Sequence alignment for CL0065

PF00134

CCNA2_MOUSE/171-297-------------------------------------------------------DIHTYLREME--VKC..-KPK----
CCNB3_CAEEL/115-241-------------------------------------------------------GIFDYYRHRE--VHF..-RVR----
CCNF_MOUSE/281-406-------------------------------------------------------ESVCQLFQAS--QAV..-NKQ----
CCT12_ARATH/28-169-------------------------------------------------------IIPWFFSREE--IER..-NSP----
CCNE_CAEEL/232-360-------------------------------------------------------KVWSLMVKRD--EIP.R-.AT----
REM1_SCHPO/145-271-------------------------------------------------------EILSHMEKLE--IRF..-MPD----
O45926_CAEEL/34-159-------------------------------------------------------DIYNYLVHHE--KKY..-VLD----
CCB14_ARATH/133-258-------------------------------------------------------DIFKFYRTVE--EEG..-GIK----
CCU41_ARATH/22-148-------------------------------------------------------ERVAESNDLT--RR.VA-TQS----
CCNB2_HUMAN/137-262-------------------------------------------------------DIYQYLRQLE--VLQ..-SIN----
CCNT_DROME/42-176-------------------------------------------------------DKIWYFSNDQ--LA...-NSP----
CG23_SCHPO/206-332-------------------------------------------------------DIFEYLNELE--IET..-MPS----
CCNA_DROME/206-332-------------------------------------------------------DILEYFRESE--KK...-HRP----
CG12_YEAST/43-195-------------------------------------------------------EISTNVIAQS--CKF..-KPN----
CCNB_DROME/260-387-------------------------------------------------------DIYDYLYQVE--LEQ..-PIH----
CCNB1_MOUSE/170-295-------------------------------------------------------DIYAYLRQLE--EEQ..-SVR----
CG21_SCHPO/166-292-------------------------------------------------------EIFHYMQSLE--RKL..-APP----
PCL1_YEAST/19-152-------------------------------------------------------DIIKFLTDTT--LRVVP-S..----
CG21_YEAST/212-337-------------------------------------------------------DIFDYLHHLE--IIT..-LPN----
CG22_YEAST/232-357-------------------------------------------------------DIFEYLHQLE--VIT..-LPK----
CG23_YEAST/171-297-------------------------------------------------------EIFEYMRKLE--DLY..-KPN----
CG24_YEAST/210-336-------------------------------------------------------DIFYYLRELE--VKY..-RPN----
PUC1_SCHPO/99-227-------------------------------------------------------DIIHHL.ITR--EKNFL-LNV----
CCNB1_SOYBN/197-322-------------------------------------------------------DIYKFYKLVE--NES..-RPH----
PCL2_YEAST/18-146-------------------------------------------------------EMVQYLASTT--ASIIK-IKK----
CCNB2_CHICK/141-266-------------------------------------------------------DIYLYLRQLE--LQQ..-SVR----
CCB11_ARATH/168-293-------------------------------------------------------DIYSFYKSVE--SEW..-RPR----
CCND2_MOUSE/24-151-------------------------------------------------------RVLQNLLTIE--ERYLP-QCS----
CCND3_HUMAN/26-153-------------------------------------------------------RVLQSLLRLE--ERYVP-RAS----
CGS5_YEAST/165-294-------------------------------------------------------EIFAFLYRRE--LET..-LPS----
CG21_EMENI/211-337-------------------------------------------------------EIFDYLRELE--MET..-LPN----
CGS6_YEAST/123-252-------------------------------------------------------SIFSHLYEKE--IQM..-LPT----
CCNA1_CAEEL/215-341-------------------------------------------------------DIIKYMLHRQ--TKN..-RAS----
CG22_SCHPO/139-265-------------------------------------------------------EIFEYIRKLD--LKC..-LPN----
CCND1_RAT/26-153-------------------------------------------------------RVLRAMLKTE--ETCAP-SVS----
CCNB3_CHICK/149-274-------------------------------------------------------EIFDYMRERE--EK...-FLL----
CCNB_DICDI/188-314-------------------------------------------------------EIFAYYREKE--QID..-KID----
CCD11_ARATH/50-182-------------------------------------------------------DSIACFIEDE--RHFVP-..G----
CCD21_ARATH/65-197-------------------------------------------------------DRIKEMLVRE--IEFCP-..G----
SSN8_YEAST/45-176-------------------------------------------------------DSKQNGIEQS--ITKNI-PIT----
CCNE1_CHICK/112-239-------------------------------------------------------DVWKNMINKE--ETY.V-.RD----
CCNE_DROME/330-459-------------------------------------------------------DVWRLMCHRD--EQDSR-LRS----
CCNA1_HUMAN/214-340-------------------------------------------------------EIYQYLREAE--IR...-HRP----
P92162_BOMMO/260-387-------------------------------------------------------DIYKYLTELE--EKY..-SIE----
CCC11_ORYSJ/4-144-------------------------------------------------------NFWTSSHCKQ--LLDQE-DVD----
CGH2_SHV21/22-148-------------------------------------------------------RVLNN.LKLR--ELLLP-KFT----
CCNB1_CAEEL/81-206-------------------------------------------------------DIYKYLVHHE--KKY..-LLE----
PCL9_YEAST/19-146-------------------------------------------------------EMIQFLATST--ASIIK-IRE----
CCA22_ARATH/175-302-------------------------------------------------------DIYDNIHVAE--LQQ..-RPL----
CCB12_ARATH/185-310-------------------------------------------------------DMYSFYKEVE--KE...-SQP----
CCB21_ARATH/174-300-------------------------------------------------------DLYAFYRTME--RFS..-CVP----
Q39878_SOYBN/207-334-------------------------------------------------------DIYSNIRVTE--LQ...-RKP----
CCNE1_MOUSE/113-240-------------------------------------------------------EVWRIMLNKE--KTY..-LRD----
CCB21_ORYSJ/157-283-------------------------------------------------------ELYKFYRENE--EMS..-CVQ----
CCD41_ARATH/45-178-------------------------------------------------------EIIMEMVEKE--KQH..-LPS----
CCNB3_DROME/308-433-------------------------------------------------------DIFNYLKVRE--AE...-FPI----
Q9S7H9_SOLLC/61-190-------------------------------------------------------DELATLLSK.--...EN-EFH----
CCB31_ARATH/146-272-------------------------------------------------------DIYQFYWTAE--ALN..-PAL----
CCB24_ARATH/180-307-------------------------------------------------------DIYCFYKKNE--CRS..-CVP----
Q9SMD4_SOLLC/51-182-------------------------------------------------------EELTSLFSK.--...ET-EYE----
CCD33_ARATH/59-186-------------------------------------------------------DELSTLISK.--....Q-E.P----
Q9U2M5_CAEEL/72-201-------------------------------------------------------DMRAFYNCME--YEEAL-QPN----
Q9VE72_DROME/6-144-------------------------------------------------------DVMSMQQHVE--LNK..-AQT----
Q9VKF0_DROME/205-327-------------------------------------------------------DIFDEKLHPL--THD..-QVP----
Q9VZP3_DROME/42-165-------------------------------------------------------DIFLTMREQE--LSR..-.RP----
Q9XGI1_SOLLC/180-306-------------------------------------------------------DLFANYRTME--VNS..-CAS----
CCNE2_MOUSE/112-239-------------------------------------------------------EVWQNMLQKE--NRY.V-.HD----
CCD61_ARATH/26-154-------------------------------------------------------TLPHSLFLVE--FQH..-MPS----
A0BXX7_PARTE/85-212-------------------------------------------------------EILQHLLIEE--NKY..-TIN----
A9UMS1_XENTR/114-240-------------------------------------------------------DVWRNMLNKD--RTY..-LRD----
B4FZZ7_MAIZE/193-318-------------------------------------------------------DIYTFYKIAQ--HD...-RRP----
B8A2G9_MAIZE/228-354-------------------------------------------------------DIYRFYKSTE--GTC..-LPL----
C4J9B6_MAIZE/173-299-------------------------------------------------------EIYRFYRKTE--GAS..-CVP----
E9QJ66_DANRE/140-266-------------------------------------------------------DIHRYLRECE--VKY..-RPK----
F1QBQ7_DANRE/117-243-------------------------------------------------------EVWNNLLGKD--KLY..-LRD----
F6QF79_XENTR/139-263-------------------------------------------------------DIYCYLRSLE--NAQ..-AVR----
F6QGW4_XENTR/133-257-------------------------------------------------------DIYNYLKQLE--VQQ..-SVR----
I1K835_SOYBN/85-213-------------------------------------------------------DIHGYLREME--MQNKR-RPM----
I1M770_SOYBN/186-311-------------------------------------------------------DIYKFYKETE--EDG..-C.V----
J3KY10_ORYBR/200-327-------------------------------------------------------DIYMHLREAE--TRK..-RPS----
K7V0X7_MAIZE/191-316-------------------------------------------------------DIYTFYKTAQ--HE...-SRP----
M1A5P4_SOLTU/185-310-------------------------------------------------------DIYKFYKLTE--DE...-NRP----
M4E4A3_BRARP/154-281-------------------------------------------------------DIYNHLRAAE--AKK..-QPA----
M7PCR8_PNEMU/176-302-------------------------------------------------------EIMSYMRELE--VLT..-LPL----
CG11_CANAL/44-171-------------------------------------------------------DIVNTLSQLE--SLT..-LVN----
CG24_CANAL/234-359-------------------------------------------------------EIFNYLHELE--NKF..-TPD----
CG13_CANAL/44-171-------------------------------------------------------EMLHHLLSVE--AKT..-LPN----
CG21_CANAL/208-334-------------------------------------------------------EIFSYYYELE--TRM..-LPD----
Q6BFS2_PARTE/82-209-------------------------------------------------------EIYTYLLTQE--EKY..-LVS----
VCYCL_HHV8P/21-146-------------------------------------------------------.IFYNILEIE--PRF.L-TSD----
Q7KUZ5_DROME/153-280-------------------------------------------------------..LENFLKVE--EKH.H-KIP----
T1EGC7_HELRO/166-290-------------------------------------------------------DILTYGKEAE--QRY..-MAK----
T1FNQ9_HELRO/256-380-------------------------------------------------------DIFDYYRDRE--VKF..-RI.----
W4XEA0_STRPU/126-253-------------------------------------------------------EVWTIMTRKE--ALC..-PRK----
W4XJF2_STRPU/207-332-------------------------------------------------------EIYQYLKTAE--SKH..-RPK----

PF08613

PHO80_YEAST/33-170-------------------------------------------------------TDLVVLISRM--LVSLI-AIN----
PSL1_SCHPO/29-176-------------------------------------------------------EKLLEMISVF--LSRLT-RLN----
PCL7_YEAST/108-264-------------------------------------------------------DELILMISAL--LNRII-TAN----
Q1K4U8_NEUCR/157-314-------------------------------------------------------.KQSQSIDGV--QLRTP-NPT----
Q389J6_TRYB2/370-620-------------------------------------------------------DLAIQQLILE--CDRRV-ANA----
Q6H3X9_ORYSJ/18-159-------------------------------------------------------.RVVAALAGI--LERVA-GRN----

PF01858

K1Q8Z2_CRAGI/498-695------------------------------------------------TPVSTATQSVSKLQTLL..LGRKA.LPS----
K3WCJ4_PYTUL/615-824------------------------------------------------TPVTAAVETSNWVRDTL..SSASG.FVT----
E9IWV1_SOLIN/372-568------------------------------------------------TPVTTATQSVIKLQALI..AG.QS.APS----
A9UZQ5_MONBE/439-632------------------------------------------------.PLRQAAQQLREFMEEL..PQHTD.GPS----
E9GV66_DAPPU/393-588------------------------------------------------TPVSTATQSVSRLQALV..SGRQT.GPS----
RBR_RICCO/415-616------------------------------------------------TPVSTAMTTAKWLRTVI..SPLPS.KPS----
Q54FX2_DICDI/628-829------------------------------------------------TPISLTLTLESWLKVEI..QNYRDPNPS----
F6VRH0_XENTR/413-608------------------------------------------------TPISSAMYCVSRLFTIL..TGFKP.APS----
V8P9V1_OPHHA/376-569------------------------------------------------TPVASATQSVSRLQSIV..AGLKN.APS----
G0NPV8_CAEBE/426-611------------------------------------------------.........RRRLRKLI..DGWS..YES----
H0ZAT2_TAEGU/371-563------------------------------------------------TPVSIATYSLSRLHTML..AGLKN.APS----
B0XDW3_CULQU/318-505------------------------------------------------TPISTANASVNKLRMKL..R.YDG.EPH----
F6W3I3_CIOIN/403-597------------------------------------------------TPVSSTCHDVMKLKKLL..QSKTD.GPS----
F7CLV0_MACMU/99-291------------------------------------------------TPVASATQSVSRLQSIV..AGLKN.APS----
I3KPC6_ORENI/402-595------------------------------------------------.PLSSAMKSVGRLHTLL..SGTKQ.GPS----
K7GZK7_CAEJA/310-501------------------------------------------------....NASETNERLKRII..GNWE..LET----
F1NAY3_CHICK/355-559------------------------------------------------TPVRAAMNTIQQLMMIL..NSATD.KPS----
T1K8P0_TETUR/388-595------------------------------------------------TPVTNAVRTVSRLQSLL..LDCKP.EPS----
RBL1_MOUSE/385-578------------------------------------------------TPVASATQSVSRLQSIV..AGLKS.APS----
Q7Q5E8_ANOGA/392-578------------------------------------------------........TLSQLMKRI..RGHEPGSPR----
T1HVA1_RHOPR/31-215------------------------------------------------....TSAQTIATLHSML..HSQEP.APS----
T1J484_STRMM/388-582------------------------------------------------TPVSTATQSVSKLQALL..SGRKT.TPS----
D7SVF2_VITVI/28-221------------------------------------------------........PAQWLQTVI..CSLPA.KPS----
W5MKN5_LEPOC/394-587------------------------------------------------TPVSSATQSVSRLQGMV..TGLRN.APS----
G1KBZ3_ANOCA/346-550------------------------------------------------TPVRTAMNTIQQLVMIL..NSASD.KPS----
B4M2G6_DROVI/370-550------------------------------------------------EPVANATNNVKKLSASI..SRIT..EPT----
B7PDQ5_IXOSC/377-572------------------------------------------------.PVSTATLCATKLQTLL..ADCKN.APS----
Q00U21_OSTTA/382-585------------------------------------------------TPISQAMASASWLQDIVCASSDLE.TKL----
D8RMF7_SELML/305-502------------------------------------------------TPVSVTMTTAKWLRTVI..APLPS.EPS----
F7AL78_CALJA/395-595------------------------------------------------TPVRTVMNTIQQLMMIL..NSASD.QPS----
A4S8I4_OSTLU/409-616------------------------------------------------TPISQAMASASWLQDVVCGSSDLE.TKT----
RBF_DROME/376-560------------------------------------------------EPVRNATNNVKQLSAF...GRIT..EPT----
H2UU61_TAKRU/351-546------------------------------------------------TPIRAAMTSIQQLRGDL..TSSGD.QPS----
F5H837_HUMAN/343-535------------------------------------------------TPVSTATHSLSRLHTML..TGLRN.APS----
F6RJP6_XENTR/389-579------------------------------------------------TPVSSATQCVSRLQSMV..AGLRN.APS----
A8NFV3_BRUMA/385-584------------------------------------------------TPVSASLYNASKLEALL..QDNWR.RLD----
F6YCW6_XENTR/1-199------------------------------------------------...RAAMNTIHQLTVTL..NSASD.NPS----
W5MK11_LEPOC/379-572------------------------------------------------TPVSMATQSVSRLHGLL..SGLKH.GPS----
G7Y3X8_CLOSI/355-571------------------------------------------------.......QNLSQLQILL..SGRSK.EPS----
E7FDM3_DANRE/375-568------------------------------------------------TPVSSAMQSVGRLHTLL..TGFKY.RPS----
A9SLF5_PHYPA/390-586------------------------------------------------TPVTVTMTTAKWLRTVI..TPLAS.EPS----
K7J2L5_NASVI/382-576------------------------------------------------.PNANPTQSVIRLQSLL..VGCQA.LPS----
M4AMR4_XIPMA/258-452------------------------------------------------TPIRAAMTSIRMLRGDL..PSNGD.QPS----
H9KR58_APIME/415-607------------------------------------------------TPVSTATQSVIRLQAML..AG.QT.SPS----
W5JE43_ANODA/403-588------------------------------------------------........TLNQLMKKI..QGHKPGQPR----
W4Y895_STRPU/330-534------------------------------------------------TPVRRAVTTVQALKSLL..TGARD.TPS----
A7RQ05_NEMVE/385-582------------------------------------------------TPVSTATQSVSRLQAMC..SGLKP.TPS----
C3XU15_BRAFL/375-568------------------------------------------------TPVSTATQSVSRLQALL..AGLKT.SPS----
H2YMF2_CIOSA/346-540------------------------------------------------TPVSSAWQDVMKLKKLL..HGKSD.APS----
F1Q9D6_DANRE/359-569------------------------------------------------TPIRAAMTSIQQLRGDL..TSGSD.QPS----
H9IXG6_BOMMO/327-522------------------------------------------------TPVSEAKNSLARLAATL..RHARP.QPS----
B4JJ99_DROGR/374-552------------------------------------------------EPVAHATNNVKKLSATI..SRIT..EPT----
F4QEM9_DICFS/396-587------------------------------------------------TPISSSLSMIEWIKKSI..QNYQA.EPS----
A8HY72_CHLRE/423-626------------------------------------------------TPISEAMGASAWLRGVT..SNMVA.EPS----
W5LEH3_ASTMX/376-569------------------------------------------------TPVSMAMQGVGRLHSLL..AGLKH.RPS----
Q231Q1_TETTS/575-761------------------------------------------------TPLSNALDNSKWI......NMYSKSDPI----
B4L4P7_DROMO/352-536------------------------------------------------EPVANATNNVKKLSATV..SHIT..EPT----
H3AQ36_LATCH/393-584------------------------------------------------TPVSSATQSVSRLQSMV..AGLRN.TPS----
W5MR28_LEPOC/371-573------------------------------------------------TPVRAAMNCIQQLKVIL..NSASD.WPS----
X1WJD7_ACYPI/378-569------------------------------------------------TPVKNASEMVFKIQSIL..ADCSP.YPS----
E4WSX2_OIKDI/375-564------------------------------------------------.PVTQHTRAVQQIKDLV..KDNDSSDIP----
RBR1_ORYSJ/419-619------------------------------------------------TPVSTAMTTAKWLRSTI..SPLPS.KPS----
M4B693_HYAAE/488-711------------------------------------------------TPITSAVETSNWVRETL..SSSTLTHMT----
H2MXX9_ORYLA/384-576------------------------------------------------TPVSSATQSVSRLQSMV..AGLRT.APS----
RBR1_MAIZE/275-476------------------------------------------------TPVTSAMTTAKWLREVI..SSLPD.KPS----
H3A0E3_LATCH/386-579------------------------------------------------TPVSSATQSVSRLHTLL..MGLKN.GPS----
B3S6M6_TRIAD/378-570------------------------------------------------TPVSSATLSVGRLQALL..AKWTV.SPS----
W5KDE3_ASTMX/254-459------------------------------------------------TPIRAAMNSIQQLRGGL..TSASD.QPS----
H9GN70_ANOCA/432-623------------------------------------------------.PISIATYNLTRLHTML..TGLKN.APS----
M0T571_MUSAM/407-609------------------------------------------------TPVSTAMTTAKWLREFI..SPLHS.KPS----
E1ZEA5_CHLVA/159-357------------------------------------------------TPITAAMSSAAWLQGTV..AGQGE.GPP----
D0NTP5_PHYIT/460-683------------------------------------------------TPVTAAVETNNWVRETL..SSTMLTPVT----
U6HGS1_ECHMU/397-581------------------------------------------------......SENLHHIQALL..SGRSR.NPS----
K1PLH3_CRAGI/285-489------------------------------------------------TPVRAALNTIQNLKKIL..FSTRD.EPS----
E0VGB1_PEDHC/321-507------------------------------------------------..LSTATQAINRLKTIL..EGRQA.HPS----
U1NNI7_ASCSU/382-582------------------------------------------------TPISGSLYNASKMEQLL..SNEWQ.TPS----
B9RGU7_RICCO/60-252------------------------------------------------......QVTRKWLETVI..SPLPS.KPS----
D2VQU0_NAEGR/217-404------------------------------------------------TPLQASLLVIQLIEEST..KGLSS.SPD----
W5KQG9_ASTMX/387-580------------------------------------------------TPVSSATQSVSRLQSMV..TGLRN.APS----

PF03261

Q9V3H5_DROME/91-460TQLSSHNLNNLANASKDTITNVLDTHNENSVLKAEKS...SFEKNLKKH..SIFINALSW.KKLS.TSHNKKKIEN.KNK
W4XFC8_STRPU/11-372PHRGDYGGYSDTTTLSVGNLNELYLNNSKNVASTKENIHLVGERPMRKHNSALFISALGL.KMFS...VSKKKTSS....
B4NP59_DROWI/88-420PQLSSHNFNNLTNTSKDTITNDLDTHLDNSIFNSEKN...SIEKNLKKH..SIFINALSW.KKLS.TSHNKKKIDN.KNK
G0MEC3_CAEBE/11-362HH.........HRTQTTSVCNHLFSPGDGGPTFAPQRDSNASSRNSSSAKESVLMQGWNWSKRNIQPVMSRRSLPK....
B4MG57_DROVI/90-432TQISSHNFNNLAYSSKDTINNDLDAHNENSTVISEKS...SIEKSLKKH..SLFINALSW.KKLS.TAHNKKKVEN.KNK
Q0G843_CAEEL/11-364HH.........HRTQTTSVCNHLFSPGDGGPTFAPQRDSNTSSRSSSNAKESVLMQGWNWSKRNIQPVMSRRSLPK....
I3JGY3_ORENI/11-321YRKAALFEDGPATVGHYTAVQNSKNAKDAAA.........AAAKSLKR...PSIISVLPW.KRIV.AVSAKRKGSK...K
B4G7J4_DROPE/90-428PQLGSHHLHNLANSSKDTITNVLDAQNENGAIKSEKS...SIDKNLKKH..SIFINALSW.KKLS.TSHNKKKIDN.KNK
E0VX77_PEDHC/62-395....HTTSNTNNNNTNHQIHANHINNNDNAKIISEKN...TLEKNFKKH..SLFINALSW.KRFSTANNNKKKLDN.KNK
Q17C39_AEDAE/119-480........NNNSNSIQERNNNNNTSNTDSARILSEKN...ALERNLKKH..SLFINALSW.KRLA.ASHGKKKLDNQKNK
H2VTT9_CAEJA/11-389................TSVCNHLFSPGDGGPTFAPQQ....QESPRPSAKESVLVQGWNWSKRNIQPVMSRRSLLK....

PF01857

E3LY90_CAERE/724-863--------------------------------------------------------.....------.RR......----
C3XU15_BRAFL/762-922--------------------------------------------------------SLGLF------FRK......----
D6WUA4_TRICA/623-757--------------------------------------------------------GVSIV------FRK......----
I7M8B4_TETTS/589-711--------------------------------------------------------AIEKF------FRR......----
W5LEH3_ASTMX/770-953--------------------------------------------------------SLSLF------FRK......----
W5KQG9_ASTMX/775-930--------------------------------------------------------SLALF------FRK......----
Q00U21_OSTTA/709-837--------------------------------------------------------ALQIF------FAK......----
K7J2L5_NASVI/706-866--------------------------------------------------------SLALF------FRK......----
G3NYF0_GASAC/762-926--------------------------------------------------------SVSLF------FRK......----
E9GV66_DAPPU/739-928--------------------------------------------------------SLSLF------FRK......----
K7V2N7_MAIZE/595-720--------------------------------------------------------TIQIF------FSK......----
B4MSL7_DROWI/606-728--------------------------------------------------------ALQIF------LRK......----
B9RGU7_RICCO/363-485--------------------------------------------------------AINVL------FSK......----
H3AQ36_LATCH/797-959--------------------------------------------------------SLALF------LRK......----
M4B693_HYAAE/750-894--------------------------------------------------------.LRLF------FRM......----
K3YG32_SETIT/683-811--------------------------------------------------------GIGVF------FSK......----
RBR_POPTR/755-884--------------------------------------------------------GINVF------FTK......----
F2UP70_SALR5/745-900--------------------------------------------------------.....------..K......----
E9CHS1_CAPO3/877-1004--------------------------------------------------------ALHLF------VRK......----
F1QY31_DANRE/771-933--------------------------------------------------------SLALF------FRK......----
H9KR58_APIME/635-797--------------------------------------------------------SVALF------FRK......----
Q17Q73_AEDAE/556-680--------------------------------------------------------SLNLF------FRK......----
H3C722_TETNG/743-911--------------------------------------------------------SLALF------FRK......----
D2VQU0_NAEGR/452-591--------------------------------------------------------.VLFF------FRK......----
A9SLF5_PHYPA/706-835--------------------------------------------------------VINVF------FQK......----
M0T571_MUSAM/727-855--------------------------------------------------------VIRVF------CNK......----
K7GZK7_CAEJA/561-706--------------------------------------------------------TLRIF------LKR......----
Q54FX2_DICDI/890-1042--------------------------------------------------------.IQNF------IKK......----
B3S6M6_TRIAD/657-840--------------------------------------------------------SLGLF------FRK......----
D7SVF2_VITVI/331-459--------------------------------------------------------GIKLL------FEK......----
H2P1U6_PONAB/787-943--------------------------------------------------------SLALF------YRK......----
RBL2_MOUSE/831-1011--------------------------------------------------------SLALF------FRK......----
G5EDT1_CAEEL/744-889--------------------------------------------------------TLRIF------LKR......----
E7FDM3_DANRE/770-952--------------------------------------------------------SLCLF------FRK......----
RBF_DROME/581-705--------------------------------------------------------PLQIF------LRK......----
U1NNI7_ASCSU/660-828--------------------------------------------------------..TLF------FRKDTPTFQ----
G1KFZ9_ANOCA/784-927--------------------------------------------------------SLALF------FRK......----
W5MK11_LEPOC/790-976--------------------------------------------------------SLTLA------AWQ......----
J0XFZ4_LOALO/562-724--------------------------------------------------------...LF------FRK......----
T1J484_STRMM/718-944--------------------------------------------------------SLGLF------FRK......----
I3KPC6_ORENI/788-976--------------------------------------------------------SLSLF------FRK......----
D7SU46_VITVI/726-854--------------------------------------------------------GINIF------FSK......----
W4ZBT1_STRPU/363-541--------------------------------------------------------SIGIF------FRK......----
T1K8P0_TETUR/710-889--------------------------------------------------------SLGLF------FRK......----
A7RQ05_NEMVE/790-960--------------------------------------------------------SLALF------FRK......----
D7G8E5_ECTSI/865-1014--------------------------------------------------------TLDLF------FRR......----
H9GN70_ANOCA/847-1031--------------------------------------------------------SLMLF------FRK......----
F6RJP6_XENTR/770-927--------------------------------------------------------SLALF------FRK......----
G3N416_GASAC/775-935--------------------------------------------------------SLALF------FRK......----
I3JCL2_ORENI/775-933--------------------------------------------------------SLALF------FRK......----
H2U458_TAKRU/718-908--------------------------------------------------------SLSLF------FRK......----
B4M2G6_DROVI/571-694--------------------------------------------------------PLQIF------LRK......----
G4VM99_SCHMA/814-941--------------------------------------------------------SIAIF------FRQ......----
H3A0E3_LATCH/805-987--------------------------------------------------------SLSLF------FRK......----
B0XDW3_CULQU/653-812--------------------------------------------------------SLNLF------FRK......----
W5JE43_ANODA/665-839--------------------------------------------------------.LNFF------FRK......----
T1HVA1_RHOPR/343-480--------------------------------------------------------SLALF------FRK......----
A8HY72_CHLRE/818-944--------------------------------------------------------....F------LRK......----
K3WCJ4_PYTUL/862-1000--------------------------------------------------------VLQLF------FRK......----
F4X6S3_ACREC/751-913--------------------------------------------------------SVALF------FRK......----
B7PDQ5_IXOSC/761-937--------------------------------------------------------SLALF------FRK......----
H2SIQ5_TAKRU/775-930--------------------------------------------------------SLALF------FRK......----
T1FJQ6_HELRO/776-947--------------------------------------------------------SIPLF------FRK......----
E0VGB1_PEDHC/551-709--------------------------------------------------------SLSIF------FRK......----
A8WW47_CAEBR/737-882--------------------------------------------------------TLRIF------LKR......----
E1ZEA5_CHLVA/548-700--------------------------------------------------------AVNKF------LRR......----
M3ZR51_XIPMA/555-736--------------------------------------------------------SLSLF------FRK......----
U3I0V9_ANAPL/751-937--------------------------------------------------------SLSLF------FRK......----
I1ILE9_BRADI/604-729--------------------------------------------------------GVNIF------FSK......----
B7G0K4_PHATC/972-1099--------------------------------------------------------.....------VRK......----
V8P9V1_OPHHA/768-918--------------------------------------------------------SLALF------FRK......----
RBR1_ARATH/729-857--------------------------------------------------------GINIF------FTK......----
G0NPV8_CAEBE/665-810--------------------------------------------------------TLRIF------LKR......----
H3D2K2_TETNG/626-748--------------------------------------------------------SLSLF------YKK......----
Q7Q5E8_ANOGA/609-787--------------------------------------------------------.....------.........----
G1NXF3_MYOLU/774-956--------------------------------------------------------SLALF------YRK......----
A0DTJ1_PARTE/585-706--------------------------------------------------------..NRL------FKR......----
C5YE98_SORBI/68-193--------------------------------------------------------AIQIF------FSK......----
U3KDL0_FICAL/672-832--------------------------------------------------------SLALF------YRK......----
U6HGS1_ECHMU/721-876--------------------------------------------------------SVAIF------FRH......----
C1N5Z8_MICPC/1035-1166--------------------------------------------------------SLRIF------FAK......----
F6W3I3_CIOIN/825-983--------------------------------------------------------SLALF------FRK......----
D0NTP5_PHYIT/716-846--------------------------------------------------------.LRLF------YRK......----
W1PFC3_AMBTC/737-865--------------------------------------------------------GISIF------FRK......----
W5MKN5_LEPOC/789-946--------------------------------------------------------SLALF------FRK......----
F6VRH0_XENTR/812-995--------------------------------------------------------SLTLF------CRR......----
G7Y3X8_CLOSI/746-873--------------------------------------------------------SLAIF------FRH......----
E4WSX2_OIKDI/638-762--------------------------------------------------------SMQLF------YRK......----
G3WX03_SARHA/792-946--------------------------------------------------------SLALF------YRK......----
D8U756_VOLCA/780-909--------------------------------------------------------.....------.KQ......----
M4AJJ3_XIPMA/767-924--------------------------------------------------------SLALF------FRK......----
H2NQW4_PONAB/835-1018--------------------------------------------------------SLSLF------FRK......----
U6I670_HYMMI/714-860--------------------------------------------------------..AIF------YRH......----
E2AA07_CAMFO/750-912--------------------------------------------------------SVALF------FRK......----
H2YMF2_CIOSA/739-893--------------------------------------------------------SLALF------FRK......----
A4S8I4_OSTLU/745-874--------------------------------------------------------ALRMF------FAK......----

PF00382

TF3B_KLULA/193-266--------------------------------------------------------------------------------
TF2B_KLULA/137-207--------------------------------------------------------------------------------
TF2B_YEAST/133-203--------------------------------------------------------------------------------
TF3B_CANAL/95-165--------------------------------------------------------------------------------
TF2B_DROME/214-284--------------------------------------------------------------------------------
TF3B_KLULA/98-168--------------------------------------------------------------------------------
TF3B_CANAL/190-263--------------------------------------------------------------------------------
TF2B_DROME/120-190--------------------------------------------------------------------------------
TF2B_KLULA/245-315--------------------------------------------------------------------------------
TF2B_PYRFU/212-282--------------------------------------------------------------------------------
Q5V5V1_HALMA/235-305--------------------------------------------------------------------------------

PF16899

CCNH_ECHMU/168-289--------------------------------------------------------TPYRP------LSG----------
D2VN70_NAEGR/180-268--------------------------------------------------------HPYRS------LYA----------
H3FVF7_PRIPA/67-164--------------------------------------------------------QPYRP------LKQ----------
G6D7P5_DANPL/155-246--------------------------------------------------------QPYRP------LLL----------
C5DE24_LACTC/194-313--------------------------------------------------------HPYKA------LHG----------
H2B1R1_KAZAF/202-304--------------------------------------------------------HPYKP------LHG----------
C5DYH4_ZYGRC/193-303--------------------------------------------------------HPYKA------LHG----------
Q6FMU5_CANGA/203-302--------------------------------------------------------HPYKP------LHG----------
G0V973_NAUCC/221-326--------------------------------------------------------HPYKP------LHG----------
G0W3A8_NAUDC/222-335--------------------------------------------------------HPYKP------LHG----------
G2YRH2_BOTF4/184-304--------------------------------------------------------HPYRG------LEG----------
R7YVJ7_CONA1/187-325--------------------------------------------------------HPHRG------LRG----------
C9SVU8_VERA1/162-263--------------------------------------------------------HPFRG------LEG----------
L2FZZ6_COLGN/165-276--------------------------------------------------------HPFRA------LEG----------
H1VJI3_COLHI/166-278--------------------------------------------------------HPFRA------LEG----------
M7TNJ7_EUTLA/145-243--------------------------------------------------------HPYRA------LEG----------
G3JT19_CORMM/158-261--------------------------------------------------------HPLRA------LEG----------
G9NI52_HYPAI/158-265--------------------------------------------------------HPFRA------LEG----------
F9F5Z4_FUSOF/158-263--------------------------------------------------------HPFRA------LEG----------
L8GA30_PSED2/187-302--------------------------------------------------------HPFRA------LEG----------
K1X5Y0_MARBU/178-294--------------------------------------------------------HPFRA------LEG----------
N1JHL3_BLUG1/188-305--------------------------------------------------------HPYRA------LEG----------
H6C5Z8_EXODN/187-301--------------------------------------------------------HPMKG------LAG----------
R1EFE2_BOTPV/206-348--------------------------------------------------------HPYRG------LNG----------
Q0UGP0_PHANO/193-328--------------------------------------------------------HPFRA------LKG----------
E5AC16_LEPMJ/211-344--------------------------------------------------------HPFRG------LKG----------
R0KJU5_SETT2/173-306--------------------------------------------------------HPFRA------LKA----------
M3AYY7_MYCFI/177-276--------------------------------------------------------QPSRG------LKG----------
N1QKL6_SPHMS/175-275--------------------------------------------------------QPYRG------LKG----------
F9XH99_MYCGM/164-291--------------------------------------------------------QPFRG------LKG----------
M2MZH1_BAUCO/171-314--------------------------------------------------------QPYRG------LKG----------
M2YNC7_MYCP1/165-265--------------------------------------------------------QPFRG------LKG----------
B6Q284_PENMQ/191-333--------------------------------------------------------HPFRG------LEG----------
G3Y4C9_ASPNA/188-330--------------------------------------------------------HPFRG------LEG----------
B0Y3L0_ASPFC/188-332--------------------------------------------------------HPFRG------LEG----------
Q5BB69_EMENI/189-333--------------------------------------------------------HPFRG------LEG----------
G7E2H9_MIXOS/177-279--------------------------------------------------------GAHNA------LRG----------
F8NWE7_SERL9/187-291--------------------------------------------------------HAHRA------LWG----------
D8PKL8_SCHCM/182-281--------------------------------------------------------HAHRA------LWG----------
K9HXY7_AGABB/176-275--------------------------------------------------------HAHRA------LWG----------
J4HVQ4_FIBRA/73-167--------------------------------------------------------HAHRA------LWG----------
E9C7X0_CAPO3/152-254--------------------------------------------------------HPMRS------LRG----------
E3M1M6_CAERE/158-270--------------------------------------------------------CPYRP------FEG----------
A7S801_NEMVE/159-255--------------------------------------------------------HPFRP------MEG----------
C3ZT09_BRAFL/159-259--------------------------------------------------------NPIRP------LEG----------
I1FML6_AMPQE/158-255--------------------------------------------------------SPFRP------LEG----------
E4YFZ2_OIKDI/97-198--------------------------------------------------------NPYRP------LEG----------
G3U0L9_LOXAF/162-261--------------------------------------------------------NPYRP------FEG----------
G1N872_MELGA/126-226--------------------------------------------------------NPYRP------FEG----------
G3UI14_LOXAF/162-261--------------------------------------------------------NPYRP------FEG----------
E3TDV0_ICTPU/162-262--------------------------------------------------------NPYRP------LEG----------
B5DG24_SALSA/163-263--------------------------------------------------------TPYRP------MEG----------
H2RRW1_TAKRU/163-263--------------------------------------------------------NPYRP------LEG----------
K4FV42_CALMI/163-263--------------------------------------------------------NPFRP------FEG----------
Q3KQ83_XENLA/162-262--------------------------------------------------------NPYRP------FEG----------
I7G2X7_MACFA/162-262--------------------------------------------------------NPYRP------FEG----------
H3A0T1_LATCH/164-264--------------------------------------------------------TPYRP------FEG----------
R7UPP9_CAPTE/154-254--------------------------------------------------------NPFRP------LEG----------
B7PB82_IXOSC/86-183--------------------------------------------------------NPYRP------LEG----------
G3MNU6_9ACAR/156-256--------------------------------------------------------NPYRP------LEG----------
F6TUV6_CIOIN/161-261--------------------------------------------------------NPFRP------LEG----------
E9G2Q3_DAPPU/159-258--------------------------------------------------------NPFRP------LEG----------
R4G2X9_RHOPR/158-256--------------------------------------------------------NPFRA------VEG----------
B8YN16_SCYPA/165-265--------------------------------------------------------QPFRP------VEG----------
K7IUX2_NASVI/159-256--------------------------------------------------------NPFRP------VEG----------
E2BY23_HARSA/159-256--------------------------------------------------------NPFRP------VEG----------
H9K562_APIME/183-280--------------------------------------------------------NPFRP------VEG----------
N6TWG3_DENPD/159-258--------------------------------------------------------NPFRP------VEG----------
Q16JQ2_AEDAE/159-257--------------------------------------------------------NPFRP------IEG----------
C6SV35_DROME/162-260--------------------------------------------------------NPFRP------IEG----------
D3TRT0_GLOMM/159-257--------------------------------------------------------NPYRP------IEG----------
H9JGM4_BOMMO/159-258--------------------------------------------------------NPFRP------VEG----------
K8F2A8_9CHLO/171-283--------------------------------------------------------GAFRP------LRG----------
L8GMB5_ACACA/173-270--------------------------------------------------------LPYNP------LHG----------
Q5SCB4_OSTTA/157-262--------------------------------------------------------GATRP------LDG----------
A4RUA6_OSTLU/106-212--------------------------------------------------------GAARP------LDG----------
D8SKW4_SELML/173-280--------------------------------------------------------APYRS------LDG----------
A9TM39_PHYPA/166-271--------------------------------------------------------TPYRS------MEG----------
B6TIT4_MAIZE/176-281--------------------------------------------------------APYRS------IEG----------
I1GNJ7_BRADI/176-281--------------------------------------------------------APYRP------IEG----------
M8CSB1_AEGTA/98-189--------------------------------------------------------APYRS------IEG----------
R0FFP6_9BRAS/176-281--------------------------------------------------------APYRA------IEG----------
K4BTS5_SOLLC/176-282--------------------------------------------------------SPYRA------LEG----------
M0U1N4_MUSAM/177-282--------------------------------------------------------APYRS------VEG----------
A9PJ64_9ROSI/178-280--------------------------------------------------------APYRS------VEG----------
B9RF84_RICCO/157-262--------------------------------------------------------APYRS------VEG----------
M5VZ28_PRUPE/175-280--------------------------------------------------------APYRS------IEG----------
D7U9R4_VITVI/178-283--------------------------------------------------------APYRS------VEG----------
G7I853_MEDTR/189-294--------------------------------------------------------APYRS------VEG----------
I1KBX5_SOYBN/178-283--------------------------------------------------------APYRS------VEG----------

PF02984

CG11_CANAL/174-308-------------------------------------------------------PTLEDC....--LQL......----
Q9GTQ8_DROME/286-422-------------------------------------------------------VTPLDF....--LEL......----
Q4T8S9_TETNG/1145-1270-------------------------------------------------------VTPLDF....--IDH......----
Q4RZE5_TETNG/155-280-------------------------------------------------------VTPHDF....--IEH......----
A7YYE4_DANRE/155-279-------------------------------------------------------VTPHDF....--IEH......----
Q7ZYJ6_XENLA/153-279-------------------------------------------------------VTPHDF....--IEH......----
CCND1_BOVIN/155-283-------------------------------------------------------MTPHDF....--IEH......----
CCND1_MOUSE/155-283-------------------------------------------------------MTPHDF....--IEH......----
Q5T8J1_HUMAN/105-230-------------------------------------------------------VIAHDF....--LAF......----
Q5ZKI9_CHICK/155-278-------------------------------------------------------VIANDF....--LAH......----
Q1L8M6_DANRE/153-279-------------------------------------------------------ITPLDF....--IEH......----
H2Q584_PANTR/154-275-------------------------------------------------------VTPHDF....--IEH......----
Q3KPK0_XENLA/154-277-------------------------------------------------------VTPHDF....--IEH......----
CCD11_ARATH/184-308-------------------------------------------------------VTPFDF....--ISF......----
Q9SNV2_ANTMA/176-296-------------------------------------------------------ISPFCY....--LSF......----
CCD42_ORYSJ/212-330-------------------------------------------------------VTPFSYIDYF--LRK......----
CCD42_ARATH/171-289-------------------------------------------------------VTPCSY....--VRY......----
CCD41_ARATH/180-299-------------------------------------------------------ITPCSYIRYF--LRK......----
P93103_OXYRB/210-333-------------------------------------------------------VTPFSF....--IDY......----
Q9ZRX9_TOBAC/198-317-------------------------------------------------------YTPYTF....--IDY......----
O82678_OXYRB/199-324-------------------------------------------------------VTPLSYFGHL--IRK......----
Q8LPW3_HELAN/178-304-------------------------------------------------------VTPISFLDHI--VRR......----
CCD33_ARATH/188-310-------------------------------------------------------VTPISFFDHI--IRR......----
CCD31_ARATH/189-307-------------------------------------------------------ITPISFVDHI--IRR......----
Q8LK74_LAGSI/187-313-------------------------------------------------------VTPFSFVDYI--SRR......----
Q9SMD4_SOLLC/184-309-------------------------------------------------------VTPFSFLDFI--TRR......----
Q8GZU3_9ROSI/205-332-------------------------------------------------------VTPISFLDYI--TRR......----
Q2ABE7_CAMSI/203-327-------------------------------------------------------VTPLSFLDHI--TRR......----
Q9S7H9_SOLLC/192-320-------------------------------------------------------VTPLSFIDHI--MRR......----
A7Y7X0_CUCSA/197-329-------------------------------------------------------VTPYSFLDHI--VKR......----
Q9SNV0_ANTMA/203-329-------------------------------------------------------VTPISFFDHI--VRR......----
Q40338_MEDSA/212-338-------------------------------------------------------VTTHSFLDHI--IRR......----
Q9SXN7_TOBAC/190-313-------------------------------------------------------VTPLSFVDHI--IRR......----
Q2ABE6_CAMSI/198-326-------------------------------------------------------VTPLSFVDHI--VRR......----
Q7XAB7_EUPES/184-308-------------------------------------------------------VTPICYFDHI--IRR......----
Q84V88_POPAL/200-324-------------------------------------------------------VTSISFFDHI--IRR......----
CCNE_HEMPU/255-381-------------------------------------------------------ITVNTW....--LNA......----
Q5U4W4_XENLA/240-362-------------------------------------------------------VTAISW....--LNL......----
Q5ZMH4_CHICK/247-368-------------------------------------------------------VTIISW....--LNL......----
Q544H6_MOUSE/241-363-------------------------------------------------------VTVISW....--LNL......----
CCNE1_HUMAN/244-366-------------------------------------------------------LTIVSW....--LNV......----
B2GQF9_DANRE/246-368-------------------------------------------------------LTPVAW....--LNI......----
CCD61_ARATH/156-288-------------------------------------------------------VTPFSF....--LAF......----
A8XRM2_CAEBR/208-340-------------------------------------------------------PSSLVF....--ARC......----
O45926_CAEEL/161-293-------------------------------------------------------PSSLVF....--LRC......----
CCNB1_CAEEL/208-340-------------------------------------------------------PSSLVF....--LRC......----
Q9U7P9_9CILI/566-681-------------------------------------------------------PNTLWF....--LNL......----
Q4T2Y9_TETNG/114-254-------------------------------------------------------PTAAHF....--IDF......----
CCNJ_XENLA/145-273-------------------------------------------------------PTPAHF....--IEY......----
CG1C_SCHPO/162-278-------------------------------------------------------PYVLSF....--IKK......----
A2F2K2_TRIVA/212-328-------------------------------------------------------ATPLFF....--LTH......----
A2DQ77_TRIVA/248-364-------------------------------------------------------PTPYFF....--LGI......----
A2DZV8_TRIVA/235-351-------------------------------------------------------PTPLFF....--LNY......----
A0C1C9_PARTE/197-310-------------------------------------------------------TSPLKF....--LER......----
A0DMF0_PARTE/199-312-------------------------------------------------------TSPIKF....--LER......----
B8N0B1_ASPFN/192-299-------------------------------------------------------PTVDSF....--LQM......----
A4RSW0_OSTLU/207-322-------------------------------------------------------TTTKTF....--LTI......----
Q5SCB7_OSTTA/222-339-------------------------------------------------------TTVNTF....--LTF......----
CCNF_MOUSE/408-531-------------------------------------------------------PTVVDY.KEV--LLT......----
CCNF_XENTR/414-537-------------------------------------------------------PTVVDY.KDV--LSH......----
A2E0Q4_TRIVA/216-333-------------------------------------------------------VVTSQF....--LRR......----
A2E6K7_TRIVA/216-333-------------------------------------------------------ILSSQF....--LRR......----
REM1_SCHPO/273-388-------------------------------------------------------PGPVSF....--LRL......----
Q4CS48_TRYCC/197-328-------------------------------------------------------PTTYPL....--ACH......----
A4HKX7_LEIBR/155-297-------------------------------------------------------PTPYPF....--ASRAWTVLE----
Q4DWL9_TRYCC/229-371-------------------------------------------------------PTPFPF....--IVRLLSVME----
Q0VA13_XENTR/226-348-------------------------------------------------------IHPLHF....--LRI......----
CCF13_ORYSJ/255-372-------------------------------------------------------PTASTF....--VQH......----
Q23JX5_TETTS/284-401-------------------------------------------------------PTSLRF....--LER......----
O96434_PARTE/212-329-------------------------------------------------------PSSYCF....--LQR......----
A0E0R4_PARTE/214-320-------------------------------------------------------PTAYQF....--LSK......----
Q9TY42_PARTE/121-227-------------------------------------------------------PTAYQF....--LQK......----
Q25123_HELRO/240-368-------------------------------------------------------PTPNYFCCDL--LDR......----
CCNB3_CAEEL/243-364-------------------------------------------------------PLSYRY....--LRR......----
Q29CG1_DROPS/434-556-------------------------------------------------------PLSYRF....--LRR......----
Q7QC70_ANOGA/538-653-------------------------------------------------------PLSYRF....--LRR......----
Q16VG6_AEDAE/419-535-------------------------------------------------------PLSYRF....--LRR......----
Q25168_HELTR/382-498-------------------------------------------------------PLSYTF....--LRR......----
A7S8H6_NEMVE/110-226-------------------------------------------------------PIPYRF....--LRR......----
Q60FY2_ANGJA/277-393-------------------------------------------------------PVPYRF....--LRR......----
Q08C91_DANRE/272-388-------------------------------------------------------PVPYRF....--LRR......----
Q60FY1_ORENI/302-418-------------------------------------------------------PIPYRF....--LRR......----
CCNB3_MOUSE/1265-1381-------------------------------------------------------PTAYNF....--LRR......----
K4Q4R6_CHICK/276-392-------------------------------------------------------PIPYRF....--LRR......----
Q3KQA7_XENLA/288-404-------------------------------------------------------PVPYRF....--LRR......----
CCNB3_HUMAN/1259-1375-------------------------------------------------------PIAYHF....--LRR......----
CCNB3_CANFA/1202-1318-------------------------------------------------------PIAYHF....--LRR......----
CCNA1_CAEEL/343-459-------------------------------------------------------PTSSWF....--GTC......----
CCNA_DROME/334-451-------------------------------------------------------PTAYVF....--INT......----
Q29DY8_DROPS/354-471-------------------------------------------------------PTAYVF....--INT......----
Q17NN3_AEDAE/310-427-------------------------------------------------------PTTLVF....--TTV......----
Q7Q0E8_ANOGA/187-304-------------------------------------------------------PTSLVF....--TNT......----
CCF32_ORYSJ/267-390-------------------------------------------------------PTVITF....--LRR......----
A3AKA7_ORYSJ/256-379-------------------------------------------------------PTTKTF....--LRM......----
A2ZM34_ORYSI/249-372-------------------------------------------------------PTIKTF....--LRR......----
Q39877_SOYBN/214-337-------------------------------------------------------PTVSTF....--LRR......----
Q40488_TOBAC/238-361-------------------------------------------------------PTTKTF....--LRI......----
CCNAL_DAUCA/208-330-------------------------------------------------------PTVKTF....--L.G......----
CCA33_ARATH/190-313-------------------------------------------------------PTTNTF....--LRR......----
Q2V5Z8_BRACM/228-351-------------------------------------------------------PTIKTF....--LRR......----
CCA31_ARATH/219-342-------------------------------------------------------PTSNTF....--LRR......----
Q9M4K9_PEA/216-340-------------------------------------------------------PTIKTF....--LRR......----
O04388_CATRO/238-361-------------------------------------------------------PTIKTF....--LRR......----
Q40492_TOBAC/247-370-------------------------------------------------------PTVKTF....--LRR......----
Q39331_BRANA/289-412-------------------------------------------------------PTVKCF....--LRR......----
CCA12_ARATH/310-433-------------------------------------------------------PTAKCF....--LRR......----
CCA14_ORYSJ/216-339-------------------------------------------------------PTTKCF....--LRR......----
CCA11_ORYSJ/372-495-------------------------------------------------------PTAKCF....--LRR......----
Q84LE4_SILLA/352-474-------------------------------------------------------PTTKNF....--LRR......----
Q40514_TOBAC/347-470-------------------------------------------------------PTAKCF....--LRR......----
Q96226_ADICA/397-520-------------------------------------------------------PTTKSF....--LRR......----
Q39878_SOYBN/336-459-------------------------------------------------------PTIKTF....--LRR......----
Q9XGI4_SOLLC/345-468-------------------------------------------------------PTTKKF....--LRR......----
CCA22_ARATH/304-427-------------------------------------------------------PTTKTF....--LRR......----
CCA21_ORYSJ/359-482-------------------------------------------------------PTTKTF....--LRR......----
CCA24_ARATH/329-452-------------------------------------------------------PTSKTF....--LRR......----
A5BUM0_VITVI/360-483-------------------------------------------------------PTAKTF....--LRR......----
Q941M7_MEDSA/349-473-------------------------------------------------------PTTKTF....--LRR......----
A7SEI5_NEMVE/172-293-------------------------------------------------------PTILNF....--LER......----
CCNA_HYDVD/296-415-------------------------------------------------------PTCRDF....--LSR......----
P90681_PATPE/322-438-------------------------------------------------------PTANAF....--LSR......----
Q6ZZ83_SPHGR/342-458-------------------------------------------------------PTINCF....--LPR......----
Q4SG06_TETNG/155-272-------------------------------------------------------PTSSQF....--LSL......----
O77212_DREPO/291-408-------------------------------------------------------PTTNWF....--CES......----
CCNA1_CARAU/268-385-------------------------------------------------------PTVHQF....--LMQ......----
CCNA1_XENLA/295-412-------------------------------------------------------PTVNQF....--LLQ......----
CCNA1_MOUSE/298-415-------------------------------------------------------PTTNQF....--LLQ......----
CCNA_PATVU/302-419-------------------------------------------------------PTINWF....--TDT......----
Q28DU2_XENTR/291-408-------------------------------------------------------PTILQY....--LNQ......----
Q98TA3_DANRE/305-422-------------------------------------------------------PTINQF....--LTQ......----
CCNA2_BOVIN/307-425-------------------------------------------------------PTINQF....--LTQ......----
CCNA2_CHICK/273-390-------------------------------------------------------PTINQF....--LTQ......----
M1KIP0_ENCCN/179-293-------------------------------------------------------VSPLNF....--LRK......----
Q6FVY0_CANGA/262-383-------------------------------------------------------PNPLNF....--LRR......----
A0A023ZJ88_YEASX/296-418-------------------------------------------------------PNPLNF....--LRR......----
A0A023ZMR1_YEASX/254-374-------------------------------------------------------PNPLNF....--IRR......----
CG21_SCHPO/294-409-------------------------------------------------------PGPMSF....--LRR......----
A0A023ZKJ3_YEASX/338-453-------------------------------------------------------PGPMPF....--LRR......----
Q6FNV2_CANGA/314-429-------------------------------------------------------PGPMSF....--LRR......----
Q6CT04_KLULA/317-432-------------------------------------------------------PGPMSF....--LRR......----
Q75A51_ASHGO/248-363-------------------------------------------------------PGPMSF....--LRR......----
Q6FQU1_CANGA/326-455-------------------------------------------------------PGPMSF....--LRR......----
A6ZXH4_YEAS7/299-414-------------------------------------------------------PGPMSF....--LRR......----
A7TR46_VANPO/331-446-------------------------------------------------------PGPMSF....--LRR......----
Q2HAS9_CHAGB/515-630-------------------------------------------------------PGPMSF....--LRR......----
F5HHN7_NEUCR/516-631-------------------------------------------------------PGPMSF....--LRR......----
Q0UCR8_PHANO/466-581-------------------------------------------------------PGPMSF....--LRR......----
A7F1V1_SCLS1/469-584-------------------------------------------------------PGPMSF....--LRR......----
A1C7V2_ASPCL/489-604-------------------------------------------------------PGPMSF....--LRK......----
Q6BGT2_DEBHA/350-465-------------------------------------------------------PGPMSF....--LRR......----
Q6CE22_YARLI/306-421-------------------------------------------------------PGPMSF....--LRR......----
Q49U21_CRYNE/355-469-------------------------------------------------------CSPYSW....--VRR......----
Q6X269_USTMD/465-579-------------------------------------------------------CSPYSW....--VRK......----
CG22_SCHPO/267-382-------------------------------------------------------PSPLNF....--LRK......----
A0A023ZMC4_YEASX/339-454-------------------------------------------------------ANPMNF....--LRR......----
Q75EI0_ASHGO/418-533-------------------------------------------------------PNPMNF....--LRR......----
Q6FVY1_CANGA/344-459-------------------------------------------------------PNPMNF....--LRR......----
A3LN44_PICST/322-438-------------------------------------------------------PNPMNF....--LRR......----
A5DUV2_LODEL/512-628-------------------------------------------------------PNPMNF....--LRR......----
Q6CEJ4_YARLI/393-508-------------------------------------------------------PNPMNF....--LRR......----
Q0UMA7_PHANO/348-462-------------------------------------------------------PNPMNF....--LRR......----
Q2HAK4_CHAGB/352-466-------------------------------------------------------PNPMNF....--LRR......----
A1CID9_ASPCL/361-475-------------------------------------------------------PNPMNF....--LRR......----
CG23_SCHPO/334-448-------------------------------------------------------PNPMNF....--LRR......----
O93916_PNECA/304-419-------------------------------------------------------PNPINF....--LRR......----
F5HE42_USTMA/433-547-------------------------------------------------------ANPMNF....--LRR......----
F5H8X2_CRYNB/366-482-------------------------------------------------------PNPLNF....--IRR......----
Q5SCB6_OSTTA/230-346-------------------------------------------------------PTPYCF....--LNR......----
CCB31_ARATH/274-391-------------------------------------------------------PTPYVF....--MLR......----
Q9ZRG1_PEA/135-252-------------------------------------------------------PTPYVF....--MVR......----
CCB21_ARATH/302-419-------------------------------------------------------PTQYPF....--LKR......----
CCB22_ARATH/303-421-------------------------------------------------------PTQYPF....--LKR......----
Q9XGI1_SOLLC/308-425-------------------------------------------------------PTAYVF....--MRR......----
CCNB2_MEDSA/201-318-------------------------------------------------------PTAYVF....--MRR......----
CCB23_ARATH/308-425-------------------------------------------------------PTPYVF....--MKR......----
CCB24_ARATH/309-426-------------------------------------------------------PTPYVF....--MRR......----
Q2WGP0_ALLCE/280-397-------------------------------------------------------PTPFVF....--LRR......----
B8AT55_ORYSI/285-402-------------------------------------------------------PTPYVF....--MRR......----
CCB22_ORYSI/293-410-------------------------------------------------------PTPYCF....--MRR......----
Q41734_MAIZE/282-407-------------------------------------------------------PTVYMF....--LVR......----
P93646_MAIZE/356-473-------------------------------------------------------PTMYMF....--IVR......----
CCB13_ORYSJ/341-458-------------------------------------------------------PTMYMF....--ILR......----
O65064_PICMA/98-215-------------------------------------------------------PTPYVF....--LVR......----
Q41733_MAIZE/317-437-------------------------------------------------------PTPYHF....--LLR......----
CCB14_ARATH/260-379-------------------------------------------------------PTPYVF....--LAR......----
CCB11_ARATH/295-418-------------------------------------------------------PTHYVF....--LAR......----
P93102_OXYRB/319-438-------------------------------------------------------PTPYMF....--LTR......----
Q2WGP2_ALLCE/358-475-------------------------------------------------------PTPYVF....--LVR......----
CCB12_ARATH/312-429-------------------------------------------------------PTQYVF....--LVR......----
CCB13_ARATH/289-406-------------------------------------------------------PTQYVF....--LVR......----
A5AEK5_VITVI/324-442-------------------------------------------------------PTPYVF....--LVR......----
O04398_TOBAC/319-436-------------------------------------------------------PTPYVF....--LVR......----
Q40516_TOBAC/291-408-------------------------------------------------------PTPYVF....--LAR......----
O82137_PEA/102-224-------------------------------------------------------PTPFVF....--LVR......----
O82717_LUPLU/324-441-------------------------------------------------------PTTFVF....--LTR......----
P93557_SESRO/318-435-------------------------------------------------------PTPFVF....--LVR......----
O04389_CATRO/313-431-------------------------------------------------------PTPYVF....--LVR......----
Q2PHK8_DAUCA/314-432-------------------------------------------------------PTPYVF....--LVR......----
Q2PHK9_DAUCA/330-448-------------------------------------------------------PTPYVF....--LVR......----
Q9LKC6_CICAR/324-443-------------------------------------------------------PTPYVF....--LVR......----
CCN2_ANTMA/319-438-------------------------------------------------------PTPYVF....--LVR......----
Q5D894_GOSHI/87-204-------------------------------------------------------PTHYVF....--LAR......----
Q40223_LUPLU/307-426-------------------------------------------------------PTTYVF....--LVR......----
Q39880_SOYBN/313-433-------------------------------------------------------PTPYHF....--LVR......----
Q2PHL0_DAUCA/311-430-------------------------------------------------------PTPYVF....--LVR......----
Q2ABE9_CAMSI/308-433-------------------------------------------------------PTPYVF....--LVR......----
Q9SBQ4_PETHY/303-423-------------------------------------------------------PTPYVF....--LVR......----
Q9XGI2_SOLLC/248-367-------------------------------------------------------PTPYVF....--LVR......----
Q5D8P0_SCHJA/269-392-------------------------------------------------------PTPLVF....--LRR......----
CCNB_DICDI/316-434-------------------------------------------------------ATPLHF....--LRR......----
P92162_BOMMO/389-509-------------------------------------------------------PIPLSF....--LRR......----
Q4TVR6_HELTR/235-352-------------------------------------------------------PLPIHF....--LRR......----
A7SPG5_NEMVE/166-283-------------------------------------------------------PLCLHF....--LRR......----
Q4T0M3_TETNG/224-342-------------------------------------------------------PLPLQF....--LRR......----
CCNB1_ANGJA/272-390-------------------------------------------------------PLPLQF....--LRR......----
CCNB1_CARAU/266-384-------------------------------------------------------PLPLQF....--LRR......----
CCNB1_CRIGR/296-414-------------------------------------------------------PLPLHF....--LRR......----
Q6P801_XENTR/266-384-------------------------------------------------------PLPLHF....--LRR......----
O93228_RANJA/239-357-------------------------------------------------------PLPLHF....--LRR......----
Q6IR86_XENLA/262-380-------------------------------------------------------PLPLHF....--LRR......----
Q7ZVA8_DANRE/252-370-------------------------------------------------------PLPLHF....--LRR......----
Q09IZ1_ONCMY/251-369-------------------------------------------------------PLPLHF....--LRR......----
CCNB2_ORYLA/254-372-------------------------------------------------------PLPLHF....--LRR......----
Q28GP5_XENTR/256-374-------------------------------------------------------PLPLNF....--LRR......----
Q6T2E9_BUFGR/263-381-------------------------------------------------------PLPLHF....--LRR......----
CCNB2_CHICK/268-386-------------------------------------------------------PLPLHF....--LRR......----
Q7Z4Z4_HUMAN/264-382-------------------------------------------------------PLPLHF....--LRR......----
CCNB_MARGL/258-375-------------------------------------------------------PLCIHF....--LRR......----
CCNB_PATPE/272-390-------------------------------------------------------PLCIHF....--LRR......----
Q95WE6_PATPE/274-391-------------------------------------------------------PLCIHF....--LRR......----
Q5UAU8_PENJP/269-385-------------------------------------------------------PLPLHF....--LRR......----
CCNB_SPISO/299-415-------------------------------------------------------PLCLHF....--LRR......----
CCNB_PATVU/282-398-------------------------------------------------------PLCLHF....--LRR......----
CCNB_HYDVD/264-380-------------------------------------------------------PLCLHF....--LRR......----
CCNB_ARBPU/274-395-------------------------------------------------------PLCLHF....--LRR......----
Q94740_SPHGR/281-401-------------------------------------------------------PLCLHF....--LRR......----
Q291N4_DROPS/375-501-------------------------------------------------------PLPIHF....--LRR......----
Q16TY2_AEDAE/355-477-------------------------------------------------------PLPTHF....--LRR......----
Q7PPJ1_ANOGA/320-449-------------------------------------------------------PLPTHF....--LRR......----

PF00134

CCNA2_MOUSE/171-297-------------------------------VGYMK.RQP.---------------------------------------
CCNB3_CAEEL/115-241-------------------------------.KYLH.KHP.---------------------------------------
CCNF_MOUSE/281-406-------------------------------QIFSV.QKG.---------------------------------------
CCT12_ARATH/28-169-------------------------------SRRDG.IDL.---------------------------------------
CCNE_CAEEL/232-360-------------------------------RFLLG.NHP.---------------------------------------
REM1_SCHPO/145-271-------------------------------YRHMS.AQP.---------------------------------------
O45926_CAEEL/34-159-------------------------------DSFIN.GGN.---------------------------------------
CCB14_ARATH/133-258-------------------------------.DYIG.SQP.---------------------------------------
CCU41_ARATH/22-148-------------------------------QRVSV.FHGL---------------------------------------
CCNB2_HUMAN/137-262-------------------------------PHFLD.GRD.---------------------------------------
CCNT_DROME/42-176-------------------------------SRRCG.IKG.---------------------------------------
CG23_SCHPO/206-332-------------------------------PTYMD.RQK.---------------------------------------
CCNA_DROME/206-332-------------------------------KPLYM.RR.Q---------------------------------------
CG12_YEAST/43-195-------------------------------PKLID.QQP.---------------------------------------
CCNB_DROME/260-387-------------------------------KDHLA.GQK.---------------------------------------
CCNB1_MOUSE/170-295-------------------------------PKYLQ.GRE.---------------------------------------
CG21_SCHPO/166-292-------------------------------PNYMS.VQQ.---------------------------------------
PCL1_YEAST/19-152-------------------------------SNYPT.PPGS---------------------------------------
CG21_YEAST/212-337-------------------------------KANLY.KHK.---------------------------------------
CG22_YEAST/232-357-------------------------------KEDLY.QHR.---------------------------------------
CG23_YEAST/171-297-------------------------------PYYMD.KQP.---------------------------------------
CG24_YEAST/210-336-------------------------------PYYMQ.NQV.---------------------------------------
PUC1_SCHPO/99-227-------------------------------HLSNQ.QPE.---------------------------------------
CCNB1_SOYBN/197-322-------------------------------.DYIG.SQP.---------------------------------------
PCL2_YEAST/18-146-------------------------------TNSMI.DIAL---------------------------------------
CCNB2_CHICK/141-266-------------------------------PHYLD.GKT.---------------------------------------
CCB11_ARATH/168-293-------------------------------.DYMA.SQP.---------------------------------------
CCND2_MOUSE/24-151-------------------------------YFKCV.QKD.---------------------------------------
CCND3_HUMAN/26-153-------------------------------YFQCV.QRE.---------------------------------------
CGS5_YEAST/165-294-------------------------------HNYLL.DKTS---------------------------------------
CG21_EMENI/211-337-------------------------------PDYID.HQP.---------------------------------------
CGS6_YEAST/123-252-------------------------------HNYLM.DTQS---------------------------------------
CCNA1_CAEEL/215-341-------------------------------HECFD.IQS.---------------------------------------
CG22_SCHPO/139-265-------------------------------PKYMD.QQK.---------------------------------------
CCND1_RAT/26-153-------------------------------YFKCV.QRE.---------------------------------------
CCNB3_CHICK/149-274-------------------------------PDYME.KQS.---------------------------------------
CCNB_DICDI/188-314-------------------------------KDYIK.NQY.---------------------------------------
CCD11_ARATH/50-182-------------------------------HDYLS.RFQT---------------------------------------
CCD21_ARATH/65-197-------------------------------TDYVK.RLLS---------------------------------------
SSN8_YEAST/45-176-------------------------------HRDLH.....---------------------------------------
CCNE1_CHICK/112-239-------------------------------KLYMQ.RHP.---------------------------------------
CCNE_DROME/330-459-------------------------------ISMLE.QHP.---------------------------------------
CCNA1_HUMAN/214-340-------------------------------KAHYM.KK.Q---------------------------------------
P92162_BOMMO/260-387-------------------------------PDHLK.KQT.---------------------------------------
CCC11_ORYSJ/4-144-------------------------------KVPQADSDRG---------------------------------------
CGH2_SHV21/22-148-------------------------------SLWEI.QTE.---------------------------------------
CCNB1_CAEEL/81-206-------------------------------ECFME.GGE.---------------------------------------
PCL9_YEAST/19-146-------------------------------NNNPI.QGCR---------------------------------------
CCA22_ARATH/175-302-------------------------------ANYMELVQR.---------------------------------------
CCB12_ARATH/185-310-------------------------------KMYMH.IQT.---------------------------------------
CCB21_ARATH/174-300-------------------------------VDYMM.QQI.---------------------------------------
Q39878_SOYBN/207-334-------------------------------LTNYM.DKLQ---------------------------------------
CCNE1_MOUSE/113-240-------------------------------EHFLQ.RHP.---------------------------------------
CCB21_ORYSJ/157-283-------------------------------PDYMS.SQG.---------------------------------------
CCD41_ARATH/45-178-------------------------------DDYIK.RLRS---------------------------------------
CCNB3_DROME/308-433-------------------------------ADYMP.RQI.---------------------------------------
Q9S7H9_SOLLC/61-190-------------------------------LGFQS..LIS---------------------------------------
CCB31_ARATH/146-272-------------------------------GHYLS.AHA.---------------------------------------
CCB24_ARATH/180-307-------------------------------PNYME.NQH.---------------------------------------
Q9SMD4_SOLLC/51-182-------------------------------ISYN...VLE---------------------------------------
CCD33_ARATH/59-186-------------------------------CLYDE..ILD---------------------------------------
Q9U2M5_CAEEL/72-201-------------------------------YHYFTGVQE.---------------------------------------
Q9VE72_DROME/6-144-------------------------------MKPID.....---------------------------------------
Q9VKF0_DROME/205-327-------------------------------DNYDT.....---------------------------------------
Q9VZP3_DROME/42-165-------------------------------LFYLS.....---------------------------------------
Q9XGI1_SOLLC/180-306-------------------------------PYYMA.QQA.---------------------------------------
CCNE2_MOUSE/112-239-------------------------------KHFQV.LHS.---------------------------------------
CCD61_ARATH/26-154-------------------------------SHYFHSLKS.---------------------------------------
A0BXX7_PARTE/85-212-------------------------------QYMTPEQQP.---------------------------------------
A9UMS1_XENTR/114-240-------------------------------KNFFQ.KHP.---------------------------------------
B4FZZ7_MAIZE/193-318-------------------------------CDYID.TQV.---------------------------------------
B8A2G9_MAIZE/228-354-------------------------------SSYMS.SQA.---------------------------------------
C4J9B6_MAIZE/173-299-------------------------------TNYMS.SQT.---------------------------------------
E9QJ66_DANRE/140-266-------------------------------PGYMR.KQP.---------------------------------------
F1QBQ7_DANRE/117-243-------------------------------TRVME.RHP.---------------------------------------
F6QF79_XENTR/139-263-------------------------------QNYLH.GQE.---------------------------------------
F6QGW4_XENTR/133-257-------------------------------PCYLE.GKE.---------------------------------------
I1K835_SOYBN/85-213-------------------------------VDYIE.KVQ.---------------------------------------
I1M770_SOYBN/186-311-------------------------------HDYMG.SQP.---------------------------------------
J3KY10_ORYBR/200-327-------------------------------TDFMETIQK.---------------------------------------
K7V0X7_MAIZE/191-316-------------------------------IDYMG.NQP.---------------------------------------
M1A5P4_SOLTU/185-310-------------------------------CDYMD.SQP.---------------------------------------
M4E4A3_BRARP/154-281-------------------------------VDYMATVQK.---------------------------------------
M7PCR8_PNEMU/176-302-------------------------------PDYMD.RQK.---------------------------------------
CG11_CANAL/44-171-------------------------------PAMID.LQP.---------------------------------------
CG24_CANAL/234-359-------------------------------PNYMD.FQD.---------------------------------------
CG13_CANAL/44-171-------------------------------LSLIE.QQP.---------------------------------------
CG21_CANAL/208-334-------------------------------PQYLF.KQT.---------------------------------------
Q6BFS2_PARTE/82-209-------------------------------NNYMN.EQQQ---------------------------------------
VCYCL_HHV8P/21-146-------------------------------SVFGT.FQQ.---------------------------------------
Q7KUZ5_DROME/153-280-------------------------------DTYFS.IQK.---------------------------------------
T1EGC7_HELRO/166-290-------------------------------ANYME.RQS.---------------------------------------
T1FNQ9_HELRO/256-380-------------------------------PDYMF.QQT.---------------------------------------
W4XEA0_STRPU/126-253-------------------------------HDCLK.SHP.---------------------------------------
W4XJF2_STRPU/207-332-------------------------------HGYMR.KQP.---------------------------------------

PF08613

PHO80_YEAST/33-170-------------------------------ENSATKKSDD---------------------------------------
PSL1_SCHPO/29-176-------------------------------DSKQEATESD---------------------------------------
PCL7_YEAST/108-264-------------------------------DETTDVSQQV---------------------------------------
Q1K4U8_NEUCR/157-314-------------------------------PPPGLSSSDA---------------------------------------
Q389J6_TRYB2/370-620-------------------------------SGTACASAHS---------------------------------------
Q6H3X9_ORYSJ/18-159-------------------------------DAAATPAELA---------------------------------------

PF01858

K1Q8Z2_CRAGI/498-695-------------------------------DDLLDILS.E---------------------------------------
K3WCJ4_PYTUL/615-824-------------------------------PQLKMFFK.D---------------------------------------
E9IWV1_SOLIN/372-568-------------------------------ESLLQMLN.N---------------------------------------
A9UZQ5_MONBE/439-632-------------------------------FELAKCFY.E---------------------------------------
E9GV66_DAPPU/393-588-------------------------------EELRRIFS.E---------------------------------------
RBR_RICCO/415-616-------------------------------PQLERFLA.S---------------------------------------
Q54FX2_DICDI/628-829-------------------------------LNLINILK.S---------------------------------------
F6VRH0_XENTR/413-608-------------------------------ERLLQMLR.S---------------------------------------
V8P9V1_OPHHA/376-569-------------------------------EQLVAIFE.S---------------------------------------
G0NPV8_CAEBE/426-611-------------------------------SKLKTECE.R---------------------------------------
H0ZAT2_TAEGU/371-563-------------------------------ENLEQILR.S---------------------------------------
B0XDW3_CULQU/318-505-------------------------------GSLRELLK.S---------------------------------------
F6W3I3_CIOIN/403-597-------------------------------EKLAAIFR.E---------------------------------------
F7CLV0_MACMU/99-291-------------------------------DQLTNIFE.S---------------------------------------
I3KPC6_ORENI/402-595-------------------------------AKLAETLR.S---------------------------------------
K7GZK7_CAEJA/310-501-------------------------------SQLTKVCE.Q---------------------------------------
F1NAY3_CHICK/355-559-------------------------------DTLIAYFN.N---------------------------------------
T1K8P0_TETUR/388-595-------------------------------PGLVEIFA.Q---------------------------------------
RBL1_MOUSE/385-578-------------------------------EQLLNIFE.S---------------------------------------
Q7Q5E8_ANOGA/392-578-------------------------------GTFLTLMK.N---------------------------------------
T1HVA1_RHOPR/31-215-------------------------------EYFIGIIK.L---------------------------------------
T1J484_STRMM/388-582-------------------------------DLLLEIFK.S---------------------------------------
D7SVF2_VITVI/28-221-------------------------------AELERFMS.S---------------------------------------
W5MKN5_LEPOC/394-587-------------------------------EQLLQIFR.S---------------------------------------
G1KBZ3_ANOCA/346-550-------------------------------DNLISYFN.N---------------------------------------
B4M2G6_DROVI/370-550-------------------------------D....FVK.Q---------------------------------------
B7PDQ5_IXOSC/377-572-------------------------------KELLTWFG.E---------------------------------------
Q00U21_OSTTA/382-585-------------------------------AELRRFVP..---------------------------------------
D8RMF7_SELML/305-502-------------------------------TELLEYLR.S---------------------------------------
F7AL78_CALJA/395-595-------------------------------ENLISYFN.N---------------------------------------
A4S8I4_OSTLU/409-616-------------------------------AELQRFVP..---------------------------------------
RBF_DROME/376-560-------------------------------D....FVK.Q---------------------------------------
H2UU61_TAKRU/351-546-------------------------------TNLATYFK.N---------------------------------------
F5H837_HUMAN/343-535-------------------------------EKLEQILR.T---------------------------------------
F6RJP6_XENTR/389-579-------------------------------EQLIEVFK.S---------------------------------------
A8NFV3_BRUMA/385-584-------------------------------AEVESILC.H---------------------------------------
F6YCW6_XENTR/1-199-------------------------------DKLNSYFN.N---------------------------------------
W5MK11_LEPOC/379-572-------------------------------AKLAQALR.S---------------------------------------
G7Y3X8_CLOSI/355-571-------------------------------EALVDLVESH---------------------------------------
E7FDM3_DANRE/375-568-------------------------------VKLRDIFR.S---------------------------------------
A9SLF5_PHYPA/390-586-------------------------------EELQLFFR.S---------------------------------------
K7J2L5_NASVI/382-576-------------------------------EKLLEMFK.N---------------------------------------
M4AMR4_XIPMA/258-452-------------------------------TTLTTYFK.N---------------------------------------
H9KR58_APIME/415-607-------------------------------ENLLQILN.N---------------------------------------
W5JE43_ANODA/403-588-------------------------------DSFLNLLK.S---------------------------------------
W4Y895_STRPU/330-534-------------------------------NVLCSYFE.G---------------------------------------
A7RQ05_NEMVE/385-582-------------------------------ERLLTIFK.E---------------------------------------
C3XU15_BRAFL/375-568-------------------------------DNLTKLFS.E---------------------------------------
H2YMF2_CIOSA/346-540-------------------------------DKLSAIFK.D---------------------------------------
F1Q9D6_DANRE/359-569-------------------------------SNLLVYYK.N---------------------------------------
H9IXG6_BOMMO/327-522-------------------------------PTLLRLFT.E---------------------------------------
B4JJ99_DROGR/374-552-------------------------------E....FVK.Q---------------------------------------
F4QEM9_DICFS/396-587-------------------------------QDLKDLVK.D---------------------------------------
A8HY72_CHLRE/423-626-------------------------------PTLQRFLA.A---------------------------------------
W5LEH3_ASTMX/376-569-------------------------------LRLREILK.A---------------------------------------
Q231Q1_TETTS/575-761-------------------------------KKIEELMN.K---------------------------------------
B4L4P7_DROMO/352-536-------------------------------D....FVKRQ---------------------------------------
H3AQ36_LATCH/393-584-------------------------------EQLLSIFK.S---------------------------------------
W5MR28_LEPOC/371-573-------------------------------ENLVKYFS.N---------------------------------------
X1WJD7_ACYPI/378-569-------------------------------DKLYTLLK.S---------------------------------------
E4WSX2_OIKDI/375-564-------------------------------ASLMSLLA.S---------------------------------------
RBR1_ORYSJ/419-619-------------------------------GELLRFFS.A---------------------------------------
M4B693_HYAAE/488-711-------------------------------PQLHRLFT.D---------------------------------------
H2MXX9_ORYLA/384-576-------------------------------ENLMQIFR.T---------------------------------------
RBR1_MAIZE/275-476-------------------------------SKLQQFLS.S---------------------------------------
H3A0E3_LATCH/386-579-------------------------------EKLLQLFR.A---------------------------------------
B3S6M6_TRIAD/378-570-------------------------------NKLLAIFG.D---------------------------------------
W5KDE3_ASTMX/254-459-------------------------------GNLIVYFK.N---------------------------------------
H9GN70_ANOCA/432-623-------------------------------ENLEQIFR.S---------------------------------------
M0T571_MUSAM/407-609-------------------------------AELEHFLT.S---------------------------------------
E1ZEA5_CHLVA/159-357-------------------------------PQLRALMQ.A---------------------------------------
D0NTP5_PHYIT/460-683-------------------------------PQLRRFFS.D---------------------------------------
U6HGS1_ECHMU/397-581-------------------------------ETLAEFIRST---------------------------------------
K1PLH3_CRAGI/285-489-------------------------------PDLLVHFK.N---------------------------------------
E0VGB1_PEDHC/321-507-------------------------------EKLYEIYA.T---------------------------------------
U1NNI7_ASCSU/382-582-------------------------------EELERIMS.Q---------------------------------------
B9RGU7_RICCO/60-252-------------------------------AELERMLGIH---------------------------------------
D2VQU0_NAEGR/217-404-------------------------------ETLLGYFK.S---------------------------------------
W5KQG9_ASTMX/387-580-------------------------------DALLQIFS.S---------------------------------------

PF03261

Q9V3H5_DROME/91-460CANLPTACFKAQLLESSFASS......SDK.NRNIQLHCNR................................IDEHNQQ
W4XFC8_STRPU/11-372......TGVSTTSLDTNFNSSKQSLTGSDKANNNVLKPKNH....................................SNQ
B4NP59_DROWI/88-420CANLPTACFKAQLLESSYTAS......SDR.NKNIQFHCNR................................IDGHQQQ
G0MEC3_CAEBE/11-362...........................SGSSSVFQKQHHRNPVIVLFLSLEMLGLLLPVNMGKYQYHLTGIIIIS.....
B4MG57_DROVI/90-432CANLPTTCFKTQLLEASYTSS......SDK.NKNIQLHCNH................................IEEHQHQ
Q0G843_CAEEL/11-364...........................SGSSSEATSSKSSDSLVSFTR...........NVSTSTSSQYGKISISLDRNQ
I3JGY3_ORENI/11-321LQSDSGDGGKGSSPDGHAAAT......TNSASNSLKLKKSQ.......................................
B4G7J4_DROPE/90-428CANLPTACFKSQFLESTFASS......SDK.NRNIQLQCNR................................IEEHNQP
E0VX77_PEDHC/62-395NLTI....FRQPLLDNIH.PI......VDK.NKNIHKSTSIPCYYPCLTVSKTVP.SLSNPE....ELDGHVDINLRSNN
Q17C39_AEDAE/119-480SANLGSATFRTPLTDTIH.PM......VDK.NKNLQQSQSF...........TQPISHSNQQLQQIQSQQPAAIQLQQQQ
H2VTT9_CAEJA/11-389...........................SSNMSEATSSKSSNSLVSFTC...........NASTFTTKQSEKTTVSLDKNQ

PF01857

E3LY90_CAERE/724-863-------------------------------TYFTAARR-----------------------------------------
C3XU15_BRAFL/762-922-------------------------------VYHLASVR-----------------------------------------
D6WUA4_TRICA/623-757-------------------------------FYNLSGER-----------------------------------------
I7M8B4_TETTS/589-711-------------------------------VLHQCAYT-----------------------------------------
W5LEH3_ASTMX/770-953-------------------------------VYHLASVR-----------------------------------------
W5KQG9_ASTMX/775-930-------------------------------VYHLASVR-----------------------------------------
Q00U21_OSTTA/709-837-------------------------------VMQLAARR-----------------------------------------
K7J2L5_NASVI/706-866-------------------------------FYNLTITR-----------------------------------------
G3NYF0_GASAC/762-926-------------------------------VYHLASVR-----------------------------------------
E9GV66_DAPPU/739-928-------------------------------FYHLASVR-----------------------------------------
K7V2N7_MAIZE/595-720-------------------------------ILKLAAIR-----------------------------------------
B4MSL7_DROWI/606-728-------------------------------VYLLGWLR-----------------------------------------
B9RGU7_RICCO/363-485-------------------------------MAKLGAIR-----------------------------------------
H3AQ36_LATCH/797-959-------------------------------VYHLASVR-----------------------------------------
M4B693_HYAAE/750-894-------------------------------VFTCAASR-----------------------------------------
K3YG32_SETIT/683-811-------------------------------IAKLAAIR-----------------------------------------
RBR_POPTR/755-884-------------------------------INKLAAVR-----------------------------------------
F2UP70_SALR5/745-900-------------------------------FYDAMLKR-----------------------------------------
E9CHS1_CAPO3/877-1004-------------------------------VYALGYMR-----------------------------------------
F1QY31_DANRE/771-933-------------------------------VYHLASVR-----------------------------------------
H9KR58_APIME/635-797-------------------------------FYNLASVR-----------------------------------------
Q17Q73_AEDAE/556-680-------------------------------YYATAALR-----------------------------------------
H3C722_TETNG/743-911-------------------------------VYHLASVR-----------------------------------------
D2VQU0_NAEGR/452-591-------------------------------MYKLVSRR-----------------------------------------
A9SLF5_PHYPA/706-835-------------------------------ALVLAGVR-----------------------------------------
M0T571_MUSAM/727-855-------------------------------ILKLAAIR-----------------------------------------
K7GZK7_CAEJA/561-706-------------------------------TLFTGARR-----------------------------------------
Q54FX2_DICDI/890-1042-------------------------------VSTLIIAK-----------------------------------------
B3S6M6_TRIAD/657-840-------------------------------FYYLASVR-----------------------------------------
D7SVF2_VITVI/331-459-------------------------------VAKLAAVR-----------------------------------------
H2P1U6_PONAB/787-943-------------------------------VYHLASVR-----------------------------------------
RBL2_MOUSE/831-1011-------------------------------VYYLAGVR-----------------------------------------
G5EDT1_CAEEL/744-889-------------------------------TYFTAARR-----------------------------------------
E7FDM3_DANRE/770-952-------------------------------VYHLASVR-----------------------------------------
RBF_DROME/581-705-------------------------------VYLLGWLR-----------------------------------------
U1NNI7_ASCSU/660-828-------------------------------VYYLAAVR-----------------------------------------
G1KFZ9_ANOCA/784-927-------------------------------VYHLASVR-----------------------------------------
W5MK11_LEPOC/790-976-------------------------------VYHLASVR-----------------------------------------
J0XFZ4_LOALO/562-724-------------------------------VYYLAAVR-----------------------------------------
T1J484_STRMM/718-944-------------------------------FYYLASVR-----------------------------------------
I3KPC6_ORENI/788-976-------------------------------VYHLASVR-----------------------------------------
D7SU46_VITVI/726-854-------------------------------IIKLAAVR-----------------------------------------
W4ZBT1_STRPU/363-541-------------------------------VYHLMNVR-----------------------------------------
T1K8P0_TETUR/710-889-------------------------------VYHLAWLR-----------------------------------------
A7RQ05_NEMVE/790-960-------------------------------VYHMASVR-----------------------------------------
D7G8E5_ECTSI/865-1014-------------------------------LMKRAAEV-----------------------------------------
H9GN70_ANOCA/847-1031-------------------------------VFHLASVR-----------------------------------------
F6RJP6_XENTR/770-927-------------------------------VYHLASVR-----------------------------------------
G3N416_GASAC/775-935-------------------------------VYHLASVR-----------------------------------------
I3JCL2_ORENI/775-933-------------------------------VYHLASVR-----------------------------------------
H2U458_TAKRU/718-908-------------------------------LYHMASVR-----------------------------------------
B4M2G6_DROVI/571-694-------------------------------VYLLGWLR-----------------------------------------
G4VM99_SCHMA/814-941-------------------------------TYQVASLR-----------------------------------------
H3A0E3_LATCH/805-987-------------------------------VYHLASVR-----------------------------------------
B0XDW3_CULQU/653-812-------------------------------FYGVAAVR-----------------------------------------
W5JE43_ANODA/665-839-------------------------------VYVVAYAR-----------------------------------------
T1HVA1_RHOPR/343-480-------------------------------FYQLASVR-----------------------------------------
A8HY72_CHLRE/818-944-------------------------------VLKLTSFR-----------------------------------------
K3WCJ4_PYTUL/862-1000-------------------------------VLSLAASR-----------------------------------------
F4X6S3_ACREC/751-913-------------------------------FYNLACVR-----------------------------------------
B7PDQ5_IXOSC/761-937-------------------------------VYHLSAVR-----------------------------------------
H2SIQ5_TAKRU/775-930-------------------------------VYHLASVR-----------------------------------------
T1FJQ6_HELRO/776-947-------------------------------VYYLASTR-----------------------------------------
E0VGB1_PEDHC/551-709-------------------------------FYSLSSVR-----------------------------------------
A8WW47_CAEBR/737-882-------------------------------TYFTAARR-----------------------------------------
E1ZEA5_CHLVA/548-700-------------------------------VLKLAAIR-----------------------------------------
M3ZR51_XIPMA/555-736-------------------------------VYHMASVR-----------------------------------------
U3I0V9_ANAPL/751-937-------------------------------VYHLASVR-----------------------------------------
I1ILE9_BRADI/604-729-------------------------------ILKLAAIR-----------------------------------------
B7G0K4_PHATC/972-1099-------------------------------ILKISFHR-----------------------------------------
V8P9V1_OPHHA/768-918-------------------------------VYNLASVR-----------------------------------------
RBR1_ARATH/729-857-------------------------------INKLAAVR-----------------------------------------
G0NPV8_CAEBE/665-810-------------------------------VYFTAASR-----------------------------------------
H3D2K2_TETNG/626-748-------------------------------LYRLAYTR-----------------------------------------
Q7Q5E8_ANOGA/609-787-------------------------------MYQVAYDR-----------------------------------------
G1NXF3_MYOLU/774-956-------------------------------VYHLASVR-----------------------------------------
A0DTJ1_PARTE/585-706-------------------------------VLHYCAFQ-----------------------------------------
C5YE98_SORBI/68-193-------------------------------ILKLAAVR-----------------------------------------
U3KDL0_FICAL/672-832-------------------------------VYHLASVR-----------------------------------------
U6HGS1_ECHMU/721-876-------------------------------VYHLAASR-----------------------------------------
C1N5Z8_MICPC/1035-1166-------------------------------VMRLSARR-----------------------------------------
F6W3I3_CIOIN/825-983-------------------------------VYHLASVR-----------------------------------------
D0NTP5_PHYIT/716-846-------------------------------VLSRAASR-----------------------------------------
W1PFC3_AMBTC/737-865-------------------------------VLKLAAIR-----------------------------------------
W5MKN5_LEPOC/789-946-------------------------------VYHLASVR-----------------------------------------
F6VRH0_XENTR/812-995-------------------------------VRHKASIR-----------------------------------------
G7Y3X8_CLOSI/746-873-------------------------------FYRVASAR-----------------------------------------
E4WSX2_OIKDI/638-762-------------------------------IYLLVTRR-----------------------------------------
G3WX03_SARHA/792-946-------------------------------VYHLASVR-----------------------------------------
D8U756_VOLCA/780-909-------------------------------VLKLAAFR-----------------------------------------
M4AJJ3_XIPMA/767-924-------------------------------VYHLSSVR-----------------------------------------
H2NQW4_PONAB/835-1018-------------------------------VYHLAAVR-----------------------------------------
U6I670_HYMMI/714-860-------------------------------VYHLAASR-----------------------------------------
E2AA07_CAMFO/750-912-------------------------------FYNLACVR-----------------------------------------
H2YMF2_CIOSA/739-893-------------------------------VYHLASVR-----------------------------------------
A4S8I4_OSTLU/745-874-------------------------------VMHLAARR-----------------------------------------

PF00382

TF3B_KLULA/193-266--------------------------------------------------------------------------------
TF2B_KLULA/137-207--------------------------------------------------------------------------------
TF2B_YEAST/133-203--------------------------------------------------------------------------------
TF3B_CANAL/95-165--------------------------------------------------------------------------------
TF2B_DROME/214-284--------------------------------------------------------------------------------
TF3B_KLULA/98-168--------------------------------------------------------------------------------
TF3B_CANAL/190-263--------------------------------------------------------------------------------
TF2B_DROME/120-190--------------------------------------------------------------------------------
TF2B_KLULA/245-315--------------------------------------------------------------------------------
TF2B_PYRFU/212-282--------------------------------------------------------------------------------
Q5V5V1_HALMA/235-305--------------------------------------------------------------------------------

PF16899

CCNH_ECHMU/168-289----------------------------------L--LV-----------------------------------------
D2VN70_NAEGR/180-268----------------------------------Y--VH-----------------------------------------
H3FVF7_PRIPA/67-164----------------------------------L--FQ-----------------------------------------
G6D7P5_DANPL/155-246----------------------------------F--VQ-----------------------------------------
C5DE24_LACTC/194-313----------------------------------F--FL-----------------------------------------
H2B1R1_KAZAF/202-304----------------------------------F--FL-----------------------------------------
C5DYH4_ZYGRC/193-303----------------------------------F--FL-----------------------------------------
Q6FMU5_CANGA/203-302----------------------------------F--FL-----------------------------------------
G0V973_NAUCC/221-326----------------------------------F--FL-----------------------------------------
G0W3A8_NAUDC/222-335----------------------------------F--FL-----------------------------------------
G2YRH2_BOTF4/184-304----------------------------------A--IM-----------------------------------------
R7YVJ7_CONA1/187-325----------------------------------A--YI-----------------------------------------
C9SVU8_VERA1/162-263----------------------------------T--IL-----------------------------------------
L2FZZ6_COLGN/165-276----------------------------------A--IL-----------------------------------------
H1VJI3_COLHI/166-278----------------------------------A--IL-----------------------------------------
M7TNJ7_EUTLA/145-243----------------------------------A--IM-----------------------------------------
G3JT19_CORMM/158-261----------------------------------A--IL-----------------------------------------
G9NI52_HYPAI/158-265----------------------------------A--IL-----------------------------------------
F9F5Z4_FUSOF/158-263----------------------------------A--IL-----------------------------------------
L8GA30_PSED2/187-302----------------------------------A--AM-----------------------------------------
K1X5Y0_MARBU/178-294----------------------------------A--VM-----------------------------------------
N1JHL3_BLUG1/188-305----------------------------------A--IM-----------------------------------------
H6C5Z8_EXODN/187-301----------------------------------G--HI-----------------------------------------
R1EFE2_BOTPV/206-348----------------------------------G--HM-----------------------------------------
Q0UGP0_PHANO/193-328----------------------------------G--HL-----------------------------------------
E5AC16_LEPMJ/211-344----------------------------------V--HL-----------------------------------------
R0KJU5_SETT2/173-306----------------------------------G--HM-----------------------------------------
M3AYY7_MYCFI/177-276----------------------------------T--LM-----------------------------------------
N1QKL6_SPHMS/175-275----------------------------------A--LM-----------------------------------------
F9XH99_MYCGM/164-291----------------------------------V--LM-----------------------------------------
M2MZH1_BAUCO/171-314----------------------------------V--LM-----------------------------------------
M2YNC7_MYCP1/165-265----------------------------------V--LM-----------------------------------------
B6Q284_PENMQ/191-333----------------------------------G--IM-----------------------------------------
G3Y4C9_ASPNA/188-330----------------------------------G--IM-----------------------------------------
B0Y3L0_ASPFC/188-332----------------------------------G--VM-----------------------------------------
Q5BB69_EMENI/189-333----------------------------------G--IM-----------------------------------------
G7E2H9_MIXOS/177-279----------------------------------L--SL-----------------------------------------
F8NWE7_SERL9/187-291----------------------------------I--WL-----------------------------------------
D8PKL8_SCHCM/182-281----------------------------------I--WL-----------------------------------------
K9HXY7_AGABB/176-275----------------------------------I--WL-----------------------------------------
J4HVQ4_FIBRA/73-167----------------------------------I--WL-----------------------------------------
E9C7X0_CAPO3/152-254----------------------------------F--FY-----------------------------------------
E3M1M6_CAERE/158-270----------------------------------H--LM-----------------------------------------
A7S801_NEMVE/159-255----------------------------------F--LI-----------------------------------------
C3ZT09_BRAFL/159-259----------------------------------L--LI-----------------------------------------
I1FML6_AMPQE/158-255----------------------------------F--LI-----------------------------------------
E4YFZ2_OIKDI/97-198----------------------------------F--LI-----------------------------------------
G3U0L9_LOXAF/162-261----------------------------------F--LI-----------------------------------------
G1N872_MELGA/126-226----------------------------------I--LI-----------------------------------------
G3UI14_LOXAF/162-261----------------------------------F--LI-----------------------------------------
E3TDV0_ICTPU/162-262----------------------------------F--LI-----------------------------------------
B5DG24_SALSA/163-263----------------------------------L--LI-----------------------------------------
H2RRW1_TAKRU/163-263----------------------------------L--LI-----------------------------------------
K4FV42_CALMI/163-263----------------------------------F--LI-----------------------------------------
Q3KQ83_XENLA/162-262----------------------------------F--LI-----------------------------------------
I7G2X7_MACFA/162-262----------------------------------F--LI-----------------------------------------
H3A0T1_LATCH/164-264----------------------------------L--LI-----------------------------------------
R7UPP9_CAPTE/154-254----------------------------------L--FI-----------------------------------------
B7PB82_IXOSC/86-183----------------------------------L--LI-----------------------------------------
G3MNU6_9ACAR/156-256----------------------------------L--LI-----------------------------------------
F6TUV6_CIOIN/161-261----------------------------------F--LI-----------------------------------------
E9G2Q3_DAPPU/159-258----------------------------------L--MI-----------------------------------------
R4G2X9_RHOPR/158-256----------------------------------F--LI-----------------------------------------
B8YN16_SCYPA/165-265----------------------------------L--LI-----------------------------------------
K7IUX2_NASVI/159-256----------------------------------L--LI-----------------------------------------
E2BY23_HARSA/159-256----------------------------------I--MI-----------------------------------------
H9K562_APIME/183-280----------------------------------L--MI-----------------------------------------
N6TWG3_DENPD/159-258----------------------------------L--LI-----------------------------------------
Q16JQ2_AEDAE/159-257----------------------------------F--LI-----------------------------------------
C6SV35_DROME/162-260----------------------------------F--LI-----------------------------------------
D3TRT0_GLOMM/159-257----------------------------------F--LI-----------------------------------------
H9JGM4_BOMMO/159-258----------------------------------F--LI-----------------------------------------
K8F2A8_9CHLO/171-283----------------------------------F--RA-----------------------------------------
L8GMB5_ACACA/173-270----------------------------------F--II-----------------------------------------
Q5SCB4_OSTTA/157-262----------------------------------F--LM-----------------------------------------
A4RUA6_OSTLU/106-212----------------------------------F--LR-----------------------------------------
D8SKW4_SELML/173-280----------------------------------F--VL-----------------------------------------
A9TM39_PHYPA/166-271----------------------------------F--IY-----------------------------------------
B6TIT4_MAIZE/176-281----------------------------------F--ID-----------------------------------------
I1GNJ7_BRADI/176-281----------------------------------F--ID-----------------------------------------
M8CSB1_AEGTA/98-189----------------------------------F--ID-----------------------------------------
R0FFP6_9BRAS/176-281----------------------------------F--VN-----------------------------------------
K4BTS5_SOLLC/176-282----------------------------------F--IS-----------------------------------------
M0U1N4_MUSAM/177-282----------------------------------F--NE-----------------------------------------
A9PJ64_9ROSI/178-280----------------------------------F--VA-----------------------------------------
B9RF84_RICCO/157-262----------------------------------F--IN-----------------------------------------
M5VZ28_PRUPE/175-280----------------------------------F--ID-----------------------------------------
D7U9R4_VITVI/178-283----------------------------------F--VD-----------------------------------------
G7I853_MEDTR/189-294----------------------------------F--TD-----------------------------------------
I1KBX5_SOYBN/178-283----------------------------------F--IN-----------------------------------------

PF02984

CG11_CANAL/174-308-------------------------------...A..ID-----------------------------------------
Q9GTQ8_DROME/286-422-------------------------------...L.MMR-----------------------------------------
Q4T8S9_TETNG/1145-1270-------------------------------...F.LRQ-----------------------------------------
Q4RZE5_TETNG/155-280-------------------------------...F.LSK-----------------------------------------
A7YYE4_DANRE/155-279-------------------------------...F.LAK-----------------------------------------
Q7ZYJ6_XENLA/153-279-------------------------------...F.LNK-----------------------------------------
CCND1_BOVIN/155-283-------------------------------...F.LSK-----------------------------------------
CCND1_MOUSE/155-283-------------------------------...F.LSK-----------------------------------------
Q5T8J1_HUMAN/105-230-------------------------------...I.LHR-----------------------------------------
Q5ZKI9_CHICK/155-278-------------------------------...I.LHH-----------------------------------------
Q1L8M6_DANRE/153-279-------------------------------...I.LHK-----------------------------------------
H2Q584_PANTR/154-275-------------------------------...I.LRK-----------------------------------------
Q3KPK0_XENLA/154-277-------------------------------...I..LR-----------------------------------------
CCD11_ARATH/184-308-------------------------------...F.AYK-----------------------------------------
Q9SNV2_ANTMA/176-296-------------------------------...F.ALK-----------------------------------------
CCD42_ORYSJ/212-330-------------------------------......LN-----------------------------------------
CCD42_ARATH/171-289-------------------------------...F.LSK-----------------------------------------
CCD41_ARATH/180-299-------------------------------...MSKCD-----------------------------------------
P93103_OXYRB/210-333-------------------------------...F..LY-----------------------------------------
Q9ZRX9_TOBAC/198-317-------------------------------...F..MR-----------------------------------------
O82678_OXYRB/199-324-------------------------------...L.KLK-----------------------------------------
Q8LPW3_HELAN/178-304-------------------------------...L.GLS-----------------------------------------
CCD33_ARATH/188-310-------------------------------...Y.SFK-----------------------------------------
CCD31_ARATH/189-307-------------------------------...L.GLK-----------------------------------------
Q8LK74_LAGSI/187-313-------------------------------...L.GFK-----------------------------------------
Q9SMD4_SOLLC/184-309-------------------------------...L.GLK-----------------------------------------
Q8GZU3_9ROSI/205-332-------------------------------...L.GLE-----------------------------------------
Q2ABE7_CAMSI/203-327-------------------------------...L.GLK-----------------------------------------
Q9S7H9_SOLLC/192-320-------------------------------...F.GFM-----------------------------------------
A7Y7X0_CUCSA/197-329-------------------------------...I.GLK-----------------------------------------
Q9SNV0_ANTMA/203-329-------------------------------...F.ELM-----------------------------------------
Q40338_MEDSA/212-338-------------------------------...L.GLK-----------------------------------------
Q9SXN7_TOBAC/190-313-------------------------------...L.GLK-----------------------------------------
Q2ABE6_CAMSI/198-326-------------------------------...F.GFK-----------------------------------------
Q7XAB7_EUPES/184-308-------------------------------...L.GLK-----------------------------------------
Q84V88_POPAL/200-324-------------------------------...L.GLK-----------------------------------------
CCNE_HEMPU/255-381-------------------------------...F..MQ-----------------------------------------
Q5U4W4_XENLA/240-362-------------------------------...Y..LQ-----------------------------------------
Q5ZMH4_CHICK/247-368-------------------------------...Y..LQ-----------------------------------------
Q544H6_MOUSE/241-363-------------------------------...F..LQ-----------------------------------------
CCNE1_HUMAN/244-366-------------------------------...Y..MQ-----------------------------------------
B2GQF9_DANRE/246-368-------------------------------...Y..MQ-----------------------------------------
CCD61_ARATH/156-288-------------------------------...F..IS-----------------------------------------
A8XRM2_CAEBR/208-340-------------------------------...L..SR-----------------------------------------
O45926_CAEEL/161-293-------------------------------...I..SK-----------------------------------------
CCNB1_CAEEL/208-340-------------------------------...L..SR-----------------------------------------
Q9U7P9_9CILI/566-681-------------------------------...Y.KEE-----------------------------------------
Q4T2Y9_TETNG/114-254-------------------------------...Y..LH-----------------------------------------
CCNJ_XENLA/145-273-------------------------------...Y..LS-----------------------------------------
CG1C_SCHPO/162-278-------------------------------...F..VA-----------------------------------------
A2F2K2_TRIVA/212-328-------------------------------...F..MQ-----------------------------------------
A2DQ77_TRIVA/248-364-------------------------------...L..LR-----------------------------------------
A2DZV8_TRIVA/235-351-------------------------------...F..LR-----------------------------------------
A0C1C9_PARTE/197-310-------------------------------......QI-----------------------------------------
A0DMF0_PARTE/199-312-------------------------------......QI-----------------------------------------
B8N0B1_ASPFN/192-299-------------------------------...A..VI-----------------------------------------
A4RSW0_OSTLU/207-322-------------------------------...Y..LS-----------------------------------------
Q5SCB7_OSTTA/222-339-------------------------------...Y.LSR-----------------------------------------
CCNF_MOUSE/408-531-------------------------------...L..VP-----------------------------------------
CCNF_XENTR/414-537-------------------------------...L..IP-----------------------------------------
A2E0Q4_TRIVA/216-333-------------------------------...F..IS-----------------------------------------
A2E6K7_TRIVA/216-333-------------------------------...F..LI-----------------------------------------
REM1_SCHPO/273-388-------------------------------...L..TI-----------------------------------------
Q4CS48_TRYCC/197-328-------------------------------...F..LD-----------------------------------------
A4HKX7_LEIBR/155-297-------------------------------GDDF..LG-----------------------------------------
Q4DWL9_TRYCC/229-371-------------------------------G..L..VH-----------------------------------------
Q0VA13_XENTR/226-348-------------------------------...L..ST-----------------------------------------
CCF13_ORYSJ/255-372-------------------------------...F..TR-----------------------------------------
Q23JX5_TETTS/284-401-------------------------------...Y..GR-----------------------------------------
O96434_PARTE/212-329-------------------------------...F..GR-----------------------------------------
A0E0R4_PARTE/214-320-------------------------------...F....-----------------------------------------
Q9TY42_PARTE/121-227-------------------------------...Y....-----------------------------------------
Q25123_HELRO/240-368-------------------------------...L.GAY-----------------------------------------
CCNB3_CAEEL/243-364-------------------------------...F..GR-----------------------------------------
Q29CG1_DROPS/434-556-------------------------------...Y..AR-----------------------------------------
Q7QC70_ANOGA/538-653-------------------------------...Y..AR-----------------------------------------
Q16VG6_AEDAE/419-535-------------------------------...Y..AR-----------------------------------------
Q25168_HELTR/382-498-------------------------------...F..AT-----------------------------------------
A7S8H6_NEMVE/110-226-------------------------------...F..AK-----------------------------------------
Q60FY2_ANGJA/277-393-------------------------------...Y..AK-----------------------------------------
Q08C91_DANRE/272-388-------------------------------...Y..AK-----------------------------------------
Q60FY1_ORENI/302-418-------------------------------...Y..AK-----------------------------------------
CCNB3_MOUSE/1265-1381-------------------------------...Y..AS-----------------------------------------
K4Q4R6_CHICK/276-392-------------------------------...F..AK-----------------------------------------
Q3KQA7_XENLA/288-404-------------------------------...F..AK-----------------------------------------
CCNB3_HUMAN/1259-1375-------------------------------...Y..AR-----------------------------------------
CCNB3_CANFA/1202-1318-------------------------------...Y..AR-----------------------------------------
CCNA1_CAEEL/343-459-------------------------------...F..AK-----------------------------------------
CCNA_DROME/334-451-------------------------------...Y.AVL-----------------------------------------
Q29DY8_DROPS/354-471-------------------------------...Y.AVM-----------------------------------------
Q17NN3_AEDAE/310-427-------------------------------...Y.CVM-----------------------------------------
Q7Q0E8_ANOGA/187-304-------------------------------...Y.CVM-----------------------------------------
CCF32_ORYSJ/267-390-------------------------------...F..LF-----------------------------------------
A3AKA7_ORYSJ/256-379-------------------------------...F..IR-----------------------------------------
A2ZM34_ORYSI/249-372-------------------------------...F..TR-----------------------------------------
Q39877_SOYBN/214-337-------------------------------...Y..AN-----------------------------------------
Q40488_TOBAC/238-361-------------------------------...F..TK-----------------------------------------
CCNAL_DAUCA/208-330-------------------------------...F..IR-----------------------------------------
CCA33_ARATH/190-313-------------------------------...F..IR-----------------------------------------
Q2V5Z8_BRACM/228-351-------------------------------...F..TR-----------------------------------------
CCA31_ARATH/219-342-------------------------------...F..TR-----------------------------------------
Q9M4K9_PEA/216-340-------------------------------...F.ITK-----------------------------------------
O04388_CATRO/238-361-------------------------------...L..TR-----------------------------------------
Q40492_TOBAC/247-370-------------------------------...F..TG-----------------------------------------
Q39331_BRANA/289-412-------------------------------...L..FS-----------------------------------------
CCA12_ARATH/310-433-------------------------------...F..LR-----------------------------------------
CCA14_ORYSJ/216-339-------------------------------...F..LR-----------------------------------------
CCA11_ORYSJ/372-495-------------------------------...F..VR-----------------------------------------
Q84LE4_SILLA/352-474-------------------------------...F..VR-----------------------------------------
Q40514_TOBAC/347-470-------------------------------...F..VR-----------------------------------------
Q96226_ADICA/397-520-------------------------------...F..VR-----------------------------------------
Q39878_SOYBN/336-459-------------------------------...F..IQ-----------------------------------------
Q9XGI4_SOLLC/345-468-------------------------------...F..VQ-----------------------------------------
CCA22_ARATH/304-427-------------------------------...F..IK-----------------------------------------
CCA21_ORYSJ/359-482-------------------------------...F..LR-----------------------------------------
CCA24_ARATH/329-452-------------------------------...F..LR-----------------------------------------
A5BUM0_VITVI/360-483-------------------------------...F..LR-----------------------------------------
Q941M7_MEDSA/349-473-------------------------------...F..LR-----------------------------------------
A7SEI5_NEMVE/172-293-------------------------------...F..IK-----------------------------------------
CCNA_HYDVD/296-415-------------------------------...Y..LF-----------------------------------------
P90681_PATPE/322-438-------------------------------...Y..LK-----------------------------------------
Q6ZZ83_SPHGR/342-458-------------------------------...F..LK-----------------------------------------
Q4SG06_TETNG/155-272-------------------------------...F..TA-----------------------------------------
O77212_DREPO/291-408-------------------------------...F..LK-----------------------------------------
CCNA1_CARAU/268-385-------------------------------...Y.TLE-----------------------------------------
CCNA1_XENLA/295-412-------------------------------...Y..LQ-----------------------------------------
CCNA1_MOUSE/298-415-------------------------------...Y..LR-----------------------------------------
CCNA_PATVU/302-419-------------------------------...Y..AK-----------------------------------------
Q28DU2_XENTR/291-408-------------------------------...Y..FQ-----------------------------------------
Q98TA3_DANRE/305-422-------------------------------...Y.FLH-----------------------------------------
CCNA2_BOVIN/307-425-------------------------------...Y..FL-----------------------------------------
CCNA2_CHICK/273-390-------------------------------...Y.FLH-----------------------------------------
M1KIP0_ENCCN/179-293-------------------------------...C..SK-----------------------------------------
Q6FVY0_CANGA/262-383-------------------------------...L..SK-----------------------------------------
A0A023ZJ88_YEASX/296-418-------------------------------...I..SK-----------------------------------------
A0A023ZMR1_YEASX/254-374-------------------------------...I..SK-----------------------------------------
CG21_SCHPO/294-409-------------------------------...I..SR-----------------------------------------
A0A023ZKJ3_YEASX/338-453-------------------------------...I..SK-----------------------------------------
Q6FNV2_CANGA/314-429-------------------------------...I..SK-----------------------------------------
Q6CT04_KLULA/317-432-------------------------------...V..SK-----------------------------------------
Q75A51_ASHGO/248-363-------------------------------...V..SK-----------------------------------------
Q6FQU1_CANGA/326-455-------------------------------...I..SK-----------------------------------------
A6ZXH4_YEAS7/299-414-------------------------------...I..SK-----------------------------------------
A7TR46_VANPO/331-446-------------------------------...I..SK-----------------------------------------
Q2HAS9_CHAGB/515-630-------------------------------...I..SK-----------------------------------------
F5HHN7_NEUCR/516-631-------------------------------...I..SK-----------------------------------------
Q0UCR8_PHANO/466-581-------------------------------...I..SK-----------------------------------------
A7F1V1_SCLS1/469-584-------------------------------...I..SK-----------------------------------------
A1C7V2_ASPCL/489-604-------------------------------...I..SK-----------------------------------------
Q6BGT2_DEBHA/350-465-------------------------------...T..SK-----------------------------------------
Q6CE22_YARLI/306-421-------------------------------...T..SK-----------------------------------------
Q49U21_CRYNE/355-469-------------------------------...I..SK-----------------------------------------
Q6X269_USTMD/465-579-------------------------------...I..SK-----------------------------------------
CG22_SCHPO/267-382-------------------------------...I..SQ-----------------------------------------
A0A023ZMC4_YEASX/339-454-------------------------------...I..SK-----------------------------------------
Q75EI0_ASHGO/418-533-------------------------------...I..SK-----------------------------------------
Q6FVY1_CANGA/344-459-------------------------------...I..SK-----------------------------------------
A3LN44_PICST/322-438-------------------------------...I..SK-----------------------------------------
A5DUV2_LODEL/512-628-------------------------------...I..SK-----------------------------------------
Q6CEJ4_YARLI/393-508-------------------------------...I..SK-----------------------------------------
Q0UMA7_PHANO/348-462-------------------------------...I..SK-----------------------------------------
Q2HAK4_CHAGB/352-466-------------------------------...I..SK-----------------------------------------
A1CID9_ASPCL/361-475-------------------------------...I..SK-----------------------------------------
CG23_SCHPO/334-448-------------------------------...I..SK-----------------------------------------
O93916_PNECA/304-419-------------------------------...V..SK-----------------------------------------
F5HE42_USTMA/433-547-------------------------------...I..SK-----------------------------------------
F5H8X2_CRYNB/366-482-------------------------------...I..SK-----------------------------------------
Q5SCB6_OSTTA/230-346-------------------------------...F..FK-----------------------------------------
CCB31_ARATH/274-391-------------------------------...F..LK-----------------------------------------
Q9ZRG1_PEA/135-252-------------------------------...F..IK-----------------------------------------
CCB21_ARATH/302-419-------------------------------...F..LK-----------------------------------------
CCB22_ARATH/303-421-------------------------------...F..LK-----------------------------------------
Q9XGI1_SOLLC/308-425-------------------------------...Y..LK-----------------------------------------
CCNB2_MEDSA/201-318-------------------------------...F..LK-----------------------------------------
CCB23_ARATH/308-425-------------------------------...F..LK-----------------------------------------
CCB24_ARATH/309-426-------------------------------...F..LK-----------------------------------------
Q2WGP0_ALLCE/280-397-------------------------------...F..LK-----------------------------------------
B8AT55_ORYSI/285-402-------------------------------...F..LK-----------------------------------------
CCB22_ORYSI/293-410-------------------------------...F..LK-----------------------------------------
Q41734_MAIZE/282-407-------------------------------...F..LK-----------------------------------------
P93646_MAIZE/356-473-------------------------------...Y..LK-----------------------------------------
CCB13_ORYSJ/341-458-------------------------------...Y..LK-----------------------------------------
O65064_PICMA/98-215-------------------------------...F..LK-----------------------------------------
Q41733_MAIZE/317-437-------------------------------...F..AK-----------------------------------------
CCB14_ARATH/260-379-------------------------------...Y..VK-----------------------------------------
CCB11_ARATH/295-418-------------------------------...F..IK-----------------------------------------
P93102_OXYRB/319-438-------------------------------...Y..VK-----------------------------------------
Q2WGP2_ALLCE/358-475-------------------------------...F..IK-----------------------------------------
CCB12_ARATH/312-429-------------------------------...F..IK-----------------------------------------
CCB13_ARATH/289-406-------------------------------...F..IK-----------------------------------------
A5AEK5_VITVI/324-442-------------------------------...F..IK-----------------------------------------
O04398_TOBAC/319-436-------------------------------...Y..IK-----------------------------------------
Q40516_TOBAC/291-408-------------------------------...F..IK-----------------------------------------
O82137_PEA/102-224-------------------------------...F..LK-----------------------------------------
O82717_LUPLU/324-441-------------------------------...F..IK-----------------------------------------
P93557_SESRO/318-435-------------------------------...F..IK-----------------------------------------
O04389_CATRO/313-431-------------------------------...F..IK-----------------------------------------
Q2PHK8_DAUCA/314-432-------------------------------...F..IK-----------------------------------------
Q2PHK9_DAUCA/330-448-------------------------------...F..IK-----------------------------------------
Q9LKC6_CICAR/324-443-------------------------------...F..IK-----------------------------------------
CCN2_ANTMA/319-438-------------------------------...F..IK-----------------------------------------
Q5D894_GOSHI/87-204-------------------------------...F..IK-----------------------------------------
Q40223_LUPLU/307-426-------------------------------...Y..IK-----------------------------------------
Q39880_SOYBN/313-433-------------------------------...D..TK-----------------------------------------
Q2PHL0_DAUCA/311-430-------------------------------...Y..IK-----------------------------------------
Q2ABE9_CAMSI/308-433-------------------------------...F..IK-----------------------------------------
Q9SBQ4_PETHY/303-423-------------------------------...Y..IK-----------------------------------------
Q9XGI2_SOLLC/248-367-------------------------------...Y..IK-----------------------------------------
Q5D8P0_SCHJA/269-392-------------------------------...L..SK-----------------------------------------
CCNB_DICDI/316-434-------------------------------...F..SK-----------------------------------------
P92162_BOMMO/389-509-------------------------------...F..VK-----------------------------------------
Q4TVR6_HELTR/235-352-------------------------------...F..SK-----------------------------------------
A7SPG5_NEMVE/166-283-------------------------------...N..SK-----------------------------------------
Q4T0M3_TETNG/224-342-------------------------------...A..SK-----------------------------------------
CCNB1_ANGJA/272-390-------------------------------...A..SK-----------------------------------------
CCNB1_CARAU/266-384-------------------------------...A..SK-----------------------------------------
CCNB1_CRIGR/296-414-------------------------------...A..SK-----------------------------------------
Q6P801_XENTR/266-384-------------------------------...A..SK-----------------------------------------
O93228_RANJA/239-357-------------------------------...A..SK-----------------------------------------
Q6IR86_XENLA/262-380-------------------------------...A..SK-----------------------------------------
Q7ZVA8_DANRE/252-370-------------------------------...A..SK-----------------------------------------
Q09IZ1_ONCMY/251-369-------------------------------...A..SK-----------------------------------------
CCNB2_ORYLA/254-372-------------------------------...A..TK-----------------------------------------
Q28GP5_XENTR/256-374-------------------------------...A..SK-----------------------------------------
Q6T2E9_BUFGR/263-381-------------------------------...A..SK-----------------------------------------
CCNB2_CHICK/268-386-------------------------------...A..SK-----------------------------------------
Q7Z4Z4_HUMAN/264-382-------------------------------...A..SK-----------------------------------------
CCNB_MARGL/258-375-------------------------------...N..SK-----------------------------------------
CCNB_PATPE/272-390-------------------------------...C..SK-----------------------------------------
Q95WE6_PATPE/274-391-------------------------------...C..SK-----------------------------------------
Q5UAU8_PENJP/269-385-------------------------------...N..SK-----------------------------------------
CCNB_SPISO/299-415-------------------------------...D..SK-----------------------------------------
CCNB_PATVU/282-398-------------------------------...N..SK-----------------------------------------
CCNB_HYDVD/264-380-------------------------------...N..SK-----------------------------------------
CCNB_ARBPU/274-395-------------------------------...N..SK-----------------------------------------
Q94740_SPHGR/281-401-------------------------------...N..SK-----------------------------------------
Q291N4_DROPS/375-501-------------------------------...Y..SK-----------------------------------------
Q16TY2_AEDAE/355-477-------------------------------...Y..SK-----------------------------------------
Q7PPJ1_ANOGA/320-449-------------------------------...F..SK-----------------------------------------

PF00134

CCNA2_MOUSE/171-297---------------------------------------------------------------..-------------DI
CCNB3_CAEEL/115-241---------------------------------------------------------------..-------------EV
CCNF_MOUSE/281-406---------------------------------------------------------------..-------------.L
CCT12_ARATH/28-169---------------------------------------------------------------..-------------KT
CCNE_CAEEL/232-360---------------------------------------------------------------..-------------DM
REM1_SCHPO/145-271---------------------------------------------------------------..-------------YY
O45926_CAEEL/34-159---------------------------------------------------------------..-------------.V
CCB14_ARATH/133-258---------------------------------------------------------------..-------------EI
CCU41_ARATH/22-148---------------------------------------------------------------SR-------------P.
CCNB2_HUMAN/137-262---------------------------------------------------------------..-------------.I
CCNT_DROME/42-176---------------------------------------------------------------..-------------DD
CG23_SCHPO/206-332---------------------------------------------------------------.E-------------.L
CCNA_DROME/206-332---------------------------------------------------------------.K-------------DI
CG12_YEAST/43-195---------------------------------------------------------------..-------------EM
CCNB_DROME/260-387---------------------------------------------------------------..-------------EV
CCNB1_MOUSE/170-295---------------------------------------------------------------..-------------.V
CG21_SCHPO/166-292---------------------------------------------------------------.E-------------.I
PCL1_YEAST/19-152---------------------------------------------------------------PG-------------EK
CG21_YEAST/212-337---------------------------------------------------------------.N-------------..
CG22_YEAST/232-357---------------------------------------------------------------.N-------------..
CG23_YEAST/171-297---------------------------------------------------------------.E-------------.L
CG24_YEAST/210-336---------------------------------------------------------------.E-------------.L
PUC1_SCHPO/99-227---------------------------------------------------------------..-------------.L
CCNB1_SOYBN/197-322---------------------------------------------------------------..-------------EI
PCL2_YEAST/18-146---------------------------------------------------------------PA-------------..
CCNB2_CHICK/141-266---------------------------------------------------------------..-------------.I
CCB11_ARATH/168-293---------------------------------------------------------------..-------------DI
CCND2_MOUSE/24-151---------------------------------------------------------------..-------------.I
CCND3_HUMAN/26-153---------------------------------------------------------------..-------------.I
CGS5_YEAST/165-294---------------------------------------------------------------KY-------------YL
CG21_EMENI/211-337---------------------------------------------------------------.D-------------.L
CGS6_YEAST/123-252---------------------------------------------------------------PY-------------HL
CCNA1_CAEEL/215-341---------------------------------------------------------------..-------------QV
CG22_SCHPO/139-265---------------------------------------------------------------.E-------------.L
CCND1_RAT/26-153---------------------------------------------------------------..-------------.I
CCNB3_CHICK/149-274---------------------------------------------------------------..-------------DI
CCNB_DICDI/188-314---------------------------------------------------------------..-------------HI
CCD11_ARATH/50-182---------------------------------------------------------------RS-------------LD
CCD21_ARATH/65-197---------------------------------------------------------------GD-------------LD
SSN8_YEAST/45-176---------------------------------------------------------------..-------------.Y
CCNE1_CHICK/112-239---------------------------------------------------------------..-------------LL
CCNE_DROME/330-459---------------------------------------------------------------..-------------GL
CCNA1_HUMAN/214-340---------------------------------------------------------------.P-------------DI
P92162_BOMMO/260-387---------------------------------------------------------------..-------------VI
CCC11_ORYSJ/4-144---------------------------------------------------------------.I-------------TL
CGH2_SHV21/22-148---------------------------------------------------------------..-------------.V
CCNB1_CAEEL/81-206---------------------------------------------------------------..-------------.P
PCL9_YEAST/19-146---------------------------------------------------------------.P-------------..
CCA22_ARATH/175-302---------------------------------------------------------------..-------------DI
CCB12_ARATH/185-310---------------------------------------------------------------..-------------EM
CCB21_ARATH/174-300---------------------------------------------------------------..-------------DL
Q39878_SOYBN/207-334---------------------------------------------------------------.K-------------DI
CCNE1_MOUSE/113-240---------------------------------------------------------------..-------------LL
CCB21_ORYSJ/157-283---------------------------------------------------------------..-------------DI
CCD41_ARATH/45-178---------------------------------------------------------------GD-------------LD
CCNB3_DROME/308-433---------------------------------------------------------------..-------------HL
Q9S7H9_SOLLC/61-190---------------------------------------------------------------.D-------------GS
CCB31_ARATH/146-272---------------------------------------------------------------..-------------EV
CCB24_ARATH/180-307---------------------------------------------------------------..-------------DI
Q9SMD4_SOLLC/51-182---------------------------------------------------------------KN-------------QS
CCD33_ARATH/59-186---------------------------------------------------------------.D-------------EF
Q9U2M5_CAEEL/72-201---------------------------------------------------------------.N-------------.I
Q9VE72_DROME/6-144---------------------------------------------------------------..-------------.Y
Q9VKF0_DROME/205-327---------------------------------------------------------------..-------------.H
Q9VZP3_DROME/42-165---------------------------------------------------------------..-------------..
Q9XGI1_SOLLC/180-306---------------------------------------------------------------..-------------DI
CCNE2_MOUSE/112-239---------------------------------------------------------------..-------------DL
CCD61_ARATH/26-154---------------------------------------------------------------..-------------SA
A0BXX7_PARTE/85-212---------------------------------------------------------------..-------------DI
A9UMS1_XENTR/114-240---------------------------------------------------------------..-------------QL
B4FZZ7_MAIZE/193-318---------------------------------------------------------------..-------------EI
B8A2G9_MAIZE/228-354---------------------------------------------------------------..-------------EI
C4J9B6_MAIZE/173-299---------------------------------------------------------------..-------------DI
E9QJ66_DANRE/140-266---------------------------------------------------------------..-------------DI
F1QBQ7_DANRE/117-243---------------------------------------------------------------..-------------NL
F6QF79_XENTR/139-263---------------------------------------------------------------..-------------.V
F6QGW4_XENTR/133-257---------------------------------------------------------------..-------------.I
I1K835_SOYBN/85-213---------------------------------------------------------------.K-------------IV
I1M770_SOYBN/186-311---------------------------------------------------------------..-------------DI
J3KY10_ORYBR/200-327---------------------------------------------------------------..-------------DV
K7V0X7_MAIZE/191-316---------------------------------------------------------------..-------------EL
M1A5P4_SOLTU/185-310---------------------------------------------------------------..-------------EI
M4E4A3_BRARP/154-281---------------------------------------------------------------..-------------DV
M7PCR8_PNEMU/176-302---------------------------------------------------------------..-------------EL
CG11_CANAL/44-171---------------------------------------------------------------..-------------EI
CG24_CANAL/234-359---------------------------------------------------------------..-------------DL
CG13_CANAL/44-171---------------------------------------------------------------..-------------EI
CG21_CANAL/208-334---------------------------------------------------------------..-------------LL
Q6BFS2_PARTE/82-209---------------------------------------------------------------.P-------------DL
VCYCL_HHV8P/21-146---------------------------------------------------------------..-------------SL
Q7KUZ5_DROME/153-280---------------------------------------------------------------..-------------DI
T1EGC7_HELRO/166-290---------------------------------------------------------------..-------------DI
T1FNQ9_HELRO/256-380---------------------------------------------------------------..-------------DL
W4XEA0_STRPU/126-253---------------------------------------------------------------..-------------SL
W4XJF2_STRPU/207-332---------------------------------------------------------------..-------------DI

PF08613

PHO80_YEAST/33-170---------------------------------------------------------------QI-------------TL
PSL1_SCHPO/29-176---------------------------------------------------------------QI-------------PL
PCL7_YEAST/108-264---------------------------------------------------------------SD-------------ET
Q1K4U8_NEUCR/157-314---------------------------------------------------------------KS-------------AL
Q389J6_TRYB2/370-620---------------------------------------------------------------PS-------------NS
Q6H3X9_ORYSJ/18-159---------------------------------------------------------------AA-------------PA

PF01858

K1Q8Z2_CRAGI/498-695---------------------------------------------------------------IG.TDPKT.......RI
K3WCJ4_PYTUL/615-824---------------------------------------------------------------CT.NDPTD.......HI
E9IWV1_SOLIN/372-568---------------------------------------------------------------CS.QDVKS.......SL
A9UZQ5_MONBE/439-632---------------------------------------------------------------CDQTRDTA.......TT
E9GV66_DAPPU/393-588---------------------------------------------------------------CS.NNPGE.......SI
RBR_RICCO/415-616---------------------------------------------------------------CD.RDVTN.......DV
Q54FX2_DICDI/628-829---------------------------------------------------------------ADQPQQTSEVD....KM
F6VRH0_XENTR/413-608---------------------------------------------------------------CS.RDPTK.......TI
V8P9V1_OPHHA/376-569---------------------------------------------------------------CI.RNPME.......NI
G0NPV8_CAEBE/426-611---------------------------------------------------------------MS.DSPAA.......TI
H0ZAT2_TAEGU/371-563---------------------------------------------------------------CS.RDPSQ.......SI
B0XDW3_CULQU/318-505---------------------------------------------------------------CA.QDPIA.......IV
F6W3I3_CIOIN/403-597---------------------------------------------------------------CT.EDPSE.......EV
F7CLV0_MACMU/99-291---------------------------------------------------------------CV.RNPME.......NI
I3KPC6_ORENI/402-595---------------------------------------------------------------CA.RDPSD.......AI
K7GZK7_CAEJA/310-501---------------------------------------------------------------MS.DNPMA.......TL
F1NAY3_CHICK/355-559---------------------------------------------------------------CT.VNPED.......SI
T1K8P0_TETUR/388-595---------------------------------------------------------------CT.TNPND.......RI
RBL1_MOUSE/385-578---------------------------------------------------------------CM.RNPMG.......NI
Q7Q5E8_ANOGA/392-578---------------------------------------------------------------CT.PSPLG.......TV
T1HVA1_RHOPR/31-215---------------------------------------------------------------CK.APP.........KI
T1J484_STRMM/388-582---------------------------------------------------------------CK.KDPGD.......NI
D7SVF2_VITVI/28-221---------------------------------------------------------------CD.GNVTD.......KV
W5MKN5_LEPOC/394-587---------------------------------------------------------------CS.RDPTE.......TI
G1KBZ3_ANOCA/346-550---------------------------------------------------------------CT.VNPTH.......DI
B4M2G6_DROVI/370-550---------------------------------------------------------------AG.EAALA.......KM
B7PDQ5_IXOSC/377-572---------------------------------------------------------------FE.PTLET.......SI
Q00U21_OSTTA/382-585---------------------------------------------------------------....GEETVIDKLHKKV
D8RMF7_SELML/305-502---------------------------------------------------------------CD.RDITE.......EV
F7AL78_CALJA/395-595---------------------------------------------------------------CT.VNPKE.......SI
A4S8I4_OSTLU/409-616---------------------------------------------------------------....DNPEIVQALKKKV
RBF_DROME/376-560---------------------------------------------------------------AG.EEVIA.......KL
H2UU61_TAKRU/351-546---------------------------------------------------------------CT.VDPTQ.......DV
F5H837_HUMAN/343-535---------------------------------------------------------------CS.RDPTQ.......AI
F6RJP6_XENTR/389-579---------------------------------------------------------------CV.RNPLE.......NV
A8NFV3_BRUMA/385-584---------------------------------------------------------------SC.QDPFE.......KI
F6YCW6_XENTR/1-199---------------------------------------------------------------CT.VNPKT.......KV
W5MK11_LEPOC/379-572---------------------------------------------------------------CA.RDPTL.......VI
G7Y3X8_CLOSI/355-571---------------------------------------------------------------CT.MSLLE.......DM
E7FDM3_DANRE/375-568---------------------------------------------------------------CV.RDPTE.......SV
A9SLF5_PHYPA/390-586---------------------------------------------------------------CD.RDISA.......DV
K7J2L5_NASVI/382-576---------------------------------------------------------------RS.PDIQT.......FV
M4AMR4_XIPMA/258-452---------------------------------------------------------------CT.VDPTQ.......DV
H9KR58_APIME/415-607---------------------------------------------------------------CS.QDVKT.......LV
W5JE43_ANODA/403-588---------------------------------------------------------------CA.PNPLA.......MV
W4Y895_STRPU/330-534---------------------------------------------------------------CS.INPQS.......AV
A7RQ05_NEMVE/385-582---------------------------------------------------------------CS.RDPLQ.......SI
C3XU15_BRAFL/375-568---------------------------------------------------------------CS.RNPQE.......SI
H2YMF2_CIOSA/346-540---------------------------------------------------------------CA.DDPSE.......EV
F1Q9D6_DANRE/359-569---------------------------------------------------------------CT.VDPSG.......EI
H9IXG6_BOMMO/327-522---------------------------------------------------------------CG.VT.DE.......MI
B4JJ99_DROGR/374-552---------------------------------------------------------------AG.EEHIA.......KI
F4QEM9_DICFS/396-587---------------------------------------------------------------CG.EENVQ.......FI
A8HY72_CHLRE/423-626---------------------------------------------------------------LP.INSNSSGPTPVQQL
W5LEH3_ASTMX/376-569---------------------------------------------------------------CA.RDPTE.......GI
Q231Q1_TETTS/575-761---------------------------------------------------------------IN.KEYKS.......QL
B4L4P7_DROMO/352-536---------------------------------------------------------------AG.EAAIA.......KM
H3AQ36_LATCH/393-584---------------------------------------------------------------CL.RDPTE.......TI
W5MR28_LEPOC/371-573---------------------------------------------------------------CT.VNPSE.......EI
X1WJD7_ACYPI/378-569---------------------------------------------------------------CS.ATLQG.......EI
E4WSX2_OIKDI/375-564---------------------------------------------------------------CE.KDHSH.......SI
RBR1_ORYSJ/419-619---------------------------------------------------------------CD.KDVTD.......DI
M4B693_HYAAE/488-711---------------------------------------------------------------CA.VDPTE.......RI
H2MXX9_ORYLA/384-576---------------------------------------------------------------CS.RDPTG.......SV
RBR1_MAIZE/275-476---------------------------------------------------------------CD.RDLTN.......AV
H3A0E3_LATCH/386-579---------------------------------------------------------------CS.RNPFH.......SI
B3S6M6_TRIAD/378-570---------------------------------------------------------------CS.NDLLD.......II
W5KDE3_ASTMX/254-459---------------------------------------------------------------CT.VDPSE.......EI
H9GN70_ANOCA/432-623---------------------------------------------------------------CS.RDPSL.......SI
M0T571_MUSAM/407-609---------------------------------------------------------------CD.QDITS.......TV
E1ZEA5_CHLVA/159-357---------------------------------------------------------------AG.MDAGAEA.....RL
D0NTP5_PHYIT/460-683---------------------------------------------------------------CT.VDPTQ.......RI
U6HGS1_ECHMU/397-581---------------------------------------------------------------VTNETPLT.......NI
K1PLH3_CRAGI/285-489---------------------------------------------------------------CS.QNPLS.......SI
E0VGB1_PEDHC/321-507---------------------------------------------------------------CE.ENPEE.......KI
U1NNI7_ASCSU/382-582---------------------------------------------------------------CR.ENPKV.......FI
B9RGU7_RICCO/60-252---------------------------------------------------------------DD.KSILD.......EV
D2VQU0_NAEGR/217-404---------------------------------------------------------------CN.IDQTS.......TI
W5KQG9_ASTMX/387-580---------------------------------------------------------------CS.RCPTD.......MI

PF03261

Q9V3H5_DROME/91-460HCNQHPHPHPHQHQLQLQNQHQHQNQNQNQNQNQVQDIREEVMTGPPGKSQNPSKAKDP....VKVNNKNSMSNH..NKL
W4XFC8_STRPU/11-372NTNNAVYRQYPDSVAILTPQKKDSKMLDSSIKKSFSCFNLNSHCPSNAQNGHHQSHKQHKISNVSGSTVTTTSTNGLNGF
B4NP59_DROWI/88-420RSN.................................DIREPFL..STNKTQNPSKKKDL....VRVNNTNSLS....NKL
G0MEC3_CAEBE/11-362....................................EIPRP.DS.TTIITNYHTLHNEF....KRNCQINNRQDLVNNNL
B4MG57_DROVI/90-432QHH............................CNQSHIIRELPLF.PSTKAQKPSTAKEL....GRVNNTNSISNH..NKL
Q0G843_CAEEL/11-364NYK.................................SVPRPSDT.TTIIPNYYSLREEF....RRGLQINTRQDLVNNNL
I3JGY3_ORENI/11-321.............................................SCANLSSYSSSQDP....AATTTTTSSHLPASKTL
B4G7J4_DROPE/90-428NHN..............................QPQDIREDSGT.VTAKSQNPSKVKDS....IKVNNKNSICNH..NKL
E0VX77_PEDHC/62-395NSNNNA.............................................................NTNNTSSSFCEKL
Q17C39_AEDAE/119-480HSHPQQTVY....................................FTPGGPKALLALDL....VRANNTNPLSQP..DKL
H2VTT9_CAEJA/11-389NYKVNAVNDENKELDVLRFVNLDSSTSTSFYSTWYKRIPRSVDQ.TTIIPNYYSLREEF....RRGVEINHGHDAVNNNL

PF01857

E3LY90_CAERE/724-863------------------------------------------------------------------------------L-
C3XU15_BRAFL/762-922------------------------------------------------------------------------------L-
D6WUA4_TRICA/623-757------------------------------------------------------------------------------M-
I7M8B4_TETTS/589-711------------------------------------------------------------------------------I-
W5LEH3_ASTMX/770-953------------------------------------------------------------------------------L-
W5KQG9_ASTMX/775-930------------------------------------------------------------------------------L-
Q00U21_OSTTA/709-837------------------------------------------------------------------------------L-
K7J2L5_NASVI/706-866------------------------------------------------------------------------------M-
G3NYF0_GASAC/762-926------------------------------------------------------------------------------L-
E9GV66_DAPPU/739-928------------------------------------------------------------------------------L-
K7V2N7_MAIZE/595-720------------------------------------------------------------------------------I-
B4MSL7_DROWI/606-728------------------------------------------------------------------------------I-
B9RGU7_RICCO/363-485------------------------------------------------------------------------------T-
H3AQ36_LATCH/797-959------------------------------------------------------------------------------L-
M4B693_HYAAE/750-894------------------------------------------------------------------------------I-
K3YG32_SETIT/683-811------------------------------------------------------------------------------I-
RBR_POPTR/755-884------------------------------------------------------------------------------I-
F2UP70_SALR5/745-900------------------------------------------------------------------------------L-
E9CHS1_CAPO3/877-1004------------------------------------------------------------------------------V-
F1QY31_DANRE/771-933------------------------------------------------------------------------------L-
H9KR58_APIME/635-797------------------------------------------------------------------------------M-
Q17Q73_AEDAE/556-680------------------------------------------------------------------------------L-
H3C722_TETNG/743-911------------------------------------------------------------------------------L-
D2VQU0_NAEGR/452-591------------------------------------------------------------------------------I-
A9SLF5_PHYPA/706-835------------------------------------------------------------------------------I-
M0T571_MUSAM/727-855------------------------------------------------------------------------------I-
K7GZK7_CAEJA/561-706------------------------------------------------------------------------------M-
Q54FX2_DICDI/890-1042------------------------------------------------------------------------------C-
B3S6M6_TRIAD/657-840------------------------------------------------------------------------------L-
D7SVF2_VITVI/331-459------------------------------------------------------------------------------I-
H2P1U6_PONAB/787-943------------------------------------------------------------------------------L-
RBL2_MOUSE/831-1011------------------------------------------------------------------------------L-
G5EDT1_CAEEL/744-889------------------------------------------------------------------------------L-
E7FDM3_DANRE/770-952------------------------------------------------------------------------------L-
RBF_DROME/581-705------------------------------------------------------------------------------I-
U1NNI7_ASCSU/660-828------------------------------------------------------------------------------L-
G1KFZ9_ANOCA/784-927------------------------------------------------------------------------------L-
W5MK11_LEPOC/790-976------------------------------------------------------------------------------L-
J0XFZ4_LOALO/562-724------------------------------------------------------------------------------L-
T1J484_STRMM/718-944------------------------------------------------------------------------------L-
I3KPC6_ORENI/788-976------------------------------------------------------------------------------L-
D7SU46_VITVI/726-854------------------------------------------------------------------------------I-
W4ZBT1_STRPU/363-541------------------------------------------------------------------------------L-
T1K8P0_TETUR/710-889------------------------------------------------------------------------------L-
A7RQ05_NEMVE/790-960------------------------------------------------------------------------------L-
D7G8E5_ECTSI/865-1014------------------------------------------------------------------------------V-
H9GN70_ANOCA/847-1031------------------------------------------------------------------------------L-
F6RJP6_XENTR/770-927------------------------------------------------------------------------------L-
G3N416_GASAC/775-935------------------------------------------------------------------------------L-
I3JCL2_ORENI/775-933------------------------------------------------------------------------------L-
H2U458_TAKRU/718-908------------------------------------------------------------------------------L-
B4M2G6_DROVI/571-694------------------------------------------------------------------------------I-
G4VM99_SCHMA/814-941------------------------------------------------------------------------------L-
H3A0E3_LATCH/805-987------------------------------------------------------------------------------L-
B0XDW3_CULQU/653-812------------------------------------------------------------------------------M-
W5JE43_ANODA/665-839------------------------------------------------------------------------------L-
T1HVA1_RHOPR/343-480------------------------------------------------------------------------------L-
A8HY72_CHLRE/818-944------------------------------------------------------------------------------L-
K3WCJ4_PYTUL/862-1000------------------------------------------------------------------------------I-
F4X6S3_ACREC/751-913------------------------------------------------------------------------------M-
B7PDQ5_IXOSC/761-937------------------------------------------------------------------------------L-
H2SIQ5_TAKRU/775-930------------------------------------------------------------------------------L-
T1FJQ6_HELRO/776-947------------------------------------------------------------------------------L-
E0VGB1_PEDHC/551-709------------------------------------------------------------------------------M-
A8WW47_CAEBR/737-882------------------------------------------------------------------------------L-
E1ZEA5_CHLVA/548-700------------------------------------------------------------------------------L-
M3ZR51_XIPMA/555-736------------------------------------------------------------------------------L-
U3I0V9_ANAPL/751-937------------------------------------------------------------------------------L-
I1ILE9_BRADI/604-729------------------------------------------------------------------------------I-
B7G0K4_PHATC/972-1099------------------------------------------------------------------------------I-
V8P9V1_OPHHA/768-918------------------------------------------------------------------------------L-
RBR1_ARATH/729-857------------------------------------------------------------------------------I-
G0NPV8_CAEBE/665-810------------------------------------------------------------------------------L-
H3D2K2_TETNG/626-748------------------------------------------------------------------------------L-
Q7Q5E8_ANOGA/609-787------------------------------------------------------------------------------L-
G1NXF3_MYOLU/774-956------------------------------------------------------------------------------L-
A0DTJ1_PARTE/585-706------------------------------------------------------------------------------I-
C5YE98_SORBI/68-193------------------------------------------------------------------------------I-
U3KDL0_FICAL/672-832------------------------------------------------------------------------------L-
U6HGS1_ECHMU/721-876------------------------------------------------------------------------------L-
C1N5Z8_MICPC/1035-1166------------------------------------------------------------------------------L-
F6W3I3_CIOIN/825-983------------------------------------------------------------------------------L-
D0NTP5_PHYIT/716-846------------------------------------------------------------------------------I-
W1PFC3_AMBTC/737-865------------------------------------------------------------------------------I-
W5MKN5_LEPOC/789-946------------------------------------------------------------------------------L-
F6VRH0_XENTR/812-995------------------------------------------------------------------------------L-
G7Y3X8_CLOSI/746-873------------------------------------------------------------------------------L-
E4WSX2_OIKDI/638-762------------------------------------------------------------------------------I-
G3WX03_SARHA/792-946------------------------------------------------------------------------------L-
D8U756_VOLCA/780-909------------------------------------------------------------------------------L-
M4AJJ3_XIPMA/767-924------------------------------------------------------------------------------L-
H2NQW4_PONAB/835-1018------------------------------------------------------------------------------L-
U6I670_HYMMI/714-860------------------------------------------------------------------------------L-
E2AA07_CAMFO/750-912------------------------------------------------------------------------------M-
H2YMF2_CIOSA/739-893------------------------------------------------------------------------------L-
A4S8I4_OSTLU/745-874------------------------------------------------------------------------------L-

PF00382

TF3B_KLULA/193-266------------------------------------------------------------------------------I-
TF2B_KLULA/137-207------------------------------------------------------------------------------I-
TF2B_YEAST/133-203------------------------------------------------------------------------------I-
TF3B_CANAL/95-165------------------------------------------------------------------------------I-
TF2B_DROME/214-284------------------------------------------------------------------------------M-
TF3B_KLULA/98-168------------------------------------------------------------------------------L-
TF3B_CANAL/190-263------------------------------------------------------------------------------I-
TF2B_DROME/120-190------------------------------------------------------------------------------I-
TF2B_KLULA/245-315------------------------------------------------------------------------------I-
TF2B_PYRFU/212-282------------------------------------------------------------------------------V-
Q5V5V1_HALMA/235-305------------------------------------------------------------------------------V-

PF16899

CCNH_ECHMU/168-289------------------------------------------------------------------------------DL
D2VN70_NAEGR/180-268------------------------------------------------------------------------------DL
H3FVF7_PRIPA/67-164------------------------------------------------------------------------------DL
G6D7P5_DANPL/155-246------------------------------------------------------------------------------DI
C5DE24_LACTC/194-313------------------------------------------------------------------------------DI
H2B1R1_KAZAF/202-304------------------------------------------------------------------------------DI
C5DYH4_ZYGRC/193-303------------------------------------------------------------------------------DI
Q6FMU5_CANGA/203-302------------------------------------------------------------------------------DI
G0V973_NAUCC/221-326------------------------------------------------------------------------------DI
G0W3A8_NAUDC/222-335------------------------------------------------------------------------------DI
G2YRH2_BOTF4/184-304------------------------------------------------------------------------------EL
R7YVJ7_CONA1/187-325------------------------------------------------------------------------------EL
C9SVU8_VERA1/162-263------------------------------------------------------------------------------EL
L2FZZ6_COLGN/165-276------------------------------------------------------------------------------EL
H1VJI3_COLHI/166-278------------------------------------------------------------------------------EL
M7TNJ7_EUTLA/145-243------------------------------------------------------------------------------EL
G3JT19_CORMM/158-261------------------------------------------------------------------------------EL
G9NI52_HYPAI/158-265------------------------------------------------------------------------------EL
F9F5Z4_FUSOF/158-263------------------------------------------------------------------------------EL
L8GA30_PSED2/187-302------------------------------------------------------------------------------EL
K1X5Y0_MARBU/178-294------------------------------------------------------------------------------EL
N1JHL3_BLUG1/188-305------------------------------------------------------------------------------EL
H6C5Z8_EXODN/187-301------------------------------------------------------------------------------EM
R1EFE2_BOTPV/206-348------------------------------------------------------------------------------EL
Q0UGP0_PHANO/193-328------------------------------------------------------------------------------EL
E5AC16_LEPMJ/211-344------------------------------------------------------------------------------EL
R0KJU5_SETT2/173-306------------------------------------------------------------------------------EL
M3AYY7_MYCFI/177-276------------------------------------------------------------------------------EL
N1QKL6_SPHMS/175-275------------------------------------------------------------------------------EL
F9XH99_MYCGM/164-291------------------------------------------------------------------------------EL
M2MZH1_BAUCO/171-314------------------------------------------------------------------------------EL
M2YNC7_MYCP1/165-265------------------------------------------------------------------------------EL
B6Q284_PENMQ/191-333------------------------------------------------------------------------------EI
G3Y4C9_ASPNA/188-330------------------------------------------------------------------------------EL
B0Y3L0_ASPFC/188-332------------------------------------------------------------------------------EL
Q5BB69_EMENI/189-333------------------------------------------------------------------------------EL
G7E2H9_MIXOS/177-279------------------------------------------------------------------------------DL
F8NWE7_SERL9/187-291------------------------------------------------------------------------------DL
D8PKL8_SCHCM/182-281------------------------------------------------------------------------------DL
K9HXY7_AGABB/176-275------------------------------------------------------------------------------DL
J4HVQ4_FIBRA/73-167------------------------------------------------------------------------------DV
E9C7X0_CAPO3/152-254------------------------------------------------------------------------------DV
E3M1M6_CAERE/158-270------------------------------------------------------------------------------DM
A7S801_NEMVE/159-255------------------------------------------------------------------------------DI
C3ZT09_BRAFL/159-259------------------------------------------------------------------------------DM
I1FML6_AMPQE/158-255------------------------------------------------------------------------------DM
E4YFZ2_OIKDI/97-198------------------------------------------------------------------------------DL
G3U0L9_LOXAF/162-261------------------------------------------------------------------------------DL
G1N872_MELGA/126-226------------------------------------------------------------------------------DL
G3UI14_LOXAF/162-261------------------------------------------------------------------------------DL
E3TDV0_ICTPU/162-262------------------------------------------------------------------------------DL
B5DG24_SALSA/163-263------------------------------------------------------------------------------DI
H2RRW1_TAKRU/163-263------------------------------------------------------------------------------DL
K4FV42_CALMI/163-263------------------------------------------------------------------------------DL
Q3KQ83_XENLA/162-262------------------------------------------------------------------------------DV
I7G2X7_MACFA/162-262------------------------------------------------------------------------------DL
H3A0T1_LATCH/164-264------------------------------------------------------------------------------DL
R7UPP9_CAPTE/154-254------------------------------------------------------------------------------DL
B7PB82_IXOSC/86-183------------------------------------------------------------------------------DI
G3MNU6_9ACAR/156-256------------------------------------------------------------------------------DL
F6TUV6_CIOIN/161-261------------------------------------------------------------------------------DL
E9G2Q3_DAPPU/159-258------------------------------------------------------------------------------DM
R4G2X9_RHOPR/158-256------------------------------------------------------------------------------DI
B8YN16_SCYPA/165-265------------------------------------------------------------------------------DI
K7IUX2_NASVI/159-256------------------------------------------------------------------------------DI
E2BY23_HARSA/159-256------------------------------------------------------------------------------DI
H9K562_APIME/183-280------------------------------------------------------------------------------DI
N6TWG3_DENPD/159-258------------------------------------------------------------------------------DI
Q16JQ2_AEDAE/159-257------------------------------------------------------------------------------DI
C6SV35_DROME/162-260------------------------------------------------------------------------------DI
D3TRT0_GLOMM/159-257------------------------------------------------------------------------------DI
H9JGM4_BOMMO/159-258------------------------------------------------------------------------------DI
K8F2A8_9CHLO/171-283------------------------------------------------------------------------------DA
L8GMB5_ACACA/173-270------------------------------------------------------------------------------DL
Q5SCB4_OSTTA/157-262------------------------------------------------------------------------------DV
A4RUA6_OSTLU/106-212------------------------------------------------------------------------------DV
D8SKW4_SELML/173-280------------------------------------------------------------------------------DI
A9TM39_PHYPA/166-271------------------------------------------------------------------------------DM
B6TIT4_MAIZE/176-281------------------------------------------------------------------------------DL
I1GNJ7_BRADI/176-281------------------------------------------------------------------------------DM
M8CSB1_AEGTA/98-189------------------------------------------------------------------------------DM
R0FFP6_9BRAS/176-281------------------------------------------------------------------------------NM
K4BTS5_SOLLC/176-282------------------------------------------------------------------------------DL
M0U1N4_MUSAM/177-282------------------------------------------------------------------------------DM
A9PJ64_9ROSI/178-280------------------------------------------------------------------------------DI
B9RF84_RICCO/157-262------------------------------------------------------------------------------DM
M5VZ28_PRUPE/175-280------------------------------------------------------------------------------DM
D7U9R4_VITVI/178-283------------------------------------------------------------------------------DM
G7I853_MEDTR/189-294------------------------------------------------------------------------------SM
I1KBX5_SOYBN/178-283------------------------------------------------------------------------------DM

PF02984

CG11_CANAL/174-308------------------------------------------------------------------------------S.
Q9GTQ8_DROME/286-422------------------------------------------------------------------------------L.
Q4T8S9_TETNG/1145-1270------------------------------------------------------------------------------L.
Q4RZE5_TETNG/155-280------------------------------------------------------------------------------L.
A7YYE4_DANRE/155-279------------------------------------------------------------------------------L.
Q7ZYJ6_XENLA/153-279------------------------------------------------------------------------------M.
CCND1_BOVIN/155-283------------------------------------------------------------------------------M.
CCND1_MOUSE/155-283------------------------------------------------------------------------------M.
Q5T8J1_HUMAN/105-230------------------------------------------------------------------------------L.
Q5ZKI9_CHICK/155-278------------------------------------------------------------------------------L.
Q1L8M6_DANRE/153-279------------------------------------------------------------------------------L.
H2Q584_PANTR/154-275------------------------------------------------------------------------------L.
Q3KPK0_XENLA/154-277------------------------------------------------------------------------------K.
CCD11_ARATH/184-308------------------------------------------------------------------------------I.
Q9SNV2_ANTMA/176-296------------------------------------------------------------------------------I.
CCD42_ORYSJ/212-330------------------------------------------------------------------------------S.
CCD42_ARATH/171-289------------------------------------------------------------------------------I.
CCD41_ARATH/180-299------------------------------------------------------------------------------Q.
P93103_OXYRB/210-333------------------------------------------------------------------------------K.
Q9ZRX9_TOBAC/198-317------------------------------------------------------------------------------K.
O82678_OXYRB/199-324------------------------------------------------------------------------------P.
Q8LPW3_HELAN/178-304------------------------------------------------------------------------------N.
CCD33_ARATH/188-310------------------------------------------------------------------------------S.
CCD31_ARATH/189-307------------------------------------------------------------------------------N.
Q8LK74_LAGSI/187-313------------------------------------------------------------------------------E.
Q9SMD4_SOLLC/184-309------------------------------------------------------------------------------H.
Q8GZU3_9ROSI/205-332------------------------------------------------------------------------------H.
Q2ABE7_CAMSI/203-327------------------------------------------------------------------------------N.
Q9S7H9_SOLLC/192-320------------------------------------------------------------------------------S.
A7Y7X0_CUCSA/197-329------------------------------------------------------------------------------N.
Q9SNV0_ANTMA/203-329------------------------------------------------------------------------------N.
Q40338_MEDSA/212-338------------------------------------------------------------------------------T.
Q9SXN7_TOBAC/190-313------------------------------------------------------------------------------S.
Q2ABE6_CAMSI/198-326------------------------------------------------------------------------------T.
Q7XAB7_EUPES/184-308------------------------------------------------------------------------------N.
Q84V88_POPAL/200-324------------------------------------------------------------------------------T.
CCNE_HEMPU/255-381------------------------------------------------------------------------------IC
Q5U4W4_XENLA/240-362------------------------------------------------------------------------------V.
Q5ZMH4_CHICK/247-368------------------------------------------------------------------------------V.
Q544H6_MOUSE/241-363------------------------------------------------------------------------------V.
CCNE1_HUMAN/244-366------------------------------------------------------------------------------V.
B2GQF9_DANRE/246-368------------------------------------------------------------------------------M.
CCD61_ARATH/156-288------------------------------------------------------------------------------L.
A8XRM2_CAEBR/208-340------------------------------------------------------------------------------V.
O45926_CAEEL/161-293------------------------------------------------------------------------------T.
CCNB1_CAEEL/208-340------------------------------------------------------------------------------I.
Q9U7P9_9CILI/566-681------------------------------------------------------------------------------L.
Q4T2Y9_TETNG/114-254------------------------------------------------------------------------------A.
CCNJ_XENLA/145-273------------------------------------------------------------------------------I.
CG1C_SCHPO/162-278------------------------------------------------------------------------------D.
A2F2K2_TRIVA/212-328------------------------------------------------------------------------------I.
A2DQ77_TRIVA/248-364------------------------------------------------------------------------------I.
A2DZV8_TRIVA/235-351------------------------------------------------------------------------------I.
A0C1C9_PARTE/197-310------------------------------------------------------------------------------Q.
A0DMF0_PARTE/199-312------------------------------------------------------------------------------S.
B8N0B1_ASPFN/192-299------------------------------------------------------------------------------D.
A4RSW0_OSTLU/207-322------------------------------------------------------------------------------K.
Q5SCB7_OSTTA/222-339------------------------------------------------------------------------------I.
CCNF_MOUSE/408-531------------------------------------------------------------------------------V.
CCNF_XENTR/414-537------------------------------------------------------------------------------L.
A2E0Q4_TRIVA/216-333------------------------------------------------------------------------------I.
A2E6K7_TRIVA/216-333------------------------------------------------------------------------------L.
REM1_SCHPO/273-388------------------------------------------------------------------------------V.
Q4CS48_TRYCC/197-328------------------------------------------------------------------------------S.
A4HKX7_LEIBR/155-297------------------------------------------------------------------------------V.
Q4DWL9_TRYCC/229-371------------------------------------------------------------------------------S.
Q0VA13_XENTR/226-348------------------------------------------------------------------------------I.
CCF13_ORYSJ/255-372------------------------------------------------------------------------------Y.
Q23JX5_TETTS/284-401------------------------------------------------------------------------------V.
O96434_PARTE/212-329------------------------------------------------------------------------------I.
A0E0R4_PARTE/214-320------------------------------------------------------------------------------..
Q9TY42_PARTE/121-227------------------------------------------------------------------------------..
Q25123_HELRO/240-368------------------------------------------------------------------------------K.
CCNB3_CAEEL/243-364------------------------------------------------------------------------------V.
Q29CG1_DROPS/434-556------------------------------------------------------------------------------C.
Q7QC70_ANOGA/538-653------------------------------------------------------------------------------V.
Q16VG6_AEDAE/419-535------------------------------------------------------------------------------V.
Q25168_HELTR/382-498------------------------------------------------------------------------------C.
A7S8H6_NEMVE/110-226------------------------------------------------------------------------------V.
Q60FY2_ANGJA/277-393------------------------------------------------------------------------------C.
Q08C91_DANRE/272-388------------------------------------------------------------------------------C.
Q60FY1_ORENI/302-418------------------------------------------------------------------------------C.
CCNB3_MOUSE/1265-1381------------------------------------------------------------------------------C.
K4Q4R6_CHICK/276-392------------------------------------------------------------------------------C.
Q3KQA7_XENLA/288-404------------------------------------------------------------------------------C.
CCNB3_HUMAN/1259-1375------------------------------------------------------------------------------C.
CCNB3_CANFA/1202-1318------------------------------------------------------------------------------C.
CCNA1_CAEEL/343-459------------------------------------------------------------------------------R.
CCNA_DROME/334-451------------------------------------------------------------------------------C.
Q29DY8_DROPS/354-471------------------------------------------------------------------------------C.
Q17NN3_AEDAE/310-427------------------------------------------------------------------------------N.
Q7Q0E8_ANOGA/187-304------------------------------------------------------------------------------N.
CCF32_ORYSJ/267-390------------------------------------------------------------------------------S.
A3AKA7_ORYSJ/256-379------------------------------------------------------------------------------S.
A2ZM34_ORYSI/249-372------------------------------------------------------------------------------S.
Q39877_SOYBN/214-337------------------------------------------------------------------------------V.
Q40488_TOBAC/238-361------------------------------------------------------------------------------A.
CCNAL_DAUCA/208-330------------------------------------------------------------------------------A.
CCA33_ARATH/190-313------------------------------------------------------------------------------V.
Q2V5Z8_BRACM/228-351------------------------------------------------------------------------------V.
CCA31_ARATH/219-342------------------------------------------------------------------------------V.
Q9M4K9_PEA/216-340------------------------------------------------------------------------------V.
O04388_CATRO/238-361------------------------------------------------------------------------------V.
Q40492_TOBAC/247-370------------------------------------------------------------------------------V.
Q39331_BRANA/289-412------------------------------------------------------------------------------G.
CCA12_ARATH/310-433------------------------------------------------------------------------------A.
CCA14_ORYSJ/216-339------------------------------------------------------------------------------A.
CCA11_ORYSJ/372-495------------------------------------------------------------------------------V.
Q84LE4_SILLA/352-474------------------------------------------------------------------------------A.
Q40514_TOBAC/347-470------------------------------------------------------------------------------A.
Q96226_ADICA/397-520------------------------------------------------------------------------------A.
Q39878_SOYBN/336-459------------------------------------------------------------------------------A.
Q9XGI4_SOLLC/345-468------------------------------------------------------------------------------A.
CCA22_ARATH/304-427------------------------------------------------------------------------------A.
CCA21_ORYSJ/359-482------------------------------------------------------------------------------A.
CCA24_ARATH/329-452------------------------------------------------------------------------------A.
A5BUM0_VITVI/360-483------------------------------------------------------------------------------A.
Q941M7_MEDSA/349-473------------------------------------------------------------------------------A.
A7SEI5_NEMVE/172-293------------------------------------------------------------------------------A.
CCNA_HYDVD/296-415------------------------------------------------------------------------------A.
P90681_PATPE/322-438------------------------------------------------------------------------------A.
Q6ZZ83_SPHGR/342-458------------------------------------------------------------------------------A.
Q4SG06_TETNG/155-272------------------------------------------------------------------------------I.
O77212_DREPO/291-408------------------------------------------------------------------------------S.
CCNA1_CARAU/268-385------------------------------------------------------------------------------G.
CCNA1_XENLA/295-412------------------------------------------------------------------------------R.
CCNA1_MOUSE/298-415------------------------------------------------------------------------------R.
CCNA_PATVU/302-419------------------------------------------------------------------------------M.
Q28DU2_XENTR/291-408------------------------------------------------------------------------------I.
Q98TA3_DANRE/305-422------------------------------------------------------------------------------Q.
CCNA2_BOVIN/307-425------------------------------------------------------------------------------H.
CCNA2_CHICK/273-390------------------------------------------------------------------------------Q.
M1KIP0_ENCCN/179-293------------------------------------------------------------------------------A.
Q6FVY0_CANGA/262-383------------------------------------------------------------------------------A.
A0A023ZJ88_YEASX/296-418------------------------------------------------------------------------------A.
A0A023ZMR1_YEASX/254-374------------------------------------------------------------------------------A.
CG21_SCHPO/294-409------------------------------------------------------------------------------A.
A0A023ZKJ3_YEASX/338-453------------------------------------------------------------------------------A.
Q6FNV2_CANGA/314-429------------------------------------------------------------------------------A.
Q6CT04_KLULA/317-432------------------------------------------------------------------------------A.
Q75A51_ASHGO/248-363------------------------------------------------------------------------------A.
Q6FQU1_CANGA/326-455------------------------------------------------------------------------------A.
A6ZXH4_YEAS7/299-414------------------------------------------------------------------------------A.
A7TR46_VANPO/331-446------------------------------------------------------------------------------A.
Q2HAS9_CHAGB/515-630------------------------------------------------------------------------------A.
F5HHN7_NEUCR/516-631------------------------------------------------------------------------------A.
Q0UCR8_PHANO/466-581------------------------------------------------------------------------------A.
A7F1V1_SCLS1/469-584------------------------------------------------------------------------------A.
A1C7V2_ASPCL/489-604------------------------------------------------------------------------------A.
Q6BGT2_DEBHA/350-465------------------------------------------------------------------------------A.
Q6CE22_YARLI/306-421------------------------------------------------------------------------------A.
Q49U21_CRYNE/355-469------------------------------------------------------------------------------A.
Q6X269_USTMD/465-579------------------------------------------------------------------------------A.
CG22_SCHPO/267-382------------------------------------------------------------------------------A.
A0A023ZMC4_YEASX/339-454------------------------------------------------------------------------------A.
Q75EI0_ASHGO/418-533------------------------------------------------------------------------------A.
Q6FVY1_CANGA/344-459------------------------------------------------------------------------------A.
A3LN44_PICST/322-438------------------------------------------------------------------------------A.
A5DUV2_LODEL/512-628------------------------------------------------------------------------------A.
Q6CEJ4_YARLI/393-508------------------------------------------------------------------------------A.
Q0UMA7_PHANO/348-462------------------------------------------------------------------------------A.
Q2HAK4_CHAGB/352-466------------------------------------------------------------------------------A.
A1CID9_ASPCL/361-475------------------------------------------------------------------------------A.
CG23_SCHPO/334-448------------------------------------------------------------------------------A.
O93916_PNECA/304-419------------------------------------------------------------------------------A.
F5HE42_USTMA/433-547------------------------------------------------------------------------------A.
F5H8X2_CRYNB/366-482------------------------------------------------------------------------------A.
Q5SCB6_OSTTA/230-346------------------------------------------------------------------------------A.
CCB31_ARATH/274-391------------------------------------------------------------------------------A.
Q9ZRG1_PEA/135-252------------------------------------------------------------------------------A.
CCB21_ARATH/302-419------------------------------------------------------------------------------A.
CCB22_ARATH/303-421------------------------------------------------------------------------------A.
Q9XGI1_SOLLC/308-425------------------------------------------------------------------------------A.
CCNB2_MEDSA/201-318------------------------------------------------------------------------------A.
CCB23_ARATH/308-425------------------------------------------------------------------------------A.
CCB24_ARATH/309-426------------------------------------------------------------------------------A.
Q2WGP0_ALLCE/280-397------------------------------------------------------------------------------A.
B8AT55_ORYSI/285-402------------------------------------------------------------------------------A.
CCB22_ORYSI/293-410------------------------------------------------------------------------------A.
Q41734_MAIZE/282-407------------------------------------------------------------------------------A.
P93646_MAIZE/356-473------------------------------------------------------------------------------A.
CCB13_ORYSJ/341-458------------------------------------------------------------------------------A.
O65064_PICMA/98-215------------------------------------------------------------------------------A.
Q41733_MAIZE/317-437------------------------------------------------------------------------------A.
CCB14_ARATH/260-379------------------------------------------------------------------------------A.
CCB11_ARATH/295-418------------------------------------------------------------------------------A.
P93102_OXYRB/319-438------------------------------------------------------------------------------A.
Q2WGP2_ALLCE/358-475------------------------------------------------------------------------------A.
CCB12_ARATH/312-429------------------------------------------------------------------------------A.
CCB13_ARATH/289-406------------------------------------------------------------------------------A.
A5AEK5_VITVI/324-442------------------------------------------------------------------------------A.
O04398_TOBAC/319-436------------------------------------------------------------------------------A.
Q40516_TOBAC/291-408------------------------------------------------------------------------------A.
O82137_PEA/102-224------------------------------------------------------------------------------A.
O82717_LUPLU/324-441------------------------------------------------------------------------------A.
P93557_SESRO/318-435------------------------------------------------------------------------------A.
O04389_CATRO/313-431------------------------------------------------------------------------------A.
Q2PHK8_DAUCA/314-432------------------------------------------------------------------------------A.
Q2PHK9_DAUCA/330-448------------------------------------------------------------------------------A.
Q9LKC6_CICAR/324-443------------------------------------------------------------------------------A.
CCN2_ANTMA/319-438------------------------------------------------------------------------------A.
Q5D894_GOSHI/87-204------------------------------------------------------------------------------A.
Q40223_LUPLU/307-426------------------------------------------------------------------------------A.
Q39880_SOYBN/313-433------------------------------------------------------------------------------A.
Q2PHL0_DAUCA/311-430------------------------------------------------------------------------------S.
Q2ABE9_CAMSI/308-433------------------------------------------------------------------------------A.
Q9SBQ4_PETHY/303-423------------------------------------------------------------------------------A.
Q9XGI2_SOLLC/248-367------------------------------------------------------------------------------A.
Q5D8P0_SCHJA/269-392------------------------------------------------------------------------------A.
CCNB_DICDI/316-434------------------------------------------------------------------------------A.
P92162_BOMMO/389-509------------------------------------------------------------------------------A.
Q4TVR6_HELTR/235-352------------------------------------------------------------------------------A.
A7SPG5_NEMVE/166-283------------------------------------------------------------------------------A.
Q4T0M3_TETNG/224-342------------------------------------------------------------------------------I.
CCNB1_ANGJA/272-390------------------------------------------------------------------------------I.
CCNB1_CARAU/266-384------------------------------------------------------------------------------I.
CCNB1_CRIGR/296-414------------------------------------------------------------------------------I.
Q6P801_XENTR/266-384------------------------------------------------------------------------------I.
O93228_RANJA/239-357------------------------------------------------------------------------------I.
Q6IR86_XENLA/262-380------------------------------------------------------------------------------I.
Q7ZVA8_DANRE/252-370------------------------------------------------------------------------------A.
Q09IZ1_ONCMY/251-369------------------------------------------------------------------------------A.
CCNB2_ORYLA/254-372------------------------------------------------------------------------------V.
Q28GP5_XENTR/256-374------------------------------------------------------------------------------C.
Q6T2E9_BUFGR/263-381------------------------------------------------------------------------------S.
CCNB2_CHICK/268-386------------------------------------------------------------------------------A.
Q7Z4Z4_HUMAN/264-382------------------------------------------------------------------------------A.
CCNB_MARGL/258-375------------------------------------------------------------------------------A.
CCNB_PATPE/272-390------------------------------------------------------------------------------A.
Q95WE6_PATPE/274-391------------------------------------------------------------------------------A.
Q5UAU8_PENJP/269-385------------------------------------------------------------------------------A.
CCNB_SPISO/299-415------------------------------------------------------------------------------A.
CCNB_PATVU/282-398------------------------------------------------------------------------------A.
CCNB_HYDVD/264-380------------------------------------------------------------------------------A.
CCNB_ARBPU/274-395------------------------------------------------------------------------------A.
Q94740_SPHGR/281-401------------------------------------------------------------------------------A.
Q291N4_DROPS/375-501------------------------------------------------------------------------------A.
Q16TY2_AEDAE/355-477------------------------------------------------------------------------------A.
Q7PPJ1_ANOGA/320-449------------------------------------------------------------------------------A.

PF00134

CCNA2_MOUSE/171-297-------------TN------------------------------------.SM--------RAI---------------
CCNB3_CAEEL/115-241-------------DV------------------------------------.KT--------RAI---------------
CCNF_MOUSE/281-406-------------SD------------------------------------.TM--------RYI---------------
CCT12_ARATH/28-169-------------ET------------------------------------.RL--------RDS---------------
CCNE_CAEEL/232-360-------------DD------------------------------------.EK--------RRI---------------
REM1_SCHPO/145-271-------------VT------------------------------------.EM--------RAS---------------
O45926_CAEEL/34-159-------------NS------------------------------------.KM--------RRI---------------
CCB14_ARATH/133-258-------------NE------------------------------------.KM--------RSI---------------
CCU41_ARATH/22-148-------------..------------------------------------...--------TIT---------------
CCNB2_HUMAN/137-262-------------NG------------------------------------.RM--------RAI---------------
CCNT_DROME/42-176-------------EL------------------------------------.QY--------RQM---------------
CG23_SCHPO/206-332-------------AW------------------------------------.KM--------RGI---------------
CCNA_DROME/206-332-------------SH------------------------------------.NM--------RSI---------------
CG12_YEAST/43-195-------------NP------------------------------------VET--------RSN---------------
CCNB_DROME/260-387-------------SH------------------------------------.KM--------RAV---------------
CCNB1_MOUSE/170-295-------------TG------------------------------------.NM--------RAI---------------
CG21_SCHPO/166-292-------------DW------------------------------------.VT--------RHM---------------
PCL1_YEAST/19-152-------------HL------------------------------------.TR--------LPS---------------
CG21_YEAST/212-337-------------IK------------------------------------.QN--------RDI---------------
CG22_YEAST/232-357-------------IH------------------------------------.QN--------RDI---------------
CG23_YEAST/171-297-------------RW------------------------------------.SF--------RST---------------
CG24_YEAST/210-336-------------TW------------------------------------.PF--------RRT---------------
PUC1_SCHPO/99-227-------------RW------------------------------------.SM--------RPA---------------
CCNB1_SOYBN/197-322-------------NE------------------------------------.RM--------RAI---------------
PCL2_YEAST/18-146-------------..------------------------------------...--------.PP---------------
CCNB2_CHICK/141-266-------------NG------------------------------------.RM--------RAI---------------
CCB11_ARATH/168-293-------------NE------------------------------------.KM--------RLI---------------
CCND2_MOUSE/24-151-------------QP------------------------------------.YM--------RRM---------------
CCND3_HUMAN/26-153-------------KP------------------------------------.HM--------RKM---------------
CGS5_YEAST/165-294-------------RP------------------------------------.SM--------RTI---------------
CG21_EMENI/211-337-------------EW------------------------------------.KM--------RGI---------------
CGS6_YEAST/123-252-------------KS------------------------------------.SM--------RAL---------------
CCNA1_CAEEL/215-341-------------NE------------------------------------.EM--------RTI---------------
CG22_SCHPO/139-265-------------TW------------------------------------.KM--------REI---------------
CCND1_RAT/26-153-------------VP------------------------------------.SM--------RKI---------------
CCNB3_CHICK/149-274-------------SR------------------------------------.DM--------RAI---------------
CCNB_DICDI/188-314-------------NE------------------------------------.RM--------RAI---------------
CCD11_ARATH/50-182-------------AS------------------------------------.A.--------RED---------------
CCD21_ARATH/65-197-------------LS------------------------------------.V.--------RNQ---------------
SSN8_YEAST/45-176-------------DK------------------------------------DYN--------LRI---------------
CCNE1_CHICK/112-239-------------QP------------------------------------.KM--------RTI---------------
CCNE_DROME/330-459-------------QP------------------------------------.RM--------RAI---------------
CCNA1_HUMAN/214-340-------------TE------------------------------------.GM--------RTI---------------
P92162_BOMMO/260-387-------------TG------------------------------------.KM--------RAT---------------
CCC11_ORYSJ/4-144-------------EE------------------------------------FRL--------VKI---------------
CGH2_SHV21/22-148-------------TV------------------------------------.DN--------RTI---------------
CCNB1_CAEEL/81-206-------------TP------------------------------------.KM--------RRI---------------
PCL9_YEAST/19-146-------------..------------------------------------...--------.PD---------------
CCA22_ARATH/175-302-------------DP------------------------------------.DM--------RKI---------------
CCB12_ARATH/185-310-------------NE------------------------------------.KM--------RAI---------------
CCB21_ARATH/174-300-------------NE------------------------------------.KM--------RAI---------------
Q39878_SOYBN/207-334-------------NP------------------------------------.SM--------RGI---------------
CCNE1_MOUSE/113-240-------------QA------------------------------------.RM--------RAV---------------
CCB21_ORYSJ/157-283-------------NE------------------------------------.KM--------RAI---------------
CCD41_ARATH/45-178-------------LN------------------------------------.VG--------RRD---------------
CCNB3_DROME/308-433-------------TT------------------------------------.WM--------RTL---------------
Q9S7H9_SOLLC/61-190-------------LM------------------------------------.GA--------RKE---------------
CCB31_ARATH/146-272-------------SP------------------------------------.VT--------RGI---------------
CCB24_ARATH/180-307-------------NE------------------------------------.RM--------RGI---------------
Q9SMD4_SOLLC/51-182-------------FI------------------------------------.SS--------RRE---------------
CCD33_ARATH/59-186-------------LV------------------------------------.LC--------REK---------------
Q9U2M5_CAEEL/72-201-------------TP------------------------------------.FH--------REQ---------------
Q9VE72_DROME/6-144-------------RK------------------------------------MNK--------PGV---------------
Q9VKF0_DROME/205-327-------------NP------------------------------------..E--------HRQ---------------
Q9VZP3_DROME/42-165-------------PQ------------------------------------LNE--------RRR---------------
Q9XGI1_SOLLC/180-306-------------NE------------------------------------.RM--------RSI---------------
CCNE2_MOUSE/112-239-------------EP------------------------------------.QM--------RSI---------------
CCD61_ARATH/26-154-------------FL------------------------------------LSN--------RNQ---------------
A0BXX7_PARTE/85-212-------------NI------------------------------------.KM--------RAI---------------
A9UMS1_XENTR/114-240-------------QP------------------------------------.NM--------RAI---------------
B4FZZ7_MAIZE/193-318-------------NP------------------------------------.KM--------RAI---------------
B8A2G9_MAIZE/228-354-------------SE------------------------------------.RM--------RAI---------------
C4J9B6_MAIZE/173-299-------------NE------------------------------------.KM--------RGI---------------
E9QJ66_DANRE/140-266-------------TN------------------------------------.CM--------RVI---------------
F1QBQ7_DANRE/117-243-------------QP------------------------------------.KM--------RAI---------------
F6QF79_XENTR/139-263-------------TG------------------------------------.NM--------RAI---------------
F6QGW4_XENTR/133-257-------------NE------------------------------------.RM--------RAI---------------
I1K835_SOYBN/85-213-------------TP------------------------------------.TM--------RAI---------------
I1M770_SOYBN/186-311-------------NA------------------------------------.KM--------RSI---------------
J3KY10_ORYBR/200-327-------------NP------------------------------------.SM--------RAI---------------
K7V0X7_MAIZE/191-316-------------SP------------------------------------.RM--------RSI---------------
M1A5P4_SOLTU/185-310-------------ND------------------------------------.RV--------RAI---------------
M4E4A3_BRARP/154-281-------------NS------------------------------------.TM--------RGI---------------
M7PCR8_PNEMU/176-302-------------QW------------------------------------.KM--------RGI---------------
CG11_CANAL/44-171-------------QW------------------------------------.FM--------RPF---------------
CG24_CANAL/234-359-------------KW------------------------------------.EM--------RAV---------------
CG13_CANAL/44-171-------------KL------------------------------------.GM--------RPL---------------
CG21_CANAL/208-334-------------KP------------------------------------.RM--------RSI---------------
Q6BFS2_PARTE/82-209-------------NA------------------------------------.RM--------RAI---------------
VCYCL_HHV8P/21-146-------------TS------------------------------------.HM--------RKL---------------
Q7KUZ5_DROME/153-280-------------TP------------------------------------.PM--------RKI---------------
T1EGC7_HELRO/166-290-------------NH------------------------------------.SM--------RSI---------------
T1FNQ9_HELRO/256-380-------------TP------------------------------------.SM--------RAI---------------
W4XEA0_STRPU/126-253-------------GE------------------------------------.RM--------RAI---------------
W4XJF2_STRPU/207-332-------------TN------------------------------------.SM--------RCI---------------

PF08613

PHO80_YEAST/33-170-------------TR....................................YHS--------KIP...............
PSL1_SCHPO/29-176-------------SP...........................TSLKNPCLIFSA--------KNV...............
PCL7_YEAST/108-264-------------ED............................ELLTPILAFYG--------KNV...............
Q1K4U8_NEUCR/157-314-------------EPYIIVGE...............NSQPLNTQHSAITRKFYS--------RLP...............
Q389J6_TRYB2/370-620-------------CNSQKQSSAHFSVNTHSFDMPTASHTKTTFAQTPKESSFAT--------FAVEQAPLEGGQLESPHR
Q6H3X9_ORYSJ/18-159-------------SP....................................FRA--------TAK...............

PF01858

K1Q8Z2_CRAGI/498-695-------------ME-------------------------------------RV........TEM---------------
K3WCJ4_PYTUL/615-824-------------AQ-------------------------------------IL........QDL---------------
E9IWV1_SOLIN/372-568-------------EA-------------------------------------KV........KQI---------------
A9UZQ5_MONBE/439-632-------------QQ-------------------------------------EC........KQL---------------
E9GV66_DAPPU/393-588-------------QA-------------------------------------RV........KEM---------------
RBR_RICCO/415-616-------------IR-------------------------------------RA........HII---------------
Q54FX2_DICDI/628-829-------------IE-------------------------------------RV........SSL---------------
F6VRH0_XENTR/413-608-------------LR-------------------------------------RL........KEM---------------
V8P9V1_OPHHA/376-569-------------LK-------------------------------------GV........KKI---------------
G0NPV8_CAEBE/426-611-------------LL-------------------------------------KC........DQL---------------
H0ZAT2_TAEGU/371-563-------------AN-------------------------------------RV........KEM---------------
B0XDW3_CULQU/318-505-------------TG-------------------------------------RI........AAE---------------
F6W3I3_CIOIN/403-597-------------KK-------------------------------------RT........DRL---------------
F7CLV0_MACMU/99-291-------------MK-------------------------------------IL........KGM---------------
I3KPC6_ORENI/402-595-------------SQ-------------------------------------RL........NDM---------------
K7GZK7_CAEJA/310-501-------------LL-------------------------------------KR........DVM---------------
F1NAY3_CHICK/355-559-------------LK-------------------------------------RV........ESL---------------
T1K8P0_TETUR/388-595-------------VE-------------------------------------RI........KEL---------------
RBL1_MOUSE/385-578-------------IK-------------------------------------IV........KGI---------------
Q7Q5E8_ANOGA/392-578-------------LE-------------------------------------HV........DRM---------------
T1HVA1_RHOPR/31-215-------------EK-------------------------------------LVLELT....NQI---------------
T1J484_STRMM/388-582-------------TA-------------------------------------RV........KEM---------------
D7SVF2_VITVI/28-221-------------IC-------------------------------------RA........SII---------------
W5MKN5_LEPOC/394-587-------------LN-------------------------------------RV........KTL---------------
G1KBZ3_ANOCA/346-550-------------VE-------------------------------------RV........ENL---------------
B4M2G6_DROVI/370-550-------------MK-------------------------------------TI........EQM---------------
B7PDQ5_IXOSC/377-572-------------AE-------------------------------------TV........REM---------------
Q00U21_OSTTA/382-585-------------DV-------------------------------------LG........QRL---------------
D8RMF7_SELML/305-502-------------TH-------------------------------------RA........KVI---------------
F7AL78_CALJA/395-595-------------LK-------------------------------------RV........KDI---------------
A4S8I4_OSTLU/409-616-------------TN-------------------------------------FG........QRI---------------
RBF_DROME/376-560-------------LS-------------------------------------II........EEI---------------
H2UU61_TAKRU/351-546-------------VK-------------------------------------RL........ETF---------------
F5H837_HUMAN/343-535-------------AN-------------------------------------RL........KEM---------------
F6RJP6_XENTR/389-579-------------LN-------------------------------------IV........RDI---------------
A8NFV3_BRUMA/385-584-------------MN-------------------------------------IV........SQL---------------
F6YCW6_XENTR/1-199-------------TE-------------------------------------RV........EHF---------------
W5MK11_LEPOC/379-572-------------TS-------------------------------------RV........KEM---------------
G7Y3X8_CLOSI/355-571-------------RT-------------------------------------TL........DGL---------------
E7FDM3_DANRE/375-568-------------AA-------------------------------------RL........KEM---------------
A9SLF5_PHYPA/390-586-------------KN-------------------------------------RA........HVL---------------
K7J2L5_NASVI/382-576-------------DS-------------------------------------KI........QDF---------------
M4AMR4_XIPMA/258-452-------------QK-------------------------------------RL........ETL---------------
H9KR58_APIME/415-607-------------ET-------------------------------------KV........KEL---------------
W5JE43_ANODA/403-588-------------LE-------------------------------------RV........VRM---------------
W4Y895_STRPU/330-534-------------EQ-------------------------------------RV........EKL---------------
A7RQ05_NEMVE/385-582-------------ID-------------------------------------RV........ENL---------------
C3XU15_BRAFL/375-568-------------SS-------------------------------------RI........KEM---------------
H2YMF2_CIOSA/346-540-------------TA-------------------------------------RV........ERL---------------
F1Q9D6_DANRE/359-569-------------KK-------------------------------------RV........EEL---------------
H9IXG6_BOMMO/327-522-------------NA-------------------------------------KLIKPCNGWMEQF---------------
B4JJ99_DROGR/374-552-------------LK-------------------------------------II........EQM---------------
F4QEM9_DICFS/396-587-------------QT-------------------------------------MACDA.....LNL---------------
A8HY72_CHLRE/423-626-------------MK-------------------------------------RV........RDL---------------
W5LEH3_ASTMX/376-569-------------AG-------------------------------------RL........REM---------------
Q231Q1_TETTS/575-761-------------LE-------------------------------------EA........SQI---------------
B4L4P7_DROMO/352-536-------------LQ-------------------------------------TI........GEM---------------
H3AQ36_LATCH/393-584-------------VS-------------------------------------RV........KEM---------------
W5MR28_LEPOC/371-573-------------TE-------------------------------------RV........VNM---------------
X1WJD7_ACYPI/378-569-------------EN-------------------------------------LI........NIL---------------
E4WSX2_OIKDI/375-564-------------RD-------------------------------------LV........STS---------------
RBR1_ORYSJ/419-619-------------TR-------------------------------------RA........GII---------------
M4B693_HYAAE/488-711-------------AR-------------------------------------VL........RDH---------------
H2MXX9_ORYLA/384-576-------------LA-------------------------------------RV........KTL---------------
RBR1_MAIZE/275-476-------------TE-------------------------------------RV........SIV---------------
H3A0E3_LATCH/386-579-------------SA-------------------------------------RL........KEM---------------
B3S6M6_TRIAD/378-570-------------QS-------------------------------------RI........NEL---------------
W5KDE3_ASTMX/254-459-------------TK-------------------------------------RV........GQL---------------
H9GN70_ANOCA/432-623-------------SN-------------------------------------RV........KEM---------------
M0T571_MUSAM/407-609-------------TR-------------------------------------RA........NII---------------
E1ZEA5_CHLVA/159-357-------------VA-------------------------------------AA........EGM---------------
D0NTP5_PHYIT/460-683-------------TR-------------------------------------VL........REH---------------
U6HGS1_ECHMU/397-581-------------RT-------------------------------------RL........QSL---------------
K1PLH3_CRAGI/285-489-------------KE-------------------------------------RL........GRL---------------
E0VGB1_PEDHC/321-507-------------DF-------------------------------------IV........NEL---------------
U1NNI7_ASCSU/382-582-------------VD-------------------------------------CL........RLM---------------
B9RGU7_RICCO/60-252-------------MT-------------------------------------RA........NVV---------------
D2VQU0_NAEGR/217-404-------------EN-------------------------------------RL........KSL---------------
W5KQG9_ASTMX/387-580-------------LN-------------------------------------RV........KTL---------------

PF03261

Q9V3H5_DROME/91-460...........IQKQPLTLSLP....................QQVQASSIQTKNTNQ..IPRKTV---------------
W4XFC8_STRPU/11-372............................................RKVSSHGLRSSSGVQTNPKKI---------------
B4NP59_DROWI/88-420...........IQKQPLALTLP....................QQLQSSSIQIKNTNQ..IPRKTV---------------
G0MEC3_CAEBE/11-362..TANELSIIGSPTHVPR...PRSI.RDDNANDECD.....QQENYISEKR........GTKKTI---------------
B4MG57_DROVI/90-432...........IQKQPLALTLP....................QQLQISSIQIKNTNQNHLPRKTV---------------
Q0G843_CAEEL/11-364..ASNDLSVIGSPKHVPR...PRSVLRDDNAN..CDISPIAEQENVPSEKR........GTKKTI---------------
I3JGY3_ORENI/11-321..................................ANVATVVAKKNSLTGSGIQPSTAAGTPKRVI---------------
B4G7J4_DROPE/90-428...........IQKQPLTLSLP....................QQMQPSSMQFKNNNQ..FPRKTV---------------
E0VX77_PEDHC/62-395...........GPKTNLS.NIP.....................QSQTSSAISNSSHHQVPPRKTV---------------
Q17C39_AEDAE/119-480...........APKLPL..QLPLPLQPIISQQ..QAVAVAQQQQNQLSQQLHHSGH...GPRKTV---------------
H2VTT9_CAEJA/11-389NENGNEYSISSSPKHVAKCTIPRLINPDDNGN..EDLINYEGDAMLPESAN........GKRRTI---------------

PF01857

E3LY90_CAERE/724-863--------------------------------------------------------------QEL---------------
C3XU15_BRAFL/762-922--------------------------------------------------------------RDL---------------
D6WUA4_TRICA/623-757--------------------------------------------------------------EHL---------------
I7M8B4_TETTS/589-711--------------------------------------------------------------NQV---------------
W5LEH3_ASTMX/770-953--------------------------------------------------------------RDL---------------
W5KQG9_ASTMX/775-930--------------------------------------------------------------RDL---------------
Q00U21_OSTTA/709-837--------------------------------------------------------------GDL---------------
K7J2L5_NASVI/706-866--------------------------------------------------------------QNL---------------
G3NYF0_GASAC/762-926--------------------------------------------------------------RDL---------------
E9GV66_DAPPU/739-928--------------------------------------------------------------QDL---------------
K7V2N7_MAIZE/595-720--------------------------------------------------------------RNL---------------
B4MSL7_DROWI/606-728--------------------------------------------------------------QKL---------------
B9RGU7_RICCO/363-485--------------------------------------------------------------QSI---------------
H3AQ36_LATCH/797-959--------------------------------------------------------------RDL---------------
M4B693_HYAAE/750-894--------------------------------------------------------------YQL---------------
K3YG32_SETIT/683-811--------------------------------------------------------------RSL---------------
RBR_POPTR/755-884--------------------------------------------------------------NGM---------------
F2UP70_SALR5/745-900--------------------------------------------------------------AMI---------------
E9CHS1_CAPO3/877-1004--------------------------------------------------------------SDL---------------
F1QY31_DANRE/771-933--------------------------------------------------------------RDL---------------
H9KR58_APIME/635-797--------------------------------------------------------------LDL---------------
Q17Q73_AEDAE/556-680--------------------------------------------------------------KHL---------------
H3C722_TETNG/743-911--------------------------------------------------------------RDL---------------
D2VQU0_NAEGR/452-591--------------------------------------------------------------QEL---------------
A9SLF5_PHYPA/706-835--------------------------------------------------------------RTV---------------
M0T571_MUSAM/727-855--------------------------------------------------------------KSL---------------
K7GZK7_CAEJA/561-706--------------------------------------------------------------QEL---------------
Q54FX2_DICDI/890-1042--------------------------------------------------------------RKL---------------
B3S6M6_TRIAD/657-840--------------------------------------------------------------KDL---------------
D7SVF2_VITVI/331-459--------------------------------------------------------------NHL---------------
H2P1U6_PONAB/787-943--------------------------------------------------------------RDL---------------
RBL2_MOUSE/831-1011--------------------------------------------------------------RDL---------------
G5EDT1_CAEEL/744-889--------------------------------------------------------------QDL---------------
E7FDM3_DANRE/770-952--------------------------------------------------------------RDL---------------
RBF_DROME/581-705--------------------------------------------------------------QKL---------------
U1NNI7_ASCSU/660-828--------------------------------------------------------------QDL---------------
G1KFZ9_ANOCA/784-927--------------------------------------------------------------RDL---------------
W5MK11_LEPOC/790-976--------------------------------------------------------------RDL---------------
J0XFZ4_LOALO/562-724--------------------------------------------------------------RDL---------------
T1J484_STRMM/718-944--------------------------------------------------------------RDL---------------
I3KPC6_ORENI/788-976--------------------------------------------------------------RDL---------------
D7SU46_VITVI/726-854--------------------------------------------------------------NGM---------------
W4ZBT1_STRPU/363-541--------------------------------------------------------------LDL---------------
T1K8P0_TETUR/710-889--------------------------------------------------------------RDL---------------
A7RQ05_NEMVE/790-960--------------------------------------------------------------RDL---------------
D7G8E5_ECTSI/865-1014--------------------------------------------------------------AEL---------------
H9GN70_ANOCA/847-1031--------------------------------------------------------------RDL---------------
F6RJP6_XENTR/770-927--------------------------------------------------------------RDL---------------
G3N416_GASAC/775-935--------------------------------------------------------------RDL---------------
I3JCL2_ORENI/775-933--------------------------------------------------------------RDL---------------
H2U458_TAKRU/718-908--------------------------------------------------------------RDL---------------
B4M2G6_DROVI/571-694--------------------------------------------------------------GKL---------------
G4VM99_SCHMA/814-941--------------------------------------------------------------RDL---------------
H3A0E3_LATCH/805-987--------------------------------------------------------------RDL---------------
B0XDW3_CULQU/653-812--------------------------------------------------------------KDL---------------
W5JE43_ANODA/665-839--------------------------------------------------------------KDL---------------
T1HVA1_RHOPR/343-480--------------------------------------------------------------KDL---------------
A8HY72_CHLRE/818-944--------------------------------------------------------------ALL---------------
K3WCJ4_PYTUL/862-1000--------------------------------------------------------------FRL---------------
F4X6S3_ACREC/751-913--------------------------------------------------------------QDL---------------
B7PDQ5_IXOSC/761-937--------------------------------------------------------------QDL---------------
H2SIQ5_TAKRU/775-930--------------------------------------------------------------RDL---------------
T1FJQ6_HELRO/776-947--------------------------------------------------------------RDL---------------
E0VGB1_PEDHC/551-709--------------------------------------------------------------QDL---------------
A8WW47_CAEBR/737-882--------------------------------------------------------------QEL---------------
E1ZEA5_CHLVA/548-700--------------------------------------------------------------ADL---------------
M3ZR51_XIPMA/555-736--------------------------------------------------------------RDL---------------
U3I0V9_ANAPL/751-937--------------------------------------------------------------RDL---------------
I1ILE9_BRADI/604-729--------------------------------------------------------------RNL---------------
B7G0K4_PHATC/972-1099--------------------------------------------------------------QII---------------
V8P9V1_OPHHA/768-918--------------------------------------------------------------RDL---------------
RBR1_ARATH/729-857--------------------------------------------------------------NGM---------------
G0NPV8_CAEBE/665-810--------------------------------------------------------------QEL---------------
H3D2K2_TETNG/626-748--------------------------------------------------------------KML---------------
Q7Q5E8_ANOGA/609-787--------------------------------------------------------------CNL---------------
G1NXF3_MYOLU/774-956--------------------------------------------------------------RDL---------------
A0DTJ1_PARTE/585-706--------------------------------------------------------------QVI---------------
C5YE98_SORBI/68-193--------------------------------------------------------------RNL---------------
U3KDL0_FICAL/672-832--------------------------------------------------------------RDL---------------
U6HGS1_ECHMU/721-876--------------------------------------------------------------RAI---------------
C1N5Z8_MICPC/1035-1166--------------------------------------------------------------ADL---------------
F6W3I3_CIOIN/825-983--------------------------------------------------------------RHL---------------
D0NTP5_PHYIT/716-846--------------------------------------------------------------YQL---------------
W1PFC3_AMBTC/737-865--------------------------------------------------------------KSL---------------
W5MKN5_LEPOC/789-946--------------------------------------------------------------RDL---------------
F6VRH0_XENTR/812-995--------------------------------------------------------------KDL---------------
G7Y3X8_CLOSI/746-873--------------------------------------------------------------RDI---------------
E4WSX2_OIKDI/638-762--------------------------------------------------------------QHI---------------
G3WX03_SARHA/792-946--------------------------------------------------------------RDL---------------
D8U756_VOLCA/780-909--------------------------------------------------------------AVL---------------
M4AJJ3_XIPMA/767-924--------------------------------------------------------------RDL---------------
H2NQW4_PONAB/835-1018--------------------------------------------------------------RDL---------------
U6I670_HYMMI/714-860--------------------------------------------------------------RAV---------------
E2AA07_CAMFO/750-912--------------------------------------------------------------QDL---------------
H2YMF2_CIOSA/739-893--------------------------------------------------------------RHL---------------
A4S8I4_OSTLU/745-874--------------------------------------------------------------GDL---------------

PF00382

TF3B_KLULA/193-266--------------------------------------------------------------QHF---------------
TF2B_KLULA/137-207--------------------------------------------------------------TMM---------------
TF2B_YEAST/133-203--------------------------------------------------------------TML---------------
TF3B_CANAL/95-165--------------------------------------------------------------KRI---------------
TF2B_DROME/214-284--------------------------------------------------------------CRF---------------
TF3B_KLULA/98-168--------------------------------------------------------------KAV---------------
TF3B_CANAL/190-263--------------------------------------------------------------QHF---------------
TF2B_DROME/120-190--------------------------------------------------------------SSM---------------
TF2B_KLULA/245-315--------------------------------------------------------------PRF---------------
TF2B_PYRFU/212-282--------------------------------------------------------------NKF---------------
Q5V5V1_HALMA/235-305--------------------------------------------------------------PRF---------------

PF16899

CCNH_ECHMU/168-289LAYRKTQLGEPM...............................................TI.EAG---------------
D2VN70_NAEGR/180-268...........................................................HD.VGG---------------
H3FVF7_PRIPA/67-164.........RDL...............................................PS.TQY---------------
G6D7P5_DANPL/155-246.................................................................---------------
C5DE24_LACTC/194-313.........QSVLA.............................................GK.VDM---------------
H2B1R1_KAZAF/202-304.........QNVLH.............................................DK.VDL---------------
C5DYH4_ZYGRC/193-303.........QVILH.............................................GK.VDL---------------
Q6FMU5_CANGA/203-302.........QKTLH.............................................GK.IDL---------------
G0V973_NAUCC/221-326.........QNVLH.............................................GK.VDL---------------
G0W3A8_NAUDC/222-335.........QNILH.............................................GK.VDL---------------
G2YRH2_BOTF4/184-304.........LAISTHKIPIPAELEPQR................................PE.NMH---------------
R7YVJ7_CONA1/187-325.........LALAAGEGAVVPG..TGKTRQELQEELRRLPLKAHEPPAEQS........DD.AVQ---------------
C9SVU8_VERA1/162-263.........RRH...............................................SD.IKT---------------
L2FZZ6_COLGN/165-276.........RRY...............................................PD.LEK---------------
H1VJI3_COLHI/166-278.........RRH...............................................TD.LEK---------------
M7TNJ7_EUTLA/145-243.........RRL...............................................GG.YDD---------------
G3JT19_CORMM/158-261.........RRK...............................................RP.TEQ---------------
G9NI52_HYPAI/158-265.........RKR...............................................LP.EEE---------------
F9F5Z4_FUSOF/158-263.........RRR...............................................LP.DEE---------------
L8GA30_PSED2/187-302.........QALANGSAPVLPGIDNAEIPPE............................LG.DVA---------------
K1X5Y0_MARBU/178-294.........QAMSLGNIPALPG.GEKLNGDR............................PR.NMG---------------
N1JHL3_BLUG1/188-305.........QAISKMGTPALPG.DSSMIGKK............................PI.NME---------------
H6C5Z8_EXODN/187-301.........NVMADEGRLGGISR....................................ST.NSA---------------
R1EFE2_BOTPV/206-348.........IALAKGENVLLPG..SGRTPQEAQAEMLKLPDKPNGPPTSND........ER.TMT---------------
Q0UGP0_PHANO/193-328.........MEIAKGTYEGPNYLEEGMTSADLSARMLKLPGKKGQPS.NAT........MQ.DME---------------
E5AC16_LEPMJ/211-344.........VQIAHGKYDGPG...DNGTSADIQTRMQSLPSTPGGPATKST........VA.ALE---------------
R0KJU5_SETT2/173-306.........LEMVHAKYQGPA...QGMTPKDIQTKILSLPLKPGATAIKMP........EK.KVE---------------
M3AYY7_MYCFI/177-276.........LNMAD.............................................IK.QAR---------------
N1QKL6_SPHMS/175-275.........LNMAEG............................................RK.QLV---------------
F9XH99_MYCGM/164-291.........INLVDE.........ERDGLKDL........KPPEGGATSWKPPPGGKMEKK.HMN---------------
M2MZH1_BAUCO/171-314.........LNMANGMVGEVIDA.ETRGAKELQASLLDLAKPSSDAKTPWKAPATGSVDVK.HLT---------------
M2YNC7_MYCP1/165-265.........LNMAEG............................................LK.HFI---------------
B6Q284_PENMQ/191-333.........QAIAQGEGQPGPLT.TGQTPESMKQAINNIAPIQGS...D..........KG.SIS---------------
G3Y4C9_ASPNA/188-330.........RAISQGQGQPAPHLQQSQTPEDLRRTLLSLSPSSA....T..........AN.TMN---------------
B0Y3L0_ASPFC/188-332.........QAMAEGLGQPAPHL.PHQTSEDLRRGLLAVPPPPNAP..Q..........SS.SIT---------------
Q5BB69_EMENI/189-333.........NAIAQGLGQPAPHL.PTQTAEDLRRAILSLPPSPNNPSTS..........SS.SIS---------------
G7E2H9_MIXOS/177-279.........QSL...............................................PG.LDE---------------
F8NWE7_SERL9/187-291.........QSL...............................................LD.APA---------------
D8PKL8_SCHCM/182-281.........QTV...............................................PD.APP---------------
K9HXY7_AGABB/176-275.........QSL...............................................PD.VPA---------------
J4HVQ4_FIBRA/73-167.........QSL...............................................PD.APM---------------
E9C7X0_CAPO3/152-254.........RARGA.............................................VS.QTA---------------
E3M1M6_CAERE/158-270.........KTR...............................................ML.LLN---------------
A7S801_NEMVE/159-255.........KMY...............................................LS.EGK---------------
C3ZT09_BRAFL/159-259.........KTR...............................................HR.SAE---------------
I1FML6_AMPQE/158-255.........KTR................................................S.SIP---------------
E4YFZ2_OIKDI/97-198.........RTR...............................................CE.GLQ---------------
G3U0L9_LOXAF/162-261.........KVN...............................................FV.LLC---------------
G1N872_MELGA/126-226.........KTR...............................................YP.LLE---------------
G3UI14_LOXAF/162-261.........KSR...............................................FI.TVY---------------
E3TDV0_ICTPU/162-262.........KTR...............................................YP.LLE---------------
B5DG24_SALSA/163-263.........KTR...............................................YP.LLE---------------
H2RRW1_TAKRU/163-263.........KTR...............................................FP.TLE---------------
K4FV42_CALMI/163-263.........KAR...............................................YS.ALE---------------
Q3KQ83_XENLA/162-262.........KTR...............................................YP.MLE---------------
I7G2X7_MACFA/162-262.........KTR...............................................YP.ILE---------------
H3A0T1_LATCH/164-264.........KTR...............................................YP.TLE---------------
R7UPP9_CAPTE/154-254.........KTR...............................................CE.DID---------------
B7PB82_IXOSC/86-183.........KTR...............................................CP.QFP---------------
G3MNU6_9ACAR/156-256.........KTR...............................................CP.QFP---------------
F6TUV6_CIOIN/161-261.........KTR...............................................YR.NLE---------------
E9G2Q3_DAPPU/159-258.........KTR...............................................FP.TFS---------------
R4G2X9_RHOPR/158-256.........KVR................................................S.RLN---------------
B8YN16_SCYPA/165-265.........KTR...............................................FP.QLH---------------
K7IUX2_NASVI/159-256.........KTR...............................................FP.CPS---------------
E2BY23_HARSA/159-256.........KTR...............................................YS.GLD---------------
H9K562_APIME/183-280.........KTR...............................................YT.SLE---------------
N6TWG3_DENPD/159-258.........KTR................................................G.SLH---------------
Q16JQ2_AEDAE/159-257.........KTR...............................................C..NMN---------------
C6SV35_DROME/162-260.........KTR................................................S.NMQ---------------
D3TRT0_GLOMM/159-257.........KTR...............................................SS.LTN---------------
H9JGM4_BOMMO/159-258.........KTR...............................................CS.LAN---------------
K8F2A8_9CHLO/171-283IHTVNSDGSEDG...............................................SSSNNN---------------
L8GMB5_ACACA/173-270.........KESTS.............................................PP.ASP---------------
Q5SCB4_OSTTA/157-262.........EDGG..............................................CKGATS---------------
A4RUA6_OSTLU/106-212.........EDGG..............................................CK.VTG---------------
D8SKW4_SELML/173-280.........QKW...............................................AD.AAK---------------
A9TM39_PHYPA/166-271.........EVR...............................................CF.VWK---------------
B6TIT4_MAIZE/176-281.........EDF...............................................CR.AGN---------------
I1GNJ7_BRADI/176-281.........DGF...............................................CK.AGN---------------
M8CSB1_AEGTA/98-189.................................................................---------------
R0FFP6_9BRAS/176-281.........EEF...............................................LQ.VRD---------------
K4BTS5_SOLLC/176-282.........EEF...............................................CG.AKD---------------
M0U1N4_MUSAM/177-282.........QEF...............................................CH.ARD---------------
A9PJ64_9ROSI/178-280.........EEF...............................................CH.PTD---------------
B9RF84_RICCO/157-262.........EDF...............................................CH.ATD---------------
M5VZ28_PRUPE/175-280.........EEF...............................................CG.IND---------------
D7U9R4_VITVI/178-283.........EEF...............................................CQ.AKN---------------
G7I853_MEDTR/189-294.........EEL...............................................CI.SGE---------------
I1KBX5_SOYBN/178-283.........EEF...............................................FN.AGD---------------

PF02984

CG11_CANAL/174-308..NNLSNNT...-----------------------------------------------..TNDI---------------
Q9GTQ8_DROME/286-422........PIGS-----------------------------------------------KNFPD.---------------
Q4T8S9_TETNG/1145-1270........PG..-----------------------------------------------...MR.---------------
Q4RZE5_TETNG/155-280........RI..-----------------------------------------------...FP.---------------
A7YYE4_DANRE/155-279........PI..-----------------------------------------------...HQ.---------------
Q7ZYJ6_XENLA/153-279........PL..-----------------------------------------------...TE.---------------
CCND1_BOVIN/155-283........PV..-----------------------------------------------...AE.---------------
CCND1_MOUSE/155-283........PE..-----------------------------------------------...AD.---------------
Q5T8J1_HUMAN/105-230........SL..-----------------------------------------------...PR.---------------
Q5ZKI9_CHICK/155-278........PL..-----------------------------------------------...PK.---------------
Q1L8M6_DANRE/153-279........PF..-----------------------------------------------...HE.---------------
H2Q584_PANTR/154-275........PQ..-----------------------------------------------...QR.---------------
Q3KPK0_XENLA/154-277............-----------------------------------------------...LP.---------------
CCD11_ARATH/184-308........DP..-----------------------------------------------...SG.---------------
Q9SNV2_ANTMA/176-296........DP..-----------------------------------------------...TG.---------------
CCD42_ORYSJ/212-330............-----------------------------------------------...GNA---------------
CCD42_ARATH/171-289............-----------------------------------------------...NG.---------------
CCD41_ARATH/180-299............-----------------------------------------------......---------------
P93103_OXYRB/210-333............-----------------------------------------------......---------------
Q9ZRX9_TOBAC/198-317............-----------------------------------------------......---------------
O82678_OXYRB/199-324............-----------------------------------------------......---------------
Q8LPW3_HELAN/178-304............-----------------------------------------------......---------------
CCD33_ARATH/188-310............-----------------------------------------------......---------------
CCD31_ARATH/189-307............-----------------------------------------------......---------------
Q8LK74_LAGSI/187-313............-----------------------------------------------......---------------
Q9SMD4_SOLLC/184-309............-----------------------------------------------......---------------
Q8GZU3_9ROSI/205-332............-----------------------------------------------......---------------
Q2ABE7_CAMSI/203-327............-----------------------------------------------......---------------
Q9S7H9_SOLLC/192-320............-----------------------------------------------......---------------
A7Y7X0_CUCSA/197-329............-----------------------------------------------......---------------
Q9SNV0_ANTMA/203-329............-----------------------------------------------......---------------
Q40338_MEDSA/212-338............-----------------------------------------------......---------------
Q9SXN7_TOBAC/190-313............-----------------------------------------------......---------------
Q2ABE6_CAMSI/198-326............-----------------------------------------------......---------------
Q7XAB7_EUPES/184-308............-----------------------------------------------......---------------
Q84V88_POPAL/200-324............-----------------------------------------------......---------------
CCNE_HEMPU/255-381NAEE.IANRKTN-----------------------------------------------FHFPS.---------------
Q5U4W4_XENLA/240-362............-----------------------------------------------...SSL---------------
Q5ZMH4_CHICK/247-368............-----------------------------------------------...DAL---------------
Q544H6_MOUSE/241-363............-----------------------------------------------...DAV---------------
CCNE1_HUMAN/244-366............-----------------------------------------------......---------------
B2GQF9_DANRE/246-368............-----------------------------------------------...AYL---------------
CCD61_ARATH/156-288............-----------------------------------------------...FEL---------------
A8XRM2_CAEBR/208-340..LSE.......-----------------------------------------------...DE.---------------
O45926_CAEEL/161-293............-----------------------------------------------LTENDV---------------
CCNB1_CAEEL/208-340..LSE.......-----------------------------------------------...ND.---------------
Q9U7P9_9CILI/566-681............-----------------------------------------------......---------------
Q4T2Y9_TETNG/114-254..SVK.......-----------------------------------------------...ED.---------------
CCNJ_XENLA/145-273..AVH.......-----------------------------------------------...DT.---------------
CG1C_SCHPO/162-278............-----------------------------------------------......---------------
A2F2K2_TRIVA/212-328............-----------------------------------------------...QD.---------------
A2DQ77_TRIVA/248-364............-----------------------------------------------...SG.---------------
A2DZV8_TRIVA/235-351............-----------------------------------------------...SG.---------------
A0C1C9_PARTE/197-310............-----------------------------------------------...GA.---------------
A0DMF0_PARTE/199-312............-----------------------------------------------...GA.---------------
B8N0B1_ASPFN/192-299............-----------------------------------------------...TS.---------------
A4RSW0_OSTLU/207-322............-----------------------------------------------......---------------
Q5SCB7_OSTTA/222-339............-----------------------------------------------......---------------
CCNF_MOUSE/408-531............-----------------------------------------------......---------------
CCNF_XENTR/414-537............-----------------------------------------------......---------------
A2E0Q4_TRIVA/216-333............-----------------------------------------------...AN.---------------
A2E6K7_TRIVA/216-333............-----------------------------------------------...VN.---------------
REM1_SCHPO/273-388............-----------------------------------------------...NK.---------------
Q4CS48_TRYCC/197-328............-----------------------------------------------...GD.---------------
A4HKX7_LEIBR/155-297............-----------------------------------------------GTDEE.---------------
Q4DWL9_TRYCC/229-371............-----------------------------------------------GSLSE.---------------
Q0VA13_XENTR/226-348............-----------------------------------------------...GK.---------------
CCF13_ORYSJ/255-372............-----------------------------------------------...YGD---------------
Q23JX5_TETTS/284-401............-----------------------------------------------...DK.---------------
O96434_PARTE/212-329............-----------------------------------------------...AG.---------------
A0E0R4_PARTE/214-320............-----------------------------------------------...SS.---------------
Q9TY42_PARTE/121-227............-----------------------------------------------...ST.---------------
Q25123_HELRO/240-368............-----------------------------------------------KGPNG.---------------
CCNB3_CAEEL/243-364............-----------------------------------------------...CR.---------------
Q29CG1_DROPS/434-556............-----------------------------------------------...AK.---------------
Q7QC70_ANOGA/538-653............-----------------------------------------------...NR.---------------
Q16VG6_AEDAE/419-535............-----------------------------------------------...NR.---------------
Q25168_HELTR/382-498............-----------------------------------------------...VG.---------------
A7S8H6_NEMVE/110-226............-----------------------------------------------...AS.---------------
Q60FY2_ANGJA/277-393............-----------------------------------------------...VQ.---------------
Q08C91_DANRE/272-388............-----------------------------------------------...VN.---------------
Q60FY1_ORENI/302-418............-----------------------------------------------...VS.---------------
CCNB3_MOUSE/1265-1381............-----------------------------------------------...IH.---------------
K4Q4R6_CHICK/276-392............-----------------------------------------------...AR.---------------
Q3KQA7_XENLA/288-404............-----------------------------------------------...AH.---------------
CCNB3_HUMAN/1259-1375............-----------------------------------------------...IH.---------------
CCNB3_CANFA/1202-1318............-----------------------------------------------...LH.---------------
CCNA1_CAEEL/343-459............-----------------------------------------------...MN.---------------
CCNA_DROME/334-451............-----------------------------------------------......---------------
Q29DY8_DROPS/354-471............-----------------------------------------------...DM.---------------
Q17NN3_AEDAE/310-427............-----------------------------------------------......---------------
Q7Q0E8_ANOGA/187-304............-----------------------------------------------......---------------
CCF32_ORYSJ/267-390............-----------------------------------------------CRGSN.---------------
A3AKA7_ORYSJ/256-379............-----------------------------------------------...SQ.---------------
A2ZM34_ORYSI/249-372............-----------------------------------------------...CQ.---------------
Q39877_SOYBN/214-337............-----------------------------------------------...AS.---------------
Q40488_TOBAC/238-361............-----------------------------------------------...AQ.---------------
CCNAL_DAUCA/208-330............-----------------------------------------------...VQ.---------------
CCA33_ARATH/190-313............-----------------------------------------------...AQ.---------------
Q2V5Z8_BRACM/228-351............-----------------------------------------------...AQ.---------------
CCA31_ARATH/219-342............-----------------------------------------------...AQ.---------------
Q9M4K9_PEA/216-340............-----------------------------------------------...GQ.---------------
O04388_CATRO/238-361............-----------------------------------------------...VQ.---------------
Q40492_TOBAC/247-370............-----------------------------------------------...AQ.---------------
Q39331_BRANA/289-412............-----------------------------------------------...CP.---------------
CCA12_ARATH/310-433............-----------------------------------------------...AQ.---------------
CCA14_ORYSJ/216-339............-----------------------------------------------...AQ.---------------
CCA11_ORYSJ/372-495............-----------------------------------------------...AQ.---------------
Q84LE4_SILLA/352-474............-----------------------------------------------...AQ.---------------
Q40514_TOBAC/347-470............-----------------------------------------------...AQ.---------------
Q96226_ADICA/397-520............-----------------------------------------------...AQ.---------------
Q39878_SOYBN/336-459............-----------------------------------------------...AQ.---------------
Q9XGI4_SOLLC/345-468............-----------------------------------------------...SQ.---------------
CCA22_ARATH/304-427............-----------------------------------------------...AQ.---------------
CCA21_ORYSJ/359-482............-----------------------------------------------...AQ.---------------
CCA24_ARATH/329-452............-----------------------------------------------...AQ.---------------
A5BUM0_VITVI/360-483............-----------------------------------------------...AQ.---------------
Q941M7_MEDSA/349-473............-----------------------------------------------...AQ.---------------
A7SEI5_NEMVE/172-293............-----------------------------------------------...TN.---------------
CCNA_HYDVD/296-415............-----------------------------------------------...ANA---------------
P90681_PATPE/322-438............-----------------------------------------------......---------------
Q6ZZ83_SPHGR/342-458............-----------------------------------------------...AQ.---------------
Q4SG06_TETNG/155-272............-----------------------------------------------QS.A..---------------
O77212_DREPO/291-408............-----------------------------------------------ID.A..---------------
CCNA1_CARAU/268-385............-----------------------------------------------......---------------
CCNA1_XENLA/295-412............-----------------------------------------------...HA.---------------
CCNA1_MOUSE/298-415............-----------------------------------------------...QG.---------------
CCNA_PATVU/302-419............-----------------------------------------------...AD.---------------
Q28DU2_XENTR/291-408............-----------------------------------------------...QP.---------------
Q98TA3_DANRE/305-422............-----------------------------------------------......---------------
CCNA2_BOVIN/307-425............-----------------------------------------------...QQP---------------
CCNA2_CHICK/273-390............-----------------------------------------------......---------------
M1KIP0_ENCCN/179-293............-----------------------------------------------...NN.---------------
Q6FVY0_CANGA/262-383............-----------------------------------------------...DG.---------------
A0A023ZJ88_YEASX/296-418............-----------------------------------------------...DD.---------------
A0A023ZMR1_YEASX/254-374............-----------------------------------------------...DN.---------------
CG21_SCHPO/294-409............-----------------------------------------------...DS.---------------
A0A023ZKJ3_YEASX/338-453............-----------------------------------------------...DD.---------------
Q6FNV2_CANGA/314-429............-----------------------------------------------...DD.---------------
Q6CT04_KLULA/317-432............-----------------------------------------------...DD.---------------
Q75A51_ASHGO/248-363............-----------------------------------------------...DN.---------------
Q6FQU1_CANGA/326-455............-----------------------------------------------...DD.---------------
A6ZXH4_YEAS7/299-414............-----------------------------------------------...DD.---------------
A7TR46_VANPO/331-446............-----------------------------------------------...DD.---------------
Q2HAS9_CHAGB/515-630............-----------------------------------------------...DD.---------------
F5HHN7_NEUCR/516-631............-----------------------------------------------...DD.---------------
Q0UCR8_PHANO/466-581............-----------------------------------------------...DD.---------------
A7F1V1_SCLS1/469-584............-----------------------------------------------...DD.---------------
A1C7V2_ASPCL/489-604............-----------------------------------------------...DD.---------------
Q6BGT2_DEBHA/350-465............-----------------------------------------------...DD.---------------
Q6CE22_YARLI/306-421............-----------------------------------------------...DD.---------------
Q49U21_CRYNE/355-469............-----------------------------------------------...DD.---------------
Q6X269_USTMD/465-579............-----------------------------------------------...DD.---------------
CG22_SCHPO/267-382............-----------------------------------------------...EG.---------------
A0A023ZMC4_YEASX/339-454............-----------------------------------------------...DD.---------------
Q75EI0_ASHGO/418-533............-----------------------------------------------...DD.---------------
Q6FVY1_CANGA/344-459............-----------------------------------------------...DD.---------------
A3LN44_PICST/322-438............-----------------------------------------------...DD.---------------
A5DUV2_LODEL/512-628............-----------------------------------------------...DD.---------------
Q6CEJ4_YARLI/393-508............-----------------------------------------------...DD.---------------
Q0UMA7_PHANO/348-462............-----------------------------------------------...DN.---------------
Q2HAK4_CHAGB/352-466............-----------------------------------------------...DN.---------------
A1CID9_ASPCL/361-475............-----------------------------------------------...DN.---------------
CG23_SCHPO/334-448............-----------------------------------------------...DF.---------------
O93916_PNECA/304-419............-----------------------------------------------...DN.---------------
F5HE42_USTMA/433-547............-----------------------------------------------...DN.---------------
F5H8X2_CRYNB/366-482............-----------------------------------------------...DG.---------------
Q5SCB6_OSTTA/230-346............-----------------------------------------------...AG.---------------
CCB31_ARATH/274-391............-----------------------------------------------...AQ.---------------
Q9ZRG1_PEA/135-252............-----------------------------------------------...AQ.---------------
CCB21_ARATH/302-419............-----------------------------------------------...AQ.---------------
CCB22_ARATH/303-421............-----------------------------------------------...AQ.---------------
Q9XGI1_SOLLC/308-425............-----------------------------------------------...AQ.---------------
CCNB2_MEDSA/201-318............-----------------------------------------------...AQ.---------------
CCB23_ARATH/308-425............-----------------------------------------------...AQ.---------------
CCB24_ARATH/309-426............-----------------------------------------------...AQ.---------------
Q2WGP0_ALLCE/280-397............-----------------------------------------------...AG.---------------
B8AT55_ORYSI/285-402............-----------------------------------------------...AQ.---------------
CCB22_ORYSI/293-410............-----------------------------------------------...AQ.---------------
Q41734_MAIZE/282-407............-----------------------------------------------...AT.---------------
P93646_MAIZE/356-473............-----------------------------------------------...AM.---------------
CCB13_ORYSJ/341-458............-----------------------------------------------...AL.---------------
O65064_PICMA/98-215............-----------------------------------------------......---------------
Q41733_MAIZE/317-437............-----------------------------------------------...AG.---------------
CCB14_ARATH/260-379............-----------------------------------------------...AV.---------------
CCB11_ARATH/295-418............-----------------------------------------------...SI.---------------
P93102_OXYRB/319-438............-----------------------------------------------...SV.---------------
Q2WGP2_ALLCE/358-475............-----------------------------------------------......---------------
CCB12_ARATH/312-429............-----------------------------------------------......---------------
CCB13_ARATH/289-406............-----------------------------------------------...SG.---------------
A5AEK5_VITVI/324-442............-----------------------------------------------......---------------
O04398_TOBAC/319-436............-----------------------------------------------......---------------
Q40516_TOBAC/291-408............-----------------------------------------------......---------------
O82137_PEA/102-224............-----------------------------------------------...ASV---------------
O82717_LUPLU/324-441............-----------------------------------------------......---------------
P93557_SESRO/318-435............-----------------------------------------------......---------------
O04389_CATRO/313-431............-----------------------------------------------...SV.---------------
Q2PHK8_DAUCA/314-432............-----------------------------------------------...SI.---------------
Q2PHK9_DAUCA/330-448............-----------------------------------------------...SL.---------------
Q9LKC6_CICAR/324-443............-----------------------------------------------......---------------
CCN2_ANTMA/319-438............-----------------------------------------------......---------------
Q5D894_GOSHI/87-204............-----------------------------------------------......---------------
Q40223_LUPLU/307-426............-----------------------------------------------...ST.---------------
Q39880_SOYBN/313-433............-----------------------------------------------...ST.---------------
Q2PHL0_DAUCA/311-430............-----------------------------------------------...SV.---------------
Q2ABE9_CAMSI/308-433............-----------------------------------------------...SV.---------------
Q9SBQ4_PETHY/303-423............-----------------------------------------------...AM.---------------
Q9XGI2_SOLLC/248-367............-----------------------------------------------...AV.---------------
Q5D8P0_SCHJA/269-392............-----------------------------------------------...VD.---------------
CCNB_DICDI/316-434............-----------------------------------------------...AG.---------------
P92162_BOMMO/389-509............-----------------------------------------------...AR.---------------
Q4TVR6_HELTR/235-352............-----------------------------------------------...GE.---------------
A7SPG5_NEMVE/166-283............-----------------------------------------------...GA.---------------
Q4T0M3_TETNG/224-342............-----------------------------------------------...YE.---------------
CCNB1_ANGJA/272-390............-----------------------------------------------...GE.---------------
CCNB1_CARAU/266-384............-----------------------------------------------...GD.---------------
CCNB1_CRIGR/296-414............-----------------------------------------------...GE.---------------
Q6P801_XENTR/266-384............-----------------------------------------------...GE.---------------
O93228_RANJA/239-357............-----------------------------------------------...GE.---------------
Q6IR86_XENLA/262-380............-----------------------------------------------...GE.---------------
Q7ZVA8_DANRE/252-370............-----------------------------------------------...GN.---------------
Q09IZ1_ONCMY/251-369............-----------------------------------------------...GN.---------------
CCNB2_ORYLA/254-372............-----------------------------------------------...AG.---------------
Q28GP5_XENTR/256-374............-----------------------------------------------...CS.---------------
Q6T2E9_BUFGR/263-381............-----------------------------------------------...CS.---------------
CCNB2_CHICK/268-386............-----------------------------------------------...GE.---------------
Q7Z4Z4_HUMAN/264-382............-----------------------------------------------...GE.---------------
CCNB_MARGL/258-375............-----------------------------------------------...GG.---------------
CCNB_PATPE/272-390............-----------------------------------------------...GG.---------------
Q95WE6_PATPE/274-391............-----------------------------------------------...GG.---------------
Q5UAU8_PENJP/269-385............-----------------------------------------------...GS.---------------
CCNB_SPISO/299-415............-----------------------------------------------...GQ.---------------
CCNB_PATVU/282-398............-----------------------------------------------...GQ.---------------
CCNB_HYDVD/264-380............-----------------------------------------------...GA.---------------
CCNB_ARBPU/274-395............-----------------------------------------------...AG.---------------
Q94740_SPHGR/281-401............-----------------------------------------------...AM.---------------
Q291N4_DROPS/375-501............-----------------------------------------------...AG.---------------
Q16TY2_AEDAE/355-477............-----------------------------------------------...AK.---------------
Q7PPJ1_ANOGA/320-449............-----------------------------------------------...AK.---------------

PF00134

CCNA2_MOUSE/171-297-----------------------------------------------------LVDWLVE.VG----------E------
CCNB3_CAEEL/115-241-----------------------------------------------------LIDWMVE.IQ----------E------
CCNF_MOUSE/281-406-----------------------------------------------------LIDWLVE.VA----------T------
CCT12_ARATH/28-169-----------------------------------------------------YCTFLEI.LG----------E------
CCNE_CAEEL/232-360-----------------------------------------------------LIDWMME.VC----------E------
REM1_SCHPO/145-271-----------------------------------------------------VINWIVG.VH----------T------
O45926_CAEEL/34-159-----------------------------------------------------LVDWLIQ.VH----------L------
CCB14_ARATH/133-258-----------------------------------------------------LIDWLVD.VH----------R------
CCU41_ARATH/22-148-----------------------------------------------------IQSYLER.IF----------K------
CCNB2_HUMAN/137-262-----------------------------------------------------LVDWLVQ.VH----------S------
CCNT_DROME/42-176-----------------------------------------------------TAYLIQE.MG----------Q------
CG23_SCHPO/206-332-----------------------------------------------------LTDWLIE.VH----------S------
CCNA_DROME/206-332-----------------------------------------------------LIDWLVE.VS----------E------
CG12_YEAST/43-195-----------------------------------------------------IITFLFE.LS----------V------
CCNB_DROME/260-387-----------------------------------------------------LIDWINE.VH----------L------
CCNB1_MOUSE/170-295-----------------------------------------------------LIDWLIQ.VQ----------M------
CG21_SCHPO/166-292-----------------------------------------------------LVDWIVQ.VQ----------I------
PCL1_YEAST/19-152-----------------------------------------------------LMTFITR.LV----------R------
CG21_YEAST/212-337-----------------------------------------------------LVNWIIK.IH----------N------
CG22_YEAST/232-357-----------------------------------------------------LVNWLVK.IH----------N------
CG23_YEAST/171-297-----------------------------------------------------LIDWIVQ.VH----------E------
CG24_YEAST/210-336-----------------------------------------------------MIDWLVQ.LH----------F------
PUC1_SCHPO/99-227-----------------------------------------------------LVNFIVE.IH----------N------
CCNB1_SOYBN/197-322-----------------------------------------------------LVDWLID.VH----------T------
PCL2_YEAST/18-146-----------------------------------------------------LTKFINR.LI----------K------
CCNB2_CHICK/141-266-----------------------------------------------------LVDWLVQ.VH----------S------
CCB11_ARATH/168-293-----------------------------------------------------LVEWLID.VH----------V------
CCND2_MOUSE/24-151-----------------------------------------------------VATWMLE.VC----------E------
CCND3_HUMAN/26-153-----------------------------------------------------LAYWMLE.VC----------E------
CGS5_YEAST/165-294-----------------------------------------------------LVDWLVE.VH----------E------
CG21_EMENI/211-337-----------------------------------------------------LVDWLIE.VH----------T------
CGS6_YEAST/123-252-----------------------------------------------------LIDWLVE.VH----------E------
CCNA1_CAEEL/215-341-----------------------------------------------------LIDWFSD.VV----------K------
CG22_SCHPO/139-265-----------------------------------------------------LNEWLVE.IH----------S------
CCND1_RAT/26-153-----------------------------------------------------VATWMLE.VC----------E------
CCNB3_CHICK/149-274-----------------------------------------------------LVDWMVE.VQ----------E------
CCNB_DICDI/188-314-----------------------------------------------------LVDWMMA.VH----------V------
CCD11_ARATH/50-182-----------------------------------------------------SVAWILK.VQ----------A------
CCD21_ARATH/65-197-----------------------------------------------------ALDWILK.VC----------A------
SSN8_YEAST/45-176-----------------------------------------------------YCYFLIMKLG----------R------
CCNE1_CHICK/112-239-----------------------------------------------------LLDWLME.VC----------E------
CCNE_DROME/330-459-----------------------------------------------------LLDWLIE.VC----------E------
CCNA1_HUMAN/214-340-----------------------------------------------------LVDWLVE.VG----------E------
P92162_BOMMO/260-387-----------------------------------------------------LIDWLVE.VQ----------R------
CCC11_ORYSJ/4-144-----------------------------------------------------HMSFHIWRLA----------Q------
CGH2_SHV21/22-148-----------------------------------------------------LLTWMHL.LC----------E------
CCNB1_CAEEL/81-206-----------------------------------------------------LVDWLVQ.VH----------V------
PCL9_YEAST/19-146-----------------------------------------------------LSIFIKN.VV----------I------
CCA22_ARATH/175-302-----------------------------------------------------LIDWLVE.VS----------D------
CCB12_ARATH/185-310-----------------------------------------------------LIDWLLE.VH----------I------
CCB21_ARATH/174-300-----------------------------------------------------LIDWLIE.VH----------D------
Q39878_SOYBN/207-334-----------------------------------------------------LVDWLVE.VS----------E------
CCNE1_MOUSE/113-240-----------------------------------------------------LLDWLME.VC----------E------
CCB21_ORYSJ/157-283-----------------------------------------------------LIDWLIE.VH----------H------
CCD41_ARATH/45-178-----------------------------------------------------ALNWIWK.AC----------E------
CCNB3_DROME/308-433-----------------------------------------------------LVDWMVE.VQ----------E------
Q9S7H9_SOLLC/61-190-----------------------------------------------------ALDWMLR.VI----------A------
CCB31_ARATH/146-272-----------------------------------------------------LINWLIE.VH----------F------
CCB24_ARATH/180-307-----------------------------------------------------LFDWLIE.VH----------Y------
Q9SMD4_SOLLC/51-182-----------------------------------------------------SVEWILK.TT----------A------
CCD33_ARATH/59-186-----------------------------------------------------ALDWIFK.VK----------S------
Q9U2M5_CAEEL/72-201-----------------------------------------------------AIDWIYD.VA----------K------
Q9VE72_DROME/6-144-----------------------------------------------------VPMYIFE.CA----------A------
Q9VKF0_DROME/205-327-----------------------------------------------------IYKFVRT.LF----------N------
Q9VZP3_DROME/42-165-----------------------------------------------------MLQLLKL.AT----------S------
Q9XGI1_SOLLC/180-306-----------------------------------------------------LIDWLIE.VH----------H------
CCNE2_MOUSE/112-239-----------------------------------------------------LLDWLLE.VC----------E------
CCD61_ARATH/26-154-----------------------------------------------------AISSITQ.YS----------R------
A0BXX7_PARTE/85-212-----------------------------------------------------LVDWLID.VH----------A------
A9UMS1_XENTR/114-240-----------------------------------------------------LLDWLME.VC----------E------
B4FZZ7_MAIZE/193-318-----------------------------------------------------LAGWIIE.VH----------H------
B8A2G9_MAIZE/228-354-----------------------------------------------------LIDWIIE.VQ----------Y------
C4J9B6_MAIZE/173-299-----------------------------------------------------LIDWLIE.VH----------Y------
E9QJ66_DANRE/140-266-----------------------------------------------------LVDWLVE.VG----------E------
F1QBQ7_DANRE/117-243-----------------------------------------------------LLDWLME.VC----------E------
F6QF79_XENTR/139-263-----------------------------------------------------LIDWLVQ.VQ----------M------
F6QGW4_XENTR/133-257-----------------------------------------------------LVDWIVQ.VH----------S------
I1K835_SOYBN/85-213-----------------------------------------------------LVDWLVE.VA----------V------
I1M770_SOYBN/186-311-----------------------------------------------------LVDWLIE.VH----------R------
J3KY10_ORYBR/200-327-----------------------------------------------------LIDWLVE.VA----------E------
K7V0X7_MAIZE/191-316-----------------------------------------------------LADWLIE.SH----------R------
M1A5P4_SOLTU/185-310-----------------------------------------------------LVDWLIE.AH----------K------
M4E4A3_BRARP/154-281-----------------------------------------------------LVDWLVE.VS----------E------
M7PCR8_PNEMU/176-302-----------------------------------------------------LVDWLIE.VH----------A------
CG11_CANAL/44-171-----------------------------------------------------LLDFLIE.LH----------S------
CG24_CANAL/234-359-----------------------------------------------------LIDWVVQ.VH----------A------
CG13_CANAL/44-171-----------------------------------------------------LLDFLME.VI----------T------
CG21_CANAL/208-334-----------------------------------------------------LVDWLVE.MH----------L------
Q6BFS2_PARTE/82-209-----------------------------------------------------LLDWLID.VH----------L------
VCYCL_HHV8P/21-146-----------------------------------------------------LGTWMFS.VC----------Q------
Q7KUZ5_DROME/153-280-----------------------------------------------------VAEWMME.VC----------A------
T1EGC7_HELRO/166-290-----------------------------------------------------LVDWLVE.VA----------D------
T1FNQ9_HELRO/256-380-----------------------------------------------------LVDWLVE.VQ----------Q------
W4XEA0_STRPU/126-253-----------------------------------------------------LLDWLIE.VC----------E------
W4XJF2_STRPU/207-332-----------------------------------------------------LVDWLVE.VS----------E------

PF08613

PHO80_YEAST/33-170.................................................PNISIFNYFIR-LT..........K------
PSL1_SCHPO/29-176.................................................PSISIQAYLTR-IL..........K------
PCL7_YEAST/108-264.................................................PEIAVVQYLER-IQ..........K------
Q1K4U8_NEUCR/157-314.................................................PPISITDYLLR-IH..........Q------
Q389J6_TRYB2/370-620DAEAEVMARDGACTTKLHRVEPRLEERVTARRENHVGNVVGRLFRDQSEDAVDLGSDCSK-LQLLIVSVGLTVS------
Q6H3X9_ORYSJ/18-159.................................................PGISVRAYAAR-IA..........R------

PF01858

K1Q8Z2_CRAGI/498-695-----------------------------------------------------GEIFCAHYVK----------E...TD.
K3WCJ4_PYTUL/615-824-----------------------------------------------------SQKLMTSRRR----------AAGLPPT
E9IWV1_SOLIN/372-568-----------------------------------------------------GEQFCSNYNS----------NADMTN.
A9UZQ5_MONBE/439-632-----------------------------------------------------LSVVQDQVVR----------ALRGHQY
E9GV66_DAPPU/393-588-----------------------------------------------------GEKFCAHYVN----------Q...AD.
RBR_RICCO/415-616-----------------------------------------------------LEAIFPSNAL----------G......
Q54FX2_DICDI/628-829-----------------------------------------------------TNNTDSLFSI----------GGIDDHQ
F6VRH0_XENTR/413-608-----------------------------------------------------SETFCENTDS----------V...AE.
V8P9V1_OPHHA/376-569-----------------------------------------------------GDIFHQNYTL----------S...VN.
G0NPV8_CAEBE/426-611-----------------------------------------------------ASKFEQTLSE----------E......
H0ZAT2_TAEGU/371-563-----------------------------------------------------HDVYCQSTQS----------E....GE
B0XDW3_CULQU/318-505-----------------------------------------------------REKFSKQMRE----------QNWNQK.
F6W3I3_CIOIN/403-597-----------------------------------------------------REIIKKKYME----------R...GG.
F7CLV0_MACMU/99-291-----------------------------------------------------GETFCQHYTQ----------S...TGF
I3KPC6_ORENI/402-595-----------------------------------------------------FDVFSQHYED----------D..AADG
K7GZK7_CAEJA/310-501-----------------------------------------------------TEKFEHKLST----------E......
F1NAY3_CHICK/355-559-----------------------------------------------------GHIFKKKFAE----------A...VG.
T1K8P0_TETUR/388-595-----------------------------------------------------GDEFLKNYCQ----------P...SE.
RBL1_MOUSE/385-578-----------------------------------------------------GETFCQHYTQ----------S...TD.
Q7Q5E8_ANOGA/392-578-----------------------------------------------------RARFVKRLTE----------Q......
T1HVA1_RHOPR/31-215-----------------------------------------------------RDFLRTNTNE----------E......
T1J484_STRMM/388-582-----------------------------------------------------GITFCTQYAQ----------P...SD.
D7SVF2_VITVI/28-221-----------------------------------------------------LAAIFPRGCN----------G......
W5MKN5_LEPOC/394-587-----------------------------------------------------GELFRQHYTR----------V...TE.
G1KBZ3_ANOCA/346-550-----------------------------------------------------GRIFKEKFAE----------A...VG.
B4M2G6_DROVI/370-550-----------------------------------------------------ELKFLAKYPI----------.......
B7PDQ5_IXOSC/377-572-----------------------------------------------------GGIFVKAYTQ----------P...AP.
Q00U21_OSTTA/382-585-----------------------------------------------------GQAIREDALV----------T......
D8RMF7_SELML/305-502-----------------------------------------------------LEAIFPIYSP----------G......
F7AL78_CALJA/395-595-----------------------------------------------------GYIFKEKFAE----------A...VG.
A4S8I4_OSTLU/409-616-----------------------------------------------------GQAIREDALV----------T......
RBF_DROME/376-560-----------------------------------------------------EQKFLAKYP.----------.......
H2UU61_TAKRU/351-546-----------------------------------------------------GETFSQRFGQ----------A...VG.
F5H837_HUMAN/343-535-----------------------------------------------------FEIYSQHFQP----------D....ED
F6RJP6_XENTR/389-579-----------------------------------------------------GRRFCHHYTQ----------S...TE.
A8NFV3_BRUMA/385-584-----------------------------------------------------SERLEEVIEN----------E...GR.
F6YCW6_XENTR/1-199-----------------------------------------------------GHVFKEKFAS----------S...VG.
W5MK11_LEPOC/379-572-----------------------------------------------------FETFCLRYSG----------K...GEG
G7Y3X8_CLOSI/355-571-----------------------------------------------------VNEFQRVYAG----------SPDTNPV
E7FDM3_DANRE/375-568-----------------------------------------------------SEIFLQNYEG----------T...GDD
A9SLF5_PHYPA/390-586-----------------------------------------------------LELIFSVERR----------G......
K7J2L5_NASVI/382-576-----------------------------------------------------GKMFCEAYSP----------K..VTE.
M4AMR4_XIPMA/258-452-----------------------------------------------------GQVFSQKFGE----------A...VG.
H9KR58_APIME/415-607-----------------------------------------------------GEQFCANYNR----------S...TN.
W5JE43_ANODA/403-588-----------------------------------------------------RARFVGRLTQ----------EGWNAR.
W4Y895_STRPU/330-534-----------------------------------------------------KELFVGHYVG----------E...VG.
A7RQ05_NEMVE/385-582-----------------------------------------------------GEIFLKEYVQ----------P...SA.
C3XU15_BRAFL/375-568-----------------------------------------------------GEQFCTSYTQ----------P...SE.
H2YMF2_CIOSA/346-540-----------------------------------------------------KKTIKLKHTE----------R...CG.
F1Q9D6_DANRE/359-569-----------------------------------------------------GEVFIQRFAQ----------A...VG.
H9IXG6_BOMMO/327-522-----------------------------------------------------GASLKEAHNT----------PHSETI.
B4JJ99_DROGR/374-552-----------------------------------------------------GNKFLAKYPM----------.......
F4QEM9_DICFS/396-587-----------------------------------------------------AQPFLSQQVG----------SSGG...
A8HY72_CHLRE/423-626-----------------------------------------------------VASVIPDEAA----------PSLLGPF
W5LEH3_ASTMX/376-569-----------------------------------------------------SEAFLQNYET----------K...QEE
Q231Q1_TETTS/575-761-----------------------------------------------------ARDVYYSVKK----------KNEVSG.
B4L4P7_DROMO/352-536-----------------------------------------------------EEQFVDKFPM----------.......
H3AQ36_LATCH/393-584-----------------------------------------------------GEKFCHHYTQ----------S...SE.
W5MR28_LEPOC/371-573-----------------------------------------------------RELFIDRFAR----------A...VG.
X1WJD7_ACYPI/378-569-----------------------------------------------------GIKFCSQYCQ----------V......
E4WSX2_OIKDI/375-564-----------------------------------------------------SNIILEKLTG----------KRDKS..
RBR1_ORYSJ/419-619-----------------------------------------------------LGAIFTSSSF----------G......
M4B693_HYAAE/488-711-----------------------------------------------------SEMLLAARKP----------GRATTGK
H2MXX9_ORYLA/384-576-----------------------------------------------------GQTFKEHYTN----------D...SE.
RBR1_MAIZE/275-476-----------------------------------------------------LEAIFPTKSS----------A......
H3A0E3_LATCH/386-579-----------------------------------------------------YDVFCHCSTQ----------S...DGE
B3S6M6_TRIAD/378-570-----------------------------------------------------KETFYDSYTK----------I...DD.
W5KDE3_ASTMX/254-459-----------------------------------------------------GQIFCQKFAE----------A...VG.
H9GN70_ANOCA/432-623-----------------------------------------------------YEIYCQKTQS----------Q....GD
M0T571_MUSAM/407-609-----------------------------------------------------LEAIFPSSSF----------G......
E1ZEA5_CHLVA/159-357-----------------------------------------------------AKAAFP....----------.......
D0NTP5_PHYIT/460-683-----------------------------------------------------SELLLAARTT----------GRVTAGR
U6HGS1_ECHMU/397-581-----------------------------------------------------SHDFTAAYVA----------SGNSAT.
K1PLH3_CRAGI/285-489-----------------------------------------------------ETVFTNTFAE----------Q...TD.
E0VGB1_PEDHC/321-507-----------------------------------------------------GKKFGEAYNQ----------PNDHTP.
U1NNI7_ASCSU/382-582-----------------------------------------------------GDKLENAVAA----------E...RE.
B9RGU7_RICCO/60-252-----------------------------------------------------LSALFP....----------.......
D2VQU0_NAEGR/217-404-----------------------------------------------------VDKV......----------.......
W5KQG9_ASTMX/387-580-----------------------------------------------------GETFKENYTK----------Q...TE.

PF03261

Q9V3H5_DROME/91-460------------------------------------------IQASTSELLKCLGMFLHCRCQ----------R------
W4XFC8_STRPU/11-372------------------------------------------LQCSTSELLKCLGNFLCRRCP----------Y------
B4NP59_DROWI/88-420------------------------------------------IQASTSELLKCLGIFLQYKCQ----------R------
G0MEC3_CAEBE/11-362------------------------------------------IQASTSELLRGLGIFISKNC.----------D------
B4MG57_DROVI/90-432------------------------------------------IQASTSELLKCLGLFLHYRCH----------R------
Q0G843_CAEEL/11-364------------------------------------------IQASTSELLRGLGIFISNNC.----------D------
I3JGY3_ORENI/11-321------------------------------------------VQASTSELMRSLGEFLCRRCY----------R------
B4G7J4_DROPE/90-428------------------------------------------IQASTSELLKCLGIFLHCRCQ----------R------
E0VX77_PEDHC/62-395------------------------------------------IQASTSELLKCLGIYLHNKCY----------R------
Q17C39_AEDAE/119-480------------------------------------------IQASTSELLKCLGMFLHDRCR----------K------
H2VTT9_CAEJA/11-389------------------------------------------IQASTSELLRGLGIFIANHC.----------T------

PF01857

E3LY90_CAERE/724-863-----------------------------------------------------T.DRV.....-----------------
C3XU15_BRAFL/762-922-----------------------------------------------------C.EKL.....-----------------
D6WUA4_TRICA/623-757-----------------------------------------------------C.THL.....-----------------
I7M8B4_TETTS/589-711-----------------------------------------------------C.SAL.....-----------------
W5LEH3_ASTMX/770-953-----------------------------------------------------C.VKL.....-----------------
W5KQG9_ASTMX/775-930-----------------------------------------------------C.LKL.....-----------------
Q00U21_OSTTA/709-837-----------------------------------------------------A.SRL.....-----------------
K7J2L5_NASVI/706-866-----------------------------------------------------C.QSL.....-----------------
G3NYF0_GASAC/762-926-----------------------------------------------------C.SKL.....-----------------
E9GV66_DAPPU/739-928-----------------------------------------------------C.NRL.....-----------------
K7V2N7_MAIZE/595-720-----------------------------------------------------C.ERI.....-----------------
B4MSL7_DROWI/606-728-----------------------------------------------------C.SEL.....-----------------
B9RGU7_RICCO/363-485-----------------------------------------------------A.ERL.....-----------------
H3AQ36_LATCH/797-959-----------------------------------------------------C.LKL.....-----------------
M4B693_HYAAE/750-894-----------------------------------------------------C.NML.....-----------------
K3YG32_SETIT/683-811-----------------------------------------------------C.ERL.....-----------------
RBR_POPTR/755-884-----------------------------------------------------I.EKL.....-----------------
F2UP70_SALR5/745-900-----------------------------------------------------C..RLAD...-----------------
E9CHS1_CAPO3/877-1004-----------------------------------------------------C.EKL.....-----------------
F1QY31_DANRE/771-933-----------------------------------------------------C.LKL.....-----------------
H9KR58_APIME/635-797-----------------------------------------------------C.GSL.....-----------------
Q17Q73_AEDAE/556-680-----------------------------------------------------C.AHL.....-----------------
H3C722_TETNG/743-911-----------------------------------------------------C.WKL.....-----------------
D2VQU0_NAEGR/452-591-----------------------------------------------------C.YHFNQTQQ-----------------
A9SLF5_PHYPA/706-835-----------------------------------------------------C.ERI.....-----------------
M0T571_MUSAM/727-855-----------------------------------------------------G.EKL.....-----------------
K7GZK7_CAEJA/561-706-----------------------------------------------------T.DRV.....-----------------
Q54FX2_DICDI/890-1042-----------------------------------------------------I.HAM.....-----------------
B3S6M6_TRIAD/657-840-----------------------------------------------------C.RSL.....-----------------
D7SVF2_VITVI/331-459-----------------------------------------------------T.LRL.....-----------------
H2P1U6_PONAB/787-943-----------------------------------------------------C.LKL.....-----------------
RBL2_MOUSE/831-1011-----------------------------------------------------C.IKL.....-----------------
G5EDT1_CAEEL/744-889-----------------------------------------------------T.DRV.....-----------------
E7FDM3_DANRE/770-952-----------------------------------------------------C.AKL.....-----------------
RBF_DROME/581-705-----------------------------------------------------C.SEL.....-----------------
U1NNI7_ASCSU/660-828-----------------------------------------------------C.ERV.....-----------------
G1KFZ9_ANOCA/784-927-----------------------------------------------------C.LKL.....-----------------
W5MK11_LEPOC/790-976-----------------------------------------------------C.AKL.....-----------------
J0XFZ4_LOALO/562-724-----------------------------------------------------C.ERV.....-----------------
T1J484_STRMM/718-944-----------------------------------------------------C.ERL.....-----------------
I3KPC6_ORENI/788-976-----------------------------------------------------C.TRL.....-----------------
D7SU46_VITVI/726-854-----------------------------------------------------V.ERL.....-----------------
W4ZBT1_STRPU/363-541-----------------------------------------------------C.HRL.....-----------------
T1K8P0_TETUR/710-889-----------------------------------------------------C.DKL.....-----------------
A7RQ05_NEMVE/790-960-----------------------------------------------------C.ARL.....-----------------
D7G8E5_ECTSI/865-1014-----------------------------------------------------CLRRL.....-----------------
H9GN70_ANOCA/847-1031-----------------------------------------------------C.LKL.....-----------------
F6RJP6_XENTR/770-927-----------------------------------------------------C.LKL.....-----------------
G3N416_GASAC/775-935-----------------------------------------------------C.VRM.....-----------------
I3JCL2_ORENI/775-933-----------------------------------------------------C.VKL.....-----------------
H2U458_TAKRU/718-908-----------------------------------------------------C.AKL.....-----------------
B4M2G6_DROVI/571-694-----------------------------------------------------C.SEL.....-----------------
G4VM99_SCHMA/814-941-----------------------------------------------------C.ERL.....-----------------
H3A0E3_LATCH/805-987-----------------------------------------------------C.SKL.....-----------------
B0XDW3_CULQU/653-812-----------------------------------------------------C.NNL.....-----------------
W5JE43_ANODA/665-839-----------------------------------------------------C.QSL.....-----------------
T1HVA1_RHOPR/343-480-----------------------------------------------------C.DWL.....-----------------
A8HY72_CHLRE/818-944-----------------------------------------------------C.ENF.....-----------------
K3WCJ4_PYTUL/862-1000-----------------------------------------------------G.TML.....-----------------
F4X6S3_ACREC/751-913-----------------------------------------------------C.NSL.....-----------------
B7PDQ5_IXOSC/761-937-----------------------------------------------------C.DRL.....-----------------
H2SIQ5_TAKRU/775-930-----------------------------------------------------C.WKL.....-----------------
T1FJQ6_HELRO/776-947-----------------------------------------------------C.DRI.....-----------------
E0VGB1_PEDHC/551-709-----------------------------------------------------C.VKL.....-----------------
A8WW47_CAEBR/737-882-----------------------------------------------------T.DRI.....-----------------
E1ZEA5_CHLVA/548-700-----------------------------------------------------L.SRLDTH..-----------------
M3ZR51_XIPMA/555-736-----------------------------------------------------C.AKL.....-----------------
U3I0V9_ANAPL/751-937-----------------------------------------------------C.VKL.....-----------------
I1ILE9_BRADI/604-729-----------------------------------------------------C.ERL.....-----------------
B7G0K4_PHATC/972-1099-----------------------------------------------------C.KEL.....-----------------
V8P9V1_OPHHA/768-918-----------------------------------------------------C.SKL.....-----------------
RBR1_ARATH/729-857-----------------------------------------------------V.ERL.....-----------------
G0NPV8_CAEBE/665-810-----------------------------------------------------T.DRI.....-----------------
H3D2K2_TETNG/626-748-----------------------------------------------------C.SHL.....-----------------
Q7Q5E8_ANOGA/609-787-----------------------------------------------------C.QNL.....-----------------
G1NXF3_MYOLU/774-956-----------------------------------------------------C.LKL.....-----------------
A0DTJ1_PARTE/585-706-----------------------------------------------------C.SNI.....-----------------
C5YE98_SORBI/68-193-----------------------------------------------------C.ERV.....-----------------
U3KDL0_FICAL/672-832-----------------------------------------------------C.LKL.....-----------------
U6HGS1_ECHMU/721-876-----------------------------------------------------C.ERIQSSSG-----------------
C1N5Z8_MICPC/1035-1166-----------------------------------------------------C.DRL.....-----------------
F6W3I3_CIOIN/825-983-----------------------------------------------------C.EQL.....-----------------
D0NTP5_PHYIT/716-846-----------------------------------------------------C.NLL.....-----------------
W1PFC3_AMBTC/737-865-----------------------------------------------------C.ERL.....-----------------
W5MKN5_LEPOC/789-946-----------------------------------------------------C.LKL.....-----------------
F6VRH0_XENTR/812-995-----------------------------------------------------C.LKL.....-----------------
G7Y3X8_CLOSI/746-873-----------------------------------------------------C.ERL.....-----------------
E4WSX2_OIKDI/638-762-----------------------------------------------------S.QRL.....-----------------
G3WX03_SARHA/792-946-----------------------------------------------------C.LKL.....-----------------
D8U756_VOLCA/780-909-----------------------------------------------------C.DNF.....-----------------
M4AJJ3_XIPMA/767-924-----------------------------------------------------C.LKL.....-----------------
H2NQW4_PONAB/835-1018-----------------------------------------------------C.AKL.....-----------------
U6I670_HYMMI/714-860-----------------------------------------------------C.ERVQPPVS-----------------
E2AA07_CAMFO/750-912-----------------------------------------------------C.NSL.....-----------------
H2YMF2_CIOSA/739-893-----------------------------------------------------C.EQL.....-----------------
A4S8I4_OSTLU/745-874-----------------------------------------------------A.SRL.....-----------------

PF00382

TF3B_KLULA/193-266-----------------------------------------------------A-EKL----------------------
TF2B_KLULA/137-207-----------------------------------------------------C-DAA----------------------
TF2B_YEAST/133-203-----------------------------------------------------C-DAA----------------------
TF3B_CANAL/95-165-----------------------------------------------------A-AAL----------------------
TF2B_DROME/214-284-----------------------------------------------------C-ANL----------------------
TF3B_KLULA/98-168-----------------------------------------------------S-YAL----------------------
TF3B_CANAL/190-263-----------------------------------------------------V-EKL----------------------
TF2B_DROME/120-190-----------------------------------------------------A-DRI----------------------
TF2B_KLULA/245-315-----------------------------------------------------C-SHL----------------------
TF2B_PYRFU/212-282-----------------------------------------------------A-DEL----------------------
Q5V5V1_HALMA/235-305-----------------------------------------------------A-SEL----------------------

PF16899

CCNH_ECHMU/168-289-----------------------------------------------------EVATA----------------------
D2VN70_NAEGR/180-268-----------------------------------------------------.....----------------------
H3FVF7_PRIPA/67-164-----------------------------------------------------.....----------------------
G6D7P5_DANPL/155-246-----------------------------------------------------.....----------------------
C5DE24_LACTC/194-313-----------------------------------------------------.....----------------------
H2B1R1_KAZAF/202-304-----------------------------------------------------.....----------------------
C5DYH4_ZYGRC/193-303-----------------------------------------------------.....----------------------
Q6FMU5_CANGA/203-302-----------------------------------------------------.....----------------------
G0V973_NAUCC/221-326-----------------------------------------------------.....----------------------
G0W3A8_NAUDC/222-335-----------------------------------------------------.....----------------------
G2YRH2_BOTF4/184-304-----------------------------------------------------.....----------------------
R7YVJ7_CONA1/187-325-----------------------------------------------------.....----------------------
C9SVU8_VERA1/162-263-----------------------------------------------------.....----------------------
L2FZZ6_COLGN/165-276-----------------------------------------------------.....----------------------
H1VJI3_COLHI/166-278-----------------------------------------------------.....----------------------
M7TNJ7_EUTLA/145-243-----------------------------------------------------.....----------------------
G3JT19_CORMM/158-261-----------------------------------------------------.....----------------------
G9NI52_HYPAI/158-265-----------------------------------------------------.....----------------------
F9F5Z4_FUSOF/158-263-----------------------------------------------------.....----------------------
L8GA30_PSED2/187-302-----------------------------------------------------.....----------------------
K1X5Y0_MARBU/178-294-----------------------------------------------------.....----------------------
N1JHL3_BLUG1/188-305-----------------------------------------------------.....----------------------
H6C5Z8_EXODN/187-301-----------------------------------------------------.....----------------------
R1EFE2_BOTPV/206-348-----------------------------------------------------.....----------------------
Q0UGP0_PHANO/193-328-----------------------------------------------------.....----------------------
E5AC16_LEPMJ/211-344-----------------------------------------------------.....----------------------
R0KJU5_SETT2/173-306-----------------------------------------------------.....----------------------
M3AYY7_MYCFI/177-276-----------------------------------------------------.....----------------------
N1QKL6_SPHMS/175-275-----------------------------------------------------.....----------------------
F9XH99_MYCGM/164-291-----------------------------------------------------.....----------------------
M2MZH1_BAUCO/171-314-----------------------------------------------------.....----------------------
M2YNC7_MYCP1/165-265-----------------------------------------------------.....----------------------
B6Q284_PENMQ/191-333-----------------------------------------------------.....----------------------
G3Y4C9_ASPNA/188-330-----------------------------------------------------.....----------------------
B0Y3L0_ASPFC/188-332-----------------------------------------------------.....----------------------
Q5BB69_EMENI/189-333-----------------------------------------------------.....----------------------
G7E2H9_MIXOS/177-279-----------------------------------------------------.....----------------------
F8NWE7_SERL9/187-291-----------------------------------------------------.....----------------------
D8PKL8_SCHCM/182-281-----------------------------------------------------.....----------------------
K9HXY7_AGABB/176-275-----------------------------------------------------.....----------------------
J4HVQ4_FIBRA/73-167-----------------------------------------------------.....----------------------
E9C7X0_CAPO3/152-254-----------------------------------------------------.....----------------------
E3M1M6_CAERE/158-270-----------------------------------------------------.....----------------------
A7S801_NEMVE/159-255-----------------------------------------------------.....----------------------
C3ZT09_BRAFL/159-259-----------------------------------------------------.....----------------------
I1FML6_AMPQE/158-255-----------------------------------------------------.....----------------------
E4YFZ2_OIKDI/97-198-----------------------------------------------------.....----------------------
G3U0L9_LOXAF/162-261-----------------------------------------------------.....----------------------
G1N872_MELGA/126-226-----------------------------------------------------.....----------------------
G3UI14_LOXAF/162-261-----------------------------------------------------.....----------------------
E3TDV0_ICTPU/162-262-----------------------------------------------------.....----------------------
B5DG24_SALSA/163-263-----------------------------------------------------.....----------------------
H2RRW1_TAKRU/163-263-----------------------------------------------------.....----------------------
K4FV42_CALMI/163-263-----------------------------------------------------.....----------------------
Q3KQ83_XENLA/162-262-----------------------------------------------------.....----------------------
I7G2X7_MACFA/162-262-----------------------------------------------------.....----------------------
H3A0T1_LATCH/164-264-----------------------------------------------------.....----------------------
R7UPP9_CAPTE/154-254-----------------------------------------------------.....----------------------
B7PB82_IXOSC/86-183-----------------------------------------------------.....----------------------
G3MNU6_9ACAR/156-256-----------------------------------------------------.....----------------------
F6TUV6_CIOIN/161-261-----------------------------------------------------.....----------------------
E9G2Q3_DAPPU/159-258-----------------------------------------------------.....----------------------
R4G2X9_RHOPR/158-256-----------------------------------------------------.....----------------------
B8YN16_SCYPA/165-265-----------------------------------------------------.....----------------------
K7IUX2_NASVI/159-256-----------------------------------------------------.....----------------------
E2BY23_HARSA/159-256-----------------------------------------------------.....----------------------
H9K562_APIME/183-280-----------------------------------------------------.....----------------------
N6TWG3_DENPD/159-258-----------------------------------------------------.....----------------------
Q16JQ2_AEDAE/159-257-----------------------------------------------------.....----------------------
C6SV35_DROME/162-260-----------------------------------------------------.....----------------------
D3TRT0_GLOMM/159-257-----------------------------------------------------.....----------------------
H9JGM4_BOMMO/159-258-----------------------------------------------------.....----------------------
K8F2A8_9CHLO/171-283-----------------------------------------------------KVVVV----------------------
L8GMB5_ACACA/173-270-----------------------------------------------------.....----------------------
Q5SCB4_OSTTA/157-262-----------------------------------------------------.....----------------------
A4RUA6_OSTLU/106-212-----------------------------------------------------.....----------------------
D8SKW4_SELML/173-280-----------------------------------------------------DENVS----------------------
A9TM39_PHYPA/166-271-----------------------------------------------------.TYRL----------------------
B6TIT4_MAIZE/176-281-----------------------------------------------------..GPF----------------------
I1GNJ7_BRADI/176-281-----------------------------------------------------..GAH----------------------
M8CSB1_AEGTA/98-189-----------------------------------------------------.....----------------------
R0FFP6_9BRAS/176-281-----------------------------------------------------..DEM----------------------
K4BTS5_SOLLC/176-282-----------------------------------------------------.EDQL----------------------
M0U1N4_MUSAM/177-282-----------------------------------------------------..EEQ----------------------
A9PJ64_9ROSI/178-280-----------------------------------------------------.....----------------------
B9RF84_RICCO/157-262-----------------------------------------------------..DQT----------------------
M5VZ28_PRUPE/175-280-----------------------------------------------------..DRL----------------------
D7U9R4_VITVI/178-283-----------------------------------------------------..DRL----------------------
G7I853_MEDTR/189-294-----------------------------------------------------..DEL----------------------
I1KBX5_SOYBN/178-283-----------------------------------------------------..NQL----------------------

PF02984

CG11_CANAL/174-308-----------------------------------------------------ENKSV----------------------
Q9GTQ8_DROME/286-422-----------------------------------------------------INIG.----------------------
Q4T8S9_TETNG/1145-1270-----------------------------------------------------DSKL.----------------------
Q4RZE5_TETNG/155-280-----------------------------------------------------STKH.----------------------
A7YYE4_DANRE/155-279-----------------------------------------------------SSKQ.----------------------
Q7ZYJ6_XENLA/153-279-----------------------------------------------------DTKQ.----------------------
CCND1_BOVIN/155-283-----------------------------------------------------ENKQ.----------------------
CCND1_MOUSE/155-283-----------------------------------------------------ENKQ.----------------------
Q5T8J1_HUMAN/105-230-----------------------------------------------------DRQA.----------------------
Q5ZKI9_CHICK/155-278-----------------------------------------------------DKME.----------------------
Q1L8M6_DANRE/153-279-----------------------------------------------------DRLT.----------------------
H2Q584_PANTR/154-275-----------------------------------------------------EKLS.----------------------
Q3KPK0_XENLA/154-277-----------------------------------------------------LPKDK----------------------
CCD11_ARATH/184-308-----------------------------------------------------TFLG.----------------------
Q9SNV2_ANTMA/176-296-----------------------------------------------------TYTG.----------------------
CCD42_ORYSJ/212-330-----------------------------------------------------APRS.----------------------
CCD42_ARATH/171-289-----------------------------------------------------YDQE.----------------------
CCD41_ARATH/180-299-----------------------------------------------------EPSN.----------------------
P93103_OXYRB/210-333-----------------------------------------------------LSGDK----------------------
Q9ZRX9_TOBAC/198-317-----------------------------------------------------MNGDQ----------------------
O82678_OXYRB/199-324-----------------------------------------------------HFHC.----------------------
Q8LPW3_HELAN/178-304-----------------------------------------------------HLHW.----------------------
CCD33_ARATH/188-310-----------------------------------------------------HHQL.----------------------
CCD31_ARATH/189-307-----------------------------------------------------NAHW.----------------------
Q8LK74_LAGSI/187-313-----------------------------------------------------HICW.----------------------
Q9SMD4_SOLLC/184-309-----------------------------------------------------CLSL.----------------------
Q8GZU3_9ROSI/205-332-----------------------------------------------------YLCL.----------------------
Q2ABE7_CAMSI/203-327-----------------------------------------------------RLCC.----------------------
Q9S7H9_SOLLC/192-320-----------------------------------------------------NLHM.----------------------
A7Y7X0_CUCSA/197-329-----------------------------------------------------NLHL.----------------------
Q9SNV0_ANTMA/203-329-----------------------------------------------------NVQC.----------------------
Q40338_MEDSA/212-338-----------------------------------------------------NLHW.----------------------
Q9SXN7_TOBAC/190-313-----------------------------------------------------HIHW.----------------------
Q2ABE6_CAMSI/198-326-----------------------------------------------------NLHL.----------------------
Q7XAB7_EUPES/184-308-----------------------------------------------------HLHW.----------------------
Q84V88_POPAL/200-324-----------------------------------------------------HMHW.----------------------
CCNE_HEMPU/255-381-----------------------------------------------------YSST.----------------------
Q5U4W4_XENLA/240-362-----------------------------------------------------KDHP.----------------------
Q5ZMH4_CHICK/247-368-----------------------------------------------------KDVP.----------------------
Q544H6_MOUSE/241-363-----------------------------------------------------KDVP.----------------------
CCNE1_HUMAN/244-366-----------------------------------------------------AYLN.----------------------
B2GQF9_DANRE/246-368-----------------------------------------------------KETA.----------------------
CCD61_ARATH/156-288-----------------------------------------------------KEED.----------------------
A8XRM2_CAEBR/208-340-----------------------------------------------------SNPV.----------------------
O45926_CAEEL/161-293-----------------------------------------------------NPIDK----------------------
CCNB1_CAEEL/208-340-----------------------------------------------------ASPI.----------------------
Q9U7P9_9CILI/566-681-----------------------------------------------------QVEE.----------------------
Q4T2Y9_TETNG/114-254-----------------------------------------------------DLYNG----------------------
CCNJ_XENLA/145-273-----------------------------------------------------DLHDG----------------------
CG1C_SCHPO/162-278-----------------------------------------------------...D.----------------------
A2F2K2_TRIVA/212-328-----------------------------------------------------ETKE.----------------------
A2DQ77_TRIVA/248-364-----------------------------------------------------QTQE.----------------------
A2DZV8_TRIVA/235-351-----------------------------------------------------QTQE.----------------------
A0C1C9_PARTE/197-310-----------------------------------------------------NLCD.----------------------
A0DMF0_PARTE/199-312-----------------------------------------------------NLCD.----------------------
B8N0B1_ASPFN/192-299-----------------------------------------------------Y..D.----------------------
A4RSW0_OSTLU/207-322-----------------------------------------------------IKAD.----------------------
Q5SCB7_OSTTA/222-339-----------------------------------------------------HTST.----------------------
CCNF_MOUSE/408-531-----------------------------------------------------...A.----------------------
CCNF_XENTR/414-537-----------------------------------------------------...D.----------------------
A2E0Q4_TRIVA/216-333-----------------------------------------------------A..D.----------------------
A2E6K7_TRIVA/216-333-----------------------------------------------------S..D.----------------------
REM1_SCHPO/273-388-----------------------------------------------------W..E.----------------------
Q4CS48_TRYCC/197-328-----------------------------------------------------T..E.----------------------
A4HKX7_LEIBR/155-297-----------------------------------------------------QRRQH----------------------
Q4DWL9_TRYCC/229-371-----------------------------------------------------DYTLQ----------------------
Q0VA13_XENTR/226-348-----------------------------------------------------C..P.----------------------
CCF13_ORYSJ/255-372-----------------------------------------------------GKEE.----------------------
Q23JX5_TETTS/284-401-----------------------------------------------------L..D.----------------------
O96434_PARTE/212-329-----------------------------------------------------L..D.----------------------
A0E0R4_PARTE/214-320-----------------------------------------------------ELDP.----------------------
Q9TY42_PARTE/121-227-----------------------------------------------------NLDP.----------------------
Q25123_HELRO/240-368-----------------------------------------------------VCDD.----------------------
CCNB3_CAEEL/243-364-----------------------------------------------------V..D.----------------------
Q29CG1_DROPS/434-556-----------------------------------------------------V..Q.----------------------
Q7QC70_ANOGA/538-653-----------------------------------------------------I..P.----------------------
Q16VG6_AEDAE/419-535-----------------------------------------------------I..D.----------------------
Q25168_HELTR/382-498-----------------------------------------------------A..N.----------------------
A7S8H6_NEMVE/110-226-----------------------------------------------------A..D.----------------------
Q60FY2_ANGJA/277-393-----------------------------------------------------A..N.----------------------
Q08C91_DANRE/272-388-----------------------------------------------------AGMD.----------------------
Q60FY1_ORENI/302-418-----------------------------------------------------ASMD.----------------------
CCNB3_MOUSE/1265-1381-----------------------------------------------------A..S.----------------------
K4Q4R6_CHICK/276-392-----------------------------------------------------A..S.----------------------
Q3KQA7_XENLA/288-404-----------------------------------------------------A..T.----------------------
CCNB3_HUMAN/1259-1375-----------------------------------------------------T..N.----------------------
CCNB3_CANFA/1202-1318-----------------------------------------------------A..S.----------------------
CCNA1_CAEEL/343-459-----------------------------------------------------F..T.----------------------
CCNA_DROME/334-451-----------------------------------------------------DMPE.----------------------
Q29DY8_DROPS/354-471-----------------------------------------------------P..E.----------------------
Q17NN3_AEDAE/310-427-----------------------------------------------------DVPD.----------------------
Q7Q0E8_ANOGA/187-304-----------------------------------------------------DVPD.----------------------
CCF32_ORYSJ/267-390-----------------------------------------------------RPIN.----------------------
A3AKA7_ORYSJ/256-379-----------------------------------------------------EDDK.----------------------
A2ZM34_ORYSI/249-372-----------------------------------------------------EDKK.----------------------
Q39877_SOYBN/214-337-----------------------------------------------------DVQK.----------------------
Q40488_TOBAC/238-361-----------------------------------------------------DNVD.----------------------
CCNAL_DAUCA/208-330-----------------------------------------------------ENPD.----------------------
CCA33_ARATH/190-313-----------------------------------------------------EDFK.----------------------
Q2V5Z8_BRACM/228-351-----------------------------------------------------EDFN.----------------------
CCA31_ARATH/219-342-----------------------------------------------------EDFE.----------------------
Q9M4K9_PEA/216-340-----------------------------------------------------EGVD.----------------------
O04388_CATRO/238-361-----------------------------------------------------DGDK.----------------------
Q40492_TOBAC/247-370-----------------------------------------------------EDYK.----------------------
Q39331_BRANA/289-412-----------------------------------------------------RVHE.----------------------
CCA12_ARATH/310-433-----------------------------------------------------GRKE.----------------------
CCA14_ORYSJ/216-339-----------------------------------------------------VCHE.----------------------
CCA11_ORYSJ/372-495-----------------------------------------------------VSDE.----------------------
Q84LE4_SILLA/352-474-----------------------------------------------------VMNE.----------------------
Q40514_TOBAC/347-470-----------------------------------------------------GLNE.----------------------
Q96226_ADICA/397-520-----------------------------------------------------AGQK.----------------------
Q39878_SOYBN/336-459-----------------------------------------------------SSYK.----------------------
Q9XGI4_SOLLC/345-468-----------------------------------------------------ASYE.----------------------
CCA22_ARATH/304-427-----------------------------------------------------ASYK.----------------------
CCA21_ORYSJ/359-482-----------------------------------------------------ASRN.----------------------
CCA24_ARATH/329-452-----------------------------------------------------VSFP.----------------------
A5BUM0_VITVI/360-483-----------------------------------------------------ASYK.----------------------
Q941M7_MEDSA/349-473-----------------------------------------------------ASYK.----------------------
A7SEI5_NEMVE/172-293-----------------------------------------------------VPESM----------------------
CCNA_HYDVD/296-415-----------------------------------------------------KPES.----------------------
P90681_PATPE/322-438-----------------------------------------------------AKAD.----------------------
Q6ZZ83_SPHGR/342-458-----------------------------------------------------ANSK.----------------------
Q4SG06_TETNG/155-272-----------------------------------------------------...C.----------------------
O77212_DREPO/291-408-----------------------------------------------------...E.----------------------
CCNA1_CARAU/268-385-----------------------------------------------------HICA.----------------------
CCNA1_XENLA/295-412-----------------------------------------------------V..S.----------------------
CCNA1_MOUSE/298-415-----------------------------------------------------.....----------------------
CCNA_PATVU/302-419-----------------------------------------------------T..D.----------------------
Q28DU2_XENTR/291-408-----------------------------------------------------V..S.----------------------
Q98TA3_DANRE/305-422-----------------------------------------------------PVSS.----------------------
CCNA2_BOVIN/307-425-----------------------------------------------------A..N.----------------------
CCNA2_CHICK/273-390-----------------------------------------------------QTNA.----------------------
M1KIP0_ENCCN/179-293-----------------------------------------------------Y..E.----------------------
Q6FVY0_CANGA/262-383-----------------------------------------------------Y..D.----------------------
A0A023ZJ88_YEASX/296-418-----------------------------------------------------Y..D.----------------------
A0A023ZMR1_YEASX/254-374-----------------------------------------------------Y..C.----------------------
CG21_SCHPO/294-409-----------------------------------------------------YDHD.----------------------
A0A023ZKJ3_YEASX/338-453-----------------------------------------------------Y..D.----------------------
Q6FNV2_CANGA/314-429-----------------------------------------------------Y..E.----------------------
Q6CT04_KLULA/317-432-----------------------------------------------------YEYD.----------------------
Q75A51_ASHGO/248-363-----------------------------------------------------YEYD.----------------------
Q6FQU1_CANGA/326-455-----------------------------------------------------Y..D.----------------------
A6ZXH4_YEAS7/299-414-----------------------------------------------------YEHD.----------------------
A7TR46_VANPO/331-446-----------------------------------------------------YEYD.----------------------
Q2HAS9_CHAGB/515-630-----------------------------------------------------Y..D.----------------------
F5HHN7_NEUCR/516-631-----------------------------------------------------Y..D.----------------------
Q0UCR8_PHANO/466-581-----------------------------------------------------Y..D.----------------------
A7F1V1_SCLS1/469-584-----------------------------------------------------Y..D.----------------------
A1C7V2_ASPCL/489-604-----------------------------------------------------Y..D.----------------------
Q6BGT2_DEBHA/350-465-----------------------------------------------------Y..D.----------------------
Q6CE22_YARLI/306-421-----------------------------------------------------Y..D.----------------------
Q49U21_CRYNE/355-469-----------------------------------------------------Y..D.----------------------
Q6X269_USTMD/465-579-----------------------------------------------------Y..D.----------------------
CG22_SCHPO/267-382-----------------------------------------------------Y..D.----------------------
A0A023ZMC4_YEASX/339-454-----------------------------------------------------Y..D.----------------------
Q75EI0_ASHGO/418-533-----------------------------------------------------Y..D.----------------------
Q6FVY1_CANGA/344-459-----------------------------------------------------Y..D.----------------------
A3LN44_PICST/322-438-----------------------------------------------------Y..D.----------------------
A5DUV2_LODEL/512-628-----------------------------------------------------Y..D.----------------------
Q6CEJ4_YARLI/393-508-----------------------------------------------------F..D.----------------------
Q0UMA7_PHANO/348-462-----------------------------------------------------Y..D.----------------------
Q2HAK4_CHAGB/352-466-----------------------------------------------------Y..D.----------------------
A1CID9_ASPCL/361-475-----------------------------------------------------Y..D.----------------------
CG23_SCHPO/334-448-----------------------------------------------------Y..D.----------------------
O93916_PNECA/304-419-----------------------------------------------------Y..D.----------------------
F5HE42_USTMA/433-547-----------------------------------------------------Y..D.----------------------
F5H8X2_CRYNB/366-482-----------------------------------------------------Y..D.----------------------
Q5SCB6_OSTTA/230-346-----------------------------------------------------G..D.----------------------
CCB31_ARATH/274-391-----------------------------------------------------S..N.----------------------
Q9ZRG1_PEA/135-252-----------------------------------------------------S..N.----------------------
CCB21_ARATH/302-419-----------------------------------------------------A..D.----------------------
CCB22_ARATH/303-421-----------------------------------------------------S..D.----------------------
Q9XGI1_SOLLC/308-425-----------------------------------------------------C..D.----------------------
CCNB2_MEDSA/201-318-----------------------------------------------------A..D.----------------------
CCB23_ARATH/308-425-----------------------------------------------------S..D.----------------------
CCB24_ARATH/309-426-----------------------------------------------------S..D.----------------------
Q2WGP0_ALLCE/280-397-----------------------------------------------------S..E.----------------------
B8AT55_ORYSI/285-402-----------------------------------------------------S..D.----------------------
CCB22_ORYSI/293-410-----------------------------------------------------S..D.----------------------
Q41734_MAIZE/282-407-----------------------------------------------------LGNIV----------------------
P93646_MAIZE/356-473-----------------------------------------------------C..D.----------------------
CCB13_ORYSJ/341-458-----------------------------------------------------G..D.----------------------
O65064_PICMA/98-215-----------------------------------------------------AGSD.----------------------
Q41733_MAIZE/317-437-----------------------------------------------------SADE.----------------------
CCB14_ARATH/260-379-----------------------------------------------------PCDA.----------------------
CCB11_ARATH/295-418-----------------------------------------------------A..D.----------------------
P93102_OXYRB/319-438-----------------------------------------------------TLDS.----------------------
Q2WGP2_ALLCE/358-475-----------------------------------------------------AMSD.----------------------
CCB12_ARATH/312-429-----------------------------------------------------SMSD.----------------------
CCB13_ARATH/289-406-----------------------------------------------------S..D.----------------------
A5AEK5_VITVI/324-442-----------------------------------------------------SIPD.----------------------
O04398_TOBAC/319-436-----------------------------------------------------AVSN.----------------------
Q40516_TOBAC/291-408-----------------------------------------------------SLPD.----------------------
O82137_PEA/102-224-----------------------------------------------------SLPS.----------------------
O82717_LUPLU/324-441-----------------------------------------------------SVPD.----------------------
P93557_SESRO/318-435-----------------------------------------------------SVPD.----------------------
O04389_CATRO/313-431-----------------------------------------------------P..D.----------------------
Q2PHK8_DAUCA/314-432-----------------------------------------------------PSEP.----------------------
Q2PHK9_DAUCA/330-448-----------------------------------------------------PNEP.----------------------
Q9LKC6_CICAR/324-443-----------------------------------------------------SMTD.----------------------
CCN2_ANTMA/319-438-----------------------------------------------------SLPD.----------------------
Q5D894_GOSHI/87-204-----------------------------------------------------SIPD.----------------------
Q40223_LUPLU/307-426-----------------------------------------------------PYDK.----------------------
Q39880_SOYBN/313-433-----------------------------------------------------PSDK.----------------------
Q2PHL0_DAUCA/311-430-----------------------------------------------------PSDP.----------------------
Q2ABE9_CAMSI/308-433-----------------------------------------------------PSNDH----------------------
Q9SBQ4_PETHY/303-423-----------------------------------------------------PSDD.----------------------
Q9XGI2_SOLLC/248-367-----------------------------------------------------PSDQ.----------------------
Q5D8P0_SCHJA/269-392-----------------------------------------------------A..D.----------------------
CCNB_DICDI/316-434-----------------------------------------------------S..D.----------------------
P92162_BOMMO/389-509-----------------------------------------------------G..T.----------------------
Q4TVR6_HELTR/235-352-----------------------------------------------------V..E.----------------------
A7SPG5_NEMVE/166-283-----------------------------------------------------V..G.----------------------
Q4T0M3_TETNG/224-342-----------------------------------------------------V..T.----------------------
CCNB1_ANGJA/272-390-----------------------------------------------------V..T.----------------------
CCNB1_CARAU/266-384-----------------------------------------------------V..T.----------------------
CCNB1_CRIGR/296-414-----------------------------------------------------V..D.----------------------
Q6P801_XENTR/266-384-----------------------------------------------------V..T.----------------------
O93228_RANJA/239-357-----------------------------------------------------V..D.----------------------
Q6IR86_XENLA/262-380-----------------------------------------------------V..D.----------------------
Q7ZVA8_DANRE/252-370-----------------------------------------------------A..D.----------------------
Q09IZ1_ONCMY/251-369-----------------------------------------------------A..D.----------------------
CCNB2_ORYLA/254-372-----------------------------------------------------A..D.----------------------
Q28GP5_XENTR/256-374-----------------------------------------------------A..D.----------------------
Q6T2E9_BUFGR/263-381-----------------------------------------------------A..D.----------------------
CCNB2_CHICK/268-386-----------------------------------------------------A..D.----------------------
Q7Z4Z4_HUMAN/264-382-----------------------------------------------------V..D.----------------------
CCNB_MARGL/258-375-----------------------------------------------------V..D.----------------------
CCNB_PATPE/272-390-----------------------------------------------------V..D.----------------------
Q95WE6_PATPE/274-391-----------------------------------------------------V..D.----------------------
Q5UAU8_PENJP/269-385-----------------------------------------------------V..D.----------------------
CCNB_SPISO/299-415-----------------------------------------------------V..D.----------------------
CCNB_PATVU/282-398-----------------------------------------------------V..D.----------------------
CCNB_HYDVD/264-380-----------------------------------------------------V..D.----------------------
CCNB_ARBPU/274-395-----------------------------------------------------V..D.----------------------
Q94740_SPHGR/281-401-----------------------------------------------------V..D.----------------------
Q291N4_DROPS/375-501-----------------------------------------------------A..E.----------------------
Q16TY2_AEDAE/355-477-----------------------------------------------------A..A.----------------------
Q7PPJ1_ANOGA/320-449-----------------------------------------------------A..S.----------------------

PF00134

CCNA2_MOUSE/171-297----------------------------EYK------------LQN-----E-TL-H------L----------------
CCNB3_CAEEL/115-241----------------------------TFE------------LNH-----E-TL-Y------N----------------
CCNF_MOUSE/281-406----------------------------MKD------------FTS-----L-CL-H------L----------------
CCT12_ARATH/28-169----------------------------RLK------------VPQ-----V-TI-A------T----------------
CCNE_CAEEL/232-360----------------------------SEK------------LHR-----E-TF-H------L----------------
REM1_SCHPO/145-271----------------------------CIN------------LLP-----E-SL-F------L----------------
O45926_CAEEL/34-159----------------------------RFH------------LTP-----E-TL-H------L----------------
CCB14_ARATH/133-258----------------------------KFE------------LMP-----E-TL-Y------L----------------
CCU41_ARATH/22-148----------------------------YAN------------CSP-----S-CF-V------V----------------
CCNB2_HUMAN/137-262----------------------------KFR------------LLQ-----E-TL-Y------M----------------
CCNT_DROME/42-176----------------------------RLQ------------VSQ-----L-CI-N------T----------------
CG23_SCHPO/206-332----------------------------RFR------------LLP-----E-TL-F------L----------------
CCNA_DROME/206-332----------------------------EYK------------LDT-----E-TL-Y------L----------------
CG12_YEAST/43-195----------------------------VTR------------VTN-----G-IF-F------H----------------
CCNB_DROME/260-387----------------------------QFH------------LAA-----E-TF-Q------L----------------
CCNB1_MOUSE/170-295----------------------------KFR------------LLQ-----E-TM-Y------M----------------
CG21_SCHPO/166-292----------------------------HFR------------LLP-----E-TL-F------L----------------
PCL1_YEAST/19-152----------------------------YTN------------VYT-----P-TL-L------T----------------
CG21_YEAST/212-337----------------------------KFG------------LLP-----E-TL-Y------L----------------
CG22_YEAST/232-357----------------------------KFG------------LLP-----E-TL-Y------L----------------
CG23_YEAST/171-297----------------------------KFQ------------LLP-----E-TL-Y------L----------------
CG24_YEAST/210-336----------------------------RFQ------------LLP-----E-TL-Y------L----------------
PUC1_SCHPO/99-227----------------------------GFD------------LSI-----D-TL-P------L----------------
CCNB1_SOYBN/197-322----------------------------KFE------------LSL-----E-TL-Y------L----------------
PCL2_YEAST/18-146----------------------------HSN------------VQT-----P-TL-M------A----------------
CCNB2_CHICK/141-266----------------------------RFQ------------LLQ-----E-TL-Y------M----------------
CCB11_ARATH/168-293----------------------------RFE------------LNP-----E-TF-Y------L----------------
CCND2_MOUSE/24-151----------------------------EQK------------CEE-----E-VF-P------L----------------
CCND3_HUMAN/26-153----------------------------EQR------------CEE-----E-VF-P------L----------------
CGS5_YEAST/165-294----------------------------KFQ------------CYP-----E-TL-F------L----------------
CG21_EMENI/211-337----------------------------RFR------------LLP-----E-TL-F------L----------------
CGS6_YEAST/123-252----------------------------KFH------------CLP-----E-TL-F------L----------------
CCNA1_CAEEL/215-341----------------------------EYN------------FQK-----E-TF-H------L----------------
CG22_SCHPO/139-265----------------------------NFC------------LMP-----E-TL-Y------L----------------
CCND1_RAT/26-153----------------------------EQK------------CEE-----E-VF-P------L----------------
CCNB3_CHICK/149-274----------------------------NFE------------LNH-----E-TL-Y------L----------------
CCNB_DICDI/188-314----------------------------RFK------------LLS-----E-TF-F------L----------------
CCD11_ARATH/50-182----------------------------YYN------------FQP-----L-TA-Y------L----------------
CCD21_ARATH/65-197----------------------------HYH------------FGH-----L-CI-C------L----------------
SSN8_YEAST/45-176----------------------------RLN------------IRQ-----Y-AL-A------T----------------
CCNE1_CHICK/112-239----------------------------VYK------------LYR-----E-TF-Y------L----------------
CCNE_DROME/330-459----------------------------VYK------------LHR-----E-TF-Y------L----------------
CCNA1_HUMAN/214-340----------------------------EYK------------LRA-----E-TL-Y------L----------------
P92162_BOMMO/260-387----------------------------QFS------------LVL-----E-TF-H------L----------------
CCC11_ORYSJ/4-144----------------------------QVK------------VRQ-----R-VI-A------T----------------
CGH2_SHV21/22-148----------------------------SFE------------LDK-----S-VF-P------L----------------
CCNB1_CAEEL/81-206----------------------------RFH------------LTP-----E-TL-H------L----------------
PCL9_YEAST/19-146----------------------------QSN------------VQT-----P-TL-M------A----------------
CCA22_ARATH/175-302----------------------------DYK------------LVP-----D-TL-Y------L----------------
CCB12_ARATH/185-310----------------------------KFE------------LNL-----E-TL-Y------L----------------
CCB21_ARATH/174-300----------------------------KFD------------LIN-----E-TL-F------L----------------
Q39878_SOYBN/207-334----------------------------EYK------------LVP-----D-TL-Y------L----------------
CCNE1_MOUSE/113-240----------------------------VYK------------LHR-----E-TF-Y------L----------------
CCB21_ORYSJ/157-283----------------------------KFE------------LMD-----E-TL-F------L----------------
CCD41_ARATH/45-178----------------------------VHQ------------FGP-----L-CF-C------L----------------
CCNB3_DROME/308-433----------------------------TFE------------LNH-----E-TL-Y------L----------------
Q9S7H9_SOLLC/61-190----------------------------YYG------------FTA-----T-TA-V------L----------------
CCB31_ARATH/146-272----------------------------KFD------------LMH-----E-TL-Y------L----------------
CCB24_ARATH/180-307----------------------------KFE------------LME-----E-TL-Y------L----------------
Q9SMD4_SOLLC/51-182----------------------------YYS------------FSA-----Q-TG-F------L----------------
CCD33_ARATH/59-186----------------------------HYG------------FNS-----L-TA-L------L----------------
Q9U2M5_CAEEL/72-201----------------------------EEN------------CDG-----D-VF-L------L----------------
Q9VE72_DROME/6-144----------------------------KLK------------MKP-----L-TA-A------C----------------
Q9VKF0_DROME/205-327----------------------------AAQ------------LTA-----E-CA-I------I----------------
Q9VZP3_DROME/42-165----------------------------AHK------------LSR-----C-AL-H------L----------------
Q9XGI1_SOLLC/180-306----------------------------KFE------------LRE-----E-TL-F------L----------------
CCNE2_MOUSE/112-239----------------------------VYT------------LHR-----E-TF-Y------L----------------
CCD61_ARATH/26-154----------------------------KFD------------D.P-----S-LT-Y------L----------------
A0BXX7_PARTE/85-212----------------------------KFK------------LKD-----E-TL-Y------I----------------
A9UMS1_XENTR/114-240----------------------------VYK------------LHR-----E-TF-Y------L----------------
B4FZZ7_MAIZE/193-318----------------------------KFE------------LMP-----E-TL-Y------L----------------
B8A2G9_MAIZE/228-354----------------------------RLT------------LMP-----E-TL-Y------L----------------
C4J9B6_MAIZE/173-299----------------------------KLE------------LLE-----E-TL-F------L----------------
E9QJ66_DANRE/140-266----------------------------EYK------------LCS-----E-TL-Y------L----------------
F1QBQ7_DANRE/117-243----------------------------VYK------------LHR-----E-TF-Y------L----------------
F6QF79_XENTR/139-263----------------------------KFR------------LLQ-----E-TM-F------M----------------
F6QGW4_XENTR/133-257----------------------------RFQ------------LLQ-----E-TL-Y------M----------------
I1K835_SOYBN/85-213----------------------------EYK------------LLS-----D-TL-H------L----------------
I1M770_SOYBN/186-311----------------------------KFE------------LMP-----E-TL-Y------L----------------
J3KY10_ORYBR/200-327----------------------------EYR------------LVP-----D-TL-Y------L----------------
K7V0X7_MAIZE/191-316----------------------------RFQ------------LMP-----E-TL-Y------L----------------
M1A5P4_SOLTU/185-310----------------------------RFE------------LRP-----E-SL-Y------L----------------
M4E4A3_BRARP/154-281----------------------------EYR------------LVP-----E-TL-Y------L----------------
M7PCR8_PNEMU/176-302----------------------------KFR------------LLP-----E-TL-F------L----------------
CG11_CANAL/44-171----------------------------SFK------------LQP-----T-TL-F------L----------------
CG24_CANAL/234-359----------------------------RFN------------LFS-----E-TL-Y------L----------------
CG13_CANAL/44-171----------------------------ILS------------LSR-----S-TF-P------L----------------
CG21_CANAL/208-334----------------------------KFK------------LLP-----E-SL-F------L----------------
Q6BFS2_PARTE/82-209----------------------------KFK------------LRD-----E-TL-Y------V----------------
VCYCL_HHV8P/21-146----------------------------EYN------------LEP-----N-VV-A------L----------------
Q7KUZ5_DROME/153-280----------------------------EEN------------CQE-----E-VV-L------L----------------
T1EGC7_HELRO/166-290----------------------------EYK------------LKR-----E-TF-F------L----------------
T1FNQ9_HELRO/256-380----------------------------SFE------------LNH-----E-TL-Y------M----------------
W4XEA0_STRPU/126-253----------------------------VYR------------LHR-----E-SF-Y------L----------------
W4XJF2_STRPU/207-332----------------------------EYR------------LHN-----E-TL-Y------L----------------

PF08613

PHO80_YEAST/33-170----------------------------FSS------------LEH-----C-VL-M------T----------------
PSL1_SCHPO/29-176----------------------------YCP------------ATN-----D-VF-L------S----------------
PCL7_YEAST/108-264----------------------------YCP------------TTN-----D-IF-L------S----------------
Q1K4U8_NEUCR/157-314----------------------------YCP------------MST-----A-VY-L------A----------------
Q389J6_TRYB2/370-620----------------------------FGE------------SAP-----L-VL-I------G----------------
Q6H3X9_ORYSJ/18-159----------------------------FAG------------CSP-----A-CY-V------V----------------

PF01858

K1Q8Z2_CRAGI/498-695....DH....AGSQI...D...FAKK..RLQ............LGE-----C-LY-Y------K----------------
K3WCJ4_PYTUL/615-824PNLDENDNMTQLPSFEYSE..............VDGSLKKTKNLAI-----A-LF-Y------R----------------
E9IWV1_SOLIN/372-568....AN....DGSAF...D...FGKK..RLL............MGQ-----T-LF-Y------K----------------
A9UZQ5_MONBE/439-632AYFWET................HEKS..LIT............ESE-----K-LF-W------W----------------
E9GV66_DAPPU/393-588....EG....RTNGFSM.D...MARK..RLQ............LGE-----S-LY-Y------K----------------
RBR_RICCO/415-616....ERCVTGSLQSTNLMDNI.WAEQ..RRL............EAL-----K-LY-Y------R----------------
Q54FX2_DICDI/628-829QQQQQQ................QEVKQRRKN............MAI-----Q-LY-Y------C----------------
F6VRH0_XENTR/413-608....KQ....FCRDFSL.D...ITKK..YFR............LAE-----V-LY-Y------K----------------
V8P9V1_OPHHA/376-569....DQ....LVCHI...D...FALH..RLK............LAE-----I-LY-Y------K----------------
G0NPV8_CAEBE/426-611......................SAEK..KSDSPLSKYHGELRKELE-----T-VF-Y------V----------------
H0ZAT2_TAEGU/371-563FSNFSK............D...VASK..HFR............RAE-----M-LY-Y------K----------------
B0XDW3_CULQU/318-505....STTA....................RFD............MIE-----A-LY-Y------R----------------
F6W3I3_CIOIN/403-597....KA....CCILT...A...IAEQ..RAT............MAT-----V-LY-Y------H----------------
F7CLV0_MACMU/99-291LNCFTS................VSPE..YFR............IAS-----L-TF-F------L----------------
I3KPC6_ORENI/402-595SRAIGK............D...IAVK..YFH............LAQ-----A-LY-Y------R----------------
K7GZK7_CAEJA/310-501......................LGEP..SEHSVLNRYHHTLRLQLE-----Q-LF-M------V----------------
F1NAY3_CHICK/355-559....QGCA..........E...IGSQASRYQ............LGV-----R-LY-Y------R----------------
T1K8P0_TETUR/388-595....DHGFSSPSASTPY.D...PTKK..MLN............SGI-----T-LY-F------K----------------
RBL1_MOUSE/385-578....KQ....PGSHI...D...FAVN..RLK............LAE-----I-LY-Y------K----------------
Q7Q5E8_ANOGA/392-578..................EGWKLALADCRFD............AVE-----A-LY-Y------Q----------------
T1HVA1_RHOPR/31-215......................ISEQ..ALE........ATGDMIL-----K-MF-Y------K----------------
T1J484_STRMM/388-582....DH....PGSQI...D...FAKK..RLQ............LGE-----S-LY-Y------K----------------
D7SVF2_VITVI/28-221....NRCMSSGLHNSSLMNSG.WIEQ..RQE............EAL-----K-LY-Y------K----------------
W5MKN5_LEPOC/394-587....DH....AASHM...D...FADN..RLK............LAE-----I-LY-Y------K----------------
G1KBZ3_ANOCA/346-550....QRCA..........E...IGSQ..RYR............LGV-----R-LY-Y------R----------------
B4M2G6_DROVI/370-550......................RSEAENRFR............MAK-----S-LY-Y------Y----------------
B7PDQ5_IXOSC/377-572....EQ....CTVAADT.E...FAHK..RLL............LGE-----T-LF-Y------K----------------
Q00U21_OSTTA/382-585....TMRTDISPHSMVMDE...LVRQ..RTT............ELV-----H-IF-F------F----------------
D8RMF7_SELML/305-502....SWKAT..LHSSGSLE...WAVQ..RRS............EAS-----K-LY-Y------R----------------
F7AL78_CALJA/395-595....QGCV..........E...IGSQ..RYK............LGV-----R-LY-Y------R----------------
A4S8I4_OSTLU/409-616....TMRTDISPHSTVMDE...LVKQ..RTS............EVS-----H-VF-F------Y----------------
RBF_DROME/376-560......................STEAKSRFQ............LAK-----S-FF-F------Y----------------
H2UU61_TAKRU/351-546....PHCV..........A...LGRQ..RFN............LGV-----K-LY-Y------K----------------
F5H837_HUMAN/343-535FSNCAK............E...IASK..HFR............FAE-----M-LY-Y------K----------------
F6RJP6_XENTR/389-579....DQ....PGSHI...D...FAVN..RWK............LAE-----I-LY-F------K----------------
A8NFV3_BRUMA/385-584....LDGAGYDASFR...Q...MFAV..RKN............NTE-----S-LF-F------R----------------
F6YCW6_XENTR/1-199....QACA..........E...IGYK..RYK............LGV-----R-LY-Y------R----------------
W5MK11_LEPOC/379-572NASLFK............D...LTVK..YFR............LAE-----A-LY-Y------K----------------
G7Y3X8_CLOSI/355-571VSSGSAESNMLA..........ISAAQQRLH............LGC-----I-LY-Y------L----------------
E7FDM3_DANRE/375-568NKSLAR............D...IAVK..YFC............LAE-----A-LY-Y------K----------------
A9SLF5_PHYPA/390-586....SWQ.....NVAGFMDTI.WAEQ..RKL............EAV-----K-LY-Y------K----------------
K7J2L5_NASVI/382-576....QA....ENNCI...D...YGKK..RLQ............SAQ-----T-LF-Y------K----------------
M4AMR4_XIPMA/258-452....PHCV..........V...YGRQ..RFA............LGV-----R-LY-Y------K----------------
H9KR58_APIME/415-607....AN....ETTS....D...FGRK..RLY............LGQ-----T-LF-Y------R----------------
W5JE43_ANODA/403-588......................NAEA..RFD............NIE-----A-LY-Y------Q----------------
W4Y895_STRPU/330-534....VQAS..........E...LACT..RFK............LGL-----R-FY-Y------R----------------
A7RQ05_NEMVE/385-582....ER....PNSPCSTRE...FALR..RLK............LAE-----I-LY-Y------K----------------
C3XU15_BRAFL/375-568....DH....PGSHI...E...FAQK..RLR............LAE-----T-LY-Y------K----------------
H2YMF2_CIOSA/346-540....DI....PAGTA...D...IGDQ..RAT............MSS-----V-LY-Y------H----------------
F1Q9D6_DANRE/359-569....QHCE..........G...LGRK..RFY............LGA-----Q-LY-Y------K----------------
H9IXG6_BOMMO/327-522....SI......................RCN............MVT-----C-LY-Y------K----------------
B4JJ99_DROGR/374-552......................RSEAENRFR............LAK-----S-LY-F------Y----------------
F4QEM9_DICFS/396-587......................IEKENKRSI............YGI-----K-LY-Y------Y----------------
A8HY72_CHLRE/423-626PLLNTS................LGAE..RRI............EAT-----K-LY-C------H----------------
W5LEH3_ASTMX/376-569NEVLAR............D...IAAK..YFR............LAE-----A-LY-Y------K----------------
Q231Q1_TETTS/575-761......................TDGIEYKVQ............KVL-----S-FF-Q------N----------------
B4L4P7_DROMO/352-536......................RSEARNRFR............MAK-----S-LY-F------Y----------------
H3AQ36_LATCH/393-584....DQ....PGSHM...D...FAVN..RLR............LAE-----I-LY-Y------K----------------
W5MR28_LEPOC/371-573....QQCI..........E...IGSQ..RFV............LGV-----R-LY-Y------R----------------
X1WJD7_ACYPI/378-569..........DHNSALHND...FAEK..RLI............MAK-----T-WF-Y------K----------------
E4WSX2_OIKDI/375-564......................LAE...RME............ISK-----K-LF-W------R----------------
RBR1_ORYSJ/419-619....ERICT.SVRSTNRIDAI.WTEQ..RKM............EAL-----K-LY-Y------R----------------
M4B693_HYAAE/488-711SCPTVSMVVIENNDDDDQD...ENSNA.SFLSGVDDSLNRTKSLTI-----V-LF-Y------R----------------
H2MXX9_ORYLA/384-576....DT....PGSHI...D...FAEN..RLK............LAE-----I-LY-Y------K----------------
RBR1_MAIZE/275-476....NRGVSLGLNCANAFDIP.WAEA..RKV............EAS-----K-LY-Y------R----------------
H3A0E3_LATCH/386-579YTGSCK............D...IATK..HFR............LAE-----V-LY-Y------K----------------
B3S6M6_TRIAD/378-570....ER....SKSPI...D...FAEN..RWN............LGI-----K-LY-Y------K----------------
W5KDE3_ASTMX/254-459....QRCE..........G...LGKT..RFT............LGV-----Q-LH-Y------K----------------
H9GN70_ANOCA/432-623PDSFSK............D...IVGK..HFH............LAE-----V-LY-Y------K----------------
M0T571_MUSAM/407-609....ERSISGSLQSVNMTEDVAWAQE..RKM............EAL-----K-LY-Y------K----------------
E1ZEA5_CHLVA/159-357....DCPAP.LDGPLLALEQS.TTAA..RRS............QGL-----R-LY-W------R----------------
D0NTP5_PHYIT/460-683VRFTATLMVDEQEDTDENE...SARNI.SFSSGVDDSLKRTKNLTI-----V-LF-Y------R----------------
U6HGS1_ECHMU/397-581......................TDAAGHRCH............LAE-----Q-LY-Y------Y----------------
K1PLH3_CRAGI/285-489....RNQT..........A...IAKQ..RFV............LAK-----R-LY-Y------R----------------
E0VGB1_PEDHC/321-507....AI............I...FYDD..KLV............LAK-----K-LF-Y------K----------------
U1NNI7_ASCSU/382-582....SRGLDFDAAFT...E...TISL..RRE............NAD-----K-LF-Y------R----------------
B9RGU7_RICCO/60-252....KRQTVSSLQDVNLMESM.WSEQ..RRS............EAL-----K-LY-Y------R----------------
D2VQU0_NAEGR/217-404................NFESLLLFNKEKRKQ............EIM-----K-IY-Y------G----------------
W5KQG9_ASTMX/387-580....DL....PGAHI...D...FAEN..RLK............LAE-----I-LY-Y------K----------------

PF03261

Q9V3H5_DROME/91-460----------------------------LNN------------FDA-----G-DA-V------M----------------
W4XFC8_STRPU/11-372----------------------------LKS------------FDA-----N-DA-I------M----------------
B4NP59_DROWI/88-420----------------------------LNN------------FDA-----G-DV-V------M----------------
G0MEC3_CAEBE/11-362----------------------------VSD------------FDP-----A-HL-V------T----------------
B4MG57_DROVI/90-432----------------------------LNK------------FDP-----G-DA-V------M----------------
Q0G843_CAEEL/11-364----------------------------VSD------------FDP-----A-HL-V------T----------------
I3JGY3_ORENI/11-321----------------------------LKR------------LSP-----T-DP-V------L----------------
B4G7J4_DROPE/90-428----------------------------LSN------------FDA-----G-DA-V------M----------------
E0VX77_PEDHC/62-395----------------------------LKD------------FQA-----G-DA-V------M----------------
Q17C39_AEDAE/119-480----------------------------LRD------------FQA-----G-DA-V------M----------------
H2VTT9_CAEJA/11-389----------------------------VKD------------FNP-----V-HL-V------T----------------

PF01857

E3LY90_CAERE/724-863----------------------------..............SMGT.....R.GK-S------Q................
C3XU15_BRAFL/762-922----------------------------..............EVGD.....E.LR-R------K................
D6WUA4_TRICA/623-757----------------------------..............KITN....TD.TK-R------K................
I7M8B4_TETTS/589-711----------------------------..............KLND.....K.IS-E------A................
W5LEH3_ASTMX/770-953----------------------------..............DIST.....E.LR-Q------K................
W5KQG9_ASTMX/775-930----------------------------..............DISA.....E.LR-G------K................
Q00U21_OSTTA/709-837----------------------------..............KLSP.....E.VT-R------D................
K7J2L5_NASVI/706-866----------------------------..............EITD....ID.LK-R------K................
G3NYF0_GASAC/762-926----------------------------..............DISS.....G.LR-R------K................
E9GV66_DAPPU/739-928----------------------------..............ELYE....ED.LR-K------K................
K7V2N7_MAIZE/595-720----------------------------..............QYME.....Q..T-E------R................
B4MSL7_DROWI/606-728----------------------------..............NLSN.....P.TP-E------K................
B9RGU7_RICCO/363-485----------------------------..............KLSK.....Q.FR-E------K................
H3AQ36_LATCH/797-959----------------------------..............DVSV.....E.LR-R------K................
M4B693_HYAAE/750-894----------------------------..............GLNS.....T.DQ-N------E................
K3YG32_SETIT/683-811----------------------------..............QLSQ.....Q.VL-E------R................
RBR_POPTR/755-884----------------------------..............QPSQ.....QHIR-E------N................
F2UP70_SALR5/745-900----------------------------..............DIDA.....V.LK-R------K................
E9CHS1_CAPO3/877-1004----------------------------..............HLTA.....E.SK-T------R................
F1QY31_DANRE/771-933----------------------------..............DISS.....E.LR-G------K................
H9KR58_APIME/635-797----------------------------..............EIMD....ID.LK-K------K................
Q17Q73_AEDAE/556-680----------------------------..............NLSS.....R.AM-V------E................
H3C722_TETNG/743-911----------------------------..............DISA.....E.LR-A------R................
D2VQU0_NAEGR/452-591----------------------------SN............SEEPMIISMD.LM-E------E................
A9SLF5_PHYPA/706-835----------------------------..............GQPQ.....H.LI-E------R................
M0T571_MUSAM/727-855----------------------------..............QLSQ.....Q.IL-E------Y................
K7GZK7_CAEJA/561-706----------------------------..............SMGV.....R.AK-S------Q................
Q54FX2_DICDI/890-1042----------------------------..............GLSS.....D.YV-V------Q................
B3S6M6_TRIAD/657-840----------------------------..............HLGE.....D.LT-S------K................
D7SVF2_VITVI/331-459----------------------------..............KPLQ.....P.IR-E------I................
H2P1U6_PONAB/787-943----------------------------..............DVSN.....E.LR-R------K................
RBL2_MOUSE/831-1011----------------------------..............DISD.....E.LR-K------K................
G5EDT1_CAEEL/744-889----------------------------..............SMGA.....R.AK-S------Q................
E7FDM3_DANRE/770-952----------------------------..............DISA.....D.LR-R------K................
RBF_DROME/581-705----------------------------..............SLCE.....K.TP-E------S................
U1NNI7_ASCSU/660-828----------------------------..............HLDE.....K.GR-H------R................
G1KFZ9_ANOCA/784-927----------------------------..............DVSN.....E.LR-R------K................
W5MK11_LEPOC/790-976----------------------------..............DISA.....E.LR-R------R................
J0XFZ4_LOALO/562-724----------------------------..............RLDE.....K.GR-Q------R................
T1J484_STRMM/718-944----------------------------..............KITD....EE.LQ-R------K................
I3KPC6_ORENI/788-976----------------------------..............DIMP.....E.LR-R------K................
D7SU46_VITVI/726-854----------------------------..............QLSQ.....Q.MR-E------N................
W4ZBT1_STRPU/363-541----------------------------..............KLSD.....D.LR-R------K................
T1K8P0_TETUR/710-889----------------------------..............NIND....ED.LR-R------K................
A7RQ05_NEMVE/790-960----------------------------..............DVNE.....E.LR-G------K................
D7G8E5_ECTSI/865-1014----------------------------..............HLPG.....D.TA-D------Q................
H9GN70_ANOCA/847-1031----------------------------..............DISD.....E.LR-K------K................
F6RJP6_XENTR/770-927----------------------------..............DVSN.....D.LR-R------K................
G3N416_GASAC/775-935----------------------------..............DVSS.....E.LR-G------K................
I3JCL2_ORENI/775-933----------------------------..............DISS.....D.LR-G------K................
H2U458_TAKRU/718-908----------------------------..............DISA.....E.LR-R------K................
B4M2G6_DROVI/571-694----------------------------..............KLGE.....K.KP-E------K................
G4VM99_SCHMA/814-941----------------------------..............SLTR.....E.LM-A------K................
H3A0E3_LATCH/805-987----------------------------..............DISD.....D.LR-Q------K................
B0XDW3_CULQU/653-812----------------------------..............GLTS....DD.KQ-K------Q................
W5JE43_ANODA/665-839----------------------------..............GLDS....TI.IQ-T------L................
T1HVA1_RHOPR/343-480----------------------------..............KITY....WD.L.-.------.................
A8HY72_CHLRE/818-944----------------------------..............DFSP.LEGPE.VN-S------K................
K3WCJ4_PYTUL/862-1000----------------------------..............ELDA.....K.YL-N------Q................
F4X6S3_ACREC/751-913----------------------------..............EISD.....N.DK-K------K................
B7PDQ5_IXOSC/761-937----------------------------..............NILD....VD.VC-R------K................
H2SIQ5_TAKRU/775-930----------------------------..............DISS.....D.LR-G------K................
T1FJQ6_HELRO/776-947----------------------------..............GIDQ.....Y.LC-N------I................
E0VGB1_PEDHC/551-709----------------------------..............GIKD....IS.LM-K------K................
A8WW47_CAEBR/737-882----------------------------..............AMAT.....R.PK-S------Q................
E1ZEA5_CHLVA/548-700----------------------------..............PADPHVLLAE.VR-R------RQGAGLGLAKAGLGLAH
M3ZR51_XIPMA/555-736----------------------------..............DISS.....E.LR-R------R................
U3I0V9_ANAPL/751-937----------------------------..............DISD.....E.LR-K------K................
I1ILE9_BRADI/604-729----------------------------..............RHVE.....Q..T-E------R................
B7G0K4_PHATC/972-1099----------------------------..............AIPS...ILP.IV-T------Q................
V8P9V1_OPHHA/768-918----------------------------..............DVSN.....D.LR-G------K................
RBR1_ARATH/729-857----------------------------..............QLSQ.....Q.IR-E------S................
G0NPV8_CAEBE/665-810----------------------------..............GMGS.....R.GK-S------Q................
H3D2K2_TETNG/626-748----------------------------..............LFSH....PE.LE-P------I................
Q7Q5E8_ANOGA/609-787----------------------------..............GIDS....EV.IQ-K------L................
G1NXF3_MYOLU/774-956----------------------------..............DVSN.....E.LR-R------K................
A0DTJ1_PARTE/585-706----------------------------..............KLQE.....Q.LQ-E------Y................
C5YE98_SORBI/68-193----------------------------..............QHVE.......LT-E------R................
U3KDL0_FICAL/672-832----------------------------..............DVSN.....D.LR-R------K................
U6HGS1_ECHMU/721-876----------------------------AAASAAGAAAATGGTATA.....P.LL-A------R................
C1N5Z8_MICPC/1035-1166----------------------------..............SLPS.....S.LT-Q------Q................
F6W3I3_CIOIN/825-983----------------------------..............VIPP.....D.LR-A------K................
D0NTP5_PHYIT/716-846----------------------------..............GLDS.....T.DQ-N------Q................
W1PFC3_AMBTC/737-865----------------------------..............QQPN.....N.VM-E------S................
W5MKN5_LEPOC/789-946----------------------------..............DISA.....E.LR-R------K................
F6VRH0_XENTR/812-995----------------------------..............DISD.....E.LR-R------K................
G7Y3X8_CLOSI/746-873----------------------------..............NLQR.....D.IL-V------K................
E4WSX2_OIKDI/638-762----------------------------..............RLSK.....N.IT-E------Y................
G3WX03_SARHA/792-946----------------------------..............DISN.....D.LR-R------K................
D8U756_VOLCA/780-909----------------------------..............DFSP.LQRLD.VN-T------K................
M4AJJ3_XIPMA/767-924----------------------------..............DVSS.....D.LR-Q------K................
H2NQW4_PONAB/835-1018----------------------------..............DISD.....E.LR-K------K................
U6I670_HYMMI/714-860----------------------------TVAASTGTP...GTSAGG.....S.LL-S------K................
E2AA07_CAMFO/750-912----------------------------..............EISD.....T.DK-K------K................
H2YMF2_CIOSA/739-893----------------------------..............VISP.....D.LR-A------K................
A4S8I4_OSTLU/745-874----------------------------..............NLST.....D.VT-R------D................

PF00382

TF3B_KLULA/193-266------------------------------------------ELGD--KKIK-VI-R------D----------------
TF2B_KLULA/137-207------------------------------------------ELPK--...I-VK-D------C----------------
TF2B_YEAST/133-203------------------------------------------ELPK--...I-VK-D------C----------------
TF3B_CANAL/95-165------------------------------------------KIPD--...Y-IA-E------A----------------
TF2B_DROME/214-284------------------------------------------DLPN--...M-VQ-R------A----------------
TF3B_KLULA/98-168------------------------------------------NIPE--...Y-VT-D------A----------------
TF3B_CANAL/190-263------------------------------------------DFKD--KATK-VA-K------D----------------
TF2B_DROME/120-190------------------------------------------NLPK--...T-IV-D------R----------------
TF2B_KLULA/245-315------------------------------------------GLSV--...Q-VA-N------A----------------
TF2B_PYRFU/212-282------------------------------------------GLSE--...K-VR-R------R----------------
Q5V5V1_HALMA/235-305------------------------------------------ELSE--...E-VQ-S------K----------------

PF16899

CCNH_ECHMU/168-289------------------------------------------DMMT-----S-LK-K------E----------------
D2VN70_NAEGR/180-268------------------------------------------...D-----A-IY-M------D----------------
H3FVF7_PRIPA/67-164------------------------------------------KDLE-----S-LE-A------S----------------
G6D7P5_DANPL/155-246------------------------------------------GQDD-----Q-LL-T------Y----------------
C5DE24_LACTC/194-313------------------------------------------NYMG-----Q-VY-T------D----------------
H2B1R1_KAZAF/202-304------------------------------------------NHMG-----R-IY-D------A----------------
C5DYH4_ZYGRC/193-303------------------------------------------KYMG-----Q-IY-D------R----------------
Q6FMU5_CANGA/203-302------------------------------------------KYMG-----K-IY-E------K----------------
G0V973_NAUCC/221-326------------------------------------------NYMG-----Q-TY-D------K----------------
G0W3A8_NAUDC/222-335------------------------------------------NYMG-----Q-IY-D------R----------------
G2YRH2_BOTF4/184-304------------------------------------------NLTL-----E-SH-G------R----------------
R7YVJ7_CONA1/187-325------------------------------------------KRIG-----N-AY-A------L----------------
C9SVU8_VERA1/162-263------------------------------------------SRID-----A-AH-Q------R----------------
L2FZZ6_COLGN/165-276------------------------------------------SRVE-----T-AH-L------R----------------
H1VJI3_COLHI/166-278------------------------------------------ARID-----T-AH-A------R----------------
M7TNJ7_EUTLA/145-243------------------------------------------DRIN-----R-AH-R------K----------------
G3JT19_CORMM/158-261------------------------------------------NRIN-----T-AH-M------R----------------
G9NI52_HYPAI/158-265------------------------------------------GRVA-----K-AH-A------M----------------
F9F5Z4_FUSOF/158-263------------------------------------------TRIN-----K-SH-A------R----------------
L8GA30_PSED2/187-302------------------------------------------ARVR-----D-AH-G------N----------------
K1X5Y0_MARBU/178-294------------------------------------------KRVK-----E-AH-G------K----------------
N1JHL3_BLUG1/188-305------------------------------------------RRIK-----D-AH-K------K----------------
H6C5Z8_EXODN/187-301------------------------------------------KRIG-----T-AA-D------H----------------
R1EFE2_BOTPV/206-348------------------------------------------NRIG-----M-AY-N------T----------------
Q0UGP0_PHANO/193-328------------------------------------------KRIT-----E-AY-G------L----------------
E5AC16_LEPMJ/211-344------------------------------------------ARIT-----A-AY-T------H----------------
R0KJU5_SETT2/173-306------------------------------------------ERIH-----A-AY-G------T----------------
M3AYY7_MYCFI/177-276------------------------------------------DRVQ-----L-AF-Q------S----------------
N1QKL6_SPHMS/175-275------------------------------------------ERIQ-----L-AW-Q------A----------------
F9XH99_MYCGM/164-291------------------------------------------DRVQ-----A-AY-A------A----------------
M2MZH1_BAUCO/171-314------------------------------------------DRIN-----A-AY-S------A----------------
M2YNC7_MYCP1/165-265------------------------------------------DRIQ-----A-CY-A------T----------------
B6Q284_PENMQ/191-333------------------------------------------SRIS-----T-AH-G------K----------------
G3Y4C9_ASPNA/188-330------------------------------------------DRIS-----R-AH-H------S----------------
B0Y3L0_ASPFC/188-332------------------------------------------DRIA-----R-AH-T------T----------------
Q5BB69_EMENI/189-333------------------------------------------DRLA-----R-AH-H------N----------------
G7E2H9_MIXOS/177-279------------------------------------------TRSA-----G-AL-E------R----------------
F8NWE7_SERL9/187-291------------------------------------------DRPE-----E-IY-N------T----------------
D8PKL8_SCHCM/182-281------------------------------------------.PDH-----N-IY-Q------K----------------
K9HXY7_AGABB/176-275------------------------------------------NLSP-----S-IY-D------T----------------
J4HVQ4_FIBRA/73-167------------------------------------------DELR-----A-AY-D------I----------------
E9C7X0_CAPO3/152-254------------------------------------------.ELE-----A-AY-R------D----------------
E3M1M6_CAERE/158-270------------------------------------------FDLE-----S-IR-R------D----------------
A7S801_NEMVE/159-255------------------------------------------VNPE-----S-WR-I------K----------------
C3ZT09_BRAFL/159-259------------------------------------------.EVE-----T-LR-R------W----------------
I1FML6_AMPQE/158-255------------------------------------------.NVE-----R-LR-K------E----------------
E4YFZ2_OIKDI/97-198------------------------------------------.NSD-----I-LR-Q------N----------------
G3U0L9_LOXAF/162-261------------------------------------------.CCS-----L-TR-R------T----------------
G1N872_MELGA/126-226------------------------------------------.NPE-----V-LR-K------S----------------
G3UI14_LOXAF/162-261------------------------------------------.NPF-----I-IS-K------S----------------
E3TDV0_ICTPU/162-262------------------------------------------.NPE-----M-LR-K------S----------------
B5DG24_SALSA/163-263------------------------------------------.NPE-----S-LR-K------S----------------
H2RRW1_TAKRU/163-263------------------------------------------.NPE-----S-LR-K------S----------------
K4FV42_CALMI/163-263------------------------------------------.NPE-----V-LR-K------M----------------
Q3KQ83_XENLA/162-262------------------------------------------.NPE-----V-LR-K------S----------------
I7G2X7_MACFA/162-262------------------------------------------.NPE-----I-LR-K------T----------------
H3A0T1_LATCH/164-264------------------------------------------.NPE-----V-LR-K------T----------------
R7UPP9_CAPTE/154-254------------------------------------------.NVE-----R-LR-P------G----------------
B7PB82_IXOSC/86-183------------------------------------------.DPE-----K-LR-S------L----------------
G3MNU6_9ACAR/156-256------------------------------------------.DPE-----K-LR-I------F----------------
F6TUV6_CIOIN/161-261------------------------------------------.NAE-----Q-LR-K------P----------------
E9G2Q3_DAPPU/159-258------------------------------------------.DPE-----R-LR-S------G----------------
R4G2X9_RHOPR/158-256------------------------------------------.NPE-----K-LR-G------G----------------
B8YN16_SCYPA/165-265------------------------------------------.DPE-----R-LR-L------Y----------------
K7IUX2_NASVI/159-256------------------------------------------.NPE-----K-LR-P------Y----------------
E2BY23_HARSA/159-256------------------------------------------.NPE-----K-LR-P------Y----------------
H9K562_APIME/183-280------------------------------------------.NPE-----R-LR-P------Y----------------
N6TWG3_DENPD/159-258------------------------------------------.DPE-----R-LR-Q------G----------------
Q16JQ2_AEDAE/159-257------------------------------------------.NPD-----R-LR-P------G----------------
C6SV35_DROME/162-260------------------------------------------.NPD-----R-LR-P------H----------------
D3TRT0_GLOMM/159-257------------------------------------------..AE-----R-LR-Q------H----------------
H9JGM4_BOMMO/159-258------------------------------------------..PE-----R-LR-S------G----------------
K8F2A8_9CHLO/171-283------------------------------------------EKIR-----E-CY-T------K----------------
L8GMB5_ACACA/173-270------------------------------------------...E-----K-LQ-G------R----------------
Q5SCB4_OSTTA/157-262------------------------------------------KQLI-----E-CR-K------K----------------
A4RUA6_OSTLU/106-212------------------------------------------AQLV-----A-CR-K------S----------------
D8SKW4_SELML/173-280------------------------------------------QKIL-----D-LQ-S------E----------------
A9TM39_PHYPA/166-271------------------------------------------HSEQ-----E-LR-A------V----------------
B6TIT4_MAIZE/176-281------------------------------------------QRLK-----E-LR-Q------A----------------
I1GNJ7_BRADI/176-281------------------------------------------QRLK-----E-LH-Q------T----------------
M8CSB1_AEGTA/98-189------------------------------------------...D-----D-LH-Q------T----------------
R0FFP6_9BRAS/176-281------------------------------------------LKLE-----N-LL-K------A----------------
K4BTS5_SOLLC/176-282------------------------------------------VALK-----G-SL-D------T----------------
M0U1N4_MUSAM/177-282------------------------------------------EKFK-----N-FL-Q------T----------------
A9PJ64_9ROSI/178-280------------------------------------------EDIE-----K-LK-E------I----------------
B9RF84_RICCO/157-262------------------------------------------QMLK-----D-LQ-V------S----------------
M5VZ28_PRUPE/175-280------------------------------------------QILQ-----N-LL-H------A----------------
D7U9R4_VITVI/178-283------------------------------------------QMLK-----D-LH-K------T----------------
G7I853_MEDTR/189-294------------------------------------------QKFK-----A-LQ-N------T----------------
I1KBX5_SOYBN/178-283------------------------------------------EMLK-----T-LQ-E------T----------------

PF02984

CG11_CANAL/174-308------------------------------------------RPNR-----K-SS.ISSAVTAV----------------
Q9GTQ8_DROME/286-422------------------------------------------....-----K-VR.G......H----------------
Q4T8S9_TETNG/1145-1270------------------------------------------....-----V-LR.K......H----------------
Q4RZE5_TETNG/155-280------------------------------------------....-----V-LR.K......H----------------
A7YYE4_DANRE/155-279------------------------------------------....-----I-LR.K......H----------------
Q7ZYJ6_XENLA/153-279------------------------------------------....-----I-IR.K......H----------------
CCND1_BOVIN/155-283------------------------------------------....-----I-IR.K......H----------------
CCND1_MOUSE/155-283------------------------------------------....-----T-IR.K......H----------------
Q5T8J1_HUMAN/105-230------------------------------------------....-----L-VK.K......H----------------
Q5ZKI9_CHICK/155-278------------------------------------------....-----L-VK.K......H----------------
Q1L8M6_DANRE/153-279------------------------------------------....-----L-IR.K......H----------------
H2Q584_PANTR/154-275------------------------------------------....-----L-IR.K......H----------------
Q3KPK0_XENLA/154-277------------------------------------------LL..-----L-IR.K......H----------------
CCD11_ARATH/184-308------------------------------------------....-----F-FI.S......H----------------
Q9SNV2_ANTMA/176-296------------------------------------------....-----F-LT.S......R----------------
CCD42_ORYSJ/212-330------------------------------------------....-----.-...W......L----------------
CCD42_ARATH/171-289------------------------------------------.PHS-----R-LV.T......R----------------
CCD41_ARATH/180-299------------------------------------------....-----T-LI.S......R----------------
P93103_OXYRB/210-333------------------------------------------MPSK-----S-LI.F......Q----------------
Q9ZRX9_TOBAC/198-317------------------------------------------IPSR-----P-LI........S----------------
O82678_OXYRB/199-324------------------------------------------....-----K-IL.T......R----------------
Q8LPW3_HELAN/178-304------------------------------------------....-----D-FF.K......K----------------
CCD33_ARATH/188-310------------------------------------------....-----E-FL.S......R----------------
CCD31_ARATH/189-307------------------------------------------....-----D-FL.N......K----------------
Q8LK74_LAGSI/187-313------------------------------------------....-----E-IL.W......Q----------------
Q9SMD4_SOLLC/184-309------------------------------------------....-----E-FL.R......R----------------
Q8GZU3_9ROSI/205-332------------------------------------------....-----E-FL.K......R----------------
Q2ABE7_CAMSI/203-327------------------------------------------....-----E-FL.K......R----------------
Q9S7H9_SOLLC/192-320------------------------------------------....-----D-FL.K......K----------------
A7Y7X0_CUCSA/197-329------------------------------------------....-----E-FF.R......R----------------
Q9SNV0_ANTMA/203-329------------------------------------------....-----E-FM.K......R----------------
Q40338_MEDSA/212-338------------------------------------------....-----E-FL.R......R----------------
Q9SXN7_TOBAC/190-313------------------------------------------....-----E-FL.K......Q----------------
Q2ABE6_CAMSI/198-326------------------------------------------....-----E-FL.W......R----------------
Q7XAB7_EUPES/184-308------------------------------------------....-----E-FL.R......R----------------
Q84V88_POPAL/200-324------------------------------------------....-----E-FL.W......R----------------
CCNE_HEMPU/255-381------------------------------------------....-----E-FV........Q----------------
Q5U4W4_XENLA/240-362------------------------------------------....-----K-LL........L----------------
Q5ZMH4_CHICK/247-368------------------------------------------....-----K-VL........L----------------
Q544H6_MOUSE/241-363------------------------------------------....-----K-VL........L----------------
CCNE1_HUMAN/244-366------------------------------------------....-----D-LH.....EVLL----------------
B2GQF9_DANRE/246-368------------------------------------------....-----E-VL........T----------------
CCD61_ARATH/156-288------------------------------------------.PLL-----L-KH.S......L----------------
A8XRM2_CAEBR/208-340------------------------------------------....-----D-QQ.AFYYAYNI----------------
O45926_CAEEL/161-293------------------------------------------EAFY-----Y-VH.N......I----------------
CCNB1_CAEEL/208-340------------------------------------------....-----D-NQ.AFCYTYNI----------------
Q9U7P9_9CILI/566-681------------------------------------------....-----E-TS.H......I----------------
Q4T2Y9_TETNG/114-254------------------------------------------WPIS-----S-ISKTKVFMDKY----------------
CCNJ_XENLA/145-273------------------------------------------WPMI-----C-LEKTKIYMAKY----------------
CG1C_SCHPO/162-278------------------------------------------.K..-----N-VT.K......V----------------
A2F2K2_TRIVA/212-328------------------------------------------....-----D-LL........L----------------
A2DQ77_TRIVA/248-364------------------------------------------....-----S-ML........F----------------
A2DZV8_TRIVA/235-351------------------------------------------....-----S-ML........F----------------
A0C1C9_PARTE/197-310------------------------------------------....-----K-IN.H......A----------------
A0DMF0_PARTE/199-312------------------------------------------....-----K-IN.Y......A----------------
B8N0B1_ASPFN/192-299------------------------------------------.P..-----E-VE.H......M----------------
A4RSW0_OSTLU/207-322------------------------------------------....-----Q-LCSH......L----------------
Q5SCB7_OSTTA/222-339------------------------------------------....-----R-CS.S......L----------------
CCNF_MOUSE/408-531------------------------------------------.P..-----R-TQ.H......L----------------
CCNF_XENTR/414-537------------------------------------------.R..-----S-TL.H......L----------------
A2E0Q4_TRIVA/216-333------------------------------------------.S..-----M-MN.S......F----------------
A2E6K7_TRIVA/216-333------------------------------------------.M..-----I-LN.R......F----------------
REM1_SCHPO/273-388------------------------------------------.S..-----Q-LR.I......M----------------
Q4CS48_TRYCC/197-328------------------------------------------.A..-----M-VR.D......A----------------
A4HKX7_LEIBR/155-297------------------------------------------FA..-----I-VR.H......A----------------
Q4DWL9_TRYCC/229-371------------------------------------------LP..-----L-LR.H......T----------------
Q0VA13_XENTR/226-348------------------------------------------.M..-----K-IL.Y......L----------------
CCF13_ORYSJ/255-372------------------------------------------....-----E-LLKE......A----------------
Q23JX5_TETTS/284-401------------------------------------------.K..-----K-SF.D......M----------------
O96434_PARTE/212-329------------------------------------------.T..-----K-NL.S......L----------------
A0E0R4_PARTE/214-320------------------------------------------....-----K-NK.A......L----------------
Q9TY42_PARTE/121-227------------------------------------------....-----K-DK.A......L----------------
Q25123_HELRO/240-368------------------------------------------.G..-----G-RWNS......L----------------
CCNB3_CAEEL/243-364------------------------------------------.M..-----K-TL.T......M----------------
Q29CG1_DROPS/434-556------------------------------------------.M..-----P-TL.T......L----------------
Q7QC70_ANOGA/538-653------------------------------------------.M..-----M-TL.T......L----------------
Q16VG6_AEDAE/419-535------------------------------------------.M..-----Q-VL.T......L----------------
Q25168_HELTR/382-498------------------------------------------.L..-----K-TL.T......L----------------
A7S8H6_NEMVE/110-226------------------------------------------.V..-----K-TL.T......L----------------
Q60FY2_ANGJA/277-393------------------------------------------.M..-----E-TL.T......L----------------
Q08C91_DANRE/272-388------------------------------------------....-----T-LT........L----------------
Q60FY1_ORENI/302-418------------------------------------------....-----T-LT........L----------------
CCNB3_MOUSE/1265-1381------------------------------------------.M..-----K-TL.T......L----------------
K4Q4R6_CHICK/276-392------------------------------------------.M..-----E-TL.T......L----------------
Q3KQA7_XENLA/288-404------------------------------------------.M..-----E-TL.T......L----------------
CCNB3_HUMAN/1259-1375------------------------------------------.M..-----K-TL.T......L----------------
CCNB3_CANFA/1202-1318------------------------------------------.M..-----K-TL.T......L----------------
CCNA1_CAEEL/343-459------------------------------------------.K..-----K-MR.N......T----------------
CCNA_DROME/334-451------------------------------------------....-----K-LK.Y......M----------------
Q29DY8_DROPS/354-471------------------------------------------....-----K-LK.S......L----------------
Q17NN3_AEDAE/310-427------------------------------------------....-----K-VK.H......M----------------
Q7Q0E8_ANOGA/187-304------------------------------------------....-----K-VK.Y......L----------------
CCF32_ORYSJ/267-390------------------------------------------.I..-----R-LE.L......M----------------
A3AKA7_ORYSJ/256-379------------------------------------------YPSL-----P-LE.F......M----------------
A2ZM34_ORYSI/249-372------------------------------------------RSSL-----L-LE.F......M----------------
Q39877_SOYBN/214-337------------------------------------------TPNS-----Q-IE.H......L----------------
Q40488_TOBAC/238-361------------------------------------------FLTL-----H-FE.F......L----------------
CCNAL_DAUCA/208-330------------------------------------------VPKL-----K-FE.F......L----------------
CCA33_ARATH/190-313------------------------------------------VPNL-----Q-LE.P......L----------------
Q2V5Z8_BRACM/228-351------------------------------------------ESLL-----Q-IE.C......L----------------
CCA31_ARATH/219-342------------------------------------------MSHL-----Q-ME.F......L----------------
Q9M4K9_PEA/216-340------------------------------------------ASEL-----Q-FE.F......L----------------
O04388_CATRO/238-361------------------------------------------NPNL-----Q-FE.F......L----------------
Q40492_TOBAC/247-370------------------------------------------TPNL-----Q-LE.F......L----------------
Q39331_BRANA/289-412------------------------------------------APCM-----Q-LE.C......M----------------
CCA12_ARATH/310-433------------------------------------------VPSL-----L-SE.C......L----------------
CCA14_ORYSJ/216-339------------------------------------------APVL-----H-LE.F......L----------------
CCA11_ORYSJ/372-495------------------------------------------DPAL-----H-LE.F......L----------------
Q84LE4_SILLA/352-474------------------------------------------VPAF-----Q-LE.C......L----------------
Q40514_TOBAC/347-470------------------------------------------VLSL-----Q-LE.H......L----------------
Q96226_ADICA/397-520------------------------------------------SPTL-----Q-LE.F......L----------------
Q39878_SOYBN/336-459------------------------------------------APYV-----E-LE.F......L----------------
Q9XGI4_SOLLC/345-468------------------------------------------VPSV-----E-LE.F......M----------------
CCA22_ARATH/304-427------------------------------------------VPFI-----E-LE.Y......L----------------
CCA21_ORYSJ/359-482------------------------------------------VPSI-----T-LG.Y......L----------------
CCA24_ARATH/329-452------------------------------------------NQSL-----E-ME.F......L----------------
A5BUM0_VITVI/360-483------------------------------------------NPSL-----E-LE.Y......L----------------
Q941M7_MEDSA/349-473------------------------------------------RPSI-----E-LE.Y......L----------------
A7SEI5_NEMVE/172-293------------------------------------------AP..-----K-VE.A......L----------------
CCNA_HYDVD/296-415------------------------------------------....-----Q-LK.Y......L----------------
P90681_PATPE/322-438------------------------------------------....-----S-RNGT......S----------------
Q6ZZ83_SPHGR/342-458------------------------------------------....-----T-EH........L----------------
Q4SG06_TETNG/155-272------------------------------------------.P..-----L-TH.N......L----------------
O77212_DREPO/291-408------------------------------------------.E..-----K-LK.S......L----------------
CCNA1_CARAU/268-385------------------------------------------....-----R-TV.N......L----------------
CCNA1_XENLA/295-412------------------------------------------.V..-----K-ME.H......L----------------
CCNA1_MOUSE/298-415------------------------------------------.VCI-----R-TE.N......L----------------
CCNA_PATVU/302-419------------------------------------------.E..-----T-TK.S......L----------------
Q28DU2_XENTR/291-408------------------------------------------.P..-----K-VE.S......L----------------
Q98TA3_DANRE/305-422------------------------------------------....-----K-VE.S......L----------------
CCNA2_BOVIN/307-425------------------------------------------.C..-----K-VE.S......L----------------
CCNA2_CHICK/273-390------------------------------------------....-----K-VE.S......L----------------
M1KIP0_ENCCN/179-293------------------------------------------.I..-----C-SR.T......V----------------
Q6FVY0_CANGA/262-383------------------------------------------.G..-----E-CR.M......I----------------
A0A023ZJ88_YEASX/296-418------------------------------------------.P..-----V-NR.N......I----------------
A0A023ZMR1_YEASX/254-374------------------------------------------.I..-----E-TR.N......M----------------
CG21_SCHPO/294-409------------------------------------------....-----.-IR.M......L----------------
A0A023ZKJ3_YEASX/338-453------------------------------------------...F-----E-PR.T......L----------------
Q6FNV2_CANGA/314-429------------------------------------------...Y-----R-TR.N......L----------------
Q6CT04_KLULA/317-432------------------------------------------....-----.-TR.T......V----------------
Q75A51_ASHGO/248-363------------------------------------------....-----.-IR.T......L----------------
Q6FQU1_CANGA/326-455------------------------------------------...Y-----N-IR.T......L----------------
A6ZXH4_YEAS7/299-414------------------------------------------....-----.-TR.T......L----------------
A7TR46_VANPO/331-446------------------------------------------....-----.-IR.T......L----------------
Q2HAS9_CHAGB/515-630------------------------------------------...L-----E-TR.T......L----------------
F5HHN7_NEUCR/516-631------------------------------------------...L-----E-TR.T......L----------------
Q0UCR8_PHANO/466-581------------------------------------------...L-----E-TR.T......L----------------
A7F1V1_SCLS1/469-584------------------------------------------...L-----E-TR.T......L----------------
A1C7V2_ASPCL/489-604------------------------------------------...L-----E-TR.T......L----------------
Q6BGT2_DEBHA/350-465------------------------------------------...Y-----E-TR.T......L----------------
Q6CE22_YARLI/306-421------------------------------------------...L-----E-TR.T......L----------------
Q49U21_CRYNE/355-469------------------------------------------.V..-----Q-TR.T......L----------------
Q6X269_USTMD/465-579------------------------------------------.I..-----R-TR.T......L----------------
CG22_SCHPO/267-382------------------------------------------.A..-----Q-TR.T......L----------------
A0A023ZMC4_YEASX/339-454------------------------------------------.I..-----Q-SR.T......L----------------
Q75EI0_ASHGO/418-533------------------------------------------.I..-----Q-SR.T......L----------------
Q6FVY1_CANGA/344-459------------------------------------------.I..-----Q-SR.T......L----------------
A3LN44_PICST/322-438------------------------------------------.V..-----Q-SR.T......L----------------
A5DUV2_LODEL/512-628------------------------------------------.V..-----Q-SR.T......L----------------
Q6CEJ4_YARLI/393-508------------------------------------------.I..-----H-SR.T......F----------------
Q0UMA7_PHANO/348-462------------------------------------------.I..-----Q-TR.T......L----------------
Q2HAK4_CHAGB/352-466------------------------------------------.I..-----Q-SR.T......I----------------
A1CID9_ASPCL/361-475------------------------------------------.I..-----Q-TR.T......L----------------
CG23_SCHPO/334-448------------------------------------------.I..-----Q-TR.T......V----------------
O93916_PNECA/304-419------------------------------------------.I..-----Q-TR.T......V----------------
F5HE42_USTMA/433-547------------------------------------------.I..-----Q-TR.T......V----------------
F5H8X2_CRYNB/366-482------------------------------------------.I..-----Q-SR.T......V----------------
Q5SCB6_OSTTA/230-346------------------------------------------.R..-----Q-FQ.L......Y----------------
CCB31_ARATH/274-391------------------------------------------.K..-----K-LE.Q......L----------------
Q9ZRG1_PEA/135-252------------------------------------------.M..-----K-LE.H......M----------------
CCB21_ARATH/302-419------------------------------------------.K..-----K-CE.V......L----------------
CCB22_ARATH/303-421------------------------------------------.K..-----K-LE.I......L----------------
Q9XGI1_SOLLC/308-425------------------------------------------.R..-----K-LE.L......L----------------
CCNB2_MEDSA/201-318------------------------------------------.K..-----K-LE.L......V----------------
CCB23_ARATH/308-425------------------------------------------.K..-----K-LE.I......L----------------
CCB24_ARATH/309-426------------------------------------------.K..-----K-LE.L......L----------------
Q2WGP0_ALLCE/280-397------------------------------------------.K..-----K-LE.L......L----------------
B8AT55_ORYSI/285-402------------------------------------------.K..-----Q-LQ.L......L----------------
CCB22_ORYSI/293-410------------------------------------------.K..-----K-LE.L......M----------------
Q41734_MAIZE/282-407------------------------------------------EK..-----E-ME.N......M----------------
P93646_MAIZE/356-473------------------------------------------.A..-----E-LE.N......M----------------
CCB13_ORYSJ/341-458------------------------------------------.E..-----E-LE.H......M----------------
O65064_PICMA/98-215------------------------------------------.K..-----E-ME.N......L----------------
Q41733_MAIZE/317-437------------------------------------------....-----Q-LQ.H......T----------------
CCB14_ARATH/260-379------------------------------------------....-----E-ME.K......L----------------
CCB11_ARATH/295-418------------------------------------------.E..-----K-ME.N......M----------------
P93102_OXYRB/319-438------------------------------------------....-----E-ME.N......M----------------
Q2WGP2_ALLCE/358-475------------------------------------------.K..-----Q-LE.H......M----------------
CCB12_ARATH/312-429------------------------------------------.P..-----E-ME.N......M----------------
CCB13_ARATH/289-406------------------------------------------.Q..-----K-LE.N......L----------------
A5AEK5_VITVI/324-442------------------------------------------.Q..-----E-ME.H......M----------------
O04398_TOBAC/319-436------------------------------------------.A..-----Q-ME.N......M----------------
Q40516_TOBAC/291-408------------------------------------------...S-----E-IE.N......M----------------
O82137_PEA/102-224------------------------------------------.SDL-----A-LE.N......M----------------
O82717_LUPLU/324-441------------------------------------------.Q..-----E-LE.N......M----------------
P93557_SESRO/318-435------------------------------------------....-----E-ALEN......M----------------
O04389_CATRO/313-431------------------------------------------.S..-----N-ME.N......M----------------
Q2PHK8_DAUCA/314-432------------------------------------------....-----A-VE.N......M----------------
Q2PHK9_DAUCA/330-448------------------------------------------....-----D-VN.N......M----------------
Q9LKC6_CICAR/324-443------------------------------------------.S..-----D-VE.N......M----------------
CCN2_ANTMA/319-438------------------------------------------...S-----D-VEKN......M----------------
Q5D894_GOSHI/87-204------------------------------------------.P..-----K-ME.N......M----------------
Q40223_LUPLU/307-426------------------------------------------....-----K-IE.D......M----------------
Q39880_SOYBN/313-433------------------------------------------....-----E-ME.N......M----------------
Q2PHL0_DAUCA/311-430------------------------------------------....-----E-ME.N......M----------------
Q2ABE9_CAMSI/308-433------------------------------------------RE..-----E-ME.N......M----------------
Q9SBQ4_PETHY/303-423------------------------------------------.Q..-----E-IQ.N......M----------------
Q9XGI2_SOLLC/248-367------------------------------------------....-----E-ME.N......M----------------
Q5D8P0_SCHJA/269-392------------------------------------------.R..-----T-MH.N......L----------------
CCNB_DICDI/316-434------------------------------------------.S..-----R-TH.S......L----------------
P92162_BOMMO/389-509------------------------------------------.S..-----R-NH.H......L----------------
Q4TVR6_HELTR/235-352------------------------------------------.G..-----E-TH.N......L----------------
A7SPG5_NEMVE/166-283------------------------------------------.A..-----E-EH.T......M----------------
Q4T0M3_TETNG/224-342------------------------------------------.A..-----E-QH.T......L----------------
CCNB1_ANGJA/272-390------------------------------------------.A..-----E-HH.T......L----------------
CCNB1_CARAU/266-384------------------------------------------.A..-----E-HH.T......L----------------
CCNB1_CRIGR/296-414------------------------------------------.V..-----E-QH.T......L----------------
Q6P801_XENTR/266-384------------------------------------------.A..-----E-QH.S......L----------------
O93228_RANJA/239-357------------------------------------------.A..-----V-LH.T......L----------------
Q6IR86_XENLA/262-380------------------------------------------.S..-----V-HH.T......L----------------
Q7ZVA8_DANRE/252-370------------------------------------------.A..-----E-KH.T......L----------------
Q09IZ1_ONCMY/251-369------------------------------------------.V..-----E-KH.T......L----------------
CCNB2_ORYLA/254-372------------------------------------------.V..-----E-KH.T......L----------------
Q28GP5_XENTR/256-374------------------------------------------.A..-----G-QH.T......L----------------
Q6T2E9_BUFGR/263-381------------------------------------------.A..-----E-QY.T......L----------------
CCNB2_CHICK/268-386------------------------------------------.A..-----E-QH.T......L----------------
Q7Z4Z4_HUMAN/264-382------------------------------------------.V..-----E-QH.T......L----------------
CCNB_MARGL/258-375------------------------------------------.G..-----Q-KH.T......M----------------
CCNB_PATPE/272-390------------------------------------------.G..-----H-KH.T......L----------------
Q95WE6_PATPE/274-391------------------------------------------.G..-----H-KH.T......L----------------
Q5UAU8_PENJP/269-385------------------------------------------.A..-----S-QH.T......L----------------
CCNB_SPISO/299-415------------------------------------------.A..-----N-KH.T......L----------------
CCNB_PATVU/282-398------------------------------------------.A..-----T-KH.T......L----------------
CCNB_HYDVD/264-380------------------------------------------.A..-----Q-KH.T......L----------------
CCNB_ARBPU/274-395------------------------------------------.A..-----Q-KH.T......L----------------
Q94740_SPHGR/281-401------------------------------------------.P..-----Q-KH.T......L----------------
Q291N4_DROPS/375-501------------------------------------------.D..-----E-HH.A......M----------------
Q16TY2_AEDAE/355-477------------------------------------------.D..-----K-NH.L......C----------------
Q7PPJ1_ANOGA/320-449------------------------------------------.D..-----V-NH.V......L----------------

PF00134

CCNA2_MOUSE/171-297-----AVN----------YIDRFLS---------SM-----------------------.S....--VLRGKLQLVG--T
CCNB3_CAEEL/115-241-----AVK----------LTDMYLC---------KT-----------------------KN....--VDKNTIQKLA--C
CCNF_MOUSE/281-406-----TVE----------CVDRYLR---------RR-----------------------.L....--VPRYKLQLLG--I
CCT12_ARATH/28-169-----AIF----------FCHRFFL---------RQ-----------------------.S....--HAKNDRQTIA--T
CCNE_CAEEL/232-360-----AVD----------YVDRYLE---------SS-----------------------NV...E--CSTDNFQLVG--T
REM1_SCHPO/145-271-----SIN----------VLDRFLS---------LQ-----------------------N.....--VPASKMKLCG--A
O45926_CAEEL/34-159-----TIF----------VLDRIIV---------KN-----------------------.I....--VSKAEFQLLG--V
CCB14_ARATH/133-258-----TIN----------LVDRFLS---------LT-----------------------.M....--VHRRELQLLG--L
CCU41_ARATH/22-148-----AYV----------YLDRFTH---------RQ-----------------------P.S.LP--INSFNVHRLL--I
CCNB2_HUMAN/137-262-----CVG----------IMDRFLQ---------VQ-----------------------.P....--VSRKKLQLVG--I
CCNT_DROME/42-176-----AIV----------YMHRFYA---------FH-----------------------SF....--T.HFHRNSMA--S
CG23_SCHPO/206-332-----AVN----------IIDRFLS---------LR-----------------------.V....--CSLNKLQLVG--I
CCNA_DROME/206-332-----SVF----------YLDRFLS---------QM-----------------------.A....--VVRSKLQLVG--T
CG12_YEAST/43-195-----SVR----------LYDRYCS---------KR-----------------------.....I--VLRDQAKLVV--A
CCNB_DROME/260-387-----AVA----------IIDRYLQ---------VV-----------------------.K...D--TKRTYLQLVG--V
CCNB1_MOUSE/170-295-----TVS----------IIDRFMQ---------NS-----------------------.C....--VPKKMLQLVG--V
CG21_SCHPO/166-292-----AVN----------LIDRFLS---------IK-----------------------.V....--VSLQKVQLVG--L
PCL1_YEAST/19-152-----AAC----------YLNKLKR---------IL-----------------------PRD.AT--GLPSTIHRIF--L
CG21_YEAST/212-337-----AIN----------IMDRFLC---------EE-----------------------.V....--VQLNRLQLVG--T
CG22_YEAST/232-357-----AIN----------IMDRFLG---------KE-----------------------.L....--VQLDKLQLVG--T
CG23_YEAST/171-297-----CIN----------IIDRYLC---------KE-----------------------.V....--VPVNKFQLVG--A
CG24_YEAST/210-336-----TIN----------IVDRFLS---------KK-----------------------.T....--VTLNRFQLVG--V
PUC1_SCHPO/99-227-----SIS----------LMDSYVS---------RR-----------------------.....V--VYCKHIQLVA--C
CCNB1_SOYBN/197-322-----TIN----------IIDRFLA---------VK-----------------------.T....--VPRRELQLVG--I
PCL2_YEAST/18-146-----TSV----------YLAKLRS---------II-----------------------PSN.VY--GIETTRHRIF--L
CCNB2_CHICK/141-266-----CVA----------VMDRFLQ---------SH-----------------------.P....--VPRKRLQLVG--V
CCB11_ARATH/168-293-----TVN----------ILDRFLS---------VK-----------------------.P....--VPRKELQLVG--L
CCND2_MOUSE/24-151-----AMN----------YLD