Sequence alignment for CL0067

PF13580

B4BKI9_9BACI/4-139--QYFQK-------------------------------------------------------------------------
Y240_THEPX/4-141--EYIDE-------------------------------------------------------------------------
D3Q8F5_STANL/7-146--AYAAA-------------------------------------------------------------------------
Y887_BACSK/6-142--QYYES-------------------------------------------------------------------------
D3FS76_BACPE/4-139--NYFEQ-------------------------------------------------------------------------
C4RNS3_9ACTO/7-145--SYLAV-------------------------------------------------------------------------
B0N1X7_9FIRM/7-143--RYYQH-------------------------------------------------------------------------
D2Q4A3_KRIFD/26-165--SYVHA-------------------------------------------------------------------------
C9ASX1_ENTFC/3-139--KYMDK-------------------------------------------------------------------------
C8N9D3_9GAMM/7-143--AYQKA-------------------------------------------------------------------------
Y3325_BACHD/7-142--DYCKF-------------------------------------------------------------------------
B5Y674_COPPD/8-143--DYLNV-------------------------------------------------------------------------
C7QC58_CATAD/12-151--GYLAE-------------------------------------------------------------------------
A1RZ59_THEPD/8-143--EFYRG-------------------------------------------------------------------------
C0CLH1_9FIRM/5-140--EYYKS-------------------------------------------------------------------------
E8S9A0_MICSL/6-145--RYADA-------------------------------------------------------------------------
Q5WKS2_BACSK/9-144--RYLDY-------------------------------------------------------------------------
C6Y1C7_PEDHD/5-146--EWLNN-------------------------------------------------------------------------
Y3403_BRUSI/7-142--RYFND-------------------------------------------------------------------------
Y4393_STRCO/9-146--QFLDA-------------------------------------------------------------------------
A8F7H2_THELT/16-151--QYYQK-------------------------------------------------------------------------
Q2CEE8_9RHOB/8-143--TYRDR-------------------------------------------------------------------------
C5C598_BEUC1/10-150--QFTHE-------------------------------------------------------------------------
A8MBI0_CALMQ/10-145--EYKAT-------------------------------------------------------------------------
A7NMQ6_ROSCS/10-151--DYLER-------------------------------------------------------------------------
B9YBN0_9FIRM/5-140--EYMNK-------------------------------------------------------------------------
A6NQL5_9FIRM/12-147--EFDSA-------------------------------------------------------------------------
YNAG_LYSSH/4-139--TYFQQ-------------------------------------------------------------------------
B5Y9Q0_COPPD/8-148--TYQDE-------------------------------------------------------------------------
B5ZFE8_GLUDA/7-148--EYFDV-------------------------------------------------------------------------
D2YKE2_VIBMI/7-142--NYLNI-------------------------------------------------------------------------
A3IFJ8_9BACI/3-138--AYFSE-------------------------------------------------------------------------
Q2BFI1_9BACI/11-147--EYFGQ-------------------------------------------------------------------------
A8F3Q5_THELT/6-147--AYIEK-------------------------------------------------------------------------
B5JPS4_9BACT/5-135--NYFKS-------------------------------------------------------------------------
A0LSD9_ACIC1/6-147--QWIAK-------------------------------------------------------------------------
D2YKF6_VIBMI/10-146--NYFSE-------------------------------------------------------------------------
A4AEP3_9ACTN/17-152--RYLSH-------------------------------------------------------------------------
D2QHK1_SPILD/6-146--EYIQR-------------------------------------------------------------------------
C7MHG6_BRAFD/6-139--TYRAA-------------------------------------------------------------------------
B9YBM7_9FIRM/6-145--EFFSA-------------------------------------------------------------------------
C6W8A4_ACTMD/9-144--AYGDA-------------------------------------------------------------------------
B9YBM8_9FIRM/8-149--LFYEE-------------------------------------------------------------------------
B9Y8L8_9FIRM/15-150--DYQKR-------------------------------------------------------------------------
B5YCA1_DICT6/2-136--RYLKS-------------------------------------------------------------------------
C1I4Z1_9CLOT/5-144--KYFEE-------------------------------------------------------------------------
GMHA_METJA/5-142--KYFEE-------------------------------------------------------------------------
B6C3E6_9GAMM/24-160--HFFSS-------------------------------------------------------------------------
B2JKC9_BURP8/9-145--HFRDS-------------------------------------------------------------------------
C8X0N1_DESRD/11-148--DYARE-------------------------------------------------------------------------
GMHA_PSEA6/8-144--NFTES-------------------------------------------------------------------------
B6BTJ5_9PROT/7-143--KHLEE-------------------------------------------------------------------------
Q02BY6_SOLUE/6-142--QFLAE-------------------------------------------------------------------------
D0RPZ2_9PROT/6-142--TFKNN-------------------------------------------------------------------------
A1U3H1_MARAV/10-147--QWFAS-------------------------------------------------------------------------
Q0YTV3_9CHLB/9-148--DFFTE-------------------------------------------------------------------------
D4HSN8_LEPIR/4-142--HYNAY-------------------------------------------------------------------------
Q2STV8_BURTA/8-142--QHIRD-------------------------------------------------------------------------
Q319P8_PROM9/4-141--KFISY-------------------------------------------------------------------------
C4KCT7_THASP/10-146--QFEDN-------------------------------------------------------------------------
A8PNA0_9COXI/5-141--KFLTE-------------------------------------------------------------------------
B9MBX1_ACIET/9-143--HFIDS-------------------------------------------------------------------------
Q1MP15_LAWIP/7-149--NYVQR-------------------------------------------------------------------------
B7RSM6_9GAMM/25-161--RFQDT-------------------------------------------------------------------------
F1TC99_9CLOT/7-146--AYLTK-------------------------------------------------------------------------

PF01380

Q7CXS2_AGRT5/132-260--LLSDR-------------------------------------------------------------------------
GFA1_CANAL/564-696--SLNDQ-------------------------------------------------------------------------
HEXR_ECOLI/124-253--LLTQA-------------------------------------------------------------------------
GFPT1_HUMAN/380-509--EIQRC-------------------------------------------------------------------------
Q8XNY4_CLOPE/36-163--KISKS-------------------------------------------------------------------------
GLMS_BACSU/286-415--AVAEA-------------------------------------------------------------------------
YFHH_ECOLI/128-258--MLRSA-------------------------------------------------------------------------
Q92SL6_RHIME/145-272--ILAKA-------------------------------------------------------------------------
Q8YAS2_LISMO/118-244--KLVNK-------------------------------------------------------------------------
KDSD_ECOLI/45-177--MFWCK-------------------------------------------------------------------------
GLMS_HAEIN/289-419--ILEKV-------------------------------------------------------------------------
AGAS_ECOLI/48-189--LLRKE-------------------------------------------------------------------------
Q8Y3Y1_LISMO/127-251--KLIQA-------------------------------------------------------------------------
GFPT1_HUMAN/551-682--ELYHQ-------------------------------------------------------------------------
NODM_RHILV/459-591--ELSHY-------------------------------------------------------------------------
Q8XNY5_CLOPE/110-235--LMYNA-------------------------------------------------------------------------
MAS2_AGRRH/37-172--ASSIS-------------------------------------------------------------------------
API_HAEIN/62-194--ILACE-------------------------------------------------------------------------
YARA_PROST/128-258--KIVEA-------------------------------------------------------------------------
Q99RU9_STAAM/110-235--KMHTA-------------------------------------------------------------------------
GFA1_SCHPO/550-679--QLINK-------------------------------------------------------------------------
GFA1_YEAST/565-700--ELKDQ-------------------------------------------------------------------------
GLMS_ECOLI/289-419--LLSKV-------------------------------------------------------------------------
Q8XLF9_CLOPE/129-256--EIFKA-------------------------------------------------------------------------
GFA1_CANAL/392-521--TIRRC-------------------------------------------------------------------------
Q92MN3_RHIME/133-262--LLADP-------------------------------------------------------------------------
Q98CV6_RHILO/140-267--LLAKA-------------------------------------------------------------------------
GFA1_SCHPO/378-507--IIRKS-------------------------------------------------------------------------
GLMS_MYCLE/301-430--ELREI-------------------------------------------------------------------------
Q8Y5Q8_LISMO/191-307--KHHQD-------------------------------------------------------------------------
Q98JM0_RHILO/163-290--LLAAA-------------------------------------------------------------------------
Q9K8R3_BACHD/130-256--SIIEA-------------------------------------------------------------------------
Q97DH6_CLOAB/196-312--KYKDD-------------------------------------------------------------------------
AGAS_ECOLI/220-357--GYAPW-------------------------------------------------------------------------
NODM_RHILV/286-415--DFAGV-------------------------------------------------------------------------
GLMS_ECOLI/461-592--DFSDK-------------------------------------------------------------------------
Q92A16_LISIN/191-307--KHHQD-------------------------------------------------------------------------
Q97I06_CLOAB/131-258--SIFSA-------------------------------------------------------------------------
RPIR_ECOLI/137-267--FFYQA-------------------------------------------------------------------------
GUTQ_ECOLI/38-170--ILHCE-------------------------------------------------------------------------
GLMS_BACSU/456-583--YLTVS-------------------------------------------------------------------------
Q97LM6_CLOAB/110-235--MIYGA-------------------------------------------------------------------------
PHI_BACSU/32-157--HILSS-------------------------------------------------------------------------
Q927E3_LISIN/127-251--KLIKA-------------------------------------------------------------------------
KPSF1_ECOLX/52-184--IMNCK-------------------------------------------------------------------------

PF10740

A6QIX0_STAAE/1-168MSKILNT-------------------------------------------------------------------------
A8FIE4_BACP2/1-172MLKIFTT-------------------------------------------------------------------------
A7Z9T3_BACA2/1-169MLKIFTT-------------------------------------------------------------------------
Q9K6E1_BACHD/1-172MIQIFTT-------------------------------------------------------------------------
Q5HM96_STAEQ/1-168MSKILNT-------------------------------------------------------------------------
A3ICF8_9BACI/7-175MSKILTT-------------------------------------------------------------------------
Q5WB44_BACSK/1-168MLKIFST-------------------------------------------------------------------------
Q4L807_STAHJ/1-168MSKILQT-------------------------------------------------------------------------
A4ITL8_GEOTN/71-239M.KILTT-------------------------------------------------------------------------
Q2BG48_9BACI/1-169M...FST-------------------------------------------------------------------------
C2ST42_BACCE/1-171MLKIFST-------------------------------------------------------------------------
A6CQ30_9BACI/7-176LIKMFTT-------------------------------------------------------------------------
YWJG_BACSU/1-169MLKIFTT-------------------------------------------------------------------------
Q65DT8_BACLD/1-172MLKIFTT-------------------------------------------------------------------------

PF00342

G6PI_HUMAN/54-546--DYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKS
G6PIB_ORYSJ/51-547--DYSRQRATGETMEKLFKLAEAAKLKEKIEKMFSGDKINSTENRSVLHVALRAPRDEVIKSDGVNVVPEVWGVKDKIKQ
G6PI_KLULA/64-548--DFSKNLVDDEILKSLIQLAKEAKVTSLRDAMFNGEPINFTEGRAVYHVALRNRSLKPMYVDGTNVTPEVDAVLQHMKE
G6PI1_CLALE/51-548--DYSRQQASPDTISKLYKLADAAHLKQKIDRMYNGDHINTTENRSVLHVALRAPRNSAICSDGKNVVPDVWNVLDKIKD
G6PIA_GEOSE/7-445--DYSKA..........LSFFGE......HELTYLRDAVKVA......HHSLHEKTG.....VGNDFLGWLDLPVNYDKE
G6PIB_GEOSE/6-440--DYSNA..........LPFMQE......NELDYLSEFVKAA......HHMLHERKG.....PGSDFLGWVDWPIRYDKN
G6PI_HAEIN/52-542--DFSKNNINQTTLSHLRQLAQECALDSAKEAMFTGEKINRTENRAVLHTALRNRTNTPVLVDGKDVMPEVNAVLAKMKD
G6PI_LEIME/101-596--DYSKSHINDEIKDALVALAEERGVRAFAKAMFDGQRVNSTENRAVLHVALRNRSNRPIIVDGKDVMSDVNNVLAQMKD
G6PI_TRYBB/102-598--DYSKSHINDEIKCALLRLAEERGIRQFVQSVFRGERVNTTENRPVLHIALRNRSNRPIYVDGKDVMPAVNKVLDQMRS
G6PI_ZYMMO/49-502--DFSKNHLDSQKLTAFKKLLEACDFDARRKALFAGEKINITEDRAVEHMAERGQGA.......PASVARAKEYHARMRT

PF13580

B4BKI9_9BACI/4-139---------------------------------------------------------------------I.NERLNLV.L
Y240_THEPX/4-141---------------------------------------------------------------------V.YKSVEKI.K
D3Q8F5_STANL/7-146---------------------------------------------------------------------I.TEVCDRA.V
Y887_BACSK/6-142---------------------------------------------------------------------I.SRLLRQT.V
D3FS76_BACPE/4-139---------------------------------------------------------------------I.KALLKKV.E
C4RNS3_9ACTO/7-145---------------------------------------------------------------------V.TETIGQV.S
B0N1X7_9FIRM/7-143---------------------------------------------------------------------I.HDILNNI.V
D2Q4A3_KRIFD/26-165---------------------------------------------------------------------L.TPIMAAV.T
C9ASX1_ENTFC/3-139---------------------------------------------------------------------I.KQLLDLV.E
C8N9D3_9GAMM/7-143---------------------------------------------------------------------V.LAILEEA.F
Y3325_BACHD/7-142---------------------------------------------------------------------F.NRILSEV.Q
B5Y674_COPPD/8-143---------------------------------------------------------------------V.SNILTQI.S
C7QC58_CATAD/12-151---------------------------------------------------------------------V.RRVLEHV.E
A1RZ59_THEPD/8-143---------------------------------------------------------------------V.VGIFDRI.L
C0CLH1_9FIRM/5-140---------------------------------------------------------------------V.RDLLETV.Y
E8S9A0_MICSL/6-145---------------------------------------------------------------------V.RPVLDRL.V
Q5WKS2_BACSK/9-144---------------------------------------------------------------------L.TETWKSV.T
C6Y1C7_PEDHD/5-146---------------------------------------------------------------------A.RAIMTQI.E
Y3403_BRUSI/7-142---------------------------------------------------------------------V.IARLSGL.R
Y4393_STRCO/9-146---------------------------------------------------------------------A.IDLLRRV.R
A8F7H2_THELT/16-151---------------------------------------------------------------------I.NASLKQI.I
Q2CEE8_9RHOB/8-143---------------------------------------------------------------------I.VAIIDGL.L
C5C598_BEUC1/10-150---------------------------------------------------------------------V.TARIERL.R
A8MBI0_CALMQ/10-145---------------------------------------------------------------------V.VRLIDDV.L
A7NMQ6_ROSCS/10-151---------------------------------------------------------------------A.EQIVRRV.R
B9YBN0_9FIRM/5-140---------------------------------------------------------------------V.EELLHKV.D
A6NQL5_9FIRM/12-147---------------------------------------------------------------------N.AAVMEHL.K
YNAG_LYSSH/4-139---------------------------------------------------------------------V.NRYLTMV.A
B5Y9Q0_COPPD/8-148---------------------------------------------------------------------A.LEILRNI.S
B5ZFE8_GLUDA/7-148---------------------------------------------------------------------L.ASRLEFV.K
D2YKE2_VIBMI/7-142---------------------------------------------------------------------I.HSKLQIL.E
A3IFJ8_9BACI/3-138---------------------------------------------------------------------I.EKLIQVV.K
Q2BFI1_9BACI/11-147---------------------------------------------------------------------I.KSYLEEI.I
A8F3Q5_THELT/6-147---------------------------------------------------------------------V.TDILKRI.K
B5JPS4_9BACT/5-135---------------------------------------------------------------------S.QVLLERV.Y
A0LSD9_ACIC1/6-147---------------------------------------------------------------------A.KQLLERF.A
D2YKF6_VIBMI/10-146---------------------------------------------------------------------LCQSIIQQI.I
A4AEP3_9ACTN/17-152---------------------------------------------------------------------T.LELIERL.R
D2QHK1_SPILD/6-146---------------------------------------------------------------------C.QGILTTI..
C7MHG6_BRAFD/6-139---------------------------------------------------------------------V.LELIQRG..
B9YBM7_9FIRM/6-145---------------------------------------------------------------------A.KHALEEV.K
C6W8A4_ACTMD/9-144---------------------------------------------------------------------V.RDLLSRV.E
B9YBM8_9FIRM/8-149---------------------------------------------------------------------M.MKVVDVL.E
B9Y8L8_9FIRM/15-150---------------------------------------------------------------------V.DQLFEQI.K
B5YCA1_DICT6/2-136---------------------------------------------------------------------L.ISLLEEL..
C1I4Z1_9CLOT/5-144---------------------------------------------------------------------M.KKVLVKI.E
GMHA_METJA/5-142---------------------------------------------------------------------S.ANVKLKF.I
B6C3E6_9GAMM/24-160---------------------------------------------------------------------A.QLKLSA..M
B2JKC9_BURP8/9-145---------------------------------------------------------------------A.AVTLAAL..
C8X0N1_DESRD/11-148---------------------------------------------------------------------G.LALRERF.F
GMHA_PSEA6/8-144---------------------------------------------------------------------I.QTMIASL..
B6BTJ5_9PROT/7-143---------------------------------------------------------------------H.QSVLSTL..
Q02BY6_SOLUE/6-142---------------------------------------------------------------------A.TEIIKQI..
D0RPZ2_9PROT/6-142---------------------------------------------------------------------F.NKTLNKI.N
A1U3H1_MARAV/10-147---------------------------------------------------------------------H.MEHTAQA.A
Q0YTV3_9CHLB/9-148---------------------------------------------------------------------Y.SCRLQNVLA
D4HSN8_LEPIR/4-142---------------------------------------------------------------------I.GRLQSVL.V
Q2STV8_BURTA/8-142---------------------------------------------------------------------S.AALAHEA.L
Q319P8_PROM9/4-141---------------------------------------------------------------------I.SRLKEAL.E
C4KCT7_THASP/10-146---------------------------------------------------------------------M.RASLEAL..
A8PNA0_9COXI/5-141---------------------------------------------------------------------T.KQIIDKL..
B9MBX1_ACIET/9-143---------------------------------------------------------------------A.DLKYQSA..
Q1MP15_LAWIP/7-149---------------------------------------------------------------------I.SKLLTSV.E
B7RSM6_9GAMM/25-161---------------------------------------------------------------------I.ESIAMSV..
F1TC99_9CLOT/7-146---------------------------------------------------------------------A.SKLTASV..

PF01380

Q7CXS2_AGRT5/132-260---------------------------------------------------------------------K-RSIYFVG--
GFA1_CANAL/564-696---------------------------------------------------------------------K-.SLLLLG--
HEXR_ECOLI/124-253---------------------------------------------------------------------K-.KIAFFG--
GFPT1_HUMAN/380-509---------------------------------------------------------------------R-.RLILIA--
Q8XNY4_CLOPE/36-163---------------------------------------------------------------------N-.RIFVYG--
GLMS_BACSU/286-415---------------------------------------------------------------------D-.RIYIIG--
YFHH_ECOLI/128-258---------------------------------------------------------------------R-.RIILTG--
Q92SL6_RHIME/145-272---------------------------------------------------------------------N-.TIYLIA--
Q8YAS2_LISMO/118-244---------------------------------------------------------------------P-.RIYFFA--
KDSD_ECOLI/45-177---------------------------------------------------------------------G-.KVVVMG--
GLMS_HAEIN/289-419---------------------------------------------------------------------E-.HIQIVA--
AGAS_ECOLI/48-189---------------------------------------------------------------------N-LRIILTG--
Q8Y3Y1_LISMO/127-251---------------------------------------------------------------------K-.TIDVYA--
GFPT1_HUMAN/551-682---------------------------------------------------------------------K-.SVLIMG--
NODM_RHILV/459-591---------------------------------------------------------------------R-.DVLYLG--
Q8XNY5_CLOPE/110-235---------------------------------------------------------------------K-.RIFVYG--
MAS2_AGRRH/37-172---------------------------------------------------------------------S-..VLFVS--
API_HAEIN/62-194---------------------------------------------------------------------G-.RLVIGG--
YARA_PROST/128-258---------------------------------------------------------------------K-.RIVLFG--
Q99RU9_STAAM/110-235---------------------------------------------------------------------S-.TIYLYG--
GFA1_SCHPO/550-679---------------------------------------------------------------------D-.KMLIIG--
GFA1_YEAST/565-700---------------------------------------------------------------------K-.SLLLLG--
GLMS_ECOLI/289-419---------------------------------------------------------------------E-.HIQILA--
Q8XLF9_CLOPE/129-256---------------------------------------------------------------------K-.RIYIIG--
GFA1_CANAL/392-521---------------------------------------------------------------------R-.RIIMIA--
Q92MN3_RHIME/133-262---------------------------------------------------------------------S-RNIFLLG--
Q98CV6_RHILO/140-267---------------------------------------------------------------------Q-.TIYVLA--
GFA1_SCHPO/378-507---------------------------------------------------------------------R-.RLIFVA--
GLMS_MYCLE/301-430---------------------------------------------------------------------D-.KVFVVA--
Q8Y5Q8_LISMO/191-307---------------------------------------------------------------------D-.IHYFVG--
Q98JM0_RHILO/163-290---------------------------------------------------------------------E-.LIYVIG--
Q9K8R3_BACHD/130-256---------------------------------------------------------------------K-.RIYVIA--
Q97DH6_CLOAB/196-312---------------------------------------------------------------------S-.VIYTMG--
AGAS_ECOLI/220-357---------------------------------------------------------------------K-.RIVYLG--
NODM_RHILV/286-415---------------------------------------------------------------------E-.SLAISA--
GLMS_ECOLI/461-592---------------------------------------------------------------------H-.HALFLG--
Q92A16_LISIN/191-307---------------------------------------------------------------------D-.IHYFVG--
Q97I06_CLOAB/131-258---------------------------------------------------------------------K-.RIYIIG--
RPIR_ECOLI/137-267---------------------------------------------------------------------R-.QRDLYG--
GUTQ_ECOLI/38-170---------------------------------------------------------------------G-.KVVVSG--
GLMS_BACSU/456-583---------------------------------------------------------------------R-.NAFFIG--
Q97LM6_CLOAB/110-235---------------------------------------------------------------------K-.HLFVYG--
PHI_BACSU/32-157---------------------------------------------------------------------H-.QIFTAG--
Q927E3_LISIN/127-251---------------------------------------------------------------------K-.TIDVYA--
KPSF1_ECOLX/52-184---------------------------------------------------------------------G-.HVILSG--

PF10740

A6QIX0_STAAE/1-168---------------------------------------------------------------------QLIGIFNRL-.
A8FIE4_BACP2/1-172---------------------------------------------------------------------QLSGIFSRI-G
A7Z9T3_BACA2/1-169---------------------------------------------------------------------QLAGIFSRI-Q
Q9K6E1_BACHD/1-172---------------------------------------------------------------------QLTGLLKQL-K
Q5HM96_STAEQ/1-168---------------------------------------------------------------------QLTGIFNRL-.
A3ICF8_9BACI/7-175---------------------------------------------------------------------QLSGLLQRI-T
Q5WB44_BACSK/1-168---------------------------------------------------------------------QLFGLIKSI-N
Q4L807_STAHJ/1-168---------------------------------------------------------------------QLTGIFNRL-.
A4ITL8_GEOTN/71-239---------------------------------------------------------------------QTIGLLQKI-T
Q2BG48_9BACI/1-169---------------------------------------------------------------------QLTGIFKKL-M
C2ST42_BACCE/1-171---------------------------------------------------------------------QLSGYFSKI-S
A6CQ30_9BACI/7-176---------------------------------------------------------------------QLSGLFNRI-A
YWJG_BACSU/1-169---------------------------------------------------------------------QLTGIFSRI-Q
Q65DT8_BACLD/1-172---------------------------------------------------------------------QLTGIFNRI-Q

PF00342

G6PI_HUMAN/54-546FCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSG..........GPRVWYVSNIDGTHIAKTLAQLNP
G6PIB_ORYSJ/51-547FSETFRSGSWVGATGKALTNVVSVGIGGSFLGPLFVHAALQTDPEAAESAKGRQ.....LRFLANVDPVDVARSIKDLDP
G6PI_KLULA/64-548FTEEVRSGAWKGYTGKSITDVVNIGIGGSDLGPVMVTEALKHYATN...........LKVHFVSNIDGTHIAETLKDLDH
G6PI1_CLALE/51-548FSDSVRNGSWIGATGKELKDVIAVGIGGSFLGPLFVHTALQTDPEASKNARGRE.....LRFLANVDPIDVARNISGLNP
G6PIA_GEOSE/7-445EFARIQKAAAKIQADS..DVLLVIGIGGSYLGARAAIEMLHHSFYNALPKEKR.NTPQIIFVGNNISSTYMKEVMDLLEG
G6PIB_GEOSE/6-440EFSRIKQAAERIRNHS..DALVVIGIGGSYLGARAAIEALSHTFHNQMN.....DTTQIYFAGQNISSTYISHLLDVLEG
G6PI_HAEIN/52-542FCQRIISGEWKGYTGKAITDVVNIGIGGSDLGPYMVTEALRPYKN...........HLNMHFVSNVDGTHIAETLKKVNP
G6PI_LEIME/101-596FTERVRSGEWKGQTGKSIYNIVNIGIGGSDLGPVMVTEALKPFSKR..........DLHCFFVSNVDGTHMAEVLKQVNL
G6PI_TRYBB/102-598FSEKVRTGEWKGHTGKAIRHVVNIGIGGSDLGPVMATEALKPFSQR..........DLSLHFVSNVDGTHIAEVLKSIDI
G6PI_ZYMMO/49-502LIEAIDAG.....AFGEVKHLLHIGIGGSALGPKLLIDALTRESGR...........YDVAVVSNVDGQALEEVFKKFNP

PF13580

B4BKI9_9BACI/4-139KH........EKDNLKKAAHA----------------------------------------------VSKAV..QNGGII
Y240_THEPX/4-141AT........QIKNIQEAAML----------------------------------------------IANSLLKEEDSVF
D3Q8F5_STANL/7-146AT........QTDAVNAAADL----------------------------------------------IAGSL..KRGGIL
Y887_BACSK/6-142DE........GEEVLGKAADI----------------------------------------------MVHAI..KEGKSL
D3FS76_BACPE/4-139VT........EAESIEKAASN----------------------------------------------IAHAI..KSGGIV
C4RNS3_9ACTO/7-145AS........QREAVGRAAEL----------------------------------------------IADAL..RADGVV
B0N1X7_9FIRM/7-143DS........QEAAIQKAALE----------------------------------------------MTQCI..EKGHTI
D2Q4A3_KRIFD/26-165EQ........IDGPIQQAADL----------------------------------------------FVTAL..RANGVI
C9ASX1_ENTFC/3-139KE........EKKSIKEAIDV----------------------------------------------LTQAN..LQKRSV
C8N9D3_9GAMM/7-143AA........EGAAIEATVAA----------------------------------------------LCAAI..HDKRAL
Y3325_BACHD/7-142ET........QEQAIIKGAHL----------------------------------------------VSEAV..MNGGRF
B5Y674_COPPD/8-143ST........QRENLLKASDI----------------------------------------------LAACT..RNDGII
C7QC58_CATAD/12-151KT........QLDGVLAAGAL----------------------------------------------IADSI..AAEGVL
A1RZ59_THEPD/8-143RE........EKLNLEKASEV----------------------------------------------LAHTL..KSGGFI
C0CLH1_9FIRM/5-140VR........EFDKIQTAGRM----------------------------------------------LAEVM..EQDGLI
E8S9A0_MICSL/6-145DS........QAVAVDRAADL----------------------------------------------IASGL..RAGCVL
Q5WKS2_BACSK/9-144EN........EIDHINQAAEF----------------------------------------------IFNSC..KDGGRF
C6Y1C7_PEDHD/5-146ET........QMDNIRKAAEI----------------------------------------------MADSI..EAGRWV
Y3403_BRUSI/7-142DR........LAAQMEKAADL----------------------------------------------IAAAA..RADRRV
Y4393_STRCO/9-146DE........EADSIEAAGTL----------------------------------------------LADTV..QNGGRL
A8F7H2_THELT/16-151EK........ETNKIEILAEK----------------------------------------------AYGAI..RSNGLI
Q2CEE8_9RHOB/8-143AQ........EEAAMDAARDA----------------------------------------------IALAL..TRGGII
C5C598_BEUC1/10-150EQ.......AEAGGFDAAIDL----------------------------------------------IVSTL..DGGGVI
A8MBI0_CALMQ/10-145KD........QWSNIKSAADL----------------------------------------------CVDSL..SKGGLI
A7NMQ6_ROSCS/10-151ET........QMPAIVEAARI----------------------------------------------CADTI..AAGGLV
B9YBN0_9FIRM/5-140DA........NKEKIQELAVK----------------------------------------------FADNI..KNNHII
A6NQL5_9FIRM/12-147KT........QKSAIISAGNA----------------------------------------------IYKAI..KAGHRF
YNAG_LYSSH/4-139QQ........ESEQINRVAQL----------------------------------------------IVKRL..VQGGII
B5Y9Q0_COPPD/8-148AK........EKENIEKASTL----------------------------------------------MAESI..SGGHLV
B5ZFE8_GLUDA/7-148TT........QHDAIRRAARL----------------------------------------------CADSI..ADDKLV
D2YKE2_VIBMI/7-142SK.........QDELNTIANV----------------------------------------------CVEAI..LNKKNL
A3IFJ8_9BACI/3-138EQ........ESACIKEAAQI----------------------------------------------IVQRL..QKGGII
Q2BFI1_9BACI/11-147AT........ESDDINLAARA----------------------------------------------VADHI..KEDRIV
A8F3Q5_THELT/6-147KE........QNTNILKAANI----------------------------------------------MAECI..EKNGMV
B5JPS4_9BACT/5-135LQ........NQAEIERLAPL----------------------------------------------IAKSI..AEGGVI
A0LSD9_ACIC1/6-147AT........QNSALDQAAKI----------------------------------------------CAESI..ANDGLV
D2YKF6_VIBMI/10-146VN........ESRNIEAAAGI----------------------------------------------MADSI..KNNGLI
A4AEP3_9ACTN/17-152TE........EGANIAAASRL----------------------------------------------IADAL..ISERTI
D2QHK1_SPILD/6-146EQ........QAEAIQQAAGW----------------------------------------------FSQTI..LAGRMV
C7MHG6_BRAFD/6-139AE........ETGSLEHASDL----------------------------------------------IARSL..QDGGVL
B9YBM7_9FIRM/6-145NT........QREAVYEAAKM----------------------------------------------MGDCM..LENGLV
C6W8A4_ACTMD/9-144EQ........NAAALDDVAEL----------------------------------------------VLASV..RGDGVV
B9YBM8_9FIRM/8-149GK........EMDNIRKASEV----------------------------------------------CADTI..AQGGVV
B9Y8L8_9FIRM/15-150TT........QRENIITAGKM----------------------------------------------IAETI..DAGGNI
B5YCA1_DICT6/2-136DK........ESNNFQKAVDK----------------------------------------------TVEAI..KNGGII
C1I4Z1_9CLOT/5-144DT........QKEKIIKISEE----------------------------------------------IADRL..EKGAAW
GMHA_METJA/5-142EE........DEEKLKKAIEV----------------------------------------------IYNAL..KNGNKI
B6C3E6_9GAMM/24-160KT........LAPGIERASRH----------------------------------------------LLESL..QHGHKV
B2JKC9_BURP8/9-145EA........LSMPIAAAVDA----------------------------------------------MFAAL..ANGNKI
C8X0N1_DESRD/11-148TS........NAEAIAALGLN----------------------------------------------IAVCL..AKGGKI
GMHA_PSEA6/8-144EE........LPEPIALATQM----------------------------------------------MVNAL..INGNKI
B6BTJ5_9PROT/7-143ES........LAPQIETVARH----------------------------------------------MIQAL..QNDNAI
Q02BY6_SOLUE/6-142..........DVAAVERVAAT----------------------------------------------LAASR..ERGGRL
D0RPZ2_9PROT/6-142YQ........TFD...NIIDL----------------------------------------------IINMK..KKGGRL
A1U3H1_MARAV/10-147ST........AGPAIEQVAQA----------------------------------------------FVDAL..LQDGKI
Q0YTV3_9CHLB/9-148NA........DWSGVKKLAED----------------------------------------------MLLCW..QAGQRV
D4HSN8_LEPIR/4-142PE........RASEIERLALS----------------------------------------------LKDAW..ETKKQV
Q2STV8_BURTA/8-142DA........LSLPIAAAVDA----------------------------------------------MFMAL..ANGNKI
Q319P8_PROM9/4-141NL........EESKINELYYE----------------------------------------------IKKRI..DTNFSI
C4KCT7_THASP/10-146EL........LAAPIAGAVEL----------------------------------------------ITASL..LDSGKV
A8PNA0_9COXI/5-141..........NVKDIEDIVQL----------------------------------------------IVELK..QQKGRL
B9MBX1_ACIET/9-143QA........LSHPISAAVQA----------------------------------------------IWACV..TNGAKV
Q1MP15_LAWIP/7-149VSISGGNSLSLEDGFIHWVQK----------------------------------------------TEELR..NTNRTV
B7RSM6_9GAMM/25-161DQ........LAAPIAQSSEL----------------------------------------------ITQVL..LQDGKI
F1TC99_9CLOT/7-146..........EQSAFYTILDE----------------------------------------------IKRVL..KRRHTV

PF01380

Q7CXS2_AGRT5/132-260----------GRITGA.IAEY----------------------------------------------FFTHM.QVIRPKT
GFA1_CANAL/564-696----------RGYQFA.TALE----------------------------------------------GALKI.KEISYMH
HEXR_ECOLI/124-253----------LGSSAA.VAHD----------------------------------------------AMNKF.FRFNVPV
GFPT1_HUMAN/380-509----------CGTSYH.AGVA----------------------------------------------TRQVL.EELTELP
Q8XNY4_CLOPE/36-163----------KGVSSSIVGQE----------------------------------------------LKRAF.TELGKYV
GLMS_BACSU/286-415----------CGTSYH.AGLV----------------------------------------------GKQYI.EMWANVP
YFHH_ECOLI/128-258----------IGASGL.VAQN----------------------------------------------FAWKL.MKIGFNA
Q92SL6_RHIME/145-272----------KRRSYP.ISSY----------------------------------------------MAYAF.GKLKVKY
Q8YAS2_LISMO/118-244----------KGLSKH.AAKY----------------------------------------------IKYLY..TMSGFL
KDSD_ECOLI/45-177----------MGKSGH.IGRK----------------------------------------------MAATF.ASTGTPS
GLMS_HAEIN/289-419----------CGTSYN.AGMV----------------------------------------------ARYWF.ESLAGVS
AGAS_ECOLI/48-189----------AGTSAF.IGDI----------------------------------------------IAPWL.ASHTGKN
Q8Y3Y1_LISMO/127-251----------ASANLF.FAQN----------------------------------------------FKFQM.QEIGVLV
GFPT1_HUMAN/551-682----------RGYHYA.TCLE----------------------------------------------GALKI.KEITYMH
NODM_RHILV/459-591----------RGTSFP.LAME----------------------------------------------GALKL.KEVSYIH
Q8XNY5_CLOPE/110-235----------TGAVQSSVAAE----------------------------------------------LKRIF.LSGQECI
MAS2_AGRRH/37-172----------AGAGLA.IARS----------------------------------------------LKRYT.DQVGRNL
API_HAEIN/62-194----------IGKSGL.IGKK----------------------------------------------MVATF.ASTGTPS
YARA_PROST/128-258----------VGTSAI.VAYD----------------------------------------------IFYKL.IRVNKYA
Q99RU9_STAAM/110-235----------TGRAQLNVASE----------------------------------------------AQRIL.LTLHNHV
GFA1_SCHPO/550-679----------RGYHYA.TALE----------------------------------------------GALKV.KEISYTH
GFA1_YEAST/565-700----------RGYQFA.AALE----------------------------------------------GALKI.KEISYMH
GLMS_ECOLI/289-419----------CGTSYN.SGMV----------------------------------------------SRYWF.ESLAGIP
Q8XLF9_CLOPE/129-256----------LRSSTA.LAEF----------------------------------------------LGFYL.NLILDNV
GFA1_CANAL/392-521----------CGTSYH.SCLA----------------------------------------------TRSIF.EELTEIP
Q92MN3_RHIME/133-262----------GRVSDS.IASF----------------------------------------------LSIHL.RQIRSGI
Q98CV6_RHILO/140-267----------KRRSYP.VATY----------------------------------------------IAYAL.GKLKIRN
GFA1_SCHPO/378-507----------CGTSYH.SCVA----------------------------------------------VRPLF.EELTNIP
GLMS_MYCLE/301-430----------CGTAYH.SGLL----------------------------------------------AKYTI.EHWTRLP
Q8Y5Q8_LISMO/191-307----------AGNQWG.ATYS----------------------------------------------YAMCYWEEQHWIK
Q98JM0_RHILO/163-290----------SKRAFP.VTAY----------------------------------------------LSLTL.SQQGVRN
Q9K8R3_BACHD/130-256----------YRSAAS.LGQF----------------------------------------------LTFYL.DLVLQNT
Q97DH6_CLOAB/196-312----------SGASYG.AAYM----------------------------------------------ESICIFMEMQWLN
AGAS_ECOLI/220-357----------SGGLQG.AARE----------------------------------------------SALKVLELTAGKL
NODM_RHILV/286-415----------CGTAYL.AGLI----------------------------------------------GKYWF.ERYARLI
GLMS_ECOLI/461-592----------RGDQYP.IALE----------------------------------------------GALKL.KEISYIH
Q92A16_LISIN/191-307----------AGNQWG.ATYS----------------------------------------------YAMCYWEEQHWIK
Q97I06_CLOAB/131-258----------LRSSTA.LAEF----------------------------------------------LGFYL.NLILDNV
RPIR_ECOLI/137-267----------AGGSNA.ICAD----------------------------------------------VQHKF.LRIGVRC
GUTQ_ECOLI/38-170----------IGKSGH.IGKK----------------------------------------------IAATL.ASTGTPA
GLMS_BACSU/456-583----------RGLDYF.VCVE----------------------------------------------GALKL.KEISYIQ
Q97LM6_CLOAB/110-235----------TGAVQIAAANE----------------------------------------------LKRHF.ISVNKFF
PHI_BACSU/32-157----------AGRSGL.MAKS----------------------------------------------FAMRL.MHMGFNA
Q927E3_LISIN/127-251----------ASANLF.FAQN----------------------------------------------FKFQM.QEIGVLV
KPSF1_ECOLX/52-184----------MGKSGH.VGRK----------------------------------------------MSATL.ASTGTPS

PF10740

A6QIX0_STAAE/1-168EK--------QSLEIQMAAQC----------------------------------------------LIQAI--GGEGYV
A8FIE4_BACP2/1-172EK--------QAEAIEDGARL----------------------------------------------LAQAV--VSGHGV
A7Z9T3_BACA2/1-169DK--------ESEAIEDGARL----------------------------------------------LAQAA--VSGHTI
Q9K6E1_BACHD/1-172EK--------EE.SFEDGGRL----------------------------------------------LAQAL--IGEGTI
Q5HM96_STAEQ/1-168EK--------QELDIQMAAQC----------------------------------------------LIQAI--GGEGHV
A3ICF8_9BACI/7-175QN--------EEDAIEETARL----------------------------------------------LAQAA--IGEGNV
Q5WB44_BACSK/1-168ET--------QEEHLEDAGRL----------------------------------------------LAQAI--IAQGNV
Q4L807_STAHJ/1-168ED--------QALDIQMAAQC----------------------------------------------LIQAI--GGEGYV
A4ITL8_GEOTN/71-239AD--------EELALEDGARL----------------------------------------------LAQAA--IGDGRI
Q2BG48_9BACI/1-169EK--------EEFSIEDAARL----------------------------------------------LAQAP--AGEGRI
C2ST42_BACCE/1-171QK--------EEMNIEDSARL----------------------------------------------LAQAL--VGDGFI
A6CQ30_9BACI/7-176DK--------EEFSIEDGARL----------------------------------------------LAQAT--VGEGSI
YWJG_BACSU/1-169DK--------ESDAIEDGARL----------------------------------------------LAQAV--ISGHSI
Q65DT8_BACLD/1-172EG--------EAQSIEDGARL----------------------------------------------LAQAV--ISDHSV

PF00342

G6PI_HUMAN/54-546ESSLFIIASKTFTTQETITNAETAKEWFLQAAKD.....PSAVAKHFVALSTNTTKVKEFGIDPQ..NMFEFWDWVGGRY
G6PIB_ORYSJ/51-547ETTLVVVVSKTFTTAETMLNARTLKEWIVSSLG......PDAVAKHMIAVSTNLELVEKFGIDPK..NAFAFWDWVGGRY
G6PI_KLULA/64-548ETTLFLIASKTFTTAETITNATSAKNWFLSKNGG....DQSHISKHFAALSTNATEVEKFGIDTK..NMFGFENWVGGRY
G6PI1_CLALE/51-548ETTLVVVVSKTFTTAETMLNARTLREWISSALG......PSAVAKHMVAVSTNLPLVEKFGIDPN..NAFAFWDWVGGRY
G6PIA_GEOSE/7-445KDFSINVISKSGTTTEPAIAFRIFRKLLEEKYG......KEEARKRIYATTDRARGALKTLATAEGYETFIIPDDVGGRY
G6PIB_GEOSE/6-440KDLSINVISKSGTTTEPAIAFRIFRDYMEKKYG......KEEARKRIYVTTDRTKGALKKLADQEGYETFVIPDNIGGRY
G6PI_HAEIN/52-542ETTLFLVASKTFTTQETMTNAQSARDWLLKAAKD.....ESAVAKHFAALSTNAKDVEKFGIDTN..NMFEFWDWVGGRY
G6PI_LEIME/101-596EETIFIIASKTFTTQETLTNAMSARNALMSYLKENGISTDGAVAKHFVALSTNTEKVREFGIDTV..NMFAFWDWVGGRY
G6PI_TRYBB/102-598EATLFIVASKTFTTQETITNALSARRALLDYLRSRGIDEKGSVAKHFVALSTNNQKVKEFGIDEE..NMFQFWDWVGGRY
G6PI_ZYMMO/49-502HKTLIAVASKTFTTAETMLNAESAMEWMKKHGVE.....DP..QGRMIALTANPAKASEMGIDDT..RILPFAESIGGRY

PF13580

B4BKI9_9BACI/4-139QLFGC.G------------------HS-----HIMAEEVFYRAG....GL.VPVK--PIFVEPLMLHE...G..A.....
Y240_THEPX/4-141HVFGC.G------------------HS-----HMAAEELFYRAG....GL.ACVN--PILPSELMLHE...G..A.....
D3Q8F5_STANL/7-146QAFGT.G------------------HS-----EALCMELAGRAG....GL.VPSN--RIALRDLVLRG...G..ED.AEL
Y887_BACSK/6-142YLFGA.S------------------HA-----GIIAEDAFYRAG....GL.ALFN--PIFSPALMLNV...E......PI
D3FS76_BACPE/4-139HVFGC.G------------------HS-----HMLSEEVFYRAG....GL.VPVQ--PIFIEELMLHK...G..A.....
C4RNS3_9ACTO/7-145HAFGT.G------------------HS-----EALAMEIAGRAG....GL.VPTN--RIALRDVVLHG...G..AP.ADV
B0N1X7_9FIRM/7-143YAFGA.S------------------HA-----GILTQELFYRAG....GL.ALIN--PIMAKEVQLDV...R......PI
D2Q4A3_KRIFD/26-165QAFGS.G------------------HS-----EALAMEIAGRAG....GL.IATN--RIALRDLVLLG...G..ES.PEL
C9ASX1_ENTFC/3-139YIFGA.S------------------HA-----GILAEEMYYRAG....GM.MTIN--AIFGREVMLDR...S......PI
C8N9D3_9GAMM/7-143YIFGA.S------------------HA-----GILAEELYYRAG....GL.MLIN--PIFGSEIMLNR.........APV
Y3325_BACHD/7-142YVFGS.G------------------HS-----HMIAEEIYNRAG....GL.ALVT--AILPPELMLHE...R..P.....
B5Y674_COPPD/8-143HTFGV.G------------------HS-----HLVAEDVFWRGA....TL.ANIH--AILEPSLTGHQ..........EI
C7QC58_CATAD/12-151QAFGT.G------------------HS-----EALAMELAGRAG....GF.VPSN--KLALRDLILFG...G..EP.VDF
A1RZ59_THEPD/8-143YVFGT.G------------------HS-----MLMAMEVFYRAG....GL.VRVY--PLLDLSVSGFN...G..A.....
C0CLH1_9FIRM/5-140HVFGC.G------------------HS-----HMIAEEMFYRAG....GL.VAID--PIFEESTMLHD...G..A.....
E8S9A0_MICSL/6-145QAFGA.G------------------HS-----EAFAAELVARAG....GL.VPAN--RLSLHDLVLHG...D..AP.RDV
Q5WKS2_BACSK/9-144YVFGS.G------------------HS-----HMIAEEIYIRAG....GL.AYVK--GILPPELMLHE...M.......P
C6Y1C7_PEDHD/5-146HTFGC.G------------------HA-----TIPIEEMYPRIG....GF.VGFH--PMIELPLTFFT...RITGE.MGV
Y3403_BRUSI/7-142YVFGT.G------------------HS-----HMMAEELHYRAG....GL.AITV--PILCGSIMLQD...G..A.....
Y4393_STRCO/9-146FAFGA.G------------------HS-----SLAAQDVVYRAG....GL.ALMN--LLTVPGVVGID...V..M...PA
A8F7H2_THELT/16-151YAFGT.G------------------HS-----HILVEEIFYRAG....GI.APVY--PVLIGSLMLHE...R..A.....
Q2CEE8_9RHOB/8-143HVAGS.G------------------HS-----HMLAEEVFYRAG....GI.AAAQ--AILDDDLMLHR...G..A.....
C5C598_BEUC1/10-150QAFGT.G------------------HS-----EAFAMEIAGRAG....GL.IPTT--RIALRDVVLHG...P..RD.VEV
A8MBI0_CALMQ/10-145YVFGT.G------------------HS-----MLMVLEVFYRSG....GL.ASIY--PILDPNLLGLN...G..M.....
A7NMQ6_ROSCS/10-151HLFGT.G------------------HS-----RIPIEEIFPRHG....SF.PGFH--PIVELSLTYHN...PVVGP.NGQ
B9YBN0_9FIRM/5-140HVFGT.G------------------HS-----HMIGIELFCRAG....GL.GNVN--AILDPDALTNF...G.......A
A6NQL5_9FIRM/12-147FVTGT.G------------------HS-----HMMAEEFYTRAG....GL.ACVT--PIMPTEFLLHE...H..P.....
YNAG_LYSSH/4-139QLFGS.G------------------HS-----MLLAQECYFRAG....GL.VPVK--PIHIESLMLHQ...G..A.....
B5Y9Q0_COPPD/8-148HLFGS.G------------------HS-----ALPALDIFPRYG....SY.VGFH--PLIDPRLVWFN...V.IGP.GGA
B5ZFE8_GLUDA/7-148FTFGT.G------------------HG-----ALPAIETFPRTG....TI.AGFR--PIVESSMISFH...RVLGD.QGA
D2YKE2_VIBMI/7-142FVFGA.S------------------HA-----GIISEELTYRAG....GL.ALFN--PIFHASLMVNV...T......PI
A3IFJ8_9BACI/3-138QLFGC.G------------------HS-----QLLAQEAFYRAG....GL.VPVR--PIFIEPLALHA...G..A.....
Q2BFI1_9BACI/11-147YVYGPGG------------------HS-----NLGSQELFFRAG....GL.MHVS--AILDEGTLLSS...G..A.....
A8F3Q5_THELT/6-147HLFGS.G------------------HS-----ILPVLDAFPRYG....SF.IGFN--PLIDPRLMWFS...P.TGP.ASA
B5JPS4_9BACT/5-135HTFGS.G------------------HS-----EIIGREMVGRAG....GL.VCVS--AILD......T............
A0LSD9_ACIC1/6-147YLFGT.G------------------HS-----RMAVEEMFPRYA....SY.PGFH--PLVELSTTFHT...QVIGS.NGQ
D2YKF6_VIBMI/10-146HVSG..G------------------HC-----QCYSMEMFYRAG....GL.VPVN--PLLPHIFATAP...H..T....A
A4AEP3_9ACTN/17-152HVFGT.G------------------HS-----HMLAEELFYRAG....GL.VNVS--PLLFEGLMLHA...S..A.....
D2QHK1_SPILD/6-146HLFGS.G------------------HS-----RIMVEEMWPRYG....SF.PGFN--PIVELSLSFHNLVVG...A.NGQ
C7MHG6_BRAFD/6-139HAFGS.G------------------HS-----MLPAIDATFRAG....GL.APVN--LLHDPALAPWE...........P
B9YBM7_9FIRM/6-145QLFGL.G------------------HG-----LAFSMELGYRAG....GL.MPFH--QIKMEDLLLRG...V..VS.PEE
C6W8A4_ACTMD/9-144LAAGA.G------------------HS-----LAAVAETFYRAG....GL.ACVR--PLYHPELLPMH...G..A.....
B9YBM8_9FIRM/8-149HVFGS.G------------------HS-----VGFGMELAGRPG....SL.VPFH--TIVTSDFVLHG...K..VSLAEF
B9Y8L8_9FIRM/15-150YLSGI.C------------------HS-----..IEMDLFNRGG....GP..AFY--RTFHYKLDVQS...D..AR..ER
B5YCA1_DICT6/2-136HILGY.G------------------HY-----NVIPMELFFKPG....AL.ACIN--PLLDLSTLYSE..........SI
C1I4Z1_9CLOT/5-144HIMDT.G------------------HM-----..LMFEGVGRTG....GM.MALQ--PIKITCEIENP...V..RY.RPS
GMHA_METJA/5-142LICGN.G------------------GS-----AANSQHFAAEIV....GR.FKLE--RKGLPAIALTT...D..I.....
B6C3E6_9GAMM/24-160LSCGN.G------------------GS-----AADAQHFSSELI....NR.FERE--RPGLPAIALTT...D..SS.ALT
B2JKC9_BURP8/9-145LTCGN.G------------------GS-----AADAQYFAAELI....GG.FERE--RPALPAIALTT...D..SS.VIT
C8X0N1_DESRD/11-148LLCGN.G------------------GS-----AADAQHLAAEFV....NR.FQIE--RPPLPAIALTT...D..SS.ILT
GMHA_PSEA6/8-144LSCGN.G------------------GS-----AAHAQSFASQML....NR.YERE--RPSLPAIALST...D..TS.TMT
B6BTJ5_9PROT/7-143FWCGN.G------------------GS-----ASDAQHLAGELI....GR.FIGN--RIPLKSIALTV...G..GA.EGS
Q02BY6_SOLUE/6-142FVLGV.G------------------GS-----AANASHAVNDFR....KI.CGFE--AYAPTDNVS............EL
D0RPZ2_9PROT/6-142FFLGV.G------------------GS-----AANASHAVNDFR....KL.CNIE--TYNPLDNVS............EV
A1U3H1_MARAV/10-147ITCAN.G------------------NA-----NVLAQYFCTALL....SR.FDQD--RPALPAINLGA...D..A.....
Q0YTV3_9CHLB/9-148FICGN.G------------------GS-----AANAIHMANDFL...YGI.SKSF--GAGMKVLALSA...N..PA.VMT
D4HSN8_LEPIR/4-142FLCGN.G------------------GS-----AGNAIHLANDFN...YGI.DKKN--GMGLRVEALPA...N..AA.VIT
Q2STV8_BURTA/8-142VACGD.G------------------PS-----AAAAERLAAALI....GG.FERE--RPGLPGLALHT...D..AS....
Q319P8_PROM9/4-141HLIGN.G------------------GS-----AANASHIAGDFT....KT.FMML--GLRLNIFCASD...N..SC.YLT
C4KCT7_THASP/10-146LVCGS.S------------------GS-----AGDARRFAAQLV....NG.FELE--RPALAAMALSA...D..SS.SLA
A8PNA0_9COXI/5-141FFLGV.G------------------GS-----AANASHAVNDFR....KL.AGIE--AYSPTDNIA............EL
B9MBX1_ACIET/9-143LACGS.G------------------PS-----SAQALQFAAFCV....AG.FERD--RPELAALALVP...D..A...LA
Q1MP15_LAWIP/7-149FFIGN.G------------------AS-----ASMASHFSADLT....KN.AQIN--TKVFTDLSLLT............
B7RSM6_9GAMM/25-161FCCGN.G------------------PD-----AALCQLFCHCLL....SG.LEHE--RPALPAFNLSA...D..SA.ILS
F1TC99_9CLOT/7-146FIIGN.G------------------TS-----AATACHFANDLMKNAGGIIAGKL--GFGIKVIALPE...N..MP.FFT

PF01380

Q7CXS2_AGRT5/132-260TLMSS-N------------------SS.....AWPQYMLNMSAG----DVLVIFD..IRRYEHDMTTL------AE.VAK
GFA1_CANAL/564-696SEGVL-A------------------GE.....LKHGILALVDED----LPIIAFA..TRDSLFPKVMS------AIEQVT
HEXR_ECOLI/124-253VYSDD-I------------------VL.....QRMS.CMNCSDG----DVVVLIS..HTGRTKNLVEL------AQ.LAR
GFPT1_HUMAN/380-509VMVEL-A------------------SD.....FLDR.NTPVFRD----DVCFFLS..QSGETADTLMG------LR.YCK
Q8XNY4_CLOPE/36-163FDFYK-A------------------DE......FDSVLSLIRED----DCIILID...IENSKDYLNL------INEKLR
GLMS_BACSU/286-415VEVHV-A------------------SE.....FSYN.MPLLSKK----PLFIFLS..QSGETADSRAV------LV.QVK
YFHH_ECOLI/128-258AAVRD-M------------------HA.....LLAT.VQASSPD----DLLLAIS..YTGVRRELNLA------AD.EML
Q92SL6_RHIME/145-272QHVGT-A------------------AG.....IDEDMLAMATKE----DAAFAVS..FSPYASESASQ------AR.LLA
Q8YAS2_LISMO/118-244VEFPE-D------------------YQ.....YRQAVLPHIGKD----DLVFILT..YGGHDIELIQT------AQ.KLK
KDSD_ECOLI/45-177FFVHP-G------------------EA.....AHGD.LGMVTPQ----DVVIAIS..NSGESSEITAL------IP.VLK
GLMS_HAEIN/289-419CDVEI-A------------------SE.....FRYR.KFVTRPN----SLLITLS..QSGETADTLAA------LR.LAK
AGAS_ECOLI/48-189FSAVP-T------------------TD.....LVTNPMDYLNPA----HPLLLISFGRSGNSPESVAA------VE.LAN
Q8Y3Y1_LISMO/127-251NVPEE-D------------------YI......QSLSAANSDEN----HIAIVVS..YGGRSRTLQRV------VK.ILS
GFPT1_HUMAN/551-682SEGIL-A------------------GE.....LKHGPLALVDKL----MPVIMII..MRDHTYAKCQN------ALQQVV
NODM_RHILV/459-591AEGYA-A------------------GE.....LKHGPIALIDEN----MPVIVIA..PHDRFFDKTVS------NMQEVA
Q8XNY5_CLOPE/110-235YNIQG-E------------------AE......ADMILNTISDE----DLIFLIS..LTGESEHVKRL------AK.QFK
MAS2_AGRRH/37-172RYEAY-A------------------SATFVNLMRANPSMVNDPT----TLVVLSS..KSGMTPETVEA------AA.FLK
API_HAEIN/62-194FFLHP-T------------------EA.....FHGD.LGMLKPI----DIVMLIS..YSGETDDVNKL------IP.SLK
YARA_PROST/128-258LFSPD-L------------------HV.....QLSY.SSNVDAD----DLVIAIT..AKGNTPDINHM------LK.LAN
Q99RU9_STAAM/110-235IVLHD-E------------------HE......LKMILNKSEPN----DLFFIIS..LSGETHELLEV------TN.LLQ
GFA1_SCHPO/550-679AEGVL-A------------------GE.....LKHGVLALVDND----MPIVMLL..PDDYNFPKAWN------AFEQVR
GFA1_YEAST/565-700SEGVL-A------------------GE.....LKHGVLALVDEN----LPIIAFG..TRDSLFPKVVS------SIEQVT
GLMS_ECOLI/289-419CDVEI-A------------------SE.....FRYR.KSAVRRN----SLMITLS..QSGETADTLAG------LR.LSK
Q8XLF9_CLOPE/129-256RVISN-G------------------IS.....DTFEQMLNLGEG----DLVIGIG..FPRYALKTIDA------LE.FAK
GFA1_CANAL/392-521VSVEL-A------------------SD.....FLDR.RSPVFRD----DTCVFVS..QSGETADSILA------LQ.YCL
Q92MN3_RHIME/133-262YHMAD-N------------------PE.....FWPEHVLRMRRK----DVVLLID..FRRYQLSLARL------AENIAQ
Q98CV6_RHILO/140-267QLIES-A------------------AG.....LNAEMIAFATPA----DAVIAIS..FSPYAPATIEE------AR.TIS
GFA1_SCHPO/378-507VVVEL-A------------------SD.....FVDR.CPSVFRD----DTFIFVS..QSGETADSLLA------LQ.YTL
GLMS_MYCLE/301-430VEVEL-A------------------SE.....FRYR.DPVLDRS----TLVVAIS..QSGETADTLEA------VR.HAK
Q8Y5Q8_LISMO/191-307TKSIE-S------------------HE.....FFHGMFEIVERD----TPITIYV..TEDSQRSLSER------VVNFIP
Q98JM0_RHILO/163-290VLVDN-V------------------GS.....SALDQVGCIGSR----DAVLAVS..FSPYNSITPDL------VA.VAH
Q9K8R3_BACHD/130-256ELVEQ-A------------------DG......VSEHLLDITED----DLVIGFG..FARYTKRTVDV------LK.YVK
Q97DH6_CLOAB/196-312SSSIH-T------------------GE.....YFHGPFEITDAN----RPFMIQI..SEGSTRDLDER------ALKFLN
AGAS_ECOLI/220-357AAFYD-S------------------PT....GFRHGPKSLVDDE----TLVVVFV.SSHPYTRQYDLD------LLAELR
NODM_RHILV/286-415VEIDV-A------------------SE.....FRYR.EIPLSPR----SAALFIS..QSGETADTLAS------LR.YCK
GLMS_ECOLI/461-592AEAYA-A------------------GE.....LKHGPLALIDAD----MPVIVVA..PNNELLEKLKS------NIEEVR
Q92A16_LISIN/191-307TKSIE-S------------------HE.....FFHGMFEIVERD----TPVTIYV..TEDSQRSLSER------VVDFIP
Q97I06_CLOAB/131-258YVVSY-K------------------IS.....DIFEQIINITSD----DLLIGIG..FPRYASRTIEA------LS.FAK
RPIR_ECOLI/137-267QAYPD-A------------------HI.....MMMS.ASLLQEG----DVVLVVT..HSGRTSDVKAA------VE.LAK
GUTQ_ECOLI/38-170FFVHP-A------------------EA.....LHGD.LGMIESR----DVMLFIS..YSGGAKELDLI------IP.RLE
GLMS_BACSU/456-583AEGFA-G------------------GE.....LKHGTIALIEQG----TPVFALA..TQEHVNLSIRG------NVKEVA
Q97LM6_CLOAB/110-235VTVHG-E------------------AE......MNMVLETATDE----DLIVIIS..LSGEKKSAVEY------LK.KVK
PHI_BACSU/32-157HIVGE-I------------------LT...........PPLAEG----DLVIIGS..GSGETKSLIHT------AA.KAK
Q927E3_LISIN/127-251NVPEE-D------------------YI......QSLSAANSDKD----HIAIVVS..YGGRSRTLQRV------VK.ILS
KPSF1_ECOLX/52-184FFIHP-A------------------EA.....FHGD.LGMITPY----DLLILIS..ASGETDEILKL------VP.SLK

PF10740

A6QIX0_STAAE/1-168YVKGYDD------------------LQFFESFILHSDERLKSSR----KLD.AIKDFKEIDSTDRVLL------FAPFYN
A8FIE4_BACP2/1-172YFHGKNE------------------LAAVALEATESKEPFPCAK----VLPLDQTERSLLHPSDRVLL------FYSEPE
A7Z9T3_BACA2/1-169YLYGANE------------------MQGILCEAELGSEPMPSVK----AFPDTAD...SITESDRVLM------FCSGPG
Q9K6E1_BACHD/1-172YIHGFHE------------------MTAVQSEALLGVETFSSVA----PLVLSNGKIAEVTAADRVML------FTRYSD
Q5HM96_STAEQ/1-168YIKGYDD------------------LKFYESFILQSHEKLASSL----PLE.DLQNFNDIDTTDRVLL------FSPYYT
A3ICF8_9BACI/7-175YFACFGE------------------MQTVELNALQAVEPFSKLA----PWTLDTS....LTEADRVCI------FTRSAH
Q5WB44_BACSK/1-168YIKGFAE------------------MEAIELAAFTGYESMPGAA----PFPKEGT....LSGQDRCLL------FAPSLN
Q4L807_STAHJ/1-168YIKGYGD------------------LKFFEPFVIESEEHLKSSK----LLS.TLTTFDDIDSTDRVLL------FSPYYT
A4ITL8_GEOTN/71-239WLYGTGE------------------LDAVVTAALLGPDSLPKAA----RLEPEAA..DDWNETDRALV------FARFSN
Q2BG48_9BACI/1-169QIYATRE------------------MKAAALEATEGAEPLASAA----HWT.DAHSENDIADTDRFLI------ISRHSN
C2ST42_BACCE/1-171YLHGTNE------------------MEGIVSEALFGAEPMKQAK----RLI.ENGEPAAVTSADRVLL------ISRFST
A6CQ30_9BACI/7-176YIKGFAE------------------MESVTLEALSGHEPLPSAK----ALTNADA....LTVADRVLL------VSRFST
YWJG_BACSU/1-169YLYGANE------------------LQGVFYEATESKEPFPSVK----AFPENAE...EVTESDRVLM------FCSGTG
Q65DT8_BACLD/1-172YVYGKNE------------------LEGILKEAMYSSEPFPSVK----PLQKDEENWPDFEMTDKVLM------FCAGSA

PF00342

G6PI_HUMAN/54-546SLWSAIG.LSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQ
G6PIB_ORYSJ/51-547SVCSAVGVLPLSLQYGFPIVQKFLEGAASIDKHFRSSSFEKNIPVLLGLLSVWNVSFLGYPARAILPYSQALEKFAPHIQ
G6PI_KLULA/64-548SVWSAIG.LSVALYIGFDNFEAFLKGAEAVDKHFVETPLEDNIPLLGGLLSVWYNNFFDAQTHLVAPFDQYLHRFPAYLQ
G6PI1_CLALE/51-548SVCSAVGVLPLSLQYGFAVVEKFLQGAHSIDQHFSSAPFEKNIPVLLGLLSVWNVSFLGYPARAILPYSQALEKLAPHIQ
G6PIA_GEOSE/7-445SVLTAVGLLPIAVSG..ANIEEMMKGAAQAREDFSSSELEENAAYQYAAIRNILYNK.GKTIELLINYEPALQYFAEWWK
G6PIB_GEOSE/6-440SVLTAVGLLPIAVAG..LNIDRMMEGAASAYHKYNNPDLLTNESYQYAAVRNILYRK.GKAIELLVNYEPSLHYVSEWWK
G6PI_HAEIN/52-542SLWSAIG.LSIALSIGFENFEALLNGAHEMDKHFLSTPIEQNIPTTLALVGLWNTNFLGAQTEAILPYDQYLHRFAAYFQ
G6PI_LEIME/101-596SVWSAIG.LSVMLSIGYDNFVEFLTGAHVMDNHFASTPTEQNLPMMLALVGIWYNNFFGSETQAVLPYDQYLWRLPAYLQ
G6PI_TRYBB/102-598SMWSAIG.LPIMISIGYENFVELLTGAHVIDEHFANAPPEQNVPLLLALVGVWYINFFGAVTHAILPYDQYLWRLPAYLQ
G6PI_ZYMMO/49-502SLWSSIG.FPAALALGWEGFQQLLEGGAAMDRHFLEAAPEKNAPILAAFADQYYSAVRGAQTHGIFAYDERLQLLPFYLQ

PF13580

B4BKI9_9BACI/4-139V.RS-SMLERM..ND------------------FAPS.FIDR..ED....I..RSGDVFFIL.STS--------------
Y240_THEPX/4-141L.KS-SYYERN..ED------------------IIKL.IFDR..YD....L..RQGECIIIV.SHS--------------
D3Q8F5_STANL/7-146L.SS-DKLERD..PQ------------------VARR.LFAL..SE....A..APEDVFVIA.SQS--------------
Y887_BACSK/6-142T.LT-SKLERL..EG------------------YGTI.LLES..KP....V..KQGDVLFIH.SVS--------------
D3FS76_BACPE/4-139A.NS-SKLERS..ED------------------YFQE.IKVQ..LD....I..RSGDVLLVA.STS--------------
C4RNS3_9ACTO/7-145..LG-PLLERD..PS------------------VAHR.LYEL..AP....V..HPSDVFVVA.SNS--------------
B0N1X7_9FIRM/7-143T.LT-TQMERL..PG------------------YGTL.ILEH..TP....I..QKEDVLIIH.SVS--------------
D2Q4A3_KRIFD/26-165L.RG-GELERD..PS------------------YSRK.LYEL..SA....A..RPGDVFVIA.SNS--------------
C9ASX1_ENTFC/3-139T.FT-SQMERL..EG------------------YGTN.LAKT..VS....F..KNQDVLILH.SVS--------------
C8N9D3_9GAMM/7-143T.TT-SRMEQL..EG------------------YGTV.LADG..VD....F..RAGDVLIVH.SVS--------------
Y3325_BACHD/7-142N.KS-TYLERI..EG------------------LSKS.YLKL..HQ....V..TNKDVIMII.SNS--------------
B5Y674_COPPD/8-143T.KS-EYLEKV..EG------------------IGRI.VVDY..HR....I..APPDVLIVI.SNS--------------
C7QC58_CATAD/12-151L.ND-PKIERR..EG------------------LAKR.IYEL..AP....V..EPQDVFVIA.SNS--------------
A1RZ59_THEPD/8-143L.KS-TYMERL..PG------------------YAKA.LLDS..TP....I..KPNSSLIIV.SNS--------------
C0CLH1_9FIRM/5-140Y.KS-SQIERM..SG------------------YAPK.VLER..YP....L..EKGDVLIIS.SSS--------------
E8S9A0_MICSL/6-145L.AD-PKLERD..PA------------------VAHQ.LYAL..AA....P..QPGDVFVVA.SQS--------------
Q5WKS2_BACSK/9-144N.KS-TYLERL..DG------------------YAKS.ILNL..YK....V..DEKDTLMVV.SNS--------------
C6Y1C7_PEDHD/5-146H.QF-VFLERV..EG------------------YGIE.IMKG..YN....F..DTRDTMWLF.SHS--------------
Y3403_BRUSI/7-142V.AS-SHFERI..EG------------------AVRP.ILDR..YG....I..RDGDVLVVV.SNS--------------
Y4393_STRCO/9-146T.LG-SALERV..DG------------------LASA.VLDS..SP....L..RAGDALVII.SLS--------------
A8F7H2_THELT/16-151V.LS-SKLERI..DG------------------IGEA.IASD..LP....I..SSRDVVIVF.SNS--------------
Q2CEE8_9RHOB/8-143E.RS-TRLERE..TG------------------QAAR.VLAR..YR....I..APGDVMVVA.SNS--------------
C5C598_BEUC1/10-150L.HS-GILERD..VD------------------VVSD.LWDA..SI....I..HPADLFVIA.SNS--------------
A8MBI0_CALMQ/10-145S.LS-SSLERL..PG------------------YASN.LLNS..QR....I..VPNSVMIIV.SNS--------------
A7NMQ6_ROSCS/10-151R.QA-MFLEKV..EG------------------FGQV.ILRN..FV....F..GPHDSFIIF.SNS--------------
B9YBN0_9FIRM/5-140R.RS-GAMEKV..SG------------------LANV.IFDQ..YK....I..DKDDIMIII.SNS--------------
A6NQL5_9FIRM/12-147L.KS-TAVERV..AA------------------YAPV.IFEV..YG....I..APGDVLLIA.SNS--------------
YNAG_LYSSH/4-139R.QS-SQNEKK..QA------------------FLAP.YKDE..LQ....F..DDKDVCIII.STS--------------
B5Y9Q0_COPPD/8-148R.EL-LWIERQ..EG------------------YVRN.FLQS..FT....F..YKEDTFVVY.SHG--------------
B5ZFE8_GLUDA/7-148R.QY-RFIHAV..EG------------------YGKA.ILSS..HQ....L..LPGDTLILF.SHS--------------
D2YKE2_VIBMI/7-142T.LT-SELEKL..PK------------------LGEK.IIRA..SK....L..KEGDILLLN.SVS--------------
A3IFJ8_9BACI/3-138I.AS-SINEKD..PA------------------IIEQ.HKEQ..FD....F..RENDICIVI.STS--------------
Q2BFI1_9BACI/11-147L.RS-MAIERT..PG------------------YGKV.VLQD..YG....L..ESGDLLIIV.NAY--------------
A8F3Q5_THELT/6-147P.GL-LLVERK..EG------------------YVENGFLRY..QP....I..AKDDVLIIY.SHG--------------
B5JPS4_9BACT/5-135..TG-GFIENL..EG------------------YGRE.LAAR..YDRNHGL..HAGEFIIVI.SNS--------------
A0LSD9_ACIC1/6-147R.QA-MFIERV..EG------------------LGEI.ILRN..FF....F..HSKDAFIVV.SAS--------------
D2YKF6_VIBMI/10-146F.AS-DLIYET..EG------------------VGEM.IFND..QS....V..SENDCIVLV.SVA--------------
A4AEP3_9ACTN/17-152P.LS-TSLERL..SG------------------LADA.LLLD..HP....I..APGDVLIVA.SNS--------------
D2QHK1_SPILD/6-146R.QA-MFLENV..PG------------------LAQR.ILRN..YD....L..SNLDSALVI.SSS--------------
C7MHG6_BRAFD/6-139T.RV-GRIERL..EG------------------YGTA.LAEL..QD....L..RAGEVLVVL.SHS--------------
B9YBM7_9FIRM/6-145A.NQ-PDFNDR..TD------------------LADK.LWNM..YN....I..DDHDMFILI.SNP--------------
C6W8A4_ACTMD/9-144I.SS-TAAERR..SG------------------LAGQ.VLRE..AG....L..ARHDVLFVF.STS--------------
B9YBM8_9FIRM/8-149KDPD-NIFERR..AD------------------IADR.LYDL..YD....I..RPQDSFIII.SNS--------------
B9Y8L8_9FIRM/15-150D.RS-DLDTDM..EG------------------LGEY.ILKA..ST....I..RPGDILFVG.SVS--------------
B5YCA1_DICT6/2-136Y.RA-NYLEKN..EG------------------YGKS.LIAN..IN....V..KENDIFYIA.SYS--------------
C1I4Z1_9CLOT/5-144V.SK-GAVGYDSIPG------------------FADF.VIGR..SN....I..LAGDIIMIG.SVS--------------
GMHA_METJA/5-142S.IL-TAIGND..YG------------------FDRI.FERQ..VE....ALGKEGDVLAGI.STS--------------
B6C3E6_9GAMM/24-160S.IA-NDYHYD..NV------------------FARQ.IEAL........G..NAGDILLAI.STS--------------
B2JKC9_BURP8/9-145G.IA-NDASLD..QI------------------FATQ.VRAL........G..QPGDVLLAI.STS--------------
C8X0N1_DESRD/11-148A.IG-NDSSFD..EV------------------FVKQ.VKAL........G..RPGDVLLGI.STS--------------
GMHA_PSEA6/8-144S.IA-NDYSYD..EV------------------FSKQ.VRAL........G..QTGDILLAI.SPN--------------
B6BTJ5_9PROT/7-143C.IA-NDFGYD..QI------------------FSRQ.VEGL........G..AKGDVLVGI.TTS--------------
Q02BY6_SOLUE/6-142T.AR-TNDEGW..AG------------------VFDS.WLRV..SR....L..RESDALLVF.SVG--------------
D0RPZ2_9PROT/6-142T.AR-TNDEGW..ET------------------VMVE.WLRV..SK....L..SHKDIIFIF.SVG--------------
A1U3H1_MARAV/10-147T.TY-SAICRD..NR------------------FNDT.FSRQ..VR....AIGKPGDLLFVI.VDD--------------
Q0YTV3_9CHLB/9-148C.LA-NDLGYE..HV------------------FSEQ.LAVQ........A..VKGDLLIAL.SGS--------------
D4HSN8_LEPIR/4-142C...-..LAND..EG------------------YDTI.FSQQLEVK....A..NKGDVLIVL.SGS--------------
Q2STV8_BURTA/8-142R.AC-TGADGD..QI------------------FAKQ.VRTL........G..QMGDVLLVL.DPL--------------
Q319P8_PROM9/4-141A.AS-NDIDYA..DV------------------YSTM.V..D..VK....F..LKGDLIVYF.SGS--------------
C4KCT7_THASP/10-146P.IA-GDPDTQ..AL------------------FARQ.IAAF........G..QPGDILLTL.SAN--------------
A8PNA0_9COXI/5-141T.AR-TNDEGW..RT------------------VFSS.WLTV..SC....L..TAKDMLFVL.SVG--------------
B9MBX1_ACIET/9-143T.GT-SAVADS..AV------------------LARQ.VRAL........G..QAGDLLLVI.TIG--------------
Q1MP15_LAWIP/7-149A.IG-NDLGFE..YV------------------FSVP.FARD........V..CSGDMLVVI.SCS--------------
B7RSM6_9GAMM/25-161G.TT-GSDDRA..QL------------------YARQ.IRAL........G..QENDLLLLIDSGP--------------
F1TC99_9CLOT/7-146A.VS-NDICLE..QT------------------Y.TQ.YLRA..Y.....A..SAGDLVMIF.SSG--------------

PF01380

Q7CXS2_AGRT5/132-260A-NG.VQI..ILFTD------------------QWTSPVARH--------A...LHTFRVRI-EAP--------------
GFA1_CANAL/564-696A-RD.GRP..IVICN------------------EGDAIISND--------K.....VHTTLE-VPE--------------
HEXR_ECOLI/124-253E-ND.AMV..IALT.------------------SAGTPLARE--------A...TLAITLDV-PED--------------
GFPT1_HUMAN/380-509E-RG.ALT..VGITN------------------TVGSSISRE--------T...DCGVHINA-GPE--------------
Q8XNY4_CLOPE/36-163G-KN.VSRFFIGLDK------------------GKKVPICTY--------D...FNRIDKNY-DEI--------------
GLMS_BACSU/286-415A-LG.HKA..LTITN------------------VPGSTLSRE--------A...DYTLLLHA-GPE--------------
YFHH_ECOLI/128-258R-VG.GKV..LAITG------------------FTPNALQQR--------A...SHCLYTIA-EEQ--------------
Q92SL6_RHIME/145-272N-RK.VPV..VSLTD------------------SAFSPLAES--------S...RVWFELVE-ADH--------------
Q8YAS2_LISMO/118-244S-RN.ETPMLISITG------------------ADNNIIQNM--------S...DINLYIFT-DEI--------------
KDSD_ECOLI/45-177R-LH.VPL..ICITG------------------RPESSMARA--------A...DVHLCVKV-AKE--------------
GLMS_HAEIN/289-419E-KGYMAA..LTICN------------------VAGSSLVRE--------S...DLAFMTRA-GVE--------------
AGAS_ECOLI/48-189Q-FV.PECYHLPITC------------------NEAGALYQN--------AINSDNAFALLM-PAE--------------
Q8Y3Y1_LISMO/127-251E-NN.VDI..ILITS------------------MQDNPLVEF--------A...THKIYMAS-AEN--------------
GFPT1_HUMAN/551-682A-RQ.GRP..VVICD------------------KEDTETIKN--------T......KRTIK-VPH--------------
NODM_RHILV/459-591A-RG.GRI..ILITD------------------ETGASMSKL--------P.....TMHTIV-LPD--------------
Q8XNY5_CLOPE/110-235L-RN.VPI..ISITK------------------LKNNTLARL--------S...DENLYINT-SMH--------------
MAS2_AGRRH/37-172D-KA.CKS..VVFTA------------------SANSKLASF--------G...HQTFSTGI-TTQ--------------
API_HAEIN/62-194N-FG.NKI..IAVTS------------------NKNSTLARH--------A...DYVLDITV-ERE--------------
YARA_PROST/128-258K-KG.CST..IVLTR------------------FGQDEAVRL--------A...DLVLPYFY-DEQ--------------
Q99RU9_STAAM/110-235L-RQ.KYF..ISVTT------------------MKDNTLAQK--------A...NYNVYVSS-NTF--------------
GFA1_SCHPO/550-679A-RG.GKP..IIITD------------------KKLDNLEGF--------T........IIK-VPK--------------
GFA1_YEAST/565-700A-RK.GHP..IIICN------------------ENDEVWAQK--------S..KSIDLQTLE-VPQ--------------
GLMS_ECOLI/289-419E-LGYLGS..LAICN------------------VPGSSLVRE--------S...DLALMTNA-GTE--------------
Q8XLF9_CLOPE/129-256T-RN.AKI..VSITD------------------SLISPLASQ--------S...DHTLIAQS-NMA--------------
GFA1_CANAL/392-521E-RG.ALT..VGIVN------------------SVGSSMSRQ--------T...HCGVHINA-GPE--------------
Q92MN3_RHIME/133-262K-RG.ATI..VVVTD------------------KWMSPAARS--------A...DHIVALPI-DAG--------------
Q98CV6_RHILO/140-267E-QG.VPI..VAITD------------------SSFSPLAQF--------A...RVWFEVAE-ADF--------------
GFA1_SCHPO/378-507E-NG.ALA..IGVVN------------------CVGSSISRK--------T...HCGVHINA-GPE--------------
GLMS_MYCLE/301-430E-QK.AKV..LAICN------------------TNGSQIPRE--------C...DAVLYTRA-GPE--------------
Q8Y5Q8_LISMO/191-307Q-IC.ANYTVIDAKD------------------YDMPGISAK--------F...........-...--------------
Q98JM0_RHILO/163-290E-RK.ARI..VTITD------------------STFSPLIAL--------S...DSWLEVVE-SDF--------------
Q9K8R3_BACHD/130-256Q-RG.AKT..IVITD------------------HALSPLVPY--------G...DRVLLAAT-EIN--------------
Q97DH6_CLOAB/196-312T-YA.KRIEVLDAKE------------------LGLSTIDAS--------V...........-...--------------
AGAS_ECOLI/220-357R-DN.QAMRVIAIAA------------------ESSDIVAAG--------P.....HIILPP-SRH--------------
NODM_RHILV/286-415A-HG.LRI..GAVVN------------------TRESTMARE--------A...DAIFPILA-GPE--------------
GLMS_ECOLI/461-592A-RG.GQL..YVFAD------------------QDAGFVSSD--------N......MHIIE-MPH--------------
Q92A16_LISIN/191-307Q-IC.ANYTVIDAKD------------------YDMPGISAK--------F...........-...--------------
Q97I06_CLOAB/131-258S-RK.TKV..VALTD------------------SLLSPLATE--------A...DYTLIAQS-NMA--------------
RPIR_ECOLI/137-267K-NG.AKI..ICITH------------------SYHSPIAKL--------A...DYIICSPA-PET--------------
GUTQ_ECOLI/38-170D-KS.IAL..LAMTG------------------KPTSPLGLA--------A...KAVLDISV-ERE--------------
GLMS_BACSU/456-583A-RG.ANT..CIISL------------------KGLDDADDR--------F..........V-LPE--------------
Q97LM6_CLOAB/110-235V-KN.IPS..ISITK------------------LSDNSIARL--------C...DENLYIIT-RNI--------------
PHI_BACSU/32-157S-LH.GIV..AALTI------------------NPESSIGKQ--------A...DLIIRMPG-SPK--------------
Q927E3_LISIN/127-251E-ND.VDI..ILITS------------------MQANPLVEF--------A...THKIYMAS-AEN--------------
KPSF1_ECOLX/52-184N-FG.NRI..IAITN------------------NGNSTLAKN--------A...DAVLELHM-ANE--------------

PF10740

A6QIX0_STAAE/1-168D.QVALDIQKLIDLD------------------IDVVLIS..NKPKTDDFP--DHLVHFIDLSTPR--------------
A8FIE4_BACP2/1-172DEEIESLVKELHAQG------------------TPVVGVG.PAQKEPSMIE--EHCDVHIDFQLKK--------------
A7Z9T3_BACA2/1-169TAEEQALAQKLYEKG------------------IGLVGVS.PVIKDQTGIE--EFCDVHIDSKLKM--------------
Q9K6E1_BACHD/1-172DAEAVTVAKTLADQG------------------VEMVGISTVKECEGTSLT--SVVDVHIDLGATL--------------
Q5HM96_STAEQ/1-168S.EVESDVLQLIDLD------------------VDLVLIC..NNPKRDDFP--NHLIHYVNLSTPR--------------
A3ICF8_9BACI/7-175DEEALALAQKLNTQF------------------IPFAAVASEPASTENPLA--DLAYTYISTRIKG--------------
Q5WB44_BACSK/1-168HKGVQAALKACEQAG------------------IAAVVVSSRHASSTASLA--P.PHLFLDTGVKG--------------
Q4L807_STAHJ/1-168E.EVAKDVQTLVDND------------------IDVVLIC..NRPKDSEIP--EHFIHFINLATPR--------------
A4ITL8_GEOTN/71-239DEEAIRLVEQLQARG------------------VDTVAVA.TLVKDEPGLA--DIAAIHIDSKLSR--------------
Q2BG48_9BACI/1-169DGQAVALAKALSEKM------------------IPFTAISTAVEGEGPSLA--ELADVHIDLKLTK--------------
C2ST42_BACCE/1-171DEEIIKTAKKLHEEG------------------QSIVGIS.AIQEGVESLE--QYTDVHIDTKLLK--------------
A6CQ30_9BACI/7-176DEEAVALAKQLSDQG------------------VAFTAISGAVSGEGESLT--DLADIHIDTKLIK--------------
YWJG_BACSU/1-169TAEEQELAKELYEKG------------------AGVVCVS.PAAKDSAGIE--QYCDVHIDSKLKM--------------
Q65DT8_BACLD/1-172DDEELKMAEKLYEKG------------------IGLVVVS.PSGKDGVPIA--SFADVHIDSKLRM--------------

PF00342

G6PI_HUMAN/54-546QGDMESNGKYITKSG.TRVDHQTGPIVWGEPGTNGQHAFYQLIHQG----TKMIPCDFLIPVQTQHPI....RKGLHHKI
G6PIB_ORYSJ/51-547QLSMESNGKGVSIDG.VQLSFETGEIDFGEPGTNGQHSFYQLIHQ.----GRVIPCDFIGVVKSQQPVYLKGEIVSNHDE
G6PI_KLULA/64-548QLSMESNGKSVTRGN.VFANYSTGSILFGEPATNAQHSFFQLIHQG----TKLIPSDFILAAQSHNPI....ENNLHQKM
G6PI1_CLALE/51-548QVSMESNGKGVSIDG.LPLPFESGEIDFGEPGTNGQHSFYQLIHQ.----GRVIPCDFIGVVKSQQPVYLKGEVVNNHDE
G6PIA_GEOSE/7-445QLFGESEGK..DQKG.....IFPASANF....STDLHSLGQYIQE.----GRRDLFETVLKVEKPR......HDLVIEAE
G6PIB_GEOSE/6-440QLFGESEGK..DQKG.....LFPASVDF....TTDLHSMGQYVQE.----GRRNLIETVLHVKKPQ......IELTIQED
G6PI_HAEIN/52-542QGNMESNGKYVDRDGNVIKNYQTGPIIWGEPGTNGQHAFYQLIHQG----TTLIPCDFIAPAQRHN......PLADHHNK
G6PI_LEIME/101-596QLDMESNGKGVTKKS.GAVAVQTGPIVFGEAGTNGQHAFYQLIHQG----TKIIPCDFIGCVQTQN......RVGDHHRT
G6PI_TRYBB/102-598QLDMESNGKYVTRSG.KTVSTLTGPIIFGEAGTNGQHAFYQLIHQG----TNLIPCDFIGAIQSQN......KIGDHHKI
G6PI_ZYMMO/49-502QLEMESNGKRVDLDG.NLIDHPSAFITWGGVGTDAQHAVFQLLHQG----TRLVPIEFIAAIKADD.....TLNPVHHKT

PF13580

B4BKI9_9BACI/4-139--------------------------------------------------GRN....-..PVPIDVALAA...KAKGAYT
Y240_THEPX/4-141--------------------------------------------------GRN....-..GAPIEAAIEA...KRRGLKV
D3Q8F5_STANL/7-146--------------------------------------------------GIN....-..GSIVEFASAV...KEAGHDL
Y887_BACSK/6-142--------------------------------------------------GRN....-..PVAIDMAIAA...KQKGMTV
D3FS76_BACPE/4-139--------------------------------------------------GRN....-..PVPIDLALYG...KAQGAYV
C4RNS3_9ACTO/7-145--------------------------------------------------GVN....-..GAIVEFAALV...TGRGHRL
B0N1X7_9FIRM/7-143--------------------------------------------------GRN....-..TIAIDMALRA...KAMGVIV
D2Q4A3_KRIFD/26-165--------------------------------------------------GVN....-..GSIVELAGVV...KEQGHPL
C9ASX1_ENTFC/3-139--------------------------------------------------GRN....-..PIIIDLALTA...KAKGVKI
C8N9D3_9GAMM/7-143--------------------------------------------------GRN....-..AVAIDLVLAA...RAKGVQI
Y3325_BACHD/7-142--------------------------------------------------GRN....-..TVPVEMAIES...RNIGAKV
B5Y674_COPPD/8-143--------------------------------------------------GNN....-..AVPIEVAKAC...QERDVNV
C7QC58_CATAD/12-151--------------------------------------------------GGN....-..GVIVDLAEHV...TSLGHKL
A1RZ59_THEPD/8-143--------------------------------------------------GKN....-..AVPVEMAVEA...RNRGVKV
C0CLH1_9FIRM/5-140--------------------------------------------------GIN....-..PFPIEMAECA...RKKGVKV
E8S9A0_MICSL/6-145--------------------------------------------------GIN....-..GSVVELATLV...KRGGHPL
Q5WKS2_BACSK/9-144--------------------------------------------------GRN....-..NIPVEMCLEA...KKLGTKV
C6Y1C7_PEDHD/5-146--------------------------------------------------GIN....-..NVNIDVALEA...KKKGMKV
Y3403_BRUSI/7-142--------------------------------------------------GVN....-..AAPIEAARYA...REKGAAI
Y4393_STRCO/9-146--------------------------------------------------GRN....-..ALPVEMAMHA...RALGLRV
A8F7H2_THELT/16-151--------------------------------------------------GSN....-..SVAVTFAEST...KKIGAYV
Q2CEE8_9RHOB/8-143--------------------------------------------------GRN....-..AYPVELAQIA...KASGATV
C5C598_BEUC1/10-150--------------------------------------------------GVN....-..GSIVGMALAA...KERGHAV
A8MBI0_CALMQ/10-145--------------------------------------------------GKN....-..AAPVEMAYEA...KRRGLRV
A7NMQ6_ROSCS/10-151--------------------------------------------------GVN....-..QVVIDVALEV...KARGMPV
B9YBN0_9FIRM/5-140--------------------------------------------------GRN....-..AVPVEMAMRC...QKEGVYT
A6NQL5_9FIRM/12-147--------------------------------------------------GRN....-..GLIVEMALEA...KKMGVTV
YNAG_LYSSH/4-139--------------------------------------------------ANN....-..PVPIDMAIYA...KEAGAHT
B5Y9Q0_COPPD/8-148--------------------------------------------------GVN....-..AAPVEAAMYA...KDFGMKV
B5ZFE8_GLUDA/7-148--------------------------------------------------GIN....-..AVILDMALEA...QAQGMAV
D2YKE2_VIBMI/7-142--------------------------------------------------GRN....-..PVVIDAALTA...KSIGATV
A3IFJ8_9BACI/3-138--------------------------------------------------GRN....-..AAPIDAALLA...KHANVFV
Q2BFI1_9BACI/11-147--------------------------------------------------GIN....-..AATIDAALEA...KRLGVKT
A8F3Q5_THELT/6-147--------------------------------------------------GIN....-..AAPVEAALYG...KKVGAKV
B5JPS4_9BACT/5-135--------------------------------------------------GKN....-..CSPIEVALYA...KEKGLKV
A0LSD9_ACIC1/6-147--------------------------------------------------GVT....-..ANSIEIAMGA...RKRGLPV
D2YKF6_VIBMI/10-146--------------------------------------------------GRT....-..IPTIDIALAA...KKRGLKI
A4AEP3_9ACTN/17-152--------------------------------------------------GSN....-..AVTSELVQRV...MADGIPV
D2QHK1_SPILD/6-146--------------------------------------------------GSN....-..VVPIEMAELF...QQQGVKV
C7MHG6_BRAFD/6-139--------------------------------------------------GIN....-..PVPIEVAQHA...AAQGLTV
B9YBM7_9FIRM/6-145--------------------------------------------------ANN....-..GVIVEFAKKI...KEKGRKL
C6W8A4_ACTMD/9-144--------------------------------------------------GVN....-..PYPVELAAHA...ADAGCPV
B9YBM8_9FIRM/8-149--------------------------------------------------GIN....-..GVVIDFAIKA...KQEGHKV
B9Y8L8_9FIRM/15-150--------------------------------------------------GRT....-..KGVVDLAWEA...KKMGIKV
B5YCA1_DICT6/2-136--------------------------------------------------GRD....-..LVAIDVCLEL...KKKGIFT
C1I4Z1_9CLOT/5-144--------------------------------------------------GYK....-..YFPVDLAIKG...NDLGCLT
GMHA_METJA/5-142--------------------------------------------------GNS....-..ENVIKAANKA...KEMGIYT
B6C3E6_9GAMM/24-160--------------------------------------------------GQS....-..TSVIHGIKAA...HDCEMTI
B2JKC9_BURP8/9-145--------------------------------------------------GNP....-..ANVLAAIEDA...HDREMIV
C8X0N1_DESRD/11-148--------------------------------------------------GKS....-..ANVNAALAAA...REGQLGT
GMHA_PSEA6/8-144--------------------------------------------------GAS....-..RSVISAMEAA...LSRDMTI
B6BTJ5_9PROT/7-143--------------------------------------------------GNS....-..ENVLNALAVA...NQKQMTT
Q02BY6_SOLUE/6-142--------------------------------------------------GGNLENN-VSPNLVAAIRYA...KTVGAKI
D0RPZ2_9PROT/6-142--------------------------------------------------GGNLKRK-VSLNIINAIKYA...KKIKAKS
A1U3H1_MARAV/10-147--------------------------------------------------GHK....-..ANLIQAIQAA...HDREMRI
Q0YTV3_9CHLB/9-148--------------------------------------------------GNS....-..ANITCALEKA...KDLGVKS
D4HSN8_LEPIR/4-142--------------------------------------------------GNS....-..PNVVKALEVG...NKLEMIT
Q2STV8_BURTA/8-142--------------------------------------------------GDS....-..PRVLAAVEEA...REREMIV
Q319P8_PROM9/4-141--------------------------------------------------GNS....-..INLVKCAQRA...KKLGIKQ
C4KCT7_THASP/10-146--------------------------------------------------PDS....-..ARVLDAIRAA...HERDMRV
A8PNA0_9COXI/5-141--------------------------------------------------GGDLERN-ISLNLIAAVDYA...RKQNSKI
B9MBX1_ACIET/9-143--------------------------------------------------GNE....-..PALLQAVQAA...HERDMTV
Q1MP15_LAWIP/7-149--------------------------------------------------GES....-..PNVVNTIRLAQSMQEKQIFC
B7RSM6_9GAMM/25-161--------------------------------------------------GSS....-..DLPI.ALEAA...RERGMLT
F1TC99_9CLOT/7-146--------------------------------------------------TPH....-..RNLIEAAKFS...YTRGLRV

PF01380

Q7CXS2_AGRT5/132-260--------------------------------------------------S..-------....AWDSSV---VTLFVVE
GFA1_CANAL/564-696--------------------------------------------------TVD-------CLQGLLNVIP---LQLISYW
HEXR_ECOLI/124-253--------------------------------------------------T..-------DIYMPMVSRL---AQLTVID
GFPT1_HUMAN/380-509--------------------------------------------------I..-------.GVASTKAYT---SQFVSLV
Q8XNY4_CLOPE/36-163--------------------------------------------------Y..-------......KGLE---LYSMLIR
GLMS_BACSU/286-415--------------------------------------------------I..-------.AVASTKAYT---AQIAVLA
YFHH_ECOLI/128-258--------------------------------------------------A..-------TNSASISACH---AQGMLTD
Q92SL6_RHIME/145-272--------------------------------------------------A..-------....GFRSLS---ASMAFAM
Q8YAS2_LISMO/118-244--------------------------------------------------E..-------......MNNL---DITSRIS
KDSD_ECOLI/45-177--------------------------------------------------ACP-------LGLAPTSSTT---ATLVMGD
GLMS_HAEIN/289-419--------------------------------------------------V..-------.GVASTKAFT---TQLAALL
AGAS_ECOLI/48-189--------------------------------------------------THD-------RGFAMTSSIT---TMMASCL
Q8Y3Y1_LISMO/127-251--------------------------------------------------H..-------......YNKV---SSFSTRQ
GFPT1_HUMAN/551-682--------------------------------------------------SVD-------CLQGILSVIP---LQLLAFH
NODM_RHILV/459-591--------------------------------------------------VAE-------IIAPMIFSLP---LQLLAYH
Q8XNY5_CLOPE/110-235--------------------------------------------------E..-------......LGGG---KTYESTT
MAS2_AGRRH/37-172--------------------------------------------------A..-------FQAIHMLMLS---LIGGILN
API_HAEIN/62-194--------------------------------------------------VCP-------NNLAPTTSAL---VTLALGD
YARA_PROST/128-258--------------------------------------------------L..-------FQTGVITPQV---LQMVVFD
Q99RU9_STAAM/110-235--------------------------------------------------Y..-------......LTDG---TDYSSFI
GFA1_SCHPO/550-679--------------------------------------------------TVD-------CLQGILNVIP---FQLLSYW
GFA1_YEAST/565-700--------------------------------------------------TVD-------CLQGLINIIP---LQLMSYW
GLMS_ECOLI/289-419--------------------------------------------------I..-------.GVASTKAFT---TQLTVLL
Q8XLF9_CLOPE/129-256--------------------------------------------------S..-------....FVDSLV---APLSVIN
GFA1_CANAL/392-521--------------------------------------------------I..-------.GVASTKAYT---SQYIALV
Q92MN3_RHIME/133-262--------------------------------------------------T..-------....AWDTVS---AAMALVE
Q98CV6_RHILO/140-267--------------------------------------------------A..-------....GFRSLS---ATMALAM
GFA1_SCHPO/378-507--------------------------------------------------I..-------.CVASTKAYT---SQYVALV
GLMS_MYCLE/301-430--------------------------------------------------I..-------.GVASTKTFL---AQVAANY
Q8Y5Q8_LISMO/191-307--------------------------------------------------...-------.......RGA---LSPFIIH
Q98JM0_RHILO/163-290--------------------------------------------------A..-------....GFRSLA---ASLAVGM
Q9K8R3_BACHD/130-256--------------------------------------------------S..-------....FIDSFA---APHSIVS
Q97DH6_CLOAB/196-312--------------------------------------------------...-------.......VDY---FNHSLFN
AGAS_ECOLI/220-357--------------------------------------------------FID-------VEQAFCFLMY---AQTFALM
NODM_RHILV/286-415--------------------------------------------------I..-------.GVASTKAFT---CQLAVLA
GLMS_ECOLI/461-592--------------------------------------------------VEE-------VIAPIFYTVP---LQLLAYH
Q92A16_LISIN/191-307--------------------------------------------------...-------.......RGA---LSPFIIH
Q97I06_CLOAB/131-258--------------------------------------------------S..-------....FVDSLV---APLSVIN
RPIR_ECOLI/137-267--------------------------------------------------P..-------LLGRNASARI---LQLTLLD
GUTQ_ECOLI/38-170--------------------------------------------------ACP-------MHLAPTSSTV---NTLMMGD
GLMS_BACSU/456-583--------------------------------------------------VNP-------ALAPLVSVVP---LQLIAYY
Q97LM6_CLOAB/110-235--------------------------------------------------K..-------......IEGV---VTCENVG
PHI_BACSU/32-157--------------------------------------------------D..-------QSNGSYKTIQ---PMGSLFE
Q927E3_LISIN/127-251--------------------------------------------------H..-------......YNKV---SSFSTRQ
KPSF1_ECOLX/52-184--------------------------------------------------TCP-------NNLAPTTSTT---LTMAIGD

PF10740

A6QIX0_STAAE/1-168--------------------------------------------------PIVYTED.YDKIVQPHAMALNYVYYDIYTQ
A8FIE4_BACP2/1-172--------------------------------------------------PLVPADD.GTRFGYPALMTCLYVYHALSFT
A7Z9T3_BACA2/1-169--------------------------------------------------PLLPDED.GTRYGFPSLMTGLYVYHALSFT
Q9K6E1_BACHD/1-172--------------------------------------------------SLVPGED.GNRYGYPGTLLALFAYQCLYLS
Q5HM96_STAEQ/1-168--------------------------------------------------PIVYTED.YDKIIQPHPMALNYIYYDIYTQ
A3ICF8_9BACI/7-175--------------------------------------------------GLLPNDL.GQRVVVPHALAGLFVYEAVKMA
Q5WB44_BACSK/1-168--------------------------------------------------GLVPDET.GKRIGHPGVIAGLYVYHGLKFV
Q4L807_STAHJ/1-168--------------------------------------------------PIVYTED.YDKVVQPHTISFNYIYYEIYTQ
A4ITL8_GEOTN/71-239--------------------------------------------------PLVPTED.GRRIAMPTVVTASFIYYGLLVL
Q2BG48_9BACI/1-169--------------------------------------------------GLLPDEE.GNRFGYPSAIAALFVYHGLKFT
C2ST42_BACCE/1-171--------------------------------------------------GLIPDDE.GNRYGFPSLIIALFAYHGLKFT
A6CQ30_9BACI/7-176--------------------------------------------------GMLPGEELGERVGFPSSMAALYIYYLIKFS
YWJG_BACSU/1-169--------------------------------------------------PLVPDED.GTRYGFPSLMTALYVYHALSFT
Q65DT8_BACLD/1-172--------------------------------------------------PLLPDED.GTRYGFPSLMVSLYIYHALSFT

PF00342

G6PI_HUMAN/54-546LLANFLAQTEALMRGKSTEEARKELQAAG.KSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAM---YEHKIFV
G6PIB_ORYSJ/51-547LMSNFFAQPDALAYGKTPEQLHSEK.........VPEHLISHKTFQGNRPSLSLLLPSLSAYEIGQLLSI---YEHRIAV
G6PI_KLULA/64-548LASNFFAQAEALMVGKDEEQVKSEGATG.........GLVPHKVFSGNRPTTSILAQKITPATLGALIAY---YEHVTFT
G6PI1_CLALE/51-548LMSNFFAQPDALAYGKTPEELKKEN.........VSEHLIPHKTFTGNRPSISILLPTLDAYRIGQLLAI---YEHRVAV
G6PIA_GEOSE/7-445END..LDGLNYLA.GKTVDFVNTKAFEG.........TLLAHTDG.G.VPNLVITLPELNEYTFGYLVYF---FEKACAM
G6PIB_GEOSE/6-440PEN..IDGLNFLA.GKTLDEVNKKAFQG.........TLLAHVDG.G.VPNLIVELDEMNEYTFGEMVYF---FEKACGI
G6PI_HAEIN/52-542LLSNFFAQTEALAFGKTKEEVEAEFVKAG.KSLDDVKNIVPFKVFTGNKPTNSILVQKITPFTLGALIAM---YEHKIFV
G6PI_LEIME/101-596LMSNFFAQTEALMVGKNAEEVRQELVKSG.MSGDAIENMIPHKTFTGSRPSNSILVNALTPRALGAIIAM---YEHKVLV
G6PI_TRYBB/102-598FMSNFFAQTEALMIGKSPSEVRRELEAAGERSAEKINALLPHKTFIGGRPSNTLLIKSLTPRALGAIIAM---YEHKVLV
G6PI_ZYMMO/49-502LLTNAFAQGAALMSGRD....NK................DPARSYPGDRPSTTILMEELRPAQLGALIAF---YEHRTFT

PF13580

B4BKI9_9BACI/4-139IAITS----------------------------------------------
Y240_THEPX/4-141VAITS----------------------------------------------
D3Q8F5_STANL/7-146IAFTS----------------------------------------------
Y887_BACSK/6-142ISLTN----------------------------------------------
D3FS76_BACPE/4-139IGITS----------------------------------------------
C4RNS3_9ACTO/7-145IAITS----------------------------------------------
B0N1X7_9FIRM/7-143IAVTN----------------------------------------------
D2Q4A3_KRIFD/26-165IAITS----------------------------------------------
C9ASX1_ENTFC/3-139ISLTN----------------------------------------------
C8N9D3_9GAMM/7-143IALTN----------------------------------------------
Y3325_BACHD/7-142IAMTS----------------------------------------------
B5Y674_COPPD/8-143IAITS----------------------------------------------
C7QC58_CATAD/12-151IAITS----------------------------------------------
A1RZ59_THEPD/8-143IAITS----------------------------------------------
C0CLH1_9FIRM/5-140IGITS----------------------------------------------
E8S9A0_MICSL/6-145IAVTS----------------------------------------------
Q5WKS2_BACSK/9-144IALTS----------------------------------------------
C6Y1C7_PEDHD/5-146IVFGS----------------------------------------------
Y3403_BRUSI/7-142IAPTS----------------------------------------------
Y4393_STRCO/9-146IGVTS----------------------------------------------
A8F7H2_THELT/16-151AAVTS----------------------------------------------
Q2CEE8_9RHOB/8-143IAVTS----------------------------------------------
C5C598_BEUC1/10-150IAVTS----------------------------------------------
A8MBI0_CALMQ/10-145IALTS----------------------------------------------
A7NMQ6_ROSCS/10-151IAVVS----------------------------------------------
B9YBN0_9FIRM/5-140IALTN----------------------------------------------
A6NQL5_9FIRM/12-147LAITS----------------------------------------------
YNAG_LYSSH/4-139ISLQS----------------------------------------------
B5Y9Q0_COPPD/8-148VAITS----------------------------------------------
B5ZFE8_GLUDA/7-148IAVTS----------------------------------------------
D2YKE2_VIBMI/7-142IGLTS----------------------------------------------
A3IFJ8_9BACI/3-138LSLQS----------------------------------------------
Q2BFI1_9BACI/11-147IGVSS----------------------------------------------
A8F3Q5_THELT/6-147IAIVS----------------------------------------------
B5JPS4_9BACT/5-135IALTS----------------------------------------------
A0LSD9_ACIC1/6-147IALTS----------------------------------------------
D2YKF6_VIBMI/10-146IVLQS----------------------------------------------
A4AEP3_9ACTN/17-152VALTS----------------------------------------------
D2QHK1_SPILD/6-146VALIT----------------------------------------------
C7MHG6_BRAFD/6-139IAITS----------------------------------------------
B9YBM7_9FIRM/6-145IVVTS----------------------------------------------
C6W8A4_ACTMD/9-144VAVTS----------------------------------------------
B9YBM8_9FIRM/8-149IVVTS----------------------------------------------
B9Y8L8_9FIRM/15-150IAMSS----------------------------------------------
B5YCA1_DICT6/2-136IGIIN----------------------------------------------
C1I4Z1_9CLOT/5-144IAITT----------------------------------------------
GMHA_METJA/5-142IGLLG----------------------------------------------
B6C3E6_9GAMM/24-160IALTG----------------------------------------------
B2JKC9_BURP8/9-145VALSG----------------------------------------------
C8X0N1_DESRD/11-148VGLAG----------------------------------------------
GMHA_PSEA6/8-144VALTG----------------------------------------------
B6BTJ5_9PROT/7-143IGLLG----------------------------------------------
Q02BY6_SOLUE/6-142TGIVG----------------------------------------------
D0RPZ2_9PROT/6-142IAIVA----------------------------------------------
A1U3H1_MARAV/10-147VVLSA----------------------------------------------
Q0YTV3_9CHLB/9-148YAILG----------------------------------------------
D4HSN8_LEPIR/4-142YAILG----------------------------------------------
Q2STV8_BURTA/8-142IALTG----------------------------------------------
Q319P8_PROM9/4-141VGIVG----------------------------------------------
C4KCT7_THASP/10-146IALTG----------------------------------------------
A8PNA0_9COXI/5-141VGIWG----------------------------------------------
B9MBX1_ACIET/9-143VALCG----------------------------------------------
Q1MP15_LAWIP/7-149VSLTG----------------------------------------------
B7RSM6_9GAMM/25-161VALIT----------------------------------------------
F1TC99_9CLOT/7-146VSITG----------------------------------------------

PF01380

Q7CXS2_AGRT5/132-260ALIEA----------------------------------------------
GFA1_CANAL/564-696LAVNR----------------------------------------------
HEXR_ECOLI/124-253VLATG----------------------------------------------
GFPT1_HUMAN/380-509MFALM----------------------------------------------
Q8XNY4_CLOPE/36-163FLYEL----------------------------------------------
GLMS_BACSU/286-415VLASV----------------------------------------------
YFHH_ECOLI/128-258LLFIA----------------------------------------------
Q92SL6_RHIME/145-272ALTVA----------------------------------------------
Q8YAS2_LISMO/118-244TIAIM----------------------------------------------
KDSD_ECOLI/45-177ALAVA----------------------------------------------
GLMS_HAEIN/289-419MLVTA----------------------------------------------
AGAS_ECOLI/48-189AVFAP----------------------------------------------
Q8Y3Y1_LISMO/127-251SLLSI----------------------------------------------
GFPT1_HUMAN/551-682LAVLR----------------------------------------------
NODM_RHILV/459-591TAVVM----------------------------------------------
Q8XNY5_CLOPE/110-235LFFTL----------------------------------------------
MAS2_AGRRH/37-172ERENW----------------------------------------------
API_HAEIN/62-194ALAVS----------------------------------------------
YARA_PROST/128-258TLFFK----------------------------------------------
Q99RU9_STAAM/110-235SYHIF----------------------------------------------
GFA1_SCHPO/550-679LAVKR----------------------------------------------
GFA1_YEAST/565-700LAVNK----------------------------------------------
GLMS_ECOLI/289-419MLVAK----------------------------------------------
Q8XLF9_CLOPE/129-256ALIIA----------------------------------------------
GFA1_CANAL/392-521MFALS----------------------------------------------
Q92MN3_RHIME/133-262ALIVR----------------------------------------------
Q98CV6_RHILO/140-267ALTVG----------------------------------------------
GFA1_SCHPO/378-507LMALY----------------------------------------------
GLMS_MYCLE/301-430LLGLA----------------------------------------------
Q8Y5Q8_LISMO/191-307AVNNR----------------------------------------------
Q98JM0_RHILO/163-290ALVQG----------------------------------------------
Q9K8R3_BACHD/130-256AFITA----------------------------------------------
Q97DH6_CLOAB/196-312NVYPI----------------------------------------------
AGAS_ECOLI/220-357QSLHM----------------------------------------------
NODM_RHILV/286-415ALRIG----------------------------------------------
GLMS_ECOLI/461-592VALIK----------------------------------------------
Q92A16_LISIN/191-307AVNNR----------------------------------------------
Q97I06_CLOAB/131-258ALIVS----------------------------------------------
RPIR_ECOLI/137-267AFFVS----------------------------------------------
GUTQ_ECOLI/38-170ALAMA----------------------------------------------
GLMS_BACSU/456-583AALHR----------------------------------------------
Q97LM6_CLOAB/110-235QYFIL----------------------------------------------
PHI_BACSU/32-157QTLLL----------------------------------------------
Q927E3_LISIN/127-251SLLSI----------------------------------------------
KPSF1_ECOLX/52-184ALAIA----------------------------------------------

PF10740

A6QIX0_STAAE/1-168MIEMT----------------------------------------------
A8FIE4_BACP2/1-172VKEIV----------------------------------------------
A7Z9T3_BACA2/1-169LKEMM----------------------------------------------
Q9K6E1_BACHD/1-172TLDIL----------------------------------------------
Q5HM96_STAEQ/1-168MIEMT----------------------------------------------
A3ICF8_9BACI/7-175YDDML----------------------------------------------
Q5WB44_BACSK/1-168IHDIL----------------------------------------------
Q4L807_STAHJ/1-168MIEMT----------------------------------------------
A4ITL8_GEOTN/71-239LDEIL----------------------------------------------
Q2BG48_9BACI/1-169IDEIL----------------------------------------------
C2ST42_BACCE/1-171IDEML----------------------------------------------
A6CQ30_9BACI/7-176LEEML----------------------------------------------
YWJG_BACSU/1-169LKEIL----------------------------------------------
Q65DT8_BACLD/1-172LKEIL----------------------------------------------

PF00342

G6PI_HUMAN/54-546QGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVT.....SHDASTNGLI
G6PIB_ORYSJ/51-547QGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKP.VQGFNSSTASLL
G6PI_KLULA/64-548EGAIWNINSFDQWGVELGKVLAKVIGSELATDNKIS.....SHDSSTNGLI
G6PI1_CLALE/51-548QGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVKGEPVEEGFNFSTKTLL
G6PIA_GEOSE/7-445SGYLLGVNPFDQPGVEAYKVNMFALLGKP............GYEEKKAELE
G6PIB_GEOSE/6-440SGHLLGVNPFDQPGVEAYKKNMFALLGKP............GFEDEKAALM
G6PI_HAEIN/52-542QGVIFNIFSFDQWGVELGKQLANRILPELTDSEKVA.....SHDSSTNGLI
G6PI_LEIME/101-596QGAIWGINSYDQWGVELGKVLAKSILPQLKSGNIVS.....DHDGSTNGLI
G6PI_TRYBB/102-598QGAIWGIDSYDQWGVELGKVLAKSILPQLRPGMRVN.....NHDSSTNGLI
G6PI_ZYMMO/49-502NGVLLGINSFDQFGVELGKEMAHAIADHPENS.........DFDPSTKALI

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window