIG-----NDP------
A4J6Y5_DESRM/5-197P----------------------------------A....QYIQQLDYVTTTSLYLLLLAIGIDLG-----RQK------
A4FXI0_METM5/7-192I----------------------------------D.....F....GNMYEIMLYIQILLIGIDLG-----KSS------
Q1QZ23_CHRSD/114-307H----------------------------------WELRVVHAWA.EPLAEWALYLLLALIGCQLR-----NSG------
Q7MLI3_VIBVY/110-298I----------------------------------S.....LDWV.DTASEWILFVLLFFIGIQLR-----NSG------
O58406_PYRHO/12-197N----------------------------------P..........GNSYEVSLYILIFIIGLDLG-----LNT------
Q1QD72_PSYCK/112-301A----------------------------------N.....YIPP.ENTMTVMLMILILLVGIGLK-----GSG------
Q1Z0Y8_PHOPR/110-298F----------------------------------D.....LSWV.DQASETILLLLLFLIGIQLR-----NSG------
A1U6W6_MARAV/112-300P----------------------------------D.....LPMV.DDVATWALMLLLFLIGLQLR-----NAG------
Q96XQ5_SULTO/108-295V----------------------------------K.....INF..NEIIDYELYALVIVIGIQVG-----ES.------
Q9YBX3_AERPE/117-302S----------------------------------S.....FP...DVVSTLLLYILLFQAGYLVG-----GAA------
A6VPB6_ACTSZ/111-299H----------------------------------I.....IALP.LGTSTYVLVLLIFFVGIQLR-----NNG------
A1RZA2_THEPD/99-286.----------------------------------W.....LRPYLSEALPVLVLAVIAATGLTM.-----HSA------
A6VTK0_MARMS/114-302D----------------------------------W.....LTGV.DELVTGLLYVLLFLIGCQLR-----QGN------
Q2NU01_SODGM/130-310S----------------------------------G.....FSLA.TQASELLLILLLWLVGIQLR-----NSG------
A5WGW5_PSYWF/135-324A----------------------------------S.....FMPP.GNTMTGLLMLLILLVGIGLK-----ASG------
A8MGH5_ALKOO/5-196P----------------------------------A...SMAEYM.GTFISSGLCLLLFFVGIDIG-----RQE------
A4W8P2_ENT38/111-299A----------------------------------F.....LQHA.TEASEYTLIFLLFLIGIQLR-----NNG------

PF06826

Y1229_BACTN/19-182S---------------------------------......VDPQMLNYAESFGLVIFVYSLGLQVG-----PGF------
O52005_HALSA/14-174.---------------------------------.......GFTVPDAYSGLTLALFVAAVGLIAA-----HEI------
O52005_HALSA/209-380I---------------------------------GPVTMRMETTILSEIRAFTLAMFLAVVGIDAG-----SGL------
Y590_CORGL/12-174.---------------------------------......TDIVIPMIVYQLGLAMFVYVIGLSAG-----PAF------
Y2211_CORGL/11-179.---------------------------------......PDISVPSLIYVVGLSLFVYTIGLEAG-----PGF------
YBJL_ECOLI/16-183.---------------------------------.......HFSINTDALNLGFMLFIFCVGVEAG-----PNF------
Y3475_BRAJA/16-184.---------------------------------......AHVPVSSMTKSFLFLLFLFGVGYSVG-----PQF------
Y2102_COREF/11-180.---------------------------------......PDITVPPLIYVVGLALFVYTIGLEAG-----RDF------
Y595_COREF/356-528T---------------------------------GPITWQLPFHANRTISTLGLALFLAGVGTSAG-----AGF------
Y3476_BRAJA/394-564V---------------------------------RPTFGRIPSPTVWFMNSVGLNVFIAIVGISSG-----PGF------
Y736_BACTN/15-179.---------------------------------.......NISVDGPMKAVFFLLFLFAVGYKVG-----PQF------
YBJL_ECOLI/385-555N---------------------------------HPTFGYIPQGALSMVKEFGLMVFMAGVGLSAG-----SGI------
Y4083_YERPE/10-180T---------------------------------YQIV..LNGDMLHFIQEFGLILFVYTIGIQVG-----PGF------
Y035_HAEIN/372-546I---------------------------------GKLYWFMPPSANLALREIGIVLFLAVVGLKSG-----GSF------
Y2102_COREF/367-539T---------------------------------GKVVWQIPYSANLALRQLGITMFLAAIGTTAG-----AGF------
Y3471_BRAJA/387-557R---------------------------------RPTMGAMPPAAQQTLSDLGLGGFIAAIGLANG-----HAA------
Y595_COREF/12-171.---------------------------------......PDIQIPAFVFQLGLAMFVYVIGISAG-----PAF------
Y2092_BACTN/378-551K---------------------------------LHLVTYTTMSANLMLREIGIVLFLASVGIDAG-----ANF------
Y736_BACTN/392-562K---------------------------------HPTFGGIPEPSLWVLNNVGLNMFIAVVGIAAG-----PSF------
ASPT_TETHA/367-540K---------------------------------HAHMDTIPDSLLEFFQSIGLNLFIATVGLSAA-----KTF------
Y3476_BRAJA/20-187.---------------------------------.......GITITGPLKPFFFLMFLFAIGYGVG-----PQF------
Y035_HAEIN/10-179Q---------------------------------YGLK..LDAHTLHFVQEFGLILFVYTIGIQVG-----PGF------
Q8RDQ8_FUSNN/294-465I---------------------------------GPITFRMDSVVLGKMRTYFLSIFLAGTGLNYG-----FRV------
Y2092_BACTN/20-185T---------------------------------......ADTHILHFIREFGLILFVFCIGLQVG-----PSF------
Y2143_SHEON/15-183.---------------------------------.......DITLSSNVKSIFFLMFLFAVGYGIG-----PQF------
Y500_BACTN/12-166.---------------------------------.......GVIIPKELGNFGLVLFIFTIGIQAG-----PGF------
YIDE_SHIFL/10-180Q---------------------------------AGMT..LSSDMLHVIQEFGLILFVYTIGIQVG-----PGF------
Y1229_BACTN/378-551R---------------------------------IHMITYTTRSANLMLRALGLSMYLACLGLDAG-----AHF------
Y1232_VIBPA/388-558N---------------------------------HPTFGYVPQGALNMVKDLGLMFFMVGIGLSAG-----GKM------
Y500_BACTN/358-529T---------------------------------GPIIWSMSGPANQLLRQLGLLLFLAEVGTSAG-----KNL------
ASPT_TETHA/15-183.---------------------------------......GVFPRDTLLGDIFFDFFMFAIGYRVG-----PSF------
Y3471_BRAJA/15-183.---------------------------------......GTFTFPALLRIVLFSLFVFTIGYKSG-----PEF------
YIDE_SHIFL/373-547I---------------------------------GKLYWFMPPSANLALRELGIVLFLSVVGLKSG-----GDF------
Y2143_SHEON/389-559F---------------------------------HPTFGWVPEPTVWFMNSVGLNVFIAAIGISAG-----PNF------

PF05982

Q8EAY3_SHEON/4-319D-----------------------------------------LKVPPAIYETLSILLMLTLGLKGG-----MAL-HG...
Q9K663_BACHD/12-337D-----------------------------------------LQFPKGLTEALSMYLLIAIGIKGG-----IEL-SH...
Q8YV47_NOSS1/18-370E-----------------------------------------LIIPEAICQIIVFMLLTKIGLTGG-----IAI-RN...
P71757_MYCTU/16-407R-----------------------------------------FEFPYVLYQGLTLYLLLAIGWHGG-----EEL-AKIKP
Q8YY66_NOSS1/13-322D-----------------------------------------LEIPAPIPKALSLYLLFAIGFKGG-----VEL-IK...
Q9A2P7_CAUCR/49-365D-----------------------------------------LALPRDAAKTLSLILMLCIGFKGG-----VEA-RA...
P73953_SYNY3/18-374Q-----------------------------------------LVIPEAISTIIVFMLLTKIGLTGG-----MAI-RN...

PF03812

KDGT_BACSU/1-314G-------------------------------TAEFFGGFTGALITGTLPILGVFIFCVGATIDFR-----SSGYIA---
KDGT_SHIFL/1-314G-------------------------------AGKYFGSFTNGMITGTVPILAVWFFCMGASIKLS-----ATGTVL---
KDGT_PECCC/1-314G-------------------------------AGKYLGSFSNGLITGTIPILAVWFFCMGASIEFK-----ATGTML---

PF05684

Q9FLW1_ARATH/79-442I-----------------------------------...PFETPSYGFFMEFLLPHTIPLLLFRAD-----LRR------
YJCL_BACSU/15-395L-----------------------------------...PVESPVYDTVWSYVVPLAIPLLLFQIN-----VRQ------
Q9LTG3_ARATH/95-460I-----------------------------------...SSQAPAFAVVLNFLLPLAVPLLLFRAD-----LRR------
Q8P790_XANCP/17-412I-----------------------------------.DGANTWLYNPIARDVLLPAALILLTLSID-----LRA------
Q9K8K1_BACHD/10-388F-----------------------------------GDSESLSNTSYGVRNALLPAMILLMLLQCD-----LRK------
Q8RIK4_FUSNN/11-392F-----------------------------------.DSEACSKAYSVLKNNLLYAMIFVMLLRCD-----FRK------

PF03601

Y2225_RHILO/7-307L-----------------------------------GTPAHAKAGIAFSQKRLLRFAIVLLGFQLT-----LGQ------
YDHF_LACLA/5-311Y-----------------------------------FKQVTLFAGTAWSEKKLLEFSVMFLGATVT-----FQT------
Y5383_PSEAE/21-335P-----------------------------------RIAAGSAAGVGFSKQILLRAGIILYGLRLT-----FQD------
Y1621_ARCFU/22-308L-----------------------------------QRDEEKKRVVERYVPFLLPIGITLYGVNIN-----IPY------
Y2119_MYCPA/67-384V-----------------------------------GLHPIFRPGVLTYE.FWLKAGIVALGSRFV-----LGD------
Y1056_STRP1/9-318Y-----------------------------------EHRDKTKEGISFTSKYILQTAVVLLGFGLN-----LTQ------
Y425_CAUCR/147-446L-----------------------------------GLQGQLGAGLDVFAKPGLRLGVAMMGAQIS-----WSE------
Y1461_PASMU/8-314P-----------------------------------KISQYTAQGVIFAKGTLLRLGIILYGFRLT-----LQD------
Y034_STRPN/9-315L-----------------------------------SSYKQLDAGLTFSSKKLLQYAVVLLGFGLN-----ISQ------
Y341_STAAM/11-311R-----------------------------------GYPEQYSSGITFSSKYLLRFAIILYGLKLN-----IFD------
Y1643_HAEIN/8-316P-----------------------------------QFSSQVEKGVLFAKGTLLRAGIVLYGFRLT-----FGD------
YEIH_SHIFL/18-326P-----------------------------------HIWKSCDGGVLFAKQYLLRLGIILYGFRLT-----FSQ------
Y999_CAMJE/18-342F-----------------------------------KYQHHFQAGVHFSAKKLLRLGIVLYGFNIT-----LTE------

PF03616

Q9HZ58_PSEAE/4-371D-----------------------------------RGWLDIGLDTS.LQTPLMVAFFTTVGLGGS-----LGL------
O26036_HELPY/4-373Q-----------------------------------FYNFGLQFDSS.LKDPLMLTFFITIGLSAD-----FKS------
Q9KNC4_VIBCH/5-376.-----------------------------------FHGIDMEFSLP.LQNVFMLMFFSTVGLAAN-----YTQ------
Q9S458_SALTM/1-366K-----------------------------------TSGYSFTFDAS.LQSLLMLTFFSSIGLSSD-----FSR------
GLTS_HAEIN/3-369K-----------------------------------IDGTSFNFDKN.LQTTMMLVFFTSIGLSAN-----FSR------
GLTS_SHIFL/2-366K-----------------------------------SMGWEVNFDMS.LRDPLMLAFFATIGLNAN-----IAS------
Q99RS8_STAAM/2-370S-----------------------------------FGMVKIKLDASFIQDFFMLAFFTTIGLGAS-----LKL------
P73275_SYNY3/4-370G-----------------------------------IFRTEVAFNFP.IRDAFLIIFFTCIGLSSK-----LKV------

PF13593

C5DGV7_LACTC/27-386-------------------GIK..K..A...ND................................PA-------------
Q6CIF6_KLULA/49-408-------------------AIK..A..A...ND................................DK-------------
B3LLT3_YEAS1/23-385-------------------AVK..A..A...ND................................PK-------------
Q6BPS9_DEBHA/26-388-------------------GIK..A..A...ND................................PS-------------
B9WFB0_CANDC/25-387-------------------GIK..A..S...HN................................GE-------------
B7NPU5_ECO7I/8-316-------------------WKP..V..N...VD................................PM-------------
A5DK55_PICGU/24-387-------------------AIR..S..S...HDGA............................IDEW-------------
A5E3X9_LODEL/29-391-------------------GIR.AS..H...DG................................QI-------------
A7MML9_CROS8/10-319-------------------IPH..S..V...LP................................PS-------------
C2M6P1_CAPGI/9-321-------------------LAK..G..T...DY................................QL-------------
A0KES2_AERHH/4-313-------------------LVP..H..W...LS................................PA-------------
B6Q6N8_PENMQ/44-391-------------------LII..A..T...DPGR...........................LIDPA-------------
Q4ZYQ4_PSEU2/13-325-------------------LLG..S..Q...VP................................AL-------------
C4UDI4_YERAL/10-319-------------------LVP..G..V...LT................................PT-------------
Q0KE25_CUPNH/16-328-------------------SLR..N..T...LP................................PD-------------
Q6FU65_CANGA/32-393-------------------GIK..A..A...ND................................KN-------------
D0Z7X4_EDWTE/10-319-------------------LVP..A..L...MS................................PA-------------
A3RYL9_RALSL/10-322-------------------ACK..P..F...IP................................AE-------------
B2Q2V9_PROST/10-320-------------------MVP..S..W...MS................................PT-------------
Q7N4G4_PHOLL/10-320-------------------LVP..E..I...MT................................ST-------------
C8NCW5_9GAMM/45-353-------------------LVP..T..L...LI................................PE-------------
C9Y8T0_9BURK/9-319-------------------VFA..W..T...LS................................PE-------------
C5DX01_ZYGRC/23-385-------------------AIK.KA..H...DK................................NM-------------
A9IQT5_BORPD/10-319-------------------VLQ..P..L...VT................................PE-------------
Q988D7_RHILO/21-330-------------------LPA..S..I...LP................................KP-------------
Q2K4B0_RHIEC/7-316-------------------IPD..T..I...LP................................RP-------------
Q2NSZ3_SODGM/10-322-------------------FVP..T..L...LS................................SS-------------
B9JA81_AGRRK/7-318-------------------VVP..N..S...IL................................PV-------------
A6UD14_SINMW/7-316-------------------VPA..W..V...LP................................PS-------------
B0VBX5_ACIBY/10-320-------------------ILL..P..L...LG................................QQ-------------
C6W4P5_DYAFD/14-325-------------------FFH..S..A...EG................................QN-------------
A5VE28_SPHWW/9-318-------------------LAS..G..V...LP................................PA-------------
B4WAZ9_9CAUL/9-317-------------------ATG..P..W...LA................................QD-------------
D2TZF8_9ENTR/10-320-------------------LVP..D..W...IS................................PT-------------
D0J170_COMT2/9-318-------------------VLS..P..L...VT................................TE-------------
B2IHJ5_BEII9/11-319-------------------FLG..S..W...LS................................EP-------------
A3XPQ3_LEEBM/6-318-------------------LVQ..N..A...EH................................EL-------------
A3I1U6_9BACT/15-326-------------------ALP.....F...IK................................EE-------------
B5JCP6_9BACT/12-331-------------------VFG..S..W...IH................................LE-------------
B4WXN7_9GAMM/9-320-------------------LAP..Q..W...IP................................AE-------------
C0XTF9_9CORY/7-316-------------------AT...A..F...IS................................EG-------------
Q0V4P5_PHANO/88-416-------------------LCA..T..N...PNF.............................MDPW-------------
A3SE09_9RHOB/10-318-------------------LCS..P..I...LG................................AT-------------
B2WB77_PYRTR/69-400-------------------ACA..T..NRAFMD................................PW-------------
D0WMS3_9ACTO/21-327-------------------AAE..P..F...WG................................HG-------------
B7G617_PHATC/64-378-------------------ALE..AGNI...LG................................QD-------------
A9USA8_MONBE/8-323-------------------AAP..A..I...LS................................DA-------------
A5P8F8_9SPHN/9-317-------------------LLA..I..G...LP................................PL-------------
A4S2B1_OSTLU/55-379-------------------VLIESG..W...LS................................EN-------------
C5BV46_BEUC1/9-317-------------------VAE..P..L...LG................................TV-------------
C1MQW6_MICPC/113-439-------------------ALL..ALDL...LT................................PA-------------
B7G616_PHATC/92-406-------------------ALT..A..AQ.IMS................................EE-------------
Q2NAY2_ERYLH/10-318-------------------LAD..N..I...LP................................PL-------------
Q1GQQ6_SPHAL/56-363-------------------ALA..R..W...LP................................AT-------------
B8LLL0_PICSI/96-415-------------------LK......L...IP................................QE-------------
A7RRB9_NEMVE/42-385-------------------LLP..F......DNDDSDWTSSSRNSTNGSRLVNRTGEITRSAVLGPE-------------
E6VTY4_DESAO/16-319-------------------LFG..L.......E................................AD-------------
C0Q8Q9_DESAH/8-317-------------------LP..........LE................................TG-------------
Q4DG32_TRYCC/64-405-------------------IFR..S..S...SG................................ED-------------

PF01758

ARSB_BACSU/49-246-------------------IFL--P------DK--------------------------------PE.............
O49665_ARATH/179-364-------------------AAV--S------LF--------------------------------QLP............
O29775_ARCFU/75-273-------------------ALL--R------DM--------------------------------PE.............
ARR3_YEAST/78-276-------------------MAL--F------DY--------------------------------KE.............
O81017_ARATH/71-248-------------------TLK--L------SA--------------------------------PL.............
NTCP2_CRIGR/39-220-------------------VAF--G------IL--------------------------------PV.............
P71942_MYCTU/62-259-------------------LLL--A------DL--------------------------------PE.............
Y944_SYNY3/61-268-------------------FFL--G------YL--------------------------------FAPLLTATEIIRGQE
O58554_PYRHO/48-238-------------------IVK--L------FH--------------------------------PID............
O86662_STRCO/51-247-------------------LLR--R------TP--------------------------------DADG...........
O26986_METTH/62-259-------------------VFL--M------DH--------------------------------PE.............
YOCS_BACSU/41-221-------------------FGL--H------LP--------------------------------AE.............
P73938_SYNY3/12-198-------------------SLF--S------LS--------------------------------PE.............
P3_HUMAN/197-381-------------------KVF--M------LP--------------------------------KA.............
O58645_PYRHO/46-238-------------------FWL--R------MM--------------------------------PNTE...........
NTCP_HUMAN/32-214-------------------KVF--R------LK--------------------------------NI.............
O67889_AQUAE/32-212-------------------KLF--K------LP--------------------------------PE.............

PF03547

Q98L58_RHILO/3-308-------------------IFG---------RD--------------------------------AR-------------
O67397_AQUAE/2-289-------------------FLK---------LE--------------------------------EK-------------
ECM3_YEAST/12-596-------------------VLP---------VP--------------------------------KR-------------
PIN1_ORYSJ/9-590-------------------..R---------GS--------------------------------LE-------------
Y1382_METTH/5-299-------------------RRG---------LD--------------------------------SG-------------
PIN5_ARATH/9-362-------------------..G---------GK--------------------------------LG-------------
Q97M34_CLOAB/2-296-------------------SFK---------FA--------------------------------MD-------------
YFDV_SHIFL/4-307-------------------FFK---------RT--------------------------------HA-------------
PIN6_ARATH/9-565-------------------..A---------GG--------------------------------LD-------------
YWKB_BACSU/5-315-------------------IFK---------YD--------------------------------LT-------------
Q9FVF6_9ROSI/9-609-------------------..R---------GC--------------------------------LE-------------
Y1031_METJA/2-303-------------------IFK---------LK--------------------------------DE-------------
PINI_ARATH/9-617-------------------..N---------GS--------------------------------LD-------------
YB8B_YEAST/13-413-------------------ILD---------LD--------------------------------KD-------------
Q9C999_ARATH/18-441-------------------ICR---------PP--------------------------------PE-------------
Q9WYQ5_THEMA/4-288-------------------LFK---------EK--------------------------------KE-------------
Q9C9K4_ARATH/9-407-------------------ITK---------PP--------------------------------SQ-------------
Q48797_OENOE/6-311-------------------IFK---------IR--------------------------------VG-------------
PIN7_ARATH/9-614-------------------..S---------GS--------------------------------LE-------------
Q9LZN2_ARATH/30-423-------------------IVR---------PP--------------------------------YP-------------
Q9SHL8_ARATH/9-388-------------------ILK---------PP--------------------------------PY-------------
PIN4_ARATH/9-611-------------------..N---------GS--------------------------------LE-------------
YDQ4_SCHPO/18-440-------------------LFR---------LT--------------------------------PR-------------
P71425_KLEPN/4-313-------------------VFK---------RT--------------------------------PQ-------------
Q9FKY4_ARATH/9-387-------------------LLN---------PK--------------------------------PQ-------------

PF03977

Q9KUH0_VIBCH/17-376-------------------EFS---------MA--------------------------------DA-------------
O59022_PYRHO/20-400-------------------.FN---------LK--------------------------------EA-------------
O28195_ARCFU/1-354-------------------.FT---------PQ--------------------------------EA-------------
OADB_PASMU/17-431-------------------SFT---------LP--------------------------------QA-------------
OADB_VIBCH/17-432-------------------DFS---------VA--------------------------------QA-------------
O83096_TREPA/89-468-------------------RYS---------IL--------------------------------DA-------------
Q99ZL5_STRP1/18-376-------------------.MT---------PQ--------------------------------EA-------------
Q99ZL0_STRP1/12-373-------------------.FD---------IK--------------------------------EA-------------
Q9WZY2_THEMA/30-384-------------------.FS---------LK--------------------------------QA-------------

PF06965

NHAA1_PSEPK/11-387GHLSK--------PSQVILPAT---------AA-----------------------------------------------
NHAA_BRUSU/14-384GQLAS--------WPNRMLPGI---------AA-----------------------------------------------
NHAA_CAUCR/11-381GQLST--------WANRALPCI---------AA-----------------------------------------------
NHAA2_PSESM/16-384GGLAT--------WGQRALPGF---------AA-----------------------------------------------
NHAA_HELPY/14-427GELSS--------FKKASFPVI---------AA-----------------------------------------------
NHAA_SHEON/5-380GALSS--------VAQASLPTF---------AA-----------------------------------------------
NHAA1_PSESM/17-385GQLAS--------WSQRALPGF---------AA-----------------------------------------------
NHAA2_VIBVU/27-435GELRN--------PQLALLSIA---------AA-----------------------------------------------
NHAA_HAEIN/17-393GALST--------YQQAIFPAI---------AA-----------------------------------------------
NHAA_RHILO/12-384GQLST--------WPRRVLPGI---------AA-----------------------------------------------
NHAA_WIGBR/8-385GSLKN--------KSRAILPGI---------AA-----------------------------------------------
NHAA2_STRCO/26-428GELRD--------RRWLLLSAI---------AG-----------------------------------------------
NHAA_VIBCH/5-373GALKS--------RETAIFPAI---------AA-----------------------------------------------
NHAA_RHIME/20-428GELRN--------PRMAALPVA---------AA-----------------------------------------------
NHAA_ECOLI/4-380GSLAS--------LRQAAFPVI---------AA-----------------------------------------------
NHAA_STRAT/25-401GDLRD--------PRAAVLPVV---------AA-----------------------------------------------
Q93DN6_9BACT/17-388GLLAQ--------KGQVFMPLL---------AA-----------------------------------------------

PF00999

YDO6_SCHPO/39-445RNIGT..............ILT---------FA-----------------------------------------------
KEA4_ARATH/173-543VVRAV..............AIP---------GG-----------------------------------------------
KEA5_ARATH/158-528VVGPV..............AVL---------GG-----------------------------------------------
KEA3_ARATH/109-496ALAKF..............AFG---------MG-----------------------------------------------
SL9A3_HUMAN/58-462GNLGT..............ILL---------YA-----------------------------------------------
Q83E71_COXBU/27-390TMFTK..............IKW---------VA-----------------------------------------------
Q9Y959_AERPE/11-361SILPQ..............AVI---------VA-----------------------------------------------
Q8XPZ0_RALSO/11-388AVKSI..............AIP---------GA-----------------------------------------------
CVRA_ECOLI/10-389VALGP..............ALS---------LA-----------------------------------------------
Q93N84_STRLA/15-400SGGRS..............VLA---------VA-----------------------------------------------
Q8XLS1_CLOPE/11-387PKEGELLKD.....SKLFNSIK---------MF-----------------------------------------------
O25795_HELPY/9-377KLGVS..............LLK---------RI-----------------------------------------------
NAH1_METJA/7-393RVIKT..............VVR---------LD-----------------------------------------------
CHX14_ARATH/58-442KAGSK..............AIL---------IG-----------------------------------------------
Q45308_BACME/8-377RNWKA..............AFA---------VA-----------------------------------------------
NHX3_CAEEL/44-444KNFDS..............VLV---------FS-----------------------------------------------
P74393_SYNY3/33-411STIKP..............ITV---------LA-----------------------------------------------
YJCE_ECOLI/3-422EHGRE..............IFG---------LA-----------------------------------------------
O66731_AQUAE/13-381KADKKQN..........AVYIS---------YV-----------------------------------------------
Q98GP4_RHILO/11-397SVRAI..............AVP---------GA-----------------------------------------------
SL9A6_HUMAN/78-503RNLGS..............ILA---------YA-----------------------------------------------
Q8S5V1_ORYSJ/176-496AVGPV..............AVI---------GG-----------------------------------------------
Q99V81_STAAM/7-388KKDKRARQGQNDDESSIPGHLN---------LA-----------------------------------------------
Q9Z9H1_PSEAI/31-448GMRWP..............ILM---------MA-----------------------------------------------
Q9XBC3_AMYOR/14-390GRGKL..............ALT---------VS-----------------------------------------------
SL9A7_HUMAN/114-534RNLGS..............ILA---------YA-----------------------------------------------
CHX13_ARATH/60-447KAGSK..............AIL---------IG-----------------------------------------------
Q894B2_CLOTE/11-387ISDGNNKGF.....KNLILCFS---------MF-----------------------------------------------
O29023_ARCFU/4-337KTWQR..............TLK---------SG-----------------------------------------------
Q8PQR8_XANAC/12-399TQVRA..............SVL---------VG-----------------------------------------------
O30022_ARCFU/11-366SGHLK.............RVVA---------FF-----------------------------------------------
Q81V05_BACAN/11-386QKGKKNTT.......NEPNTFQ---------AA-----------------------------------------------
NHEB_ONCMY/73-472ENVGT..............ILV---------FA-----------------------------------------------
Q87RG9_VIBPA/2-353KEIWG.............GATA---------HN-----------------------------------------------
Q8EIY2_SHEON/2-355AEVWA.............GSSV---------HL-----------------------------------------------
Q9RV80_DEIRA/10-368TNLKA..............NRQ---------IG-----------------------------------------------
NAH1_YEAST/17-440KHWVS..............VTM---------LL-----------------------------------------------
O58040_PYRHO/8-379HVGLS..............AFI---------VA-----------------------------------------------
SL9A1_HUMAN/105-505ENLGT..............ILI---------FA-----------------------------------------------
O29412_ARCFU/6-377ENFGP..............IAL---------IA-----------------------------------------------
Q9L191_STRCO/11-375SGGKR..............LLT---------AG-----------------------------------------------
NAH2_SCHPO/16-437RHWRS..............MFV---------ML-----------------------------------------------
NHX7_ARATH/37-450RCLGQ..............MVL---------LA-----------------------------------------------
YJBQ_BACSU/10-389EKGKKKQFLPN..GKEAPNTFA---------AA-----------------------------------------------
NAPA_ENTHR/8-379KYFKP..............GMF---------VA-----------------------------------------------
Q48731_9LACT/8-376KNFKA..............SML---------VA-----------------------------------------------
Q93JF3_STRCO/15-406VRARS..............SVN---------VA-----------------------------------------------
TMCO3_MOUSE/274-662KVWRI..............SLQ---------GP-----------------------------------------------
Q09432_CAEEL/35-439DNFGS..............ILC---------FA-----------------------------------------------
NAH_SCHPO/16-434HNFRS..............IIV---------ML-----------------------------------------------
Q9KTB1_VIBCH/2-353KEIWA.............GSTI---------HN-----------------------------------------------
Q23706_CARMA/81-483DNLFT..............ILV---------FA-----------------------------------------------
Q9X8F2_STRCO/12-382GD.................TLR---------RS-----------------------------------------------
NAH2_METJA/7-395RVLDV..............IIK---------LD-----------------------------------------------
Q8PYD4_METMA/9-374KMKKA..............IMG---------GG-----------------------------------------------
SL9A2_RAT/85-486ENLGT..............IFW---------YA-----------------------------------------------
O67072_AQUAE/23-407RVGLW..............STL---------VA-----------------------------------------------
Q8KHN6_NOCAE/16-400GNGKV..............VWA---------LV-----------------------------------------------
Y2309_MYCBO/17-417WNLRV..............IVM---------FS-----------------------------------------------
O82871_PSEAI/9-410SYKWP..............IGL---------LA-----------------------------------------------
P73863_SYNY3/19-406ENWFP..............ITL---------FA-----------------------------------------------
O58682_PYRHO/8-388RNKVK..............ASV---------VA-----------------------------------------------
Q8PVQ3_METMA/9-375NMKKA..............VLV---------GG-----------------------------------------------
CHX23_ARATH/59-444ITELK..............PVI---------IA-----------------------------------------------
Q55736_SYNY3/17-390RTRNR..............SLL---------YG-----------------------------------------------
KEFX_HAEIN/13-387AMRKA..............IFG---------RG-----------------------------------------------
Q97BQ9_THEVO/10-379GNVRR..............SII---------LT-----------------------------------------------
O26854_METTH/5-391KVGMT..............AVK---------MS-----------------------------------------------
Q8KLM5_STRTO/6-396GAGSR..............VTL---------VS-----------------------------------------------
NAH1_ZYGRO/16-438KHWLS..............VTM---------LL-----------------------------------------------
NHAK_BACSU/3-415NLRAP..............ILL---------LA-----------------------------------------------
Q55190_SYNY3/65-446RVGPQ..............AAI---------VA-----------------------------------------------
Q55388_SYNY3/8-396QVSGS..............LRN---------LV-----------------------------------------------
NAH3_METJA/8-380QEFKN..............SLI---------LS-----------------------------------------------
Q93KW8_STRVR/66-455GAGRT..............GAA---------VG-----------------------------------------------
Q8GRF9_9PROT/12-375EVWKT..............AIF---------TT-----------------------------------------------
SL9A4_RAT/73-477ENIGS..............ILW---------WA-----------------------------------------------
Q815T7_BACCR/11-379KSGRS..............IAI---------GG-----------------------------------------------
Q9PBK4_XYLFA/11-395EVKAI..............AIP---------GA-----------------------------------------------
SL9A5_RAT/52-457DNLGA..............ILT---------YA-----------------------------------------------

PF03956

Q8U272_PYRFU/7-192RISEL--------------RDK---------FN-----------------------------------------------
Q5JE53_PYRKO/7-192LNAEE--------------LKK---------LG-----------------------------------------------
Q0W307_UNCMA/5-198TVITE--------------IRR---------LG-----------------------------------------------
Q3A9X2_CARHZ/110-301ELIKK--------------VRE---------KG-----------------------------------------------
Q6D3T3_ERWCT/111-299MTLRQ--------------IV.---------LN-----------------------------------------------
Q65TG5_MANSM/110-298ISLRE--------------VL.---------FN-----------------------------------------------
A0Q670_FRATN/117-306ISLKD--------------LF.---------KN-----------------------------------------------
Q8ZX41_PYRAE/114-291.AWVP--------------LR.---------LE-----------------------------------------------
Q5LD53_BACFN/7-205NLKFL--------------IKS---------LR-----------------------------------------------
Q0I3G0_HAES1/111-299ISLKE--------------VF.---------FN-----------------------------------------------
Q30YZ4_DESDG/7-199RCWRI--------------LRE---------MH-----------------------------------------------
A7HMA4_FERNB/6-189IEKRF--------------LK.---------..-----------------------------------------------
Q1MPD6_LAWIP/7-198QAWQV--------------IRS---------LK-----------------------------------------------
Q9CNG6_PASMU/111-299IALRD--------------VL.---------FN-----------------------------------------------
Q7P6I1_FUSNV/4-194NILND--------------LKK---------LN-----------------------------------------------
A1EJA4_VIBCL/110-298LSLKQ--------------IL.---------LN-----------------------------------------------
A9KSU8_CLOPH/5-197GIIQK--------------IKE---------YH-----------------------------------------------
A1ISW6_NEIMA/109-298VSLRQ--------------VL.---------VN-----------------------------------------------
A4YEP1_METS5/91-281IKFRA--------------ILH---------VT-----------------------------------------------
Q9UYY3_PYRAB/7-192KAEEV--------------KKA---------IS-----------------------------------------------
B8G2D2_DESHD/116-308DIWRH--------------MLK---------VG-----------------------------------------------
A0KIW8_AERHH/111-299MRLRQ--------------IL.---------LN-----------------------------------------------
Y1452_HAEIN/4-192ISLKE--------------VL.---------LN-----------------------------------------------
A1RUU6_PYRIL/96-273IR...--------------...---------LE-----------------------------------------------
A1VEH4_DESVV/7-199RSWRI--------------LRE---------LH-----------------------------------------------
Q64PG3_BACFR/7-199QTLKS--------------FRS---------LN-----------------------------------------------
A4J6Y5_DESRM/5-197EVWVR--------------LWN---------MG-----------------------------------------------
A4FXI0_METM5/7-192.GLRG--------------VKK---------VG-----------------------------------------------
Q1QZ23_CHRSD/114-307MPLKQ--------------IL.---------LN-----------------------------------------------
Q7MLI3_VIBVY/110-298LTLRQ--------------IL.---------LN-----------------------------------------------
O58406_PYRHO/12-197KIKDF--------------KKV---------LS-----------------------------------------------
Q1QD72_PSYCK/112-301ITLKE--------------VL.---------LN-----------------------------------------------
Q1Z0Y8_PHOPR/110-298MTLRQ--------------IL.---------LN-----------------------------------------------
A1U6W6_MARAV/112-300LSLRK--------------LL.---------MN-----------------------------------------------
Q96XQ5_SULTO/108-295LKLEI--------------LKR---------IS-----------------------------------------------
Q9YBX3_AERPE/117-302.GLRG--------------MLR---------GG-----------------------------------------------
A6VPB6_ACTSZ/111-299ISLRN--------------VL.---------FN-----------------------------------------------
A1RZA2_THEPD/99-286LSVAS--------------LRR---------GG-----------------------------------------------
A6VTK0_MARMS/114-302HRLRK--------------LF.---------LN-----------------------------------------------
Q2NU01_SODGM/130-310MTLRQ--------------IF.---------LN-----------------------------------------------
A5WGW5_PSYWF/135-324ITLKE--------------VL.---------LS-----------------------------------------------
A8MGH5_ALKOO/5-196NIVGK--------------IKE---------LG-----------------------------------------------
A4W8P2_ENT38/111-299MTLKQ--------------IV.---------LN-----------------------------------------------

PF06826

Y1229_BACTN/19-182-------------------FSS---------FR-----------------------------------------------
O52005_HALSA/14-174-------------------EGT---------VK-----------------------------------------------
O52005_HALSA/209-380-------------------VET---------IA-----------------------------------------------
Y590_CORGL/12-174-------------------FSE---------FA-----------------------------------------------
Y2211_CORGL/11-179-------------------FTS---------MK-----------------------------------------------
YBJL_ECOLI/16-183-------------------FSI---------FF-----------------------------------------------
Y3475_BRAJA/16-184-------------------VQA---------MK-----------------------------------------------
Y2102_COREF/11-180-------------------FRS---------LR-----------------------------------------------
Y595_COREF/356-528-------------------RQA---------LT-----------------------------------------------
Y3476_BRAJA/394-564-------------------VAG---------LK-----------------------------------------------
Y736_BACTN/15-179-------------------FRG---------LK-----------------------------------------------
YBJL_ECOLI/385-555-------------------NNG---------LG-----------------------------------------------
Y4083_YERPE/10-180-------------------FSS---------LR-----------------------------------------------
Y035_HAEIN/372-546-------------------FDT---------LV-----------------------------------------------
Y2102_COREF/367-539-------------------RSA---------LS-----------------------------------------------
Y3471_BRAJA/387-557-------------------WVA---------IQ-----------------------------------------------
Y595_COREF/12-171-------------------FRE---------FR-----------------------------------------------
Y2092_BACTN/378-551-------------------VQT---------VV-----------------------------------------------
Y736_BACTN/392-562-------------------VTG---------FK-----------------------------------------------
ASPT_TETHA/367-540-------------------ISA---------IQ-----------------------------------------------
Y3476_BRAJA/20-187-------------------VRG---------IA-----------------------------------------------
Y035_HAEIN/10-179-------------------FSS---------LR-----------------------------------------------
Q8RDQ8_FUSNN/294-465-------------------VEA---------VT-----------------------------------------------
Y2092_BACTN/20-185-------------------FSS---------FK-----------------------------------------------
Y2143_SHEON/15-183-------------------VQG---------IA-----------------------------------------------
Y500_BACTN/12-166-------------------FDS---------FR-----------------------------------------------
YIDE_SHIFL/10-180-------------------FAS---------LR-----------------------------------------------
Y1229_BACTN/378-551-------------------FDT---------VF-----------------------------------------------
Y1232_VIBPA/388-558-------------------FEH---------LT-----------------------------------------------
Y500_BACTN/358-529-------------------VAT---------FQ-----------------------------------------------
ASPT_TETHA/15-183-------------------ISS---------MK-----------------------------------------------
Y3471_BRAJA/15-183-------------------FAS---------LS-----------------------------------------------
YIDE_SHIFL/373-547-------------------VNT---------LV-----------------------------------------------
Y2143_SHEON/389-559-------------------VAG---------LK-----------------------------------------------

PF05982

Q8EAY3_SHEON/4-319HTQNL----------.VFTELV---------AV-----------------------------------------------
Q9K663_BACHD/12-337YHLEA----------.VIGPVI---------GT-----------------------------------------------
Q8YV47_NOSS1/18-370SNLTE----------.MVLPAA---------SA-----------------------------------------------
P71757_MYCTU/16-407SNVGA----------.IVGFMV---------VG-----------------------------------------------
Q8YY66_NOSS1/13-322SGVTQ----------EVVFTLL---------AA-----------------------------------------------
Q9A2P7_CAUCR/49-365HGLDA----------GFLKAAG---------LG-----------------------------------------------
P73953_SYNY3/18-374SNLTE----------.MLLPVA---------FS-----------------------------------------------

PF03812

KDGT_BACSU/1-314RKGIT--------------LLL---------GK-----------------------------------------------
KDGT_SHIFL/1-314RKSGT--------------LVV---------TK-----------------------------------------------
KDGT_PECCC/1-314RKSGV--------------LVV---------TK-----------------------------------------------

PF05684

Q9FLW1_ARATH/79-442-------------------IIR---------ST-----------------------------------------------
YJCL_BACSU/15-395-------------------IFK---------ES-----------------------------------------------
Q9LTG3_ARATH/95-460-------------------VVQ---------ST-----------------------------------------------
Q8P790_XANCP/17-412-------------------ILR---------LG-----------------------------------------------
Q9K8K1_BACHD/10-388-------------------IIK---------LG-----------------------------------------------
Q8RIK4_FUSNN/11-392-------------------LAK---------LG-----------------------------------------------

PF03601

Y2225_RHILO/7-307-------------------VVS---------IG-----------------------------------------------
YDHF_LACLA/5-311-------------------IGK---------LG-----------------------------------------------
Y5383_PSEAE/21-335-------------------IAG---------VG-----------------------------------------------
Y1621_ARCFU/22-308-------------------LGE---------FH-----------------------------------------------
Y2119_MYCPA/67-384-------------------IAK---------LG-----------------------------------------------
Y1056_STRP1/9-318-------------------VMA---------VG-----------------------------------------------
Y425_CAUCR/147-446-------------------FAA---------LG-----------------------------------------------
Y1461_PASMU/8-314-------------------ISN---------VG-----------------------------------------------
Y034_STRPN/9-315-------------------VFA---------VG-----------------------------------------------
Y341_STAAM/11-311-------------------IIG---------QG-----------------------------------------------
Y1643_HAEIN/8-316-------------------IAD---------VG-----------------------------------------------
YEIH_SHIFL/18-326-------------------IAD---------VG-----------------------------------------------
Y999_CAMJE/18-342-------------------LLS---------VG-----------------------------------------------

PF03616

Q9HZ58_PSEAE/4-371-------------------LRK---------GG-----------------------------------------------
O26036_HELPY/4-373-------------------LQK---------GG-----------------------------------------------
Q9KNC4_VIBCH/5-376-------------------LIK---------GG-----------------------------------------------
Q9S458_SALTM/1-366-------------------LIK---------GG-----------------------------------------------
GLTS_HAEIN/3-369-------------------LIK---------GG-----------------------------------------------
GLTS_SHIFL/2-366-------------------LRA---------GG-----------------------------------------------
Q99RS8_STAAM/2-370-------------------FKL---------GG-----------------------------------------------
P73275_SYNY3/4-370-------------------LLQ---------GG-----------------------------------------------

PF13593

C5DGV7_LACTC/27-386-ID.DWVLMGLIVTATC-------------------------------------PTTVASNVVMTKKAGGN---------
Q6CIF6_KLULA/49-408-ID.DWVLIGIIVTATC-------------------------------------PTTVSSNVVMTTKADGN---------
B3LLT3_YEAS1/23-385-ID.DWVLIGLILTATC-------------------------------------PTTVASNVIMTTNAGGN---------
Q6BPS9_DEBHA/26-388-MD.EWLLAGMIVTHAC-------------------------------------PTTVSSNVVMTKQAHGN---------
B9WFB0_CANDC/25-387-ID.DWLLIGLIVTHAC-------------------------------------PTTVSSNVVMTKQAHGN---------
B7NPU5_ECO7I/8-316-.....LYSGFLYLCIL-------------------------------------PATVQSAIAFTSMAGGN---------
A5DK55_PICGU/24-387-.....LLVGMIVTHAC-------------------------------------PTTVSSNVVMTKQAHGN---------
A5E3X9_LODEL/29-391-D..DWLLVGMIVTHAC-------------------------------------PTTVSSNVVMTKQADGN---------
A7MML9_CROS8/10-319-.....LYMGFLYLCAL-------------------------------------PATVQSAIAFTSVARGN---------
C2M6P1_CAPGI/9-321-.....VWLSIFFLASL-------------------------------------PSTVSSSVVMVSIAKGN---------
A0KES2_AERHH/4-313-.....IYLGFLYLCAL-------------------------------------PATVQSAIAFTSMAGGN---------
B6Q6N8_PENMQ/44-391-.....VLAGFILTSAI-------------------------------------PTTIASNVVMTRSAGGD---------
Q4ZYQ4_PSEU2/13-325-.....LMLGFLYLCAL-------------------------------------PSTISSSVALTGSAGGN---------
C4UDI4_YERAL/10-319-.....LYLGFLYLCAL-------------------------------------PATVQSAIAYTSVAGGN---------
Q0KE25_CUPNH/16-328-.....LLLGVFFLCAL-------------------------------------PSTVSSSVAMTSMARGN---------
Q6FU65_CANGA/32-393-ID.DWVLIGLLMTAAC-------------------------------------PTTVASNVLMTTEAGGN---------
D0Z7X4_EDWTE/10-319-.....IYLGFLYLCAL-------------------------------------PATVQSAIAYTSMAGGN---------
A3RYL9_RALSL/10-322-.....LLLGVFYLCAL-------------------------------------PSTVSSSVAMTAMAKGN---------
B2Q2V9_PROST/10-320-.....VYMGFLYLCAL-------------------------------------PATVQSAIAFTSVAGGN---------
Q7N4G4_PHOLL/10-320-.....VYWGFLYLCAL-------------------------------------PATVQSAIAFTSVAGGN---------
C8NCW5_9GAMM/45-353-.....TYQGFLYLCAL-------------------------------------PATVQSAIAFTSVARGN---------
C9Y8T0_9BURK/9-319-.....LAVGMLFLCTL-------------------------------------PATVQSAIAFTAMARGN---------
C5DX01_ZYGRC/23-385-D..DWVLIGFLLMAAS-------------------------------------PTTVASNVMMTSQAGGN---------
A9IQT5_BORPD/10-319-.....LYTGILFLCCL-------------------------------------PATVQSAIAFTSMARGN---------
Q988D7_RHILO/21-330-.....LYLGILFLCVL-------------------------------------PSTVQSSIAFTSIAGGN---------
Q2K4B0_RHIEC/7-316-.....LYLGILFLCVL-------------------------------------PSTVQSSIAFTSMAGGN---------
Q2NSZ3_SODGM/10-322-.....VYMGFLYLCAL-------------------------------------PATVQSAIAFTSVACGN---------
B9JA81_AGRRK/7-318-....SLYTGLLFLSVL-------------------------------------PSTVQSSIAFTSIAGGN---------
A6UD14_SINMW/7-316-.....LYTGILFLCVL-------------------------------------PSTVQSSIAFTSMAGGN---------
B0VBX5_ACIBY/10-320-.....LYWGFLFMCFL-------------------------------------PSTVQSSIAFTSVAKGN---------
C6W4P5_DYAFD/14-325-.....MWLAIFFLTVL-------------------------------------PSTVSSSVVMVSIARGN---------
A5VE28_SPHWW/9-318-.....LLVGVVLLCLM-------------------------------------PSTVQSSIAFTSIAHGN---------
B4WAZ9_9CAUL/9-317-.....LRIGLFYLCLL-------------------------------------PSTVQSSIAFTAIARGN---------
D2TZF8_9ENTR/10-320-.....IYIGFLYLCAL-------------------------------------PATVQSAIAFTSVAGGN---------
D0J170_COMT2/9-318-.....MYIGVLFLCTL-------------------------------------PATVQSAIAFTSMARGN---------
B2IHJ5_BEII9/11-319-.....VAVGLLFLTLV-------------------------------------PSTVQSSIAFTSIAGGN---------
A3XPQ3_LEEBM/6-318-.....LWLSFFFLAAL-------------------------------------PSTVSSSVVMVSIAKGN---------
A3I1U6_9BACT/15-326-.....FKLGITYLSVL-------------------------------------PSTVSASVVMVSIAGGN---------
B5JCP6_9BACT/12-331-.....MKAGFFYLAAL-------------------------------------PTTISSAIVMTSNSEGD---------
B4WXN7_9GAMM/9-320-.....LALGFLYLGVL-------------------------------------PSAVSSSIAFTAMARGN---------
C0XTF9_9CORY/7-316-.....MYQGILYAMLV-------------------------------------PSTVQSSVALTGIARGN---------
Q0V4P5_PHANO/88-416-.....LLIGFLFVGSA-------------------------------------PTTMNSNVVMTRQAHGN---------
A3SE09_9RHOB/10-318-.....VTMGLLFLSVL-------------------------------------PSTVQSSIAFTSIAGGN---------
B2WB77_PYRTR/69-400-.....LLIGLLFVGSA-------------------------------------PTTMSSNVVMTRQAHGN---------
D0WMS3_9ACTO/21-327-.....FATGFLYLSIL-------------------------------------PSTIQSSVTFVSIAKGN---------
B7G617_PHATC/64-378-.....LADGMVVCASL-------------------------------------PMTINMVLVLTKSSGGD---------
A9USA8_MONBE/8-323-LTNGSVLAHFTVLSCM-------------------------------------PPPVSSAVILTKAANGN---------
A5P8F8_9SPHN/9-317-.....VAVGLLYLGVL-------------------------------------PSTVQSATSYTTLANGN---------
A4S2B1_OSTLU/55-379-.....VVDGLFVLACL-------------------------------------PTTVGSGVAFTRSANGN---------
C5BV46_BEUC1/9-317-.....LATGMLFLTLL-------------------------------------PSTVQSSVAFVSVARGD---------
C1MQW6_MICPC/113-439-.....LVDGLIVLACL-------------------------------------PTTIGSGVALTSAAEGS---------
B7G616_PHATC/92-406-.....LADGMVITACM-------------------------------------PTAINIVIVLSAATGAD---------
Q2NAY2_ERYLH/10-318-.....IALGFLYLGTL-------------------------------------PSTIQSATSYTTIAGGN---------
Q1GQQ6_SPHAL/56-363-.....LAIGFLFLGIL-------------------------------------PSTVQSATAATSMAGGN---------
B8LLL0_PICSI/96-415-.....FVTGLAMFCCM-------------------------------------PTTLSSGVALTQVVGGN---------
A7RRB9_NEMVE/42-385-....TFRAGIQLYFIV-------------------------------------PCTISAGVVLVAQAGGN---------
E6VTY4_DESAO/16-319-.....FHIGFILLASL-------------------------------------PTSLEAAMAMAASAGGD---------
C0Q8Q9_DESAH/8-317-.....TALGLVLVAAM-------------------------------------PTTLSSGVVMTGQAGGS---------
Q4DG32_TRYCC/64-405-N...YLLVGLMCTFCL-------------------------------------PPSVILSVAATRSSQGN---------

PF01758

ARSB_BACSU/49-246......YMIGLIMIGLA-------------------------------------RCI-AMVIVWNDLSKGD---------
O49665_ARATH/179-364....TPIGAGIMLVSCV-------------------------------------SGA-QLSNYATFLTDPA---------
O29775_ARCFU/75-273......FMIGVILVGLA-------------------------------------RCI-AMVIVWNELAEGD---------
ARR3_YEAST/78-276......YRQGIIMIGVA-------------------------------------RCI-AMVLIWNQIAGGD---------
O81017_ARATH/71-248.......ATGLILVSCC-------------------------------------PGG-QASNVATYISKGN---------
NTCP2_CRIGR/39-220......QAVVVLIQGCC-------------------------------------PGG-TASNILAYWVDGD---------
P71942_MYCTU/62-259......YRTGLIIVGLA-------------------------------------RCI-AMVIIWNDLACGD---------
Y944_SYNY3/61-268VTLANSYIAGCILLGIA-------------------------------------PCT-AMVLMWGYLSYSN---------
O58554_PYRHO/48-238....HTLALGLLLAVVV-------------------------------------PCS-SMSIAYTGFTKGN---------
O86662_STRCO/51-247...GSGLLTAMILVVAM-------------------------------------PVA-AGATVWTDKGEGD---------
O26986_METTH/62-259......YMIGLILIGLA-------------------------------------RCI-AMVIVWNELAMGD---------
YOCS_BACSU/41-221......IAVGVILVGCC-------------------------------------PGG-TASNVMTFLAKGN---------
P73938_SYNY3/12-198......LAVGLMILAAC-------------------------------------PGG-STSNVITYLLKGN---------
P3_HUMAN/197-381......LALGLIITCSS-------------------------------------PGG-GGSYLFSLLLGGD---------
O58645_PYRHO/46-238....PQLLAGMVLIGLA-------------------------------------PLP-SSSPAFTNLAGGR---------
NTCP_HUMAN/32-214......EALAILVCGCS-------------------------------------PGG-NLSNVFSLAMKGD---------
O67889_AQUAE/32-212......LLVGVVLVGSA-------------------------------------PGG-TASNLITYLSRGD---------

PF03547

Q98L58_RHILO/3-308------AGVVGGVSSAY-------------------------------------SNVVLLGAPFILGIFGP.........
O67397_AQUAE/2-289------TLRAFLLVSSF-------------------------------------GNTAFMGYPFLYALEGN.........
ECM3_YEAST/12-596------WRGGILAGGMF-------------------------------------PNISDLPIAYLQSMDQG.........
PIN1_ORYSJ/9-590------WTITLFSLSTL-------------------------------------PNTLVMGIPLLKGMYGE.........
Y1382_METTH/5-299------KTWGLTVAAAM-------------------------------------MNSGFLGYPVTAGIFGS.........
PIN5_ARATH/9-362------WVITGLSISVL-------------------------------------PNTLILGMPILSAIYGD.........
Q97M34_CLOAB/2-296------KRDILMFMSIF-------------------------------------SNCGFIGFPVLKVVYGN.........
YFDV_SHIFL/4-307------EAAVCALIAGS-------------------------------------PTIGFLGFAVLDPIYGD.........
PIN6_ARATH/9-565------WLITLFSIATL-------------------------------------PNTLVMGIPLLQAMYGD.........
YWKB_BACSU/5-315------NSSVFSLNSAQ-------------------------------------PTFAFMGIPVLGSLFGA.........
Q9FVF6_9ROSI/9-609------WTITLFSLSTL-------------------------------------PNTLVMGIPLLKGMYGD.........
Y1031_METJA/2-303------KLGGLILVSML-------------------------------------GNTGFLGYPVALGMFGE.........
PINI_ARATH/9-617------WTITLFSLSTL-------------------------------------PNTLVMGIPLLKGMYGN.........
YB8B_YEAST/13-413------ETNFVVANSVF-------------------------------------GNSNSLPVSLTLSLAYTLPNLTWDQI
Q9C999_ARATH/18-441------FNRFTIVMTAF-------------------------------------GNTGNLLLAIVSSVCHT........K
Q9WYQ5_THEMA/4-288------VIHVTAVT...-------------------------------------ANVGYLGYPILLSLWGE.........
Q9C9K4_ARATH/9-407------LRGLIISCCAS-------------------------------------GNLGTMPLIIIPAICKE......KGG
Q48797_OENOE/6-311------RRGTFINMFVN-------------------------------------ANTIFIGLPLNSALFGT.........
PIN7_ARATH/9-614------WSITIFSLSTL-------------------------------------PNTLVMGIPLLIAMYGE.........
Q9LZN2_ARATH/30-423------YFKFTIIQIGV-------------------------------------GNIGNVPLVLLAALCRD......TSN
Q9SHL8_ARATH/9-388------LEGLIVATCSA-------------------------------------GNMGNLPIILVPAICDE......DKS
PIN4_ARATH/9-611------WMITIFSLSTL-------------------------------------PNTLVMGIPLLIAMYGT.........
YDQ4_SCHPO/18-440------QRNFATACITF-------------------------------------QNSNSLPLALVSSLATTVKDLLWDKI
P71425_KLEPN/4-313------DGAVLTLTVAL-------------------------------------PNYAALGLPILGSVLGE.........
Q9FKY4_ARATH/9-387------LHGLIIATCAS-------------------------------------GNMGNLMLILVPAICDE......EGS

PF03977

Q9KUH0_VIBCH/17-376------SSIAIIGGADG-------------------------------------PTAIFLASQLSPDLLGA---------
O59022_PYRHO/20-400------ASIGIIGGADG-------------------------------------PTTIYLTTKLAPHILSA---------
O28195_ARCFU/1-354------ASIGIIGGADG-------------------------------------PTTIYTTTILAPHLLAA---------
OADB_PASMU/17-431------AAIGIIGGADG-------------------------------------PTAIYLSSKLAPELLGA---------
OADB_VIBCH/17-432------AAIGIIGGADG-------------------------------------PTAIYVSSMLAPELLGA---------
O83096_TREPA/89-468------CAIAIIGGADG-------------------------------------PTSIYVSAKLAPELMAV---------
Q99ZL5_STRP1/18-376------ASVGIIGGADG-------------------------------------PTAIYVTTKLAPDLLST---------
Q99ZL0_STRP1/12-373------ASIGIIGAADG-------------------------------------PTSIFVANQLAKDLLGP---------
Q9WZY2_THEMA/30-384------ASIAIIGGADG-------------------------------------PTAIYITNTLSPELIAP---------

PF06965

NHAA1_PSEPK/11-387------VG-GMVVPALI------------------------------YWFINRDNPAAVAGWAIPTATDIAF-----ALG
NHAA_BRUSU/14-384------AG-GVILPAII------------------------------FAVLNHDNPAKLRGWAVPSATDIAF-----ALG
NHAA_CAUCR/11-381------AG-GVVVPGLI------------------------------YASLNAGSPETLRGWAIPTATDIAF-----ALG
NHAA2_PSESM/16-384------LG-GMLVPALI------------------------------YIAINWGNPQTLSGWAIPAATDIAF-----ALG
NHAA_HELPY/14-427------IG-GMIAPGLI------------------------------YFFLNANTP.SQHGFGIPMATDIAF-----ALG
NHAA_SHEON/5-380------IG-GMLVPAGI------------------------------YLLFNYGDPITQAGWAIPAATDIAF-----ALG
NHAA1_PSESM/17-385------LG-GMVVPALI------------------------------YVAFNWGQPETIGGWAIPAATDIAF-----ALG
NHAA2_VIBVU/27-435------LG-GMSTPPLF------------------------------YLLLQYGES.GQHGWGTVMATDTAF-----VIG
NHAA_HAEIN/17-393------IG-GMVIPAVV------------------------------YWFIAKQDPSLANGWAIPMATDIAF-----ALG
NHAA_RHILO/12-384------AG-GMLVPALV------------------------------YVFINRNNSAALSGWAIPTATDIAF-----ALG
NHAA_WIGBR/8-385------IG-GMIFPALI------------------------------YNFITKEDSSISSGWAITVATDIAF-----AVG
NHAA2_STRCO/26-428------LG-SMIVPALI------------------------------FVLVN.AGRESVHGWGTAMSTDTAF-----ALG
NHAA_VIBCH/5-373------VG-GMLAPALI------------------------------YVAFNFNDPAAIQGWAIPAATDIAF-----ALG
NHAA_RHIME/20-428------LG-GMAAPAGI------------------------------YLLLVGGGPG.ASGWGTVMSTDTAF-----VIG
NHAA_ECOLI/4-380------IG-GMIVPALL------------------------------YLAFNYADPITREGWAIPAATDIAF-----ALG
NHAA_STRAT/25-401------LC-GMAVPALV------------------------------YTLTNLTGHGSTQGWAVPTATDIAF-----ALA
Q93DN6_9BACT/17-388------IG-GMAVPALL------------------------------FYALNHSNPETVKGWAIPSATDIAF-----ALC

PF00999

YDO6_SCHPO/39-445------FA-GTFISAVT...........LGVLVY.IFSF....LNFEN.LSMTFVEALSMGATL.SATDPVT-----VLA
KEA4_ARATH/173-543------LL-QIFLFMCL...........SGITASL..............CGGKLTEGIFVGAFL.SMSSTAV-----VLK
KEA5_ARATH/158-528------LL-QIVLLMFL...........CGVTALL..............CGARLSEGIFVGAFL.SMSSTAV-----VVK
KEA3_ARATH/109-496------LT-QVLLCTAAFTAFELPPNGAIGTKILEFLFHS...RPDLV.NIRSIDEAVVIGAAL.SLSSSAF-----VLQ
SL9A3_HUMAN/58-462------VV-GTVWNAAT...........TGLSLY.GVFL....SGLMGDLQIGLLDFLLFGSLM.AAVDPVA-----VLA
Q83E71_COXBU/27-390------LI-SSIVFAAT............GYGVAY.............FFNYPVVECLVIGGAM.MFSSTII-----GIK
Q9Y959_AERPE/11-361------LV-SALAPLAL............TALLHVYL.........GL....SLTSSLVILASL.SATSVAL-----TYL
Q8XPZ0_RALSO/11-388------IG-QIALATLM............GMGLAWLL.........GW....AWGPGLVFGLAL.SVASTVV-----LLK
CVRA_ECOLI/10-389------TL-GVLITSGL...........TGMMAAW............L.FNLDLIEGLLIGAIV.GSTDAAA-----VFS
Q93N84_STRLA/15-400------AL-ALLVPAGL............STGAV.TLLEGMFTAVEPD.AGGRTF.VMFMAVAC.SVTALPV-----LVA
Q8XLS1_CLOPE/11-387------IV-SIITAIIL............SFTLK.FAG......ISEG........YIFFALLF.TAAAPGL-----LVP
O25795_HELPY/9-377------FA-YLLILYTL............SFILTFSL.........NL........EPIFMVIF.PIISLGM-----IMT
NAH1_METJA/7-393------TI-TFLITLLI...........SGFIFN.M..........VLNLPYTSPVGYLFGAIT.AATDPAT-----LIP
CHX14_ARATH/58-442------TA-SYALPFSL............GNLTVLFLK......NTYN.LPPDVVHCISTVISLNAMTSFPV-----TTT
Q45308_BACME/8-377------VL-GIILPFIG............GFGVGE............L.FGLGATYSLFIGVLL.CATSVSI-----TVQ
NHX3_CAEEL/44-444------VL-GTLWNTFA...........IGGSLL.IMSK....YQLFT.MPFTTFEILVFSALI.SAVDPVA-----VIA
P74393_SYNY3/33-411------GP-GVVISAAI...........TAVLLKI............G.LGLAWVTAAGVSVIL.TITDTVS-----VIA
YJCE_ECOLI/3-422------LA-LVVVTVVG...........IGFLIY.W..........VV.PGIPLIPAFALAAVL.SPTDAVA-----LSG
O66731_AQUAE/13-381------LL-IFLSAFVF............GILLGI.....................GTAPAIIL.SLISLGL-----MVA
Q98GP4_RHILO/11-397------IV-QIGFATAL............GAGLSWML.........GW....SMGAGLVFGLAL.SVASTVV-----LLR
SL9A6_HUMAN/78-503------FL-GTAISCFV...........IGSIMY.GCVTLMKVTGQLA.GDFYFTDCLLFGAIV.SATDPVT-----VLA
Q8S5V1_ORYSJ/176-496------LL-QIVLFMFL...........CGLTAAL..............CGAKSSEGVFVGAFL.SMSSTAV-----VSK
Q99V81_STAAM/7-388------LT-VFAFIMII............SILLA.YVF......KWLG....LVDDVLLMVIII.STISLGV-----VVP
Q9Z9H1_PSEAI/31-448------FG-LVFFTVVG...........AGYFIH.L..........LI.PEIPLAASFALAAVL.SPTDALA-----VSA
Q9XBC3_AMYOR/14-390------VS-SIVLPFTL............GVGLA.FYLA.....MNRP.VEHRLGFLLFIGAAM.SVTAFPV-----LAR
SL9A7_HUMAN/114-534------FL-GTAVSCFI...........IGNLMY.GVVKLMKIMGQLS.DKFYYTDCLFFGAII.SATDPVT-----VLA
CHX13_ARATH/60-447------TA-SYAFPFSL............GNLTIMFIS......KTMG.LPSDVISCTSSAISLSSMTSFPV-----TTT
Q894B2_CLOTE/11-387------LI-SLVISFLI............SKFLV.SIN......LIRN........VTFFTFLF.ASSAPGF-----IVP
O29023_ARCFU/4-337------TI-DFLFNFLP............PLVLLYLI.........GF....DLRDAFILASAI.YISSSAI-----NLK
Q8PQR8_XANAC/12-399------VA-GIVLPLLL............GLAAA.PWLFP...RFAPQ.GVSFWPFALFIAAAM.SVTAFPV-----LAR
O30022_ARCFU/11-366------AL-SLALSVAL............TALMGL.....................NLFYAIIL.TNVAVGV-----VVS
Q81V05_BACAN/11-386------SV-IFLFIFIL............SYALS.LLF......VWLG....FVDNAMFMTLII.STISLGV-----VVP
NHEB_ONCMY/73-472------VI-GTLWNAFF...........MGGLLY.ALCQ....IESVGLSGVDLLACLLFGSIV.SAVDPVA-----VLA
Q87RG9_VIBPA/2-353------IL-STVFFALALSGL...KLLGLTSLASM.................ESGQILLLAFAL.SFSSTVF-----AVK
Q8EIY2_SHEON/2-355------IL-SILVFVPILKIL...GLLGLSQLTSL.................GIEQLTLLAFAL.SFSSTVF-----AVK
Q9RV80_DEIRA/10-368------LI-DLALNFTP............GVVAGALL.........GL....PPLAWVLLGGIT.FLTSSGI-----ASK
NAH1_YEAST/17-440------LP-VMTAGWLI...........IGLFVWIL...........I.PGLNFSASLLISACI.TATDPIL-----AQS
O58040_PYRHO/8-379------TM-GVFVPFLL............GYLIAI............V.YGYRSLAALFLGGIL.TATSVGL-----TTS
SL9A1_HUMAN/105-505------VV-GTLWNAFF...........LGGLMY.AVCL....VGGEQINNIGLLDNLLFGSII.SAVDPVA-----VLA
O29412_ARCFU/6-377------FL-GVVVTTTV...........VGFSLNW............I.LGIPLALALIFGAMV.SATDPVS-----VLA
Q9L191_STRCO/11-375------GI-YLLLNVGA............GLGFGFVL.........GW....GVREALVLAGVL.GISSSAI-----VTK
NAH2_SCHPO/16-437------LP-VMIFGWLV...........STGFMYAL...........I.PRLSFLESLAIAACI.TATDPVL-----ASS
NHX7_ARATH/37-450------VP-GVLISTAC...........LGSLVKVT..........FP.YEWDWKTSLLLGGLL.SATDPVA-----VVA
YJBQ_BACSU/10-389------SV-IFVGIFIL............SLLLS.YGF......VLAG....FIQNAFLMTLII.STISLGV-----VVP
NAPA_ENTHR/8-379------LL-GILFPVFF............GWLTGE............A.FQVANNEAIFFGIIL.AATSVSI-----SVE
Q48731_9LACT/8-376------IG-GVIVPLIV............FGLVAF............S.FGYGMSTSFFYGIVF.AATSVSI-----TVE
Q93JF3_STRCO/15-406------LA-SFAVPMAV............GSGCA.LLFGDALHDLGMP.GDLSPGMVVFAGVAL.ATTAVPV-----LTA
TMCO3_MOUSE/274-662------CY-MTLLMIAFG........LWWGHLLRI.................RPTQSVFISTCL.SLSSTPL-----VSR
Q09432_CAEEL/35-439------MI-GTSFNIVA...........IALSLW.AISL....TGLFS.VETPLMHMLLFGSVA.ADVDPVA-----VIV
NAH_SCHPO/16-434------LP-VMAYGWLV...........TAGFAYAL...........F.PQINFLGSLLIAGCI.TSTDPVL-----SAL
Q9KTB1_VIBCH/2-353------LL-STALFTLLLLIF...KQLGLDSLADL.................SFDKLILIGFAL.SFSSTVF-----AVK
Q23706_CARMA/81-483------VI-GTIWNALT...........IGITMY.AISL....TGLFG.LDIPMLHMFLFSSLI.SAVDPVA-----VLA
Q9X8F2_STRCO/12-382------LW-SWPVALVA............GIALALL...........V.SGGDVFEAFVIGTAL.TSTTLGT-----VLP
NAH2_METJA/7-395------IL-ALLIVWII...........SGIVFN.F..........VFHLPILSLIGLLFGAIV.SATDPAT-----LIP
Q8PYD4_METMA/9-374------VL-QILFTTTL............AFIICTWI.........GF....SSSTSIFIGLLI.SLSSTAI-----VLK
SL9A2_RAT/85-486------VV-GTLWNSIG...........IGLSLF.GICQ....IEAFGLSDITLLQNLLFGSLI.SAVDPVA-----VLA
O67072_AQUAE/23-407------IV-GAALPFAG............GFIVSYY...........F.FGLDLVASLFMGGAL.TATSIGI-----TVR
Q8KHN6_NOCAE/16-400------AG-SILLPFLA............GTGFA.LLTRPAFGTPQVS.TTAY...ALFVGLAM.SITALPV-----LAR
Y2309_MYCBO/17-417------IG-LVIATAVA...........VSWTARA..............LGMESHAAAVLGAVL.SPTDAAA-----VAG
O82871_PSEAI/9-410------TA-GVLIATFV...........IGGLAY.YTF......PLFG.WQVDFIYCLLFGALI.SPTDPIA-----VLG
P73863_SYNY3/19-406------TL-GVVICVVG...........IAFPLS.Y...........W.GGMELAIAFLAAAAL.SATDPVS-----VIA
O58682_PYRHO/8-388------MF-GVAFSFIL............GFLTVY............F.LEKSLIAALFVGITL.GNTAIEV-----TSG
Q8PVQ3_METMA/9-375------AL-QILFTTGI............VLAVCTNL.........GF....SHSASLFTGLLI.SLSSTAI-----VLK
CHX23_ARATH/59-444------FT-GLLVALPV............GAFLYYLPGNG...HPDKI.....ISGCVFWSVAL.ACTNFPD-----LAR
Q55736_SYNY3/17-390------SL-TFAVPLLT............GLAVGLTF.........GY....SFNASVLLGSLF.A.SHTLL-----GYP
KEFX_HAEIN/13-387------LL-QVGLCGCLLTFS...GIYLLGLTKEV.....................SFIAGMGF.TLSSTAI-----VMQ
Q97BQ9_THEVO/10-379------IS-SFIAPSML............GFLY..LQA......VAHL....PIIPAFVLSMSV.GVPSISI-----ISV
O26854_METTH/5-391------FI-PDVFEGLAVMVA...SHYILGL.....................PIIEAGILGFVI.AAVSPAV-----IVP
Q8KLM5_STRTO/6-396------LS-SMALPMAL............GAGLA.VLLFPLYDKSQLS.SDGVLAPAIFLGVAM.SITAFPV-----LAR
NAH1_ZYGRO/16-438------VP-VMTSGWLV...........IALFVWIL...........V.PGLNFPASLLMGACI.TATDPVL-----AQS
NHAK_BACSU/3-415------LG-LVFATVIV...........GGYTIH.W..........MI.PAIPLAAAFGLAAIL.SPTDVVA-----VSA
Q55190_SYNY3/65-446------VV-GVVTPFSL............GTIGLMT...........I.FGVAAIPAIFAGAAL.TATSIGI-----TAK
Q55388_SYNY3/8-396------TI-GTLITLVG...........GGLAAHW............L.AEFPWYLAFLYGSLV.VVTGPTV-----VGP
NAH3_METJA/8-380------LF-SLLIPGVG............GYLIGQYL.........GL....GFIGSLLYAVIF.ASHSVAI-----VYA
Q93KW8_STRVR/66-455------IV-GVCVSFAL............GCALG.YALYT...GYAPD.GVGFLPFTLFLGIAM.SVTAFPV-----LAR
Q8GRF9_9PROT/12-375------VL-QIAGSVGT............ALLLRHGL.........GW....SLGLAVVLGCAV.AVSSTAV-----VIK
SL9A4_RAT/73-477------GL-GALINAFG...........IGLSLY.FICQ....IKAFGLGDINLLQNLLFGSLI.SAVDPVA-----VLA
Q815T7_BACCR/11-379------TI-YILINFSL............GLLYGFIM.........GF....PLLEILIIAGII.TISSSAI-----VAK
Q9PBK4_XYLFA/11-395------LV-QIAAATLL............GWGLAWTM.........GW....PMVQGVVFGLAL.SVASTVV-----LLR
SL9A5_RAT/52-457------VV-GTLWNAFT...........TGVALW.GLQQA...GLVAPRVQAGLLDFLLFGSLI.SAVDPVA-----VLA

PF03956

Q8U272_PYRFU/7-192------AK-ILLMPLLT-------------------------------------LMGSMVGGVL----------------
Q5JE53_PYRKO/7-192------KK-SLLLPTET-------------------------------------LLGSLLGGAV----------------
Q0W307_UNCMA/5-198------VK-ILLLPLFI-------------------------------------ACGSIAGGLA----------------
Q3A9X2_CARHZ/110-301------VK-IISFPLLA-------------------------------------LLGSILGGMA----------------
Q6D3T3_ERWCT/111-299------RR-GLVIALIV-------------------------------------GISALGGGLL----------------
Q65TG5_MANSM/110-298------KR-GIYTAIIM-------------------------------------IITALIGGIV----------------
A0Q670_FRATN/117-306------KE-ALFIVILV-------------------------------------IGLSISSAIF----------------
Q8ZX41_PYRAE/114-291------KS-MLASPAIS-------------------------------------LASAAAVAPI----------------
Q5LD53_BACFN/7-205------PN-MLLVPIAT-------------------------------------IVGTLLFSAF----------------
Q0I3G0_HAES1/111-299------KR-GLYTGIIF-------------------------------------VFTSLLGGIL----------------
Q30YZ4_DESDG/7-199------IK-VLLVPVFI-------------------------------------MLGTFAGALA----------------
A7HMA4_FERNB/6-189------.G-ILMTIIST-------------------------------------IVGTLIFAFI----------------
Q1MPD6_LAWIP/7-198------GK-ILLVPLGI-------------------------------------LIGTLLGAVI----------------
Q9CNG6_PASMU/111-299------KR-GLITGVIF-------------------------------------IITSLLGGLL----------------
Q7P6I1_FUSNV/4-194------KK-VLFLPFIT-------------------------------------IISSLAGGAV----------------
A1EJA4_VIBCL/110-298------KH-GMVIAAVI-------------------------------------ILTSWLGGVI----------------
A9KSU8_CLOPH/5-197------VK-VFIIPFGI-------------------------------------IIGSLLGGII----------------
A1ISW6_NEIMA/109-298------RR-GIRLSVWF-------------------------------------MLSSLSGGLL----------------
A4YEP1_METS5/91-281------RE-ALVTTLVV-------------------------------------IIGAVVCALA----------------
Q9UYY3_PYRAB/7-192------HK-TLALPIAT-------------------------------------LLGSIIGGIV----------------
B8G2D2_DESHD/116-308------WQ-VFLAPVGV-------------------------------------VLGSIAAAML----------------
A0KIW8_AERHH/111-299------PW-GMKIAVTV-------------------------------------ILSSWLGSLL----------------
Y1452_HAEIN/4-192------KQ-GLMMGAIF-------------------------------------TLSSLIGGVI----------------
A1RUU6_PYRIL/96-273------KA-VLLAPAAA-------------------------------------LLGAGIVGFL----------------
A1VEH4_DESVV/7-199------IK-VALVPLAV-------------------------------------MAGTFGGAAM----------------
Q64PG3_BACFR/7-199------PR-LLFLPVMT-------------------------------------ILGTLAGCAV----------------
A4J6Y5_DESRM/5-197------WK-VLLIPVLV-------------------------------------AVGSLAGAVV----------------
A4FXI0_METM5/7-192------KF-GILLPLFT-------------------------------------IIGSLIGGII----------------
Q1QZ23_CHRSD/114-307------RH-GLAIAICV-------------------------------------ALSSLLGGLL----------------
Q7MLI3_VIBVY/110-298------KQ-GMVIALVI-------------------------------------IITSMVGGLI----------------
O58406_PYRHO/12-197------HK-TIALPFST-------------------------------------LIGSIIGGAL----------------
Q1QD72_PSYCK/112-301------KR-GVEMSIIF-------------------------------------TLSVLVGGLI----------------
Q1Z0Y8_PHOPR/110-298------KK-GIIIALVI-------------------------------------IGTSLPGGII----------------
A1U6W6_MARAV/112-300------RQ-GLGIALAL-------------------------------------VVSSLVAGLA----------------
Q96XQ5_SULTO/108-295------GL-AIVSILVD-------------------------------------VFGAIISAIL----------------
Q9YBX3_AERPE/117-302------RL-GLLLALSC-------------------------------------LVGGVIGGAA----------------
A6VPB6_ACTSZ/111-299------KR-GMYTGIIM-------------------------------------IVTSLCGGII----------------
A1RZA2_THEPD/99-286------VV-ALKAVAVT-------------------------------------LASAVLAGLT----------------
A6VTK0_MARMS/114-302------SQ-GVIIALVT-------------------------------------IFTTLLAGWI----------------
Q2NU01_SODGM/130-310------RR-ELLVVVVS-------------------------------------ALAAVLL...----------------
A5WGW5_PSYWF/135-324------KR-GMQTSVIF-------------------------------------TLAVLMGGII----------------
A8MGH5_ALKOO/5-196------VK-VLLVPLMV-------------------------------------AVGSIAGAIV----------------
A4W8P2_ENT38/111-299------RR-GMMVAVVV-------------------------------------VASSMVAGVI----------------

PF06826

Y1229_BACTN/19-182------KG.GVTLNMLA---------------------------------------------------------------
O52005_HALSA/14-174------TY.GLNFIAIS---------------------------------------------------------------
O52005_HALSA/209-380------EY.GVEIVVTA---------------------------------------------------------------
Y590_CORGL/12-174------KK.GWKLTIFM---------------------------------------------------------------
Y2211_CORGL/11-179------TT.GLRNNALT---------------------------------------------------------------
YBJL_ECOLI/16-183------RD.GKNYLMLA---------------------------------------------------------------
Y3475_BRAJA/16-184------RD.GLKPVLLA---------------------------------------------------------------
Y2102_COREF/11-180------ST.GLRNNGLA---------------------------------------------------------------
Y595_COREF/356-528------DPQSFVYMGVG---------------------------------------------------------------
Y3476_BRAJA/394-564------AL.GFGLFLWG---------------------------------------------------------------
Y736_BACTN/15-179------KD.GLPQVGFA---------------------------------------------------------------
YBJL_ECOLI/385-555------AI.GGQMLIAG---------------------------------------------------------------
Y4083_YERPE/10-180------VS.GLRLNCFA---------------------------------------------------------------
Y035_HAEIN/372-546------NGSGLEWMGYG---------------------------------------------------------------
Y2102_COREF/367-539------DPASLLIIGVG---------------------------------------------------------------
Y3471_BRAJA/387-557------AH.GLLLVGMG---------------------------------------------------------------
Y595_COREF/12-171------SR.GWKLTLFM---------------------------------------------------------------
Y2092_BACTN/378-551------EGDGLLYVGCG---------------------------------------------------------------
Y736_BACTN/392-562------EV.GFSLFIVG---------------------------------------------------------------
ASPT_TETHA/367-540------SM.GISVLLIG---------------------------------------------------------------
Y3476_BRAJA/20-187------QD.GVPQAIFA---------------------------------------------------------------
Y035_HAEIN/10-179------KS.GLKLNAFA---------------------------------------------------------------
Q8RDQ8_FUSNN/294-465------GD.GIMIAIVS---------------------------------------------------------------
Y2092_BACTN/20-185------KG.GMTLNLLA---------------------------------------------------------------
Y2143_SHEON/15-183------KD.GLPQALFA---------------------------------------------------------------
Y500_BACTN/12-166------SK.GKTLILIT---------------------------------------------------------------
YIDE_SHIFL/10-180------VS.GLRLNLFA---------------------------------------------------------------
Y1229_BACTN/378-551------RPEGLLWIALG---------------------------------------------------------------
Y1232_VIBPA/388-558------QV.GPQVIGLA---------------------------------------------------------------
Y500_BACTN/358-529------ES.GLLMFGVG---------------------------------------------------------------
ASPT_TETHA/15-183------KF.GAKIVYAT---------------------------------------------------------------
Y3471_BRAJA/15-183------VR.TLAQVAMA---------------------------------------------------------------
YIDE_SHIFL/373-547------NGEGLSWIGYG---------------------------------------------------------------
Y2143_SHEON/389-559------EL.GFSLFLWG---------------------------------------------------------------

PF05982

Q8EAY3_SHEON/4-319------VALGLLIPLAL-------------------------YPVLTRLVRLGRTDAISIAAHYGSVSAGTF-----AVV
Q9K663_BACHD/12-337------IFLGMLIPVIV-------------------------LMITRLFMKVDLKNSIALAATYGSTSIVTY-----GAA
Q8YV47_NOSS1/18-370------VAVGVLVVFIA-------------------------RYTLAKLPKVNTVDAIATGGLFGAVSGSTM-----AAA
P71757_MYCTU/16-407------FALNFVIGTLA-------------------------YFLLSKLTAMRRVDRATVAGYYGSDSAGTF-----ATC
Q8YY66_NOSS1/13-322------MLMACFVPIYT-------------------------FFILK..LKLDTYDAAAIAATYGSISAVTF-----ITA
Q9A2P7_CAUCR/49-365------LALSFLLPLPA-------------------------YALLRR.TGLDTLTAAATAAHYGSVSVVTF-----AAA
P73953_SYNY3/18-374------VILGILIVFIA-------------------------RFTLAKLPNVRTVDALATGGLFGAVSGSTM-----AAA

PF03812

KDGT_BACSU/1-314------IGFAALLGVIA----------------------------AQFIPDDGIQSGFFAGLSVLAIVAV----------
KDGT_SHIFL/1-314------IAVAWVVAAIA----------------------------SRIIPEHGVEVGFFAGLSTLALVAA----------
KDGT_PECCC/1-314------IATAWVVALIA----------------------------GTFLPGDGIQNGMLAGISVLALVAA----------

PF05684

Q9FLW1_ARATH/79-442------GS-LLLAFLIG-------------------------------------SVATIVGTVVAFMLVPMR...SLGPD
YJCL_BACSU/15-395------RR-LLFIFLIS-------------------------------------SVGTVLGSILAFFLLKQH.....IPY
Q9LTG3_ARATH/95-460------GK-LLLAFLIG-------------------------------------SVATTVGTALAYYLVPMK...SLGPD
Q8P790_XANCP/17-412------PK-LVAMYLGA-------------------------------------SLSIMLGAVVAFWVMRWLHPATVAGD
Q9K8K1_BACHD/10-388------PK-LLITYFVA-------------------------------------AFSIVLGFTLTYLVMQSF....FLDD
Q8RIK4_FUSNN/11-392------GR-MVAIFLAC-------------------------------------SFTLFIGFIVGYPIFKSF....LGTD

PF03601

Y2225_RHILO/7-307------AG-GVGIVAAT-------------------------------------LGATFV--FTITLG.RLI-----GVD
YDHF_LACLA/5-311------FS-GVGFILIQ-------------------------------------MISTII--FVLFMG.KKL-----GFS
Y5383_PSEAE/21-335------LH-GVLLDALM-------------------------------------LASTFG--LACLLGTRLF-----GLD
Y1621_ARCFU/22-308------PE-IVAATLIS-------------------------------------TSLIFL--TVFWLS.SRL-----KLS
Y2119_MYCPA/67-384------G.-ISLVQILV-------------------------------------DMTIAG--TIIIAVARWF-----GLS
Y1056_STRP1/9-318------M.-QSLPIIIS-------------------------------------TIATAL--LVAYGLQKWL-----RLD
Y425_CAUCR/147-446------GP-AVLASGAV-------------------------------------VLGGLG--IGALAG.AAL-----GLP
Y1461_PASMU/8-314------IN-AIATDTIM-------------------------------------LISTFL--LTLWLGIRYL-----KMD
Y034_STRPN/9-315------Q.-SSLPVILS-------------------------------------TISIAL--IIAYLFQRFF-----ALD
Y341_STAAM/11-311------SK-LLAIDVGV-------------------------------------VIFSIV--MMLFVN.KLL-----HGD
Y1643_HAEIN/8-316------LN-AVVTDAIM-------------------------------------LISTFF--LTALLGIRYL-----KMD
YEIH_SHIFL/18-326------IS-GIIIDVLT-------------------------------------LSSTFL--LACFLGQKVF-----GLD
Y999_CAMJE/18-342------LK-GFLLSAIV-------------------------------------IFFVFI--IALFVGTKIF-----KLD

PF03616

Q9HZ58_PSEAE/4-371------KT-LLVYLSAC-------------------------------------WALAILQNLIGVGSAGLL-----GLD
O26036_HELPY/4-373------KM-LAVFLLAV-------------------------------------AGFVVCQNAVGISTASLL-----GVN
Q9KNC4_VIBCH/5-376------AK-VFLFLAVA-------------------------------------SVFIIIQNGVGVSLAAGL-----GLD
Q9S458_SALTM/1-366------KP-LVLLTIAV-------------------------------------TILIAIQNTVGMSMAVMM-----NES
GLTS_HAEIN/3-369------KP-LVVFLFIA-------------------------------------ALLIFGQNVIGIASSMAL-----GIH
GLTS_SHIFL/2-366------RV-VGIFLIVV-------------------------------------VGLLVMQNAIGIGMASLL-----GLD
Q99RS8_STAAM/2-370------KV-LLLYFMFC-------------------------------------AIISVIQNIVGVSLAKVL-----NIK
P73275_SYNY3/4-370------KP-LLILLATA-------------------------------------VSFLVIQNFVGVGMASLL-----GQA

PF13593

C5DGV7_LACTC/27-386-------DL-LCLCEVFIGN----VLGAFVTPALV.------------------QMF.TSSSLFAFGNPAS.GS......
Q6CIF6_KLULA/49-408-------AL-LCLCEVFIGN----VLGAFITPALV.------------------QMY.T...........S.SGPMVFG.
B3LLT3_YEAS1/23-385-------SL-LCVCEVFIGN----LLGAFITPALV.------------------QMF.TNRAPFAYGNPAT.GN......
Q6BPS9_DEBHA/26-388-------DV-LTLLEVSVGN----ILGAFVTPALV.------------------QMY.L...........V.GTWEFANP
B9WFB0_CANDC/25-387-------DI-LTLCEVFIGN----VLGAFITPALL.------------------QMY.M...........T.GTWEIGNP
B7NPU5_ECO7I/8-316-------VA-AAVCSASASS----LLGIFLSPLLV.------------------GLV.M...........N.VH......
A5DK55_PICGU/24-387-------DI-LTLCEVFIGN----LLGAFITPALV.------------------QMY.L...........R.GTWAFGNP
A5E3X9_LODEL/29-391-------DI-LTLCEVTVGN----ILGAFITPALL.------------------QMY.M...........T.GVWDFGNP
A7MML9_CROS8/10-319-------VA-AAVCSASASS----ILGIFLSPVLV.------------------GVM.M...........Q.AQ......
C2M6P1_CAPGI/9-321-------IT-SAIFNASISG----LIGIVATPLLM.------------------GFF.L...........E.NT......
A0KES2_AERHH/4-313-------VS-AAVCSASASS----ILGIFLSPVLV.------------------GLM.I...........N.VQ......
B6Q6N8_PENMQ/44-391-------DA-AALVEVLIAN----FLGPFLTAGWT.------------------VTL.MPKTAEFELWRSG.SS......
Q4ZYQ4_PSEU2/13-325-------VP-AAILNASMSS----VIGIFITPWLV.------------------SLV.V...........G.TG......
C4UDI4_YERAL/10-319-------VA-AAICSASASS----ILGVFLSPLLV.------------------GML.M...........Q.TQ......
Q0KE25_CUPNH/16-328-------VS-GAIFNATISG----LIGMLVTPLLM.------------------GLV.I...........S.AS......
Q6FU65_CANGA/32-393-------DL-LCVCEVFIGN----LLGAFITPALS.------------------QLY.TDRAPFEYGNPAN.GN......
D0Z7X4_EDWTE/10-319-------VA-AAICSASASS----MLGVFLSPLLV.------------------GLL.M...........H.TQ......
A3RYL9_RALSL/10-322-------VP-AAIFNATISG----LIGMVATPLLM.------------------SFV.I...........Q.AS......
B2Q2V9_PROST/10-320-------VA-AAICSASASS----ILGVFLSPILV.------------------GLL.M...........D.ED......
Q7N4G4_PHOLL/10-320-------VA-AAICSASASS----ILGVFLSPILV.------------------GLM.I...........H.TQ......
C8NCW5_9GAMM/45-353-------VA-AAICSAATSS----LLGVFLSPLLV.------------------GLL.L.............SA......
C9Y8T0_9BURK/9-319-------VA-AAVCSASASS----LIGVFVTPLLV.------------------SWF.V..........VP.GG......
C5DX01_ZYGRC/23-385-------DL-LCTCEVFIGN----ILGAFVTPGII.------------------QLF.T...........D.SALFKFG.
A9IQT5_BORPD/10-319-------VP-AAVCSASASS----LLGIFLTPLLV.------------------GTV.V...........AASA......
Q988D7_RHILO/21-330-------VP-AAICSASASN----IFGMFLTPLLV.------------------GLL.F...........S.IG......
Q2K4B0_RHIEC/7-316-------VP-AAICSASASN----IFGMFLTPLLV.------------------GLL.F...........S.VG......
Q2NSZ3_SODGM/10-322-------VA-AAICSASASS----ILGVFLSPVLV.------------------RLL.MY........TQE.GG......
B9JA81_AGRRK/7-318-------VP-AAICSASASN----IFGMFLTPLLV.------------------GVL.FS.........VG.GQ......
A6UD14_SINMW/7-316-------VP-AAVCAASASN----IFGVFLTPLLV.------------------GVI.F..........SA.GG......
B0VBX5_ACIBY/10-320-------VA-GAVCSASFSN----LVGMFITPVLV.------------------SFFIL...........G.QS......
C6W4P5_DYAFD/14-325-------IP-AAIFNASISS----LIGVFITPLWM.------------------GLV.L...........D.AG......
A5VE28_SPHWW/9-318-------VA-AALCAASLSN----FLGVFISPLLV.------------------GWL.L...........Q.TS......
B4WAZ9_9CAUL/9-317-------VP-AALCAASVSN----LAGVVITPLLV.------------------MLL.L...........P.VG......
D2TZF8_9ENTR/10-320-------IA-AAICSASASS----LLGVFLSPILV.------------------SIL.I...........D.ID......
D0J170_COMT2/9-318-------VP-AAVCSASAST----LLGILVTPILV.------------------SLI.L...........H.KN......
B2IHJ5_BEII9/11-319-------VP-AALCSASASS----FFGIFLTPALV.------------------SLL.L...........S.SK......
A3XPQ3_LEEBM/6-318-------IP-AAIFNASISG----IIGIVITPLWM.------------------GLF.I...........D.DM......
A3I1U6_9BACT/15-326-------LP-GAIFNASISS----LIGVVLTPAWM.------------------GLL.N...........D.SG......
B5JCP6_9BACT/12-331-------SS-AALFSTTLSN----VLGIFITPLLCA------------------QFL.A...........A.SS......
B4WXN7_9GAMM/9-320-------VP-AAVCSAAASN----VFGMMLTPFLL.------------------MLM.V...........SASG......
C0XTF9_9CORY/7-316-------VS-GAVVAASVSS----LVGVIATPLLV.------------------MLL.M...........GTGE......
Q0V4P5_PHANO/88-416-------TA-LTVVQSVIGQ----FLCPFLTPIIL.------------------QMY.L...........S.SGAW....
A3SE09_9RHOB/10-318-------VP-AAICAASVSN----LIGVILTPVLV.------------------TLL.L...........H.QG......
B2WB77_PYRTR/69-400-------AA-LTVVQSVIGQ----FLCPFLTPVIL.------------------QMW.L...........A.TGPWYGEV
D0WMS3_9ACTO/21-327-------VA-AAVCSATISN----ILGMFVTPLLV.------------------LLA.L.....................
B7G617_PHATC/64-378-------EA-AAIFNAAFGN----LIGVFLSPVLI.------------------LGY.L...........G.V.......
A9USA8_MONBE/8-323-------EA-AAIFNSALGS----FLGIFATPALL.------------------MLT.I.............GA......
A5P8F8_9SPHN/9-317-------VG-LSVISAALLN----ILGVFVSVPIF.------------------LLL.G...........G.TG......
A4S2B1_OSTLU/55-379-------VE-AALLNSMAAN----LAGIFLTPALI.------------------HFY.L.............GA......
C5BV46_BEUC1/9-317-------VA-GAICGATLSN----VLGMLLTPALV.------------------LLI.M...........G.RT......
C1MQW6_MICPC/113-439-------VS-LAVFHAVFGN----LAGIVATPALL.------------------FLY.L...........G.GGGGGG..
B7G616_PHATC/92-406-------EA-AAIFNSTFGN----IIGIFLSPVLI.------------------LAY.L.............GA......
Q2NAY2_ERYLH/10-318-------VA-LSVIGAALIN----IAGVFITAPLF.------------------GVL.............G.GG......
Q1GQQ6_SPHAL/56-363-------VA-ASVVAAALLN----LVGVALSPLLF.------------------ALL.A.............GS......
B8LLL0_PICSI/96-415-------SA-LALSLTVASN----LLGIVTVPFMLS------------------KLV.A...........Q.GV......
A7RRB9_NEMVE/42-385-------ST-LALMTTIICN----IMAVFIVPPMM.------------------KWL.M...........S.VQ......
E6VTY4_DESAO/16-319-------PL-TAVILLVSLN----LIGIATIPANI.------------------ALW.V...........G..G......
C0Q8Q9_DESAH/8-317-------MA-HALFTTILSN----CLAVVSIPLVL.------------------PLL.LIP.......LHL.EA......
Q4DG32_TRYCC/64-405-------EA-LSQYLSAVGI----VCGVIASPLLM.------------------LAC.ML........FSY.SS......

PF01758

ARSB_BACSU/49-246-------TE.YAAGLVAFNS...IFQMLFFSVYAY-------------------IFV-T-------------VI------
O49665_ARATH/179-364-------LAPLSIVMTSLST....ATAVLVTPMLS-------------------LLL-I-------------GK------
O29775_ARCFU/75-273-------RE.LAVGLVAFNA...IFQILFYAVYIY-------------------IFI-T-------------FA------
ARR3_YEAST/78-276-------ND.LCVVLVITNS...LLQMVLYAPLQI-------------------FYC-Y-------------VI------
O81017_ARATH/71-248-------VA.LSVLMTTCST....IGAIIMTPLLT-------------------KLL-A-------------GQ------
NTCP2_CRIGR/39-220-------MD.LSVSMTTCST....LLALGMMPLCL-------------------FIY-T-------------KM------
P71942_MYCTU/62-259-------RE.AAAVLVALNS...IFQVAMFAALGW-------------------FYL-S-------------VL------
Y944_SYNY3/61-268-------QG.LTLVMVAVNS...LAMLFLYAPLGK-------------------WLL-A-------------AS------
O58554_PYRHO/48-238-------LE.LATIVVALS.....FTLAIVTVPGW-------------------LKV-F-------------AS------
O86662_STRCO/51-247-------QP.TMVGLVLASTLLSPLTTPVLLATLS-------------------PLL-S-------------GG------
O26986_METTH/62-259-------RE.YAAGLVAFNS...LFQVFFYSIYAW-------------------VFI-T-------------LL------
YOCS_BACSU/41-221-------TA.LSVAVTTIST....LLAPVVTPLLI-------------------MLF-A-------------KE------
P73938_SYNY3/12-198-------VA.LSITLTAISSLVTIITIPLVVNLAA-------------------NYF-M-------------GE------
P3_HUMAN/197-381-------VT.LAISMTFLST....VAATGFLPLSS-------------------AIY-S-------------RL------
O58645_PYRHO/46-238-------FQ.LTLVGVMWTF....LLSIFVMPFYA-------------------KLI-L-------------HT------
NTCP_HUMAN/32-214-------MN.LSIVMTTCST....FCALGMMPLLL-------------------YIY-S-------------RG------
O67889_AQUAE/32-212-------LS.YSISMTTTST....LLSPLFTPLWT-------------------YVL-A-------------GK------

PF03547

Q98L58_RHILO/3-308........SGFEVLSLLVSV----HLPVMMMASIVL..................FEM-F-----------GRGG------
O67397_AQUAE/2-289..........EGLKYAILYD----QLGSFLMVITLG.....................-.-----------....------
ECM3_YEAST/12-596.FIFTEAEGEKGVANVIIFL----AMFLICVFNLGGFRLIENDFHYKGDDDEENTLT-N-----------DDSA------
PIN1_ORYSJ/9-590..........FSGSLMVQIV----VLQCIIWYTLML..................FMF-E-----------YRGA------
Y1382_METTH/5-299..........EGLVRAIFYD----TGTTLMFTSLGL..................LLS-H-----------ISGG------
PIN5_ARATH/9-362..........EAASILEQIV----VLQSLIWYTILL..................FLF-E-----------LNAA------
Q97M34_CLOAB/2-296..........KGVLYTSIFN----LVYNVFIWTIGI..................VII-N-----------DKRE------
YFDV_SHIFL/4-307.......SVSTGLVVAIISI----IVNAITIPIGLY..................LLN-P-----------SSGA------
PIN6_ARATH/9-565..........YTQTLMVQLV----VLQCIIWYTLLL..................FLF-E-----------LRAA------
YWKB_BACSU/5-315..........NEVAIPIAVT----GIVVNAILDPLA..................III-A-----------TVGE------
Q9FVF6_9ROSI/9-609..........YSGSLMVQVV----VLQCIIWYTLML..................FMF-E-----------YRGA------
Y1031_METJA/2-303..........EGLARAIFCD----LGGVFATMLLGT..................YVG-I-----------RFGK------
PINI_ARATH/9-617..........FSGDLMVQIV----VLQCIIWYTLML..................FLF-E-----------YRGA------
YB8B_YEAST/13-413PNDNRDNVASRGILYLLIFQ----QIGQMLRWSWGY..................NKL-M-----------KWSG------
Q9C999_ARATH/18-441TNPFGPNCNSRGVSYVSFAQ----WVAVILVYTVVY..................HMM-E-----------PPLE------
Q9WYQ5_THEMA/4-288..........EALSLGVVYA----TLNIIMFSAVLP..................MFL-G-----------EK..------
Q9C9K4_ARATH/9-407PFGDSESCEKYGMGYVTLSM----T..AFFISVYKHDTNWYVSGGNGLLMDLYINLM-R-----------....------
Q48797_OENOE/6-311..........KSMPYFLIYY----VMNTISTWAIGI..................FFI-S-----------SDDP------
PIN7_ARATH/9-614..........YSGSLMVQIV----VLQCIIWYTLLL..................FLF-E-----------YRGA------
Q9LZN2_ARATH/30-423PFGDSEKCSIDGTAYISFGQ----WVGAIILYTYVY..................QMF-A-----------PPPE------
Q9SHL8_ARATH/9-388PFGNRSVCRTVGLSYASFSM----ALGGFYIWTYTF..................RLI-K-----------GSAM------
PIN4_ARATH/9-611..........YAGSLMVQVV----VLQCIIWYTLLL..................FLF-E-----------YRGA------
YDQ4_SCHPO/18-440PDDTPDKVASRGIMYLLIFS----QLGQALRWSYGY..................RIL-L-----------SPNQ------
P71425_KLEPN/4-313.........GASTSLSVAVS----IACGSVLMTPFC..................LLI-L-----------EREK------
Q9FKY4_ARATH/9-387PFGNRSVCRSIGLSYASFSM----ALGGFYIWTYSY..................QLV-R-----------SSAT------

PF03977

Q9KUH0_VIBCH/17-376----------IAVAAYSYMA----LVPIIQPPIMK-------------------ALT-T-----------PEER------
O59022_PYRHO/20-400----------TAVAAYSYMS----LVPLIQPPVIK-------------------ALT-T-----------PEER------
O28195_ARCFU/1-354----------TAVAAYSYMS----LVPIIQPPIIK-------------------ALT-S-----------SRER------
OADB_PASMU/17-431----------IAVAAYSYMA----LVPLIQPPIMR-------------------ALT-T-----------QAER------
OADB_VIBCH/17-432----------IAVAAYSYMA----LVPMIQPPIMR-------------------ALT-T-----------QEER------
O83096_TREPA/89-468----------IAVAAYSYMA----LVPIIQPPLMR-------------------LLT-T-----------RKER------
Q99ZL5_STRP1/18-376----------IALAAYSYMA----LVPIIQPPIIK-------------------LLT-T-----------KAER------
Q99ZL0_STRP1/12-373----------ITVAAYSYMA----LVPIIQPFAIK-------------------LVT-T-----------KKER------
Q9WZY2_THEMA/30-384----------IAISAYSYIA----LIPILQPVVSR-------------------ILV-S-----------KEER------

PF06965

NHAA1_PSEPK/11-387VLAL----LGKRVPVSLKLF----LMTLAIIDDLG-------------------A---I---------------------
NHAA_BRUSU/14-384VLSL----LGSRAPSSLKVF----LATLAILDDLA-------------------A---V---------------------
NHAA_CAUCR/11-381VLSL----LGSRVPTSLKIF----LATLAIVDDLV-------------------A---V---------------------
NHAA2_PSESM/16-384VLSL----LGNRVPTSLKVF----LAALAILDDLG-------------------A---V---------------------
NHAA_HELPY/14-427VIML----LGKRVPTALKVF----LITLAVADDLG-------------------A---I---------------------
NHAA_SHEON/5-380IMAL----LGSRVPVALKVF----LLALAIIDDLG-------------------V---I---------------------
NHAA1_PSESM/17-385VLSL----LGKRVPLSLKIF----LSALAILDDLG-------------------A---V---------------------
NHAA2_VIBVU/27-435CLAL----LGRSIPSSLRIF----MLSMAVVDDIG-------------------A---I---------------------
NHAA_HAEIN/17-393IMAL----LSKQVPLPLKIF----LLALAIIDDLG-------------------A---I---------------------
NHAA_RHILO/12-384VLSL----LGSRVPASLKVF----LTALAIIDDLG-------------------A---V---------------------
NHAA_WIGBR/8-385VLKI----LGHSIPHSLLIF----LLSLAIFDDIG-------------------A---I---------------------
NHAA2_STRCO/26-428VLAV----FGSRLPASLRAF----LLSVSVVDDLV-------------------A---L---------------------
NHAA_VIBCH/5-373IMAL----LGKRVPVSLKVF----LLALAIIDDLG-------------------V---V---------------------
NHAA_RHIME/20-428CLAL----LGSRVPGSLRLF----LLSLAIFDDIG-------------------A---I---------------------
NHAA_ECOLI/4-380VLAL----LGSRVPLALKIF----LMALAIIDDLG-------------------A---I---------------------
NHAA_STRAT/25-401VLAV----IGTSLPSALRAF----LLTLAVVDDLF-------------------A---I---------------------
Q93DN6_9BACT/17-388ILMM----FGKSVPASAKIL----LLAIAIFDDLG-------------------A---I---------------------

PF00999

YDO6_SCHPO/39-445IF......NSYKVDQKLYTI----IFGESILNDAV-------------------A---I---------------------
KEA4_ARATH/173-543FLM.....ERNSISALHGQI----TVGTLILQDCA-------------------V---G---------------------
KEA5_ARATH/158-528FLV.....ERNSTSSLHGQV----TIGILIFQDCV-------------------V---G---------------------
KEA3_ARATH/109-496LLA.....EKGELPTRFGSA----TLGILLLQDIA-------------------V---V---------------------
SL9A3_HUMAN/58-462VF......EEVHVNEVLFII----VFGESLLNDAV-------------------T---V---------------------
Q83E71_COXBU/27-390LLP.....TTILHHQHTGEV----MISVLLLQDLI-------------------A---I---------------------
Q9Y959_AERPE/11-361LLS.....SYRLVRSRLGQL----ALASAMLLDLS-------------------G---M---------------------
Q8XPZ0_RALSO/11-388ALE.....DRGIEGSHEGHI----AVGWLIVEDLV-------------------M---V---------------------
CVRA_ECOLI/10-389LL......GGKGLNERVGST----LEIESGSNDPM-------------------A---V---------------------
Q93N84_STRLA/15-400IVR.....ERGMAGTSTGTV----ATTAAGVMDVA-------------------A---W---------------------
Q8XLS1_CLOPE/11-387ILK.....TKHIINSSYGQT----LLVFGIITQLV-------------------S---L---------------------
O25795_HELPY/9-377LVK.....DYRK.EILWLDL----VLKVGVIGELL-------------------S---I---------------------
NAH1_METJA/7-393VF......SRVRTNPEVAIT----LEAESIFNDPL-------------------G---I---------------------
CHX14_ARATH/58-442VLA.....ELNILNSDLGRL----ATNCSIVCEAF-------------------S---W---------------------
Q45308_BACME/8-377VLK.....DMNRLNSREGST----ILGAAVVDDVL-------------------V---V---------------------
NHX3_CAEEL/44-444IF......EEIHVNEFLFIN----VFGEALFNDGV-------------------T---V---------------------
P74393_SYNY3/33-411AF......RSVPVPRRLATI----VEGESMLNDGV-------------------A---M---------------------
YJCE_ECOLI/3-422IV......GEGRIPKKIMGI----LQGEALMNDAS-------------------G---L---------------------
O66731_AQUAE/13-381TLK.....DMSVLEEPFAKK----VLLIGVFGEII-------------------S---L---------------------
Q98GP4_RHILO/11-397ALQ.....ERRLIETERGRI----AVGWLIVEDLA-------------------M---V---------------------
SL9A6_HUMAN/78-503IF......HELQVDVELYAL----LFGESVLNDAV-------------------A---I---------------------
Q8S5V1_ORYSJ/176-496FLV.....EKGSTNALHGQV----TIGTLILQAAC-------------------I---I---------------------
Q99V81_STAAM/7-388TLK.....EMNIMRTTIGQF----ILLVAVLADLV-------------------T---M---------------------
Q9Z9H1_PSEAI/31-448I.......TQGRLPKRLMHL----LEGEALMNDAS-------------------G---L---------------------
Q9XBC3_AMYOR/14-390ILQ.....DRGMLRTMLGGL----ALTCAAIGDVL-------------------A---W---------------------
SL9A7_HUMAN/114-534IF......NELHADVDLYAL----LFGESVLNDAV-------------------A---I---------------------
CHX13_ARATH/60-447VLA.....ELNILNSELGRL----ATHCSMVCEVC-------------------S---W---------------------
Q894B2_CLOTE/11-387FLK.....ERDLLNTEYGQI----ILIFNLIAEFI-------------------C---L---------------------
O29023_ARCFU/4-337MLV.....DDRKLVFTFAEV----VVLLMVFEDIV-------------------L---V---------------------
Q8PQR8_XANAC/12-399ILK.....DRNMTRTPAGRL----ALGAAVIDDAT-------------------V---W---------------------
O30022_ARCFU/11-366VLR.....EIGLEKEDFGQL----NIVTALVSDFS-------------------T---M---------------------
Q81V05_BACAN/11-386TLK.....ENNLGKTAIGQI----ILLVAVIADLV-------------------T---M---------------------
NHEB_ONCMY/73-472VF......EEIHINELVHIL----VFGESLLNDAV-------------------T---V---------------------
Q87RG9_VIBPA/2-353TLQ.....EKGELNATYATL----AIGILVMQDIF-------------------A---V---------------------
Q8EIY2_SHEON/2-355VLE.....DKGDMQSLYGRV----AIGILIMQDIF-------------------A---V---------------------
Q9RV80_DEIRA/10-368ILS.....DLGRLGNRETPI----ILAVCVIEDVV-------------------M---A---------------------
NAH1_YEAST/17-440VVSG...KFAQRVPGHLRNL----LSAESGCNDGM-------------------A---F---------------------
O58040_PYRHO/8-379ILM.....EMKKLRTKVGTT----ILAAAIVDDVL-------------------G---I---------------------
SL9A1_HUMAN/105-505VF......EEIHINELLHIL----VFGESLLNDAV-------------------T---V---------------------
O29412_ARCFU/6-377TF......KSISAPKKLSIL----IEGESVLNDGA-------------------A---I---------------------
Q9L191_STRCO/11-375ILI.....DLGRIGRPETRL----ILGVIVVEDIF-------------------L---A---------------------
NAH2_SCHPO/16-437IVGK..GKFARRVPGHLRNM----LLAESGCNDGM-------------------A---I---------------------
NHX7_ARATH/37-450LLK.....ELGA.SKKLSTI----IEGESLMNDGT-------------------A---I---------------------
YJBQ_BACSU/10-389TLK.....EERIMNSNIGQI----ILLVAVIADLA-------------------T---M---------------------
NAPA_ENTHR/8-379VLK.....ELNVVNTKEGST----ILGASVVDDIL-------------------V---V---------------------
Q48731_9LACT/8-376VLQ.....EYGKLSTRAGSI----ILGAAVVDDIL-------------------A---V---------------------
Q93JF3_STRCO/15-406IVR.....ENGLSRTVPGVV----AVSAAGVLDAI-------------------C---W---------------------
TMCO3_MOUSE/274-662FLVGSARGDKEAGDIDYSTV----LLGMLVMQDVQ-------------------L---G---------------------
Q09432_CAEEL/35-439IF......EELKVNEVLFIA----VFGESLLNDGV-------------------A---V---------------------
NAH_SCHPO/16-434IVGE..GPLAKKTPERIRSL----LIAESGCNDGM-------------------A---V---------------------
Q9KTB1_VIBCH/2-353SLQ.....EKGEMNATYGTL----AIGILVMQDIF-------------------A---V---------------------
Q23706_CARMA/81-483VF......EEMQVEEVLFIL----VFGESLLNDGV-------------------T---V---------------------
Q9X8F2_STRCO/12-382MLR.....DSGELRGRFGTV----ISAFGAVGEFG-------------------P---V---------------------
NAH2_METJA/7-395IF......SSMDIDPEVAIT----LEAESVFNDPL-------------------G---I---------------------
Q8PYD4_METMA/9-374VFQ.....DKNEVDTPHGKT----SLAILIFQDLA-------------------I---V---------------------
SL9A2_RAT/85-486VF......ENIHVNEQLYIL----VFGESLLNDAV-------------------T---V---------------------
O67072_AQUAE/23-407VLT.....DLNKHKERFAQI----VLGAAVLDDIM-------------------G---V---------------------
Q8KHN6_NOCAE/16-400ILA.....DFRADQSFLGTL----ALMAAAVGDAL-------------------A---W---------------------
Y2309_MYCBO/17-417LAK........RLPRRALTV----LRGESLINDGT-------------------A---L---------------------
O82871_PSEAI/9-410IL......KSAGAPKPLATT----IVGESLFNDGT-------------------A---V---------------------
P73863_SYNY3/19-406LF......KELGASKKLNTL----MEGESLFNDGV-------------------A---V---------------------
O58682_PYRHO/8-388VLV.....R.ERVKKDISSV----LMGAAFADDII-------------------A---V---------------------
Q8PVQ3_METMA/9-375VLQ.....DRNEVYTPHGKT----SLAILIFQDLA-------------------I---V---------------------
CHX23_ARATH/59-444ILA.....DLKLLRSDMGRT----AMCAAIVTDLC-------------------T---W---------------------
Q55736_SYNY3/17-390IVQ.....RLGIVRNQAVMV----TIGATIFTDIA-------------------A---L---------------------
KEFX_HAEIN/13-387SLE.....ERGLTSTSKGQR----VISTLIFEDIA-------------------I---V---------------------
Q97BQ9_THEVO/10-379LLM.....RYDLLKLNAGRL----ILSSVVLTDTS-------------------A---F---------------------
O26854_METTH/5-391QMLSF.IERRMGTAKGIPTI----ILTGASVDDVV-------------------S---I---------------------
Q8KLM5_STRTO/6-396IIA.....ENGMQRTRIGAM----ALACAVVQDFL-------------------A---W---------------------
NAH1_ZYGRO/16-438VVSG...TFAQKVPGHLRNL----LSCESGCNDGL-------------------A---F---------------------
NHAK_BACSU/3-415LS......GRVKMPKGILRL----LEGEGLMNDAS-------------------G---L---------------------
Q55190_SYNY3/65-446VLA.....EINRLSSNEGQI----IIGAAVLDDIL-------------------G---I---------------------
Q55388_SYNY3/8-396LI......KQVQVQKSVATL----LEGEGVLIDPV-------------------G---A---------------------
NAH3_METJA/8-380ILE.....ELKMVKTRLGTI----ILSATIIVDLF-------------------T---L---------------------
Q93KW8_STRVR/66-455LLM.....ERGMLQSRAGTY----AIVGAATADLA-------------------C---W---------------------
Q8GRF9_9PROT/12-375VLE.....SSDELDTPVGRT----TLGILIAQDMA-------------------V---V---------------------
SL9A4_RAT/73-477VF......EEARVNEQLYMM----IFGEALLNDGI-------------------S---V---------------------
Q815T7_BACCR/11-379VLV.....DLRRTGNNETEL----ILGIIMFEDIF-------------------L---A---------------------
Q9PBK4_XYLFA/11-395ALE.....ERRLIDTQRGRI----AVGWLIVEDLV-------------------M---V---------------------
SL9A5_RAT/52-457VF......EEVHVNETLFII----VFGESLLNDAV-------------------T---A---------------------

PF03956

Q8U272_PYRFU/7-192--------------------------------------------------------------------------------
Q5JE53_PYRKO/7-192--------------------------------------------------------------------------------
Q0W307_UNCMA/5-198--------------------------------------------------------------------------------
Q3A9X2_CARHZ/110-301--------------------------------------------------------------------------------
Q6D3T3_ERWCT/111-299--------------------------------------------------------------------------------
Q65TG5_MANSM/110-298--------------------------------------------------------------------------------
A0Q670_FRATN/117-306--------------------------------------------------------------------------------
Q8ZX41_PYRAE/114-291--------------------------------------------------------------------------------
Q5LD53_BACFN/7-205--------------------------------------------------------------------------------
Q0I3G0_HAES1/111-299--------------------------------------------------------------------------------
Q30YZ4_DESDG/7-199--------------------------------------------------------------------------------
A7HMA4_FERNB/6-189--------------------------------------------------------------------------------
Q1MPD6_LAWIP/7-198--------------------------------------------------------------------------------
Q9CNG6_PASMU/111-299--------------------------------------------------------------------------------
Q7P6I1_FUSNV/4-194--------------------------------------------------------------------------------
A1EJA4_VIBCL/110-298--------------------------------------------------------------------------------
A9KSU8_CLOPH/5-197--------------------------------------------------------------------------------
A1ISW6_NEIMA/109-298--------------------------------------------------------------------------------
A4YEP1_METS5/91-281--------------------------------------------------------------------------------
Q9UYY3_PYRAB/7-192--------------------------------------------------------------------------------
B8G2D2_DESHD/116-308--------------------------------------------------------------------------------
A0KIW8_AERHH/111-299--------------------------------------------------------------------------------
Y1452_HAEIN/4-192--------------------------------------------------------------------------------
A1RUU6_PYRIL/96-273--------------------------------------------------------------------------------
A1VEH4_DESVV/7-199--------------------------------------------------------------------------------
Q64PG3_BACFR/7-199--------------------------------------------------------------------------------
A4J6Y5_DESRM/5-197--------------------------------------------------------------------------------
A4FXI0_METM5/7-192--------------------------------------------------------------------------------
Q1QZ23_CHRSD/114-307--------------------------------------------------------------------------------
Q7MLI3_VIBVY/110-298--------------------------------------------------------------------------------
O58406_PYRHO/12-197--------------------------------------------------------------------------------
Q1QD72_PSYCK/112-301--------------------------------------------------------------------------------
Q1Z0Y8_PHOPR/110-298--------------------------------------------------------------------------------
A1U6W6_MARAV/112-300--------------------------------------------------------------------------------
Q96XQ5_SULTO/108-295--------------------------------------------------------------------------------
Q9YBX3_AERPE/117-302--------------------------------------------------------------------------------
A6VPB6_ACTSZ/111-299--------------------------------------------------------------------------------
A1RZA2_THEPD/99-286--------------------------------------------------------------------------------
A6VTK0_MARMS/114-302--------------------------------------------------------------------------------
Q2NU01_SODGM/130-310--------------------------------------------------------------------------------
A5WGW5_PSYWF/135-324--------------------------------------------------------------------------------
A8MGH5_ALKOO/5-196--------------------------------------------------------------------------------
A4W8P2_ENT38/111-299--------------------------------------------------------------------------------

PF06826

Y1229_BACTN/19-182--------------------------------------------------------------------------------
O52005_HALSA/14-174--------------------------------------------------------------------------------
O52005_HALSA/209-380--------------------------------------------------------------------------------
Y590_CORGL/12-174--------------------------------------------------------------------------------
Y2211_CORGL/11-179--------------------------------------------------------------------------------
YBJL_ECOLI/16-183--------------------------------------------------------------------------------
Y3475_BRAJA/16-184--------------------------------------------------------------------------------
Y2102_COREF/11-180--------------------------------------------------------------------------------
Y595_COREF/356-528--------------------------------------------------------------------------------
Y3476_BRAJA/394-564--------------------------------------------------------------------------------
Y736_BACTN/15-179--------------------------------------------------------------------------------
YBJL_ECOLI/385-555--------------------------------------------------------------------------------
Y4083_YERPE/10-180--------------------------------------------------------------------------------
Y035_HAEIN/372-546--------------------------------------------------------------------------------
Y2102_COREF/367-539--------------------------------------------------------------------------------
Y3471_BRAJA/387-557--------------------------------------------------------------------------------
Y595_COREF/12-171--------------------------------------------------------------------------------
Y2092_BACTN/378-551--------------------------------------------------------------------------------
Y736_BACTN/392-562--------------------------------------------------------------------------------
ASPT_TETHA/367-540--------------------------------------------------------------------------------
Y3476_BRAJA/20-187--------------------------------------------------------------------------------
Y035_HAEIN/10-179--------------------------------------------------------------------------------
Q8RDQ8_FUSNN/294-465--------------------------------------------------------------------------------
Y2092_BACTN/20-185--------------------------------------------------------------------------------
Y2143_SHEON/15-183--------------------------------------------------------------------------------
Y500_BACTN/12-166--------------------------------------------------------------------------------
YIDE_SHIFL/10-180--------------------------------------------------------------------------------
Y1229_BACTN/378-551--------------------------------------------------------------------------------
Y1232_VIBPA/388-558--------------------------------------------------------------------------------
Y500_BACTN/358-529--------------------------------------------------------------------------------
ASPT_TETHA/15-183--------------------------------------------------------------------------------
Y3471_BRAJA/15-183--------------------------------------------------------------------------------
YIDE_SHIFL/373-547--------------------------------------------------------------------------------
Y2143_SHEON/389-559--------------------------------------------------------------------------------

PF05982

Q8EAY3_SHEON/4-319IA------MVEKSGMTLRPE----TTLYLVLLELP-------------------A---I---------------------
Q9K663_BACHD/12-337VS------FLEKSGTTYEGF----MNAMVVLKESP-------------------A---I---------------------
Q8YV47_NOSS1/18-370LT------LLEEQKIQYEAW----AAALYPFMDIP-------------------A---L---------------------
P71757_MYCTU/16-407VA------VLTSVGMAFDAY----MPVMLAVMEIP-------------------G---C---------------------
Q8YY66_NOSS1/13-322ST------FLSELGIAFDGY----MVAALALMESP-------------------A---I---------------------
Q9A2P7_CAUCR/49-365QS------YLSSIGQAPGGY----MSAVLALMETP-------------------G---L---------------------
P73953_SYNY3/18-374LT------TLEESKISYEAW----AGALYPFMDIP-------------------A---L---------------------

PF03812

KDGT_BACSU/1-314--------MNETNGGLYLAL----MNHMGRKEDAG-------------------A---F---------------------
KDGT_SHIFL/1-314--------MDMTNGGLYASI----MQQYGTKEEAG-------------------A---F---------------------
KDGT_PECCC/1-314--------MDMTNGGLYAAL----MNQYGSKEEAG-------------------A---F---------------------

PF05684

Q9FLW1_ARATH/79-442NWKIAAALMGSYIGGSLNFV----AISEALQISPS-------------------V---I---------------------
YJCL_BACSU/15-395LDKIGGMISASYIGGGVNFA----AMAAKFETPGE-------------------Y---V---------------------
Q9LTG3_ARATH/95-460SWKIAAALMGRHIGGAVNYV----AISNALGVTPS-------------------V---L---------------------
Q8P790_XANCP/17-412TWAGMAALAGSWIGGGANML----AMREVFAVNAS-------------------T---F---------------------
Q9K8K1_BACHD/10-388TWRAFSALAGSWTGGSANMV----ALQDILAVPET-------------------I---F---------------------
Q8RIK4_FUSNN/11-392VWGAVAALYASWVGGSANMA----AMQAALPVDAG-------------------A---Y---------------------

PF03601

Y2225_RHILO/7-307RKLAQLIAAGTSICGASAIV----ATNIVTDARDE-------------------D...V---------------------
YDHF_LACLA/5-311ANVSALMASGNAVCGSSAIA----AVEPVIGAETS-------------------E...K---------------------
Y5383_PSEAE/21-335RTTTLLIGAGSSICGAAAVM----ATEPVVRGRAE-------------------Q...V---------------------
Y1621_ARCFU/22-308RQMSILLACGSGICGVSAIA----IISPLIKPRKE-------------------E...F---------------------
Y2119_MYCPA/67-384GKLGSLLAIGTSICGVSAIV----AAKGAIRARNS-------------------D...V---------------------
Y1056_STRP1/9-318VNTATLVGVGSSICGGSAVA----ATAPVIKAKDD-------------------E...V---------------------
Y425_CAUCR/147-446LAEALIAAAACSICGASAAL----AASQAAPSSPE-------------------NQRTT---------------------
Y1461_PASMU/8-314KQIVYLTAGGCSICGAAAIM----SMQPVTKAESH-------------------H...V---------------------
Y034_STRPN/9-315TKLATLVGVGSSICGGSAIA----ATAPVIDAKEK-------------------E...V---------------------
Y341_STAAM/11-311KNIALLLGVGTGVCGAAAIA----AVAPIFKSREK-------------------D...T---------------------
Y1643_HAEIN/8-316KQLVYLTGAGCSICGAAAVM----AAEPVTKAESH-------------------K...V---------------------
YEIH_SHIFL/18-326KHTSWLIGAGSSICGAAAVL----ATEPVVKAEAS-------------------K...V---------------------
Y999_CAMJE/18-342KETSMLVGAGSAICGAAAVL----ALESSLKSDPF-------------------K...G---------------------

PF03616

Q9HZ58_PSEAE/4-371PLLGIMAGAVSLEGGFGAAA----AFGPVAEGL..-------------------G---A---------------------
O26036_HELPY/4-373PLMGLLGGSIALVGGHGTSA----AWANFFTQPPY-------------------N---F---------------------
Q9KNC4_VIBCH/5-376PLLGLIAGSITLSGGHGTGA----AWANTFAEN.Y-------------------G---L---------------------
Q9S458_SALTM/1-366PFIGLIAGSITLTGGHGNAG----AWGPILADK.Y-------------------G---V---------------------
GLTS_HAEIN/3-369PAYGLLAGSVTLTGGHGTGA----AWADTFAHQ.F-------------------N---L---------------------
GLTS_SHIFL/2-366PLMGLLAGSITLSGGHGTGA----AWSKLFIER.Y-------------------G---F---------------------
Q99RS8_STAAM/2-370PLLGLTAGSMSMEGGHGNAA----AYGKTIQDL..-------------------G---I---------------------
P73275_SYNY3/4-370LPVGLLSGSISLSGGHGTAI----AWSPVFYDN.H-------------------G---I---------------------

PF13593

C5DGV7_LACTC/27-386.........SVSHL-...--------------------------------------------------------------
Q6CIF6_KLULA/49-408...NPATDTSVQQL-...--------------------------------------------------------------
B3LLT3_YEAS1/23-385.........GIGAL-...--------------------------------------------------------------
Q6BPS9_DEBHA/26-388T.HQSSGDTTIQDL-...--------------------------------------------------------------
B9WFB0_CANDC/25-387S.HQTDGDSTVQEL-...--------------------------------------------------------------
B7NPU5_ECO7I/8-316.........GAGGS-...--------------------------------------------------------------
A5DK55_PICGU/24-387THQGSGSSETIQQL-...--------------------------------------------------------------
A5E3X9_LODEL/29-391S.HQPSGENSIGDL-...--------------------------------------------------------------
A7MML9_CROS8/10-319.........QGETD-...--------------------------------------------------------------
C2M6P1_CAPGI/9-321.........SAEVD-...--------------------------------------------------------------
A0KES2_AERHH/4-313.........GEGVD-...--------------------------------------------------------------
B6Q6N8_PENMQ/44-391.........DMSQM-...--------------------------------------------------------------
Q4ZYQ4_PSEU2/13-325.........AGGID-...--------------------------------------------------------------
C4UDI4_YERAL/10-319.........GGDTD-...--------------------------------------------------------------
Q0KE25_CUPNH/16-328.........GASMP-...--------------------------------------------------------------
Q6FU65_CANGA/32-393.........SIGSL-...--------------------------------------------------------------
D0Z7X4_EDWTE/10-319.........GDNID-...--------------------------------------------------------------
A3RYL9_RALSL/10-322.........GAELP-...--------------------------------------------------------------
B2Q2V9_PROST/10-320........GSQAMD-...--------------------------------------------------------------
Q7N4G4_PHOLL/10-320........GEGSAD-...--------------------------------------------------------------
C8NCW5_9GAMM/45-353.........QGQTD-...--------------------------------------------------------------
C9Y8T0_9BURK/9-319.........LSGGS-...--------------------------------------------------------------
C5DX01_ZYGRC/23-385...NPANHSSVKDV-...--------------------------------------------------------------
A9IQT5_BORPD/10-319.........SAPIS-...--------------------------------------------------------------
Q988D7_RHILO/21-330........GHSGFS-...--------------------------------------------------------------
Q2K4B0_RHIEC/7-316.........GHGGY-...--------------------------------------------------------------
Q2NSZ3_SODGM/10-322.........AGGHD-...--------------------------------------------------------------
B9JA81_AGRRK/7-318.........GGGFS-...--------------------------------------------------------------
A6UD14_SINMW/7-316.........HGGVS-...--------------------------------------------------------------
B0VBX5_ACIBY/10-320.........QHGFD-...--------------------------------------------------------------
C6W4P5_DYAFD/14-325.........PGHFD-...--------------------------------------------------------------
A5VE28_SPHWW/9-318.........GVVLS-...--------------------------------------------------------------
B4WAZ9_9CAUL/9-317.........GAGVS-...--------------------------------------------------------------
D2TZF8_9ENTR/10-320........NHQQIN-...--------------------------------------------------------------
D0J170_COMT2/9-318.........AEGGD-...--------------------------------------------------------------
B2IHJ5_BEII9/11-319.........GVGLS-...--------------------------------------------------------------
A3XPQ3_LEEBM/6-318.........QTDFD-...--------------------------------------------------------------
A3I1U6_9BACT/15-326.........EISME-...--------------------------------------------------------------
B5JCP6_9BACT/12-331.........DAAPP-...--------------------------------------------------------------
B4WXN7_9GAMM/9-320.........DGAFD-...--------------------------------------------------------------
C0XTF9_9CORY/7-316.........GITID-...--------------------------------------------------------------
Q0V4P5_PHANO/88-416.......YSKV..L-IHG--------------------------------------------------------------
A3SE09_9RHOB/10-318.........DGGVS-...--------------------------------------------------------------
B2WB77_PYRTR/69-400L.SQRGGAAGYAGI-...--------------------------------------------------------------
D0WMS3_9ACTO/21-327.........DVGGA-...--------------------------------------------------------------
B7G617_PHATC/64-378.........TGDID-...--------------------------------------------------------------
A9USA8_MONBE/8-323.........SADMD-...--------------------------------------------------------------
A5P8F8_9SPHN/9-317.........EGAVG-...--------------------------------------------------------------
A4S2B1_OSTLU/55-379.........DSSVD-...--------------------------------------------------------------
C5BV46_BEUC1/9-317.........SGAAG-...--------------------------------------------------------------
C1MQW6_MICPC/113-439.....GGGGGAGVN-...--------------------------------------------------------------
B7G616_PHATC/92-406.........AGDIS-...--------------------------------------------------------------
Q2NAY2_ERYLH/10-318.........DIAST-...--------------------------------------------------------------
Q1GQQ6_SPHAL/56-363.........AAAIH-...--------------------------------------------------------------
B8LLL0_PICSI/96-415.........GVSVP-...--------------------------------------------------------------
A7RRB9_NEMVE/42-385.........GVQID-...--------------------------------------------------------------
E6VTY4_DESAO/16-319.........AAHVS-...--------------------------------------------------------------
C0Q8Q9_DESAH/8-317.........GITLD-...--------------------------------------------------------------
Q4DG32_TRYCC/64-405.........KFPVT-...--------------------------------------------------------------

PF01758

ARSB_BACSU/49-246---------PQWLGMEG.--------------------------------------------------------------
O49665_ARATH/179-364---------KLPVD....--------------------------------------------------------------
O29775_ARCFU/75-273---------LNALGLVEG--------------------------------------------------------------
ARR3_YEAST/78-276---------SHDHLNT..--------------------------------------------------------------
O81017_ARATH/71-248---------LVPVD....--------------------------------------------------------------
NTCP2_CRIGR/39-220---------WVDSG....--------------------------------------------------------------
P71942_MYCTU/62-259---------PGWLGLEQ.--------------------------------------------------------------
Y944_SYNY3/61-268---------NLTVP....--------------------------------------------------------------
O58554_PYRHO/48-238---------SYHVA....--------------------------------------------------------------
O86662_STRCO/51-247---------YAHTL....--------------------------------------------------------------
O26986_METTH/62-259---------PPLFGVQG.--------------------------------------------------------------
YOCS_BACSU/41-221---------WLPVS....--------------------------------------------------------------
P73938_SYNY3/12-198---------QFALQ....--------------------------------------------------------------
P3_HUMAN/197-381---------LSIHE....--------------------------------------------------------------
O58645_PYRHO/46-238---------IIQVP....--------------------------------------------------------------
NTCP_HUMAN/32-214---------IYDGDL...--------------------------------------------------------------
O67889_AQUAE/32-212---------YVEVP....--------------------------------------------------------------

PF03547

Q98L58_RHILO/3-308---------GEHV...................................................................
O67397_AQUAE/2-289---------.......................................................................
ECM3_YEAST/12-596---------QQPTQPIEGNSSSSSNQDILKEPNESTVPNSSQASYISEKNKKEKTELSVPKPTHTAPPAIDDRSSNSSAV
PIN1_ORYSJ/9-590---------RMLITEQFP.DTAANIASIVVDPDVVSLDGRRDAIETETEVKEDGRIHVTVRRSNASRSDIYS.....RRS
Y1382_METTH/5-299---------EGSR...................................................................
PIN5_ARATH/9-362---------RALPSSGASLEHTGN........................................................
Q97M34_CLOAB/2-296---------KIDY...................................................................
YFDV_SHIFL/4-307---------DGKK...................................................................
PIN6_ARATH/9-565---------RLLIRAEFPGQAAGSIAKIQVDDDVISLDGMD.PLRTETETDVNGRIRLRIRRSVSSVPDSVMSSSLC...
YWKB_BACSU/5-315---------SSKKNEESGD.............................................................
Q9FVF6_9ROSI/9-609---------KLLISEQFP.DTAGSIVSIHVDSDIMSLDGRQ.PLETEAAIKEDGKLHVTVRKSNASRSDIFS.....RRS
Y1031_METJA/2-303---------GRDK...................................................................
PINI_ARATH/9-617---------KLLISEQFP.DTAGSIVSIHVDSDIMSLDGRQ.PLETEAEIKEDGKLHVTVRRSNASRSDIYS.....RRS
YB8B_YEAST/13-413---------ENTQHMPPSQVQSLLERTPNIDNEELVNEEQEEQELLEEENNRMNSSFLSSSSIGDKIWQKSCTVFER...
Q9C999_ARATH/18-441---------YYEVVEEEG.VEIEEINVENHDASRPLLVEAEWPGIEDKETEHCKTPFIARVFNSISSFSQTSFPEVDLGG
Q9WYQ5_THEMA/4-288---------.......................................................................
Q9C9K4_ARATH/9-407---------..VLSNSPVETHTHSIESNYDDSCKVQLISSK.......................................
Q48797_OENOE/6-311---------TRDKTEKQSFN............................................................
PIN7_ARATH/9-614---------KILIMEQFP.ETGASIVSFKVESDVVSLDGHD.FLETDAQIGDDGKLHVTVRKSNASRRSFYG........
Q9LZN2_ARATH/30-423---------GFDAEEENLALKTLPVDAAPEQVPLLTQNFPKDFSPTQDL...............................
Q9SHL8_ARATH/9-388---------KVQAIEESEKIAIKSSNSDLEADHKTHLLGAP.......................................
PIN4_ARATH/9-611---------KLLIMEQFP.ETGASIVSFKVESDVVSLDGHD.FLETDAEIGNDGKLHVTVRKSNASRRSLMM........
YDQ4_SCHPO/18-440---------PEDPLPIGNRSWSHSDVNEEEIQNLLASSANVDGVQNSVQANEGSTVQTDSSAISKNDNVQVETSNEEVGG
P71425_KLEPN/4-313---------ARAAGENSG..............................................................
Q9FKY4_ARATH/9-387---------QFRALEAAG..LVKSPNKDIDSDPHALLLKPH.......................................

PF03977

Q9KUH0_VIBCH/17-376---------KIKMA------------------------------------------------------------------
O59022_PYRHO/20-400---------KIRME------------------------------------------------------------------
O28195_ARCFU/1-354---------KIKMR------------------------------------------------------------------
OADB_PASMU/17-431---------KIKMV------------------------------------------------------------------
OADB_VIBCH/17-432---------KIQMQ------------------------------------------------------------------
O83096_TREPA/89-468---------LIRMK------------------------------------------------------------------
Q99ZL5_STRP1/18-376---------QVKMT------------------------------------------------------------------
Q99ZL0_STRP1/12-373---------RIRMT------------------------------------------------------------------
Q9WZY2_THEMA/30-384---------KIRMK------------------------------------------------------------------

PF06965

NHAA1_PSEPK/11-387--------------------------------------------------------------------------------
NHAA_BRUSU/14-384--------------------------------------------------------------------------------
NHAA_CAUCR/11-381--------------------------------------------------------------------------------
NHAA2_PSESM/16-384--------------------------------------------------------------------------------
NHAA_HELPY/14-427--------------------------------------------------------------------------------
NHAA_SHEON/5-380--------------------------------------------------------------------------------
NHAA1_PSESM/17-385--------------------------------------------------------------------------------
NHAA2_VIBVU/27-435--------------------------------------------------------------------------------
NHAA_HAEIN/17-393--------------------------------------------------------------------------------
NHAA_RHILO/12-384--------------------------------------------------------------------------------
NHAA_WIGBR/8-385--------------------------------------------------------------------------------
NHAA2_STRCO/26-428--------------------------------------------------------------------------------
NHAA_VIBCH/5-373--------------------------------------------------------------------------------
NHAA_RHIME/20-428--------------------------------------------------------------------------------
NHAA_ECOLI/4-380--------------------------------------------------------------------------------
NHAA_STRAT/25-401--------------------------------------------------------------------------------
Q93DN6_9BACT/17-388--------------------------------------------------------------------------------

PF00999

YDO6_SCHPO/39-445--------------------------------------------------------------------------------
KEA4_ARATH/173-543--------------------------------------------------------------------------------
KEA5_ARATH/158-528--------------------------------------------------------------------------------
KEA3_ARATH/109-496--------------------------------------------------------------------------------
SL9A3_HUMAN/58-462--------------------------------------------------------------------------------
Q83E71_COXBU/27-390--------------------------------------------------------------------------------
Q9Y959_AERPE/11-361--------------------------------------------------------------------------------
Q8XPZ0_RALSO/11-388--------------------------------------------------------------------------------
CVRA_ECOLI/10-389--------------------------------------------------------------------------------
Q93N84_STRLA/15-400--------------------------------------------------------------------------------
Q8XLS1_CLOPE/11-387--------------------------------------------------------------------------------
O25795_HELPY/9-377--------------------------------------------------------------------------------
NAH1_METJA/7-393--------------------------------------------------------------------------------
CHX14_ARATH/58-442--------------------------------------------------------------------------------
Q45308_BACME/8-377--------------------------------------------------------------------------------
NHX3_CAEEL/44-444--------------------------------------------------------------------------------
P74393_SYNY3/33-411--------------------------------------------------------------------------------
YJCE_ECOLI/3-422--------------------------------------------------------------------------------
O66731_AQUAE/13-381--------------------------------------------------------------------------------
Q98GP4_RHILO/11-397--------------------------------------------------------------------------------
SL9A6_HUMAN/78-503--------------------------------------------------------------------------------
Q8S5V1_ORYSJ/176-496--------------------------------------------------------------------------------
Q99V81_STAAM/7-388--------------------------------------------------------------------------------
Q9Z9H1_PSEAI/31-448--------------------------------------------------------------------------------
Q9XBC3_AMYOR/14-390--------------------------------------------------------------------------------
SL9A7_HUMAN/114-534--------------------------------------------------------------------------------
CHX13_ARATH/60-447--------------------------------------------------------------------------------
Q894B2_CLOTE/11-387--------------------------------------------------------------------------------
O29023_ARCFU/4-337--------------------------------------------------------------------------------
Q8PQR8_XANAC/12-399--------------------------------------------------------------------------------
O30022_ARCFU/11-366--------------------------------------------------------------------------------
Q81V05_BACAN/11-386--------------------------------------------------------------------------------
NHEB_ONCMY/73-472--------------------------------------------------------------------------------
Q87RG9_VIBPA/2-353--------------------------------------------------------------------------------
Q8EIY2_SHEON/2-355--------------------------------------------------------------------------------
Q9RV80_DEIRA/10-368--------------------------------------------------------------------------------
NAH1_YEAST/17-440--------------------------------------------------------------------------------
O58040_PYRHO/8-379--------------------------------------------------------------------------------
SL9A1_HUMAN/105-505--------------------------------------------------------------------------------
O29412_ARCFU/6-377--------------------------------------------------------------------------------
Q9L191_STRCO/11-375--------------------------------------------------------------------------------
NAH2_SCHPO/16-437--------------------------------------------------------------------------------
NHX7_ARATH/37-450--------------------------------------------------------------------------------
YJBQ_BACSU/10-389--------------------------------------------------------------------------------
NAPA_ENTHR/8-379--------------------------------------------------------------------------------
Q48731_9LACT/8-376--------------------------------------------------------------------------------
Q93JF3_STRCO/15-406--------------------------------------------------------------------------------
TMCO3_MOUSE/274-662--------------------------------------------------------------------------------
Q09432_CAEEL/35-439--------------------------------------------------------------------------------
NAH_SCHPO/16-434--------------------------------------------------------------------------------
Q9KTB1_VIBCH/2-353--------------------------------------------------------------------------------
Q23706_CARMA/81-483--------------------------------------------------------------------------------
Q9X8F2_STRCO/12-382--------------------------------------------------------------------------------
NAH2_METJA/7-395--------------------------------------------------------------------------------
Q8PYD4_METMA/9-374--------------------------------------------------------------------------------
SL9A2_RAT/85-486--------------------------------------------------------------------------------
O67072_AQUAE/23-407--------------------------------------------------------------------------------
Q8KHN6_NOCAE/16-400--------------------------------------------------------------------------------
Y2309_MYCBO/17-417--------------------------------------------------------------------------------
O82871_PSEAI/9-410--------------------------------------------------------------------------------
P73863_SYNY3/19-406--------------------------------------------------------------------------------
O58682_PYRHO/8-388--------------------------------------------------------------------------------
Q8PVQ3_METMA/9-375--------------------------------------------------------------------------------
CHX23_ARATH/59-444--------------------------------------------------------------------------------
Q55736_SYNY3/17-390--------------------------------------------------------------------------------
KEFX_HAEIN/13-387--------------------------------------------------------------------------------
Q97BQ9_THEVO/10-379--------------------------------------------------------------------------------
O26854_METTH/5-391--------------------------------------------------------------------------------
Q8KLM5_STRTO/6-396--------------------------------------------------------------------------------
NAH1_ZYGRO/16-438--------------------------------------------------------------------------------
NHAK_BACSU/3-415--------------------------------------------------------------------------------
Q55190_SYNY3/65-446--------------------------------------------------------------------------------
Q55388_SYNY3/8-396--------------------------------------------------------------------------------
NAH3_METJA/8-380--------------------------------------------------------------------------------
Q93KW8_STRVR/66-455--------------------------------------------------------------------------------
Q8GRF9_9PROT/12-375--------------------------------------------------------------------------------
SL9A4_RAT/73-477--------------------------------------------------------------------------------
Q815T7_BACCR/11-379--------------------------------------------------------------------------------
Q9PBK4_XYLFA/11-395--------------------------------------------------------------------------------
SL9A5_RAT/52-457--------------------------------------------------------------------------------

PF03956

Q8U272_PYRFU/7-192--------------------------------------------------------------------------------
Q5JE53_PYRKO/7-192--------------------------------------------------------------------------------
Q0W307_UNCMA/5-198--------------------------------------------------------------------------------
Q3A9X2_CARHZ/110-301--------------------------------------------------------------------------------
Q6D3T3_ERWCT/111-299--------------------------------------------------------------------------------
Q65TG5_MANSM/110-298--------------------------------------------------------------------------------
A0Q670_FRATN/117-306--------------------------------------------------------------------------------
Q8ZX41_PYRAE/114-291--------------------------------------------------------------------------------
Q5LD53_BACFN/7-205--------------------------------------------------------------------------------
Q0I3G0_HAES1/111-299--------------------------------------------------------------------------------
Q30YZ4_DESDG/7-199--------------------------------------------------------------------------------
A7HMA4_FERNB/6-189--------------------------------------------------------------------------------
Q1MPD6_LAWIP/7-198--------------------------------------------------------------------------------
Q9CNG6_PASMU/111-299--------------------------------------------------------------------------------
Q7P6I1_FUSNV/4-194--------------------------------------------------------------------------------
A1EJA4_VIBCL/110-298--------------------------------------------------------------------------------
A9KSU8_CLOPH/5-197--------------------------------------------------------------------------------
A1ISW6_NEIMA/109-298--------------------------------------------------------------------------------
A4YEP1_METS5/91-281--------------------------------------------------------------------------------
Q9UYY3_PYRAB/7-192--------------------------------------------------------------------------------
B8G2D2_DESHD/116-308--------------------------------------------------------------------------------
A0KIW8_AERHH/111-299--------------------------------------------------------------------------------
Y1452_HAEIN/4-192--------------------------------------------------------------------------------
A1RUU6_PYRIL/96-273--------------------------------------------------------------------------------
A1VEH4_DESVV/7-199--------------------------------------------------------------------------------
Q64PG3_BACFR/7-199--------------------------------------------------------------------------------
A4J6Y5_DESRM/5-197--------------------------------------------------------------------------------
A4FXI0_METM5/7-192--------------------------------------------------------------------------------
Q1QZ23_CHRSD/114-307--------------------------------------------------------------------------------
Q7MLI3_VIBVY/110-298--------------------------------------------------------------------------------
O58406_PYRHO/12-197--------------------------------------------------------------------------------
Q1QD72_PSYCK/112-301--------------------------------------------------------------------------------
Q1Z0Y8_PHOPR/110-298--------------------------------------------------------------------------------
A1U6W6_MARAV/112-300--------------------------------------------------------------------------------
Q96XQ5_SULTO/108-295--------------------------------------------------------------------------------
Q9YBX3_AERPE/117-302--------------------------------------------------------------------------------
A6VPB6_ACTSZ/111-299--------------------------------------------------------------------------------
A1RZA2_THEPD/99-286--------------------------------------------------------------------------------
A6VTK0_MARMS/114-302--------------------------------------------------------------------------------
Q2NU01_SODGM/130-310--------------------------------------------------------------------------------
A5WGW5_PSYWF/135-324--------------------------------------------------------------------------------
A8MGH5_ALKOO/5-196--------------------------------------------------------------------------------
A4W8P2_ENT38/111-299--------------------------------------------------------------------------------

PF06826

Y1229_BACTN/19-182--------------------------------------------------------------------------------
O52005_HALSA/14-174--------------------------------------------------------------------------------
O52005_HALSA/209-380--------------------------------------------------------------------------------
Y590_CORGL/12-174--------------------------------------------------------------------------------
Y2211_CORGL/11-179--------------------------------------------------------------------------------
YBJL_ECOLI/16-183--------------------------------------------------------------------------------
Y3475_BRAJA/16-184--------------------------------------------------------------------------------
Y2102_COREF/11-180--------------------------------------------------------------------------------
Y595_COREF/356-528--------------------------------------------------------------------------------
Y3476_BRAJA/394-564--------------------------------------------------------------------------------
Y736_BACTN/15-179--------------------------------------------------------------------------------
YBJL_ECOLI/385-555--------------------------------------------------------------------------------
Y4083_YERPE/10-180--------------------------------------------------------------------------------
Y035_HAEIN/372-546--------------------------------------------------------------------------------
Y2102_COREF/367-539--------------------------------------------------------------------------------
Y3471_BRAJA/387-557--------------------------------------------------------------------------------
Y595_COREF/12-171--------------------------------------------------------------------------------
Y2092_BACTN/378-551--------------------------------------------------------------------------------
Y736_BACTN/392-562--------------------------------------------------------------------------------
ASPT_TETHA/367-540--------------------------------------------------------------------------------
Y3476_BRAJA/20-187--------------------------------------------------------------------------------
Y035_HAEIN/10-179--------------------------------------------------------------------------------
Q8RDQ8_FUSNN/294-465--------------------------------------------------------------------------------
Y2092_BACTN/20-185--------------------------------------------------------------------------------
Y2143_SHEON/15-183--------------------------------------------------------------------------------
Y500_BACTN/12-166--------------------------------------------------------------------------------
YIDE_SHIFL/10-180--------------------------------------------------------------------------------
Y1229_BACTN/378-551--------------------------------------------------------------------------------
Y1232_VIBPA/388-558--------------------------------------------------------------------------------
Y500_BACTN/358-529--------------------------------------------------------------------------------
ASPT_TETHA/15-183--------------------------------------------------------------------------------
Y3471_BRAJA/15-183--------------------------------------------------------------------------------
YIDE_SHIFL/373-547--------------------------------------------------------------------------------
Y2143_SHEON/389-559--------------------------------------------------------------------------------

PF05982

Q8EAY3_SHEON/4-319--------------------------------------------------------------------------------
Q9K663_BACHD/12-337--------------------------------------------------------------------------------
Q8YV47_NOSS1/18-370--------------------------------------------------------------------------------
P71757_MYCTU/16-407--------------------------------------------------------------------------------
Q8YY66_NOSS1/13-322--------------------------------------------------------------------------------
Q9A2P7_CAUCR/49-365--------------------------------------------------------------------------------
P73953_SYNY3/18-374--------------------------------------------------------------------------------

PF03812

KDGT_BACSU/1-314--------------------------------------------------------------------------------
KDGT_SHIFL/1-314--------------------------------------------------------------------------------
KDGT_PECCC/1-314--------------------------------------------------------------------------------

PF05684

Q9FLW1_ARATH/79-442--------------------------------------------------------------------------------
YJCL_BACSU/15-395--------------------------------------------------------------------------------
Q9LTG3_ARATH/95-460--------------------------------------------------------------------------------
Q8P790_XANCP/17-412--------------------------------------------------------------------------------
Q9K8K1_BACHD/10-388--------------------------------------------------------------------------------
Q8RIK4_FUSNN/11-392--------------------------------------------------------------------------------

PF03601

Y2225_RHILO/7-307--------------------------------------------------------------------------------
YDHF_LACLA/5-311--------------------------------------------------------------------------------
Y5383_PSEAE/21-335--------------------------------------------------------------------------------
Y1621_ARCFU/22-308--------------------------------------------------------------------------------
Y2119_MYCPA/67-384--------------------------------------------------------------------------------
Y1056_STRP1/9-318--------------------------------------------------------------------------------
Y425_CAUCR/147-446--------------------------------------------------------------------------------
Y1461_PASMU/8-314--------------------------------------------------------------------------------
Y034_STRPN/9-315--------------------------------------------------------------------------------
Y341_STAAM/11-311--------------------------------------------------------------------------------
Y1643_HAEIN/8-316--------------------------------------------------------------------------------
YEIH_SHIFL/18-326--------------------------------------------------------------------------------
Y999_CAMJE/18-342--------------------------------------------------------------------------------

PF03616

Q9HZ58_PSEAE/4-371--------------------------------------------------------------------------------
O26036_HELPY/4-373--------------------------------------------------------------------------------
Q9KNC4_VIBCH/5-376--------------------------------------------------------------------------------
Q9S458_SALTM/1-366--------------------------------------------------------------------------------
GLTS_HAEIN/3-369--------------------------------------------------------------------------------
GLTS_SHIFL/2-366--------------------------------------------------------------------------------
Q99RS8_STAAM/2-370--------------------------------------------------------------------------------
P73275_SYNY3/4-370--------------------------------------------------------------------------------

PF13593

C5DGV7_LACTC/27-386--------------------------------------------------------------------------------
Q6CIF6_KLULA/49-408--------------------------------------------------------------------------------
B3LLT3_YEAS1/23-385--------------------------------------------------------------------------------
Q6BPS9_DEBHA/26-388--------------------------------------------------------------------------------
B9WFB0_CANDC/25-387--------------------------------------------------------------------------------
B7NPU5_ECO7I/8-316--------------------------------------------------------------------------------
A5DK55_PICGU/24-387--------------------------------------------------------------------------------
A5E3X9_LODEL/29-391--------------------------------------------------------------------------------
A7MML9_CROS8/10-319--------------------------------------------------------------------------------
C2M6P1_CAPGI/9-321--------------------------------------------------------------------------------
A0KES2_AERHH/4-313--------------------------------------------------------------------------------
B6Q6N8_PENMQ/44-391--------------------------------------------------------------------------------
Q4ZYQ4_PSEU2/13-325--------------------------------------------------------------------------------
C4UDI4_YERAL/10-319--------------------------------------------------------------------------------
Q0KE25_CUPNH/16-328--------------------------------------------------------------------------------
Q6FU65_CANGA/32-393--------------------------------------------------------------------------------
D0Z7X4_EDWTE/10-319--------------------------------------------------------------------------------
A3RYL9_RALSL/10-322--------------------------------------------------------------------------------
B2Q2V9_PROST/10-320--------------------------------------------------------------------------------
Q7N4G4_PHOLL/10-320--------------------------------------------------------------------------------
C8NCW5_9GAMM/45-353--------------------------------------------------------------------------------
C9Y8T0_9BURK/9-319--------------------------------------------------------------------------------
C5DX01_ZYGRC/23-385--------------------------------------------------------------------------------
A9IQT5_BORPD/10-319--------------------------------------------------------------------------------
Q988D7_RHILO/21-330--------------------------------------------------------------------------------
Q2K4B0_RHIEC/7-316--------------------------------------------------------------------------------
Q2NSZ3_SODGM/10-322--------------------------------------------------------------------------------
B9JA81_AGRRK/7-318--------------------------------------------------------------------------------
A6UD14_SINMW/7-316--------------------------------------------------------------------------------
B0VBX5_ACIBY/10-320--------------------------------------------------------------------------------
C6W4P5_DYAFD/14-325--------------------------------------------------------------------------------
A5VE28_SPHWW/9-318--------------------------------------------------------------------------------
B4WAZ9_9CAUL/9-317--------------------------------------------------------------------------------
D2TZF8_9ENTR/10-320--------------------------------------------------------------------------------
D0J170_COMT2/9-318--------------------------------------------------------------------------------
B2IHJ5_BEII9/11-319--------------------------------------------------------------------------------
A3XPQ3_LEEBM/6-318--------------------------------------------------------------------------------
A3I1U6_9BACT/15-326--------------------------------------------------------------------------------
B5JCP6_9BACT/12-331--------------------------------------------------------------------------------
B4WXN7_9GAMM/9-320--------------------------------------------------------------------------------
C0XTF9_9CORY/7-316--------------------------------------------------------------------------------
Q0V4P5_PHANO/88-416--------------------------------------------------------------------------------
A3SE09_9RHOB/10-318--------------------------------------------------------------------------------
B2WB77_PYRTR/69-400--------------------------------------------------------------------------------
D0WMS3_9ACTO/21-327--------------------------------------------------------------------------------
B7G617_PHATC/64-378--------------------------------------------------------------------------------
A9USA8_MONBE/8-323--------------------------------------------------------------------------------
A5P8F8_9SPHN/9-317--------------------------------------------------------------------------------
A4S2B1_OSTLU/55-379--------------------------------------------------------------------------------
C5BV46_BEUC1/9-317--------------------------------------------------------------------------------
C1MQW6_MICPC/113-439--------------------------------------------------------------------------------
B7G616_PHATC/92-406--------------------------------------------------------------------------------
Q2NAY2_ERYLH/10-318--------------------------------------------------------------------------------
Q1GQQ6_SPHAL/56-363--------------------------------------------------------------------------------
B8LLL0_PICSI/96-415--------------------------------------------------------------------------------
A7RRB9_NEMVE/42-385--------------------------------------------------------------------------------
E6VTY4_DESAO/16-319--------------------------------------------------------------------------------
C0Q8Q9_DESAH/8-317--------------------------------------------------------------------------------
Q4DG32_TRYCC/64-405--------------------------------------------------------------------------------

PF01758

ARSB_BACSU/49-246--------------------------------------------------------------------------------
O49665_ARATH/179-364--------------------------------------------------------------------------------
O29775_ARCFU/75-273--------------------------------------------------------------------------------
ARR3_YEAST/78-276--------------------------------------------------------------------------------
O81017_ARATH/71-248--------------------------------------------------------------------------------
NTCP2_CRIGR/39-220--------------------------------------------------------------------------------
P71942_MYCTU/62-259--------------------------------------------------------------------------------
Y944_SYNY3/61-268--------------------------------------------------------------------------------
O58554_PYRHO/48-238--------------------------------------------------------------------------------
O86662_STRCO/51-247--------------------------------------------------------------------------------
O26986_METTH/62-259--------------------------------------------------------------------------------
YOCS_BACSU/41-221--------------------------------------------------------------------------------
P73938_SYNY3/12-198--------------------------------------------------------------------------------
P3_HUMAN/197-381--------------------------------------------------------------------------------
O58645_PYRHO/46-238--------------------------------------------------------------------------------
NTCP_HUMAN/32-214--------------------------------------------------------------------------------
O67889_AQUAE/32-212--------------------------------------------------------------------------------

PF03547

Q98L58_RHILO/3-308................................................................................
O67397_AQUAE/2-289................................................................................
ECM3_YEAST/12-596VSIDSITHSLRTNHVDAQSVSELNDPTYRTRSQPIAYTTESRTSHVHNNRRNSITGSLRSIDMRELPAEGMSDLIREYSN
PIN1_ORYSJ/9-590MGFSSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHT.DFY....................SMV....GRSSNFGAADA.
Y1382_METTH/5-299................................................................................
PIN5_ARATH/9-362................................................................................
Q97M34_CLOAB/2-296................................................................................
YFDV_SHIFL/4-307................................................................................
PIN6_ARATH/9-565.....LTPRASNLSNAEIFSVN..........TPNNR.FFHGGGGSGT.....LQFYNGSNEIMF.CNGDLGGFGFTRPG
YWKB_BACSU/5-315................................................................................
Q9FVF6_9ROSI/9-609QGLSSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHT.DFY....................SMMA..AGRNSNFGASDVY
Y1031_METJA/2-303................................................................................
PINI_ARATH/9-617QGL.SATPRPSNLTNAEIYSLQSSRNPTPRGSSFNHT.DFY....................SMMASGGGRNSNFGPGEA.
YB8B_YEAST/13-413................................................................................
Q9C999_ARATH/18-441EYGGESSSPRSIQCLAEPRVMR..........................................................
Q9WYQ5_THEMA/4-288................................................................................
Q9C9K4_ARATH/9-407...EEEKEEDNHQVGRWEEVKQ..........................................................
Q48797_OENOE/6-311................................................................................
PIN7_ARATH/9-614GGGTNMTPRPSNLTGAEIYSL....NTTPRGSNFNHS.DFY....................SMMGFPGGRLSNFGPADMY
Q9LZN2_ARATH/30-423.LPVQSTEPRGRGVSRKGKIAQ..........................................................
Q9SHL8_ARATH/9-388..EDKENKVVKEKTGFWRKGVD..........................................................
PIN4_ARATH/9-611......TPRPSNLTGAEIYSLS....STPRGSNFNHS.DFY....................SVMGFPGGRLSNFGPADLY
YDQ4_SCHPO/18-440FGAASSKISK......................................................................
P71425_KLEPN/4-313................................................................................
Q9FKY4_ARATH/9-387.QNQDLEIQGKQKVSTRTYIKD..........................................................

PF03977

Q9KUH0_VIBCH/17-376--------------------------------------------------------------------------------
O59022_PYRHO/20-400--------------------------------------------------------------------------------
O28195_ARCFU/1-354--------------------------------------------------------------------------------
OADB_PASMU/17-431--------------------------------------------------------------------------------
OADB_VIBCH/17-432--------------------------------------------------------------------------------
O83096_TREPA/89-468--------------------------------------------------------------------------------
Q99ZL5_STRP1/18-376--------------------------------------------------------------------------------
Q99ZL0_STRP1/12-373--------------------------------------------------------------------------------
Q9WZY2_THEMA/30-384--------------------------------------------------------------------------------

PF06965

NHAA1_PSEPK/11-387--------------------------------------------------------------------------------
NHAA_BRUSU/14-384--------------------------------------------------------------------------------
NHAA_CAUCR/11-381--------------------------------------------------------------------------------
NHAA2_PSESM/16-384--------------------------------------------------------------------------------
NHAA_HELPY/14-427--------------------------------------------------------------------------------
NHAA_SHEON/5-380--------------------------------------------------------------------------------
NHAA1_PSESM/17-385--------------------------------------------------------------------------------
NHAA2_VIBVU/27-435--------------------------------------------------------------------------------
NHAA_HAEIN/17-393--------------------------------------------------------------------------------
NHAA_RHILO/12-384--------------------------------------------------------------------------------
NHAA_WIGBR/8-385--------------------------------------------------------------------------------
NHAA2_STRCO/26-428--------------------------------------------------------------------------------
NHAA_VIBCH/5-373--------------------------------------------------------------------------------
NHAA_RHIME/20-428--------------------------------------------------------------------------------
NHAA_ECOLI/4-380--------------------------------------------------------------------------------
NHAA_STRAT/25-401--------------------------------------------------------------------------------
Q93DN6_9BACT/17-388--------------------------------------------------------------------------------

PF00999

YDO6_SCHPO/39-445--------------------------------------------------------------------------------
KEA4_ARATH/173-543--------------------------------------------------------------------------------
KEA5_ARATH/158-528--------------------------------------------------------------------------------
KEA3_ARATH/109-496--------------------------------------------------------------------------------
SL9A3_HUMAN/58-462--------------------------------------------------------------------------------
Q83E71_COXBU/27-390--------------------------------------------------------------------------------
Q9Y959_AERPE/11-361--------------------------------------------------------------------------------
Q8XPZ0_RALSO/11-388--------------------------------------------------------------------------------
CVRA_ECOLI/10-389--------------------------------------------------------------------------------
Q93N84_STRLA/15-400--------------------------------------------------------------------------------
Q8XLS1_CLOPE/11-387--------------------------------------------------------------------------------
O25795_HELPY/9-377--------------------------------------------------------------------------------
NAH1_METJA/7-393--------------------------------------------------------------------------------
CHX14_ARATH/58-442--------------------------------------------------------------------------------
Q45308_BACME/8-377--------------------------------------------------------------------------------
NHX3_CAEEL/44-444--------------------------------------------------------------------------------
P74393_SYNY3/33-411--------------------------------------------------------------------------------
YJCE_ECOLI/3-422--------------------------------------------------------------------------------
O66731_AQUAE/13-381--------------------------------------------------------------------------------
Q98GP4_RHILO/11-397--------------------------------------------------------------------------------
SL9A6_HUMAN/78-503--------------------------------------------------------------------------------
Q8S5V1_ORYSJ/176-496--------------------------------------------------------------------------------
Q99V81_STAAM/7-388--------------------------------------------------------------------------------
Q9Z9H1_PSEAI/31-448--------------------------------------------------------------------------------
Q9XBC3_AMYOR/14-390--------------------------------------------------------------------------------
SL9A7_HUMAN/114-534--------------------------------------------------------------------------------
CHX13_ARATH/60-447--------------------------------------------------------------------------------
Q894B2_CLOTE/11-387--------------------------------------------------------------------------------
O29023_ARCFU/4-337--------------------------------------------------------------------------------
Q8PQR8_XANAC/12-399--------------------------------------------------------------------------------
O30022_ARCFU/11-366--------------------------------------------------------------------------------
Q81V05_BACAN/11-386--------------------------------------------------------------------------------
NHEB_ONCMY/73-472--------------------------------------------------------------------------------
Q87RG9_VIBPA/2-353--------------------------------------------------------------------------------
Q8EIY2_SHEON/2-355--------------------------------------------------------------------------------
Q9RV80_DEIRA/10-368--------------------------------------------------------------------------------
NAH1_YEAST/17-440--------------------------------------------------------------------------------
O58040_PYRHO/8-379--------------------------------------------------------------------------------
SL9A1_HUMAN/105-505--------------------------------------------------------------------------------
O29412_ARCFU/6-377--------------------------------------------------------------------------------
Q9L191_STRCO/11-375--------------------------------------------------------------------------------
NAH2_SCHPO/16-437--------------------------------------------------------------------------------
NHX7_ARATH/37-450--------------------------------------------------------------------------------
YJBQ_BACSU/10-389--------------------------------------------------------------------------------
NAPA_ENTHR/8-379--------------------------------------------------------------------------------
Q48731_9LACT/8-376--------------------------------------------------------------------------------
Q93JF3_STRCO/15-406--------------------------------------------------------------------------------
TMCO3_MOUSE/274-662--------------------------------------------------------------------------------
Q09432_CAEEL/35-439--------------------------------------------------------------------------------
NAH_SCHPO/16-434--------------------------------------------------------------------------------
Q9KTB1_VIBCH/2-353--------------------------------------------------------------------------------
Q23706_CARMA/81-483--------------------------------------------------------------------------------
Q9X8F2_STRCO/12-382--------------------------------------------------------------------------------
NAH2_METJA/7-395--------------------------------------------------------------------------------
Q8PYD4_METMA/9-374--------------------------------------------------------------------------------
SL9A2_RAT/85-486--------------------------------------------------------------------------------
O67072_AQUAE/23-407--------------------------------------------------------------------------------
Q8KHN6_NOCAE/16-400--------------------------------------------------------------------------------
Y2309_MYCBO/17-417--------------------------------------------------------------------------------
O82871_PSEAI/9-410--------------------------------------------------------------------------------
P73863_SYNY3/19-406--------------------------------------------------------------------------------
O58682_PYRHO/8-388--------------------------------------------------------------------------------
Q8PVQ3_METMA/9-375--------------------------------------------------------------------------------
CHX23_ARATH/59-444--------------------------------------------------------------------------------
Q55736_SYNY3/17-390--------------------------------------------------------------------------------
KEFX_HAEIN/13-387--------------------------------------------------------------------------------
Q97BQ9_THEVO/10-379--------------------------------------------------------------------------------
O26854_METTH/5-391--------------------------------------------------------------------------------
Q8KLM5_STRTO/6-396--------------------------------------------------------------------------------
NAH1_ZYGRO/16-438--------------------------------------------------------------------------------
NHAK_BACSU/3-415--------------------------------------------------------------------------------
Q55190_SYNY3/65-446--------------------------------------------------------------------------------
Q55388_SYNY3/8-396--------------------------------------------------------------------------------
NAH3_METJA/8-380--------------------------------------------------------------------------------
Q93KW8_STRVR/66-455--------------------------------------------------------------------------------
Q8GRF9_9PROT/12-375--------------------------------------------------------------------------------
SL9A4_RAT/73-477--------------------------------------------------------------------------------
Q815T7_BACCR/11-379--------------------------------------------------------------------------------
Q9PBK4_XYLFA/11-395--------------------------------------------------------------------------------
SL9A5_RAT/52-457--------------------------------------------------------------------------------

PF03956

Q8U272_PYRFU/7-192--------------------------------------------------------------------------------
Q5JE53_PYRKO/7-192--------------------------------------------------------------------------------
Q0W307_UNCMA/5-198--------------------------------------------------------------------------------
Q3A9X2_CARHZ/110-301--------------------------------------------------------------------------------
Q6D3T3_ERWCT/111-299--------------------------------------------------------------------------------
Q65TG5_MANSM/110-298--------------------------------------------------------------------------------
A0Q670_FRATN/117-306--------------------------------------------------------------------------------
Q8ZX41_PYRAE/114-291--------------------------------------------------------------------------------
Q5LD53_BACFN/7-205--------------------------------------------------------------------------------
Q0I3G0_HAES1/111-299--------------------------------------------------------------------------------
Q30YZ4_DESDG/7-199--------------------------------------------------------------------------------
A7HMA4_FERNB/6-189--------------------------------------------------------------------------------
Q1MPD6_LAWIP/7-198--------------------------------------------------------------------------------
Q9CNG6_PASMU/111-299--------------------------------------------------------------------------------
Q7P6I1_FUSNV/4-194--------------------------------------------------------------------------------
A1EJA4_VIBCL/110-298--------------------------------------------------------------------------------
A9KSU8_CLOPH/5-197--------------------------------------------------------------------------------
A1ISW6_NEIMA/109-298--------------------------------------------------------------------------------