Sequence alignment for CL0065

PF00134

CG11_CANAX/48-176------------------------------------------------------------------------DIVNTLSQ
CCNA2_MOUSE/171-297------------------------------------------------------------------------DIHTYLRE
CCNB3_CAEEL/115-241------------------------------------------------------------------------GIFDYYRH
CCNF_MOUSE/281-406------------------------------------------------------------------------ESVCQLFQ
CCT12_ARATH/28-169------------------------------------------------------------------------IIPWFFSR
CCNE_CAEEL/232-360------------------------------------------------------------------------KVWSLMVK
O04388_CATRO/107-236------------------------------------------------------------------------DIYEYLHK
O04389_CATRO/186-311------------------------------------------------------------------------DIYKFYKI
O04399_TOBAC/107-236------------------------------------------------------------------------LIYQHLHS
REM1_SCHPO/145-271------------------------------------------------------------------------EILSHMEK
CCNE_HEMPU/126-253------------------------------------------------------------------------EVWTIMTR
O40946_HHV8/20-147------------------------------------------------------------------------RIFYNILE
CCNE3_XENLA/114-241------------------------------------------------------------------------DVWRNMLN
O45926_CAEEL/34-159------------------------------------------------------------------------DIYNYLVH
CCB14_ARATH/133-258------------------------------------------------------------------------DIFKFYRT
O62573_SPHGR/213-339------------------------------------------------------------------------EIYQYLKT
O65065_PICMA/77-204------------------------------------------------------------------------LSYALRRL
O76513_DROME/43-156------------------------------------------------------------------------LNEHFLTS
CCU41_ARATH/22-148------------------------------------------------------------------------ERVAESND
O82136_PEA/72-205------------------------------------------------------------------------EELTTLFS
O93228_RANJA/112-237------------------------------------------------------------------------DIYCYLRD
O93231_BUFJA/24-149------------------------------------------------------------------------DIYLYLHQ
O93911_CANAX/234-360------------------------------------------------------------------------EIFNYLHE
O93916_PNECA/176-302------------------------------------------------------------------------EIMGYMRE
CCNB2_HUMAN/137-262------------------------------------------------------------------------DIYQYLRQ
CCNT_DROME/42-176------------------------------------------------------------------------DKIWYFSN
O96434_PARTE/82-210------------------------------------------------------------------------EIYTYLLT
O97482_PARTE/85-212------------------------------------------------------------------------EILQHLLI
CCNB_ARBPU/145-272------------------------------------------------------------------------DIYLYLRR
CG23_SCHPO/206-332------------------------------------------------------------------------DIFEYLNE
CCNB1_XENLA/139-264------------------------------------------------------------------------DIYAYLRS
CCNB2_XENLA/134-259------------------------------------------------------------------------DIYNYLKQ
CCNB_SPISO/172-297------------------------------------------------------------------------DIYDYMRD
CCNA_DROME/206-332------------------------------------------------------------------------DILEYFRE
CCNB_ASTPE/147-270------------------------------------------------------------------------DIYLYMRH
CG12_YEAST/43-195------------------------------------------------------------------------EISTNVIA
CCNB_DROME/260-387------------------------------------------------------------------------DIYDYLYQ
CCNB1_MOUSE/170-295------------------------------------------------------------------------DIYAYLRQ
CCNA_PATVU/174-300------------------------------------------------------------------------DIYKHLRE
CCNB_PATVU/155-280------------------------------------------------------------------------DIYHYMRH
CG21_SCHPO/166-292------------------------------------------------------------------------EIFHYMQS
PCL1_YEAST/19-152------------------------------------------------------------------------DIIKFLTD
CG21_YEAST/212-337------------------------------------------------------------------------DIFDYLHH
CG22_YEAST/232-357------------------------------------------------------------------------DIFEYLHQ
CG23_YEAST/171-297------------------------------------------------------------------------EIFEYMRK
CG24_YEAST/210-336------------------------------------------------------------------------DIFYYLRE
PUC1_SCHPO/99-227------------------------------------------------------------------------DIIHHL.I
CCNAL_DAUCA/77-206------------------------------------------------------------------------DVYEYLKQ
CCNB1_SOYBN/197-322------------------------------------------------------------------------DIYKFYKL
PCL2_YEAST/18-146------------------------------------------------------------------------EMVQYLAS
CCNB2_CHICK/141-266------------------------------------------------------------------------DIYLYLRQ
CCB11_ARATH/168-293------------------------------------------------------------------------DIYSFYKS
CCNB2_MEDSA/73-199------------------------------------------------------------------------DLHAYYRK
CCND2_MOUSE/24-151------------------------------------------------------------------------RVLQNLLT
CCND3_HUMAN/26-153------------------------------------------------------------------------RVLQSLLR
CGS5_YEAST/165-294------------------------------------------------------------------------EIFAFLYR
CG21_EMENI/211-337------------------------------------------------------------------------EIFDYLRE
CGS6_YEAST/123-252------------------------------------------------------------------------SIFSHLYE
CCNA1_CAEEL/215-341------------------------------------------------------------------------DIIKYMLH
CCN1_ANTMA/197-322------------------------------------------------------------------------DMYKFYKS
CG22_SCHPO/139-265------------------------------------------------------------------------EIFEYIRK
CCND1_RAT/26-153------------------------------------------------------------------------RVLRAMLK
CCNB3_CHICK/149-274------------------------------------------------------------------------EIFDYMRE
CCNB_DICDI/188-314------------------------------------------------------------------------EIFAYYRE
CCD11_ARATH/50-182------------------------------------------------------------------------DSIACFIE
CCD21_ARATH/65-197------------------------------------------------------------------------DRIKEMLV
CG12_CANAX/44-172------------------------------------------------------------------------EMLHHL.L
SSN8_YEAST/45-176------------------------------------------------------------------------DSKQNGIE
CG21_CANAX/208-334------------------------------------------------------------------------EIFSYYYE
CCNE1_CHICK/112-239------------------------------------------------------------------------DVWKNMIN
CCNA_HYDVD/168-294------------------------------------------------------------------------DIHNYLKK
CCNB_HYDVD/137-262------------------------------------------------------------------------DIYKYMNK
CCNE_DROME/330-459------------------------------------------------------------------------DVWRLMCH
CCNA1_HUMAN/214-340------------------------------------------------------------------------EIYQYLRE
P92162_BOMMO/260-387------------------------------------------------------------------------DIYKYLTE
P93102_CHERU/192-317------------------------------------------------------------------------DIYSFYKI
P93103_CHERU/77-208------------------------------------------------------------------------ECLASLFD
CCC11_ORYSJ/4-144------------------------------------------------------------------------NFWTSSHC
P93646_MAIZE/228-354------------------------------------------------------------------------DIYRFYKS
CGH2_SHV21/22-148------------------------------------------------------------------------RVLNN.LK
CG1_COLGL/38-166------------------------------------------------------------------------DAIKHMEY
CCNB1_CAEEL/81-206------------------------------------------------------------------------DIYKYLVH
PCL9_YEAST/19-146------------------------------------------------------------------------EMIQFLAT
CCA22_ARATH/175-302------------------------------------------------------------------------DIYDNIHV
Q24158_DROME/126-255------------------------------------------------------------------------RCLENFLK
Q25123_HELRO/112-238------------------------------------------------------------------------DILTYGKE
Q25168_HELTR/256-380------------------------------------------------------------------------DIFDYYRD
CCB12_ARATH/185-310------------------------------------------------------------------------DMYSFYKE
CCB21_ARATH/174-300------------------------------------------------------------------------DLYAFYRT
Q39331_BRANA/160-287------------------------------------------------------------------------DIYNHLRA
Q39877_SOYBN/83-212------------------------------------------------------------------------DIHEYLRE
Q39878_SOYBN/207-334------------------------------------------------------------------------DIYSNIRV
Q39880_SOYBN/186-311------------------------------------------------------------------------DIYKFYKE
Q40794_PETCR/187-312------------------------------------------------------------------------DMYKFYKL
Q41731_MAIZE/173-299------------------------------------------------------------------------EIYRFYRK
Q41732_MAIZE/188-315------------------------------------------------------------------------DIYMHLRE
Q41733_MAIZE/189-315------------------------------------------------------------------------DIYTFYRP
Q41734_MAIZE/155-280------------------------------------------------------------------------DIYTFYKI
CCNE1_MOUSE/113-240------------------------------------------------------------------------EVWRIMLN
CCB21_ORYSJ/157-283------------------------------------------------------------------------ELYKFYRE
CCD41_ARATH/45-178------------------------------------------------------------------------EIIMEMVE
Q96226_ADICA/268-395------------------------------------------------------------------------EIYHHLRM
CCNB3_DROME/308-433------------------------------------------------------------------------DIFNYLKV
Q9PVT7_CARAU/117-244------------------------------------------------------------------------DVWNNLLR
Q9PW42_CARAU/140-266------------------------------------------------------------------------DIHRYLRE
Q9S7H9_SOLLC/61-190------------------------------------------------------------------------DELATLLS
CCB31_ARATH/146-272------------------------------------------------------------------------DIYQFYWT
CCB24_ARATH/180-307------------------------------------------------------------------------DIYCFYKK
Q9SMD4_SOLLC/51-182------------------------------------------------------------------------EELTSLFS
CCD33_ARATH/59-186------------------------------------------------------------------------DELSTLIS
Q9SNV1_ANTMA/59-187------------------------------------------------------------------------EELSSLLC
Q9SNV2_ANTMA/45-174------------------------------------------------------------------------ESIAGLLE
Q9SXN7_TOBAC/59-188------------------------------------------------------------------------EELLSLFT
Q9U2M5_CAEEL/72-201------------------------------------------------------------------------DMRAFYNC
Q9U7P9_9CILI/433-564------------------------------------------------------------------------THLAQLLE
Q9VE72_DROME/6-144------------------------------------------------------------------------DVMSMQQH
Q9VKF0_DROME/205-327------------------------------------------------------------------------DIFDEKLH
Q9VZP3_DROME/42-165------------------------------------------------------------------------DIFLTMRE
Q9WRM3_9GAMA/20-147------------------------------------------------------------------------RALSNLLA
Q9XGI0_MEDSA/224-351------------------------------------------------------------------------DIYDHLRV
Q9XGI1_SOLLC/180-306------------------------------------------------------------------------DLFANYRT
Q9XGI2_SOLLC/121-246------------------------------------------------------------------------DIYKFYKL
Q9YTJ4_ATHV3/30-156------------------------------------------------------------------------RVLNN.LK
CCNE2_MOUSE/112-239------------------------------------------------------------------------EVWQNMLQ
CCD61_ARATH/26-154------------------------------------------------------------------------TLPHSLFL
Q9ZRG1_PEA/7-133------------------------------------------------------------------------DIYHYYWV
Q9ZRX9_TOBAC/64-196------------------------------------------------------------------------ECLSFMVQ

PF08613

PHO80_YEAST/33-170------------------------------------------------------------------------TDLVVLIS
YGZA_SCHPO/29-176------------------------------------------------------------------------EKLLEMIS
Q872V6_NEUCS/156-314------------------------------------------------------------------------HKQSQSID
Q8IEW5_9TRYP/370-620------------------------------------------------------------------------DLAIQQLI
Q949F8_ORYSA/17-159------------------------------------------------------------------------PRVVAALA
CGP1_SCHPO/7-134------------------------------------------------------------------------RALLESFS
Q8I8A9_9TRYP/370-620------------------------------------------------------------------------DLAIQQLI
PCL7_YEAST/108-264------------------------------------------------------------------------DELILMIS
Q83C02_COXBU/10-148------------------------------------------------------------------------DEVIEAIC

PF00382

TF3B_KLULA/193-266-----------------------------------------------------------------------IQHFAEKLE
TF2B_PYRWO/116-186-----------------------------------------------------------------------LDRITAQLK
TF2B_KLULA/137-207-----------------------------------------------------------------------ITMMCDAAE
TF2B_YEAST/133-203-----------------------------------------------------------------------ITMLCDAAE
TF2B_HALVA/30-100-----------------------------------------------------------------------VPRFASELE
TF3B_CANAL/95-165-----------------------------------------------------------------------IKRIAAALK
TF2B_DROME/214-284-----------------------------------------------------------------------MCRFCANLD
TF2B_PYRWO/212-282-----------------------------------------------------------------------VNKFADELG
TF3B_KLULA/98-168-----------------------------------------------------------------------LKAVSYALN
TF3B_CANAL/190-263-----------------------------------------------------------------------IQHFVEKLD
TF2B_DROME/120-190-----------------------------------------------------------------------ISSMADRIN
TF2B_KLULA/245-315-----------------------------------------------------------------------IPRFCSHLG

PF01857

RBR2_MAIZE/594-721-----------------------------------------------------------------------VTIQIFFSK
RBL1_HUMAN/786-944-----------------------------------------------------------------------GSLALFYRK
RB_HUMAN/645-766-----------------------------------------------------------------------TSLSLFYKK
RBL2_HUMAN/834-992-----------------------------------------------------------------------SSLSLFFRK
RBF_DROME/580-706-----------------------------------------------------------------------GPLQIFLRK
RBR_CHERU/724-863-----------------------------------------------------------------------TGINIFFSK

PF02984

CCNB3_CAEEL/243-364-----------------------------------------------------------------------PLSYRYLRR
Q7QC70_ANOGA/538-653-----------------------------------------------------------------------PLSYRFLRR
A4HKX7_LEIBR/155-297-----------------------------------------------------------------------PTPYPFASR
CCNF_MOUSE/408-531-----------------------------------------------------------------------PTVVDYKEV
CCNB3_HUMAN/1259-1375-----------------------------------------------------------------------PIAYHFLRR
Q0UCR8_PHANO/466-581-----------------------------------------------------------------------PGPMSFLRR
Q291N4_DROPS/375-501-----------------------------------------------------------------------PLPIHFLRR
CCNA1_MOUSE/298-415-----------------------------------------------------------------------PTTNQFLLQ
Q6BGT2_DEBHA/350-465-----------------------------------------------------------------------PGPMSFLRR
A0C1C9_PARTE/197-310-----------------------------------------------------------------------TSPLKFLER
A0DMF0_PARTE/199-312-----------------------------------------------------------------------TSPIKFLER
A0E0R4_PARTE/214-320-----------------------------------------------------------------------PTAYQFLSK
CCA33_ARATH/190-313-----------------------------------------------------------------------PTTNTFLRR
A1C7V2_ASPCL/489-604-----------------------------------------------------------------------PGPMSFLRK
A1CID9_ASPCL/361-475-----------------------------------------------------------------------PNPMNFLRR
A2DQ77_TRIVA/248-364-----------------------------------------------------------------------PTPYFFLGI
A2DZV8_TRIVA/235-351-----------------------------------------------------------------------PTPLFFLNY
A2E0Q4_TRIVA/216-333-----------------------------------------------------------------------VVTSQFLRR
A2E6K7_TRIVA/216-333-----------------------------------------------------------------------ILSSQFLRR
A2F2K2_TRIVA/212-328-----------------------------------------------------------------------ATPLFFLTH
A2ZM34_ORYSI/249-372-----------------------------------------------------------------------PTIKTFLRR
A3AKA7_ORYSJ/256-379-----------------------------------------------------------------------PTTKTFLRM
A3LN44_PICST/322-438-----------------------------------------------------------------------PNPMNFLRR
A4RSW0_OSTLU/207-322-----------------------------------------------------------------------TTTKTFLTI
A5AEK5_VITVI/324-442-----------------------------------------------------------------------PTPYVFLVR
A5BUM0_VITVI/360-483-----------------------------------------------------------------------PTAKTFLRR
A5DUV2_LODEL/512-628-----------------------------------------------------------------------PNPMNFLRR
A6RR46_BOTFB/346-460-----------------------------------------------------------------------PNPMNFLRR
A6ZXH4_YEAS7/299-414-----------------------------------------------------------------------PGPMSFLRR
A7A198_YEAS7/338-453-----------------------------------------------------------------------PGPMPFLRR
A7F1V1_SCLS1/469-584-----------------------------------------------------------------------PGPMSFLRR
A7S8H6_NEMVE/110-226-----------------------------------------------------------------------PIPYRFLRR
A7SEI5_NEMVE/172-293-----------------------------------------------------------------------PTILNFLER
A7SPG5_NEMVE/166-283-----------------------------------------------------------------------PLCLHFLRR
A7TR46_VANPO/331-446-----------------------------------------------------------------------PGPMSFLRR
A7Y7X0_CUCSA/197-329-----------------------------------------------------------------------VTPYSFLDH
A7YYE4_DANRE/155-279-----------------------------------------------------------------------VTPHDFIEH
O04388_CATRO/238-361-----------------------------------------------------------------------PTIKTFLRR
O04389_CATRO/313-431-----------------------------------------------------------------------PTPYVFLVR
O04398_TOBAC/319-436-----------------------------------------------------------------------PTPYVFLVR
REM1_SCHPO/273-388-----------------------------------------------------------------------PGPVSFLRL
CCNE_HEMPU/255-381-----------------------------------------------------------------------ITVNTWLNA
O45926_CAEEL/161-293-----------------------------------------------------------------------PSSLVFLRC
CCB14_ARATH/260-379-----------------------------------------------------------------------PTPYVFLAR
O65064_PICMA/98-215-----------------------------------------------------------------------PTPYVFLVR
CG1C_SCHPO/162-280-----------------------------------------------------------------------PYVLSFIKK
O77212_DREPO/291-408-----------------------------------------------------------------------PTTNWFCES
O82137_PEA/102-224-----------------------------------------------------------------------PTPFVFLVR
O82678_CHERU/199-326-----------------------------------------------------------------------VTPLSYFGH
O82717_LUPLU/324-441-----------------------------------------------------------------------PTTFVFLTR
O93228_RANJA/239-357-----------------------------------------------------------------------PLPLHFLRR
O93916_PNECA/304-419-----------------------------------------------------------------------PNPINFLRR
O96434_PARTE/212-329-----------------------------------------------------------------------PSSYCFLQR
CCNB_ARBPU/274-395-----------------------------------------------------------------------PLCLHFLRR
CG23_SCHPO/334-448-----------------------------------------------------------------------PNPMNFLRR
CCNB_SPISO/299-415-----------------------------------------------------------------------PLCLHFLRR
CCNA_DROME/334-451-----------------------------------------------------------------------PTAYVFINT
CCNB_MARGL/258-375-----------------------------------------------------------------------PLCIHFLRR
CCNB_ASTPE/272-390-----------------------------------------------------------------------PLCIHFLRR
CCNA1_XENLA/295-412-----------------------------------------------------------------------PTVNQFLLQ
CCNA_PATVU/302-419-----------------------------------------------------------------------PTINWFTDT
CCNB_PATVU/282-398-----------------------------------------------------------------------PLCLHFLRR
CCNE1_HUMAN/244-366-----------------------------------------------------------------------LTIVSWLNV
CG21_SCHPO/294-409-----------------------------------------------------------------------PGPMSFLRR
CG21_YEAST/339-454-----------------------------------------------------------------------ANPMNFLRR
CCNAL_DAUCA/208-330-----------------------------------------------------------------------PTVKTFLG.
CCNB2_CHICK/268-386-----------------------------------------------------------------------PLPLHFLRR
CCB11_ARATH/295-418-----------------------------------------------------------------------PTHYVFLAR
CCNA2_BOVIN/307-425-----------------------------------------------------------------------PTINQFLTQ
CCNB2_MEDSA/201-318-----------------------------------------------------------------------PTAYVFMRR
CCND2_HUMAN/154-277-----------------------------------------------------------------------VTPHDFIEH
CGS5_YEAST/296-418-----------------------------------------------------------------------PNPLNFLRR
CGS6_YEAST/254-374-----------------------------------------------------------------------PNPLNFIRR
CCNA1_CAEEL/343-459-----------------------------------------------------------------------PTSSWFGTC
CCN2_ANTMA/319-438-----------------------------------------------------------------------PTPYVFLVR
CG22_SCHPO/267-382-----------------------------------------------------------------------PSPLNFLRK
CCNB3_CHICK/276-392-----------------------------------------------------------------------PIPYRFLRR
CCD11_ARATH/184-308-----------------------------------------------------------------------VTPFDFISF
CCD31_ARATH/189-307-----------------------------------------------------------------------ITPISFVDH
CCNA2_CHICK/273-390-----------------------------------------------------------------------PTINQFLTQ
CCNE1_DANRE/246-368-----------------------------------------------------------------------LTPVAWLNI
CCNA_HYDVD/296-415-----------------------------------------------------------------------PTCRDFLSR
CCNB_HYDVD/264-380-----------------------------------------------------------------------PLCLHFLRR
P90681_ASTPE/322-438-----------------------------------------------------------------------PTANAFLSR
P92162_BOMMO/389-509-----------------------------------------------------------------------PIPLSFLRR
P93102_CHERU/319-438-----------------------------------------------------------------------PTPYMFLTR
P93103_CHERU/210-333-----------------------------------------------------------------------VTPFSFIDY
P93557_SESRO/318-435-----------------------------------------------------------------------PTPFVFLVR
P93646_MAIZE/356-473-----------------------------------------------------------------------PTMYMFIVR
CCB21_ORYSI/285-402-----------------------------------------------------------------------PTPYVFMRR
CCNB1_CRIGR/296-414-----------------------------------------------------------------------PLPLHFLRR
Q08C91_DANRE/272-388-----------------------------------------------------------------------PVPYRFLRR
Q09IZ1_ONCMY/251-369-----------------------------------------------------------------------PLPLHFLRR
CCB22_ORYSJ/293-410-----------------------------------------------------------------------PTPYCFMRR
CCA14_ORYSJ/216-339-----------------------------------------------------------------------PTTKCFLRR
CCB13_ORYSJ/341-458-----------------------------------------------------------------------PTMYMFILR
Q0UMA7_PHANO/348-462-----------------------------------------------------------------------PNPMNFLRR
Q0VA13_XENTR/226-348-----------------------------------------------------------------------IHPLHFLRI
CCD42_ARATH/171-289-----------------------------------------------------------------------VTPCSYVRY
CCNB1_CAEEL/208-340-----------------------------------------------------------------------PSSLVFLRC
CCF32_ORYSJ/267-390-----------------------------------------------------------------------PTVITFLRR
CCA22_ARATH/304-427-----------------------------------------------------------------------PTTKTFLRR
Q16TY2_AEDAE/355-477-----------------------------------------------------------------------PLPTHFLRR
Q16VG6_AEDAE/419-535-----------------------------------------------------------------------PLSYRFLRR
Q17NN3_AEDAE/310-427-----------------------------------------------------------------------PTTLVFTTV
Q1L8M6_DANRE/153-279-----------------------------------------------------------------------ITPLDFIEH
Q23JX5_TETTS/324-441-----------------------------------------------------------------------PTSLRFLER
Q25123_HELRO/240-368-----------------------------------------------------------------------PTPNYFCCD
Q25168_HELTR/382-498-----------------------------------------------------------------------PLSYTFLRR
Q28DU2_XENTR/291-408-----------------------------------------------------------------------PTILQYLNQ
Q28GP5_XENTR/256-374-----------------------------------------------------------------------PLPLNFLRR
Q29CG1_DROPS/434-556-----------------------------------------------------------------------PLSYRFLRR
Q29DY8_DROPS/354-471-----------------------------------------------------------------------PTAYVFINT
Q2ABE6_CAMSI/198-326-----------------------------------------------------------------------VTPLSFVDH
Q2ABE7_CAMSI/203-327-----------------------------------------------------------------------VTPLSFLDH
Q2ABE9_CAMSI/308-433-----------------------------------------------------------------------PTPYVFLVR
Q2HAK4_CHAGB/352-466-----------------------------------------------------------------------PNPMNFLRR
Q2HAS9_CHAGB/515-630-----------------------------------------------------------------------PGPMSFLRR
CCND1_BOVIN/155-283-----------------------------------------------------------------------MTPHDFIEH
Q2PHK8_DAUCA/314-432-----------------------------------------------------------------------PTPYVFLVR
Q2PHK9_DAUCA/330-448-----------------------------------------------------------------------PTPYVFLVR
Q2PHL0_DAUCA/311-430-----------------------------------------------------------------------PTPYVFLVR
CCA21_ORYSJ/359-482-----------------------------------------------------------------------PTTKTFLRR
Q2UPT4_ASPOR/192-299-----------------------------------------------------------------------PTVDSFLQM
Q2V5Z8_BRACM/228-351-----------------------------------------------------------------------PTIKTFLRR
Q2WGP0_ALLCE/280-397-----------------------------------------------------------------------PTPFVFLRR
Q2WGP2_ALLCE/358-475-----------------------------------------------------------------------PTPYVFLVR
CCB12_ARATH/312-429-----------------------------------------------------------------------PTQYVFLVR
CCB21_ARATH/302-419-----------------------------------------------------------------------PTQYPFLKR
CCB13_ARATH/289-406-----------------------------------------------------------------------PTQYVFLVR
CCB22_ARATH/303-421-----------------------------------------------------------------------PTQYPFLKR
Q39331_BRANA/289-412-----------------------------------------------------------------------PTVKCFLRR
Q39877_SOYBN/214-337-----------------------------------------------------------------------PTVSTFLRR
Q39878_SOYBN/336-459-----------------------------------------------------------------------PTIKTFLRR
Q39880_SOYBN/313-433-----------------------------------------------------------------------PTPYHFLVR
Q3KPK0_XENLA/154-279-----------------------------------------------------------------------VTPHDFIEH
Q3KQA7_XENLA/288-404-----------------------------------------------------------------------PVPYRFLRR
Q40223_LUPLU/307-426-----------------------------------------------------------------------PTTYVFLVR
Q40338_MEDSA/212-338-----------------------------------------------------------------------VTTHSFLDH
Q40488_TOBAC/238-361-----------------------------------------------------------------------PTTKTFLRI
Q40492_TOBAC/247-370-----------------------------------------------------------------------PTVKTFLRR
Q40514_TOBAC/347-470-----------------------------------------------------------------------PTAKCFLRR
Q40516_TOBAC/291-408-----------------------------------------------------------------------PTPYVFLAR
Q41733_MAIZE/317-437-----------------------------------------------------------------------PTPYHFLLR
Q41734_MAIZE/282-407-----------------------------------------------------------------------PTVYMFLVR
Q49U21_CRYNE/355-469-----------------------------------------------------------------------CSPYSWVRR
Q4CS48_TRYCC/197-328-----------------------------------------------------------------------PTTYPLACH
Q4DWL9_TRYCC/229-371-----------------------------------------------------------------------PTPFPFIVR
CCD42_ORYSJ/212-330-----------------------------------------------------------------------VTPFSYIDY
Q4RZE5_TETNG/155-280-----------------------------------------------------------------------VTPHDFIEH
Q4SG06_TETNG/155-272-----------------------------------------------------------------------PTSSQFLSL
Q4T0M3_TETNG/224-342-----------------------------------------------------------------------PLPLQFLRR
Q4T2Y9_TETNG/114-254-----------------------------------------------------------------------PTAAHFIDF
Q4T8S9_TETNG/1145-1270-----------------------------------------------------------------------VTPLDFIDH
Q4TVR6_HELTR/235-352-----------------------------------------------------------------------PLPIHFLRR
CCNB_DICDI/316-434-----------------------------------------------------------------------ATPLHFLRR
CG11_CANAL/174-308-----------------------------------------------------------------------PTLEDCLQL
Q5D894_GOSHI/87-204-----------------------------------------------------------------------PTHYVFLAR
Q5D8P0_SCHJA/269-392-----------------------------------------------------------------------PTPLVFLRR
Q5KAX2_CRYNJ/366-482-----------------------------------------------------------------------PNPLNFIRR
Q5SCB6_OSTTA/230-346-----------------------------------------------------------------------PTPYCFLNR
Q5SCB7_OSTTA/222-339-----------------------------------------------------------------------TTVNTFLTF
Q5T8J1_HUMAN/105-230-----------------------------------------------------------------------VIAHDFLAF
Q5U4W4_XENLA/240-362-----------------------------------------------------------------------VTAISWLNL
Q5UAU8_PENJP/269-385-----------------------------------------------------------------------PLPLHFLRR
CCNF_XENTR/414-537-----------------------------------------------------------------------PTVVDYKDV
Q5ZKI9_CHICK/155-280-----------------------------------------------------------------------VIANDFLAH
Q5ZMH4_CHICK/247-368-----------------------------------------------------------------------VTIISWLNL
CCNB1_ANGJA/272-390-----------------------------------------------------------------------PLPLQFLRR
Q60FY1_ORENI/302-418-----------------------------------------------------------------------PIPYRFLRR
Q60FY2_ANGJA/277-393-----------------------------------------------------------------------PVPYRFLRR
A8XRM2_CAEBR/208-340-----------------------------------------------------------------------PSSLVFARC
CCNB3_CANFA/1202-1318-----------------------------------------------------------------------PIAYHFLRR
Q6CE22_YARLI/306-421-----------------------------------------------------------------------PGPMSFLRR
Q6CEJ4_YARLI/393-508-----------------------------------------------------------------------PNPMNFLRR
Q6CT04_KLULA/317-432-----------------------------------------------------------------------PGPMSFLRR
CCNJ_XENLA/145-273-----------------------------------------------------------------------PTPAHFIEY
Q6FNV2_CANGA/314-429-----------------------------------------------------------------------PGPMSFLRR
Q6FQU1_CANGA/326-455-----------------------------------------------------------------------PGPMSFLRR
Q6FVY0_CANGA/262-383-----------------------------------------------------------------------PNPLNFLRR
Q6FVY1_CANGA/344-459-----------------------------------------------------------------------PNPMNFLRR
Q6IR86_XENLA/262-380-----------------------------------------------------------------------PLPLHFLRR
CCF13_ORYSJ/255-372-----------------------------------------------------------------------PTASTFVQH
Q6P801_XENTR/266-384-----------------------------------------------------------------------PLPLHFLRR
Q6T2E9_BUFBG/263-381-----------------------------------------------------------------------PLPLHFLRR
Q6X269_USTMD/465-579-----------------------------------------------------------------------CSPYSWVRK
Q6X270_USTMD/433-547-----------------------------------------------------------------------ANPMNFLRR
Q6ZZ83_SPHGR/342-458-----------------------------------------------------------------------PTINCFLPR
Q75A51_ASHGO/248-363-----------------------------------------------------------------------PGPMSFLRR
Q75EI0_ASHGO/418-533-----------------------------------------------------------------------PNPMNFLRR
Q790L7_MOUSE/155-283-----------------------------------------------------------------------MTPHDFIEH
CCA11_ORYSJ/372-495-----------------------------------------------------------------------PTAKCFLRR
Q7PPJ1_ANOGA/320-449-----------------------------------------------------------------------PLPTHFLRR
Q7Q0E8_ANOGA/187-304-----------------------------------------------------------------------PTSLVFTNT
Q7XAB7_EUPES/184-308-----------------------------------------------------------------------VTPICYFDH
Q7Z4Z4_HUMAN/264-382-----------------------------------------------------------------------PLPLHFLRR
Q7ZVA8_DANRE/252-370-----------------------------------------------------------------------PLPLHFLRR
Q7ZYJ6_XENLA/153-279-----------------------------------------------------------------------VTPHDFIEH
CCNB3_MOUSE/1265-1381-----------------------------------------------------------------------PTAYNFLRR
Q84LE4_SILLA/352-474-----------------------------------------------------------------------PTTKNFLRR
Q84V88_POPAL/200-324-----------------------------------------------------------------------VTSISFFDH
Q8GZU3_9ROSI/205-332-----------------------------------------------------------------------VTPISFLDY
CCD41_ARATH/180-299-----------------------------------------------------------------------ITPCSYIRY
Q8LK74_LAGSI/187-313-----------------------------------------------------------------------VTPFSFVDY
Q8LPW3_HELAN/178-304-----------------------------------------------------------------------VTPISFLDH
Q8SRF2_ENCCU/179-293-----------------------------------------------------------------------VSPLNFLRK
CCNA1_CARAU/268-385-----------------------------------------------------------------------PTVHQFLMQ
CCNB1_CARAU/266-384-----------------------------------------------------------------------PLPLQFLRR
Q941M7_MEDSA/349-473-----------------------------------------------------------------------PTTKTFLRR
Q94740_SPHGR/281-401-----------------------------------------------------------------------PLCLHFLRR
Q95WE6_ASTPE/274-391-----------------------------------------------------------------------PLCIHFLRR
Q96226_ADICA/397-520-----------------------------------------------------------------------PTTKSFLRR
Q98TA3_DANRE/305-422-----------------------------------------------------------------------PTINQFLTQ
Q9C2K2_NEUCS/516-631-----------------------------------------------------------------------PGPMSFLRR
CCA24_ARATH/329-452-----------------------------------------------------------------------PTSKTFLRR
CCA31_ARATH/219-342-----------------------------------------------------------------------PTSNTFLRR
CCA12_ARATH/310-433-----------------------------------------------------------------------PTAKCFLRR
Q9GTQ8_DROME/286-422-----------------------------------------------------------------------VTPLDFLEL
CCNB2_ORYLA/254-372-----------------------------------------------------------------------PLPLHFLRR
CCB23_ARATH/308-425-----------------------------------------------------------------------PTPYVFMKR
Q9LKC6_CICAR/324-443-----------------------------------------------------------------------PTPYVFLVR
Q9M4K9_PEA/216-340-----------------------------------------------------------------------PTIKTFLRR
Q9S7H9_SOLLC/192-320-----------------------------------------------------------------------VTPLSFIDH
CCB31_ARATH/274-391-----------------------------------------------------------------------PTPYVFMLR
Q9SBQ4_PETHY/303-423-----------------------------------------------------------------------PTPYVFLVR
CCB24_ARATH/309-426-----------------------------------------------------------------------PTPYVFMRR
Q9SMD4_SOLLC/184-309-----------------------------------------------------------------------VTPFSFLDF
CCD33_ARATH/188-310-----------------------------------------------------------------------VTPISFFDH
Q9SNV0_ANTMA/203-329-----------------------------------------------------------------------VTPISFFDH
Q9SNV2_ANTMA/176-296-----------------------------------------------------------------------ISPFCYLSF
Q9SXN7_TOBAC/190-313-----------------------------------------------------------------------VTPLSFVDH
Q9TY42_PARTE/121-227-----------------------------------------------------------------------PTAYQFLQK
Q9U7P9_9CILI/566-681-----------------------------------------------------------------------PNTLWFLNL
Q9XGI1_SOLLC/308-425-----------------------------------------------------------------------PTAYVFMRR
Q9XGI2_SOLLC/248-367-----------------------------------------------------------------------PTPYVFLVR
Q9XGI4_SOLLC/345-468-----------------------------------------------------------------------PTTKKFLRR
CCNE2_MOUSE/241-363-----------------------------------------------------------------------VTVISWLNL
CCD61_ARATH/156-288-----------------------------------------------------------------------VTPFSFLAF
Q9ZRG1_PEA/135-252-----------------------------------------------------------------------PTPYVFMVR
Q9ZRX9_TOBAC/198-319-----------------------------------------------------------------------YTPYTFIDY

PF03261

CD5R2_MOUSE/1-332MGTVLS........LSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKG..ESRL.......KRPSVLISA
CD5R1_RAT/1-296MGTVLS........LSPSY.....RKATLFED.......GAATVGHYTAVQNSKNAK...DKNL.......KRHS.IISV
O13123_XENLA/1-285MGTVLS........LSPGS.....RKASLYDD.......GSGSLAHYTSVSKGSGQKS..DKTL.......KRHSMFIPA
CD5R1_CAEEL/1-356MGANLTSPLPHHHRTQTTS.....VCNHLFSP.GDGGPTFAPQRDSNTSSRSSSNAK...ESVLMQGWNWSKRN..IQPV
Q9Y0G0_DROME/81-464GGVHIN........LQTQTQLSSHNLNNLANASKDT...ITNVLDTHNENSVLKAEKSSFEKNL.......KKHSIFINA

PF01858

RBL1_MOUSE/385-578-----------------------------------------------------------------TPVASATQSVSRLQS
RBR1_MAIZE/275-476-----------------------------------------------------------------TPVTSAMTTAKWLRE
RBF_DROME/376-560-----------------------------------------------------------------EPVRNATNNVKQLSA
RBR_CHERU/403-604-----------------------------------------------------------------TPVSTAMTTAKWLRT
RBL2_HUMAN/417-609-----------------------------------------------------------------TPVSTATHSLSRLHT
RB_HUMAN/373-573-----------------------------------------------------------------TPVRTVMNTIQQLMM
Q98966_NOTVI/353-548-----------------------------------------------------------------TPVRTAMNTIQNLLN

PF00134

CG11_CANAX/48-176----LESL-----------T..LVNP--------------------------------AMID-----------.LQP...
CCNA2_MOUSE/171-297----MEVK-----------C..KPKV--------------------------------GYMK-----------.RQP...
CCNB3_CAEEL/115-241----REVH-----------F..RVR.--------------------------------KYLH-----------.KHP...
CCNF_MOUSE/281-406----ASQA-----------V..NKQQ--------------------------------IFSV-----------.QKG...
CCT12_ARATH/28-169----EEIE-----------R..NSPS--------------------------------RRDG-----------.IDL...
CCNE_CAEEL/232-360----RDEI-----------P.R.ATR--------------------------------FLLG-----------.NHP...
O04388_CATRO/107-236----MEME-----------T.KRRPL--------------------------------PDYL-----------.DKVQ.K
O04389_CATRO/186-311----AENE-----------S..RVH.--------------------------------NYMD-----------.SQP...
O04399_TOBAC/107-236----LEVE-----------A.RRRPL--------------------------------SNYM-----------.EKVQ.N
REM1_SCHPO/145-271----LEIR-----------F..MPDY--------------------------------RHMS-----------.AQP...
CCNE_HEMPU/126-253----KEAL-----------C.P.RKH--------------------------------DCLK-----------.SHP...
O40946_HHV8/20-147----IEPR-----------FLTSDSV--------------------------------FGSF-----------.QQS...
CCNE3_XENLA/114-241----KDRI-----------Y.L.RDK--------------------------------NFFE-----------.KHP...
O45926_CAEEL/34-159----HEKK-----------Y..VLDD--------------------------------SFIN-----------.GGN...
CCB14_ARATH/133-258----VEEE-----------G..GIK.--------------------------------DYIG-----------.SQP...
O62573_SPHGR/213-339----AELK-----------...HRPK--------------------------------HGYM-----------.RK.Q.P
O65065_PICMA/77-204----VTRN-----------DQFTPKN--------------------------------FVTV-----------.FHGVRT
O76513_DROME/43-156----AEER-----------.......--------------------------------LLLK-----------.......
CCU41_ARATH/22-148----LTRR-----------.VATQSQ--------------------------------RVSV-----------.FHGLSR
O82136_PEA/72-205----KEKT-----------QQETYYE--------------------------------DLKN-----------..VVD.F
O93228_RANJA/112-237----LEAE-----------R..AVRP--------------------------------DYLK-----------.GQE...
O93231_BUFJA/24-149----LEIT-----------Q..AVKP--------------------------------KYLE-----------.GKE...
O93911_CANAX/234-360----LENK-----------F..TPDP--------------------------------NYMD-----------.FQD..D
O93916_PNECA/176-302----LEVL-----------T..LPLP--------------------------------DYMD-----------.RQK..E
CCNB2_HUMAN/137-262----LEVL-----------Q..SINP--------------------------------HFLD-----------.GRD...
CCNT_DROME/42-176----DQLA-----------...NSPS--------------------------------RRCG-----------.IKG...
O96434_PARTE/82-210----QEEK-----------Y..LVSN--------------------------------NYMN-----------.EQQQ.P
O97482_PARTE/85-212----EENK-----------Y..TI.N--------------------------------QYMT-----------.PEQQ.P
CCNB_ARBPU/145-272----LEVE-----------M..MVPA--------------------------------NYLD-----------.RQE..T
CG23_SCHPO/206-332----LEIE-----------T..MPSP--------------------------------TYMD-----------.RQK..E
CCNB1_XENLA/139-264----LEDA-----------Q..AVRQ--------------------------------NYLH-----------.GQE...
CCNB2_XENLA/134-259----LEVQ-----------Q..SVHP--------------------------------CYLE-----------.GKE...
CCNB_SPISO/172-297----LEGK-----------Y..PIRH--------------------------------NYLE-----------.NQE...
CCNA_DROME/206-332----SEKK-----------...HRPK--------------------------------PLYM-----------.RR.Q.K
CCNB_ASTPE/147-270----LERE-----------F..KVRT--------------------------------DYMA-----------.MQE...
CG12_YEAST/43-195----QSCK-----------F..KPNP--------------------------------KLID-----------.QQP...
CCNB_DROME/260-387----VELE-----------Q..PIHK--------------------------------DHLA-----------.GQK...
CCNB1_MOUSE/170-295----LEEE-----------Q..SVRP--------------------------------KYLQ-----------.GRE...
CCNA_PATVU/174-300----AESR-----------...HRSK--------------------------------PGYM-----------.KK.Q.P
CCNB_PATVU/155-280----LEET-----------F..AVKA--------------------------------NFLE-----------.GQE...
CG21_SCHPO/166-292----LERK-----------L..APPP--------------------------------NYMS-----------.VQQ..E
PCL1_YEAST/19-152----TTLR-----------VVPS..S--------------------------------NYPT-----------.PPGSPG
CG21_YEAST/212-337----LEII-----------T..LPNK--------------------------------ANLY-----------.KHK..N
CG22_YEAST/232-357----LEVI-----------T..LPKK--------------------------------EDLY-----------.QHR..N
CG23_YEAST/171-297----LEDL-----------Y..KPNP--------------------------------YYMD-----------.KQP..E
CG24_YEAST/210-336----LEVK-----------Y..RPNP--------------------------------YYMQ-----------.NQV..E
PUC1_SCHPO/99-227----TREK-----------NFLLNVH--------------------------------LSNQ-----------.QPE...
CCNAL_DAUCA/77-206----MEME-----------T.KRRPM--------------------------------MNYI-----------.EQVQ.K
CCNB1_SOYBN/197-322----VENE-----------S..RPH.--------------------------------DYIG-----------.SQP...
PCL2_YEAST/18-146----TTAS-----------IIKIKKT--------------------------------NSMI-----------.DIALPA
CCNB2_CHICK/141-266----LELQ-----------Q..SVRP--------------------------------HYLD-----------.GKT...
CCB11_ARATH/168-293----VESE-----------W..RPR.--------------------------------DYMA-----------.SQP...
CCNB2_MEDSA/73-199----IEYL-----------G..CVSP--------------------------------TYMD-----------.EQL...
CCND2_MOUSE/24-151----IEER-----------YLPQCSY--------------------------------FKCV-----------.QKD...
CCND3_HUMAN/26-153----LEER-----------YVPRASY--------------------------------FQCV-----------.QRE...
CGS5_YEAST/165-294----RELE-----------T..LPSH--------------------------------NYLL-----------.DKTSKY
CG21_EMENI/211-337----LEME-----------T..LPNP--------------------------------DYID-----------.HQP..D
CGS6_YEAST/123-252----KEIQ-----------M..LPTH--------------------------------NYLM-----------.DTQSPY
CCNA1_CAEEL/215-341----RQTK-----------N..RASH--------------------------------ECFD-----------.IQS...
CCN1_ANTMA/197-322----VENE-----------S..RPH.--------------------------------DYMG-----------.SQP...
CG22_SCHPO/139-265----LDLK-----------C..LPNP--------------------------------KYMD-----------.QQK..E
CCND1_RAT/26-153----TEET-----------CAPSVSY--------------------------------FKCV-----------.QRE...
CCNB3_CHICK/149-274----REEK-----------...FLLP--------------------------------DYME-----------.KQS...
CCNB_DICDI/188-314----KEQI-----------D..KIDK--------------------------------DYIK-----------.NQY...
CCD11_ARATH/50-182----DERH-----------FVP..GH--------------------------------DYLS-----------.RFQTRS
CCD21_ARATH/65-197----REIE-----------FCP..GT--------------------------------DYVK-----------.RLLSGD
CG12_CANAX/44-172----SVEA-----------KTLPSLS--------------------------------LIEQ-----------.QPE...
SSN8_YEAST/45-176----QSIT-----------KNIPITH--------------------------------RDLH-----------.......
CG21_CANAX/208-334----LETR-----------M..LPDP--------------------------------QYLF-----------.KQT...
CCNE1_CHICK/112-239----KEET-----------Y.V.RDK--------------------------------LYMQ-----------.RHP...
CCNA_HYDVD/168-294----SEAK-----------...YRPK--------------------------------SNYM-----------.RK.Q.T
CCNB_HYDVD/137-262----LEQR-----------...LVPG--------------------------------DYMP-----------.NQT...
CCNE_DROME/330-459----RDEQ-----------DSRLRSI--------------------------------SMLE-----------.QHP...
CCNA1_HUMAN/214-340----AEIR-----------...HRPK--------------------------------AHYM-----------.KK.Q.P
P92162_BOMMO/260-387----LEEK-----------Y..SIEP--------------------------------DHLK-----------.KQT...
P93102_CHERU/192-317----AEDE-----------S..RVR.--------------------------------DYMD-----------.SQP...
P93103_CHERU/77-208----NERQ-----------HFL..GL--------------------------------DYLK-----------.RFRNGD
CCC11_ORYSJ/4-144----KQLL-----------DQEDVDK--------------------------------VPQA-----------DSDRG.I
P93646_MAIZE/228-354----TEGT-----------C..LPLS--------------------------------SYMS-----------.SQA...
CGH2_SHV21/22-148----LREL-----------LLPKFTS--------------------------------LWEI-----------.QTE...
CG1_COLGL/38-166----IESE-----------T..TPDK--------------------------------RCIP-----------.......
CCNB1_CAEEL/81-206----HEKK-----------Y..LLEE--------------------------------CFME-----------.GGE...
PCL9_YEAST/19-146----STAS-----------IIKIREN--------------------------------NNPI-----------.QGCR.P
CCA22_ARATH/175-302----AELQ-----------Q..RPLA--------------------------------NYME-----------LVQR...
Q24158_DROME/126-255----VEEK-----------HHKIPDT--------------------------------YFSI-----------.QKD...
Q25123_HELRO/112-238----AEQR-----------...YMAK--------------------------------ANYM-----------.ER.Q.S
Q25168_HELTR/256-380----REVK-----------...FRIP--------------------------------DYMF-----------.QQT...
CCB12_ARATH/185-310----VEKE-----------...SQPK--------------------------------MYMH-----------.IQT...
CCB21_ARATH/174-300----MERF-----------S..CVPV--------------------------------DYMM-----------.QQI...
Q39331_BRANA/160-287----AEAK-----------...KQPA--------------------------------VDYM-----------.ETVQ.K
Q39877_SOYBN/83-212----MEMQ-----------K.KRRPM--------------------------------VNYI-----------.EKFQ.K
Q39878_SOYBN/207-334----TELQ-----------...RKPL--------------------------------TNYM-----------.DKLQ.K
Q39880_SOYBN/186-311----TEED-----------G..CVH.--------------------------------DYMG-----------.SQP...
Q40794_PETCR/187-312----AEHE-----------S..RVF.--------------------------------DYID-----------.FQP...
Q41731_MAIZE/173-299----TEGA-----------S..CVPT--------------------------------NYMS-----------.SQT...
Q41732_MAIZE/188-315----AETK-----------...KRPS--------------------------------TDFM-----------.EMIQ.K
Q41733_MAIZE/189-315----PMHE-----------S..RPID--------------------------------YMGQ-----------.TSP...
Q41734_MAIZE/155-280----AQHD-----------R..RPCD--------------------------------YI.D-----------.TQV...
CCNE1_MOUSE/113-240----KEKT-----------Y..LRDE--------------------------------HFLQ-----------.RHP...
CCB21_ORYSJ/157-283----NEEM-----------S..CVQP--------------------------------DYMS-----------.SQG...
CCD41_ARATH/45-178----KEKQ-----------H..LPSD--------------------------------DYIK-----------.RLRSGD
Q96226_ADICA/268-395----AELK-----------...RRPS--------------------------------LNFM-----------.DTVQ.Q
CCNB3_DROME/308-433----REAE-----------...FPIA--------------------------------DYMP-----------.RQI...
Q9PVT7_CARAU/117-244----KDKL-----------Y.L.RDT--------------------------------HVME-----------.RHP...
Q9PW42_CARAU/140-266----CEVK-----------...YRPK--------------------------------PGYM-----------.RK.Q.P
Q9S7H9_SOLLC/61-190----K...-----------.ENEFHL--------------------------------GFQS-----------..LIS.D
CCB31_ARATH/146-272----AEAL-----------N..PALG--------------------------------HYLS-----------.AHA...
CCB24_ARATH/180-307----NECR-----------S..CVPP--------------------------------NYME-----------.NQH...
Q9SMD4_SOLLC/51-182----K...-----------.ETEYEI--------------------------------SYN.-----------..VLEKN
CCD33_ARATH/59-186----K...-----------..QE.PC--------------------------------LYDE-----------..ILD.D
Q9SNV1_ANTMA/59-187----K...-----------.EQEYEL--------------------------------.YRV-----------..LED.N
Q9SNV2_ANTMA/45-174----DERD-----------L.A..GV--------------------------------NSSS-----------...SNQS
Q9SXN7_TOBAC/59-188----KEK.-----------..ET.IS--------------------------------NFET-----------..IKT.D
Q9U2M5_CAEEL/72-201----MEYE-----------EALQPNY--------------------------------HYFT-----------GVQE..N
Q9U7P9_9CILI/433-564----WEET-----------N..IPTG--------------------------------DYWK-----------.KQP...
Q9VE72_DROME/6-144----VELN-----------K..AQTM--------------------------------KPID-----------.......
Q9VKF0_DROME/205-327----PLTH-----------D..QVPD--------------------------------NYDT-----------.......
Q9VZP3_DROME/42-165----QELS-----------R...RPL--------------------------------FYLS-----------.......
Q9WRM3_9GAMA/20-147----HEAS-----------F.VTSTA--------------------------------CYGT-----------.IQT...
Q9XGI0_MEDSA/224-351----AELS-----------...RRPY--------------------------------PNFM-----------.ETVQ.Q
Q9XGI1_SOLLC/180-306----MEVN-----------S..CASP--------------------------------YYMA-----------.QQA...
Q9XGI2_SOLLC/121-246----TEDE-----------N..RPC.--------------------------------DYMD-----------.SQP...
Q9YTJ4_ATHV3/30-156----LREL-----------LLPKWTS--------------------------------LWEN-----------.QQE...
CCNE2_MOUSE/112-239----KENR-----------Y.V.HDK--------------------------------HFQV-----------.LHS...
CCD61_ARATH/26-154----VEFQ-----------H..MPSS--------------------------------HYFH-----------SLKS...
Q9ZRG1_PEA/7-133----TEAH-----------S..QALS--------------------------------NYMS-----------.IQT...
Q9ZRX9_TOBAC/64-196----REME-----------FLP..KD--------------------------------DYVE-----------.RLRSGD

PF08613

PHO80_YEAST/33-170----RMLV-----------SLIAINE--------------------------------NSAT-----------KKSDDQI
YGZA_SCHPO/29-176----VFLS-----------RLTRLND--------------------------------SKQE-----------ATESDQI
Q872V6_NEUCS/156-314----GVQL-----------RTPNPTP--------------------------------PPGL-----------SSSDAKS
Q8IEW5_9TRYP/370-620----LECD-----------RRVANAS--------------------------------GTAC-----------ASAHSPS
Q949F8_ORYSA/17-159----GILE-----------RVAGRND--------------------------------AAAT-----------PAELAAA
CGP1_SCHPO/7-134----TVIL-----------SIYPLAK--------------------------------STNQ-----------QSHS...
Q8I8A9_9TRYP/370-620----LECD-----------RRVANAS--------------------------------GTAC-----------ASAHSPS
PCL7_YEAST/108-264----ALLN-----------RIITAND--------------------------------ETTD-----------VSQQVSD
Q83C02_COXBU/10-148----RILD-----------LFPAFSL--------------------------------TPVE-----------KSSFHSC

PF00382

TF3B_KLULA/193-266----LGDK-----------KIKVIRD--------------------------------AVKL------------------
TF2B_PYRWO/116-186----LPR.-----------..HVEEE--------------------------------AARL------------------
TF2B_KLULA/137-207----LPK.-----------..IVKDC--------------------------------AKEA------------------
TF2B_YEAST/133-203----LPK.-----------..IVKDC--------------------------------AKEA------------------
TF2B_HALVA/30-100----LSE.-----------..EVQSK--------------------------------ANEI------------------
TF3B_CANAL/95-165----IPD.-----------..YIAEA--------------------------------AGEW------------------
TF2B_DROME/214-284----LPN.-----------..MVQRA--------------------------------ATHI------------------
TF2B_PYRWO/212-282----LSE.-----------..KVRRR--------------------------------AIEI------------------
TF3B_KLULA/98-168----IPE.-----------..YVTDA--------------------------------AFQW------------------
TF3B_CANAL/190-263----FKDK-----------ATKVAKD--------------------------------AVKL------------------
TF2B_DROME/120-190----LPK.-----------..TIVDR--------------------------------ANNL------------------
TF2B_KLULA/245-315----LSV.-----------..QVANA--------------------------------AEYI------------------

PF01857

RBR2_MAIZE/594-721----ILKL-----------AAIRIRN--------------------------------LCER-----------I.Q....
RBL1_HUMAN/786-944----VYHL-----------ASVRLRD--------------------------------LCLK-----------L.D....
RB_HUMAN/645-766----VYRL-----------AYLRLNT--------------------------------LCER-----------LLS....
RBL2_HUMAN/834-992----VYHL-----------AAVRLRD--------------------------------LCAK-----------L.D....
RBF_DROME/580-706----VYLL-----------GWLRIQK--------------------------------LCSE-----------L.S....
RBR_CHERU/724-863----IVKL-----------AAVRING--------------------------------MIER-----------L.EKLEK

PF02984

CCNB3_CAEEL/243-364....F.GR...........V...CRV..................D..M.K........TLTM------------------
Q7QC70_ANOGA/538-653....Y.AR...........V...NRI..................P..M.M........TLTL------------------
A4HKX7_LEIBR/155-297....A.WT...........V...LEGDDFLGVGT..DEEQRRQHF..A.I........VRHA------------------
CCNF_MOUSE/408-531....L.LT...........L...VPV..................A..P.R........TQHL------------------
CCNB3_HUMAN/1259-1375....Y.AR...........C...IHT..................N..M.K........TLTL------------------
Q0UCR8_PHANO/466-581....I.SK...........A...DDY..................D..L.E........TRTL------------------
Q291N4_DROPS/375-501....Y.SK...........A...AGA..................E..D.E........HHAM------------------
CCNA1_MOUSE/298-415....Y.LR...........R...QGV..................C..I.R........TENL------------------
Q6BGT2_DEBHA/350-465....T.SK...........A...DDY..................D..Y.E........TRTL------------------
A0C1C9_PARTE/197-310....Q.IQ...........G...ANL..................C..D.K........INHA------------------
A0DMF0_PARTE/199-312....Q.IS...........G...ANL..................C..D.K........INYA------------------
A0E0R4_PARTE/214-320....F.S................SEL..................D..P.K........NKAL------------------
CCA33_ARATH/190-313....F.IR...........V...AQEDF.............KVPN..L.Q........LEPL------------------
A1C7V2_ASPCL/489-604....I.SK...........A...DDY..................D..L.E........TRTL------------------
A1CID9_ASPCL/361-475....I.SK...........A...DNY..................D..I.Q........TRTL------------------
A2DQ77_TRIVA/248-364....L.LR...........I...SGQ..................T..Q.E........SMLF------------------
A2DZV8_TRIVA/235-351....F.LR...........I...SGQ..................T..Q.E........SMLF------------------
A2E0Q4_TRIVA/216-333....F.IS...........I...ANA..................D..S.M........MNSF------------------
A2E6K7_TRIVA/216-333....F.LI...........L...VNS..................D..M.I........LNRF------------------
A2F2K2_TRIVA/212-328....F.MQ...........I...QDE..................T..K.E........DLLL------------------
A2ZM34_ORYSI/249-372....F.TR...........S...CQEDK.............KRSS..L.L........LEFM------------------
A3AKA7_ORYSJ/256-379....F.IR...........S...SQEDD.............KYPS..L.P........LEFM------------------
A3LN44_PICST/322-438....I.SK...........A...DDY..................D..V.Q........SRTL------------------
A4RSW0_OSTLU/207-322....YLSK...............IKA..................D..Q.L........CSHL------------------
A5AEK5_VITVI/324-442....F.IK...........A...SIP..................D..Q.E........MEHM------------------
A5BUM0_VITVI/360-483....F.LR...........A...AQASY.............KNPS..L.E........LEYL------------------
A5DUV2_LODEL/512-628....I.SK...........A...DDY..................D..V.Q........SRTL------------------
A6RR46_BOTFB/346-460....I.SK...........A...DDY..................D..I.Q........TRTL------------------
A6ZXH4_YEAS7/299-414....I.SK...........A...DDY..................E..H.D........TRTL------------------
A7A198_YEAS7/338-453....I.SK...........A...DDY..................D..F.E........PRTL------------------
A7F1V1_SCLS1/469-584....I.SK...........A...DDY..................D..L.E........TRTL------------------
A7S8H6_NEMVE/110-226....F.AK...........V...ASA..................D..V.K........TLTL------------------
A7SEI5_NEMVE/172-293....F.IK...........A...TN.VP.............ESMA..P.K........VEAL------------------
A7SPG5_NEMVE/166-283....N.SK...........A...GAV..................G..A.E........EHTM------------------
A7TR46_VANPO/331-446....I.SK...........A...DDY..................E..Y.D........IRTL------------------
A7Y7X0_CUCSA/197-329....IVKR...........I...GL.................................KNNL------------------
A7YYE4_DANRE/155-279....FLAKLPI.....HQSS...KQI................................LRKH------------------
O04388_CATRO/238-361....L.TR...........V...VQDGD.............KNPN..L.Q........FEFL------------------
O04389_CATRO/313-431....F.IK...........A...SVP..................D..S.N........MENM------------------
O04398_TOBAC/319-436....Y.IK...........A...AVS..................N..A.Q........MENM------------------
REM1_SCHPO/273-388....L.TI...........V...NKW..................E..S.Q........LRIM------------------
CCNE_HEMPU/255-381....F.MQ...........ICNAEEIANRK.........TNFHF..............PSYS------------------
O45926_CAEEL/161-293....I.SK...........TLTENDVN...............PID..K.EAF....YYVHNI------------------
CCB14_ARATH/260-379....Y.VK...........A...AVP.................CD..A.E........MEKL------------------
O65064_PICMA/98-215....F.LK...........A...AGS..................D..K.E........MENL------------------
CG1C_SCHPO/162-280....FVAD....................................D..K.N........VTKV------------------
O77212_DREPO/291-408....F.LK...........S...IDA..................E..E.K........LKSL------------------
O82137_PEA/102-224....F.LK...........AASVSLPS................SD..L.A........LENM------------------
O82678_CHERU/199-326....LIRK...........L...KL.................................KPHF------------------
O82717_LUPLU/324-441....F.IK...........A...SVP..................D..Q.E........LENM------------------
O93228_RANJA/239-357....A.SK...........I...GEV..................D..A.V........LHTL------------------
O93916_PNECA/304-419....V.SK...........A...DNY..................D..I.Q........TRTV------------------
O96434_PARTE/212-329....F.GR...........I...AGL..................D..T.K........NLSL------------------
CCNB_ARBPU/274-395....N.SK...........A...AGV..................D..A.Q........KHTL------------------
CG23_SCHPO/334-448....I.SK...........A...DFY..................D..I.Q........TRTV------------------
CCNB_SPISO/299-415....D.SK...........A...GQV..................D..A.N........KHTL------------------
CCNA_DROME/334-451....Y.AV...........L...CDM..................P..E.K........LKYM------------------
CCNB_MARGL/258-375....N.SK...........A...GGV..................D..G.Q........KHTM------------------
CCNB_ASTPE/272-390....C.SK...........A...GGV..................D..G.H........KHTL------------------
CCNA1_XENLA/295-412....Y.LQ...........R...HAV..................S..V.K........MEHL------------------
CCNA_PATVU/302-419....Y.AK...........M...ADT..................D..E.T........TKSL------------------
CCNB_PATVU/282-398....N.SK...........A...GQV..................D..A.T........KHTL------------------
CCNE1_HUMAN/244-366....Y.MQ...........VAYLNDLHE.............VLL..............PQYP------------------
CG21_SCHPO/294-409....I.SR...........A...DSY..................D..H.D........IRML------------------
CG21_YEAST/339-454....I.SK...........A...DDY..................D..I.Q........SRTL------------------
CCNAL_DAUCA/208-330....F.IR...........A...VQENP.............DVPK..L.K........FEFL------------------
CCNB2_CHICK/268-386....A.SK...........A...GEA..................D..A.E........QHTL------------------
CCB11_ARATH/295-418....F.IK...........A...SIA..................D..E.K........MENM------------------
CCNA2_BOVIN/307-425....Y.FL...........H...QQP.................AN..C.K........VESL------------------
CCNB2_MEDSA/201-318....F.LK...........A...AQA..................D..K.K........LELV------------------
CCND2_HUMAN/154-277....ILRKLPQ.....QREK...LSL................................IRKH------------------
CGS5_YEAST/296-418....I.SK...........A...DDY..................D..P.V........NRNI------------------
CGS6_YEAST/254-374....I.SK...........A...DNY..................C..I.E........TRNM------------------
CCNA1_CAEEL/343-459....F.AK...........R...MNF..................T..K.K........MRNT------------------
CCN2_ANTMA/319-438....F.IK...........A...SLP..................D..SDV........EKNM------------------
CG22_SCHPO/267-382....I.SQ...........A...EGY..................D..A.Q........TRTL------------------
CCNB3_CHICK/276-392....F.AK...........C...ARA..................S..M.E........TLTL------------------
CCD11_ARATH/184-308....FAYK...........I...DP.................................SGTF------------------
CCD31_ARATH/189-307....IIRR...........L...GL.................................KNNA------------------
CCNA2_CHICK/273-390....Y.FL...........H...QQT..................N..A.K........VESL------------------
CCNE1_DANRE/246-368....Y.MQ...........MAYLKETAE.............VLT..............AQYP------------------
CCNA_HYDVD/296-415....Y.LF...........A...ANA..................KPES.Q........LKYL------------------
CCNB_HYDVD/264-380....N.SK...........A...GAV..................D..A.Q........KHTL------------------
P90681_ASTPE/322-438....Y.LK...........A...AKA..................D..S.R........NGTS------------------
P92162_BOMMO/389-509....F.VK...........A...ARG..................T..S.R........NHHL------------------
P93102_CHERU/319-438....Y.VK...........A...SVT.................LD..S.E........MENM------------------
P93103_CHERU/210-333....FLYK...........L...SG.................................DKMP------------------
P93557_SESRO/318-435....F.IK...........A...SVP..................D..E.A........LENM------------------
P93646_MAIZE/356-473....Y.LK...........A...AMC..................D..A.E........LENM------------------
CCB21_ORYSI/285-402....F.LK...........A...AQS..................D..K.Q........LQLL------------------
CCNB1_CRIGR/296-414....A.SK...........I...GEV..................D..V.E........QHTL------------------
Q08C91_DANRE/272-388....Y.AK...........C...VNA..................G..M.D........TLTL------------------
Q09IZ1_ONCMY/251-369....A.SK...........A...GNA..................D..V.E........KHTL------------------
CCB22_ORYSJ/293-410....F.LK...........A...AQS..................D..K.K........LELM------------------
CCA14_ORYSJ/216-339....F.LR...........A...AQVCH.............EAPV..L.H........LEFL------------------
CCB13_ORYSJ/341-458....Y.LK...........A...ALG..................D..E.E........LEHM------------------
Q0UMA7_PHANO/348-462....I.SK...........A...DNY..................D..I.Q........TRTL------------------
Q0VA13_XENTR/226-348....L.ST...........I...GKC..................P..M.K........ILYL------------------
CCD42_ARATH/171-289....FLSK...........I...NGY................................DQEP------------------
CCNB1_CAEEL/208-340....L.SR...........ILSENDAS...............PID..N.QAF....CYTYNI------------------
CCF32_ORYSJ/267-390....F.LF...........S...CRGSN.............RPIN..I.R........LELM------------------
CCA22_ARATH/304-427....F.IK...........A...AQASY.............KVPF..I.E........LEYL------------------
Q16TY2_AEDAE/355-477....Y.SK...........A...AKA..................A..D.K........NHLC------------------
Q16VG6_AEDAE/419-535....Y.AR...........V...NRI..................D..M.Q........VLTL------------------
Q17NN3_AEDAE/310-427....Y.CV...........M...NDV..................P..D.K........VKHM------------------
Q1L8M6_DANRE/153-279....ILHKLPF.....HEDR...LTL................................IRKH------------------
Q23JX5_TETTS/324-441....Y.GR...........V...DKL..................D..K.K........SFDM------------------
Q25123_HELRO/240-368....L.LDRLGAYKKGPNGV...CDD..................G..G.R........WNSL------------------
Q25168_HELTR/382-498....F.AT...........C...VGA..................N..L.K........TLTL------------------
Q28DU2_XENTR/291-408....Y.FQ...........I...QPV..................S..P.K........VESL------------------
Q28GP5_XENTR/256-374....A.SK...........C...CSA..................D..A.G........QHTL------------------
Q29CG1_DROPS/434-556....Y.AR...........C...AKV..................Q..M.P........TLTL------------------
Q29DY8_DROPS/354-471....Y.AV...........M...CDM..................P..E.K........LKSL------------------
Q2ABE6_CAMSI/198-326....IVRR...........F...GF.................................KTNL------------------
Q2ABE7_CAMSI/203-327....ITRR...........L...GL.................................KNRL------------------
Q2ABE9_CAMSI/308-433....F.IK...........A...SVPS................NDHRE.E........MENM------------------
Q2HAK4_CHAGB/352-466....I.SK...........A...DNY..................D..I.Q........SRTI------------------
Q2HAS9_CHAGB/515-630....I.SK...........A...DDY..................D..L.E........TRTL------------------
CCND1_BOVIN/155-283....FLSKMPV.....AEEN...KQI................................IRKH------------------
Q2PHK8_DAUCA/314-432....F.IK...........A...SIP..................S..EPA........VENM------------------
Q2PHK9_DAUCA/330-448....F.IK...........A...SLP..................N..EPD........VNNM------------------
Q2PHL0_DAUCA/311-430....Y.IK...........S...SVP.................SD..P.E........MENM------------------
CCA21_ORYSJ/359-482....F.LR...........A...AQASR.............NVPS..I.T........LGYL------------------
Q2UPT4_ASPOR/192-299....AVID...............TSY..................D..P.E........VEHM------------------
Q2V5Z8_BRACM/228-351....F.TR...........V...AQEDF.............NESL..L.Q........IECL------------------
Q2WGP0_ALLCE/280-397....F.LK...........A...AGS..................E..K.K........LELL------------------
Q2WGP2_ALLCE/358-475....F.IK...........A...AMS..................D..K.Q........LEHM------------------
CCB12_ARATH/312-429....F.IK...........A...SMS..................D..P.E........MENM------------------
CCB21_ARATH/302-419....F.LK...........A...AQA..................D..K.K........CEVL------------------
CCB13_ARATH/289-406....F.IK...........A...SGS..................D..Q.K........LENL------------------
CCB22_ARATH/303-421....F.LK...........A...AQS..................D..K.K........LEIL------------------
Q39331_BRANA/289-412....L.FS...........G...CPRVH.............EAPC..M.Q........LECM------------------
Q39877_SOYBN/214-337....Y.AN...........V...ASDVQ.............KTPN..S.Q........IEHL------------------
Q39878_SOYBN/336-459....F.IQ...........A...AQSSY.............KAPY..V.E........LEFL------------------
Q39880_SOYBN/313-433....D.TK...........A...STP.................SD..K.E........MENM------------------
Q3KPK0_XENLA/154-279....ILRKLPL.....PKDK...LLL................................IRKH------------------
Q3KQA7_XENLA/288-404....F.AK...........C...AHA..................T..M.E........TLTL------------------
Q40223_LUPLU/307-426....Y.IK...........A...STP.................YD..K.K........IEDM------------------
Q40338_MEDSA/212-338....IIRR...........L...GL.................................KTNL------------------
Q40488_TOBAC/238-361....F.TK...........A...AQDNV.............DFLT..L.H........FEFL------------------
Q40492_TOBAC/247-370....F.TG...........V...AQEDY.............KTPN..L.Q........LEFL------------------
Q40514_TOBAC/347-470....F.VR...........A...AQGLN.............EVLS..L.Q........LEHL------------------
Q40516_TOBAC/291-408....F.IK...........A...SLP..................D..S.E........IENM------------------
Q41733_MAIZE/317-437....F.AK...........A...AGS.................AD..E.Q........LQHT------------------
Q41734_MAIZE/282-407....F.LK...........A...AT.LG.............NIVE..K.E........MENM------------------
Q49U21_CRYNE/355-469....I.SK...........A...DDY..................D..V.Q........TRTL------------------
Q4CS48_TRYCC/197-328....F.LD...........S...GDT..................E..A.M........VRDA------------------
Q4DWL9_TRYCC/229-371....L.LS...........VMEGLVHS...............GSL..S.EDYTLQLPLLRHT------------------
CCD42_ORYSJ/212-330....FLRK...........L...NS.................................GNAA------------------
Q4RZE5_TETNG/155-280....FLSKLRI.....FPST...KHV................................LRKH------------------
Q4SG06_TETNG/155-272....F.TA...........I...QSA.....................CPL........THNL------------------
Q4T0M3_TETNG/224-342....A.SK...........I...YEV..................T..A.E........QHTL------------------
Q4T2Y9_TETNG/114-254YLHASVKE..................................................DDLY------------------
Q4T8S9_TETNG/1145-1270....FLRQLPG.....MRDS...KLV................................LRKH------------------
Q4TVR6_HELTR/235-352....F.SK...........A...GEV..................E..G.E........THNL------------------
CCNB_DICDI/316-434....F.SK...........A...AGS..................D..S.R........THSL------------------
CG11_CANAL/174-308....A.ID...........SNNLSNNTTNDIENKSVRPNRKSSIS..S.A........VTAV------------------
Q5D894_GOSHI/87-204....F.IK...........A...SIP..................D..P.K........MENM------------------
Q5D8P0_SCHJA/269-392....L.SK...........A...VDA..................D..R.T........MHNL------------------
Q5KAX2_CRYNJ/366-482....I.SK...........A...DGY..................D..I.Q........SRTV------------------
Q5SCB6_OSTTA/230-346....F.FK...........A...AGG..................D..R.Q........FQLY------------------
Q5SCB7_OSTTA/222-339....YLSR...............IHT..................S..T.R........CSSL------------------
Q5T8J1_HUMAN/105-230....ILHRLSL.....PRDR...QAL................................VKKH------------------
Q5U4W4_XENLA/240-362....Y.LQ...........VSSLKDHPK.............LLL..............PQYS------------------
Q5UAU8_PENJP/269-385....N.SK...........A...GSV..................D..A.S........QHTL------------------
CCNF_XENTR/414-537....L.SH...........L...IPL..................D..R.S........TLHL------------------
Q5ZKI9_CHICK/155-280....ILHHLPL.....PKDK...MEL................................VKKH------------------
Q5ZMH4_CHICK/247-368....Y.LQ...........VDALKDVPK.............VLL..............PQYS------------------
CCNB1_ANGJA/272-390....A.SK...........I...GEV..................T..A.E........HHTL------------------
Q60FY1_ORENI/302-418....Y.AK...........C...VSA..................S..M.D........TLTL------------------
Q60FY2_ANGJA/277-393....Y.AK...........C...VQA..................N..M.E........TLTL------------------
A8XRM2_CAEBR/208-340....L.SR...........VLSEDESN...............PVD..Q.QAF....YYAYNI------------------
CCNB3_CANFA/1202-1318....Y.AR...........C...LHA..................S..M.K........TLTL------------------
Q6CE22_YARLI/306-421....T.SK...........A...DDY..................D..L.E........TRTL------------------
Q6CEJ4_YARLI/393-508....I.SK...........A...DDF..................D..I.H........SRTF------------------
Q6CT04_KLULA/317-432....V.SK...........A...DDY..................E..Y.D........TRTV------------------
CCNJ_XENLA/145-273YLSIAVHD..................................................TDLH------------------
Q6FNV2_CANGA/314-429....I.SK...........A...DDY..................E..Y.R........TRNL------------------
Q6FQU1_CANGA/326-455....I.SK...........A...DDY..................D..Y.N........IRTL------------------
Q6FVY0_CANGA/262-383....L.SK...........A...DGY..................D..G.E........CRMI------------------
Q6FVY1_CANGA/344-459....I.SK...........A...DDY..................D..I.Q........SRTL------------------
Q6IR86_XENLA/262-380....A.SK...........I...GEV..................D..S.V........HHTL------------------
CCF13_ORYSJ/255-372....F.TR...........YYGDGKE..................E..E.L........LKEA------------------
Q6P801_XENTR/266-384....A.SK...........I...GEV..................T..A.E........QHSL------------------
Q6T2E9_BUFBG/263-381....A.SK...........S...CSA..................D..A.E........QYTL------------------
Q6X269_USTMD/465-579....I.SK...........A...DDY..................D..I.R........TRTL------------------
Q6X270_USTMD/433-547....I.SK...........A...DNY..................D..I.Q........TRTV------------------
Q6ZZ83_SPHGR/342-458....F.LK...........A...AQA..................N..S.K........TEHL------------------
Q75A51_ASHGO/248-363....V.SK...........A...DNY..................E..Y.D........IRTL------------------
Q75EI0_ASHGO/418-533....I.SK...........A...DDY..................D..I.Q........SRTL------------------
Q790L7_MOUSE/155-283....FLSKMPE.....ADEN...KQT................................IRKH------------------
CCA11_ORYSJ/372-495....F.VR...........V...AQVSD.............EDPA..L.H........LEFL------------------
Q7PPJ1_ANOGA/320-449....F.SK...........A...AKA..................S..D.V........NHVL------------------
Q7Q0E8_ANOGA/187-304....Y.CV...........M...NDV..................P..D.K........VKYL------------------
Q7XAB7_EUPES/184-308....IIRR...........L...GL.................................KNHL------------------
Q7Z4Z4_HUMAN/264-382....A.SK...........A...GEV..................D..V.E........QHTL------------------
Q7ZVA8_DANRE/252-370....A.SK...........A...GNA..................D..A.E........KHTL------------------
Q7ZYJ6_XENLA/153-279....FLNKMPL.....TEDT...KQI................................IRKH------------------
CCNB3_MOUSE/1265-1381....Y.AS...........C...IHA..................S..M.K........TLTL------------------
Q84LE4_SILLA/352-474....F.VR...........A...AQVMN.............EVPA..F.Q........LECL------------------
Q84V88_POPAL/200-324....IIRR...........L...GL.................................KTHM------------------
Q8GZU3_9ROSI/205-332....ITRR...........L...GL.................................EHYL------------------
CCD41_ARATH/180-299....FLRK...........M...SKC................................DQEP------------------
Q8LK74_LAGSI/187-313....ISRR...........L...GF.................................KEHI------------------
Q8LPW3_HELAN/178-304....IVRR...........L...GL.................................SNHL------------------
Q8SRF2_ENCCU/179-293....C.SK...........A...NNY..................E..I.C........SRTV------------------
CCNA1_CARAU/268-385....YTLE...............GHI..................C..A.R........TVNL------------------
CCNB1_CARAU/266-384....A.SK...........I...GDV..................T..A.E........HHTL------------------
Q941M7_MEDSA/349-473....F.LR...........A...AQASY.............KRPS..I.E........LEYL------------------
Q94740_SPHGR/281-401....N.SK...........A...AMV..................D..P.Q........KHTL------------------
Q95WE6_ASTPE/274-391....C.SK...........A...GGV..................D..G.H........KHTL------------------
Q96226_ADICA/397-520....F.VR...........A...AQAGQ.............KSPT..L.Q........LEFL------------------
Q98TA3_DANRE/305-422....Y.FL...........H...QPV..................S..S.K........VESL------------------
Q9C2K2_NEUCS/516-631....I.SK...........A...DDY..................D..L.E........TRTL------------------
CCA24_ARATH/329-452....F.LR...........A...AQVSF.............PNQS..L.E........MEFL------------------
CCA31_ARATH/219-342....F.TR...........V...AQEDF.............EMSH..L.Q........MEFL------------------
CCA12_ARATH/310-433....F.LR...........A...AQGRK.............EVPS..L.L........SECL------------------
Q9GTQ8_DROME/286-422....LMMRLPIGSKNFPDIN...IGK................................VRGH------------------
CCNB2_ORYLA/254-372....A.TK...........V...AGA..................D..V.E........KHTL------------------
CCB23_ARATH/308-425....F.LK...........A...AQS..................D..K.K........LEIL------------------
Q9LKC6_CICAR/324-443....F.IK...........A...SMT..................D..S.D........VENM------------------
Q9M4K9_PEA/216-340....FITK...........V...GQEGV.............DASE..L.Q........FEFL------------------
Q9S7H9_SOLLC/192-320....IMRR...........F...GF.................................MSNL------------------
CCB31_ARATH/274-391....F.LK...........A...AQS..................N..K.K........LEQL------------------
Q9SBQ4_PETHY/303-423....Y.IK...........A...AMPS................DD..Q.E........IQNM------------------
CCB24_ARATH/309-426....F.LK...........A...AQS..................D..K.K........LELL------------------
Q9SMD4_SOLLC/184-309....ITRR...........L...GL.................................KHCL------------------
CCD33_ARATH/188-310....IIRR...........Y...SF.................................KSHH------------------
Q9SNV0_ANTMA/203-329....IVRR...........F...EL.................................MNNV------------------
Q9SNV2_ANTMA/176-296....FALK...........I...DP.................................TGTY------------------
Q9SXN7_TOBAC/190-313....IIRR...........L...GL.................................KSHI------------------
Q9TY42_PARTE/121-227....Y.S................TNL..................D..P.K........DKAL------------------
Q9U7P9_9CILI/566-681....YKEE...............LQV..................E..E.E........TSHI------------------
Q9XGI1_SOLLC/308-425....Y.LK...........A...AQC..................D..R.K........LELL------------------
Q9XGI2_SOLLC/248-367....Y.IK...........A...AVP.................SD..Q.E........MENM------------------
Q9XGI4_SOLLC/345-468....F.VQ...........A...SQASY.............EVPS..V.E........LEFM------------------
CCNE2_MOUSE/241-363....F.LQ...........VDAVKDVPK.............VLL..............PQYS------------------
CCD61_ARATH/156-288FISLFELK...........E...ED.................................PLLL------------------
Q9ZRG1_PEA/135-252....F.IK...........A...AQS..................N..M.K........LEHM------------------
Q9ZRX9_TOBAC/198-319....FMRK...........M...NG.................................DQIP------------------

PF03261

CD5R2_MOUSE/1-332----LTWKRLVAASAKKKKGSKKVTPKP..............ASTGPDPLVQQRNRENLLRKGRDGPDGGGTAKPLAVPV
CD5R1_RAT/1-296----LPWKRIVAV.SAKKKNSKKAQPN.................SSYQSNIAHLNNENLKKS..................
O13123_XENLA/1-285----LTWKRLVA..STKKKTSRKSTAN.................NNYQKDVAHLNHENVKKS..................
CD5R1_CAEEL/1-356----MSRRSLPKSGSSSEATSSKSSDSL..VSFTRNVSTS..TSSQYGKISISLDRNQNYKS...........VPRPSDT
Q9Y0G0_DROME/81-464----LSWKKLSTSHNKKKIENKNKCANLPTACFKAQLLESSFASSSDKNRNIQLHCNRIDEHNQQHCNQHPHPHPHPHQH

PF01858

RBL1_MOUSE/385-578----IVAGLKSAPSEQLLNIFESCMR-----------------------NPMGNIIKIVKGI------------------
RBR1_MAIZE/275-476----VISSLPDKPSSKLQQFLSSCDR-----------------------DLTNAVTERVSIV------------------
RBF_DROME/376-560----FGR..ITEPTDFVKQAG.....-----------------------...EEVIAKLLSI------------------
RBR_CHERU/403-604----YISPLPSKPSPQLEKYLMSCDR-----------------------NISSEVVRRAHII------------------
RBL2_HUMAN/417-609----MLTGLRNAPSEKLEQILRTCSR-----------------------DPTQAIANRLKEM------------------
RB_HUMAN/373-573----ILNSASDQPSENLISYFNNCTV-----------------------NPKESILKRVKDI------------------
Q98966_NOTVI/353-548----SLASASDQPSPTLKAYFNNCTS-----------------------NPTRAIQERENNL------------------

PF00134

CG11_CANAX/48-176EIQW.F--------------------------------------------------------------------------
CCNA2_MOUSE/171-297DITN.S--------------------------------------------------------------------------
CCNB3_CAEEL/115-241EVDV.K--------------------------------------------------------------------------
CCNF_MOUSE/281-406.LSD.T--------------------------------------------------------------------------
CCT12_ARATH/28-169KTET.R--------------------------------------------------------------------------
CCNE_CAEEL/232-360DMDD.E--------------------------------------------------------------------------
O04388_CATRO/107-236DVTA.N--------------------------------------------------------------------------
O04389_CATRO/186-311EIND.K--------------------------------------------------------------------------
O04399_TOBAC/107-236DVTP.T--------------------------------------------------------------------------
REM1_SCHPO/145-271YYVT.E--------------------------------------------------------------------------
CCNE_HEMPU/126-253SLGE.R--------------------------------------------------------------------------
O40946_HHV8/20-147.LTS.H--------------------------------------------------------------------------
CCNE3_XENLA/114-241QLQP.N--------------------------------------------------------------------------
O45926_CAEEL/34-159.VNS.K--------------------------------------------------------------------------
CCB14_ARATH/133-258EINE.K--------------------------------------------------------------------------
O62573_SPHGR/213-339DITN.N--------------------------------------------------------------------------
O65065_PICMA/77-204P.....--------------------------------------------------------------------------
O76513_DROME/43-156.....Q--------------------------------------------------------------------------
CCU41_ARATH/22-148P.....--------------------------------------------------------------------------
O82136_PEA/72-205VSLS.Q--------------------------------------------------------------------------
O93228_RANJA/112-237.ITG.N--------------------------------------------------------------------------
O93231_BUFJA/24-149.ITG.N--------------------------------------------------------------------------
O93911_CANAX/234-360.LKW.E--------------------------------------------------------------------------
O93916_PNECA/176-302.LQW.K--------------------------------------------------------------------------
CCNB2_HUMAN/137-262.ING.R--------------------------------------------------------------------------
CCNT_DROME/42-176DDEL.Q--------------------------------------------------------------------------
O96434_PARTE/82-210DLNA.R--------------------------------------------------------------------------
O97482_PARTE/85-212DINI.K--------------------------------------------------------------------------
CCNB_ARBPU/145-272QITG.R--------------------------------------------------------------------------
CG23_SCHPO/206-332.LAW.K--------------------------------------------------------------------------
CCNB1_XENLA/139-264.VTG.N--------------------------------------------------------------------------
CCNB2_XENLA/134-259.INE.R--------------------------------------------------------------------------
CCNB_SPISO/172-297.ITG.K--------------------------------------------------------------------------
CCNA_DROME/206-332DISH.N--------------------------------------------------------------------------
CCNB_ASTPE/147-270.ITE.R--------------------------------------------------------------------------
CG12_YEAST/43-195EMNPVE--------------------------------------------------------------------------
CCNB_DROME/260-387EVSH.K--------------------------------------------------------------------------
CCNB1_MOUSE/170-295.VTG.N--------------------------------------------------------------------------
CCNA_PATVU/174-300DITN.S--------------------------------------------------------------------------
CCNB_PATVU/155-280.VTG.K--------------------------------------------------------------------------
CG21_SCHPO/166-292.IDW.V--------------------------------------------------------------------------
PCL1_YEAST/19-152EKHL.T--------------------------------------------------------------------------
CG21_YEAST/212-337..IK.Q--------------------------------------------------------------------------
CG22_YEAST/232-357..IH.Q--------------------------------------------------------------------------
CG23_YEAST/171-297.LRW.S--------------------------------------------------------------------------
CG24_YEAST/210-336.LTW.P--------------------------------------------------------------------------
PUC1_SCHPO/99-227.LRW.S--------------------------------------------------------------------------
CCNAL_DAUCA/77-206DVTS.N--------------------------------------------------------------------------
CCNB1_SOYBN/197-322EINE.R--------------------------------------------------------------------------
PCL2_YEAST/18-146......--------------------------------------------------------------------------
CCNB2_CHICK/141-266.ING.R--------------------------------------------------------------------------
CCB11_ARATH/168-293DINE.K--------------------------------------------------------------------------
CCNB2_MEDSA/73-199DLNE.R--------------------------------------------------------------------------
CCND2_MOUSE/24-151.IQP.Y--------------------------------------------------------------------------
CCND3_HUMAN/26-153.IKP.H--------------------------------------------------------------------------
CGS5_YEAST/165-294YLRP.S--------------------------------------------------------------------------
CG21_EMENI/211-337.LEW.K--------------------------------------------------------------------------
CGS6_YEAST/123-252HLKS.S--------------------------------------------------------------------------
CCNA1_CAEEL/215-341QVNE.E--------------------------------------------------------------------------
CCN1_ANTMA/197-322EINE.K--------------------------------------------------------------------------
CG22_SCHPO/139-265.LTW.K--------------------------------------------------------------------------
CCND1_RAT/26-153.IVP.S--------------------------------------------------------------------------
CCNB3_CHICK/149-274DISR.D--------------------------------------------------------------------------
CCNB_DICDI/188-314HINE.R--------------------------------------------------------------------------
CCD11_ARATH/50-182LDAS.A--------------------------------------------------------------------------
CCD21_ARATH/65-197LDLS.V--------------------------------------------------------------------------
CG12_CANAX/44-172.IKL.G--------------------------------------------------------------------------
SSN8_YEAST/45-176.YDKDY--------------------------------------------------------------------------
CG21_CANAX/208-334LLKP.R--------------------------------------------------------------------------
CCNE1_CHICK/112-239LLQP.K--------------------------------------------------------------------------
CCNA_HYDVD/168-294DINS.S--------------------------------------------------------------------------
CCNB_HYDVD/137-262EINF.K--------------------------------------------------------------------------
CCNE_DROME/330-459GLQP.R--------------------------------------------------------------------------
CCNA1_HUMAN/214-340DITE.G--------------------------------------------------------------------------
P92162_BOMMO/260-387VITG.K--------------------------------------------------------------------------
P93102_CHERU/192-317DINE.K--------------------------------------------------------------------------
P93103_CHERU/77-208LDLG.A--------------------------------------------------------------------------
CCC11_ORYSJ/4-144TLEEFR--------------------------------------------------------------------------
P93646_MAIZE/228-354EISE.R--------------------------------------------------------------------------
CGH2_SHV21/22-148.VTV.D--------------------------------------------------------------------------
CG1_COLGL/38-166.ASVLE--------------------------------------------------------------------------
CCNB1_CAEEL/81-206.PTP.K--------------------------------------------------------------------------
PCL9_YEAST/19-146......--------------------------------------------------------------------------
CCA22_ARATH/175-302DIDP.D--------------------------------------------------------------------------
Q24158_DROME/126-255.ITP.P--------------------------------------------------------------------------
Q25123_HELRO/112-238DINH.S--------------------------------------------------------------------------
Q25168_HELTR/256-380DLTP.S--------------------------------------------------------------------------
CCB12_ARATH/185-310EMNE.K--------------------------------------------------------------------------
CCB21_ARATH/174-300DLNE.K--------------------------------------------------------------------------
Q39331_BRANA/160-287DVNS.T--------------------------------------------------------------------------
Q39877_SOYBN/83-212IVTP.T--------------------------------------------------------------------------
Q39878_SOYBN/207-334DINP.S--------------------------------------------------------------------------
Q39880_SOYBN/186-311DINA.K--------------------------------------------------------------------------
Q40794_PETCR/187-312EINQ.K--------------------------------------------------------------------------
Q41731_MAIZE/173-299DINE.K--------------------------------------------------------------------------
Q41732_MAIZE/188-315DVNP.S--------------------------------------------------------------------------
Q41733_MAIZE/189-315ELSP.R--------------------------------------------------------------------------
Q41734_MAIZE/155-280EINP.K--------------------------------------------------------------------------
CCNE1_MOUSE/113-240LLQA.R--------------------------------------------------------------------------
CCB21_ORYSJ/157-283DINE.K--------------------------------------------------------------------------
CCD41_ARATH/45-178LDLN.V--------------------------------------------------------------------------
Q96226_ADICA/268-395DINA.S--------------------------------------------------------------------------
CCNB3_DROME/308-433HLTT.W--------------------------------------------------------------------------
Q9PVT7_CARAU/117-244HLQP.K--------------------------------------------------------------------------
Q9PW42_CARAU/140-266DITN.C--------------------------------------------------------------------------
Q9S7H9_SOLLC/61-190GSLM.G--------------------------------------------------------------------------
CCB31_ARATH/146-272EVSP.V--------------------------------------------------------------------------
CCB24_ARATH/180-307DINE.R--------------------------------------------------------------------------
Q9SMD4_SOLLC/51-182QSFI.S--------------------------------------------------------------------------
CCD33_ARATH/59-186EFLV.L--------------------------------------------------------------------------
Q9SNV1_ANTMA/59-187PSLA.K--------------------------------------------------------------------------
Q9SNV2_ANTMA/45-174VDSS.T--------------------------------------------------------------------------
Q9SXN7_TOBAC/59-188PLLC.L--------------------------------------------------------------------------
Q9U2M5_CAEEL/72-201.ITP.F--------------------------------------------------------------------------
Q9U7P9_9CILI/433-564ALNT.T--------------------------------------------------------------------------
Q9VE72_DROME/6-144.YRKMN--------------------------------------------------------------------------
Q9VKF0_DROME/205-327.HNP..--------------------------------------------------------------------------
Q9VZP3_DROME/42-165..PQLN--------------------------------------------------------------------------
Q9WRM3_9GAMA/20-147EVTV.G--------------------------------------------------------------------------
Q9XGI0_MEDSA/224-351DITP.S--------------------------------------------------------------------------
Q9XGI1_SOLLC/180-306DINE.R--------------------------------------------------------------------------
Q9XGI2_SOLLC/121-246EIND.R--------------------------------------------------------------------------
Q9YTJ4_ATHV3/30-156.ITI.S--------------------------------------------------------------------------
CCNE2_MOUSE/112-239DLEP.Q--------------------------------------------------------------------------
CCD61_ARATH/26-154SAFLLS--------------------------------------------------------------------------
Q9ZRG1_PEA/7-133EITP.H--------------------------------------------------------------------------
Q9ZRX9_TOBAC/64-196LDLS.V--------------------------------------------------------------------------

PF08613

PHO80_YEAST/33-170TLTR....................................YHSKIP..................................
YGZA_SCHPO/29-176PLSP...........................TSLKNPCLIFSAKNV..................................
Q872V6_NEUCS/156-314ALEP...............YIIVGENSQPLNTQHSAITRKFYSRLP..................................
Q8IEW5_9TRYP/370-620NSCNSQKQSSAHFSVNTHSFDMPTASHTKTTFAQTPKESSFATFAVEQAPLEGGQLESPHRDAEAEVMARDGACTTKLHR
Q949F8_ORYSA/17-159PASP....................................FRATAK..................................
CGP1_SCHPO/7-134................................................................................
Q8I8A9_9TRYP/370-620NSCNSQKQSSAHFSVNTHSFDMPTASHTKTTFAQTPKESSFATFAVEQAPLEGGQLESPHRDAEAEVMARDGACTTKLHR
PCL7_YEAST/108-264ETED............................ELLTPILAFYGKNV..................................
Q83C02_COXBU/10-148P...............................................................................

PF00382

TF3B_KLULA/193-266--------------------------------------------------------------------------------
TF2B_PYRWO/116-186--------------------------------------------------------------------------------
TF2B_KLULA/137-207--------------------------------------------------------------------------------
TF2B_YEAST/133-203--------------------------------------------------------------------------------
TF2B_HALVA/30-100--------------------------------------------------------------------------------
TF3B_CANAL/95-165--------------------------------------------------------------------------------
TF2B_DROME/214-284--------------------------------------------------------------------------------
TF2B_PYRWO/212-282--------------------------------------------------------------------------------
TF3B_KLULA/98-168--------------------------------------------------------------------------------
TF3B_CANAL/190-263--------------------------------------------------------------------------------
TF2B_DROME/120-190--------------------------------------------------------------------------------
TF2B_KLULA/245-315--------------------------------------------------------------------------------

PF01857

RBR2_MAIZE/594-721..------------------------------------------------------------------------------
RBL1_HUMAN/786-944..------------------------------------------------------------------------------
RB_HUMAN/645-766..------------------------------------------------------------------------------
RBL2_HUMAN/834-992..------------------------------------------------------------------------------
RBF_DROME/580-706..------------------------------------------------------------------------------
RBR_CHERU/724-863QS------------------------------------------------------------------------------

PF02984

CCNB3_CAEEL/243-364--------------------------------------------------------------------------------
Q7QC70_ANOGA/538-653--------------------------------------------------------------------------------
A4HKX7_LEIBR/155-297--------------------------------------------------------------------------------
CCNF_MOUSE/408-531--------------------------------------------------------------------------------
CCNB3_HUMAN/1259-1375--------------------------------------------------------------------------------
Q0UCR8_PHANO/466-581--------------------------------------------------------------------------------
Q291N4_DROPS/375-501--------------------------------------------------------------------------------
CCNA1_MOUSE/298-415--------------------------------------------------------------------------------
Q6BGT2_DEBHA/350-465--------------------------------------------------------------------------------
A0C1C9_PARTE/197-310--------------------------------------------------------------------------------
A0DMF0_PARTE/199-312--------------------------------------------------------------------------------
A0E0R4_PARTE/214-320--------------------------------------------------------------------------------
CCA33_ARATH/190-313--------------------------------------------------------------------------------
A1C7V2_ASPCL/489-604--------------------------------------------------------------------------------
A1CID9_ASPCL/361-475--------------------------------------------------------------------------------
A2DQ77_TRIVA/248-364--------------------------------------------------------------------------------
A2DZV8_TRIVA/235-351--------------------------------------------------------------------------------
A2E0Q4_TRIVA/216-333--------------------------------------------------------------------------------
A2E6K7_TRIVA/216-333--------------------------------------------------------------------------------
A2F2K2_TRIVA/212-328--------------------------------------------------------------------------------
A2ZM34_ORYSI/249-372--------------------------------------------------------------------------------
A3AKA7_ORYSJ/256-379--------------------------------------------------------------------------------
A3LN44_PICST/322-438--------------------------------------------------------------------------------
A4RSW0_OSTLU/207-322--------------------------------------------------------------------------------
A5AEK5_VITVI/324-442--------------------------------------------------------------------------------
A5BUM0_VITVI/360-483--------------------------------------------------------------------------------
A5DUV2_LODEL/512-628--------------------------------------------------------------------------------
A6RR46_BOTFB/346-460--------------------------------------------------------------------------------
A6ZXH4_YEAS7/299-414--------------------------------------------------------------------------------
A7A198_YEAS7/338-453--------------------------------------------------------------------------------
A7F1V1_SCLS1/469-584--------------------------------------------------------------------------------
A7S8H6_NEMVE/110-226--------------------------------------------------------------------------------
A7SEI5_NEMVE/172-293--------------------------------------------------------------------------------
A7SPG5_NEMVE/166-283--------------------------------------------------------------------------------
A7TR46_VANPO/331-446--------------------------------------------------------------------------------
A7Y7X0_CUCSA/197-329--------------------------------------------------------------------------------
A7YYE4_DANRE/155-279--------------------------------------------------------------------------------
O04388_CATRO/238-361--------------------------------------------------------------------------------
O04389_CATRO/313-431--------------------------------------------------------------------------------
O04398_TOBAC/319-436--------------------------------------------------------------------------------
REM1_SCHPO/273-388--------------------------------------------------------------------------------
CCNE_HEMPU/255-381--------------------------------------------------------------------------------
O45926_CAEEL/161-293--------------------------------------------------------------------------------
CCB14_ARATH/260-379--------------------------------------------------------------------------------
O65064_PICMA/98-215--------------------------------------------------------------------------------
CG1C_SCHPO/162-280--------------------------------------------------------------------------------
O77212_DREPO/291-408--------------------------------------------------------------------------------
O82137_PEA/102-224--------------------------------------------------------------------------------
O82678_CHERU/199-326--------------------------------------------------------------------------------
O82717_LUPLU/324-441--------------------------------------------------------------------------------
O93228_RANJA/239-357--------------------------------------------------------------------------------
O93916_PNECA/304-419--------------------------------------------------------------------------------
O96434_PARTE/212-329--------------------------------------------------------------------------------
CCNB_ARBPU/274-395--------------------------------------------------------------------------------
CG23_SCHPO/334-448--------------------------------------------------------------------------------
CCNB_SPISO/299-415--------------------------------------------------------------------------------
CCNA_DROME/334-451--------------------------------------------------------------------------------
CCNB_MARGL/258-375--------------------------------------------------------------------------------
CCNB_ASTPE/272-390--------------------------------------------------------------------------------
CCNA1_XENLA/295-412--------------------------------------------------------------------------------
CCNA_PATVU/302-419--------------------------------------------------------------------------------
CCNB_PATVU/282-398--------------------------------------------------------------------------------
CCNE1_HUMAN/244-366--------------------------------------------------------------------------------
CG21_SCHPO/294-409--------------------------------------------------------------------------------
CG21_YEAST/339-454--------------------------------------------------------------------------------
CCNAL_DAUCA/208-330--------------------------------------------------------------------------------
CCNB2_CHICK/268-386--------------------------------------------------------------------------------
CCB11_ARATH/295-418--------------------------------------------------------------------------------
CCNA2_BOVIN/307-425--------------------------------------------------------------------------------
CCNB2_MEDSA/201-318--------------------------------------------------------------------------------
CCND2_HUMAN/154-277--------------------------------------------------------------------------------
CGS5_YEAST/296-418--------------------------------------------------------------------------------
CGS6_YEAST/254-374--------------------------------------------------------------------------------
CCNA1_CAEEL/343-459--------------------------------------------------------------------------------
CCN2_ANTMA/319-438--------------------------------------------------------------------------------
CG22_SCHPO/267-382--------------------------------------------------------------------------------
CCNB3_CHICK/276-392--------------------------------------------------------------------------------
CCD11_ARATH/184-308--------------------------------------------------------------------------------
CCD31_ARATH/189-307--------------------------------------------------------------------------------
CCNA2_CHICK/273-390--------------------------------------------------------------------------------
CCNE1_DANRE/246-368--------------------------------------------------------------------------------
CCNA_HYDVD/296-415--------------------------------------------------------------------------------
CCNB_HYDVD/264-380--------------------------------------------------------------------------------
P90681_ASTPE/322-438--------------------------------------------------------------------------------
P92162_BOMMO/389-509--------------------------------------------------------------------------------
P93102_CHERU/319-438--------------------------------------------------------------------------------
P93103_CHERU/210-333--------------------------------------------------------------------------------
P93557_SESRO/318-435--------------------------------------------------------------------------------
P93646_MAIZE/356-473--------------------------------------------------------------------------------
CCB21_ORYSI/285-402--------------------------------------------------------------------------------
CCNB1_CRIGR/296-414--------------------------------------------------------------------------------
Q08C91_DANRE/272-388--------------------------------------------------------------------------------
Q09IZ1_ONCMY/251-369--------------------------------------------------------------------------------
CCB22_ORYSJ/293-410--------------------------------------------------------------------------------
CCA14_ORYSJ/216-339--------------------------------------------------------------------------------
CCB13_ORYSJ/341-458--------------------------------------------------------------------------------
Q0UMA7_PHANO/348-462--------------------------------------------------------------------------------
Q0VA13_XENTR/226-348--------------------------------------------------------------------------------
CCD42_ARATH/171-289--------------------------------------------------------------------------------
CCNB1_CAEEL/208-340--------------------------------------------------------------------------------
CCF32_ORYSJ/267-390--------------------------------------------------------------------------------
CCA22_ARATH/304-427--------------------------------------------------------------------------------
Q16TY2_AEDAE/355-477--------------------------------------------------------------------------------
Q16VG6_AEDAE/419-535--------------------------------------------------------------------------------
Q17NN3_AEDAE/310-427--------------------------------------------------------------------------------
Q1L8M6_DANRE/153-279--------------------------------------------------------------------------------
Q23JX5_TETTS/324-441--------------------------------------------------------------------------------
Q25123_HELRO/240-368--------------------------------------------------------------------------------
Q25168_HELTR/382-498--------------------------------------------------------------------------------
Q28DU2_XENTR/291-408--------------------------------------------------------------------------------
Q28GP5_XENTR/256-374--------------------------------------------------------------------------------
Q29CG1_DROPS/434-556--------------------------------------------------------------------------------
Q29DY8_DROPS/354-471--------------------------------------------------------------------------------
Q2ABE6_CAMSI/198-326--------------------------------------------------------------------------------
Q2ABE7_CAMSI/203-327--------------------------------------------------------------------------------
Q2ABE9_CAMSI/308-433--------------------------------------------------------------------------------
Q2HAK4_CHAGB/352-466--------------------------------------------------------------------------------
Q2HAS9_CHAGB/515-630--------------------------------------------------------------------------------
CCND1_BOVIN/155-283--------------------------------------------------------------------------------
Q2PHK8_DAUCA/314-432--------------------------------------------------------------------------------
Q2PHK9_DAUCA/330-448--------------------------------------------------------------------------------
Q2PHL0_DAUCA/311-430--------------------------------------------------------------------------------
CCA21_ORYSJ/359-482--------------------------------------------------------------------------------
Q2UPT4_ASPOR/192-299--------------------------------------------------------------------------------
Q2V5Z8_BRACM/228-351--------------------------------------------------------------------------------
Q2WGP0_ALLCE/280-397--------------------------------------------------------------------------------
Q2WGP2_ALLCE/358-475--------------------------------------------------------------------------------
CCB12_ARATH/312-429--------------------------------------------------------------------------------
CCB21_ARATH/302-419--------------------------------------------------------------------------------
CCB13_ARATH/289-406--------------------------------------------------------------------------------
CCB22_ARATH/303-421--------------------------------------------------------------------------------
Q39331_BRANA/289-412--------------------------------------------------------------------------------
Q39877_SOYBN/214-337--------------------------------------------------------------------------------
Q39878_SOYBN/336-459--------------------------------------------------------------------------------
Q39880_SOYBN/313-433--------------------------------------------------------------------------------
Q3KPK0_XENLA/154-279--------------------------------------------------------------------------------
Q3KQA7_XENLA/288-404--------------------------------------------------------------------------------
Q40223_LUPLU/307-426--------------------------------------------------------------------------------
Q40338_MEDSA/212-338--------------------------------------------------------------------------------
Q40488_TOBAC/238-361--------------------------------------------------------------------------------
Q40492_TOBAC/247-370--------------------------------------------------------------------------------
Q40514_TOBAC/347-470--------------------------------------------------------------------------------
Q40516_TOBAC/291-408--------------------------------------------------------------------------------
Q41733_MAIZE/317-437--------------------------------------------------------------------------------
Q41734_MAIZE/282-407--------------------------------------------------------------------------------
Q49U21_CRYNE/355-469--------------------------------------------------------------------------------
Q4CS48_TRYCC/197-328--------------------------------------------------------------------------------
Q4DWL9_TRYCC/229-371--------------------------------------------------------------------------------
CCD42_ORYSJ/212-330--------------------------------------------------------------------------------
Q4RZE5_TETNG/155-280--------------------------------------------------------------------------------
Q4SG06_TETNG/155-272--------------------------------------------------------------------------------
Q4T0M3_TETNG/224-342--------------------------------------------------------------------------------
Q4T2Y9_TETNG/114-254--------------------------------------------------------------------------------
Q4T8S9_TETNG/1145-1270--------------------------------------------------------------------------------
Q4TVR6_HELTR/235-352--------------------------------------------------------------------------------
CCNB_DICDI/316-434--------------------------------------------------------------------------------
CG11_CANAL/174-308--------------------------------------------------------------------------------
Q5D894_GOSHI/87-204--------------------------------------------------------------------------------
Q5D8P0_SCHJA/269-392--------------------------------------------------------------------------------
Q5KAX2_CRYNJ/366-482--------------------------------------------------------------------------------
Q5SCB6_OSTTA/230-346--------------------------------------------------------------------------------
Q5SCB7_OSTTA/222-339--------------------------------------------------------------------------------
Q5T8J1_HUMAN/105-230--------------------------------------------------------------------------------
Q5U4W4_XENLA/240-362--------------------------------------------------------------------------------
Q5UAU8_PENJP/269-385--------------------------------------------------------------------------------
CCNF_XENTR/414-537--------------------------------------------------------------------------------
Q5ZKI9_CHICK/155-280--------------------------------------------------------------------------------
Q5ZMH4_CHICK/247-368--------------------------------------------------------------------------------
CCNB1_ANGJA/272-390--------------------------------------------------------------------------------
Q60FY1_ORENI/302-418--------------------------------------------------------------------------------
Q60FY2_ANGJA/277-393--------------------------------------------------------------------------------
A8XRM2_CAEBR/208-340--------------------------------------------------------------------------------
CCNB3_CANFA/1202-1318--------------------------------------------------------------------------------
Q6CE22_YARLI/306-421--------------------------------------------------------------------------------
Q6CEJ4_YARLI/393-508--------------------------------------------------------------------------------
Q6CT04_KLULA/317-432--------------------------------------------------------------------------------
CCNJ_XENLA/145-273--------------------------------------------------------------------------------
Q6FNV2_CANGA/314-429--------------------------------------------------------------------------------
Q6FQU1_CANGA/326-455--------------------------------------------------------------------------------
Q6FVY0_CANGA/262-383--------------------------------------------------------------------------------
Q6FVY1_CANGA/344-459--------------------------------------------------------------------------------
Q6IR86_XENLA/262-380--------------------------------------------------------------------------------
CCF13_ORYSJ/255-372--------------------------------------------------------------------------------
Q6P801_XENTR/266-384--------------------------------------------------------------------------------
Q6T2E9_BUFBG/263-381--------------------------------------------------------------------------------
Q6X269_USTMD/465-579--------------------------------------------------------------------------------
Q6X270_USTMD/433-547--------------------------------------------------------------------------------
Q6ZZ83_SPHGR/342-458--------------------------------------------------------------------------------
Q75A51_ASHGO/248-363--------------------------------------------------------------------------------
Q75EI0_ASHGO/418-533--------------------------------------------------------------------------------
Q790L7_MOUSE/155-283--------------------------------------------------------------------------------
CCA11_ORYSJ/372-495--------------------------------------------------------------------------------
Q7PPJ1_ANOGA/320-449--------------------------------------------------------------------------------
Q7Q0E8_ANOGA/187-304--------------------------------------------------------------------------------
Q7XAB7_EUPES/184-308--------------------------------------------------------------------------------
Q7Z4Z4_HUMAN/264-382--------------------------------------------------------------------------------
Q7ZVA8_DANRE/252-370--------------------------------------------------------------------------------
Q7ZYJ6_XENLA/153-279--------------------------------------------------------------------------------
CCNB3_MOUSE/1265-1381--------------------------------------------------------------------------------
Q84LE4_SILLA/352-474--------------------------------------------------------------------------------
Q84V88_POPAL/200-324--------------------------------------------------------------------------------
Q8GZU3_9ROSI/205-332--------------------------------------------------------------------------------
CCD41_ARATH/180-299--------------------------------------------------------------------------------
Q8LK74_LAGSI/187-313--------------------------------------------------------------------------------
Q8LPW3_HELAN/178-304--------------------------------------------------------------------------------
Q8SRF2_ENCCU/179-293--------------------------------------------------------------------------------
CCNA1_CARAU/268-385--------------------------------------------------------------------------------
CCNB1_CARAU/266-384--------------------------------------------------------------------------------
Q941M7_MEDSA/349-473--------------------------------------------------------------------------------
Q94740_SPHGR/281-401--------------------------------------------------------------------------------
Q95WE6_ASTPE/274-391--------------------------------------------------------------------------------
Q96226_ADICA/397-520--------------------------------------------------------------------------------
Q98TA3_DANRE/305-422--------------------------------------------------------------------------------
Q9C2K2_NEUCS/516-631--------------------------------------------------------------------------------
CCA24_ARATH/329-452--------------------------------------------------------------------------------
CCA31_ARATH/219-342--------------------------------------------------------------------------------
CCA12_ARATH/310-433--------------------------------------------------------------------------------
Q9GTQ8_DROME/286-422--------------------------------------------------------------------------------
CCNB2_ORYLA/254-372--------------------------------------------------------------------------------
CCB23_ARATH/308-425--------------------------------------------------------------------------------
Q9LKC6_CICAR/324-443--------------------------------------------------------------------------------
Q9M4K9_PEA/216-340--------------------------------------------------------------------------------
Q9S7H9_SOLLC/192-320--------------------------------------------------------------------------------
CCB31_ARATH/274-391--------------------------------------------------------------------------------
Q9SBQ4_PETHY/303-423--------------------------------------------------------------------------------
CCB24_ARATH/309-426--------------------------------------------------------------------------------
Q9SMD4_SOLLC/184-309--------------------------------------------------------------------------------
CCD33_ARATH/188-310--------------------------------------------------------------------------------
Q9SNV0_ANTMA/203-329--------------------------------------------------------------------------------
Q9SNV2_ANTMA/176-296--------------------------------------------------------------------------------
Q9SXN7_TOBAC/190-313--------------------------------------------------------------------------------
Q9TY42_PARTE/121-227--------------------------------------------------------------------------------
Q9U7P9_9CILI/566-681--------------------------------------------------------------------------------
Q9XGI1_SOLLC/308-425--------------------------------------------------------------------------------
Q9XGI2_SOLLC/248-367--------------------------------------------------------------------------------
Q9XGI4_SOLLC/345-468--------------------------------------------------------------------------------
CCNE2_MOUSE/241-363--------------------------------------------------------------------------------
CCD61_ARATH/156-288--------------------------------------------------------------------------------
Q9ZRG1_PEA/135-252--------------------------------------------------------------------------------
Q9ZRX9_TOBAC/198-319--------------------------------------------------------------------------------

PF03261

CD5R2_MOUSE/1-332PTVPTTAATCEPP...........................SGGSAAAPP....PGSGGGKP..................P
CD5R1_RAT/1-296.LSCANLSTFAQP...........................PPAQPPAPP....ASQLSGSQTGV...............S
O13123_XENLA/1-285.LSCANLSSYD...............................SQPLAP........LSSKQ..................I
CD5R1_CAEEL/1-356TTIIPNYYSLREEFRRGLQINTRQDLVNNNLASNDLSVIGSPKHVPRP.....RSVLRDDNANC...........DISPI
Q9Y0G0_DROME/81-464QLQLQNQHQHQNQNQNQNQ.NQVQDIREEVMT.......GPPGKSQNPSKAKDPVKVNNKNSMSNHNKLIQKQPLTLS.L

PF01858

RBL1_MOUSE/385-578--------------------------------------------------------------------------------
RBR1_MAIZE/275-476--------------------------------------------------------------------------------
RBF_DROME/376-560--------------------------------------------------------------------------------
RBR_CHERU/403-604--------------------------------------------------------------------------------
RBL2_HUMAN/417-609--------------------------------------------------------------------------------
RB_HUMAN/373-573--------------------------------------------------------------------------------
Q98966_NOTVI/353-548--------------------------------------------------------------------------------

PF00134

CG11_CANAX/48-176------------------------------MRPFLL------DFLIE.LH----------SSFKLQP-----TTLFLCL-
CCNA2_MOUSE/171-297------------------------------MRAILV------DWLVE.VG----------EEYKLQN-----ETLHLAV-
CCNB3_CAEEL/115-241------------------------------TRAILI------DWMVE.IQ----------ETFELNH-----ETLYNAV-
CCNF_MOUSE/281-406------------------------------MRYILI------DWLVE.VA----------TMKDFTS-----LCLHLTV-
CCT12_ARATH/28-169------------------------------LRDSYC------TFLEI.LG----------ERLKVPQ-----VTIATAI-
CCNE_CAEEL/232-360------------------------------KRRILI------DWMME.VC----------ESEKLHR-----ETFHLAV-
O04388_CATRO/107-236------------------------------MRGVLI------DWLVE.VA----------EEYKLLP-----DTLYLTV-
O04389_CATRO/186-311------------------------------MRAILI------DWLIE.VH----------HKFELNP-----ETLYLTI-
O04399_TOBAC/107-236------------------------------MRMILV------DWLVE.VA----------DEYKLVS-----DTLYLTV-
REM1_SCHPO/145-271------------------------------MRASVI------NWIVG.VH----------TCINLLP-----ESLFLSI-
CCNE_HEMPU/126-253------------------------------MRAILL------DWLIE.VC----------EVYRLHR-----ESFYLAA-
O40946_HHV8/20-147------------------------------MRKLLG------TWMFS.VC----------QEYNLEP-----NVVALAL-
CCNE3_XENLA/114-241------------------------------MRAILL------DWLME.VC----------EVYKLHR-----ETFYLAQ-
O45926_CAEEL/34-159------------------------------MRRILV------DWLIQ.VH----------LRFHLTP-----ETLHLTI-
CCB14_ARATH/133-258------------------------------MRSILI------DWLVD.VH----------RKFELMP-----ETLYLTI-
O62573_SPHGR/213-339------------------------------MRCILI------DWLVE.VS----------EEYRLHN-----ETLYLAA-
O65065_PICMA/77-204------------------------------.GISIA------KYLER.VY----------KYTSCSP-----SCFVVAY-
O76513_DROME/43-156------------------------------YEIYLF------DFCRR...----------FEPTMPK-----CVVGTAF-
CCU41_ARATH/22-148------------------------------.TITIQ------SYLER.IF----------KYANCSP-----SCFVVAY-
O82136_PEA/72-205------------------------------PRREAV------QWMLK.VN----------AHYAFSP-----LTATLAV-
O93228_RANJA/112-237------------------------------MRAILV------DWLVQ.VH----------LRFKLLQ-----ETMFMTV-
O93231_BUFJA/24-149------------------------------MRAILI------DWLVQ.VQ----------IKFRLLQ-----ETMYMTV-
O93911_CANAX/234-360------------------------------MRAVLI------DWVVQ.VH----------ARFNLFS-----ETLYLTV-
O93916_PNECA/176-302------------------------------MRGILV------DWLIE.VH----------AKFRLLP-----ETLFLSV-
CCNB2_HUMAN/137-262------------------------------MRAILV------DWLVQ.VH----------SKFRLLQ-----ETLYMCV-
CCNT_DROME/42-176------------------------------YRQMTA------YLIQE.MG----------QRLQVSQ-----LCINTAI-
O96434_PARTE/82-210------------------------------MRAILL------DWLID.VH----------LKFKLRD-----ETLYVTT-
O97482_PARTE/85-212------------------------------MRAILV------DWLID.VH----------AKFELKD-----ETLYITI-
CCNB_ARBPU/145-272------------------------------MRLILV------DWLVQ.VH----------LRFHLLQ-----ETLFLTV-
CG23_SCHPO/206-332------------------------------MRGILT------DWLIE.VH----------SRFRLLP-----ETLFLAV-
CCNB1_XENLA/139-264------------------------------MRAILI------DWLVQ.VQ----------MKFRLLQ-----ETMFMTV-
CCNB2_XENLA/134-259------------------------------MRAILV------DWLVQ.VH----------SRFQLLQ-----ETLYMGV-
CCNB_SPISO/172-297------------------------------MRAILI------DWLCQ.VH----------HRFHLLQ-----ETLYLTV-
CCNA_DROME/206-332------------------------------MRSILI------DWLVE.VS----------EEYKLDT-----ETLYLSV-
CCNB_ASTPE/147-270------------------------------MRTILI------DWLVQ.VH----------LRFHLLQ-----ETLFLTI-
CG12_YEAST/43-195------------------------------TRSNII------TFLFE.LS----------VVTRVTN-----GIFFHSV-
CCNB_DROME/260-387------------------------------MRAVLI------DWINE.VH----------LQFHLAA-----ETFQLAV-
CCNB1_MOUSE/170-295------------------------------MRAILI------DWLIQ.VQ----------MKFRLLQ-----ETMYMTV-
CCNA_PATVU/174-300------------------------------MRSILV------DWMVE.VS----------EEYKLHR-----ETLFLAI-
CCNB_PATVU/155-280------------------------------MRSILI------DWLCQ.VH----------HRFHLLQ-----ETLYLTV-
CG21_SCHPO/166-292------------------------------TRHMLV------DWIVQ.VQ----------IHFRLLP-----ETLFLAV-
PCL1_YEAST/19-152------------------------------RLPSLM------TFITR.LV----------RYTNVYT-----PTLLTAA-
CG21_YEAST/212-337------------------------------NRDILV------NWIIK.IH----------NKFGLLP-----ETLYLAI-
CG22_YEAST/232-357------------------------------NRDILV------NWLVK.IH----------NKFGLLP-----ETLYLAI-
CG23_YEAST/171-297------------------------------FRSTLI------DWIVQ.VH----------EKFQLLP-----ETLYLCI-
CG24_YEAST/210-336------------------------------FRRTMI------DWLVQ.LH----------FRFQLLP-----ETLYLTI-
PUC1_SCHPO/99-227------------------------------MRPALV------NFIVE.IH----------NGFDLSI-----DTLPLSI-
CCNAL_DAUCA/77-206------------------------------MRGVLV------DWLVE.VS----------LEYKLLP-----ETLYLAI-
CCNB1_SOYBN/197-322------------------------------MRAILV------DWLID.VH----------TKFELSL-----ETLYLTI-
PCL2_YEAST/18-146------------------------------..PPLT------KFINR.LI----------KHSNVQT-----PTLMATS-
CCNB2_CHICK/141-266------------------------------MRAILV------DWLVQ.VH----------SRFQLLQ-----ETLYMCV-
CCB11_ARATH/168-293------------------------------MRLILV------EWLID.VH----------VRFELNP-----ETFYLTV-
CCNB2_MEDSA/73-199------------------------------MRAILV------DWLIE.VH----------DKFDLMQ-----ETLFLTV-
CCND2_MOUSE/24-151------------------------------MRRMVA------TWMLE.VC----------EEQKCEE-----EVFPLAM-
CCND3_HUMAN/26-153------------------------------MRKMLA------YWMLE.VC----------EEQRCEE-----EVFPLAM-
CGS5_YEAST/165-294------------------------------MRTILV------DWLVE.VH----------EKFQCYP-----ETLFLSI-
CG21_EMENI/211-337------------------------------MRGILV------DWLIE.VH----------TRFRLLP-----ETLFLAV-
CGS6_YEAST/123-252------------------------------MRALLI------DWLVE.VH----------EKFHCLP-----ETLFLAI-
CCNA1_CAEEL/215-341------------------------------MRTILI------DWFSD.VV----------KEYNFQK-----ETFHLAV-
CCN1_ANTMA/197-322------------------------------MRAILI------DWLVQ.VH----------HKFELSP-----ETLYLTI-
CG22_SCHPO/139-265------------------------------MREILN------EWLVE.IH----------SNFCLMP-----ETLYLAV-
CCND1_RAT/26-153------------------------------MRKIVA------TWMLE.VC----------EEQKCEE-----EVFPLAM-
CCNB3_CHICK/149-274------------------------------MRAILV------DWMVE.VQ----------ENFELNH-----ETLYLAV-
CCNB_DICDI/188-314------------------------------MRAILV------DWMMA.VH----------VRFKLLS-----ETFFLSV-
CCD11_ARATH/50-182------------------------------.REDSV------AWILK.VQ----------AYYNFQP-----LTAYLAV-
CCD21_ARATH/65-197------------------------------.RNQAL------DWILK.VC----------AHYHFGH-----LCICLSM-
CG12_CANAX/44-172------------------------------MRPLLL------DFLME.VI----------TILNLSR-----STFPLTV-
SSN8_YEAST/45-176------------------------------NLRIYC------YFLIMKLG----------RRLNIRQ-----YALATAH-
CG21_CANAX/208-334------------------------------MRSILV------DWLVE.MH----------LKFKLLP-----ESLFLAV-
CCNE1_CHICK/112-239------------------------------MRTILL------DWLME.VC----------EVYKLYR-----ETFYLAQ-
CCNA_HYDVD/168-294------------------------------MRAILI------DWLVE.VS----------EEYKLIP-----QTLYLSV-
CCNB_HYDVD/137-262------------------------------MRSILV------DWLIQ.VQ----------SRFNLLQ-----ETLYLTI-
CCNE_DROME/330-459------------------------------MRAILL------DWLIE.VC----------EVYKLHR-----ETFYLAV-
CCNA1_HUMAN/214-340------------------------------MRTILV------DWLVE.VG----------EEYKLRA-----ETLYLAV-
P92162_BOMMO/260-387------------------------------MRATLI------DWLVE.VQ----------RQFSLVL-----ETFHLTV-
P93102_CHERU/192-317------------------------------MRSILV------DWLIE.VH----------YKFELRQ-----ETLYLTI-
P93103_CHERU/77-208------------------------------.RNLVI------DWIHK.VQ----------SHYNFGP-----LCVYLSV-
CCC11_ORYSJ/4-144------------------------------LVKIHM------SFHIWRLA----------QQVKVRQ-----RVIATAV-
P93646_MAIZE/228-354------------------------------MRAILI------DWIIE.VQ----------YRLTLMP-----ETLYLTV-
CGH2_SHV21/22-148------------------------------NRTILL------TWMHL.LC----------ESFELDK-----SVFPLSV-
CG1_COLGL/38-166------------------------------MRPEVI------RSLIK.IH----------KELNLLP-----QTLLLSV-
CCNB1_CAEEL/81-206------------------------------MRRILV------DWLVQ.VH----------VRFHLTP-----ETLHLTV-
PCL9_YEAST/19-146------------------------------..PDLS------IFIKN.VV----------IQSNVQT-----PTLMATS-
CCA22_ARATH/175-302------------------------------MRKILI------DWLVE.VS----------DDYKLVP-----DTLYLTV-
Q24158_DROME/126-255------------------------------MRKIVA------EWMME.VC----------AEENCQE-----EVVLLAL-
Q25123_HELRO/112-238------------------------------MRSILV------DWLVE.VA----------DEYKLKR-----ETFFLAV-
Q25168_HELTR/256-380------------------------------MRAILV------DWLVE.VQ----------QSFELNH-----ETLYMAV-
CCB12_ARATH/185-310------------------------------MRAILI------DWLLE.VH----------IKFELNL-----ETLYLTV-
CCB21_ARATH/174-300------------------------------MRAILI------DWLIE.VH----------DKFDLIN-----ETLFLTV-
Q39331_BRANA/160-287------------------------------MRGILV------DWLVE.VS----------EEYRLVP-----ETLYLTV-
Q39877_SOYBN/83-212------------------------------MRGILV------DWLVE.VA----------EEYKLLS-----DTLHLSV-
Q39878_SOYBN/207-334------------------------------MRGILV------DWLVE.VS----------EEYKLVP-----DTLYLTV-
Q39880_SOYBN/186-311------------------------------MRSILV------DWLIE.VH----------RKFELMP-----ETLYLTL-
Q40794_PETCR/187-312------------------------------MRAILV------DWLIE.VH----------NKFELMP-----ETLYLAI-
Q41731_MAIZE/173-299------------------------------MRGILI------DWLIE.VH----------YKLELLE-----ETLFLTV-
Q41732_MAIZE/188-315------------------------------MRAILI------DWLVE.VA----------EEYRLVP-----DTLYLTV-
Q41733_MAIZE/189-315------------------------------MRSILA------DWLIE.SH----------RRFQLMP-----ETLYLTI-
Q41734_MAIZE/155-280------------------------------MRAILA------DWIIE.VH----------HKFALMP-----ETLYLTM-
CCNE1_MOUSE/113-240------------------------------MRAVLL------DWLME.VC----------EVYKLHR-----ETFYLAQ-
CCB21_ORYSJ/157-283------------------------------MRAILI------DWLIE.VH----------HKFELMD-----ETLFLTV-
CCD41_ARATH/45-178------------------------------GRRDAL------NWIWK.AC----------EVHQFGP-----LCFCLAM-
Q96226_ADICA/268-395------------------------------MRGILV------DWLVE.VA----------EEYKLVP-----DTLYLTI-
CCNB3_DROME/308-433------------------------------MRTLLV------DWMVE.VQ----------ETFELNH-----ETLYLAV-
Q9PVT7_CARAU/117-244------------------------------MRAILL------DWLIE.VC----------EVYKLHR-----ETFYLGQ-
Q9PW42_CARAU/140-266------------------------------MRVILV------DWLVE.VG----------EEYKLCS-----ETLFLAV-
Q9S7H9_SOLLC/61-190------------------------------ARKEAL------DWMLR.VI----------AYYGFTA-----TTAVLAV-
CCB31_ARATH/146-272------------------------------TRGILI------NWLIE.VH----------FKFDLMH-----ETLYLTM-
CCB24_ARATH/180-307------------------------------MRGILF------DWLIE.VH----------YKFELME-----ETLYLTI-
Q9SMD4_SOLLC/51-182------------------------------SRRESV------EWILK.TT----------AYYSFSA-----QTGFLAV-
CCD33_ARATH/59-186------------------------------CREKAL------DWIFK.VK----------SHYGFNS-----LTALLAV-
Q9SNV1_ANTMA/59-187------------------------------ARDEAV------EWMFK.VI----------GYYSFSA-----LTAVLAV-
Q9SNV2_ANTMA/45-174------------------------------.RTEST------AWILK.VQ----------RYYGFQP-----LTAYLAV-
Q9SXN7_TOBAC/59-188------------------------------SRKEAV------KWILK.VN----------AHYGFST-----FTAILAI-
Q9U2M5_CAEEL/72-201------------------------------HREQAI------DWIYD.VA----------KEENCDG-----DVFLLAV-
Q9U7P9_9CILI/433-564------------------------------MRSILV------DWLID.VS----------VHFEVSD-----DTLHIAV-
Q9VE72_DROME/6-144------------------------------KPGVVP------MYIFE.CA----------AKLKMKP-----LTAACAA-
Q9VKF0_DROME/205-327------------------------------EHRQIY------KFVRT.LF----------NAAQLTA-----ECAIITL-
Q9VZP3_DROME/42-165------------------------------ERRRML------QLLKL.AT----------SAHKLSR-----CALHLAV-
Q9WRM3_9GAMA/20-147------------------------------MRVILG------TWMRS.VA----------RAHQADA-----SVFPLAV-
Q9XGI0_MEDSA/224-351------------------------------MRAILV------DWLVE.VS----------EGYKLQA-----NTLFLTV-
Q9XGI1_SOLLC/180-306------------------------------MRSILI------DWLIE.VH----------HKFELRE-----ETLFLTV-
Q9XGI2_SOLLC/121-246------------------------------VRAILV------DWLIE.AH----------KRFELRP-----ESLYLTV-
Q9YTJ4_ATHV3/30-156------------------------------NRTTLL------TWLYI.LC----------EEFDLDP-----SVFPLTV-
CCNE2_MOUSE/112-239------------------------------MRSILL------DWLLE.VC----------EVYTLHR-----ETFYLAQ-
CCD61_ARATH/26-154------------------------------NRNQAI------SSITQ.YS----------RKFDD.P-----SLTYLAV-
Q9ZRG1_PEA/7-133------------------------------MRGVLV------NWLIE.VH----------FKLDLMP-----ETLYLTV-
Q9ZRX9_TOBAC/64-196------------------------------.RKEAL------DWILK.AH----------MHYGFGE-----LSFCLSI-

PF08613

PHO80_YEAST/33-170..............................PNISIF------NYFIR-LT..........KFSSLEH.....CVLMTSL-
YGZA_SCHPO/29-176..............................PSISIQ------AYLTR-IL..........KYCPATN.....DVFLSVL-
Q872V6_NEUCS/156-314..............................PPISIT------DYLLR-IH..........QYCPMST.....AVYLAAS-
Q8IEW5_9TRYP/370-620VEPRLEERVTARRENHVGNVVGRLFRDQSEDAVDLG------SDCSK-LQLLIVSVGLTVSFGESAP.....LVLIGTL-
Q949F8_ORYSA/17-159..............................PGISVR------AYAAR-IA..........RFAGCSP.....ACYVVAY-
CGP1_SCHPO/7-134..............................HSLSLT------QFLYE-TI..........RRSRVDY.....TTLLLAL-
Q8I8A9_9TRYP/370-620VEPRLEERVTARRENHVGNVVGRLFRDQSEDAVDLG------SDCSK-LQLLIVSVGLTVSFGESAP.....LVLIGTL-
PCL7_YEAST/108-264..............................PEIAVV------QYLER-IQ..........KYCPTTN.....DIFLSLL-
Q83C02_COXBU/10-148..............................PPYPLL------DYFSR-FK........AIKYPKTRKSIMEWDVFIHAF-

PF00382

TF3B_KLULA/193-266------------------------------AQTMSR------DWMYE---------------------------------
TF2B_PYRWO/116-186------------------------------YREAVR------KGLIR---------------------------------
TF2B_KLULA/137-207------------------------------YKLCFE------ERVLK---------------------------------
TF2B_YEAST/133-203------------------------------YKLCHD------EKTLK---------------------------------
TF2B_HALVA/30-100------------------------------IDTTAE------QGLLS---------------------------------
TF3B_CANAL/95-165------------------------------FRLALT------LNFVQ---------------------------------
TF2B_DROME/214-284------------------------------AKKAVE------MDIVP---------------------------------
TF2B_PYRWO/212-282------------------------------LDEAYK------RGLTS---------------------------------
TF3B_KLULA/98-168------------------------------YRLALS------NNFVQ---------------------------------
TF3B_CANAL/190-263------------------------------AHRMAA------DWIHE---------------------------------
TF2B_DROME/120-190------------------------------FKQVHD------GKNLK---------------------------------
TF2B_KLULA/245-315------------------------------AKHSKD------VNVLA---------------------------------

PF01857

RBR2_MAIZE/594-721------------------------------....YM------EQT.ERVY----------------------NVFKQIL-
RBL1_HUMAN/786-944------------------------------....VS------NELRRKIW----------------------TCFEFTL-
RB_HUMAN/645-766------------------------------....EH------PELEHIIW----------------------TLFQHTL-
RBL2_HUMAN/834-992------------------------------....IS------DELRKKIW----------------------TCFEFSI-
RBF_DROME/580-706------------------------------....LC------EKTPESIW----------------------HIFEHSI-
RBR_CHERU/724-863------------------------------QTQQLR------EQLRENVY----------------------CRFHIIL-

PF02984

CCNB3_CAEEL/243-364------------------------------GRFILE......TSLMVYE............YAMVSQ-----SRLAAAA.
Q7QC70_ANOGA/538-653------------------------------ARYILE......TGLMDYN............TVLVRD-----SKLACGA.
A4HKX7_LEIBR/155-297------------------------------TSFFME......HALLDYK............CLQFTP-----SQIAHAS.
CCNF_MOUSE/408-531------------------------------CSFLCE......LTLLHTS............LSIYAP-----ARLASAA.
CCNB3_HUMAN/1259-1375------------------------------SRYICE......MTLQEYH............YVQEKA-----SKLAAAS.
Q0UCR8_PHANO/466-581------------------------------AKYFLE......ITVMDER............FVGCAP-----SFLSAGA.
Q291N4_DROPS/375-501------------------------------SKYFVE......LASVDYD............LASYKP-----SEIAAAS.
CCNA1_MOUSE/298-415------------------------------AKYVAE......LSLLEAD...........PFLKYLP-----SLVAAAA.
Q6BGT2_DEBHA/350-465------------------------------AKYFLE......ITIMDSR............FVASQP-----SWLAAGA.
A0C1C9_PARTE/197-310------------------------------SRMILE......LSLLDIK............CLKFSS-----SLLATTS.
A0DMF0_PARTE/199-312------------------------------SRMILE......LSLLDVK............CLKFSS-----SLLATTA.
A0E0R4_PARTE/214-320------------------------------AQYILE......LALVEYK............FIVYKP-----SLITEAA.
CCA33_ARATH/190-313------------------------------CCYLSE......LSMLDYS............CVKFVP-----SLLAASA.
A1C7V2_ASPCL/489-604------------------------------AKYFLE......VTIMDER............FVGSPP-----SFIAAGA.
A1CID9_ASPCL/361-475------------------------------GKYLME......ISLLDHR............FMCYPQ-----SHVAAAA.
A2DQ77_TRIVA/248-364------------------------------ARYVME......VCMTCSN............FIDVRP-----SAVASTS.
A2DZV8_TRIVA/235-351------------------------------ARYIVE......MCLTSEK............FNDVKA-----SAIAATA.
A2E0Q4_TRIVA/216-333------------------------------ANYISE......LILLDSE............FLGILP-----SKLTAAI.
A2E6K7_TRIVA/216-333------------------------------AHYVNE......SILLDSE............FIGISP-----SKTAAAI.
A2F2K2_TRIVA/212-328------------------------------ARYILE......IMQTQSQ............FFGMKP-----SMMASIA.
A2ZM34_ORYSI/249-372------------------------------GSYLAE......LSLLDYS............CLRFLP-----SVVAASV.
A3AKA7_ORYSJ/256-379------------------------------CSYLAE......LSLLEYG............CVRLLP-----SVVAASV.
A3LN44_PICST/322-438------------------------------GKYLLE......ITAIDYK............FIGYKP-----SLCCASA.
A4RSW0_OSTLU/207-322------------------------------ASFLSE......VTLMRSV............FLQFPP-----AVIAAAA.
A5AEK5_VITVI/324-442------------------------------VYFYAE......LGLANYA............TMMYCS-----SMXAASS.
A5BUM0_VITVI/360-483------------------------------GNYLAE......LTLIDYG............CLKYLP-----SIIAASA.
A5DUV2_LODEL/512-628------------------------------GKYLLE......ITIVDHR............FIGMKP-----SLCSALA.
A6RR46_BOTFB/346-460------------------------------GKYLME......ISLLDHR............FMKYLP-----SHVAAAS.
A6ZXH4_YEAS7/299-414------------------------------AKYLLE......STIMDHR............LVSAQP-----SWLAAGA.
A7A198_YEAS7/338-453------------------------------AKYLLE......TTIVEPK............LVAAAP-----SWLAAGA.
A7F1V1_SCLS1/469-584------------------------------AKYFLE......VTIMDER............FVGSPP-----SFVAAAS.
A7S8H6_NEMVE/110-226------------------------------SRFILE......TTLHHYK............FIVHKP-----SFLAAAC.
A7SEI5_NEMVE/172-293------------------------------ARYLCE......ISLLDSE...........PFLKYLP-----STIAASA.
A7SPG5_NEMVE/166-283------------------------------AKYLME......LTLIDYQ............SIKFLP-----SEIAAAS.
A7TR46_VANPO/331-446------------------------------AKYLLE......ITIMDSR............LVAAPP-----SWLASGA.
A7Y7X0_CUCSA/197-329------------------------------HLEFFRRSEYLLLSLLSDS...........RFVGYLP-----SVLATAT.
A7YYE4_DANRE/155-279------------------------------AQTFVA......LCATDVN............FIASPP-----SMIAAGS.
O04388_CATRO/238-361------------------------------GYYLAE......LSLLDYG............CVKFLP-----SLIASSV.
O04389_CATRO/313-431------------------------------VYFFAE......LGMMNYS...........VAMMYCS-----SMIAASA.
O04398_TOBAC/319-436------------------------------VYFLAE......LGLMNYA............TNIYCP-----SMIAASA.
REM1_SCHPO/273-388------------------------------IKYFLE......VSLVEQR............FSSLRA-----SQLVATC.
CCNE_HEMPU/255-381------------------------------STEFVQVAQLLDVCTLDIG............SMDFDY-----SILAASA.
O45926_CAEEL/161-293------------------------------SKCLGE......LALLDSV............MSTVPR-----SHVASAS.
CCB14_ARATH/260-379------------------------------VFYLAE......LGLMQYP...........IVVLNRP-----SMLAASA.
O65064_PICMA/98-215------------------------------AFFLVD......LSLLHYI............MIKYSP-----SMLAAAA.
CG1C_SCHPO/162-280------------------------------AWTYIN......DSTRSIA............CLLYSP-----KTIAAAAF
O77212_DREPO/291-408------------------------------TMFLSE......LTLIEMD...........SYLKYVP-----SITASAC.
O82137_PEA/102-224------------------------------AHFLSE......LGMMHYA............TLMYSP-----SMMAAAA.
O82678_CHERU/199-326------------------------------HCKILTRCENIIVSVILDP...........RFLCYVP-----SVLAAAS.
O82717_LUPLU/324-441------------------------------GHFLSE......LGMMHYA............TLVYCP-----SMVAASA.
O93228_RANJA/239-357------------------------------AKYLIE......LSMVDYE............MVHFPP-----SQVAAAA.
O93916_PNECA/304-419------------------------------AKYLME......ISLLDHR............FLPFVP-----SNIAASG.
O96434_PARTE/212-329------------------------------AQYLLE......LSIVDIK............FMNYKP-----SFLSAAA.
CCNB_ARBPU/274-395------------------------------AKYLME......ITLPEYS............MVQYSP-----SEIAAAA.
CG23_SCHPO/334-448------------------------------AKYLVE......IGLLDHK............LLPYPP-----SQQCAAA.
CCNB_SPISO/299-415------------------------------AKYLME......LTITEYD............MVQYLP-----SKIAAAA.
CCNA_DROME/334-451------------------------------TLYISE......LSLMEGE...........TYLQYLP-----SLMSSAS.
CCNB_MARGL/258-375------------------------------AKYLME......LTLPEYA............FVPYDP-----SEIAAAA.
CCNB_ASTPE/272-390------------------------------SKYIME......LTLXEYS............FVKYD.-----XEIAAAA.
CCNA1_XENLA/295-412------------------------------AMYMAE......LTLLEVE...........PFLKYVP-----SLTAAAA.
CCNA_PATVU/302-419------------------------------SMYLSE......LTLVDAD...........PYLKYLP-----STIAAAS.
CCNB_PATVU/282-398------------------------------AKYLME......LTIIEYD............MVHCNP-----SIIAAAA.
CCNE1_HUMAN/244-366------------------------------QQIFIQIAELLDLCVLDVD............CLEFPY-----GILAASA.
CG21_SCHPO/294-409------------------------------AKYLQE......VTLMDEI............FIGAHI-----SFIAATA.
CG21_YEAST/339-454------------------------------AKFLME......ISIVDFK............FIGILP-----SLCASAA.
CCNAL_DAUCA/208-330------------------------------ANYLAE......LSLLDYG............CLEFVP-----SLIAASV.
CCNB2_CHICK/268-386------------------------------AKYLME......LTLIDYD............MVHYHP-----SEIAAAA.
CCB11_ARATH/295-418------------------------------VHYLAE......LGVMHYD...........TMIMFSP-----SMVAASA.
CCNA2_BOVIN/307-425------------------------------AMFLGE......LSLIDAD...........PYLKYLP-----SVIAAAA.
CCNB2_MEDSA/201-318------------------------------AFFLVD......LSLVEYE............MLKFPP-----SLVAAAA.
CCND2_HUMAN/154-277------------------------------AQTFIA......LCATDFK............FAMYPP-----SMIATGS.
CGS5_YEAST/296-418------------------------------GKFILE......YAYCCHQ............FIHLPP-----STVSAMA.
CGS6_YEAST/254-374------------------------------AKFIME......YSICCNK............FIHLKP-----SYLAAMS.
CCNA1_CAEEL/343-459------------------------------VHYLLE......LSLIDVH............FLRYRP-----SDIAAAA.
CCN2_ANTMA/319-438------------------------------VYFLAE......LGMMNYA...........TIIMYCP-----SMIAAAA.
CG22_SCHPO/267-382------------------------------GKYLTE......IYLFDHD............LLRYPM-----SKIAAAA.
CCNB3_CHICK/276-392------------------------------ARFVCE......MTLQEYD............YARERP-----SKLAASS.
CCD11_ARATH/184-308------------------------------LGFFISHATEIILSNIKEA...........SFLEYWP-----SSIAAAA.
CCD31_ARATH/189-307------------------------------HWDFLNKCHRLLLSVISDS...........RFVGYLP-----SVVAAAT.
CCNA2_CHICK/273-390------------------------------SMYLGE......LTLIDAD...........PYLKYLP-----SVIAAAA.
CCNE1_DANRE/246-368------------------------------QATFVQIAELLDLCILDVR............SLEFSY-----SLLAASA.
CCNA_HYDVD/296-415------------------------------AEYLSE......LTLINCD...........ISVKYAP-----SMIAASS.
CCNB_HYDVD/264-380------------------------------AKYLME......LTLVEYE............FITKLP-----SEVAAAA.
P90681_ASTPE/322-438------------------------------SQYLAE......LTLPDCE............YIKYIP-----STIAAAA.
P92162_BOMMO/389-509------------------------------AKYFVD......LCLVEYT............MAHYRP-----SELAAAA.
P93102_CHERU/319-438------------------------------SYFFSE......LGMMNYS...........TTIKYPP-----SLLAASS.
P93103_CHERU/210-333------------------------------SKSLIFQAIQLILSTIKGI...........DLMEFRP-----SEIAAAV.
P93557_SESRO/318-435------------------------------AHFLSE......LGMMHYA............TLMYCS-----SMVAASA.
P93646_MAIZE/356-473------------------------------AFFYSE......LALVQYA............MLVYPP-----SVTAAAA.
CCB21_ORYSI/285-402------------------------------SFFILE......LSLVEYQ............MLKYRP-----SLLAAAA.
CCNB1_CRIGR/296-414------------------------------AKYLME......LTMLDYD............MVHFAP-----SQIAAGA.
Q08C91_DANRE/272-388------------------------------ARFICE......LSLLEME............FVPVRA-----SLLASAC.
Q09IZ1_ONCMY/251-369------------------------------AKYLME......LTLLDYD............MVHYHP-----SEIAAAA.
CCB22_ORYSJ/293-410------------------------------SFFIIE......LSLVEYE............MLKFQP-----SMLAAAA.
CCA14_ORYSJ/216-339------------------------------ANYIAE......LSLLEYS............LICYVP-----SLIAASS.
CCB13_ORYSJ/341-458------------------------------TFFYAE......LALVQYS............MLFFAP-----SVIAAAA.
Q0UMA7_PHANO/348-462------------------------------GKYLLE......IGCLDHR............FLAHPP-----SQVAAAS.
Q0VA13_XENTR/226-348------------------------------AMYFME......LTLLEAE............GSMIEP-----ALLAIGA.
CCD42_ARATH/171-289------------------------------HSRLVTRSLQVIASTTKGI...........DFLEFRA-----SEIAAAV.
CCNB1_CAEEL/208-340------------------------------SKCLGE......LALLDSV............MASTPR-----SHIASAS.
CCF32_ORYSJ/267-390------------------------------CIYLAE......LSLLDDY............NIRFLP-----SIVAAAC.
CCA22_ARATH/304-427------------------------------ANYLAE......LTLVEYS............FLRFLP-----SLIAASA.
Q16TY2_AEDAE/355-477------------------------------AKFLIE......MASIDYS............TAHYKP-----SEIAAAA.
Q16VG6_AEDAE/419-535------------------------------ARYILE......FTLMEYA............IVGLRD-----SKLACAA.
Q17NN3_AEDAE/310-427------------------------------CMYLCE......LSLLDAD...........PFLTYLP-----SKISAGA.
Q1L8M6_DANRE/153-279------------------------------TQTFIA......LCATDHS............FTMYPP-----SMIATGC.
Q23JX5_TETTS/324-441------------------------------SLYILQ......LCLVEYK............FVKYSE-----SLKACAA.
Q25123_HELRO/240-368------------------------------AMYMLE......TTTVFGD...........CFLKFSP-----SMISTSC.
Q25168_HELTR/382-498------------------------------SRFLLE......SSLMDYQ............FVVCLD-----SILACAC.
Q28DU2_XENTR/291-408------------------------------SMFLGE......LSLVDAD...........PFLRYLP-----SVVAAAA.
Q28GP5_XENTR/256-374------------------------------AKYFME......LTLLDYD............MVHFHP-----SAIAAAA.
Q29CG1_DROPS/434-556------------------------------ARYILE......LSLMDYA............TIGFSD-----SQMASAA.
Q29DY8_DROPS/354-471------------------------------TLFLCE......LALMQGE...........LYLEHLP-----SLTSAAA.
Q2ABE6_CAMSI/198-326------------------------------HLEFLWRCERLLLSAITDS...........RFGCYLP-----SVLAAAT.
Q2ABE7_CAMSI/203-327------------------------------CCEFLKRCESILLCIISDS...........RFMLYLP-----SVLSTAT.
Q2ABE9_CAMSI/308-433------------------------------VFFLAE......LGLMHYP...........TIILYCP-----SMIAASA.
Q2HAK4_CHAGB/352-466------------------------------GKYLME......ISLLDHR............LMAYRS-----SHIAAAA.
Q2HAS9_CHAGB/515-630------------------------------AKYFLE......ITIMDER............FVSSPP-----SFLAAGA.
CCND1_BOVIN/155-283------------------------------AQTFVA......LCATDVK............FISNPP-----SMVAAGS.
Q2PHK8_DAUCA/314-432------------------------------AYFLAE......LGLMNYA............TVMYCP-----SMLAASA.
Q2PHK9_DAUCA/330-448------------------------------TYFLAE......LGMMNYA............TVMYLP-----SMVAASA.
Q2PHL0_DAUCA/311-430------------------------------TFFLAE......LGLTHYT...........TVMTYCP-----SVIAASA.
CCA21_ORYSJ/359-482------------------------------ANYLAE......LTLIDYS............FLKFLP-----SVVAASA.
Q2UPT4_ASPOR/192-299------------------------------ALYISE......ISLFHRE............FVSKPS-----SDLARAS.
Q2V5Z8_BRACM/228-351------------------------------CCYLSE......LSLLDYS............CVKFLP-----SMLAASA.
Q2WGP0_ALLCE/280-397------------------------------SSFIIE......LSLVEYQ............MLKFQP-----SLLAAAA.
Q2WGP2_ALLCE/358-475------------------------------VYFFAE......LGLLQYK............MVMNCP-----SMLAASA.
CCB12_ARATH/312-429------------------------------VHFLAE......LGMMHYD............TLTFCP-----SMLAASA.
CCB21_ARATH/302-419------------------------------ASFLIE......LALVEYE............MLRFPP-----SLLAATS.
CCB13_ARATH/289-406------------------------------VHFLAE......LGLMHHD............SLMFCP-----SMLAASA.
CCB22_ARATH/303-421------------------------------ASFLIE......LALVDYE............MVRYPP-----SLLAATA.
Q39331_BRANA/289-412------------------------------ASYIAE......LSLLEYT............MLSHPP-----SLVAASA.
Q39877_SOYBN/214-337------------------------------GSYIGE......LSLLDYD............CLRFLP-----SIVAASV.
Q39878_SOYBN/336-459------------------------------ANYLAE......LALVECS............FFQFLP-----SLIAASA.
Q39880_SOYBN/313-433------------------------------VFFLAE......LGLMHYP...........TVILYRP-----SLIAASA.
Q3KPK0_XENLA/154-279------------------------------AQTFIA......LCATDFN............FAMYPP-----SMIATGS.
Q3KQA7_XENLA/288-404------------------------------ARYICE......LTLQEYD............FVQERA-----SKMAASC.
Q40223_LUPLU/307-426------------------------------IFFLAE......LSLMDYP...........LVISYCP-----SMIAASA.
Q40338_MEDSA/212-338------------------------------HWEFLRRCENLLLSVLLDS...........RFVGCVP-----SVLATAT.
Q40488_TOBAC/238-361------------------------------GCYLTE......LSLLDYS............CVQFLP-----SVVAASA.
Q40492_TOBAC/247-370------------------------------GYYLAE......LSILDYS............CVKYVP-----SLLAAAV.
Q40514_TOBAC/347-470------------------------------ASYIAE......LSLLEYN............MLCYAP-----SVIAASA.
Q40516_TOBAC/291-408------------------------------VYFLAE......LGLMNYA............TIIYCP-----SMIAASA.
Q41733_MAIZE/317-437------------------------------INFFGE......LALMDYG............MVMTNP-----STAAACA.
Q41734_MAIZE/282-407------------------------------VFFFAE......LALMQYG............LVTRLP-----SLVAASV.
Q49U21_CRYNE/355-469------------------------------SKFLME......VTLLDHR............FLRCKP-----SMIAAIG.
Q4CS48_TRYCC/197-328------------------------------TFFFLE......SASHNYE............MLQYLP-----SRIAAAS.
Q4DWL9_TRYCC/229-371------------------------------ALFFLE......HGMLDYK............CLRFKS-----SQQANAS.
CCD42_ORYSJ/212-330------------------------------PRSWLLRSSELILRIAAGT...........GFLEFRP-----SEIAAAV.
Q4RZE5_TETNG/155-280------------------------------AQTFVA......LCATDVN............FIASPP-----SMVAAGS.
Q4SG06_TETNG/155-272------------------------------AMYIAE......LGLLETD...........VLLRYPP-----SLLAAAA.
Q4T0M3_TETNG/224-342------------------------------AKYLLE......LTMVDYE............MVSFPP-----SIVACAA.
Q4T2Y9_TETNG/114-254------------------------------NGWPISSISKTKVFMDKYTHYFLEVSLQDHAFLSFRP-----SQVASAC.
Q4T8S9_TETNG/1145-1270------------------------------AQTFVA......LCATDVK............FIASPP-----SMVAASS.
Q4TVR6_HELTR/235-352------------------------------AKYFME......MILVEYD............MVHYLP-----SKIAAAA.
CCNB_DICDI/316-434------------------------------SKYLSE......LSMVEYR............MVQFVP-----SMIAAAS.
CG11_CANAL/174-308------------------------------ARFLCE......LSLYDKY............FLSVPP-----SLIAITA.
Q5D894_GOSHI/87-204------------------------------VYFLAE......LGIMHYE............TIRYCP-----SMVAASA.
Q5D8P0_SCHJA/269-392------------------------------AKYFLE......LTVQEYD............LAHLPG-----NLRSVTA.
Q5KAX2_CRYNJ/366-482------------------------------AKYLVE......ISCVDHR............LLGYTP-----SMLAAAS.
Q5SCB6_OSTTA/230-346------------------------------ASYAVE......CALPEYG............MLKYSG-----STLAAAG.
Q5SCB7_OSTTA/222-339------------------------------AAFLAE......LTLMCQT............FLDFTP-----AVVATAA.
Q5T8J1_HUMAN/105-230------------------------------AQTFLA......LCATDYT............FAMYPP-----SMIATGS.
Q5U4W4_XENLA/240-362------------------------------QEQFIHVAQLLDLCILHHT............SLNFQY-----RILAAAA.
Q5UAU8_PENJP/269-385------------------------------AKYLME......LCLPEYG............MCHYKS-----SMIAASA.
CCNF_XENTR/414-537------------------------------CSYISE......LSLLYTE............LSTYSP-----AQLAAGA.
Q5ZKI9_CHICK/155-280------------------------------AQTFIA......LCATDYT............FAMYPP-----SMIATGS.
Q5ZMH4_CHICK/247-368------------------------------QEKFIQIAQLLDLCILDVN............SLDFQY-----RTLAAAA.
CCNB1_ANGJA/272-390------------------------------AKYFME......LTMVDYE............MVHFPP-----SLVASAA.
Q60FY1_ORENI/302-418------------------------------ARYYCE......MSLMEMD............LVPERG-----SLVASAC.
Q60FY2_ANGJA/277-393------------------------------ARYVCE......LSLLEVE............LIPERA-----SLLASAC.
A8XRM2_CAEBR/208-340------------------------------SKLLGE......LALLDSV............MSSVPK-----SHIAIAA.
CCNB3_CANFA/1202-1318------------------------------SRFICE......MTLQEYD............YVQERA-----SKLAAGS.
Q6CE22_YARLI/306-421------------------------------AKYLLE......VTIMEKT............FVGAPP-----SWLAAAA.
Q6CEJ4_YARLI/393-508------------------------------GKYLCE......IALVDHT............FMEFKH-----SLVAAAA.
Q6CT04_KLULA/317-432------------------------------AKYLLE......TSIMEPE............IIAAPP-----SWLAAGA.
CCNJ_XENLA/145-273------------------------------DGWPMICLEKTKIYMAKYADYFLEVSLQDHMFLNYGP-----SLVAAAC.
Q6FNV2_CANGA/314-429------------------------------AKYLLE......TTLMESS............LISALP-----SWLAAGA.
Q6FQU1_CANGA/326-455------------------------------AKYLLE......TTIMDAR............LIGTPP-----SWLASGA.
Q6FVY0_CANGA/262-383------------------------------AKFILE......YSLCSSK............FVGEKP-----SELAAMA.
Q6FVY1_CANGA/344-459------------------------------AKFLLE......ISLVDFR............FIGVLP-----SLCAAAA.
Q6IR86_XENLA/262-380------------------------------AKYLIE......LVMTDYD............MVHIPP-----SQLAAAA.
CCF13_ORYSJ/255-372------------------------------AHRFTD......GSLLTYG............FHRYLP-----SVVAASA.
Q6P801_XENTR/266-384------------------------------AKYLME......LVMVDYD............MVHYSP-----SQIAAAA.
Q6T2E9_BUFBG/263-381------------------------------AKYLME......LTLIDYD............MVHFRP-----SEIASAA.
Q6X269_USTMD/465-579------------------------------SKFLME......LALLDHR............FLRARP-----SLVAAVG.
Q6X270_USTMD/433-547------------------------------AKYFME......ISLLDYR............LMEHPP-----SLIAAAS.
Q6ZZ83_SPHGR/342-458------------------------------TQYLAE......LTLQEYD............FIKYVP-----SMIAASA.
Q75A51_ASHGO/248-363------------------------------AKYLLE......TTIMDPR............LVAAPP-----SWLAAGA.
Q75EI0_ASHGO/418-533------------------------------AKYLLE......ISVVDFK............FIGILP-----SLCAAAS.
Q790L7_MOUSE/155-283------------------------------AQTFVA......LCATDVK............FISNPP-----SMVAAGS.
CCA11_ORYSJ/372-495------------------------------ANYVAE......LSLLEYN............LLSYPP-----SLVAASA.
Q7PPJ1_ANOGA/320-449------------------------------AKYLIE......LASVDYS............TAHYKP-----SEIAAAA.
Q7Q0E8_ANOGA/187-304------------------------------TMYLCE......LSLLEAD...........PFLTYMP-----SKIAAGA.
Q7XAB7_EUPES/184-308------------------------------HWEFLRRCELLLLSVISDS...........RFMSYAP-----SILATSI.
Q7Z4Z4_HUMAN/264-382------------------------------AKYLME......LTLIDYD............MVHYHP-----SKVAAAA.
Q7ZVA8_DANRE/252-370------------------------------AKYFLE......LTLLDYD............MVHYNP-----SETAAAA.
Q7ZYJ6_XENLA/153-279------------------------------AQTFVA......LCATDVK............FISNPP-----SMIAAGS.
CCNB3_MOUSE/1265-1381------------------------------SRFICE......MTLQEYE............YIEERP-----SKLAAAS.
Q84LE4_SILLA/352-474------------------------------ANYVAE......LSLLEYS............MLKYAP-----SLIAASS.
Q84V88_POPAL/200-324------------------------------HWEFLWRCERLLLSVISDS...........RFMSYLP-----SILATAT.
Q8GZU3_9ROSI/205-332------------------------------CLEFLKRCERMVLSILADS...........RSMPYVP-----SVMAAAT.
CCD41_ARATH/180-299------------------------------SNTLISRSLQVIASTTKGI...........DFLEFRP-----SEVAAAV.
Q8LK74_LAGSI/187-313------------------------------CWEILWQCERTILSVILES...........DFMSFLP-----SVMATAT.
Q8LPW3_HELAN/178-304------------------------------HWDFFKKCEAMILYLVADS...........RFVCYKP-----SVLATAT.
Q8SRF2_ENCCU/179-293------------------------------GKYLLE......LMTLYEE............FLRFKG-----SVRAAAA.
CCNA1_CARAU/268-385------------------------------ALYLSE......LSLLEVD...........PFVQYLP-----SKTAAAA.
CCNB1_CARAU/266-384------------------------------AKYFLE......LTMVDYD............MVHFPP-----SQVASAR.
Q941M7_MEDSA/349-473------------------------------ANYLAE......LTLMNYG............FLNFLP-----SMVAASS.
Q94740_SPHGR/281-401------------------------------AKFLME......ITLPEYN............MVQYDP-----SEIAAAA.
Q95WE6_ASTPE/274-391------------------------------SKYIME......LTLPEYS............FVKYDP-----SEIAAAA.
Q96226_ADICA/397-520------------------------------GNYLAE......LTLLEYG............FLHFLP-----SMIAGAA.
Q98TA3_DANRE/305-422------------------------------SMFLGE......LSLIDCD...........PFLKYLP-----SQMAAAA.
Q9C2K2_NEUCS/516-631------------------------------AKYLLE......VTIMDER............FVGCPA-----SYLAAGA.
CCA24_ARATH/329-452------------------------------ANYLTE......LTLMDYP............FLKFLP-----SIIAASA.
CCA31_ARATH/219-342------------------------------CSYLSE......LSMLDYQ............SVKFLP-----STVAASA.
CCA12_ARATH/310-433------------------------------ACYLTE......LSLLDYA............MLRYAP-----SLVAASA.
Q9GTQ8_DROME/286-422------------------------------AQAFIS......LAAKEHK............FAKFSA-----STIAASS.
CCNB2_ORYLA/254-372------------------------------AKYLME......LTLLDYH............MVHYRP-----SEVAAAA.
CCB23_ARATH/308-425------------------------------SFFMIE......LCLVEYE............MLEYLP-----SKLAASA.
Q9LKC6_CICAR/324-443------------------------------VYFLAE......LGMMNYA............TLIYCP-----SMIAAASH
Q9M4K9_PEA/216-340------------------------------CCYLAE......LSLLDYN............CVKFLP-----SMVAASV.
Q9S7H9_SOLLC/192-320------------------------------HMDFLKKCERLILDIITDS...........RLLHYPP-----SVIATAS.
CCB31_ARATH/274-391------------------------------AFYLIE......LCLVEYE............ALKYKP-----SLLCASA.
Q9SBQ4_PETHY/303-423------------------------------AFFFAE......LGLMNYT...........TTISYCP-----SMLAASA.
CCB24_ARATH/309-426------------------------------SFFMIE......LCLVEYE............MLQYTP-----SQLAASA.
Q9SMD4_SOLLC/184-309------------------------------SLEFLRRCEKVLLYTITDD...........RFIGYLP-----SAMASAT.
CCD33_ARATH/188-310------------------------------QLEFLSRCESLLLSIIPDS...........RFLSFSP-----SVLATAI.
Q9SNV0_ANTMA/203-329------------------------------QCEFMKRCESVILSIITDY...........RFVRYLP-----SVVAAAT.
Q9SNV2_ANTMA/176-296------------------------------TGFLTSRAKEIILSTVQET...........SLIEYRP-----SCIAAAT.
Q9SXN7_TOBAC/190-313------------------------------HWEFLKQCERILLLVIADC...........RFLSYMP-----SVLATAT.
Q9TY42_PARTE/121-227------------------------------AQYILE......LALVEYK............FIIYKP-----SQIVQSV.
Q9U7P9_9CILI/566-681------------------------------SKYLAD......LMLLRHE............LIGIRP-----SLLASAI.
Q9XGI1_SOLLC/308-425------------------------------SFMLVE......LCLVEYE............MLKFPP-----SFIAAAA.
Q9XGI2_SOLLC/248-367------------------------------TFFLAE......LGLMNYT...........TVISYCP-----SKIAASA.
Q9XGI4_SOLLC/345-468------------------------------ANYLAE......LTLAEYS............FLKFLP-----SVTAASA.
CCNE2_MOUSE/241-363------------------------------QETFIQIAQLLDLCILAID............SLEFQY-----RILAAAA.
CCD61_ARATH/156-288------------------------------KHSLKSQTSDLTFSLQHDI...........SFLEFKP-----SVIAGAA.
Q9ZRG1_PEA/135-252------------------------------AFFLID......LCLVEYE............TLAFKP-----SLLCAST.
Q9ZRX9_TOBAC/198-319------------------------------SRPLISGSMQLILSIIRSI...........DFLEFRS-----SEIAASV.

PF03261

CD5R2_MOUSE/1-332PPPPPAPQAAPPAPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPAN-
CD5R1_RAT/1-296SSVKKAPHPAITSAG.TPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPAN-
O13123_XENLA/1-285SSIKNVSN...TSGGGSPKRVIVQASTSELLKCLGEFLCRRCYRLKHLSPTDPILWLRSVDRSLLLQGWQDQAFVTPAN-
CD5R1_CAEEL/1-356AEQENVPS...............EASTSELLRGLGIFISNNCD.VSDFDPAHLVTWLRSVDRSLLLQGWQDIAFINPAN-
Q9Y0G0_DROME/81-464PQQVQASSIQIKNTNQIPRKTVIQASTSELLKCLGMFLHCRCQRLNNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPAN-

PF01858

RBL1_MOUSE/385-578------------------------------GETFCQ------HYTQSTDKQP.......GSHIDFAV-----NRLKLAE-
RBR1_MAIZE/275-476------------------------------LEAIFP------TKSSANRGVSLGLNCANAFDIPWAE-----ARKVEAS-
RBF_DROME/376-560------------------------------IEEI.E------QKFLA.K...........YPSTEAK-----SRFQLAK-
RBR_CHERU/403-604------------------------------MEAIFP------NSALGERCIAGSLPNSNLTDNIWAQ-----QRRLEAL-
RBL2_HUMAN/417-609------------------------------FEIYSQ------HFQPDEDFS........NCAKEIAS-----KHFRFAE-
RB_HUMAN/373-573------------------------------GYIFKE------KFAKAVGQG..........CVEIGS-----QRYKLGV-
Q98966_NOTVI/353-548------------------------------GQIFKQ------KFAEAVGQA..........CEEIGY-----QRFKVGV-

PF00134

CG11_CANAX/48-176-NIIDRYC------A---------KR.I....VFK----RHYQLVGCTALWIASK........YEDKK............
CCNA2_MOUSE/171-297-NYIDRFL------S---------SM.S....VLR----GKLQLVGTAAMLLASK........FEEI.............
CCNB3_CAEEL/115-241-KLTDMYL------C---------KTKN....VDK----NTIQKLACVAIFIAAK........YDER.............
CCNF_MOUSE/281-406-ECVDRYL------R---------RR.L....VPR----YKLQLLGIACMVICTR........FISK.............
CCT12_ARATH/28-169-FFCHRFF------L---------RQ.S....HAK----NDRQTIATVCMLLAGK........VEET.............
CCNE_CAEEL/232-360-DYVDRYL------E---------SSNV...ECST----DNFQLVGTAALFIAAK........YEEI.............
O04388_CATRO/107-236-SYIDRFL------S---------MN.A....LSR----QKLQLLGVSSMLIASK........YEEI.............
O04389_CATRO/186-311-NIVDRYL------A---------VQ.T....TLR----KELQLVGMSAMLIASK........YEEI.............
O04399_TOBAC/107-236-TFVDRFL------S---------SH.V....MAR----NSLQLLGVSCMLVASK........YEEI.............
REM1_SCHPO/145-271-NVLDRFL------S---------LQN.....VPA----SKMKLCGATALFIACK........YEEI.............
CCNE_HEMPU/126-253-DFVDRYL------A---------AK.E...NVPK----TKLQLIGITSLFVAAK........LEEI.............
O40946_HHV8/20-147-NLLDRLL------L---------IK.....QVSK----EHFQKTGSACLLVASK........LRSL.............
CCNE3_XENLA/114-241-DFFDRFM------A---------TQ.K...NVIK----SRLQLIGITSLFIAAK........MEEI.............
O45926_CAEEL/34-159-FVLDRII------V---------KN.I....VSK----AEFQLLGVAALFVASK........FEDI.............
CCB14_ARATH/133-258-NLVDRFL------S---------LT.M....VHR----RELQLLGLGAMLIACK........YEEI.............
O62573_SPHGR/213-339-AFIDRFL------S---------QM.S....VLR----AKLQLVGTASMFVASK........YEEI.............
O65065_PICMA/77-204-IYIDRLV------H---------RQP.N.FPVIS----LNIHRLLLTSLMIAAK........MLDD.............
O76513_DROME/43-156-HYFKRFY------L---------NNSP.....MD----YHPKEILATCVFVACK........VEEF.............
CCU41_ARATH/22-148-VYLDRFT------H---------RQP.S.LPINS----FNVHRLLITSVMVAAK........FLDD.............
O82136_PEA/72-205-TYFDRFL------L---------TFHFQ..KDKP----WMIQLVAVTCISLAAK........VEET.............
O93228_RANJA/112-237-SILDRFL------Q---------VN.P....VPK----KSLQLAGVSAMFIASK........YEEI.............
O93231_BUFJA/24-149-AIIDRFL------Q---------DH.P....VPK----KQLQLVGVTAMFIASK........YEEM.............
O93911_CANAX/234-360-NYIDRFL------S---------KR.R....VSL----SRFQLVGAVALFIAAK........YEEI.............
O93916_PNECA/176-302-NIIDRFL------S---------LR.V....CSL----PKLQLVGITALFIAAK........YEEV.............
CCNB2_HUMAN/137-262-GIMDRFL------Q---------VQ.P....VSR----KKLQLVGITALLLASK........YEEM.............
CCNT_DROME/42-176-VYMHRFY------A---------FHSF....T.H----FHRNSMASASLFLAAK........VEEQ.............
O96434_PARTE/82-210-YLIDRFL------N---------F..K...TTTR----QQLQLVGVASLFIACK........YEEI.............
O97482_PARTE/85-212-SLIDRYL------A---------L..A...QVTR----MRLQLVGVAALFIACK........YEEI.............
CCNB_ARBPU/145-272-QLIDRFL------A---------EH.S....VSK----GKLQLVGVTAMFIASK........YEEM.............
CG23_SCHPO/206-332-NIIDRFL------S---------LR.V....CSL----NKLQLVGIAALFIASK........YEEV.............
CCNB1_XENLA/139-264-GIIDRFL------Q---------EH.P....VPK----NQLQLVGVTAMFLAAK........YEEM.............
CCNB2_XENLA/134-259-AIMDRFL------Q---------VQ.P....VSR----SKLQLVGVTSLLIASK........YEEM.............
CCNB_SPISO/172-297-AIIDRLL------Q---------ES.P....VPR----NKLQLVGVTSMLIASK........YEEM.............
CCNA_DROME/206-332-FYLDRFL------S---------QM.A....VVR----SKLQLVGTAAMYIAAK........YEEI.............
CCNB_ASTPE/147-270-QILDRYL------E---------GA.S....VSK----TKLQLVGVTSMLIAA.........YEEM.............
CG12_YEAST/43-195-RLYDRYC------S---------KR.....IVLR----DQAKLVVATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNP
CCNB_DROME/260-387-AIIDRYL------Q---------VV.K...DTKR----TYLQLVGVTALFIATK........YEEL.............
CCNB1_MOUSE/170-295-SIIDRFM------Q---------NS.C....VPK----KMLQLVGVTAMFIASK........YEEM.............
CCNA_PATVU/174-300-NYIDRFL------S---------QM.S....VLR----GKLQLVGAASMFIASK........YEEI.............
CCNB_PATVU/155-280-SIIDRFL------Q---------VH.P....ISR----NKLQLVGVTSMLLASK........YEEM.............
CG21_SCHPO/166-292-NLIDRFL------S---------IK.V....VSL----QKVQLVGLSALLIACK........YEEI.............
PCL1_YEAST/19-152-CYLNKLK------R---------ILPRD.ATGLP----STIHRIFLACLILSAK........FHND.............
CG21_YEAST/212-337-NIMDRFL------C---------EE.V....VQL----NRLQLVGTSCLFIASK........YEEI.............
CG22_YEAST/232-357-NIMDRFL------G---------KE.L....VQL----DKLQLVGTSCLFIASK........YEEV.............
CG23_YEAST/171-297-NIIDRYL------C---------KE.V....VPV----NKFQLVGAASLFIAAK........YEEI.............
CG24_YEAST/210-336-NIVDRFL------S---------KK.T....VTL----NRFQLVGVSALFIAAK........FEEI.............
PUC1_SCHPO/99-227-SLMDSYV------S---------RR.....VVYC----KHIQLVACVCLWIASK........FHETE............
CCNAL_DAUCA/77-206-SYVDRYL------S---------VN.V....LNR----QKLQLLGVSSFLIASK........YEEI.............
CCNB1_SOYBN/197-322-NIIDRFL------A---------VK.T....VPR----RELQLVGISAMLMASK........YEEI.............
PCL2_YEAST/18-146-VYLAKLR------S---------IIPSN.VYGIE----TTRHRIFLGCLILAAK........TLND.............
CCNB2_CHICK/141-266-AVMDRFL------Q---------SH.P....VPR----KRLQLVGVTALLLASK........YEEM.............
CCB11_ARATH/168-293-NILDRFL------S---------VK.P....VPR----KELQLVGLSALLMSAK........YEEI.............
CCNB2_MEDSA/73-199-NLIDRFL------A---------K..Q...NVVR----KKLQLVGLVAMLLACK........YEEV.............
CCND2_MOUSE/24-151-NYLDRFL------A---------GV.....PTPK----THLQLLGAVCMFLASK........LKET.............
CCND3_HUMAN/26-153-NYLDRYL------S---------CV.....PTRK----AQLQLLGAVCMLLASK........LRET.............
CGS5_YEAST/165-294-NLMDRFL------A---------KN.K....VTM----NKLQLLAVTSLFIAAK........FEEV.............
CG21_EMENI/211-337-NIIDRFL------S---------AE.V....VAL----DRLQLVGVAAMFIASK........YEEV.............
CGS6_YEAST/123-252-NLLDRFL------S---------QN.V....VKL----NKLQLLCITCLFIACK........FEEV.............
CCNA1_CAEEL/215-341-SLVDRAL------S---------MFN.....IDK----MRFQLVGTTSMMIAVK........YEEI.............
CCN1_ANTMA/197-322-NIVDRYL------A---------SE.T....TIR----RELQLVGIGAMLIASK........YEEI.............
CG22_SCHPO/139-265-NIIDRFL------S---------RR.S....CSL----SKFQLTGITALLIASK........YEEV.............
CCND1_RAT/26-153-NYLDRFL------S---------LE.....PLKK----SRLQLLGATCMFVASK........MKET.............
CCNB3_CHICK/149-274-KLVDHYL------V---------EVV.....SMR----DKLQLIGSTAVLIASK........FEER.............
CCNB_DICDI/188-314-NIVDRYL------A---------K..V...MIPV----TKLQLVGITAILLACK........YEEI.............
CCD11_ARATH/50-182-NYMDRFL------Y---------ARRLP..ETSG----WPMQLLAVACLSLAAK........MEEI.............
CCD21_ARATH/65-197-NYLDRFL------T---------SYELP..KDKD----WAAQLLAVSCLSLASK........MEET.............
CG12_CANAX/44-172-NLIDRYC------S---------TR.....IVKK----QHYQLLGLTSLWISCK........NLDSK............
SSN8_YEAST/45-176-IYLSRFL------I---------KAS.....VRE----INLYMLVTTCVYLACK........VEEC.............
CG21_CANAX/208-334-NVMDRFM------S---------VE.V....VQI----DKLQLLATAALFTAAK........NEEV.............
CCNE1_CHICK/112-239-DFFDRFM------A---------TQ.Q...NVVK----TLLQLIGISSLFIAAK........LEEI.............
CCNA_HYDVD/168-294-SYIDRFL------S---------HM.S....VLR----GKLQLVGAACMLVAAK........FEEI.............
CCNB_HYDVD/137-262-YILDRFL------N---------KQ.N....VKR----AELQLVGVTAMLLASK........YEEM.............
CCNE_DROME/330-459-DYLDRYL------H---------VA.H...KVQK----THLQLIGITCLFVAAK........VEEI.............
CCNA1_HUMAN/214-340-NFLDRFL------S---------CM.S....VLR----GKLQLVGTAAMLLASK........YEEI.............
P92162_BOMMO/260-387-GIIDRYL------Q---------VV.P...NVQR----NQLQLVGVTAMFIASK........YEEI.............
P93102_CHERU/192-317-NIIDRFL------S---------MK.I....VPR----KELQLVGIASMLIACK........YEEI.............
P93103_CHERU/77-208-NYLDRFL------S---------AYEL...PGKA----WMMQLLGVACLSLAAK........VDET.............
CCC11_ORYSJ/4-144-TYFRRVY------T---------RK.S....MTE----YDPRLVAPTCLYLASK........VEES.............
P93646_MAIZE/228-354-YIIDQYL------S---------ME.S....VPR----KELQLVGISAMLIASK........YEEI.............
CGH2_SHV21/22-148-SILDRYL------C---------KK.....QGTK----KTLQKIGAACVLIGSK........IRTV.............
CG1_COLGL/38-166-NLLDRFC------C---------KKDF....LGQ----VYYRVFSCAALWIASK........FVEDK............
CCNB1_CAEEL/81-206-FILDRML------Q---------KK.V....TSK----ADLQLLGISAMFVASK........FEEV.............
PCL9_YEAST/19-146-VYLNKLK------S---------VIPKN.VYGIN----TTRHRIFLGCLILAAK........TLND.............
CCA22_ARATH/175-302-NLIDRFL------S---------NS.Y....IER----QRLQLLGVSCMLIASK........YEEL.............
Q24158_DROME/126-255-NYMDRFL------S---------SK.....SVRK----TQLQILAAACLLLASK........LREPS............
Q25123_HELRO/112-238-NYIDRFL------S---------MM.S....VIR----CRLQLLGAAAMFIAAK........YEEI.............
Q25168_HELTR/256-380-KLIDIFS------S---------KVT.....IKR----NKLQLIGAVALNLACK........FEER.............
CCB12_ARATH/185-310-NIIDRFL------S---------VK.A....VPK----RELQLVGISALLIASK........YEEI.............
CCB21_ARATH/174-300-NLIDRFL------S---------KQ.N....VMR----KKLQLVGLVALLLACK........YEEV.............
Q39331_BRANA/160-287-NYIDRYL------S---------GN.V....ISR----QKLQLLGVACMMIAAK........YEEV.............
Q39877_SOYBN/83-212-SYIDRFL------S---------VN.P....VTK----SRLQLLGVSSMLIAAK........YEET.............
Q39878_SOYBN/207-334-NLIDRYL------S---------TR.L....IQK----QKLQLLGVTCMLIASK........YEEM.............
Q39880_SOYBN/186-311-NIVDRFL------S---------VK.A....VPR----RELQLVGISSMLIASK........YEEI.............
Q40794_PETCR/187-312-NILDRYL------S---------TE.S....VAR----KELQLVGISSMLTASK........YEEI.............
Q41731_MAIZE/173-299-NIIDRFL------A---------R..E...NVVR----KKLQLAGVTAMLLACK........YEEV.............
Q41732_MAIZE/188-315-NYIDRYL------S---------GN.E....IRR----KRLQLLGVACMLIAAK........YEEI.............
Q41733_MAIZE/189-315-YIVDRYL------S---------LQ.P....TPR----RELQLVGVAALLIACK........YEEI.............
Q41734_MAIZE/155-280-YIIDQYL------S---------LQ.P....VLR----RELQLVGVSAMLIACK........IEEI.............
CCNE1_MOUSE/113-240-DFFDRYM------A---------SQHN....IIK----TLLQLIGISALFIASK........LEEI.............
CCB21_ORYSJ/157-283-NIVDRFL------E---------KQ.V....VPR----KKLQLVGVTAMLLACK........YEEV.............
CCD41_ARATH/45-178-NYLDRFL------S---------VHDLP..SGKG----WILQLLAVACLSLAAK........IEET.............
Q96226_ADICA/268-395-SYIDRFL------S---------GN.L....VTR----QRLQLLGVASMLIASK........YEEI.............
CCNB3_DROME/308-433-KIVDLYL------C---------REV.....INK----EKLQLLGAAAFFIACK........YDER.............
Q9PVT7_CARAU/117-244-DYFDRFM------A---------TQ.E...NVLK----TTLQLIGISCLFIAAK........MEEI.............
Q9PW42_CARAU/140-266-NYLDRFL------S---------CM.S....VLR----GKLQLVGTAAVLLAAK........YEEV.............
Q9S7H9_SOLLC/61-190-NYFDRFV------S---------GWCFQ..KDKP----WMSQLAAVACLSIAAK........VEET.............
CCB31_ARATH/146-272-DLLDRYL------S---------QV.P....IHK----NEMQLIGLTALLLASK........YEDY.............
CCB24_ARATH/180-307-NLIDRFL------A---------VH.Q...HIAR----KKLQLVGVTAMLLACK........YEEV.............
Q9SMD4_SOLLC/51-182-NYFDRFL------L---------FSFNQSLNHKP----WMNQLVAVTCLSLAAK........VEET.............
CCD33_ARATH/59-186-NYFDRFI------T---------SRKFQ..TDKP----WMSQLTALACLSLAAK........VEEI.............
Q9SNV1_ANTMA/59-187-NYLDRFL------C---------TFQFQ..QDKP----WMYQLAAVACLSLAAK........VEET.............
Q9SNV2_ANTMA/45-174-SYFDRFL------N---------AHHLP..KLNG----WPMQLLSVACLSLAAK........MEES.............
Q9SXN7_TOBAC/59-188-NYFDRFL------S---------SLHFQ..KDKP----WMIQLVAVTCLSLAAK........VEET.............
Q9U2M5_CAEEL/72-201-SLIDRFM------S---------VQN.....ILK----HDIQMIAGVALFIASK........LKAP.............
Q9U7P9_9CILI/433-564-GLVDRAL------E---------VIP.....VER----AHLQLVGVACMKLADVL.....NEKSKEY............
Q9VE72_DROME/6-144-IVFHRFF------R---------EVK.....ASD----YDEFLIAAGSLYLAGK........IKEDE............
Q9VKF0_DROME/205-327-VYLERLL------T---------YAEL...DVGP----CNWKRMVLGAILLASK........VWDD.............
Q9VZP3_DROME/42-165-YYMDRFV------D---------YY.....KIRP----DKLLLVAITCLHIAAQ........IENTD............
Q9WRM3_9GAMA/20-147-SILDRYL------E---------CR.....SIPR----RRFQRLGAACLFLAGK........IRDL.............
Q9XGI0_MEDSA/224-351-YLIDWFL------S---------KN.C....IER----ERLQLLGITCMLIATK........YEEI.............
Q9XGI1_SOLLC/180-306-NLIDRFL------E---------K..Q...GIVR----KKLQLVGLVAMLLACK........YEEV.............
Q9XGI2_SOLLC/121-246-NIMDRFL------S---------EE.P....VPR----RELQLLCISSMLIASK........YEEI.............
Q9YTJ4_ATHV3/30-156-SILDRYL------C---------KE.....QGTK----TTLQKIGAACVLIASK........IRTV.............
CCNE2_MOUSE/112-239-DFFDRFM------L---------TQ.K...DVNK----NMLQLIGITSLFIASK........LEEI.............
CCD61_ARATH/26-154-NYLDRFL------S---------SEDMP..QSKP----WILKLISLSCVSLSAK........MRKP.............
Q9ZRG1_PEA/7-133-TLLDQYL------S---------QV.T....VKR----SDMQLVGLTALLLASK........YEDF.............
Q9ZRX9_TOBAC/64-196-NYLDRFL------S---------LYELP..RSKT----WTVQLLAVACLSLAAK........MEEI.............

PF08613

PHO80_YEAST/33-170-YYIDLLQ------T...........VYPDFTLNS----LTAHRFLLTATTVATK--------GLCD-------------
YGZA_SCHPO/29-176-IYLDRIV------H..........HFHFTVFINS----FNIHRFLIAGFTAASK--------FFSD-------------
Q872V6_NEUCS/156-314-LYIHRLA------I...........IERAIVVTK----RNAHRLLLAGIRVAMK--------ALED-------------
Q8IEW5_9TRYP/370-620-IYLFRIV------K.........RCDSEYSSVTA----ANWYRLTAVALLVATK--------MYVD-------------
Q949F8_ORYSA/17-159-IYLDRLL------R......RGRRCLALALAVDS----YSVHRLLITAVLSAVK--------FMDD-------------
CGP1_SCHPO/7-134-YYFIRFR------D........AASSKPTNYIPL----LCGRRLFLVCLMAATK--------FLQD-------------
Q8I8A9_9TRYP/370-620-IYLFRIV------K.........RCDSEYSSVTA----ANWYRLTAVALLVATK--------MYVD-------------
PCL7_YEAST/108-264-VYFDRIS------KNYGHSSERNGCAKQLFVMDS----GNIHRLLITGVTICTK--------FLSD-------------
Q83C02_COXBU/10-148-ILIRRAE------E........IKEKKKNITITR----SNVYRLFAIALMVSAK--------YLND-------------

PF00382

TF3B_KLULA/193-266----------------------------------G----RRPAGIAGACLLLACR--------MNNL-------------
TF2B_PYRWO/116-186----------------------------------G----RSIESVMAACVYAACR--------LLKV-------------
TF2B_KLULA/137-207----------------------------------G----KSQESIMASVILVGCR--------RAEV-------------
TF2B_YEAST/133-203----------------------------------G----KSMESIMAASILIGCR--------RAEV-------------
TF2B_HALVA/30-100----------------------------------G----KSPTGYAAAAIYAASL--------LCNE-------------
TF3B_CANAL/95-165----------------------------------G----RRSNNVLATCLYVACR--------KERT-------------
TF2B_DROME/214-284----------------------------------G----RSPISVAAAAIYMASQ--------ASEH-------------
TF2B_PYRWO/212-282----------------------------------G----KSPAGLVAAALYIASL--------LEGE-------------
TF3B_KLULA/98-168----------------------------------G----RKSQNVIAACLYIACR--------KERT-------------
TF3B_CANAL/190-263----------------------------------G----RRPAGIAGACVLLAAR--------MNNF-------------
TF2B_DROME/120-190----------------------------------G----RSNDAKASACLYIACR--------QEGV-------------
TF2B_KLULA/245-315----------------------------------G----RSPITIAAAAIYMATL--------LFKL-------------

PF01857

RBR2_MAIZE/594-721-DQQTTLF------F-------------------N----RHIDQLILCCLYGVAK--------VCQ.-------------
RBL1_HUMAN/786-944-VHCPDLM------K-------------------D----RHLDQLLLCAFYIMAK--------VTK.-------------
RB_HUMAN/645-766-QNEYELM------R-------------------D----RHLDQIMMCSMYGICK--------VKN.-------------
RBL2_HUMAN/834-992-IQCPELM------M-------------------D----RHLDQLLMCAIYVMAK--------VTK.-------------
RBF_DROME/580-706-THETELM------K-------------------D----RHLDQNIMCAIYIYIR--------VKRM-------------
RBR_CHERU/724-863-NQRTSLF------F-------------------N----RHIDQIILCAFYGVAK--------ISQ.-------------

PF02984

CCNB3_CAEEL/243-364.FVLAMRM......LD.....KNNE.......YE.----WNPVLEKYS.GF...T--------GEEV-------------
Q7QC70_ANOGA/538-653.LFIARRM......LD.....Q.P.........G.----WNETLEYYS.SY...K--------VEQF-------------
A4HKX7_LEIBR/155-297.VFLALLV......LR.....TKLELPKASNFPV.----WTDALRYYT.KA...E--------VHEF-------------
CCNF_MOUSE/408-531.LLLARLM......HG.....QTQ.........P.----WTTHLWDLT.GF...S--------YSDL-------------
CCNB3_HUMAN/1259-1375.LLLALYM.............KKL........GY.----WVPFLEHYS.GY...S--------ISEL-------------
Q0UCR8_PHANO/466-581.HCLARMM......LK.....K.G.........D.----WSQPHVHYS.GY...T--------LSQL-------------
Q291N4_DROPS/375-501.LFLSLHL......LN....GNYRTSTG.FNDKH.----WTPTLAYYS.RY...T--------ATHL-------------
CCNA1_MOUSE/298-415.YCLANYI......VN.....R.H.........F.----WPETLAAFT.GY...S--------LNEI-------------
Q6BGT2_DEBHA/350-465.HYLSRKL......LN.....R.G.........H.----WTEAHVYYS.GY...T--------ESQL-------------
A0C1C9_PARTE/197-310.ILLAINL......LR.....SPQ.........V.----LPSSLHYIE......D--------QEEL-------------
A0DMF0_PARTE/199-312.ILLAINL......LR.....SPQ.........V.----LPSSLHYVD......N--------QEDL-------------
A0E0R4_PARTE/214-320.IFLVNKI......R......SPN.........Y.----RTQ............N--------EASL-------------
CCA33_ARATH/190-313.VFLARFI......IL....PNQH.........P.----WSQMLEECT.KY...K--------AADL-------------
A1C7V2_ASPCL/489-604.HCLARLL......LR....K...........GN.----WTPAHVHYA.EY...T--------YSQL-------------
A1CID9_ASPCL/361-475.MYLARLI......LE....R...........GA.----WDATLAHYA.GY...T--------EEEI-------------
A2DQ77_TRIVA/248-364.IVITRVY......Y......GEV.........P.----WNEKLEGYT.GY...S--------LENL-------------
A2DZV8_TRIVA/235-351.VVIMRVV......Y......SET.........P.----WTEDLMMFS.RY...S--------LKDL-------------
A2E0Q4_TRIVA/216-333.IFYAMQI......TH.....NAS.........S.----LNQDFEKKI.GY...S--------MKDI-------------
A2E6K7_TRIVA/216-333.LYYSMVI......TN.....NST.........L.----WTKDLERQL.CY...T--------KSEL-------------
A2F2K2_TRIVA/212-328.VMFTHYL......R......GVT.........L.----WSNTFSGYT.QY...T--------LEDM-------------
A2ZM34_ORYSI/249-372.VFVAKLN......ID....PYTN.........P.----WSKKMQKLT.GY...K--------VSEL-------------
A3AKA7_ORYSJ/256-379.VFVARLT......LD....SDTN.........P.----WSKKLQEVT.GY...R--------ASEL-------------
A3LN44_PICST/322-438.MYLARLI......LG....K...........SPV----WNGNLIHYSGGY...R--------VNNM-------------
A4RSW0_OSTLU/207-322.TVLAEFY......LC.................R.----EKPQIIPF..LVD.LD--------TPKL-------------
A5AEK5_VITVI/324-442.VYAARCA......LN.....KSP.........V.----WDETLKAYT.GF...S--------EAQL-------------
A5BUM0_VITVI/360-483.VFLARWT......LD....QSGH.........P.----WNPTLEHYT.RY...K--------ASDL-------------
A5DUV2_LODEL/512-628.MYLARLI......LK....K...........IPV----WNGNLIHYSGGY...R--------INDM-------------
A6RR46_BOTFB/346-460.MYLARLI......LE....K...........GE.----WDPMLTHYS.GY...S--------EDEI-------------
A6ZXH4_YEAS7/299-414.YFLSKII......LG....Q...........NQ.----WSLAHVYYS.NY...T--------QEQI-------------
A7A198_YEAS7/338-453.YFLSRTI......LG....S...........ND.----WSLKHVFYS.GY...T--------SSQI-------------
A7F1V1_SCLS1/469-584.HAVARFM......LG....K...........GD.----WSPAHVYYS.GY...T--------WNQL-------------
A7S8H6_NEMVE/110-226.LRLALRM......KG....CD...........D.----WTPTVVHYT.GY...S--------VAQL-------------
A7SEI5_NEMVE/172-293.IVLSLHT......L......GLS.........Y.----WNNTLSHYT.GF...E--------LHDL-------------
A7SPG5_NEMVE/166-283.LSLAMRV......MG....KGS..........E.----WTPTLEHYS.GY...S--------EKKL-------------
A7TR46_VANPO/331-446.YFLSKII......LG....Y...........SD.----WTIQHVYYS.GY...T--------QEQI-------------
A7Y7X0_CUCSA/197-329.MMEVIDQ.............I.EPHK...KLEH.----QDK....LL.GVVKMN--------KEKV-------------
A7YYE4_DANRE/155-279.VAAAVQG......LY.....LKSTDSC.LSSQN.----LTNFLSQVI.RS...D--------PDCL-------------
O04388_CATRO/238-361.IFLSRFT......LQ....PKVH.........P.----WNSLLQHNS.GY...K--------PADL-------------
O04389_CATRO/313-431.VYAARCT......FN.....KTP.........S.----WDDTLKLHT.GF...S--------EYQL-------------
O04398_TOBAC/319-436.VYVAQHT......LN.....CTP.........F.----WNDTLKLHT.GF...S--------ESQL-------------
REM1_SCHPO/273-388.AYTGQSI......L......QEE.........N.----WSNTLPQIT.GY...D--------YMSL-------------
CCNE_HEMPU/255-381.LYHVTNE...........................----..EVTLSVT.GL...K--------WDDI-------------
O45926_CAEEL/161-293.MIITLNVITVDGINP....K............T.----AASMIRKQL.GA...S--------KQDI-------------
CCB14_ARATH/260-379.VYAARQI......LK.....KTP.........F.----WTETLKHHT.GY...S--------EDEI-------------
O65064_PICMA/98-215.VYTAQCT......LK.....KSS.........P.----WSKTLILHT.GY...S--------EADL-------------
CG1C_SCHPO/162-280QFALEKNE.............INLSTTT.DGLPV.----WMEESQV........S--------YEDV-------------
O77212_DREPO/291-408.ICLARYS......L......GLE.........P.----WPQSLVKKT.GY...E--------VGHF-------------
O82137_PEA/102-224.VYAARCT......LN.....KSP.........V.----WDETLTMHT.GY...S--------EEEL-------------
O82678_CHERU/199-326.MVQTLKE.............I.GLWS...ILEH.----QND....IM.NTLKLD--------KVKV-------------
O82717_LUPLU/324-441.VFAARCT......LN.....KTP.........I.----WNETLQLHT.GY...S--------EEQL-------------
O93228_RANJA/239-357.FCLSQKV......LD....GG...........E.----WTPTLQHYM.GY...S--------ESSL-------------
O93916_PNECA/304-419.IYLARIM......VT....G...........GN.----WNANLIHYS.GY...K--------ESDL-------------
O96434_PARTE/212-329.IYLVHKI......RK.....TPQ.........S.----WSEEMQKMT.GY...N--------EQEL-------------
CCNB_ARBPU/274-395.IYLSMTL......LD....PETH........SS.----WCPKMTHYS.MY...S--------EDHL-------------
CG23_SCHPO/334-448.MYLAREM......LG....R...........GP.----WNRNLVHYS.GY...E--------EYQL-------------
CCNB_SPISO/299-415.LCLSMKL......LD....ST...........H.----WTETLTHYS.SY...C--------EKDL-------------
CCNA_DROME/334-451.VALARHI......L......GME.........M.----WTPRLEEIT.TY...K--------LEDL-------------
CCNB_MARGL/258-375.LCLSSKI......LE....PDM..........E.----WGTTLVHYS.AY...S--------EDHL-------------
CCNB_ASTPE/272-390..LLSTRF......WD....EDM..........E.----WTKSLVHYS.AY...S--------EGHL-------------
CCNA1_XENLA/295-412.YCLANYA......L......NKV.........F.----WPDTLEAFT.GY...A--------LSDI-------------
CCNA_PATVU/302-419.LCLANIT......L......GSE.........P.----WPSSLAKES.KY...E--------ISEF-------------
CCNB_PATVU/282-398.LCLSMKV......LD....DS...........Q.----WSETLAHYS.NY...S--------EKEI-------------
CCNE1_HUMAN/244-366.LYHFSSS...........................----..ELMQKVS.GY...Q--------WCDI-------------
CG21_SCHPO/294-409.YYLSMQM......LG....H...........LD.----WTPCHVYYS.GY...T--------ARQL-------------
CG21_YEAST/339-454.MFLSRKM......LG....K...........GT.----WDGNLIHYSGGY...T--------KAKL-------------
CCNAL_DAUCA/208-330.TFLARFT......IR....PNVN.........P.----WSIALQKCS.GY...K--------SKDL-------------
CCNB2_CHICK/268-386.LCLSQKV......LG....HD...........K.----WGTKQQYYT.GY...A--------EDSL-------------
CCB11_ARATH/295-418.IYAARSS......LR.....QVP.........I.----WTSTLKHHT.GY...S--------ETQL-------------
CCNA2_BOVIN/307-425.FHLALYT......V......TGQ.........S.----WPESLVQKT.GY...T--------LETL-------------
CCNB2_MEDSA/201-318.VYTAQCT......VS.....GFK.........H.----WNKTCEWHT.NY...S--------EDQL-------------
CCND2_HUMAN/154-277.VGAAICG......LQ.....QDEEVSS.LTCDA.----LTELLAKIT.NT...D--------VDCL-------------
CGS5_YEAST/296-418.MYIARRM......TN....RNKN........EL.----WNGTLQHYSGGIDPIH--------DEAF-------------
CGS6_YEAST/254-374.MYIARKI......KN....ENS..........K.----WDETFIHYSGGIDIES--------DPAF-------------
CCNA1_CAEEL/343-459.CCFAN........LQ....ADVE.........S.----WPQKMVDDT.GI...S--------TEDF-------------
CCN2_ANTMA/319-438.VYAARCT......LN.....KMP.........I.----WNETLRMHT.GF...S--------EVQL-------------
CG22_SCHPO/267-382.MYLSRRL......LR....R...........GP.----WTPKLVESSGGY...E--------EHEL-------------
CCNB3_CHICK/276-392.LLLALTM......KN....LG...........G.----WTPTLEYYS.GY...C--------AQDL-------------
CCD11_ARATH/184-308.ILCVANE.............L..PS....LSSV.----VNPHESPET.WCDGLS--------KEKI-------------
CCD31_ARATH/189-307.MMRIIEQ.............V.DPFD...PLSY.----QTN....LL.GVLNLT--------KEKV-------------
CCNA2_CHICK/273-390.FHLASYT......I......TGQ.........T.----WPESLCKVT.GY...T--------LEHI-------------
CCNE1_DANRE/246-368.LFHFSSL...........................----..ELVIKVS.GL...K--------WCDL-------------
CCNA_HYDVD/296-415.ICVANHM......L......NSI.........P.----WTPTLEFYS.GY...N--------IQDL-------------
CCNB_HYDVD/264-380.LYLSMKL......ID....DS...........N.----WTPTLVHYS.GY...T--------EDAI-------------
P90681_ASTPE/322-438.VCLANYT......L......SGT.........A.----WTPMLEKHS.GY...N--------LEDI-------------
P92162_BOMMO/389-509.ICLSLHL......LSSKTLSEV............----WTSTLSYYS.GY...D--------LDHI-------------
P93102_CHERU/319-438.VYTARCT......LN.....NSP.........S.----WTETLKHYT.GY...S--------ENQL-------------
P93103_CHERU/210-333.AISVTQQ................T.......QI.----VEFTDKAFSFLTDHVE--------KERL-------------
P93557_SESRO/318-435.VYAARCT......LN.....KSP.........V.----WNETLKQHT.GY...S--------EEQL-------------
P93646_MAIZE/356-473.VYAARST......LG.....MNP.........P.----WTDILEHHT.GL...A--------EPQL-------------
CCB21_ORYSI/285-402.VYTAQCA......LT.....RCQ.........Q.----WTKTCELHS.RY...T--------GEQL-------------
CCNB1_CRIGR/296-414.FCLALKI......LD....NG...........E.----WTPTLQHYL.SY...T--------EESL-------------
Q08C91_DANRE/272-388.LLIALVT......KD....LG...........G.----WTQCLQFHS.GY...S--------AEDL-------------
Q09IZ1_ONCMY/251-369.LCLSQLL......LD....EL...........N.----WTPTQEHYS.TY...N--------ENHL-------------
CCB22_ORYSJ/293-410.IYTAQCT......IN.....GFK.........S.----WNKCCELHT.KY...S--------EEQL-------------
CCA14_ORYSJ/216-339.IFLAKFI......LK....PTEN.........P.----WNSTLSFYT.QY...K--------PSDL-------------
CCB13_ORYSJ/341-458.VYAARCT......LG.....LSP.........L.----WSDLLEYHT.GL...A--------EPQL-------------
Q0UMA7_PHANO/348-462.MYLARLV......LD....R...........GP.----WDATLVHYS.GY...T--------EEEI-------------
Q0VA13_XENTR/226-348.LSLAQRV.............SLESGSL.TSDEM.----WHGVQQYFS..Y...S--------DAQL-------------
CCD42_ARATH/171-289.ALSVSGE........................HF.----DKF..SFSS.SFSSLE--------KERV-------------
CCNB1_CAEEL/208-340.MIIALEVHPVDGIEA....E............N.----AVSVICKQL.GA...S--------KKVI-------------
CCF32_ORYSJ/267-390.LFVGKFT......LN....PNTR.........P.----WNLSVQRIT.GY...K--------VSDI-------------
CCA22_ARATH/304-427.VFLARWT......LD....QTDH.........P.----WNPTLQHYT.RY...E--------VAEL-------------
Q16TY2_AEDAE/355-477.LYISLTL......FP....LANNTE.....PKV.----WTKTLEHYT.HY...T--------VQHL-------------
Q16VG6_AEDAE/419-535.LFIAMRM......ND....MP...........G.----WNKTLEFYS.GY...K--------IEDF-------------
Q17NN3_AEDAE/310-427.LALSRYT......L......DLP.........I.----WSRMLETNT.GY...R--------LEDL-------------
Q1L8M6_DANRE/153-279.VGAAVCG......LQ.....SSQSNQS.LWGDN.----LMELLAKIT.NT...E--------LDCL-------------
Q23JX5_TETTS/324-441.IYLTNKL......FK.....KNI.........C.----WSDVLTGHT.QH...T--------EQQI-------------
Q25123_HELRO/240-368.VALSHYL......I......NMT.........G.----CMSELSRIT.SY...T--------VFSL-------------
Q25168_HELTR/382-498.LFIAMCM.............NQD........GS.----WDDTIYHYT.QY...R--------PVDF-------------
Q28DU2_XENTR/291-408.LVIANYT......V......NER.........T.----WSDSLVQYT.GY...A--------LETL-------------
Q28GP5_XENTR/256-374.LCLTQKV......LN....IG...........T.----WDATLQFYT.GY...S--------QDDL-------------
Q29CG1_DROPS/434-556.LYMALRMHAGVANLE....QQ...........T.----WTSTLVHYT.GF...Q--------LADF-------------
Q29DY8_DROPS/354-471.LALSRHI......L......GME.........I.----WTPRLEEIT.TY...K--------LEDL-------------
Q2ABE6_CAMSI/198-326.MLHVIKE.............V.EPSN...VLDC.----QNE....LM.DVLKMS--------KDKV-------------
Q2ABE7_CAMSI/203-327.MLLVFSS.............L.EPCL...AVEY.----QNQ....LL.GILQID--------KDKV-------------
Q2ABE9_CAMSI/308-433.VYAARCT......LN.....SNP.........L.----WTETLKHHT.GY...S--------EDQL-------------
Q2HAK4_CHAGB/352-466.MYLSRLI......LD....R...........GE.----WDDTLEYYA.GY...S--------EEEI-------------
Q2HAS9_CHAGB/515-630.HCISRLF......LG....K...........GD.----WTLAHVHYS.GY...T--------LCQL-------------
CCND1_BOVIN/155-283.VAAAAQG......LH.....LGSANGF.LSYHR.----LTRFLSKVI.RC...D--------PDCL-------------
Q2PHK8_DAUCA/314-432.VYGARCT......LD.....TAP.........F.----WNETLKLHT.GF...S--------EQQL-------------
Q2PHK9_DAUCA/330-448.VYAARCT......LN.....KTP.........V.----WNDTLKLHT.GF...S--------EAQL-------------
Q2PHL0_DAUCA/311-430.VYAARCT......LK.....KSP.........F.----WTETLKHYT.GY...S--------EDQL-------------
CCA21_ORYSJ/359-482.VFLARWT......LD....QSDI.........P.----WNHTLEHYT.SY...K--------SSDI-------------
Q2UPT4_ASPOR/192-299.LALARCI......LN....R............P.----QPRHTEWAS.QY...D--------SMTL-------------
Q2V5Z8_BRACM/228-351.VFLARFI......IR....PKQR.........P.----WNQMLEEYT.KY...K--------ASDL-------------
Q2WGP0_ALLCE/280-397.IYTAQCS......LK.....GFK.........F.----WTRTCEQYT.MY...T--------EDQL-------------
Q2WGP2_ALLCE/358-475.VYAARCT......LS.....RSP.........L.----WTETLRRHT.GF...S--------EPEL-------------
CCB12_ARATH/312-429.VYTARCS......LN.....KSP.........A.----WTDTLQFHT.GY...T--------ESEI-------------
CCB21_ARATH/302-419.VYTAQCT......LD.....GSR.........K.----WNSTCEFHC.HY...S--------EDQL-------------
CCB13_ARATH/289-406.VYTARCC......LN.....KTP.........T.----WTDTLKFHT.GY...S--------ESQL-------------
CCB22_ARATH/303-421.VYTAQCT......IH.....GFS.........E.----WNSTCEFHC.HY...S--------ENQL-------------
Q39331_BRANA/289-412.IFLAKYT......LD....PTRR.........P.----WNSTLRHYT.QY...E--------AMEL-------------
Q39877_SOYBN/214-337.IFLAKFI......IW....PEVH.........P.----WTSSLCECS.GY...K--------PAEL-------------
Q39878_SOYBN/336-459.VFLAKWT......LN....ESEH.........P.----WNPTLEHYT.KY...K--------ASDL-------------
Q39880_SOYBN/313-433.VFAARCT......LG.....RSP.........F.----WTNTLMHYT.GY...S--------EEQL-------------
Q3KPK0_XENLA/154-279.VGAAICG......LQ.....LDDGETS.LSGDS.----LTEHLAKIT.ST...D--------VDCL-------------
Q3KQA7_XENLA/288-404.LLLALQM......KG....LG...........R.----WTATLHYYS.GY...Q--------TNDL-------------
Q40223_LUPLU/307-426.VYAARCI......LG.....RVP.........Y.----WTETLKHYT.GY...Y--------EEQL-------------
Q40338_MEDSA/212-338.MLHVIDQ.............I.EQSDD.NGVDY.----KNQ....LL.NVLKIS--------KEKV-------------
Q40488_TOBAC/238-361.IFLSRFT......IL....PKVH.........P.----WNLALQQCT.GY...K--------PSEL-------------
Q40492_TOBAC/247-370.VFLSRFT......LQ....PNTH.........P.----WSLALQQYS.GY...K--------AADL-------------
Q40514_TOBAC/347-470.IFLAKYI......LL....PSKK.........P.----WNSTLRHYT.LY...Q--------PSDL-------------
Q40516_TOBAC/291-408.VYAARHT......LN.....RTP.........F.----WNETLKLHT.GF...S--------ESQL-------------
Q41733_MAIZE/317-437.VYAARLT......LG.....RSP.........L.----WTETLKHHT.GP...Q--------RAAD-------------
Q41734_MAIZE/282-407.VYAARLT......LK.....RAP.........L.----WTDTLKHHT.GFR.ES--------EAEL-------------
Q49U21_CRYNE/355-469.MYLARKM......LG....G............D.----WNDAFIYYS.NF...T--------ESQL-------------
Q4CS48_TRYCC/197-328.VLLGRLLVAWNRSLDRSNISQEK.........L.----WDREMIHVSRGI...T--------LDE.-------------
Q4DWL9_TRYCC/229-371.LFLALVT......LRI..KQKGGSCSF.AGETI.----WTRQLQHYS.RA...K--------VHDF-------------
CCD42_ORYSJ/212-330.AATVAGE.........................A.----TGVVEEDIAEAFTHVD--------KGRV-------------
Q4RZE5_TETNG/155-280.VVAAVQG......LD.....LKSLNAS.FSSQN.----LTNLLSQVI.GS...D--------PDCL-------------
Q4SG06_TETNG/155-272.YSLASFT......V......STL.........L.----WPDNLHAFT.GL...K--------MADV-------------
Q4T0M3_TETNG/224-342.LALTLRV......LD....VG...........E.----WDATLQHYM.DY...N--------VESL-------------
Q4T2Y9_TETNG/114-254.VAASRIC................LQ....ISPS.----WTTALHLLT.GY...S--------WDHL-------------
Q4T8S9_TETNG/1145-1270.MVAAVEG......LQ.....GRLPGER.DLSQK.----MAEQLAQTI.RC...D--------PDCL-------------
Q4TVR6_HELTR/235-352.LLLSKLI......LE....GT...........Q.----WTASLVHYS.TY...T--------EAEL-------------
CCNB_DICDI/316-434.IYVARRM......TM....KSGP.........Y.----WNVTLEYYT.CY...K--------ESEI-------------
CG11_CANAL/174-308.NLLSCSM......LQI...P............H.----ASITLKNLI......E--------QEII-------------
Q5D894_GOSHI/87-204.VYAARCT......LK.....KTP.........A.----WTDTLKFHT.GY...T--------EQQL-------------
Q5D8P0_SCHJA/269-392.LCLSRAL.....CLG....TSELE.......RA.----WCNKLSYLS.GY...V--------LDDI-------------
Q5KAX2_CRYNJ/366-482.MWLARLC......LE....R...........GE.----WNANLVHYS.TY...S--------EDEI-------------
Q5SCB6_OSTTA/230-346.VYIAIRG......L......QTG.........S.----WNHTMEAHT.RL...S--------ESEV-------------
Q5SCB7_OSTTA/222-339.IFLAEYN......LS.................D.----ARPRILELD.LFELLD--------NNQL-------------
Q5T8J1_HUMAN/105-230.IGAAVQG......L.......GACSM...SGDE.----LTELLAGIT.GT...E--------VDCL-------------
Q5U4W4_XENLA/240-362.LYHCTSI...........................----..EVVTKAT.GL...E--------MDNI-------------
Q5UAU8_PENJP/269-385.LCLSLKL......LD....GS...........S.----WSNTLTYYS.RY...T--------EEQI-------------
CCNF_XENTR/414-537.LLLARIL........H...KQAR.........P.----WPAQLAETT.GF...T--------LEHL-------------
Q5ZKI9_CHICK/155-280.ISAAVHG.............LSISVNG.FGGEA.----VTELLAGIT.GT...E--------VDCL-------------
Q5ZMH4_CHICK/247-368.LCHYTST...........................----..EVVKKAS.GL...D--------WDNI-------------
CCNB1_ANGJA/272-390.FALSLKV......FD....CG...........E.----WTPTLQYYM.DY...T--------EACL-------------
Q60FY1_ORENI/302-418.LLMALVT......KD....LG...........G.----WSPILQFHS.GY...Q--------ASDL-------------
Q60FY2_ANGJA/277-393.LLLALIM......KG....LG...........G.----WTPILEFHT.GY...T--------LSDL-------------
A8XRM2_CAEBR/208-340.MIIALNAHPVAGIDP....K............K.----AQEAVINQL.EA...K--------TEDI-------------
CCNB3_CANFA/1202-1318.FLLALYM......MK....LR...........Y.----WVPALEYYS.GY...K--------TSDL-------------
Q6CE22_YARLI/306-421.HFLSRRM......LN....R...........GH.----WTDGHTYYS.GY...T--------EKQL-------------
Q6CEJ4_YARLI/393-508.MHVGRMM......LA....R...........SQ.----WTNNLVYYSGGY...T--------QKDI-------------
Q6CT04_KLULA/317-432.YYLSKII......IG....L...........TG.----WSDEHIYYS.GY...T--------EEQL-------------
CCNJ_XENLA/145-273.VAASRII................LR....LSPS.----WPTRLHRLT.VY...A--------WDIL-------------
Q6FNV2_CANGA/314-429.YFLSRII......LG....Y...........EE.----WTLKHVYYS.GY...T--------HEQL-------------
Q6FQU1_CANGA/326-455.YFLSKTI......LSYGNEERDAEERS.VYETG.----WTLKHVFYS.GY...T--------QEQV-------------
Q6FVY0_CANGA/262-383.IFLARRI......LK....RESP.........I.----WDDTFIHYSGGIDALN--------DNHF-------------
Q6FVY1_CANGA/344-459.MFLSRKM......LG....K...........GQ.----WDGNLIHYSGGY...T--------KNQL-------------
Q6IR86_XENLA/262-380.FCLAMKI......LN....SG...........E.----WTPTLEHYM.AY...K--------ESSL-------------
CCF13_ORYSJ/255-372.IFLARLH......VL.....GHE.........P.----WSRDLAELT.GY...E--------AIDL-------------
Q6P801_XENTR/266-384.SCLSLKI......LN....TG...........E.----WTPTMHHYM.AY...F--------EDDL-------------
Q6T2E9_BUFBG/263-381.LCLAQKV......LG....QG...........S.----WGATRHHYT.GY...S--------EEDL-------------
Q6X269_USTMD/465-579.MFLAKKM......LG....G............E.----WDDAFVYYS.DF...T--------EEQL-------------
Q6X270_USTMD/433-547.VWLAREV......LE....R...........GE.----WTPTLVHYS.TY...S--------EQEL-------------
Q6ZZ83_SPHGR/342-458.VCLANHT......L......NNE.........G.----WTPTMAHYT.DY...Q--------LADI-------------
Q75A51_ASHGO/248-363.YYLSRII......IG....Y...........NT.----WTRQHVFYS.GY...T--------AEQL-------------
Q75EI0_ASHGO/418-533.MFLSRKM......LG....K...........GK.----WDGNLIHYSGGY...S--------TTEL-------------
Q790L7_MOUSE/155-283.VVAAMQG......LN.....LGSPNNF.LSCYR.----TTHFLSRVI.KC...D--------PDCL-------------
CCA11_ORYSJ/372-495.IFLAKFI......LQ....PTKH.........P.----WNSTLAHYT.QY...K--------SSEL-------------
Q7PPJ1_ANOGA/320-449.LYISLYL......FP....LTSNGGNG.TSAII.----WTKTLEHYT.HY...N--------VKYL-------------
Q7Q0E8_ANOGA/187-304.LALARRT......L......DLP.........M.----WSKMLENNT.GY...K--------LVDM-------------
Q7XAB7_EUPES/184-308.MIHVIKE.............V.DPFS...QMEY.----QNQ....LL.DVIKIN--------KEEV-------------
Q7Z4Z4_HUMAN/264-382.SCLSQKV......LG....QG...........K.----WNLKQQYYT.GY...T--------ENEV-------------
Q7ZVA8_DANRE/252-370.LCLSQLV......LD....GQ...........K.----WSSTQQHYS.TY...D--------EAHL-------------
Q7ZYJ6_XENLA/153-279.VAAAVQG......LN.....LGNADGV.FSTQR.----LTLFLSQVI.KC...D--------PDCL-------------
CCNB3_MOUSE/1265-1381.FILALYM......RN....LS...........N.----CVPTLEYFT.GY...K--------MAEL-------------
Q84LE4_SILLA/352-474.VFLAKYM......LT.....SSR.........P.----WNATLRHYT.LY...E--------ASDL-------------
Q84V88_POPAL/200-324.MLHVIKE.............V.EPRN...QLQY.----QTQ....LM.AVLKTN--------EDEV-------------
Q8GZU3_9ROSI/205-332.MLYVIDN.............I.EPSL...AAEY.----QSQ....LL.SILGID--------KDKV-------------
CCD41_ARATH/180-299.ALSVSGE.............L..QR.....VHF.----DNS..SFSP.LFSLLQ--------KERV-------------
Q8LK74_LAGSI/187-313.MLHVFKA.............MEEPTL...SVEY.----DSQ....LL.NILGID--------KGNV-------------
Q8LPW3_HELAN/178-304.MLCVVEE.............I.DPTN...SIGY.----KSQ....LL.DLLKTT--------KDHI-------------
Q8SRF2_ENCCU/179-293.MYLARKI......TS....QDQ............----CKNLFIMYS.GH...T--------KDDI-------------
CCNA1_CARAU/268-385.YCLANYT......L......NGV.........L.----WPENLYAFT.GY...S--------LAVI-------------
CCNB1_CARAU/266-384.YALTLKV......FN....CG...........D.----WTPTLQHYM.GY...T--------EDSL-------------
Q941M7_MEDSA/349-473.VFLARWT......LD....QSSH.........P.----WNPTLEQYA.SY...K--------ASDL-------------
Q94740_SPHGR/281-401.IYMSMTL......LG....SEGD.........S.----WGAKMTHYS.MY...N--------EDHI-------------
Q95WE6_ASTPE/274-391.LCLSTKI......LD....EDM..........E.----WNKTLVHYS.AY...S--------EGHL-------------
Q96226_ADICA/397-520.VLVARVT......LN....PTWR.........P.----WNSTLQHYS.GY...K--------ASEL-------------
Q98TA3_DANRE/305-422.FILANHT......L......ASG.........S.----WSKSLVDLT.GY...S--------LEDL-------------
Q9C2K2_NEUCS/516-631.HCLSRFF......LQ....R...........GP.----WTHAHVHFS.GY...T--------LAQL-------------
CCA24_ARATH/329-452.VFLAKWT......LN....QSSH.........P.----WNPTLEHYT.TY...K--------ASDL-------------
CCA31_ARATH/219-342.VFLARFI......IR....PKQH.........P.----WNVMLEEYT.RY...K--------AGDL-------------
CCA12_ARATH/310-433.VFLAQYT......LH....PSRK.........P.----WNATLEHYT.SY...R--------AKHM-------------
Q9GTQ8_DROME/286-422.IAASMNG......LK.....WHLRSG..HNLHF.----LLSLMTDLT.SV...E--------QAQV-------------
CCNB2_ORYLA/254-372.LCLSQLL......LD....GL...........P.----WSLTQQQYS.TY...E--------EQHL-------------
CCB23_ARATH/308-425.IYTAQCT......LK.....GFE.........E.----WSKTCEFHT.GY...N--------EKQL-------------
Q9LKC6_CICAR/324-443QVYAARCT......LN.....KAP.........F.----WNETLQLHT.GF...S--------EPQL-------------
Q9M4K9_PEA/216-340.VFLARFM......LN....PKSR.........P.----WNSAICQFT.SY...K--------PADL-------------
Q9S7H9_SOLLC/192-320.MFYVIND.............I.EPSN...AMEY.----QNQ....LM.SVLKVR--------KDIF-------------
CCB31_ARATH/274-391.IYVARCT......LH.....MTP.........V.----WTSLLNNHT.HY...N--------VSQM-------------
Q9SBQ4_PETHY/303-423.VYAARGT......LN.....KGP.........L.----WTPTLQHHT.GY...S--------EEQL-------------
CCB24_ARATH/309-426.IYTAQST......LK.....GYE.........D.----WSKTSEFHS.GY...T--------EEAL-------------
Q9SMD4_SOLLC/184-309.MLHVLDR.............L.KPCI...GEKY.----QDQ....LL.GILGIV--------KEKV-------------
CCD33_ARATH/188-310.MVSVIRD.............L.KMCD...EAVY.----QSQ....LM.TLLKVD--------SEKV-------------
Q9SNV0_ANTMA/203-329.MIYVIKE.............L.YPCD...ALEY.----QNE....FV.TVLRTS--------KEKT-------------
Q9SNV2_ANTMA/176-296.MLSSAND.............L..PK....FSFI.----TAQHAEA...WCDGLH--------KDNI-------------
Q9SXN7_TOBAC/190-313.MLHVIHQ.............V.EPCN...AADY.----QNQ....LL.EVLNIS--------KEKV-------------
Q9TY42_PARTE/121-227.IFLVNKI......R......TPT.........Y.----KTP............N--------ENQL-------------
Q9U7P9_9CILI/566-681.LFLACCV.........................T.----GQFPNKQMAPMY...T--------PAEF-------------
Q9XGI1_SOLLC/308-425.IYTAQTT......LY.....GVQ.........Q.----WSKTCEVHT.TY...S--------EDQL-------------
Q9XGI2_SOLLC/248-367.GYAARST......LN.....RSP.........R.----WTDTLKHHT.GY...T--------EDQL-------------
Q9XGI4_SOLLC/345-468.VFLARWT......LD....QSNH.........P.----WNSTLEHYT.TY...K--------ASDL-------------
CCNE2_MOUSE/241-363.LCHFTSI...........................----..EVVKKAS.GL...E--------WDDI-------------
CCD61_ARATH/156-288.LLFASFE.............LCPLQFP.CFSNR.----INQ........CTYVN--------KDEL-------------
Q9ZRG1_PEA/135-252.LYLARCT......LQ.....ITP.........S.----WTPLLQKHA.RY...D--------VSQI-------------
Q9ZRX9_TOBAC/198-319.AMSVSGE................I.......QA.----KDI.DKAMPCFFIHLD--------KGRV-------------

PF03261

CD5R2_MOUSE/1-332-LVFVYLL------CRESLRGDE...LASAAELQA----AFLTCLYLAYSYMGNE--------ISYPLKPFLVEPDKERF
CD5R1_RAT/1-296-VVFLYML------CRDVISS.E...VGSDHELQA----VLLTCLYLSYSYMGNE--------ISYPLKPFLVESCKEAF
O13123_XENLA/1-285-VVFVYLL------CRDVIDGDS...VATEHDLQA----TLLTCLYLSYSYMGNE--------ISYPLKPFLVEAGKDAF
CD5R1_CAEEL/1-356-LVFIFLL------VRDVLPD.ERHLIHTLEELHA----WILSCLYVSYSYMGNE--------ISYPLKPFLIGNDRNTF
Q9Y0G0_DROME/81-464-VVFVYML------VRELVSG.E...ESKESDLQA----SVLTCLYLSYSYMGNE--------ISYPLKPFLVEDSKEKF

PF01858

RBL1_MOUSE/385-578-ILYYKIL---ETIMVQETRRLHGMDMSVLLEQDI....FHKSLMACCLEIVLFA--------YSS.-........P.RT
RBR1_MAIZE/275-476-KLYYRVL---EAICRAELQNSNVNNLTPLLSNER....FHRCLIACSADLVLAT--------HKT.-........VIMM
RBF_DROME/376-560-SFFFYLL---DQILQAEIRNKPDIDLKRLLVQKVSLVIFNITLMACCVELVLEA--------YK..-........TELK
RBR_CHERU/403-604-KLYYRVL---ETMCTAEAQLLHANNLTSLLTNER....FHRCMLACSAELVLAT--------HKT.-........VTML
RBL2_HUMAN/417-609-MLYYKVL---ESVIEQEQKRLGDMDLSGILEQDA....FHRSLLACCLEVVTFS--------YKP.-........P.GN
RB_HUMAN/373-573-RLYYRVM---ESMLKSEEERLSIQNFSKLLNDNI....FHMSLLACALEVVMAT--------YSRS-TSQNLDSGTDLS
Q98966_NOTVI/353-548-RLAYRVM---EAMLKSEEKRLSVQNFSNLLNNSA....FHESLLACSIEVVMAT--------YGSI-S.....RETDLS

PF00134

CG11_CANAX/48-176.SRVPT-LK----ELTI---MC.....RN.AY----D...............EEMFVQM---------------------
CCNA2_MOUSE/171-297..YPPE-VA----EFVY---IT.....DD.TY----S...............KKQVLRM---------------------
CCNB3_CAEEL/115-241..SPPL-VD----DLIY---LS.....GD.RF----S...............RDELLAM---------------------
CCNF_MOUSE/281-406..EILT-IR----EAVW---LT.....DN.TY----K...............YEDLVRV---------------------
CCT12_ARATH/28-169...PVT-LE----DVII---AS....YER.IH----KKDLAGAQRKEVYDQQKELVLIG---------------------
CCNE_CAEEL/232-360..YPPK-CI----DFAH---LT.....DS.AF----T...............CDNIRTM---------------------
O04388_CATRO/107-236..SPPH-VE----DFCY---IT.....DN.TY----K...............KEEVVKM---------------------
O04389_CATRO/186-311..WAPE-VN----DFVC---IS.....DR.AY----S...............HQQVLVM---------------------
O04399_TOBAC/107-236..SPPH-VE----DFCY---IT.....DN.TY----T...............GEEVVNM---------------------
REM1_SCHPO/145-271..HPPT-VK----DLEI---VL....EGE.WI----G................EDICGM---------------------
CCNE_HEMPU/126-253..YPPK-LH----EFAY---VT.....DG.AC----T...............DDQILDQ---------------------
O40946_HHV8/20-147..TPIS-TS----SLCY---AA....ADS..F----S...............RQELIDQ---------------------
CCNE3_XENLA/114-241..YPPK-LH----QFAF---IT.....DC.AC----T...............EDEITSM---------------------
O45926_CAEEL/34-159..YLPD-IL----EYEM---IT.....DN.TF----S...............KKQIMAM---------------------
CCB14_ARATH/133-258..WAPE-VN----DFVC---IS.....DN.AY----N...............RKQVLAM---------------------
O62573_SPHGR/213-339..YPPD-VK----EFIY---IT.....DD.TY----S...............IKQVLRM---------------------
O65065_PICMA/77-204..AHYN-NA----FYAR---V.......G.GV----S...............IAELNRL---------------------
O76513_DROME/43-156.N..VS-IN----QFVN---NI....K.GDRN----K..............ATDIVLSN---------------------
CCU41_ARATH/22-148..LYYN-NA----YYAK---V.......G.GI----S...............TKEMNFL---------------------
O82136_PEA/72-205..QVPL-LL----DLQV---QD....TKY.VF----E...............AKTIQRM---------------------
O93228_RANJA/112-237..YCPT-IG----DFSF---VT.....DH.TF----T...............KSQIRNM---------------------
O93231_BUFJA/24-149..YPPE-IA----DFAF---VT.....DR.AY----T...............TGQIREM---------------------
O93911_CANAX/234-360..NCPT-VQ----EIAY---MA.....DN.AY----S...............IDEFLKA---------------------
O93916_PNECA/176-302..MCPS-IQ----NFMY---MA.....DG.GY----T...............NEEILKA---------------------
CCNB2_HUMAN/137-262..FSPN-IE----DFVY---IT.....DN.AY----T...............SSQIREM---------------------
CCNT_DROME/42-176...PRK-LE----HVIR---AA....NKC.LP----PTTEQ......NYAELAQELVFN---------------------
O96434_PARTE/82-210..YPPD-LK----DFVY---IT.....DN.AY----T...............KQDVLEM---------------------
O97482_PARTE/85-212..YPPA-LK----DFVY---IT.....DN.AY----V...............KSDVLEM---------------------
CCNB_ARBPU/145-272..YPPE-IN----DFVY---IT.....DN.AY----T...............KAQIRQM---------------------
CG23_SCHPO/206-332..MCPS-VQ----NFVY---MA.....DG.GY----D...............EEEILQA---------------------
CCNB1_XENLA/139-264..YPPE-IG----DFTF---VT.....DH.TY----T...............KAQIRDM---------------------
CCNB2_XENLA/134-259..YTPE-VA----DFVY---IT.....DN.AY----T...............ASQIREM---------------------
CCNB_SPISO/172-297..YAPE-VA----DFVY---IT.....DN.AY----T...............KKEILEM---------------------
CCNA_DROME/206-332..YPPE-VG----EFVF---LT.....DD.SY----T...............KAQVLRM---------------------
CCNB_ASTPE/147-270..Y.AE-IG----DFVY---IT.....DN.AY----S...............KAQIRAM---------------------
CG12_YEAST/43-195RARIPR-LS----ELVH---YC....GDGQVF----D...............ESMFLQM---------------------
CCNB_DROME/260-387..FPPA-IG----DFVF---IT.....DD.TY----T...............ARQIRQM---------------------
CCNB1_MOUSE/170-295..YPPE-IG----DFAF---VT.....NN.TY----T...............KHQIRQM---------------------
CCNA_PATVU/174-300..YPPE-VS----EFVY---IT.....DD.TY----E...............QKQVLRM---------------------
CCNB_PATVU/155-280..YAPE-VA----DFVY---IT.....DN.AY----T...............KADIRTM---------------------
CG21_SCHPO/166-292..HPPS-IY----NFAH---VV.....QG.IF----T...............VDEIIRA---------------------
PCL1_YEAST/19-152..SSPL-NK----HWAR---YT.....DG.LF----T...............LEDINLM---------------------
CG21_YEAST/212-337..YSPS-IK----HFAY---ET.....DG.AC----S...............VEDIKEG---------------------
CG22_YEAST/232-357..YSPS-IK----HFAS---ET.....DG.AC----T...............EDEIKEG---------------------
CG23_YEAST/171-297..NCPT-IK----DFVY---MS.....EN.CY----S...............RNDLLDA---------------------
CG24_YEAST/210-336..NCPT-LD----DLVY---ML.....EN.TY----T...............RDDIIRA---------------------
PUC1_SCHPO/99-227.DRVPL-LQ----ELKL---AC.....KN.IY----A...............EDLFIRM---------------------
CCNAL_DAUCA/77-206..KPKN-VA----DFVD---IT.....DN.TY----S...............QQEVVKM---------------------
CCNB1_SOYBN/197-322..WPPE-VN----DFVC---LS.....DR.AY----T...............HEHILTM---------------------
PCL2_YEAST/18-146..SSPL-NK----HWAE---YT.....DG.LL----I...............LREVNTI---------------------
CCNB2_CHICK/141-266..YSPD-IA----DFVY---IT.....DN.AY----N...............SAEVREM---------------------
CCB11_ARATH/168-293..WPPQ-VE----DLVD---IA.....DH.AY----S...............HKQILVM---------------------
CCNB2_MEDSA/73-199..SVPV-VS----DLIH---IA.....DR.AY----T...............RKDILEM---------------------
CCND2_MOUSE/24-151..IPLT-AE----KLCI---YT.....DN.SV----K...............PQELLEW---------------------
CCND3_HUMAN/26-153..TPLT-IE----KLCI---YT.....DH.AV----S...............PRQLRDW---------------------
CGS5_YEAST/165-294..NLPK-LA----EYAY---IT.....DG.AA----S...............KNDIKNA---------------------
CG21_EMENI/211-337..LSPH-VA----NFSH---VA.....DE.TF----S...............DKEILDA---------------------
CGS6_YEAST/123-252..KLPK-IT----NFAY---VT.....DG.AA----T...............VEGIRKA---------------------
CCNA1_CAEEL/215-341..FPPE-IE----DFAL---IT.....DN.TY----R...............VPDILLM---------------------
CCN1_ANTMA/197-322..WAPE-VH----ELVC---IS.....DN.TY----S...............DKQILVM---------------------
CG22_SCHPO/139-265..MCPS-IQ----NFVY---MT.....DG.AF----T...............VEDVCVA---------------------
CCND1_RAT/26-153..IPLT-AE----KLCI---YT.....DN.SI----R...............PEELLQM---------------------
CCNB3_CHICK/149-274..CPPC-VD----DFLY---IC.....DD.AY----K...............REELIAM---------------------
CCNB_DICDI/188-314..YSPQ-IK----DFVH---TS.....DD.AC----T...............HAEVIDM---------------------
CCD11_ARATH/50-182..LVPS-LF----DFQV---AG....VKY.LF----E...............AKTIKRM---------------------
CCD21_ARATH/65-197..DVPH-IV----DLQV---ED....PKF.VF----E...............AKTIKRM---------------------
CG12_CANAX/44-172.FKVPT-LN----DLRK---IC.....VD.SY----Y...............KELFVEM---------------------
SSN8_YEAST/45-176...PQY-IR----TLVS---EAR...TLWPEF----IP............PDPTKVTEF---------------------
CG21_CANAX/208-334..FSPS-VK----NYAY---FT.....DG.SY----T...............PEEVVQA---------------------
CCNE1_CHICK/112-239..YPPK-LH----QFAY---VT.....DG.AC----T...............EDEILSM---------------------
CCNA_HYDVD/168-294..YPPE-VA----EFVY---IT.....DD.TY----T...............AKQVLRM---------------------
CCNB_HYDVD/137-262..YAPE-IG----DFVY---IT.....DN.AY----S...............KEKIRQM---------------------
CCNE_DROME/330-459..YPPK-IG----EFAY---VT.....DG.AC----T...............ERDILNH---------------------
CCNA1_HUMAN/214-340..YPPE-VD----EFVY---IT.....DD.TY----T...............KRQLLKM---------------------
P92162_BOMMO/260-387..YAPD-VG----DFVY---VT.....DN.AY----T...............KSDVFRC---------------------
P93102_CHERU/192-317..WAPE-VN----DFVQ---IS.....DK.AY----V...............REQVLCM---------------------
P93103_CHERU/77-208..DVPL-IL----DLQV---SE....SKF.VF----E...............AKTIQRM---------------------
CCC11_ORYSJ/4-144..TVQA-RL----LVFY---IKKMCASDE.KY----RF.............EIKDILEM---------------------
P93646_MAIZE/228-354..WAPL-VK----DLMC---LC.....DN.AF----T...............RDQILTK---------------------
CGH2_SHV21/22-148..KPMT-VS----KLTY---LS.....CD.CF----T...............NLELINQ---------------------
CG1_COLGL/38-166.DRVPS-VC----RVLD---YV....PSG.MY----C..............NSALFFRL---------------------
CCNB1_CAEEL/81-206..YLPD-IH----DYEF---IT.....EN.TY----S...............KKQILAM---------------------
PCL9_YEAST/19-146..SSPW-NK----HWTT---YT.....EG.LL----R...............IREVNTI---------------------
CCA22_ARATH/175-302..SAPG-VE----EFCF---IT.....AN.TY----T...............RPEVLSM---------------------
Q24158_DROME/126-255.CRALS-VD----LLVV---YT.....DN.SI----Y...............KDDLIKW---------------------
Q25123_HELRO/112-238..YPPD-VA----EFVY---IT.....DD.TY----T...............MKQVLQM---------------------
Q25168_HELTR/256-380..CPPM-LD----DFVY---VC.....T..CL----P...............PTEFLKM---------------------
CCB12_ARATH/185-310..WPPQ-VN----DLVY---VT.....DN.AY----S...............SRQILVM---------------------
CCB21_ARATH/174-300..SVPV-VE----DLVL---IS.....DK.AY----T...............RNDVLEM---------------------
Q39331_BRANA/160-287..CAPQ-VE----EFCY---IT.....DN.TY----L...............KDEVLDM---------------------
Q39877_SOYBN/83-212..DPPS-VD----EFCS---IT.....DN.TY----D...............KAEVVKM---------------------
Q39878_SOYBN/207-334..CAPR-VE----EFCF---IT.....DN.TY----T...............KEEVLKM---------------------
Q39880_SOYBN/186-311..WAPE-VN----DFVC---IS.....DN.GY----V...............SEQVLMM---------------------
Q40794_PETCR/187-312..WPPE-VN----DLTK---IS.....DN.AY----T...............NQQVLIM---------------------
Q41731_MAIZE/173-299..SVPV-VE----DLIL---IC.....DR.AY----T...............RADILEM---------------------
Q41732_MAIZE/188-315..CAPQ-VE----EFCY---IT.....DN.TY----F...............RDEVLDM---------------------
Q41733_MAIZE/189-315..WAPE-VN----DLIH---IA.....DG.AF----N...............RSQILAA---------------------
Q41734_MAIZE/155-280..WAPE-VN----DFIL---IS.....DS.AY----S...............REQILSM---------------------
CCNE1_MOUSE/113-240..YPPK-LH----QFAY---VT.....DG.AC----S...............GDEILTM---------------------
CCB21_ORYSJ/157-283..AVPV-VE----DLVL---IS.....DR.AY----T...............KGQILEM---------------------
CCD41_ARATH/45-178..EVPM-LI----DLQV---GD....PQF.VF----E...............AKSVQRM---------------------
Q96226_ADICA/268-395..CAPQ-VD----EFCY---IT.....DN.TY----N...............REEVLEM---------------------
CCNB3_DROME/308-433..QPPL-IE----DFLY---IC.....DG.AY----N...............HDELVRM---------------------
Q9PVT7_CARAU/117-244..YPPK-VH----QFAY---VT.....DG.AC----T...............EDDILSM---------------------
Q9PW42_CARAU/140-266..YPPE-VD----EFVY---IT.....DD.TY----T...............KKQLLRM---------------------
Q9S7H9_SOLLC/61-190..QVPL-LL----DLQV---AD....SRF.VF----E...............AKTIQRM---------------------
CCB31_ARATH/146-272..WHPR-IK----DLIS---IS.....AE.SY----T...............REQILGM---------------------
CCB24_ARATH/180-307..SVPV-VD----DLIL---IS.....DK.AY----T...............RTEILDM---------------------
Q9SMD4_SOLLC/51-182..DVPL-LL----DLQV---EE....SGF.LF----E...............SKTIQRM---------------------
CCD33_ARATH/59-186..RVPF-LL----DFQV---EE....ARY.VF----E...............AKTIQRM---------------------
Q9SNV1_ANTMA/59-187..QVPL-LL----DLQV---EE....SKY.VF----E...............SKTIQRM---------------------
Q9SNV2_ANTMA/45-174..LVPS-LL----DLQV---EG....ANF.IF----E...............PRNIQRM---------------------
Q9SXN7_TOBAC/59-188..QVPL-LL----DFQV---ED....AKY.VF----E...............AKTIQRM---------------------
Q9U2M5_CAEEL/72-201..HPMT-AS----KIAY---YS.....DN.SC----P...............IDMILQW---------------------
Q9U7P9_9CILI/433-564.YRQEN-SI----EYAY---IT....AD..EY----S...............PREVVSM---------------------
Q9VE72_DROME/6-144SVKIRD-VI----NVAY---CTLNRGNDPVDL----NDEY.........WSMRDAIVQA---------------------
Q9VKF0_DROME/205-327..QAVW-NV----DYCQ---IL....KDI...----T...............VEDMNEL---------------------
Q9VZP3_DROME/42-165.AFIPR-YS----EMNR---LV.....KN.AY----T...............AFEYKAV---------------------
Q9WRM3_9GAMA/20-147.N..PF-KA----AFLC---FC....AAE.DF----S...............VADLLKQ---------------------
Q9XGI0_MEDSA/224-351..NAPR-IE----DFCF---IT.....DN.TY----V...............KEEVVKL---------------------
Q9XGI1_SOLLC/180-306..CAPL-VE----DLVL---IS.....DK.AY----T...............RKEVLEM---------------------
Q9XGI2_SOLLC/121-246..WAPE-VN----DFLT---IT.....DN.AY----V...............RDQILLM---------------------
Q9YTJ4_ATHV3/30-156..KPMS-VA----HLTY---LS.....CE.CF----T...............HSELRDQ---------------------
CCNE2_MOUSE/112-239..YAPK-LQ----EFAY---VT.....DG.AC----S...............EVDILKM---------------------
CCD61_ARATH/26-154...DMS-VS----DLPV---EG.......EFF----D...............AQMIERM---------------------
Q9ZRG1_PEA/7-133..WHPR-VK----DLIS---IS.....AE.TY----T...............RDQMLGM---------------------
Q9ZRX9_TOBAC/64-196..NVPL-TV----DLQV---GD....PKF.VF----E...............GKTIQRM---------------------

PF08613

PHO80_YEAST/33-170--SFST.NA----HYAK---VG--------GV----R---------------CHELNIL---------------------
YGZA_SCHPO/29-176--VFYT.NS----RYAK---VG--------GI----P---------------LHELNHL---------------------
Q872V6_NEUCS/156-314--LSYP.HS----KFAK---VG--------GV----S---------------ETELARL---------------------
Q8IEW5_9TRYP/370-620--GSGSWNE----CFSN---AT--------DI----P---------------LKELNKL---------------------
Q949F8_ORYSA/17-159--ICYN.NA----YFAK---VG--------GI----S---------------LAEMNYL---------------------
CGP1_SCHPO/7-134--RSFS.NR----AWSR---LS--------GL----P---------------VDKLLVL---------------------
Q8I8A9_9TRYP/370-620--GSGSWNE----CFSN---AT--------DI----P---------------LKELNKL---------------------
PCL7_YEAST/108-264--FFYS.NS----RYAK---VG--------GI----S---------------LQELNHL---------------------
Q83C02_COXBU/10-148--YHLT.NK----PWVD---FV--------GV----S---------------LEELNEL---------------------

PF00382

TF3B_KLULA/193-266---RRT-HS----EIVA---IS--------HV----A---------------EETL------------------------
TF2B_PYRWO/116-186---PRT-LD----EIAD---IA--------RV----D---------------KKEI------------------------
TF2B_KLULA/137-207---GRS-FK----EILS---LT--------NV----R---------------KKEI------------------------
TF2B_YEAST/133-203---ART-FK----EIQS---LI--------HV----K---------------TKEF------------------------
TF2B_HALVA/30-100---KKT-QR----EVAD---VA--------QV----T---------------EVTI------------------------
TF3B_CANAL/95-165---HHM-LI----DFSS---RL--------QI----S---------------VYSL------------------------
TF2B_DROME/214-284---KRS-QK----EIGD---IA--------GV----A---------------DVTI------------------------
TF2B_PYRWO/212-282---KRT-QR----EVAE---VA--------RV----T---------------EVTV------------------------
TF3B_KLULA/98-168---HHM-LI----DFSS---RL--------QV----S---------------VYSI------------------------
TF3B_CANAL/190-263---RRS-HA----EIVA---VS--------HV----G---------------EETL------------------------
TF2B_DROME/120-190---PRT-FK----EICA---VS--------KI----S---------------KKEI------------------------
TF2B_KLULA/245-315---NIS-PT----RISQ---TL--------QV----T---------------EGTV------------------------

PF01857

RBR2_MAIZE/594-721--LELS-FR----EILN---NYKKEAQCKPEV----F---------------LSIYIGS.......RNH.NG........
RBL1_HUMAN/786-944--EERT-FQ----EIMK---SYRNQPQANSHV----Y---------------RSVLLKSIPREVVAYNKNINDDFEMIDC
RB_HUMAN/645-766--IDLK-FK----IIVT---AYKDLPHAVQET----F---------------KRVLIKE.....................
RBL2_HUMAN/834-992--EDKS-FQ----NIMR---CYRTQPQARSQV----Y---------------RSVLIKG.......KRKRRNSGSSDSRS
RBF_DROME/580-706--EDPK-FS----DIMR---AYRNQPQAVNSV----Y---------------REVFIDI.............NE......
RBR_CHERU/724-863--YELT-FK----EIIL---NYRKQPQCKPQV----F---------------RSVFVDW.......SFSR..R.......

PF02984

CCNB3_CAEEL/243-364-MPLVEHMN....HILH...FSKD...KWAQL.T..S---------------VRQKYSH---------------------
Q7QC70_ANOGA/538-653-TDAIVLLN....NGMS...SRQ......YSF.D..T---------------VHKKYSH---------------------
A4HKX7_LEIBR/155-297-RGCAEVIL....EYVN...YVP.....TTKY.Q..A---------------VRRKYNS---------------------
CCNF_MOUSE/408-531-VPCVLSLH...KKCFH...DDAPKDYRQVSL.T..A---------------VKQRFED---------------------
CCNB3_HUMAN/1259-1375-HPLVRQLN....KLLT...FSS.....YDSL.K..A---------------VYYKYSH---------------------
Q0UCR8_PHANO/466-581-RQLLCTIL....ECCD...NPQ......KHH.A..A---------------VYEKYTD---------------------
Q291N4_DROPS/375-501-RPITRQIA....KLAR...DAP.....QAKL.K..A---------------IHNKYQG---------------------
CCNA1_MOUSE/298-415-VPCLSELH....KACL...SIP.....HRPQ.Q..A---------------IREKYKA---------------------
Q6BGT2_DEBHA/350-465-RPLAEILL....QNCR...NAE......SNH.K..A---------------IFEKYQE---------------------
A0C1C9_PARTE/197-310-RECLSEFL....PVIS...LLK.....SFNM.T..A---------------IRRKYQL---------------------
A0DMF0_PARTE/199-312-RQCLQEFL....PIIK...LLQ.....SSTM.T..A---------------IKRKYSL---------------------
A0E0R4_PARTE/214-320-KPCAKELC....QLLQ...TAD.....LNTL.Q..A---------------VRRKFNT---------------------
CCA33_ARATH/190-313-QVCVEIML....DLYL...SRS.....EGAS.K..A---------------VREKYKQ---------------------
A1C7V2_ASPCL/489-604-FPLVSLML....ECCE...IPR......KHH.C..A---------------IYEKYTD---------------------
A1CID9_ASPCL/361-475-DPVFRLMI....DYLH...RPV......C.H.E..A---------------FFKKYAS---------------------
A2DQ77_TRIVA/248-364-SEHIKDAY....EILT...MPD.....REES.K..F---------------IRLKYST---------------------
A2DZV8_TRIVA/235-351-SSNIRDAY....EILT...DLE.....REES.T..F---------------IRLKYGS---------------------
A2E0Q4_TRIVA/216-333-SQIMNMIH....KSIQ...NAA.....ASRF.Q..A---------------IRKKYAT---------------------
A2E6K7_TRIVA/216-333-SPVANMIH....LSLQ...ATA.....ASRY.Q..A---------------IRKKYAT---------------------
A2F2K2_TRIVA/212-328-DASAKCIR....EMLT...EED.....REET.R..F---------------MRRKYGS---------------------
A2ZM34_ORYSI/249-372-KDCILAIH....DLQL...RKK.....CSNL.T..A---------------IRDKYKQ---------------------
A3AKA7_ORYSJ/256-379-KDCITCIH....DLQL...NRK.....GSSL.M..A---------------IRDKYKQ---------------------
A3LN44_PICST/322-438-KVCVEMIF....QYLI...SPV......E.H.D..E---------------FFKKYAT---------------------
A4RSW0_OSTLU/207-322-RQCIDILH....ADMM...AYE.....PDQF.Q..A---------------IHEKYSE---------------------
A5AEK5_VITVI/324-442-LDCAKLLA....SFHS...MAA.....ENKLIK..A---------------VYRKYSQ---------------------
A5BUM0_VITVI/360-483-KTAVFALQ....DLQL...NTS.....GCPL.N..A---------------IRGKYRQ---------------------
A5DUV2_LODEL/512-628-KHCIELLY....QYLL...QPI......E.H.E..E---------------FFKKYAM---------------------
A6RR46_BOTFB/346-460-EPVFQLMV....DYLA...RPV......T.H.E..A---------------FFKKYAS---------------------
A6ZXH4_YEAS7/299-414-LPLATIIL....ENCR...YAS......KRH.N..A---------------IWRKYSS---------------------
A7A198_YEAS7/338-453-IPLASLIL....ENCK...NAS......RRH.H..S---------------IWKKYFD---------------------
A7F1V1_SCLS1/469-584-KPLVSLVM....ECCE...NAR......KHH.A..A---------------VFEKYSD---------------------
A7S8H6_NEMVE/110-226-DGCVIELN....EMIS...EPP.....KQNL.M..T---------------VRNKYSH---------------------
A7SEI5_NEMVE/172-293-QTCIQDLH....RSFA...YAP.....NHPQ.Q..A---------------TREKYRS---------------------
A7SPG5_NEMVE/166-283-STCMQRLA....QLVL...GAR.....DSKQ.K..A---------------VYNKYAS---------------------
A7TR46_VANPO/331-446-FPLATTIL....ENCR...DAS......TKH.E..A---------------IWKKYSE---------------------
A7Y7X0_CUCSA/197-329-QCCYDLVV....EHSK...AYNNGFYHPINP.H..K---------------R..KHEQ---------------------
A7YYE4_DANRE/155-279-RSCQEQIE....SLLESSLRQA......QQH.....---------------..ISTET---------------------
O04388_CATRO/238-361-KECVLIIH....DLQL...SKR.....GSSL.V..A---------------VRDKYKQ---------------------
O04389_CATRO/313-431-IDCAKVLV....NLHA...MAA.....DNKL.K..V---------------IFRKYSS---------------------
O04398_TOBAC/319-436-LGCAKLLV....SYHM...EAP.....EHKL.K..V---------------IYKKYSK---------------------
REM1_SCHPO/273-388-VSYVHLLL....KCLE...NPF......DHH.Y..A---------------IYSKYAT---------------------
CCNE_HEMPU/255-381-AACVQWMS....TFAMTIREVG......VAQ.L..K---------------NFKNIYA---------------------
O45926_CAEEL/161-293-YDAIALLA...........QVAYKNFRHQKL.C..A---------------IREKYQS---------------------
CCB14_ARATH/260-379-MEHAKMLM....KLRD...SAS.....ESKL.I..A---------------VFKKYSV---------------------
O65064_PICMA/98-215-KECAHFMV....NFHL...NAG.....GSKL.R..V---------------VHKKYSD---------------------
CG1C_SCHPO/162-280-KGVLTLID....SLYK...KIN....PSKQA.L..P---------------IDQKNGS---------------------
O77212_DREPO/291-408-VDCLKELH....KTYQ...AAE.....SHPQ.Q..A---------------VQEKYKQ---------------------
O82137_PEA/102-224-MGCARLLV....SFHS...ASG.....SGKL.K..G---------------VYKKYAD---------------------
O82678_CHERU/199-326-EDCYNFIQ....EVS...........SNEKA.R..K---------------R..KWYN---------------------
O82717_LUPLU/324-441-MDCARLLV....SFHS...TLA.....NGKL.K..V---------------LYRKYSD---------------------
O93228_RANJA/239-357-IPSMRHLA....KNVL...KVNG...GLTKF.M..S---------------VRDKYAK---------------------
O93916_PNECA/304-419-VPCSKMML....DYLS...RSV......IKH.E..A---------------FFKKYAS---------------------
O96434_PARTE/212-329-RYCAKEMC....LVLQ...SSD.....KSNL.Q..A---------------VRKKFAQ---------------------
CCNB_ARBPU/274-395-RPIVQKIV....QILL...RDDS...ASQKY.S..A---------------VKTKYGS---------------------
CG23_SCHPO/334-448-ISVVKKMI....NYLQ...KPV......Q.H.E..A---------------FFKKYAS---------------------
CCNB_SPISO/299-415-VSTMQKLA....SLVI...KAE.....NSKL.T..A---------------VHTKYSS---------------------
CCNA_DROME/334-451-KTVVLHLC....HTHK...TAK.....ELNT.Q..A---------------MREKYNR---------------------
CCNB_MARGL/258-375-MPIVQKMA....LVLK...NAP.....TAKF.Q..A---------------VRKKYSS---------------------
CCNB_ASTPE/272-390-GPIVQKMA....VLSQ...QSHP...SPNSR.L..D---------------QEEDMAS---------------------
CCNA1_XENLA/295-412-APCLSDLH....QFCL...GAP.....YQAQ.Q..A---------------IREKYKT---------------------
CCNA_PATVU/302-419-SECLQEMY....QTYL...NAP.....NHPQ.Q..A---------------IREKYKS---------------------
CCNB_PATVU/282-398-YPVMQKLA....QLVV...KAE.....TSKL.T..A---------------VKIKYSS---------------------
CCNE1_HUMAN/244-366-ENCVKWMV....PFAMVIRETG......SSK.L..K---------------HFRGVAD---------------------
CG21_SCHPO/294-409-KPCAIIIM....ECLV...DAP......NHH.N..A---------------IYRKYSE---------------------
CG21_YEAST/339-454-YPVCQLLM....DYLV...GST......I.H.D..E---------------FLKKYQS---------------------
CCNAL_DAUCA/208-330-KECVLLLH....DLQM...GRR.....GGSL.S..A---------------VRDKYKK---------------------
CCNB2_CHICK/268-386-AMTMKHMA....KNVV...KVNE...NLTKY.T..A---------------VRNKYAS---------------------
CCB11_ARATH/295-418-MDCAKLLAYQQWKQQE...EGS.....ESSTKG..A---------------LRKKYSK---------------------
CCNA2_BOVIN/307-425-KPCLLDLH....QTYL...RAP.....QHAQ.Q..S---------------IREKYKN---------------------
CCNB2_MEDSA/201-318-LECSMLMV....GFHQ...KAG.....AGKL.T..G---------------VHRKYGS---------------------
CCND2_HUMAN/154-277-KACQEQIE....AVLLNSLQQY..............---------------...RQDQ---------------------
CGS5_YEAST/296-418-QSLCIDLV....KDIA...SSK......THL.D..S---------------LILKYKK---------------------
CGS6_YEAST/254-374-KDFISELV....EDIA...VPD......TNL.D..S---------------LRLKYKK---------------------
CCNA1_CAEEL/343-459-VDVLRDLH....RMYL...NAS.....TADF.K..S---------------IFYNYSE---------------------
CCN2_ANTMA/319-438-MDCAKLLI....DFHG...GST.....DQKL.Q..G---------------IYRKYSR---------------------
CG22_SCHPO/267-382-KEIAYIML....HYHN...KPL......E.H.K..A---------------FFQKYSS---------------------
CCNB3_CHICK/276-392-HPLVKRLN....FLLT...YQP.....CDKL.K..A---------------VRTKYSH---------------------
CCD11_ARATH/184-308-VRCYRLMK....AMAI............ENN.R..L---------------NTPKVIA---------------------
CCD31_ARATH/189-307-KTCYDLIL....QLPV...DRIGLQIQIQSS.K..K---------------R..KSH.---------------------
CCNA2_CHICK/273-390-KPCLMDLH....RTYL...KAA.....QHTQ.Q..S---------------IREKYKS---------------------
CCNE1_DANRE/246-368-EECVRWMV....PFAMSIREAG......SSA.L..K---------------TFKGIAA---------------------
CCNA_HYDVD/296-415-RSCLNEIH....LLHL...AAS.....TNPQ.Q..A---------------IQQKYKS---------------------
CCNB_HYDVD/264-380-LPTVSKLS....VLTL...SMD.....NSKY.Q..A---------------VKNKYAA---------------------
P90681_ASTPE/322-438-APCVRDLL....KTFT...NAP.....SQSQ.Q..A---------------AQEKYKS---------------------
P92162_BOMMO/389-509-DPIIRKIA....KIVI...NIE.....NSKY.K..A---------------VYNKYLD---------------------
P93102_CHERU/319-438-LECARLLV....SFHM...AAP.....EGRL.R..A---------------VYKKFSK---------------------
P93103_CHERU/210-333-MKCVEIMH....................DLR.M..S---------------SRSNGAL---------------------
P93557_SESRO/318-435-MDCARLLV....SLHS...TVG.....NGKL.K..V---------------VYRKYSD---------------------
P93646_MAIZE/356-473-LDCARRLI....SFHA...LAP.....ESKQ.K..A---------------VYRKYSK---------------------
CCB21_ORYSI/285-402-LECSRMMV....DFHQ...KAG.....AGKL.T..G---------------VHRKYST---------------------
CCNB1_CRIGR/296-414-LPVMQHLA....KNVV...MVNR...GLTKH.M..T---------------IKNKYAT---------------------
Q08C91_DANRE/272-388-APVVRKLH....HMLS...SPA.....DSKL.A..V---------------IRSKYAH---------------------
Q09IZ1_ONCMY/251-369-KPIMQHIA....KNVV...SVNE...GRTKL.Q..A---------------VKNKYAS---------------------
CCB22_ORYSJ/293-410-MECSKMMV....ELHQ...KAG.....HGKL.T..G---------------VHRKYST---------------------
CCA14_ORYSJ/216-339-CNCAKGLH....RLFL...VGP.....GGNL.R..A---------------VREKYSQ---------------------
CCB13_ORYSJ/341-458-LECARRLV....SLHA...AAP.....ESRQ.K..V---------------VYKKYAS---------------------
Q0UMA7_PHANO/348-462-QPVLQLMI....DYLS...SPV......I.H.E..A---------------FFKKYAS---------------------
Q0VA13_XENTR/226-348-INCQHLMA....KAAL...RAG.....SMEN.K..S---------------TWHKYSR---------------------
CCD42_ARATH/171-289-KKIGEMIE..............R...DGSSS.S..S---------------QTPNNTV---------------------
CCNB1_CAEEL/208-340-EDAVALLA...........EVSYKNFKQGKL.V..A---------------IKNKYQS---------------------
CCF32_ORYSJ/267-390-EDCIRSIH....DLQA...GRK.....WSNL.R..A---------------IRSKYED---------------------
CCA22_ARATH/304-427-KNTVLAME....DLQL...NTS.....GCTL.A..A---------------TREKYNQ---------------------
Q16TY2_AEDAE/355-477-MPIVQRLA....KVVK...NAP.....NMKV.H..A---------------VYHKYQS---------------------
Q16VG6_AEDAE/419-535-AEIAILLN....NIMT...RKP.....KESL.N..T---------------VRHKYSH---------------------
Q17NN3_AEDAE/310-427-KDIILDLN....KVHQ...KTE.....SLAQ.Q..A---------------IQEKFKG---------------------
Q1L8M6_DANRE/153-279-KSCQEQIE....QLLTDSLKES.....QQQH.Q..Q---------------...QQQD---------------------
Q23JX5_TETTS/324-441-RPCALEMC....LLLQ...SAS.....TNQT.Q..A---------------VRRKFLS---------------------
Q25123_HELRO/240-368-SECLNSIF....TTLH...NSP.....NVPQ.Q..A---------------LRVKYNS---------------------
Q25168_HELTR/382-498-EEVVYKLN....DMIC...NPP.....EPSL.T..T---------------ILSKYSH---------------------
Q28DU2_XENTR/291-408-KPCILDLY....QTYL...SAA.....SHQQ.Q..A---------------VREKYKT---------------------
Q28GP5_XENTR/256-374-ILPMKHMA....KVIV...QVNQ...NQTKF.L..S---------------VKNKYSS---------------------
Q29CG1_DROPS/434-556-AEIVPVLN....AGLH...RKP.....RATI.K..T---------------IRNKYSH---------------------
Q29DY8_DROPS/354-471-KTVVLELC....QTHN...TSK.....ELNT.Q..A---------------IREKYNR---------------------
Q2ABE6_CAMSI/198-326-DDCYKLIL....ELP......GNNSQMQCQT.H..K---------------R..KYQ.---------------------
Q2ABE7_CAMSI/203-327-EDCYKLML....EST.......S...GIHQS.N..K---------------R..KFR.---------------------
Q2ABE9_CAMSI/308-433-GDCAKMLA....RFHSDGGGVE.....KSKL.K..A---------------VYKKFSS---------------------
Q2HAK4_CHAGB/352-466-QPVVMLMV....DYMA...RPV......I.H.E..A---------------FFKKYAH---------------------
Q2HAS9_CHAGB/515-630-KPLIKMLF....ECCQ...DPR......KHH.G..A---------------VYDKYST---------------------
CCND1_BOVIN/155-283-RACQEQIE....ALLESSLRQA.....QQQN.L..D---------------PKAAEEE---------------------
Q2PHK8_DAUCA/314-432-MDCARALV....RFHS...CAA.....ENKL.R..V---------------IYRKYSL---------------------
Q2PHK9_DAUCA/330-448-MDCAKLLV....GLHS...AAA.....ENKL.R..V---------------IYRKYSN---------------------
Q2PHL0_DAUCA/311-430-RDCAKLLV....SYHA...ALS.....ESKL.K..A---------------VYKKFAR---------------------
CCA21_ORYSJ/359-482-QICVCALR....ELQH...NTS.....NCPL.N..A---------------IREKYRQ---------------------
Q2UPT4_ASPOR/192-299-VGLSQQLH...........QPS..........Q..I---------------LFRKYSS---------------------
Q2V5Z8_BRACM/228-351-QQPVGIIH....DLYL...SRR.....GNSL.E..A---------------VRNKYKQ---------------------
Q2WGP0_ALLCE/280-397-LECSKMMV....GFHR...NAG.....SGKL.T..G---------------VHRKYST---------------------
Q2WGP2_ALLCE/358-475-KECAKMLV....SSHI...AAP.....EGKL.N..A---------------IYKKYSR---------------------
CCB12_ARATH/312-429-MDCSKLLA....FLHS...RCG.....ESRL.R..A---------------VYKKYSK---------------------
CCB21_ARATH/302-419-MECSRKLV....SLHQ...RAA.....TGNL.T..G---------------VYRKYST---------------------
CCB13_ARATH/289-406-MDCSKLLA....FIHS...KAG.....ESKL.R..G---------------VLKKYSK---------------------
CCB22_ARATH/303-421-LECCRRMV....RLHQ...KAG.....TDKL.T..G---------------VHRKYSS---------------------
Q39331_BRANA/289-412-RGCVMDLQ....RLCS...NAH.....VSTL.P..A---------------VRDKYSQ---------------------
Q39877_SOYBN/214-337-KECVLILH....DLYL...SRK.....AASF.K..A---------------VREKYKH---------------------
Q39878_SOYBN/336-459-KTVVLALQ....DLQL...NTK.....GCFL.N..A---------------VREKYKQ---------------------
Q39880_SOYBN/313-433-RDCAKIMA....NLHA..AAAP.....GSKL.R..A---------------VYKKFSN---------------------
Q3KPK0_XENLA/154-279-KACQEQIE....SVLVRSLRQT..............---------------.RQQAQQ---------------------
Q3KQA7_XENLA/288-404-LPLVKRLN....FLLT...YPP.....NKKL.K..A---------------VRSKYSH---------------------
Q40223_LUPLU/307-426-RDCAKLMV....NFHS...VAP.....ESKL.R..A---------------VYKKFSS---------------------
Q40338_MEDSA/212-338-DECYNAIL....HLT.......N...ANNYG.H..K---------------R..KYE.---------------------
Q40488_TOBAC/238-361-KDCVLVIH....ELQS...GRR.....AASV.Q..A---------------VRKKYMD---------------------
Q40492_TOBAC/247-370-KECILILH....DLQL...SRR.....GGSL.A..A---------------VRDKYKQ---------------------
Q40514_TOBAC/347-470-RDCVVALH....SLCC...NNN.....NSSL.P..A---------------IREKYSQ---------------------
Q40516_TOBAC/291-408-IECARLLV....SYQS...AAA.....THKL.K..V---------------IYKKYSS---------------------
Q41733_MAIZE/317-437-TGRAKTLV....GSHA...ASAS...PDARL.K..A---------------VYQKYAT---------------------
Q41734_MAIZE/282-407-IECTRCW.....SAHT...RRPH...ADSKL.R..A---------------VYKKYSS---------------------
Q49U21_CRYNE/355-469-ITGASLLC....ERLI...EPD......FES.V..Y---------------VYKKYAN---------------------
Q4CS48_TRYCC/197-328-...IFSLS...EKLLS...FTKTLSSSSSKL.Q..A---------------IRRKYVS---------------------
Q4DWL9_TRYCC/229-371-KACAEAIL....EFVN...YVP.....TTKY.Q..A---------------VRRKYSS---------------------
CCD42_ORYSJ/212-330-LQCQEAIQ..............D..HHYSMA.TINT---------------VQPKPAS---------------------
Q4RZE5_TETNG/155-280-RACQEQIE....SLLVSSLQQA......QHH.....---------------.SSTTEP---------------------
Q4SG06_TETNG/155-272-SACVADLH....QLHL...SAQ.....SHPH.Q..A---------------IRERYKS---------------------
Q4T0M3_TETNG/224-342-TPVMAHIA....KNVV...KVNE...GQTKH.M..A---------------VKGKYST---------------------
Q4T2Y9_TETNG/114-254-TQCIELML....LAHD...........NDVK.E..A---------------NKTKASP---------------------
Q4T8S9_TETNG/1145-1270-RACREQIE....SLLETSLRQA.....PPH......---------------.AVTTET---------------------
Q4TVR6_HELTR/235-352-LPLVYKLA....SFVI...KTN....SATKL.V..A---------------VKNKFAS---------------------
CCNB_DICDI/316-434-LQCAQELK....EVRK...RAD.....TSNL.K..A---------------TRKKYLS---------------------
CG11_CANAL/174-308-NPQQKKQK....KAFS...........SNSS.R..T---------------TTASYTH---------------------
Q5D894_GOSHI/87-204-MECAKLLA....CFHS...KAV.....DSRL.Q..V---------------VYRKYSS---------------------
Q5D8P0_SCHJA/269-392-RDYLQILA....RAAY...RQN....SPSKY.R..A---------------IFNKYRM---------------------
Q5KAX2_CRYNJ/366-482-RPCAQVML....DHIL...DPD......F.D.ESTS---------------FYKKYAS---------------------
Q5SCB6_OSTTA/230-346-YPCACDMA....ELMR...KAP.....TATL.T..A---------------VYKKYSS---------------------
Q5SCB7_OSTTA/222-339-TRCIESMN....KEFA...SYD.....AEKF.H..A---------------LHEKYSS---------------------
Q5T8J1_HUMAN/105-230-RACQEQIE....AALRESLREA.....SQTS.S..S---------------PAPKAPR---------------------
Q5U4W4_XENLA/240-362-SECVHWMA....PFVRVVKRSL......PLK.L..K---------------VFKKVAP---------------------
Q5UAU8_PENJP/269-385-MPVICKMA....AVVV...KSS.....SAKQ.Q..A---------------VRQKYKA---------------------
CCNF_XENTR/414-537-TPCVVLLH...KKCFH...DDAPKDYRQVSL.T..A---------------VKQRFQD---------------------
Q5ZKI9_CHICK/155-280-KACQEQIE....AALAESLKQA.............S---------------QSQQEYS---------------------
Q5ZMH4_CHICK/247-368