Sequence alignment for CL0069

PF01353

GFPL_CLASP/43-260MGVIKPDMKIKLKMEGNVNGHAFVIEGEG--EGKPYDGTH..TLNLEVKEGAPLPFSYD-ILSNAFQYGNRALTKYPDDI
Q8T5E7_CONGI/2-220YPWIKETMRSKVYMEGDVNNHAFKCTAVG--EGKPYKGSQ..DLTITVTEGGPLPFAFD-ILSHAFQYGNKVFTDYPDDI
Q8MMA1_AGAAA/12-234VNGIAEEMKTDLIMEGIVNGHSFTIEGKG--TGYXYKGDQ..FMKLEVVKGAPLPFSFD-ILTTAFMYGNRVFTKYPSNI
Q8MMA2_AGAFR/34-254TNGIAEEMKTRVHLEGTVNGHSFTIKGEG--RGYPYKGEQ..FMSLEVVNGAPLPFSFD-ILTPAFMYGNRVFTKYPPNI
Q8T5F0_9CNID/7-229KNVVKDFMKITLRMDGAVNGKPFAVNGTG--DGNPYGGIQ..SLKLTVDGNKPLPFAFD-ILSAAFQYGNRAFTEYPKEI
Q9GTJ7_9CNID/5-223KNVIKEFMRFKVRMEGTVNGHEFEIKGEG--EGRPYEGHC..SVKLMVTKGGPLPFAFD-ILSPQFQYGSKVYVKHPADI
Q8T5F3_9CNID/6-223MK.VKEHMKIKLRMGGTVNGKHFAVNGTG--DGYPYQGKQ..ILKLIVEGSEPLPFAFD-ILSAAFQYGNRAFTEYPTEI
Q95VT0_9CNID/1-221MSVIKPDMKIKLRMEGAVNGHKFVIEGDG--KGKPFEGTQ..SMDLTVIEGAPLPFAYD-ILTTVFDYGNRVFAKYPQDI
Q9GPI5_ANESU/2-222ASFLKKTMPFKTTIEGTVNGHYFKCTGKG--EGNPFEGTQ..EMKIEVIEGGPLPFAFH-ILSTSCMYGSKTFIKYVSGI
Q8T5F1_9CNID/1-219MSVIKSVMKIKLRMEGSVNGHNFVIVGEG--EGKPYEGTQ..SMDLTVKEGAPLPFAYD-IMTTVFHYGNRVFAKYPKHI
Q8MU46_RICFL/1-221MNALQEEMKIKLTMVGVVNGQSFKIDGKG--KGKPYEGSQ..ELTLKVVEGGPLLFSYD-ILTTIFQYGNRAFVNYPKDI
NFCP_GONTE/1-218MSVIAKQMTYKVYMSGTVNGHYFEVQGDG--KGKPYEGEQ..TVKLTVTKGGPLPFAWD-ILSPQSQYGSIPFTKYPEDI
Q9BLY9_RENMU/8-225NTCLQEVMSYKVNLEGIVNNHVFTMEGCG--KGNILFGNQ..LVQIRVTKGAPLPFAFD-IVSPAFQYGNRTFTKYPNDI
GFPL_ANEMA/5-224NKFIGDDMKMTYHMDGCVNGHYFTVKGEG--NGKPYEGTQTSTFKVTMANGGPLAFSFD-ILSTVFKYGNRCFTAYPTSM
Q8T4U4_9CNID/5-228KHGLTDDMTMHFRMEGCVDGHKFVIEGNG--NGNPFKGKQ..FINLCVIEGGPLPFSED-ILSAAFDYGNRLFTEYPEGI
Q95UA7_9CNID/1-218MSVIKSVMKIKLRMDGIVNGHKFMITGEG--EGKPFEGTH..TIILKVKEGGPLPFAYD-ILTTAFQYGNRVFTKYPKDI
GFPL_DISST/5-223KSVIKEEMLIDLHLEGTFNGHYFEIKGKG--KGQPNEGTN..TVTLEVTKGGPLPFGWH-ILCPQFQYGNKAFVHHPDNI
Q8MU48_9CNID/1-218MSMIKPEMKIKMRMDGAVNGHKFVITGEG--SGEPFEGKQ..TMNLTVIDGGPLPFAFD-ILTTAFDYGXRVFAKYPEDI
Q963F5_9CNID/1-218MSVIKPIMEIKLRMQGVVNGHKFVIKGEG--EGKPFEGTQ..TINLTVKEGAPLPFAYD-ILTSAFQYGNRVFTKYPDDI
GFP_AEQVI/5-229EELFTGVVPILVELDGDVNGHKFSVSGEG--EGDATYGKL..TLKF.ICTTGKLPVPWP-TLVTTFSYGVQCFSRYPDHM
Q9BLZ0_9CNID/8-225NTGLKEIMSAKASVEGIVNNHVFSMEGFG--KGNVLFGNQ..LMQIRVTKGGPLPFAFD-IVSIAFQYGNRTFTKYPDDI
RFP_ENTQU/2-222NSLIKENMRMMVVMEGSVNGYQFKCTGEG--DGNPYMGTQ..TMRIKVVEGGPLPFAFD-ILATSFMYGSKTFIKHTKGI
Q963I9_RENRE/5-223KLGLKEVMPTKINLEGLVGDHAFSMEGVG--EGNILEGTQ..EVKISVTKGAPLPFAFD-IVSVAFSYGNRAYTGYPEEI
Q9GPI6_ANESU/2-219YPSIKETMRVQLSMEGSVNYHAFKCTGKG--EGKPYEGTQ..SLNITITEGGPLPFAFD-ILSHAFQYGIKVFAKYPKEI
Q8I6J8_9CNID/1-219MSLIKPEMKIKLLMEGNVNGHQFVIEGDG--KGHPFEGKQ..SMDLVVKEGAPLPFAYD-ILTTAFHYGNRVFAKYPDHI
NFCP_CONPS/2-220AGLLKESMRIKIYMEGTVNGYHFKCEGEG--DGNPYEGTQ..NMRIRVTEGAPLPFAFD-ILSPCCAYGSKTFIKHTSGI
Q8T6T9_HETCR/2-220CSYIKETMQSKVYMEGKVNDHNFKCTAEG--KGEPYKGSQ..SLTITVTEGGPLPFAFD-ILSHAFRYGNKVFAKYPKDH

PF07474

NID2_MOUSE/549-740-------EGAPHRVNGKVSGRLRVG..H...IPVHFTDVD--LHAYIVGNDGRAYTAIS.HVPQPAAQALLPVLPIGGLF
NID1_MOUSE/426-624-------EGSPQRVNGKVKGRIFVGSSQ...VPVVFENTD--LHSYVVMNHGRSYTAIS.TIPETVGYSLLPLAPIGGII
Q04901_HALRO/309-508-------KDIAVRYNGQVSGYSIVLNHDNSWSNETAGAID--LHGYVVTSEGRAFTVLNGNLSPALARSLQPMTIFGTTL
Q96K89_HUMAN/92-279-------PGGPQRARGSVIGNINDV..E...FGIAFLNAT--ITDSPNSDTRIIRAKIT.NVPRSLGSAMRKIVSILNPI
Q93791_CAEEL/399-587-------KGEPQRISGSFEGVINRIP.........IDKTE--LHTFATSTDGNVHTAVS.KIPSDLGHPLRFLYSIGGVM

PF01353

GFPL_CLASP/43-260..ADYFKQSF-PE...GYSWERTMTFEDKGIVKVKSDISM...EE-D.....SFIYEIRFDGMNFPPN---GPVMQKKTL
Q8T5E7_CONGI/2-220..PDFFKQSL-SD...GFTWRRVSXYXXGGVLTVTQDTSL...KG-D.....CIICNIKVHGTNFPEN---GPVMQNKTD
Q8MMA1_AGAAA/12-234..PDFFKQTF-PE...GYHWERIMPFEDQAVCTVTSHIRL...EE-KEEGEMRFVDNVKFHCVNFPPN---GPVMQRKIM
Q8MMA2_AGAFR/34-254..PDYFKQTF-PE...GYHWERNIPFEDQAACTVTSHIRL...EE-EE...RRFVNNVRFHCVNFPPN---GPVMQRRIL
Q8T5F0_9CNID/7-229..SDYFKQSF-.EFGEGFTWERSFTFEDGAICVATNDIKM...VG-D.....EFQYNIRFDGVNFPED---GPVMQKKTV
Q9GTJ7_9CNID/5-223..PDYKKLSF-PE...GFKWERVMNFEDGGVVTVSQDSSL...KD-G.....CFIYEVKFIGVNFPSD---GPVMQRRTR
Q8T5F3_9CNID/6-223..ADYFKQSF-.EFGEGFSWERSFTFEDGAICVATNDITM...VG-G.....EFQYDIRFDGLNFPXD---GPVMQKKTV
Q95VT0_9CNID/1-221..TDYFKQTF-PE...GYFWERSMTYEDQGICIATNDITMMKGVD-D.....CFVYKIRFDGVNFPAN---GPVMQRKTL
Q9GPI5_ANESU/2-222..PDYFKQSF-PE...GFTWERTTTYEDGGFLTAHQDTSL...DG-D.....CLVYKVKILGNNFPAD---GPVMQNKAE
Q8T5F1_9CNID/1-219..PDYFKQMF-PE...EYSWERSMNFEGGGICTARNEITM...EG-D.....CFFNKVRFDGVNFPPN---GPVMQKKTL
Q8MU46_RICFL/1-221..PDIFKQTC-SGLDGGYSWQRTMTYEDGGVCTATSNVSV...VG-D.....TFNYEIHFMGANFPPN---GPVMQKRTV
NFCP_GONTE/1-218..PDYVKQSF-PE...GYTWERIMNFEDGAVCTVSNDSSI...QG-N.....CFIYNVKFSGLNFPPN---GPVMQKKTQ
Q9BLY9_RENMU/8-225..SDYFIQSF-PA...GFMYERTLRYEDGGLVEIRSDINL...IE-D.....KFVYRVEYKGSNFPDD---GPVMQKTIL
GFPL_ANEMA/5-224..PDYFKQAF-PD...GMSYERTFTYEDGGVATASWEISL...KG-N.....CFEHKSTFHGVNFPAD---GPVMAKKTT
Q8T4U4_9CNID/5-228..VDYFKNSC-PA...GYTWHRSFRFEDGAVCICSADITVN.VRE-N.....CIYHESTFYGVNFPAD---GPVMKKMTT
Q95UA7_9CNID/1-218..PDYFKQSF-PE...GYSWERSMTFEDQGVCTVTSDIKL...EG-D.....CFFYEIRFYGVNFPSS---GPVMQKKTL
GFPL_DISST/5-223..HDYLKLSF-PE...GYTWERSMHFEDGGLCCITNDISL...TG-N.....CFYYDIKFTGLNFPPN---GPVVQKKTT
Q8MU48_9CNID/1-218..PDYFKQSF-PE...GFSWERSMTYEDGGICIATNDIKM...EG-D.....CFSYEIRFDGVNFPAN---SPVMQKKTV
Q963F5_9CNID/1-218..PDYFKQTF-PE...GYSWERIMAYEDQSICTATSDIKM...EG-D.....CFIYEIQFHGVNFPPN---GPVMQKKTL
GFP_AEQVI/5-229KQHDFFKSAM-PE...GYVQERTIFFKDDGNYKTRAEVKF...EG-D.....TLVNRIELKGIDFKED---GNILGHKLE
Q9BLZ0_9CNID/8-225..ADYFVQSF-PA...GFFYERNLRFEDGAIVDIRSDISL...ED-D.....KFHYKVEYRGNGFPSN---GPVMQKAIL
RFP_ENTQU/2-222..PDFFKQSF-PE...GFTWERVTRYEDGGVFTVMQDTSL...ED-G.....CLVYHAKVTGVNFPSN---GAVMQKKTK
Q963I9_RENRE/5-223..SDYFLQSF-PE...GFTYERNIRYQDGGTAIVKSDISL...ED-G.....KFIVNVDFKAKDLRRM---GPVMQQDIV
Q9GPI6_ANESU/2-219..PDFFKQSL-PG...GFSWERVSTYEDGGVLSATQETSL...QG-D.....CIICKVKVLGTNFPAN---GPVMQKKTC
Q8I6J8_9CNID/1-219..PDYFKQSF-PK...GFSWERSLMFEDGGVCIATNDITL...KG-D.....TFFNKVRFDGVNFPPN---GPVMQKKTL
NFCP_CONPS/2-220..PDYFKQSF-PE...GFTWERTTIYEDGGVLTAHQDTSL...EG-N.....CLNYKVKVLGTNFPAD---GPVMKNISG
Q8T6T9_HETCR/2-220..PDFFKQSL-PE...GFTWERVSNYEDGGVLTVKQETSL...EG-D.....CIICKIKAHGTNFPAD---GPVMQKRTN

PF07474

NID2_MOUSE/549-740--GWLFALEK.PGSENGFSL-------TGATFVHDVEVTF..HPGEE-----RVRITQTAEGLDPE.....NYLSIKTNI
NID1_MOUSE/426-624--GWMFAVEQ.DGFKNGFSI-------TGGEFTRQAEVTFLGHPG..-----KLVLKQQFSGIDEH.....GHLTISTEL
Q04901_HALRO/309-508--GWLFSKTT.QPAINGVQY-------SGGKVSSHTYIRY..TTGAY-----EFRIDQKYDRVVSDESGVGKVLNGKMTF
Q96K89_HUMAN/92-279--YWTTAKEI.GEAVNGFTL-------TNAVFKRETQVEF..ATG.E-----ILQMSHIARGLDSD.....GSLLLDIVV
Q93791_CAEEL/399-587--GWLFADVQSPNVYNGFQL-------TGGLFNRTVALHI..EQN.Y-----YVTIKQEFSGRNIH.....DYFKSHLFV

PF01353

GFPL_CLASP/43-260.KWEP.STEIMYV..RDGVLVGDISHSLL.LEGGGHYRCDFKSIYKAKKV.VKL..PDYHFVDHRIEILNHDK.DYNKVT
Q8T5E7_CONGI/2-220.GWEPSSTETVIP..QDGGIVAARSPALR.LRDKGHLICHMETTYKPNKE.VKL..PELHFHHLRMEKLSVSD.DGKTIK
Q8MMA1_AGAAA/12-234.RWEP.STENMYP..RNGLLEGYDEKTFR.LKGGGYYQAEHKSIYEGKGS.ISM..PDFHFIDHRIMITNHDE.DYTNVE
Q8MMA2_AGAFR/34-254.KWEP.STENIYP..RDGFLEGHVDMTLR.VEGGGYYRAEFKSTYKGKTPVRDM..PDFHFIDHRIEITEHDE.DYTNVE
Q8T5F0_9CNID/7-229.KWEP.STEIMRV..QGGVLKGEVNMALL.LKDKSHYRCDFKTTYKAKNPVPPTALPXYHYVDHCIEITEENR.DYVKLQ
Q9GTJ7_9CNID/5-223.GWEA.SSERLYP..RDGVLKGDIHMALR.LEGGGHYLVEFKSIYMVKKPSVQL..PGYYYVDSKLDMTSHNE.DYTVVE
Q8T5F3_9CNID/6-223.KWEP.STEIMYM..QNGVLKGEVNMALL.LXDKSHYRCDLKTTYKAKNNVPHP..PGYHYVDHCIEILEERK.DH..VK
Q95VT0_9CNID/1-221.KWEP.STEIMYA..RDGVLKGDVNMALL.LEGGGHYRCDFKTTYKAKKV.VRL..PDYHFVDHRIEIVSHDK.DYNKVK
Q9GPI5_ANESU/2-222.RWEP.ATEILYE..VDGVLRGQSLMALK.CPGGRHLTCHLHSTYRSKKPASALKMPGFHFGDHRIEIMEEVE.KGKCYK
Q8T5F1_9CNID/1-219.KWEP.STEKMYV..RDGVLTGDINMALL.LEGGGHYRCDFRTTYRAKKKGVKL..PDYHFEDHSIEILRHDK.EYTEVK
Q8MU46_RICFL/1-221.KWEP.SXEIXFE..RDGLLRGDVPMSLL.LKGGDHYRCDFKTIYKPNKK.VKL..PGYHFVDHCIEIKSQEN.DYNMVA
NFCP_GONTE/1-218.GWEP.NTERLFA..RDGMLIGNNFMALK.LEGGGHYLCEFKSTYKAKKP.VKM..PGYHYVDRKLDVTNHNI.DYTSVE
Q9BLY9_RENMU/8-225.GIEP.SFEAMYM..NNGVLVGEVILVYK.LNSGKYYSCHMKTLMKSKGVVKEF..PSYHFIQHRLEKTYVE..DGGFVE
GFPL_ANEMA/5-224.GWDP.SFEKMTV..CDGILKGDVTAFLM.LQGGGNYRCQFHTSYKTKKP.VTM..PPNHVVEHRIARTDLDK.GGNSVQ
Q8T4U4_9CNID/5-228.NWEP.SCEKIIPINSQKILKGDVSMYLL.LKDGGRYRCQFDTIYKAKTEPKEM..PDWHFIQHKLNREDRSDAKNQKWQ
Q95UA7_9CNID/1-218.KWEP.STENMYV..RDGVLLGDVSRTLL.LEGDKHHRCNFRSTYGAKKG.VVL..PEYHFVDHRIEILSHDK.DYNTVE
GFPL_DISST/5-223.GWEP.STERLYP..RDGVLIGDIHHALT.VEGGGHYACDIKTVYRAKKAALKM..PGYHYVDTKLVIWNNDK.EFMKVE
Q8MU48_9CNID/1-218.KWEP.CTXEMYV..RDGVLKGGLNMALL.LEGGGHFRCDLKTTYKAKKV.VQM..PDYHFVNHRLEITWHDE.DYNNVK
Q963F5_9CNID/1-218.KWEP.STEKMYV..RDGVLKGDVNMALL.LEGGGHYRCDFRSTYKAKKR.VQL..PDYHFVDHRIEILSHDN.DYNTVK
GFP_AEQVI/5-229YNYNS.HNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLL..PDNHYLSTQSALSKDPNEKRDHMV
Q9BLZ0_9CNID/8-225.GMEP.SFEVVYM..NSGVLVGEVDLVYK.LESGNYYSCHMKTFYRSKGGVKEF..PEYHFIHHRLEKTYVE..EGSFVE
RFP_ENTQU/2-222.GWEP.NTEMLYP..ADGGLRGYSQMALN.VDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESD.KEMFVV
Q963I9_RENRE/5-223.GMQP.SYESMYT..NVTSVIGECIIAFK.LQTGKHFTYHMRTVYKSKKPVETM..PLYHFIQHRLVKTNVDT.ASGYVV
Q9GPI6_ANESU/2-219.GWEP.STETVIP..RDGGLLLRDTPALM.LADGGHLSCFMETTYKSKKE.VKL..PELHFHHLRMEKLNISD.DWKTVE
Q8I6J8_9CNID/1-219.KWEA.STEKMYL..RDGVLTGDITMALL.LKGDVHYRCDFRTTYKSRQEGVKL..PGYHFVDHCISILRHDK.DYNEVK
NFCP_CONPS/2-220.GWEP.CTEIVYQ..DNGVLRGRNVMALK.VSGRPPLICHLHSTYRSKKA.CALTMPGFHFADLRIQMPKKK..KDEYFE
Q8T6T9_HETCR/2-220.GWEP.STETVIP..RGGGILMRDVPALKLLGNKGHLLCVMETTYKSKKK.VNL..PKPHFHHLRMEKDSVSD.DEKTIE

PF07474

NID2_MOUSE/549-740EGQVP----FIPA--NFTAHITPYKEFYH-YR.DSVVTSSSSRSFSLTS....---.GSINQTWSYHID-----QNITYQ
NID1_MOUSE/426-624EGRVP----QIPY--GASVHIEPYTELYH-YS.SSVITSSSTREYTVMEPDQD---GAAPSHTHIYQWR-----QTITFQ
Q04901_HALRO/309-508RGRLP----AVGE--KDTVTIDDYSQVYT-KTGPGIIRTHDTRSYTVRN....---.....VTHSYTVD-----QTIKFE
Q96K89_HUMAN/92-279SGYVL----QLQS--PAEVTVKDYTEDYI-QTGPGQLYAYSTRLFTIDG....---.....ISIPYTWN-----HTVFYD
Q93791_CAEEL/399-587SGTLP----DIAP--GSEVIFPDYEEEYV-RERRGYLTSKAAFDVIVRD....---.GGNVQTYRMSVD-----QQITFE

PF01353

GFPL_CLASP/43-260LYENAVARYS
Q8T5E7_CONGI/2-220QHEYVVASYS
Q8MMA1_AGAAA/12-234LREVALARYS
Q8MMA2_AGAFR/34-254LHDVSWARYS
Q8T5F0_9CNID/7-229EYAKARSGLH
Q9GTJ7_9CNID/5-223QYEKTQGRHH
Q8T5F3_9CNID/6-223LREHAKARSS
Q95VT0_9CNID/1-221LYEHAEAXXG
Q9GPI5_ANESU/2-222QYEAAVARYC
Q8T5F1_9CNID/1-219LYEHAEAHSG
Q8MU46_RICFL/1-221LFEDAVAHYS
NFCP_GONTE/1-218QCEISIARKP
Q9BLY9_RENMU/8-225QHETAIAQMT
GFPL_ANEMA/5-224LTEHAVAHIT
Q8T4U4_9CNID/5-228LIEHAIASRS
Q95UA7_9CNID/1-218VYENAVARPS
GFPL_DISST/5-223EHEIAVARHH
Q8MU48_9CNID/1-218LSEHAEAHSG
Q963F5_9CNID/1-218LSEDAEARYS
GFP_AEQVI/5-229LLEFVTAAGI
Q9BLZ0_9CNID/8-225QHETAIAQLT
RFP_ENTQU/2-222QHEHAVAKFC
Q963I9_RENRE/5-223QHETAIAAHS
Q9GPI6_ANESU/2-219QHESVVASYS
Q8I6J8_9CNID/1-219LYEHAVAHSG
NFCP_CONPS/2-220LYEASVARYS
Q8T6T9_HETCR/2-220QHENVRASYF

PF07474

NID2_MOUSE/549-740ACRHAPRHLA
NID1_MOUSE/426-624ECAHDDARPA
Q04901_HALRO/309-508GCEERFAEVP
Q96K89_HUMAN/92-279QAQGRMPFLV
Q93791_CAEEL/399-587ECPNKEFDRD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window