Sequence alignment for CL0071

PF00328

Q9BL40_CAEEL/16-290ELEMVQVLVRHGD-----------RA------------------------------PSFTYP..................
PPA6_HUMAN/49-379KLKMVQVVFRHGA-----------RS------------------------------PLKPLPLEEQVEWNPQLLEVPPQT
PHYA_ASPFU/71-425RITLVQVLSRHGA-----------RY------------------------------PTSSKSKKYKKLVTAIQA......
VIP1_CAEEL/363-914ELRCVVAVIRHGD-----------RT------------------------------PKQKMKLIVTDQRFFALFEKYDGY
Q22525_CAEEL/28-375KLMMVQAIWRHGD-----------RT------------------------------PTETY...................
Q6BUR8_DEBHA/63-396TIEQVQLISRHGE-----------RF------------------------------PSSNAGKQYEHIMQKFED......
VIP1_HUMAN/390-910ELRCVIAIIRHGD-----------RT------------------------------PKQKMKMEVKHPRFFALFEKHGGY
P90949_CAEEL/21-327KLEFVQALWRHGD-----------RA------------------------------P.......................
PPAX_CAEEL/28-365KLEFVQTIWRHGD-----------RS------------------------------ALEGL...................
Q6BWV9_DEBHA/521-1079VFKGMVSVIRHAD-----------RT------------------------------PKQKFKYSFRSPLFISLLKGHLEE
VIP2_HUMAN/379-894ELRCVIAVIRHGD-----------RT------------------------------PKQKMKMEVRHQKFFDLFEKCDGY
VIP1_DROME/402-926ELRCVVAVIRHGD-----------RT------------------------------PKQKMKVEVRHPKFFEIFEKYDGY
PHYB_EMENI/70-422EVTFVQVLSRHGA-----------RY------------------------------PTESKSKAYSGLIEAIQK......
Q7SEH2_NEUCR/194-548EIIWLQMVSRHGS-----------RY------------------------------PTGGSNVESFGARLANAT......
Q7S8D6_NEUCR/949-1549KLKGVVSVIRHAD-----------.H------------------------------P............FIQLLKGHQEE
ACPL2_DANRE/88-449KLLSVQVMIRHGD-----------RF------------------------------PLYSIPKTKKPTIDCILSEKRKPS
Q9U5U6_DROSU/56-354ELKFAHVIFRHGD-----------RT------------------------------PVDPYPTDPWNNRK..........
PPA_ECOLI/29-375KLESVVIVSRHGV-----------RA------------------------------PTKATQ..................
Q6BM75_DEBHA/63-397TIEQVQLLSRHGE-----------RY------------------------------PSKNVGKALEKINEKFKG......
PHYA1_ASPTE/72-427HITFVQVLARHGA-----------RS------------------------------PTHSKTKAYAATIAAIQK......
A8BDL2_GIAIC/21-353RLLKVFIYTRHGA-----------RS------------------------------PYTAFPRDNVSWYCDEITADSV..
PPAD_YEAST/66-400RLTQVQMIGRHGE-----------RY------------------------------PTRSEAKDIFEVWYKISN......
Q6CZF4_ERWCT/34-372LMEKVVEVSRHGV-----------RP------------------------------PTESNTT.................
Q96VH9_9HOMO/61-394TVTQVNLIQRHGA-----------RW------------------------------PTSGARSRQVAAVAKIQM......
Q19390_CAEEL/17-320KLKFVQIWFRHGE-----------RT------------------------------P.......................
VIP1_YEAST/538-1047VFKGLAIIIRHAD-----------RT------------------------------PKQKFKHSFTSPIFISLLKGHKEE
O93838_ASPNG/72-427HVTFAQVLSRHGA-----------RY------------------------------PTDSKGKKYSALIEEIQQ......
Q6FJ21_CANGA/510-1016VFKGLVTVIRHAD-----------RT------------------------------PKQKFKHSFTSPIFISLLKGHKEE
PHYB_ASPNG/72-404EVDQVIMVKRHGE-----------RY------------------------------PSPSAGKSIEEALAKVYSINTT..
PPA1_PICPA/74-409TIDQAHLLMRHGE-----------RY------------------------------PSTNVGKQLEALYQKLLDA.....
Q8PF53_XANAC/34-377TLEKVVILKRHGV-----------RA------------------------------AMSSPE..................
Q6CYI2_KLULA/67-401TVEHVQMLARHGE-----------RY------------------------------PTASKGKLMIALWDKLKV......
Q6CWN2_KLULA/534-1048VFKGLVTVIRHAD-----------RT------------------------------PKQKLKHSFTSPIFLSLLKGHKEE
Q6CES1_YARLI/413-907VLKGQAIVIRHAD-----------RT------------------------------PKQKIKVSFKHPLFIDLLKGHKEE
Q6AVJ1_ORYSJ/361-950ELRSVIVVIRHGD-----------RT------------------------------PKQKVKLKVTEEKLLNLMLKYNGG
Q8SQJ1_ENCCU/48-332NLEKLFVIFRHGA-----------RT------------------------------PVRNLARMWDSQECM.........
Q90XY1_TAKRU/74-416RIIHLTAIVRHGT-----------RY------------------------------PTGKNIKKMHDFYELM........
O17373_CAEEL/52-377ELLLSQVVWRHGD-----------RA------------------------------PTGTYPTDPHKEE...........
Q757D1_ASHGO/560-1065FFKGLVTVIRHAD-----------RT------------------------------PKQKFKHSFRSQIFISLLKGHKEE
Q9APF7_LEGPN/24-324KLIFAVDIIRHGD-----------RT------------------------------PIVALPTVNY..............
Q8MY06_DROVI/44-342ELKFVHVIFRHGD-----------RM------------------------------PVDPY...................
Q9GUF1_CAEEL/33-333NTEFVIFGTRHGN-----------RN------------------------------P.......................
Q9AAQ4_CAUCR/24-359TLEKVVILSRHGV-----------RS------------------------------AMSSPE..................
Q6YNE9_PENOX/62-418ELTFVQVLSRHGA-----------RY------------------------------PTASKSKKYKSLIQAIQA......
PPAL_HUMAN/32-330SLRFVTLLYRHGD-----------RS------------------------------PVKTYPKDPYQEE...........
Q8I0P9_DROME/64-362QLKFVHVIYRHGD-----------RT------------------------------PVDPY...................
PPA6_MOUSE/42-371ELKMVQVVFRHGA-----------RS------------------------------PLKPLPLEEQVEWNPKLL......
Q19175_CAEEL/28-376ELKMVHIVWRHGD-----------RS------------------------------PTTTF...................
Q6GPK4_XENLA/34-333QLRFVTLVYRHGD-----------RS------------------------------PVHGYPADVHKES...........
Q6CLW3_KLULA/69-406IIEQVQMIARHAE-----------RF------------------------------PKAAKGEKLEIMWNKFKE......
Q95WU2_GIAIN/15-344ELKRVQVVTRHGA-----------RT------------------------------TLNPFPAETEDWICDGIGTIAF..
PHO11_CAEEL/25-364KLEFVQAMWRHGE-----------RA------------------------------SQVDQYPIYEKDWI..........
Q8GD20_PSESX/30-365VLDKVVQVSRHGV-----------RP------------------------------PTDTP...................
Q8PPX6_XANAC/29-351HLRLTIVLVRHGI-----------RA------------------------------PTQPGS..................
PPA5_YEAST/65-399EMKQLQMVGRHGE-----------RY------------------------------PTVSLAKTIKSTWYKLSN......
Q9GNT0_9TRYP/33-338TLHLVQLVHRHGA-----------RY------------------------------PLVPHN....ATEI..........
Q7YWJ0_MELIC/28-378ELVLVQALWRHGD-----------RS------------------------------PTKTFKTDKYQEK...........
PPA4_SCHPO/25-385QLKYLQVIFRHGE-----------RA------------------------------PVKERLGSAGIPKDWKLCNNARRF
Q19460_CAEEL/78-372SLLFTQVIFRHGA-----------RA------------------------------PGNEKQTDTK..............
PHYA_THIHE/65-447EVTFAQVLSRHGA-----------RA------------------------------PTLKRAASYVDLIDRIHH......
Q8P330_XANCP/64-389TLERVVVVFRHGV-----------RA------------------------------PLQGEA..................
PPA1_SCHPO/59-395KIKQVHTLQRHGS-----------RN------------------------------PTGGNAAFDAVGIANFQQR.....
ACP1_CAEEL/19-323QLISVHVIFRHGA-----------RA------------------------------PVLNVTSEEAKS............
Q6TAQ8_9ENTR/42-388QLEKVVILSRHGV-----------RA------------------------------PTKMTQ..................
Q6NY36_DANRE/54-394RAIHMVSVIRHGT-----------RY------------------------------PTTKNVRKIAQLFDLVKSDSL...
Q25327_LEIME/33-349KVELVQVVHRHGA-----------RS------------------------------PLVDDNHTLICGT...........
PHYA_ASPOR/71-426QVTFAQVLSRHGA-----------RY------------------------------PTKSKSEKYAKLIKAVQH......
Q96VF5_TRAPU/64-400QINQVHIIQRHGA-----------RF------------------------------PTSGAAKRIQTAVAKLKA......
PPAP_HUMAN/34-332ELKFVTLVFRHGD-----------RS------------------------------PIDTFPTDPIKES...........
O00096_TALTH/69-423KITFVQLLSRHGA-----------RY------------------------------PTSSKTELYSQLISRIQK......
Q6CSM6_KLULA/63-401ELKQVQLLARHGE-----------RY------------------------------PSKSKGAKLSNVYQKLQN......
Q6CCS5_YARLI/180-538TLRQAHVLHRHGE-----------RY------------------------------PTDGAADNMVAFADKLKSS.....
Q19076_CAEEL/26-371DLVFVQTLWRHGD-----------RS------------------------------PTKTF...................
Q9VW00_DROME/55-355TLKLVHVLFRHGP-----------RT------------------------------PVSTYPNDPYINET..........
O74677_PICAN/61-383EIEQAQLFMRHGE-----------RF------------------------------PTKSSGKQYKKFYDKLKKANIT..
Q96VT0_9AGAR/59-411KITQVNIIQRHGA-----------RF------------------------------PTSGAGTRIQAAVKKLQS......
PHO5_CAEEL/30-322TLEYVHTVWRHGD-----------RT------------------------------P.......................
Q9VD68_DROME/41-345NLRMISILFRHGA-----------KN------------------------------PSGFYPLDPHAAH...........
ACPL2_HUMAN/87-424KLVSVHVFIRHGD-----------RY------------------------------PLYVIPKTKRPEIDCTLVANRKPY
Q84TX6_ORYSJ/68-441RVIHLNLVARHGT-----------RA------------------------------PTKKRIKELDRLAVRLKALIDEA.
Q8VQS2_KLEPN/30-355QLEKVVELSRHGI-----------RP------------------------------PTPATGKPSRPPPRTVD.......
Q84WW3_ARATH/362-953ELRCVIAIVRHGD-----------RT------------------------------PKQKVKLKVTEEKLLNLMLKYNGG
Q57QN8_SALCH/30-362QLQQVLMMSRHNL-----------RA------------------------------PLANNGS.................
Q9VW01_DROME/61-361TLELVHIVFRHGI-----------RT------------------------------PVDTYP..................
Q8X1W7_MONPU/76-407SVDQVIMIMRHGE-----------RY------------------------------PSPDLGASIEAALAKIKSS.....
PPA2_SCHPO/59-405AIKQVHLLQRHGS-----------RN------------------------------PTGDDTATDVSSAQYIDIFQN...
VIP1_SCHPO/387-861RLKSLVGVLRHAD-----------RT------------------------------PKQKFKFSFTSDPFVKLLQGHTEE
PPA3_SCHPO/59-405EIQQVHLLQRHGS-----------RN------------------------------PTGDVTATDVYSSQYLNNFQE...
PPAT_HUMAN/31-338PLVFVALVFRHGD-----------RA------------------------------PLASYPMDPHKEVAST........
Q7WSY1_RAOTE/31-357QLEKVVELSRHGI-----------RP------------------------------PTAGNNE.................
Q25332_LEIME/26-334VVRMVQVVHRHGA-----------RS------------------------------ALIDDNTTEICGT...........
AGP_PRORE/32-365VLDQVLVLSRHNL-----------RT------------------------------PIVNTG..................
Q96VK8_9APHY/60-397EINQVNIIQRHGA-----------RF------------------------------PTSGAATRIKAGLSKLQS......

PF00300

Q7QC58_ANOGA/471-664----KVYVMRHGE...........RIDFTFGSWVPYCFDEAGNYVRKDLNMPTSLPTR......KPSL............
Q6BI57_DEBHA/3-214----ELYFLRHGQ...........RID...........................HVIN.....K.EDKGIE.........
Q6C210_YARLI/6-172----LIILIRHGE...........SE..............................GN.....C.DKS............
Q6BIM7_DEBHA/15-162----RIFIIRHGQ...........TE..............................HN.....V.QKI............
Q6BJ83_DEBHA/95-281----LFFLARHGE...........GY..............................HN.....I.AGDGYPEKNWTC.YW
Q9WWA7_AGRRK/32-170----SFLFLRHGR...........TN..............................SN.....V.KGI............
TIGRB_DANRE/5-190----ALTIVRHGE...........TQ..............................YN.....R.DKL............
Q6C0R4_YARLI/4-173----TIYITRHGF...........RA.............................NWL.....T.DQPIP..........
Q7SB57_NEUCR/5-199----VIYVTRHGFRSNWLVDHTNGSYS...........................ST.........LRS............
PMGE_HUMAN/5-195----KLIMLRHGE...........GA..............................WN......KENR............
PMG2_YEAST/11-249----TLFLLRHGQ...........SE..............................LN......HENI............
Q7U5E4_SYNPX/4-170----RLLLVRHGL...........SS..............................FN......KERR............
Q8XP82_CLOPE/2-158----KIYFTRHGE...........TL..............................WN......LEHR............
Q6FCF7_ACIAD/10-173----TLF.TRHSL...........RE..............................L.......................
Q8DJJ5_THEEB/2-154----RLILIRHGE...........AV..............................GN......DSGV............
Q9F3Q7_STRCO/2-156----RLLLIRHGQ...........TP...............................S......N...............
Q720T2_LISMF/2-154----QLIFVRHGE...........TD..............................WN......VAKK............
Q7RS23_PLAYO/107-246----HIILVRHGQ...........YE......................................................
P96241_MYCTU/4-163----RLVLLRHGQ...........SY...............................G......N...............
Q883Y2_PSESM/2-110----KVWVLRHGE...........AQ...............................S......R...............
Q74HS5_LACJO/3-176----RIYIVRHGQ...........TY..............................IN......RYDK............
Q9CEU3_LACLA/2-155----RIYFVRHGK...........TE..............................WN......LARR............
Q87CY4_XYLFT/2-158----RILLARHGE...........TL..............................WN......AEGR............
Q8Y237_RALSO/16-171----HIVLVRHGE...........TD..............................WN......RERR............
GPMA_RHIEC/3-164----TLVIVRHGQ...........SE......................................................
Q8XXU8_RALSO/11-172----RIYLMRHGA...........VT..............................Y.......................
Q6N2V9_RHOPA/3-118----RLILLRHAK...........TE......................................................
Q6FQW7_CANGA/5-175----TVYIARHGY..........RANW............................IIGA...EVPPPPT...........
Q72JY3_THET2/2-111----ELYLIRHAI...........AL..............................P.......................
Q6E597_XENNE/2-159----RFFLVRHGQ...........TQ..............................AN......IDDV............
Q86HD1_DICDI/259-430----ELVLVRHGQ...........SE..............................GNEAQARSKRGD............
A9CJY0_AGRT5/2-161----LVYVIRHGQ...........TD..............................WN......AIRR............
Q8FUA9_COREF/10-122----RLVIMRHSK...........SS..............................W.......................
Q6ZG49_ORYSJ/77-245----EVVVVRHGE...........TA..............................WNASRIIQVPCSVPPAPSPIYFSE
Q6NEM7_CORDI/3-167----RLILMRHGR...........TF...............................A......N...............
Q87UC2_PSESM/3-156----HVRLIRHGE...........SA......................................................
O67797_AQUAE/3-157----KLIVVRHAE...........SE..............................WN......PIGR............
Q9AAW6_CAUCR/25-130----TVVIVRHGE...........KV..............................S.......................
Q8G0Q3_BRUSU/3-115----RLFLLRHAK...........AA..............................W........AKP............
PMU1_YEAST/55-227----LLILARHGQ...........GYHNAAIL..................RYGMEKWDAYWSLLSGDE............
Q6MNJ9_BDEBA/2-119----KIYVFRHAQ...........KA...............................M......D...............
Q8XLK3_CLOPE/2-156----IIYLIRHGK...........TY..............................CN......ENKL............
Q6BTP4_DEBHA/103-303----VLFLARHGEGWH.....NIASHKYPAEE..................WMKKWRFL......G...............
Q8PBP4_XANCP/19-193----RLWVVRHGQSAG.....NVARDV............................AESNGATLIDLEH............
O29260_ARCFU/2-108----RLYLMQHGK...........AK.......................................PKE............
Q7YTB0_BOMMO/111-267----KLAHRAGGK...........GG......................................................
Q8YLU6_NOSS1/32-195----RVILLRHGE...........ST..............................FN......ALGL............
Q6FRI4_CANGA/10-264----LIVLIRHGE...................................................................
Q6HKL4_BACHK/3-144----TIYFVRHAH...........ST......................................................
Q6AAY7_PROAC/6-160----TVHLLRHGE...........VD...............................N......PTGV............
AIS_ECOLI/55-165----VVVLFRHAERCD.....RSTNQ..............................C.......................
Q8G4E1_BIFLO/4-202----EVMMLRHGR...........TQ..............................YN......LEHR............
Q6BRZ2_DEBHA/5-194----KLIILRHGE...........SE..............................WN......HENR............
Q83FQ2_TROWT/180-278----TVILLRHAH...................................................................
Q6HBT6_BACHK/3-143----KIIVIRHCS...................................................................
Q83MP8_TROWT/3-153----MIHLVRHAQ...........VN...............................N......PTGI............
Q726G1_DESVH/226-380----NLYLVRHGE...........TT..............................YN......VEGR............
Q8DRP1_STRR6/23-174----KIIFVRHGE...........PDY............................REL......E...............
Q74L50_LACJO/4-181----EVYLVRHGE...........TM..............................FN......QLNK............
Q6MP54_BDEBA/2-119----ELIIIRHAV...........AE...............................DKEEFAKKGQE............
Q6C302_YARLI/61-286----VLFLARHGQ...........GVHNLVMAQ................YGREWWEKEGMNAQYSNGEY...........
Q6GB32_STAAS/4-153----TLYLMRHGQ...........TL..............................FN......FKGL............
Q7XSW9_ORYSJ/19-188----RYWILRHGR...........SV...............................PNERGIIVSSL............
Q72VE8_LEPIC/2-114----KIIIARHGE...........AE.......................................TTS............
Q98MW8_RHILO/4-147----RLTMICNGA...........TA...............................A......T...............
Q8CPX4_STAES/10-160----TLYLMRHGQ...........TV..............................FN......LKGK............
Q9CEX0_LACLA/3-144----EVYFIRHSL...........RD...............................N......A...............
Q9RWR4_DEIRA/2-154----NLTLLRHGR...........SR...............................A......D...............
Q6HJQ4_BACHK/2-150----QILLIRHGE...........SEA...........................DILN......V...............
P73454_SYNY3/4-160----KLYFLRHAQ...........TA..............................YS......A...............
Q7P7V2_FUSNV/2-159----EIYFVRHGQ...........TI..............................WN......VEKR............
Q6BZ00_DEBHA/5-181----TIYIARHGY..........RANW............................LPP......P...............
Q9BL94_CAEEL/8-173----KIWIVRHAE...........RE..............................DN......I...............
Q8YSV8_NOSS1/4-164----IVWIARHANRLD.....FVNPDW............................FLT......A...............
COBC_SALTY/2-156----RLWLVRHGE...........TE..............................AN......VAGL............
Q86BN5_DROME/6-194----RLVILRHGE...........SD..............................FN......IENK............
YA03_SCHPO/8-174----TVYLIRHGQ...........AQ...............................H......N...............
Q6HJT5_BACHK/4-158----TVYVTRHGE...........TE..............................WN......VAKR............
Y2622_SYNP2/2-116----ELYFFRHGI...................................................................
Q8P6B2_XANCP/4-152----QITLLRHGD...........TG.......................................QRS............
Q74JW8_LACJO/2-163----QLYFVRHGK...........TK..............................WN.....LEGRY............
Q82LG3_STRAW/4-147----RVTLISPAM...........NR...............................S......L...R...........
Q74A29_GEOSL/2-115----KLLVVRHAE...........AV...............................E......R.AP............
Q8RA82_THETN/4-158----RLYIARHGQ...........SK..............................WN......LESR............
Q82W48_NITEU/2-106----DLILWRHAE...........AE.......................................DGI............
Q7BKI0_PRB01/3-117----QIYLLRHAQ...........SD..............................W........ESS............
Q722Z4_LISMF/8-186----VIYLTRHGK...........TI..............................LN......TLDR............
Q7VY96_BORPE/3-161----EIWFIRHGE...........TD..............................WN......RQRR............
Q6BUK7_DEBHA/10-192----RVIFIRHGQ...........TE.............................WS.......................
Q6LIL4_PHOPR/7-157----RIDILRHGL...........PE..............................G........DGC............
Q7S800_NEUCR/250-403----TTFFVRAGP...........AE......................................GEEF............
Q6NJJ1_CORDI/5-157----IVHLVRHGE...........VH...............................N......PERI............
Q8DRV1_STRMU/2-148----KFYIIRHAK...........VNM............................RWP......K...K...........
Q9FNJ9_ARATH/49-203----RVVLVRHGQ...........ST..............................WN......EEGR............
Q98M20_RHILO/3-114----RLYLLRHAK...........AG..............................W........ALP............
Q6SGN8_9BACT/3-117----TLHLMRHAK...........SA..............................WN......QPEL............
PHOE_BACSU/3-146----AVCLVRHGE...........TD..............................WN......LQQK............
P72649_SYNY3/132-291----RLLLIRHGE...........TQ..............................WN......REGR............
Q8G5U1_BIFLO/6-177----DLYVIRHGE...........SE................................ANVIVQAGEQ............
Q93CQ7_LACSK/5-178----TLYLVRHGQ...........TF..............................FN......RYNR............
Q6KZ44_PICTO/3-140----YVILVRHGE...........SM...............................T......N...............
O04035_ARATH/11-189----RIILMRHGE...................................................................
A8B7W8_GIAIC/5-160----HIYLVRHGE...........TDF............................NTD......PEPR............
Q6PY96_9TRYP/451-652----PIYFVRNGM...........SV..............................YH......CEDR............
O06240_MYCTU/2-159----TVILLRHAR...........ST..............................SN......TAGV............
Q82LK1_STRAW/3-156----DLLLVRHGE...........TE..............................WS......VSGR............
Q8K620_STRP3/5-182----RLYIARHGK...........TM..............................FN......TIGR............
O69483_MYCLE/173-327----RLLLLRHGQ...........TE..............................LS......VQRR............
Q73U87_MYCPA/36-190----TVTFVRHAQ...........SE...............................A......N...............
Q89WM0_BRAJA/39-171----YVLIFRHTA...........TD.............................DSQKDVYPFRFDD............
Q7MLF0_VIBVY/2-151----EVILLRHGK...........TA......................................AEAG............
A9CJ67_AGRT5/8-120----RVYLLRHAK...........AA..............................W........AAP............
Q6CHK2_YARLI/4-192----QIFIVRHTTRQD.....TVQSNW............................AET......A...............
Q7NMJ4_GLOVI/2-158----RVVLVRHGQ...........ST..............................WN......AQGL............
GPMA_CAUCR/3-186----TLVLLRHGQ...........SQ..............................WN......LENR............
Q82HM5_STRAW/8-150----FLYLARHGE...................................................................
Q92PF7_RHIME/10-122----QLLLLRHAR...........SG.............................WA.......................
SIXA_HAEIN/2-122----NIFIMRHGE...........AE......................................................
GPMA2_LACJO/7-189----KLVLVRHGESVA.....NRDNV......................................................
Q6AJL1_DESPS/3-117----TLYLIRHGK...........SS..............................W........LDL............
Q7MUJ7_PORGI/236-394----VIYLVRHAE...........TE...............................EN....SDGDR............
Q746P6_THET2/2-140----ELWLVRHGE...........TL..............................WN......REGR............
Q97MM8_CLOAB/5-183----TFYFMRHGE...........TI..............................IN......RAGR............
O67630_AQUAE/20-173----KIYLIRHAQ...........SE..............................YN......EKGI............
Q721Q6_LISMF/6-181----SLYFVRHGQ...........TY..............................LN......KNLR............
PGAM5_DROME/88-228----HIILVRHGE...........YL......................................................
Q826X4_STRAW/13-125----RLVVLRHAK...........SA..............................W.......................
Q94BY1_ARATH/44-166----RLILLRHAH...........SS..............................W........DDL............
Q6M6A8_CORGL/20-172----VVLLIRHGQ...........TP...............................T......TGQV............
Q897L7_CLOTE/2-155----NIYLVRHGE...........TE..............................KN......TLKK............
Q6A9K1_PROAC/2-175----HLLLIRHGQ...........SE..............................NNAFATQSVETY............
Q8G704_BIFLO/5-171----TIHFVRHGK...........VY...............................NPDHLLYE...............
Q72U60_LEPIC/3-113----IIHLIRHGQ...........AN......................................................
Q7UQ84_RHOBA/2-196----QLLLVRHAE...........SE...............................N......N...............
Q72H77_THET2/3-155----EIWYVRHGE...........TE..............................WN......AQRR............
Q92L77_RHIME/11-123----RLMLLRHAK...........SA..............................W.......................
Q748J5_GEOSL/23-177----RIYLIRHGEVEG.....AGVPR......................................................
Q6AAP8_PROAC/49-201----RIVIVRHGQ...........ST..............................WN......RQGR............
Q6GC97_STAAS/2-167----TIYLVRHGE...........SK...............................SNYDNKHFRSY............
Q82ZR6_ENTFA/1-148----MLYVVRHGE...........TD..............................YN......VARR............
Q72G92_THET2/16-169----TLLLTRAGP...........VE...............................N......PRHV............
O68088_RHOCA/12-153----ELWLIRHAP...........AR..............................H........EGR............
Q74HK6_LACJO/2-158----DLLLVRHGV...........SE..............................HN......TSDV............
Q9KEW3_BACHD/2-150----KIGLLRHFK.............V............................TRGYPNRLVTSDE............
Q6ALU2_DESPS/17-166----KIYFLRHGH...........TP......................................................
Q9A6W6_CAUCR/3-145----IVHVIRHGR...........PA...............................S......T...............
Q7V6P3_PROMM/5-151----QLWIIRHGA...........TE..............................WA......LQGR............
Q22323_CAEEL/5-201----RVFIIRHGERCD.....FAFGKSG.........................LWINSFDSRGRYRPLDINLP.......
Q75FR3_LEPIC/10-168----VIYVFRHGE...........TD..............................WN......REGR............
Q8G5W7_BIFLO/22-200----HLHLVRHGQ...........TY..............................FN......RYNR............
Q9X194_THEMA/2-156----KLYLIRHGE...........TI..............................WN......EKGL............
Q82CU3_STRAW/4-153----RILLARHGQ...........TE..............................WS......LLGK............
Q756M6_ASHGO/9-242----KLFLLRHGE...........SE..............................LN......HAKI............
Q97JA1_CLOAB/3-152----RITLVRHGE...........TD..............................SN......RNKK............
Q72BT4_DESVH/21-170----AVILLRHAA...........TT...............................G......GEGR............
Q723D3_LISMF/42-225----TFYVVRHGK...........TM..............................LN......TTDR............
Y525_MYCTU/6-158----QVHVVRHGE...........VH...............................N......PTGI............
O24559_MAIZE/141-292----PILLTRHGE...........SL..............................HN......VRGR............
YL345_YEAST/293-466----CVYFARCGT...........SD.......................................KDN............
Q8DIP9_THEEB/22-190----RVIIVRHGE...........ST..............................FN......VQER............
Q8EIT5_SHEON/52-156----LIILVRHAE...........KA...............................D......A...............
Q724D7_LISMF/7-163----TIYFVRHGK...........TE..............................WN......MTGQ............
Q7P810_FUSNV/3-153----KLILVRHGQ...........TE..............................MN......AQSL............
Q829E2_STRAW/8-119----RIVLFRHAK...........AD..............................W.......................
Q9RXN2_DEIRA/7-157----TLLLVRHGA...........TA..............................WN......EGGQ............
Q7UH13_RHOBA/12-156----QIYLARHGE...........TP..............................WT......ITGQ............
Q72M33_LEPIC/2-151----ELYLIRHTT...........PEI............................PKG......I...............
F263_RAT/248-395----TIYLCRHGE...........NE..............................YN......V...Q...........
Q7MBR9_VIBVY/3-157----QFFILRHGQ...........TL..............................FN......AEQK............
Q6AME6_DESPS/37-191----DFFLLRHGE...........TE..............................WN......REKR............
Q9RSI0_DEIRA/4-149----TLHLIKHGQ...........PT..............................LV......PDVP............
GPMA1_GLOVI/3-191----HLILIRHGQ...........SL..............................WN......AANK............
Q8LE79_ARATH/14-208----NIFVMRHGDRID.....NFKPLW............................VST......A...............
Q74HK7_LACJO/2-158----RVVILRHGT...........TE..............................LN......KQGM............
Q876B1_SACEX/5-177----NIYIARHAY...........STS...........................WLPK......D...............
YQGD_SCHPO/55-208----TCLLVRHAE...........SE...............................H......N...............
YFFL_SCHPO/2-149----KVFLIRHGQ...........TD..............................QN......KRGI............
Q970Q5_SULTO/3-117----SLIIVRHGD...........AE...............................P......Q...............
Q7WY90_MYXXA/7-116----PLLFIRHAV...........AE..............................DS......H...............
Q8EQG8_OCEIH/3-144----RIYFIRHCS...................................................................
Q7MWC4_PORGI/2-148----QITLIRHTT...........PDV............................PAG......I...............
6P21_YEAST/398-572----QIWITRSGE...........SE...............................D.....NVSGR............
Q82C73_STRAW/18-172----RVILWRHGQ...........TS..............................WN......VERR............
Q87HE6_VIBPA/2-157----DIIFVRHGV...........PD..............................FS......L...............
UBS3A_HUMAN/397-595----SVLVVRHGERVD.....QIFGKA...........................WLQQCSTPDGKYYRPDLNF.......
Q97ET5_CLOAB/4-158----TVLLVRHGE...........TE..............................WN......VQGR............
Q8YRV4_NOSS1/3-172----RVIIVRHGQ...........ST..............................YN.....IERRIQ...........
Q88KP7_PSEPK/26-164----RLTLICHAL...........TQ...............................A......Q...............
Q752M0_ASHGO/18-169----RLFVIRHGQ...........TD..............................EN......VNKI............
GPMA_BLOFL/5-191----KTVLIRHGE...........SQ..............................WN......KDNR............
Q6FD82_ACIAD/1-156----MIYLIRHAQ...........SM...............................A......N...............
Q6HEN0_BACHK/5-149----EICLVRHGQ...........TD..............................WN......FQEI............
Q878F8_STRPQ/2-160----KLYFVRHGK...........TL..............................WN.....LEGRFQ...........
Q87Q43_VIBPA/5-154----NIYLMRHGK...........VD...............................AA....PG...............
Q9FYE8_ARATH/21-178----EIVLVRHGE...........TT..............................WN......AAGR............
PGAM5_XENTR/89-226----HIFLIRHSQ...........YK......................................................
YNK8_YEAST/5-175----NIYIARHGY..........RSNW............................LPK......G...............
Q7MA12_WOLSU/5-120----RIVLVRHAK..........AMD......................................................
Q9ZAX0_AMYME/2-161----KLYLVRHGQ...........TA...............................S......N...............
Q9KCH8_BACHD/6-157----DILLIRHSL...........TV..............................CN......EQKR............
YKJ2_SCHPO/9-173----TIYFVRHGQ...........VS......................................................
Q8XWS5_RALSO/2-152----DIILIRHAR...........PAM............................AAG......L...............
Q7VGN6_HELHP/3-123----TITLLRHAD...........TI...............................SREEYRLNNKK............
Q9CN14_PASMU/5-159----TFYLIRHGK...........TE..............................WN......EKRL............
Y400_SYNY3/2-117----ELYLIRHGIAQE.....QSPDI......................................................
Q8DJF9_THEEB/5-120----TVFFFRHGIAV.......ERET......................................................
Q6HFU7_BACHK/12-186----TLYVTRHGK...........TI..............................LN......TNHR............
Q6N4Q1_RHOPA/27-181----RWWWVRHAP...........VR...............................S......DGGN............
Q6LTK1_PHOPR/2-117----RIFIMRHGE...........AQ...............................N......F...............
Q6CVE6_KLULA/56-257----LLVLARHGQ...........GH..............................HNAL.ESKYGTQEWER........
Q930B9_RHIME/3-151----RIILVRHGE...........SA..............................WN......SVRR............
Q6KZ21_PICTO/2-149----RAILIRHGE...........SD..............................IN......IAGL............
Q828M5_STRAW/15-174----TLILVRHGR.............S............................TAN......TAGL............
UBS3B_MOUSE/374-572----CLFVCRHGERMD.....VVFGK.............................YWLSQ.CFDAKGRYIRTNLNMPHSL
GPMA_METMA/6-194----HLILVRHGE...........PG..............................LK......PGER............
Q8G5N9_BIFLO/7-171----SVFLIRHGR...........TS..............................YN......AAHK............
PGAM5_CAEEL/96-232----NIFLIRHGQ...........................................Y.......................
Q6MWZ7_MYCTU/7-154----RLLLLRHGE...........TA..............................WS......TLGR............
Q7V2G5_PROMP/228-384----RIFLIRHGE...........TN..............................WN......KEGR............
Q8GWG7_ARATH/18-200----TLHLVRHAQ............................................GVHNIALEEKG............
Q8DU47_STRMU/4-153----TLYLMRHGE...........TL..............................FN......TQKR............
Q6MA06_PARUW/9-167----DIYLIRHGE...........TD..............................WN......MLGK............
Q722Z3_LISMF/7-184----NVYLVRHGK...........TM..............................FN......TSRR............
YO283_YEAST/18-173----RLFIIRHGQ...........TE..............................HN......VKKI............
Q7XTB5_ORYSJ/18-214----TIYLVRHAQ...........GV...............................H......N...............
Q73JH0_TREDE/2-153----KLFVVRHGE...........TD..............................WN......SKML............
Q6HF65_BACHK/4-150----YIYMVRHGE...........SP...............................K......L...............
Q830V5_ENTFA/2-160----KLYFTRHGK...........TE..............................WN.....QQKRFQ...........
Q9A8K2_CAUCR/1-157----MIYLCRHGQ...........TF..............................HN......REGR............
GPMA_BORBU/3-189----KLVLVRHGE...........SE..............................WN......KENL............
Q8TLM8_METAC/12-167----NVITIQHTQ...........SV..............................HH......TNGM............
Q890L1_CLOTE/6-160----TLYITRHGQ...........TE..............................WN......TERR............
Q9KSL6_VIBCH/3-151----RIWLLRHGK...........TQ...............................GP....AA...............
Q74L54_LACJO/3-97----TVYFVRHAE...........PD......................................................
Q9KG30_BACHD/3-141----SIYVIRHCE...................................................................
Q9CEL7_LACLA/2-151----KLYLVRHGE...........TQ..............................NN......QQNL............
Q8IG34_CAEEL/84-241----RLPIQRPLK............D......................................................
Q885W5_PSESM/4-154----RLDLLRHGE...........TE..............................L........GGG............
Q8EI22_SHEON/5-200----RLLLLRHGE...........CE..............................G........GAI............
GPMA1_NITEU/9-195----RLVLLRHGQ...........SI..............................WN......QDRH............
Q89HY2_BRAJA/10-128----RLMLLRHAK...........TE......................................................
Q73K38_TREDE/2-150----KIVLIRHGI...........TV..............................TN......KKRI............
O69984_STRCO/6-166----RIVLVRHGE...................................................................
Q6FCM2_ACIAD/2-111----QLTLVRHGE...........AS...............................P......A...............
SHB17_YEAST/7-183----RCIIVRHGQ...........TE..............................WS......KSGQ............
Q6C9Q2_YARLI/4-181----RVIFVRHGE...........TE......................................................
Q8KG77_CHLTE/3-117----TLYLVRHAK...........AG..............................W........KDP............
Q7NLX7_GLOVI/47-172----YVLFWRHPK...........TD..............................P.......................
Q7MTE1_PORGI/2-150----KIYLMRHTS...........VLF............................NGN......EHCY............
Q8Z077_NOSS1/2-117----ELYLIRHGI...........AE...............................A......Q...............
GPMB_SHIFL/3-157----QVYLVRHGE...........TQ..............................WN......AERR............
Q745R9_MYCPA/2-150----QVLLVRHAL...........PLR............................SEH......G...............
Q743X7_MYCPA/6-146----RLTLVSHGM...................................................................
Q9AAS0_CAUCR/3-115----RLILMRHGK...........AE..............................R........HAQ............
Q6C8W1_YARLI/9-209----RIILVRHGQ...........TD..............................HN......KAGI............
Q79VT0_SALTM/49-158----VIFLFRHGE...................................................................
Q97AR8_THEVO/3-140----RAILVRHGE...........SE...............................T......N...............
Q92WT9_RHIME/4-157----TFLLVRHAA...........HD...............................R......VGCF............
Q97AG4_THEVO/21-171----KVYLVRHAK...........TI..............................MN......YTNR............
Q7NT51_CHRVO/7-162----RFCLVRHGE...........TD..............................WN......REYR............
Q7VNP3_HAEDU/2-126----NIWIMRHGE...........AS......................................................
GPMA_CHLTR/3-186----LLILLRHGQ...........SVW............................NQK.....NL...............
Q6NB37_RHOPA/6-148----RLWLVRHAP...........VD..............................G.......................
Q9RRC8_DEIRA/41-217----NLLLIRHAQ...........ST...............................NNLLYAQTGG.............
Q9RVD2_DEIRA/22-177----RLILVRHGQ...........TA..............................HN......RERR............
Y2419_MYCTU/5-166----RLVMLRHGQ...........TD..............................YN......VGSR............
A9CKF0_AGRT5/3-149----ALYITHPQV...........KID............................PAV......P...............

PF00328

Q9BL40_CAEEL/16-290.........................................................................LDEFNVA
PPA6_HUMAN/49-379Q..........................................................FDYTVTNLAGGPKPYSPYDSQ
PHYA_ASPFU/71-425..................................................................NATDFKGKFAFLKT
VIP1_CAEEL/363-914KKHEIKMKKPNQLMEVLELARALVIEKQRDRHQILEKLREGTGEEEIHKSEHDLEVCEEEMKKWEQMRTVLEMYGHFSGI
Q22525_CAEEL/28-375...................................................................HNDQFTENYWM..
Q6BUR8_DEBHA/63-396..................................................................YNGTFKGQLSFLND
VIP1_HUMAN/390-910KTGKLKLKRPEQLQEVLDI......................TRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMYGHFSGI
P90949_CAEEL/21-327...................................................................LHLPYPNDQYTEK
PPAX_CAEEL/28-365.....................................................................FPISEKNWT..
Q6BWV9_DEBHA/521-1079VIIRDVPDLQVVL..................................ETVKIAEEKKLEDLKKLKQLRGALEKKMDFPGT
VIP2_HUMAN/379-894KSGKLKLKKPKQLQEVLDI......................ARQLLMELGQNNDSEIEENKPKLEQLKTVLEMYGHFSGI
VIP1_DROME/402-926KLGHVKLKRPKQLQEILDI......................ARFLLSEIHTKAHAEIEEKESKLEQLKNVLEMYGHFSGI
PHYB_EMENI/70-422..................................................................NATSFWGQYAFLES
Q7SEH2_NEUCR/194-548..................................................................GKFNATGELEFLNN
Q7S8D6_NEUCR/949-1549VLLIGEPALASVL..................................DAVDVALKAGIEDPVKLKSLRNVLVKKGGWAGT
ACPL2_DANRE/88-449H..........................................................PLLASFISHMALGGRGHWDAS
Q9U5U6_DROSU/56-354................................................................................
PPA_ECOLI/29-375...................................................................LMQDVTPDAWP..
Q6BM75_DEBHA/63-397..................................................................YNGTFKGELSFLND
PHYA1_ASPTE/72-427..................................................................SATAFPGKYAFLQS
A8BDL2_GIAIC/21-353..............................................................AYASEGIMQEIGKGFLHL
PPAD_YEAST/66-400..................................................................YTGKYEGSLSFLNN
Q6CZF4_ERWCT/34-372...................................................................ALESGTARQWP..
Q96VH9_9HOMO/61-394..................................................................ARPFTDPKYEFLND
Q19390_CAEEL/17-320.......................................................................GHYLYFPGD
VIP1_YEAST/538-1047VVIRNVNDLKIVL..................................QALRIALDEKAGNPAKIKVLANALEKKLNFPGT
O93838_ASPNG/72-427..................................................................NATTFEGKYAFLKT
Q6FJ21_CANGA/510-1016VVIRKVNDLKIVL..................................QALRIALEEKAGNPTKIKLLANTLEKKLELPGT
PHYB_ASPNG/72-404...............................................................EYKGDLAFLN..DWTYY
PPA1_PICPA/74-409..................................................................DVEVPTGPLSFFQD
Q8PF53_XANAC/34-377...................................................................RLGRYSLHPWP..
Q6CYI2_KLULA/67-401..................................................................FQGQFDGPLEIFND
Q6CWN2_KLULA/534-1048VVIRNINDLQIVL..................................QALKIAQEENAEDPAKLAVLANALEKKISFPGT
Q6CES1_YARLI/413-907VLYREKDRLMEVLE.................................TTRRATREATDEDPQKMANLIIALEKKMDFPGT
Q6AVJ1_ORYSJ/361-950KPRAETKLKSAVQLQDLLDATR.................QLVPPTRSGRESDSDAEDLEHIEKLRQVKAVLEEGGHFSGI
Q8SQJ1_ENCCU/48-332...................................................................RCSFDNGTILNCE
Q90XY1_TAKRU/74-416...................................................................KSSAVGRESWLQE
O17373_CAEEL/52-377................................................................................
Q757D1_ASHGO/560-1065VVIRNVSDLQIVL..................................QALRIAMEEGVEDPNKLEVLANALEKKLNFPGT
Q9APF7_LEGPN/24-324................................................................................
Q8MY06_DROVI/44-342........................................................................PTDPWNNR
Q9GUF1_CAEEL/33-333..........................................................................DEYLN.
Q9AAQ4_CAUCR/24-359...................................................................RLEEASARPWP..
Q6YNE9_PENOX/62-418..................................................................NATAYNGQSVFLRA
PPAL_HUMAN/32-330................................................................................
Q8I0P9_DROME/64-362........................................................................PTDPWGDR
PPA6_MOUSE/42-371...................................................................EIPPQTRFDYTVT
Q19175_CAEEL/28-376...................................................................NVDPFQEDSWT..
Q6GPK4_XENLA/34-333................................................................................
Q6CLW3_KLULA/69-406..................................................................MKGEFKGPLAIFNE
Q95WU2_GIAIN/15-344...............................................................STLQAGSTAHTKHFLAV
PHO11_CAEEL/25-364................................................................................
Q8GD20_PSESX/30-365...................................................................KLAKVTGRELP..
Q8PPX6_XANAC/29-351...................................................................ELDRYSAQPWP..
PPA5_YEAST/65-399..................................................................YTRQFNGSLSFLND
Q9GNT0_9TRYP/33-338................................................................................
Q7YWJ0_MELIC/28-378................................................................................
PPA4_SCHPO/25-385FA........................................................QIKGEKEWSVLGFERKVESPVD
Q19460_CAEEL/78-372................................................................................
PHYA_THIHE/65-447..................................................................GAISYGPGYEFLRT
Q8P330_XANCP/64-389...................................................................AAAHYADAPWP..
PPA1_SCHPO/59-395.................................................................LLNGSVPIDYSVSGN
ACP1_CAEEL/19-323................................................................................
Q6TAQ8_9ENTR/42-388...................................................................TMRDVTPNTWP..
Q6NY36_DANRE/54-394................................................................RSASSWLNDLKTWK..
Q25327_LEIME/33-349................................................................................
PHYA_ASPOR/71-426..................................................................NATSFSGKYAFLKS
Q96VF5_TRAPU/64-400..................................................................ASNYTDPLLAFVTN
PPAP_HUMAN/34-332................................................................................
O00096_TALTH/69-423..................................................................TATAYKGYYAFLKD
Q6CSM6_KLULA/63-401..................................................................YTGALNGSLSFLND
Q6CCS5_YARLI/180-538..................................................................INNQTDEMFAWVD.
Q19076_CAEEL/26-371...................................................................KTDPFQEDAWQ..
Q9VW00_DROME/55-355................................................................................
O74677_PICAN/61-383...............................................................DYKGPLAFIEDLEYFV.
Q96VT0_9AGAR/59-411..................................................................AKTYTDPRLDFLTN
PHO5_CAEEL/30-322....................................................................AELLFPDDIT..
Q9VD68_DROME/41-345................................................................................
ACPL2_HUMAN/87-424H..........................................................PKLEAFISHMSKGSGASFESP
Q84TX6_ORYSJ/68-441..............................................................KQGPESDSLKKIPSWMK.
Q8VQS2_KLEPN/30-355...................................................................RVDHPCRGAHR..
Q84WW3_ARATH/362-953KPRAETKLKTAVQLQDLLDAT..................RMLIPRARSGESDSDAEDLEHADKLRQVKAVLEEGGHFSGI
Q57QN8_SALCH/30-362...................................................................VLAQSTPNAWP..
Q9VW01_DROME/61-361.........................................................................KDPYLND
Q8X1W7_MONPU/76-407..................................................................NVSTYQGDLDFLNS
PPA2_SCHPO/59-405................................................................KLLNGSIPVNFSYPEN
VIP1_SCHPO/387-861VILRNEQLNSVLA...................................ATNLATELKCEDINKLKQLRLALETKKDLPGT
PPA3_SCHPO/59-405................................................................KLLNGSIPVNFSYPEN
PPAT_HUMAN/31-338................................................................................
Q7WSY1_RAOTE/31-357...................................................................EIIAATGRPWT..
Q25332_LEIME/26-334................................................................................
AGP_PRORE/32-365...................................................................ILTEVTDKKWP..
Q96VK8_9APHY/60-397..................................................................VQNFTDPKFDFIKS

PF00300

Q7QC58_ANOGA/471-664.....---------------------------------------------------------------------------
Q6BI57_DEBHA/3-214...AI---------------------------------------------------------------------------
Q6C210_YARLI/6-172.....---------------------------------------------------------------------------
Q6BIM7_DEBHA/15-162.....---------------------------------------------------------------------------
Q6BJ83_DEBHA/95-281SIQDG---------------------------------------------------------------------------
Q9WWA7_AGRRK/32-170.....---------------------------------------------------------------------------
TIGRB_DANRE/5-190.....---------------------------------------------------------------------------
Q6C0R4_YARLI/4-173....P---------------------------------------------------------------------------
Q7SB57_NEUCR/5-199.....---------------------------------------------------------------------------
PMGE_HUMAN/5-195.....---------------------------------------------------------------------------
PMG2_YEAST/11-249.....---------------------------------------------------------------------------
Q7U5E4_SYNPX/4-170.....---------------------------------------------------------------------------
Q8XP82_CLOPE/2-158.....---------------------------------------------------------------------------
Q6FCF7_ACIAD/10-173.....---------------------------------------------------------------------------
Q8DJJ5_THEEB/2-154.....---------------------------------------------------------------------------
Q9F3Q7_STRCO/2-156.....---------------------------------------------------------------------------
Q720T2_LISMF/2-154.....---------------------------------------------------------------------------
Q7RS23_PLAYO/107-246.....---------------------------------------------------------------------------
P96241_MYCTU/4-163.....---------------------------------------------------------------------------
Q883Y2_PSESM/2-110.....---------------------------------------------------------------------------
Q74HS5_LACJO/3-176.....---------------------------------------------------------------------------
Q9CEU3_LACLA/2-155.....---------------------------------------------------------------------------
Q87CY4_XYLFT/2-158.....---------------------------------------------------------------------------
Q8Y237_RALSO/16-171.....---------------------------------------------------------------------------
GPMA_RHIEC/3-164.....---------------------------------------------------------------------------
Q8XXU8_RALSO/11-172.....---------------------------------------------------------------------------
Q6N2V9_RHOPA/3-118.....---------------------------------------------------------------------------
Q6FQW7_CANGA/5-175.....---------------------------------------------------------------------------
Q72JY3_THET2/2-111.....---------------------------------------------------------------------------
Q6E597_XENNE/2-159.....---------------------------------------------------------------------------
Q86HD1_DICDI/259-430.....---------------------------------------------------------------------------
A9CJY0_AGRT5/2-161.....---------------------------------------------------------------------------
Q8FUA9_COREF/10-122.....---------------------------------------------------------------------------
Q6ZG49_ORYSJ/77-245ALVFN---------------------------------------------------------------------------
Q6NEM7_CORDI/3-167.....---------------------------------------------------------------------------
Q87UC2_PSESM/3-156.....---------------------------------------------------------------------------
O67797_AQUAE/3-157.....---------------------------------------------------------------------------
Q9AAW6_CAUCR/25-130.....---------------------------------------------------------------------------
Q8G0Q3_BRUSU/3-115.....---------------------------------------------------------------------------
PMU1_YEAST/55-227.....---------------------------------------------------------------------------
Q6MNJ9_BDEBA/2-119.....---------------------------------------------------------------------------
Q8XLK3_CLOPE/2-156.....---------------------------------------------------------------------------
Q6BTP4_DEBHA/103-303.....---------------------------------------------------------------------------
Q8PBP4_XANCP/19-193.....---------------------------------------------------------------------------
O29260_ARCFU/2-108.....---------------------------------------------------------------------------
Q7YTB0_BOMMO/111-267.....---------------------------------------------------------------------------
Q8YLU6_NOSS1/32-195.....---------------------------------------------------------------------------
Q6FRI4_CANGA/10-264.....---------------------------------------------------------------------------
Q6HKL4_BACHK/3-144.....---------------------------------------------------------------------------
Q6AAY7_PROAC/6-160.....---------------------------------------------------------------------------
AIS_ECOLI/55-165.....---------------------------------------------------------------------------
Q8G4E1_BIFLO/4-202.....---------------------------------------------------------------------------
Q6BRZ2_DEBHA/5-194.....---------------------------------------------------------------------------
Q83FQ2_TROWT/180-278.....---------------------------------------------------------------------------
Q6HBT6_BACHK/3-143.....---------------------------------------------------------------------------
Q83MP8_TROWT/3-153.....---------------------------------------------------------------------------
Q726G1_DESVH/226-380.....---------------------------------------------------------------------------
Q8DRP1_STRR6/23-174.....---------------------------------------------------------------------------
Q74L50_LACJO/4-181.....---------------------------------------------------------------------------
Q6MP54_BDEBA/2-119.....---------------------------------------------------------------------------
Q6C302_YARLI/61-286.....---------------------------------------------------------------------------
Q6GB32_STAAS/4-153.....---------------------------------------------------------------------------
Q7XSW9_ORYSJ/19-188.....---------------------------------------------------------------------------
Q72VE8_LEPIC/2-114.....---------------------------------------------------------------------------
Q98MW8_RHILO/4-147.....---------------------------------------------------------------------------
Q8CPX4_STAES/10-160.....---------------------------------------------------------------------------
Q9CEX0_LACLA/3-144.....---------------------------------------------------------------------------
Q9RWR4_DEIRA/2-154.....---------------------------------------------------------------------------
Q6HJQ4_BACHK/2-150.....---------------------------------------------------------------------------
P73454_SYNY3/4-160.....---------------------------------------------------------------------------
Q7P7V2_FUSNV/2-159.....---------------------------------------------------------------------------
Q6BZ00_DEBHA/5-181.....---------------------------------------------------------------------------
Q9BL94_CAEEL/8-173.....---------------------------------------------------------------------------
Q8YSV8_NOSS1/4-164.....---------------------------------------------------------------------------
COBC_SALTY/2-156.....---------------------------------------------------------------------------
Q86BN5_DROME/6-194.....---------------------------------------------------------------------------
YA03_SCHPO/8-174.....---------------------------------------------------------------------------
Q6HJT5_BACHK/4-158.....---------------------------------------------------------------------------
Y2622_SYNP2/2-116.....---------------------------------------------------------------------------
Q8P6B2_XANCP/4-152.....---------------------------------------------------------------------------
Q74JW8_LACJO/2-163.....---------------------------------------------------------------------------
Q82LG3_STRAW/4-147.....---------------------------------------------------------------------------
Q74A29_GEOSL/2-115.....---------------------------------------------------------------------------
Q8RA82_THETN/4-158.....---------------------------------------------------------------------------
Q82W48_NITEU/2-106.....---------------------------------------------------------------------------
Q7BKI0_PRB01/3-117.....---------------------------------------------------------------------------
Q722Z4_LISMF/8-186.....---------------------------------------------------------------------------
Q7VY96_BORPE/3-161.....---------------------------------------------------------------------------
Q6BUK7_DEBHA/10-192.....---------------------------------------------------------------------------
Q6LIL4_PHOPR/7-157.....---------------------------------------------------------------------------
Q7S800_NEUCR/250-403.....---------------------------------------------------------------------------
Q6NJJ1_CORDI/5-157.....---------------------------------------------------------------------------
Q8DRV1_STRMU/2-148.....---------------------------------------------------------------------------
Q9FNJ9_ARATH/49-203.....---------------------------------------------------------------------------
Q98M20_RHILO/3-114.....---------------------------------------------------------------------------
Q6SGN8_9BACT/3-117.....---------------------------------------------------------------------------
PHOE_BACSU/3-146.....---------------------------------------------------------------------------
P72649_SYNY3/132-291.....---------------------------------------------------------------------------
Q8G5U1_BIFLO/6-177.....---------------------------------------------------------------------------
Q93CQ7_LACSK/5-178.....---------------------------------------------------------------------------
Q6KZ44_PICTO/3-140.....---------------------------------------------------------------------------
O04035_ARATH/11-189.....---------------------------------------------------------------------------
A8B7W8_GIAIC/5-160.....---------------------------------------------------------------------------
Q6PY96_9TRYP/451-652.....---------------------------------------------------------------------------
O06240_MYCTU/2-159.....---------------------------------------------------------------------------
Q82LK1_STRAW/3-156.....---------------------------------------------------------------------------
Q8K620_STRP3/5-182.....---------------------------------------------------------------------------
O69483_MYCLE/173-327.....---------------------------------------------------------------------------
Q73U87_MYCPA/36-190.....---------------------------------------------------------------------------
Q89WM0_BRAJA/39-171.....---------------------------------------------------------------------------
Q7MLF0_VIBVY/2-151.....---------------------------------------------------------------------------
A9CJ67_AGRT5/8-120.....---------------------------------------------------------------------------
Q6CHK2_YARLI/4-192.....---------------------------------------------------------------------------
Q7NMJ4_GLOVI/2-158.....---------------------------------------------------------------------------
GPMA_CAUCR/3-186.....---------------------------------------------------------------------------
Q82HM5_STRAW/8-150.....---------------------------------------------------------------------------
Q92PF7_RHIME/10-122.....---------------------------------------------------------------------------
SIXA_HAEIN/2-122.....---------------------------------------------------------------------------
GPMA2_LACJO/7-189.....---------------------------------------------------------------------------
Q6AJL1_DESPS/3-117.....---------------------------------------------------------------------------
Q7MUJ7_PORGI/236-394.....---------------------------------------------------------------------------
Q746P6_THET2/2-140.....---------------------------------------------------------------------------
Q97MM8_CLOAB/5-183.....---------------------------------------------------------------------------
O67630_AQUAE/20-173.....---------------------------------------------------------------------------
Q721Q6_LISMF/6-181.....---------------------------------------------------------------------------
PGAM5_DROME/88-228.....---------------------------------------------------------------------------
Q826X4_STRAW/13-125.....---------------------------------------------------------------------------
Q94BY1_ARATH/44-166.....---------------------------------------------------------------------------
Q6M6A8_CORGL/20-172.....---------------------------------------------------------------------------
Q897L7_CLOTE/2-155.....---------------------------------------------------------------------------
Q6A9K1_PROAC/2-175.....---------------------------------------------------------------------------
Q8G704_BIFLO/5-171.....---------------------------------------------------------------------------
Q72U60_LEPIC/3-113.....---------------------------------------------------------------------------
Q7UQ84_RHOBA/2-196.....---------------------------------------------------------------------------
Q72H77_THET2/3-155.....---------------------------------------------------------------------------
Q92L77_RHIME/11-123.....---------------------------------------------------------------------------
Q748J5_GEOSL/23-177.....---------------------------------------------------------------------------
Q6AAP8_PROAC/49-201.....---------------------------------------------------------------------------
Q6GC97_STAAS/2-167.....---------------------------------------------------------------------------
Q82ZR6_ENTFA/1-148.....---------------------------------------------------------------------------
Q72G92_THET2/16-169.....---------------------------------------------------------------------------
O68088_RHOCA/12-153.....---------------------------------------------------------------------------
Q74HK6_LACJO/2-158.....---------------------------------------------------------------------------
Q9KEW3_BACHD/2-150.....---------------------------------------------------------------------------
Q6ALU2_DESPS/17-166.....---------------------------------------------------------------------------
Q9A6W6_CAUCR/3-145.....---------------------------------------------------------------------------
Q7V6P3_PROMM/5-151.....---------------------------------------------------------------------------
Q22323_CAEEL/5-201.RTLP---------------------------------------------------------------------------
Q75FR3_LEPIC/10-168.....---------------------------------------------------------------------------
Q8G5W7_BIFLO/22-200.....---------------------------------------------------------------------------
Q9X194_THEMA/2-156.....---------------------------------------------------------------------------
Q82CU3_STRAW/4-153.....---------------------------------------------------------------------------
Q756M6_ASHGO/9-242.....---------------------------------------------------------------------------
Q97JA1_CLOAB/3-152.....---------------------------------------------------------------------------
Q72BT4_DESVH/21-170.....---------------------------------------------------------------------------
Q723D3_LISMF/42-225.....---------------------------------------------------------------------------
Y525_MYCTU/6-158.....---------------------------------------------------------------------------
O24559_MAIZE/141-292.....---------------------------------------------------------------------------
YL345_YEAST/293-466.....---------------------------------------------------------------------------
Q8DIP9_THEEB/22-190.....---------------------------------------------------------------------------
Q8EIT5_SHEON/52-156.....---------------------------------------------------------------------------
Q724D7_LISMF/7-163.....---------------------------------------------------------------------------
Q7P810_FUSNV/3-153.....---------------------------------------------------------------------------
Q829E2_STRAW/8-119.....---------------------------------------------------------------------------
Q9RXN2_DEIRA/7-157.....---------------------------------------------------------------------------
Q7UH13_RHOBA/12-156.....---------------------------------------------------------------------------
Q72M33_LEPIC/2-151.....---------------------------------------------------------------------------
F263_RAT/248-395.....---------------------------------------------------------------------------
Q7MBR9_VIBVY/3-157.....---------------------------------------------------------------------------
Q6AME6_DESPS/37-191.....---------------------------------------------------------------------------
Q9RSI0_DEIRA/4-149.....---------------------------------------------------------------------------
GPMA1_GLOVI/3-191.....---------------------------------------------------------------------------
Q8LE79_ARATH/14-208.....---------------------------------------------------------------------------
Q74HK7_LACJO/2-158.....---------------------------------------------------------------------------
Q876B1_SACEX/5-177.....---------------------------------------------------------------------------
YQGD_SCHPO/55-208.....---------------------------------------------------------------------------
YFFL_SCHPO/2-149.....---------------------------------------------------------------------------
Q970Q5_SULTO/3-117.....---------------------------------------------------------------------------
Q7WY90_MYXXA/7-116.....---------------------------------------------------------------------------
Q8EQG8_OCEIH/3-144.....---------------------------------------------------------------------------
Q7MWC4_PORGI/2-148.....---------------------------------------------------------------------------
6P21_YEAST/398-572.....---------------------------------------------------------------------------
Q82C73_STRAW/18-172.....---------------------------------------------------------------------------
Q87HE6_VIBPA/2-157.....---------------------------------------------------------------------------
UBS3A_HUMAN/397-595.PCSL---------------------------------------------------------------------------
Q97ET5_CLOAB/4-158.....---------------------------------------------------------------------------
Q8YRV4_NOSS1/3-172.....---------------------------------------------------------------------------
Q88KP7_PSEPK/26-164.....---------------------------------------------------------------------------
Q752M0_ASHGO/18-169.....---------------------------------------------------------------------------
GPMA_BLOFL/5-191.....---------------------------------------------------------------------------
Q6FD82_ACIAD/1-156.....---------------------------------------------------------------------------
Q6HEN0_BACHK/5-149.....---------------------------------------------------------------------------
Q878F8_STRPQ/2-160.....---------------------------------------------------------------------------
Q87Q43_VIBPA/5-154.....---------------------------------------------------------------------------
Q9FYE8_ARATH/21-178.....---------------------------------------------------------------------------
PGAM5_XENTR/89-226.....---------------------------------------------------------------------------
YNK8_YEAST/5-175.....---------------------------------------------------------------------------
Q7MA12_WOLSU/5-120.....---------------------------------------------------------------------------
Q9ZAX0_AMYME/2-161.....---------------------------------------------------------------------------
Q9KCH8_BACHD/6-157.....---------------------------------------------------------------------------
YKJ2_SCHPO/9-173.....---------------------------------------------------------------------------
Q8XWS5_RALSO/2-152.....---------------------------------------------------------------------------
Q7VGN6_HELHP/3-123.....---------------------------------------------------------------------------
Q9CN14_PASMU/5-159.....---------------------------------------------------------------------------
Y400_SYNY3/2-117.....---------------------------------------------------------------------------
Q8DJF9_THEEB/5-120.....---------------------------------------------------------------------------
Q6HFU7_BACHK/12-186.....---------------------------------------------------------------------------
Q6N4Q1_RHOPA/27-181.....---------------------------------------------------------------------------
Q6LTK1_PHOPR/2-117.....---------------------------------------------------------------------------
Q6CVE6_KLULA/56-257...YW---------------------------------------------------------------------------
Q930B9_RHIME/3-151.....---------------------------------------------------------------------------
Q6KZ21_PICTO/2-149.....---------------------------------------------------------------------------
Q828M5_STRAW/15-174.....---------------------------------------------------------------------------
UBS3B_MOUSE/374-572PQRSG---------------------------------------------------------------------------
GPMA_METMA/6-194.....---------------------------------------------------------------------------
Q8G5N9_BIFLO/7-171.....---------------------------------------------------------------------------
PGAM5_CAEEL/96-232.....---------------------------------------------------------------------------
Q6MWZ7_MYCTU/7-154.....---------------------------------------------------------------------------
Q7V2G5_PROMP/228-384.....---------------------------------------------------------------------------
Q8GWG7_ARATH/18-200.....---------------------------------------------------------------------------
Q8DU47_STRMU/4-153.....---------------------------------------------------------------------------
Q6MA06_PARUW/9-167.....---------------------------------------------------------------------------
Q722Z3_LISMF/7-184.....---------------------------------------------------------------------------
YO283_YEAST/18-173.....---------------------------------------------------------------------------
Q7XTB5_ORYSJ/18-214.....---------------------------------------------------------------------------
Q73JH0_TREDE/2-153.....---------------------------------------------------------------------------
Q6HF65_BACHK/4-150.....---------------------------------------------------------------------------
Q830V5_ENTFA/2-160.....---------------------------------------------------------------------------
Q9A8K2_CAUCR/1-157.....---------------------------------------------------------------------------
GPMA_BORBU/3-189.....---------------------------------------------------------------------------
Q8TLM8_METAC/12-167.....---------------------------------------------------------------------------
Q890L1_CLOTE/6-160.....---------------------------------------------------------------------------
Q9KSL6_VIBCH/3-151.....---------------------------------------------------------------------------
Q74L54_LACJO/3-97.....---------------------------------------------------------------------------
Q9KG30_BACHD/3-141.....---------------------------------------------------------------------------
Q9CEL7_LACLA/2-151.....---------------------------------------------------------------------------
Q8IG34_CAEEL/84-241.....---------------------------------------------------------------------------
Q885W5_PSESM/4-154.....---------------------------------------------------------------------------
Q8EI22_SHEON/5-200.....---------------------------------------------------------------------------
GPMA1_NITEU/9-195.....---------------------------------------------------------------------------
Q89HY2_BRAJA/10-128.....---------------------------------------------------------------------------
Q73K38_TREDE/2-150.....---------------------------------------------------------------------------
O69984_STRCO/6-166.....---------------------------------------------------------------------------
Q6FCM2_ACIAD/2-111.....---------------------------------------------------------------------------
SHB17_YEAST/7-183.....---------------------------------------------------------------------------
Q6C9Q2_YARLI/4-181.....---------------------------------------------------------------------------
Q8KG77_CHLTE/3-117.....---------------------------------------------------------------------------
Q7NLX7_GLOVI/47-172.....---------------------------------------------------------------------------
Q7MTE1_PORGI/2-150.....---------------------------------------------------------------------------
Q8Z077_NOSS1/2-117.....---------------------------------------------------------------------------
GPMB_SHIFL/3-157.....---------------------------------------------------------------------------
Q745R9_MYCPA/2-150.....---------------------------------------------------------------------------
Q743X7_MYCPA/6-146.....---------------------------------------------------------------------------
Q9AAS0_CAUCR/3-115.....---------------------------------------------------------------------------
Q6C8W1_YARLI/9-209.....---------------------------------------------------------------------------
Q79VT0_SALTM/49-158.....---------------------------------------------------------------------------
Q97AR8_THEVO/3-140.....---------------------------------------------------------------------------
Q92WT9_RHIME/4-157.....---------------------------------------------------------------------------
Q97AG4_THEVO/21-171.....---------------------------------------------------------------------------
Q7NT51_CHRVO/7-162.....---------------------------------------------------------------------------
Q7VNP3_HAEDU/2-126.....---------------------------------------------------------------------------
GPMA_CHLTR/3-186.....---------------------------------------------------------------------------
Q6NB37_RHOPA/6-148.....---------------------------------------------------------------------------
Q9RRC8_DEIRA/41-217.....---------------------------------------------------------------------------
Q9RVD2_DEIRA/22-177.....---------------------------------------------------------------------------
Y2419_MYCTU/5-166.....---------------------------------------------------------------------------
A9CKF0_AGRT5/3-149.....---------------------------------------------------------------------------

PF00328

Q9BL40_CAEEL/16-290E...............................................................................
PPA6_HUMAN/49-379YHE.....................................................T.....................TL
PHYA_ASPFU/71-425Y...............................................................................
VIP1_CAEEL/363-914NRKVQMKYLKE.....................................RETKTSDEE.LRR..............EGPAL
Q22525_CAEEL/28-375................................................................................
Q6BUR8_DEBHA/63-396YTYF...................................................VS....................NSD
VIP1_HUMAN/390-910NRKVQLTYYPHG...................................VKASNEGQDP.QRE.............TLAPSL
P90949_CAEEL/21-327................................................................................
PPAX_CAEEL/28-365................................................................................
Q6BWV9_DEBHA/521-1079KIQLKPSL............................................NSENP.ET................VEKV
VIP2_HUMAN/379-894NRKVQLTYLPHG....................................CPKTSSEEE.DSR.............REEPSL
VIP1_DROME/402-926NRKVQMKYQPKGR.................................PRGSSSDDTNL.AADQ............PVEPSL
PHYB_EMENI/70-422Y...............................................................................
Q7SEH2_NEUCR/194-548W...............................................................................
Q7S8D6_NEUCR/949-1549KVQIKPMFRKKDKPKKEDKEKEGEKPDQEAKEDAAPGEGDSVDKDGNSKPRRPVKRHDSLSGVTMSKFTAAEESLVLDKL
ACPL2_DANRE/88-449LGSL...................................................PR....................LPS
Q9U5U6_DROSU/56-354................................................................................
PPA_ECOLI/29-375................................................................................
Q6BM75_DEBHA/63-397YTYF...................................................VE....................DKD
PHYA1_ASPTE/72-427Y...............................................................................
A8BDL2_GIAIC/21-353YDK.....................................................S....................NVL
PPAD_YEAST/66-400GYEFFIP..............................................DESL.L.................EMET
Q6CZF4_ERWCT/34-372................................................................................
Q96VH9_9HOMO/61-394F...............................................................................
Q19390_CAEEL/17-320DLN..........................................................................NVD
VIP1_YEAST/538-1047KIQLKPV.............................................LNKEN.E.................VEKV
O93838_ASPNG/72-427Y...............................................................................
Q6FJ21_CANGA/510-1016KIQLKPV.............................................LTQNN.E.................VEKV
PHYB_ASPNG/72-404V...............................................................................
PPA1_PICPA/74-409YDYF....................................................V....................SDA
Q8PF53_XANAC/34-377................................................................................
Q6CYI2_KLULA/67-401YEFFVS................................................DTK.Y.................FDQL
Q6CWN2_KLULA/534-1048KIQLKPV.............................................LNKDN.E.................VEKV
Q6CES1_YARLI/413-907KVQIKPT.............................................INKST.GE................VEKV
Q6AVJ1_ORYSJ/361-950YRKVQLKPLKWI....................................RVPKRCGDG.EEE..............RPIEA
Q8SQJ1_ENCCU/48-332................................................................................
Q90XY1_TAKRU/74-416LQ.............................................................................N
O17373_CAEEL/52-377................................................................................
Q757D1_ASHGO/560-1065KIQLKPV.............................................LNDDN.E.................VEKV
Q9APF7_LEGPN/24-324................................................................................
Q8MY06_DROVI/44-342K...............................................................................
Q9GUF1_CAEEL/33-333................................................................................
Q9AAQ4_CAUCR/24-359................................................................................
Q6YNE9_PENOX/62-418Y...............................................................................
PPAL_HUMAN/32-330................................................................................
Q8I0P9_DROME/64-362K...............................................................................
PPA6_MOUSE/42-371NLAG...................................................GP.K..................PHS
Q19175_CAEEL/28-376................................................................................
Q6GPK4_XENLA/34-333................................................................................
Q6CLW3_KLULA/69-406YEYLVE................................................DNI.Y.................LDQM
Q95WU2_GIAIN/15-344YNTP...................................................HP....................TLK
PHO11_CAEEL/25-364................................................................................
Q8GD20_PSESX/30-365................................................................................
Q8PPX6_XANAC/29-351................................................................................
PPA5_YEAST/65-399DYEFFIR..............................................DDDD.L.................EMET
Q9GNT0_9TRYP/33-338................................................................................
Q7YWJ0_MELIC/28-378................................................................................
PPA4_SCHPO/25-385TSLAA.................................................PTS.D..................NSP
Q19460_CAEEL/78-372................................................................................
PHYA_THIHE/65-447Y...............................................................................
Q8P330_XANCP/64-389................................................................................
PPA1_SCHPO/59-395PLS..........................................................................FVP
ACP1_CAEEL/19-323................................................................................
Q6TAQ8_9ENTR/42-388................................................................................
Q6NY36_DANRE/54-394................................................................................
Q25327_LEIME/33-349................................................................................
PHYA_ASPOR/71-426Y...............................................................................
Q96VF5_TRAPU/64-400Y...............................................................................
PPAP_HUMAN/34-332................................................................................
O00096_TALTH/69-423Y...............................................................................
Q6CSM6_KLULA/63-401DNYHIFW.............................................EDTSQ.L.................ELEV
Q6CCS5_YARLI/180-538................................................................................
Q19076_CAEEL/26-371................................................................................
Q9VW00_DROME/55-355................................................................................
O74677_PICAN/61-383................................................................................
Q96VT0_9AGAR/59-411Y...............................................................................
PHO5_CAEEL/30-322................................................................................
Q9VD68_DROME/41-345................................................................................
ACPL2_HUMAN/87-424LNSL...................................................PL....................YPN
Q84TX6_ORYSJ/68-441................................................................................
Q8VQS2_KLEPN/30-355................................................................................
Q84WW3_ARATH/362-953YRKVQLKPLKWV....................................NVPKSDGEG.EEE..............RPVEA
Q57QN8_SALCH/30-362................................................................................
Q9VW01_DROME/61-361G...............................................................................
Q8X1W7_MONPU/76-407WTY...........................................................................YV
PPA2_SCHPO/59-405PLY..........................................................................FVK
VIP1_SCHPO/387-861KVQLKPA.............................................YSPEG.K.................LLKL
PPA3_SCHPO/59-405PLC..........................................................................FIK
PPAT_HUMAN/31-338................................................................................
Q7WSY1_RAOTE/31-357................................................................................
Q25332_LEIME/26-334................................................................................
AGP_PRORE/32-365................................................................................
Q96VK8_9APHY/60-397F...............................................................................

PF00300

Q7QC58_ANOGA/471-664--------------------------------------------------------------------------------
Q6BI57_DEBHA/3-214--------------------------------------------------------------------------------
Q6C210_YARLI/6-172--------------------------------------------------------------------------------
Q6BIM7_DEBHA/15-162--------------------------------------------------------------------------------
Q6BJ83_DEBHA/95-281--------------------------------------------------------------------------------
Q9WWA7_AGRRK/32-170--------------------------------------------------------------------------------
TIGRB_DANRE/5-190--------------------------------------------------------------------------------
Q6C0R4_YARLI/4-173--------------------------------------------------------------------------------
Q7SB57_NEUCR/5-199--------------------------------------------------------------------------------
PMGE_HUMAN/5-195--------------------------------------------------------------------------------
PMG2_YEAST/11-249--------------------------------------------------------------------------------
Q7U5E4_SYNPX/4-170--------------------------------------------------------------------------------
Q8XP82_CLOPE/2-158--------------------------------------------------------------------------------
Q6FCF7_ACIAD/10-173--------------------------------------------------------------------------------
Q8DJJ5_THEEB/2-154--------------------------------------------------------------------------------
Q9F3Q7_STRCO/2-156--------------------------------------------------------------------------------
Q720T2_LISMF/2-154--------------------------------------------------------------------------------
Q7RS23_PLAYO/107-246--------------------------------------------------------------------------------
P96241_MYCTU/4-163--------------------------------------------------------------------------------
Q883Y2_PSESM/2-110--------------------------------------------------------------------------------
Q74HS5_LACJO/3-176--------------------------------------------------------------------------------
Q9CEU3_LACLA/2-155--------------------------------------------------------------------------------
Q87CY4_XYLFT/2-158--------------------------------------------------------------------------------
Q8Y237_RALSO/16-171--------------------------------------------------------------------------------
GPMA_RHIEC/3-164--------------------------------------------------------------------------------
Q8XXU8_RALSO/11-172--------------------------------------------------------------------------------
Q6N2V9_RHOPA/3-118--------------------------------------------------------------------------------
Q6FQW7_CANGA/5-175--------------------------------------------------------------------------------
Q72JY3_THET2/2-111--------------------------------------------------------------------------------
Q6E597_XENNE/2-159--------------------------------------------------------------------------------
Q86HD1_DICDI/259-430--------------------------------------------------------------------------------
A9CJY0_AGRT5/2-161--------------------------------------------------------------------------------
Q8FUA9_COREF/10-122--------------------------------------------------------------------------------
Q6ZG49_ORYSJ/77-245--------------------------------------------------------------------------------
Q6NEM7_CORDI/3-167--------------------------------------------------------------------------------
Q87UC2_PSESM/3-156--------------------------------------------------------------------------------
O67797_AQUAE/3-157--------------------------------------------------------------------------------
Q9AAW6_CAUCR/25-130--------------------------------------------------------------------------------
Q8G0Q3_BRUSU/3-115--------------------------------------------------------------------------------
PMU1_YEAST/55-227--------------------------------------------------------------------------------
Q6MNJ9_BDEBA/2-119--------------------------------------------------------------------------------
Q8XLK3_CLOPE/2-156--------------------------------------------------------------------------------
Q6BTP4_DEBHA/103-303--------------------------------------------------------------------------------
Q8PBP4_XANCP/19-193--------------------------------------------------------------------------------
O29260_ARCFU/2-108--------------------------------------------------------------------------------
Q7YTB0_BOMMO/111-267--------------------------------------------------------------------------------
Q8YLU6_NOSS1/32-195--------------------------------------------------------------------------------
Q6FRI4_CANGA/10-264--------------------------------------------------------------------------------
Q6HKL4_BACHK/3-144--------------------------------------------------------------------------------
Q6AAY7_PROAC/6-160--------------------------------------------------------------------------------
AIS_ECOLI/55-165--------------------------------------------------------------------------------
Q8G4E1_BIFLO/4-202--------------------------------------------------------------------------------
Q6BRZ2_DEBHA/5-194--------------------------------------------------------------------------------
Q83FQ2_TROWT/180-278--------------------------------------------------------------------------------
Q6HBT6_BACHK/3-143--------------------------------------------------------------------------------
Q83MP8_TROWT/3-153--------------------------------------------------------------------------------
Q726G1_DESVH/226-380--------------------------------------------------------------------------------
Q8DRP1_STRR6/23-174--------------------------------------------------------------------------------
Q74L50_LACJO/4-181--------------------------------------------------------------------------------
Q6MP54_BDEBA/2-119--------------------------------------------------------------------------------
Q6C302_YARLI/61-286--------------------------------------------------------------------------------
Q6GB32_STAAS/4-153--------------------------------------------------------------------------------
Q7XSW9_ORYSJ/19-188--------------------------------------------------------------------------------
Q72VE8_LEPIC/2-114--------------------------------------------------------------------------------
Q98MW8_RHILO/4-147--------------------------------------------------------------------------------
Q8CPX4_STAES/10-160--------------------------------------------------------------------------------
Q9CEX0_LACLA/3-144--------------------------------------------------------------------------------
Q9RWR4_DEIRA/2-154--------------------------------------------------------------------------------
Q6HJQ4_BACHK/2-150--------------------------------------------------------------------------------
P73454_SYNY3/4-160--------------------------------------------------------------------------------
Q7P7V2_FUSNV/2-159--------------------------------------------------------------------------------
Q6BZ00_DEBHA/5-181--------------------------------------------------------------------------------
Q9BL94_CAEEL/8-173--------------------------------------------------------------------------------
Q8YSV8_NOSS1/4-164--------------------------------------------------------------------------------
COBC_SALTY/2-156--------------------------------------------------------------------------------
Q86BN5_DROME/6-194--------------------------------------------------------------------------------
YA03_SCHPO/8-174--------------------------------------------------------------------------------
Q6HJT5_BACHK/4-158--------------------------------------------------------------------------------
Y2622_SYNP2/2-116--------------------------------------------------------------------------------
Q8P6B2_XANCP/4-152--------------------------------------------------------------------------------
Q74JW8_LACJO/2-163--------------------------------------------------------------------------------
Q82LG3_STRAW/4-147--------------------------------------------------------------------------------
Q74A29_GEOSL/2-115--------------------------------------------------------------------------------
Q8RA82_THETN/4-158--------------------------------------------------------------------------------
Q82W48_NITEU/2-106--------------------------------------------------------------------------------
Q7BKI0_PRB01/3-117--------------------------------------------------------------------------------
Q722Z4_LISMF/8-186--------------------------------------------------------------------------------
Q7VY96_BORPE/3-161--------------------------------------------------------------------------------
Q6BUK7_DEBHA/10-192--------------------------------------------------------------------------------
Q6LIL4_PHOPR/7-157--------------------------------------------------------------------------------
Q7S800_NEUCR/250-403--------------------------------------------------------------------------------
Q6NJJ1_CORDI/5-157--------------------------------------------------------------------------------
Q8DRV1_STRMU/2-148--------------------------------------------------------------------------------
Q9FNJ9_ARATH/49-203--------------------------------------------------------------------------------
Q98M20_RHILO/3-114--------------------------------------------------------------------------------
Q6SGN8_9BACT/3-117--------------------------------------------------------------------------------
PHOE_BACSU/3-146--------------------------------------------------------------------------------
P72649_SYNY3/132-291--------------------------------------------------------------------------------
Q8G5U1_BIFLO/6-177--------------------------------------------------------------------------------
Q93CQ7_LACSK/5-178--------------------------------------------------------------------------------
Q6KZ44_PICTO/3-140--------------------------------------------------------------------------------
O04035_ARATH/11-189--------------------------------------------------------------------------------
A8B7W8_GIAIC/5-160--------------------------------------------------------------------------------
Q6PY96_9TRYP/451-652--------------------------------------------------------------------------------
O06240_MYCTU/2-159--------------------------------------------------------------------------------
Q82LK1_STRAW/3-156--------------------------------------------------------------------------------
Q8K620_STRP3/5-182--------------------------------------------------------------------------------
O69483_MYCLE/173-327--------------------------------------------------------------------------------
Q73U87_MYCPA/36-190--------------------------------------------------------------------------------
Q89WM0_BRAJA/39-171--------------------------------------------------------------------------------
Q7MLF0_VIBVY/2-151--------------------------------------------------------------------------------
A9CJ67_AGRT5/8-120--------------------------------------------------------------------------------
Q6CHK2_YARLI/4-192--------------------------------------------------------------------------------
Q7NMJ4_GLOVI/2-158--------------------------------------------------------------------------------
GPMA_CAUCR/3-186--------------------------------------------------------------------------------
Q82HM5_STRAW/8-150--------------------------------------------------------------------------------
Q92PF7_RHIME/10-122--------------------------------------------------------------------------------
SIXA_HAEIN/2-122--------------------------------------------------------------------------------
GPMA2_LACJO/7-189--------------------------------------------------------------------------------
Q6AJL1_DESPS/3-117--------------------------------------------------------------------------------
Q7MUJ7_PORGI/236-394--------------------------------------------------------------------------------
Q746P6_THET2/2-140--------------------------------------------------------------------------------
Q97MM8_CLOAB/5-183--------------------------------------------------------------------------------
O67630_AQUAE/20-173--------------------------------------------------------------------------------
Q721Q6_LISMF/6-181--------------------------------------------------------------------------------
PGAM5_DROME/88-228--------------------------------------------------------------------------------
Q826X4_STRAW/13-125--------------------------------------------------------------------------------
Q94BY1_ARATH/44-166--------------------------------------------------------------------------------
Q6M6A8_CORGL/20-172--------------------------------------------------------------------------------
Q897L7_CLOTE/2-155--------------------------------------------------------------------------------
Q6A9K1_PROAC/2-175--------------------------------------------------------------------------------
Q8G704_BIFLO/5-171--------------------------------------------------------------------------------
Q72U60_LEPIC/3-113--------------------------------------------------------------------------------
Q7UQ84_RHOBA/2-196--------------------------------------------------------------------------------
Q72H77_THET2/3-155--------------------------------------------------------------------------------
Q92L77_RHIME/11-123--------------------------------------------------------------------------------
Q748J5_GEOSL/23-177--------------------------------------------------------------------------------
Q6AAP8_PROAC/49-201--------------------------------------------------------------------------------
Q6GC97_STAAS/2-167--------------------------------------------------------------------------------
Q82ZR6_ENTFA/1-148--------------------------------------------------------------------------------
Q72G92_THET2/16-169--------------------------------------------------------------------------------
O68088_RHOCA/12-153--------------------------------------------------------------------------------
Q74HK6_LACJO/2-158--------------------------------------------------------------------------------
Q9KEW3_BACHD/2-150--------------------------------------------------------------------------------
Q6ALU2_DESPS/17-166--------------------------------------------------------------------------------
Q9A6W6_CAUCR/3-145--------------------------------------------------------------------------------
Q7V6P3_PROMM/5-151--------------------------------------------------------------------------------
Q22323_CAEEL/5-201--------------------------------------------------------------------------------
Q75FR3_LEPIC/10-168--------------------------------------------------------------------------------
Q8G5W7_BIFLO/22-200--------------------------------------------------------------------------------
Q9X194_THEMA/2-156--------------------------------------------------------------------------------
Q82CU3_STRAW/4-153--------------------------------------------------------------------------------
Q756M6_ASHGO/9-242--------------------------------------------------------------------------------
Q97JA1_CLOAB/3-152--------------------------------------------------------------------------------
Q72BT4_DESVH/21-170--------------------------------------------------------------------------------
Q723D3_LISMF/42-225--------------------------------------------------------------------------------
Y525_MYCTU/6-158--------------------------------------------------------------------------------
O24559_MAIZE/141-292--------------------------------------------------------------------------------
YL345_YEAST/293-466--------------------------------------------------------------------------------
Q8DIP9_THEEB/22-190--------------------------------------------------------------------------------
Q8EIT5_SHEON/52-156--------------------------------------------------------------------------------
Q724D7_LISMF/7-163--------------------------------------------------------------------------------
Q7P810_FUSNV/3-153--------------------------------------------------------------------------------
Q829E2_STRAW/8-119--------------------------------------------------------------------------------
Q9RXN2_DEIRA/7-157--------------------------------------------------------------------------------
Q7UH13_RHOBA/12-156--------------------------------------------------------------------------------
Q72M33_LEPIC/2-151--------------------------------------------------------------------------------
F263_RAT/248-395--------------------------------------------------------------------------------
Q7MBR9_VIBVY/3-157--------------------------------------------------------------------------------
Q6AME6_DESPS/37-191--------------------------------------------------------------------------------
Q9RSI0_DEIRA/4-149--------------------------------------------------------------------------------
GPMA1_GLOVI/3-191--------------------------------------------------------------------------------
Q8LE79_ARATH/14-208--------------------------------------------------------------------------------
Q74HK7_LACJO/2-158--------------------------------------------------------------------------------
Q876B1_SACEX/5-177--------------------------------------------------------------------------------
YQGD_SCHPO/55-208--------------------------------------------------------------------------------
YFFL_SCHPO/2-149--------------------------------------------------------------------------------
Q970Q5_SULTO/3-117--------------------------------------------------------------------------------
Q7WY90_MYXXA/7-116--------------------------------------------------------------------------------
Q8EQG8_OCEIH/3-144--------------------------------------------------------------------------------
Q7MWC4_PORGI/2-148--------------------------------------------------------------------------------
6P21_YEAST/398-572--------------------------------------------------------------------------------
Q82C73_STRAW/18-172--------------------------------------------------------------------------------
Q87HE6_VIBPA/2-157--------------------------------------------------------------------------------
UBS3A_HUMAN/397-595--------------------------------------------------------------------------------
Q97ET5_CLOAB/4-158--------------------------------------------------------------------------------
Q8YRV4_NOSS1/3-172--------------------------------------------------------------------------------
Q88KP7_PSEPK/26-164--------------------------------------------------------------------------------
Q752M0_ASHGO/18-169--------------------------------------------------------------------------------
GPMA_BLOFL/5-191--------------------------------------------------------------------------------
Q6FD82_ACIAD/1-156--------------------------------------------------------------------------------
Q6HEN0_BACHK/5-149--------------------------------------------------------------------------------
Q878F8_STRPQ/2-160--------------------------------------------------------------------------------
Q87Q43_VIBPA/5-154--------------------------------------------------------------------------------
Q9FYE8_ARATH/21-178--------------------------------------------------------------------------------
PGAM5_XENTR/89-226--------------------------------------------------------------------------------
YNK8_YEAST/5-175--------------------------------------------------------------------------------
Q7MA12_WOLSU/5-120--------------------------------------------------------------------------------
Q9ZAX0_AMYME/2-161--------------------------------------------------------------------------------
Q9KCH8_BACHD/6-157--------------------------------------------------------------------------------
YKJ2_SCHPO/9-173--------------------------------------------------------------------------------
Q8XWS5_RALSO/2-152--------------------------------------------------------------------------------
Q7VGN6_HELHP/3-123--------------------------------------------------------------------------------
Q9CN14_PASMU/5-159--------------------------------------------------------------------------------
Y400_SYNY3/2-117--------------------------------------------------------------------------------
Q8DJF9_THEEB/5-120--------------------------------------------------------------------------------
Q6HFU7_BACHK/12-186--------------------------------------------------------------------------------
Q6N4Q1_RHOPA/27-181--------------------------------------------------------------------------------
Q6LTK1_PHOPR/2-117--------------------------------------------------------------------------------
Q6CVE6_KLULA/56-257--------------------------------------------------------------------------------
Q930B9_RHIME/3-151--------------------------------------------------------------------------------
Q6KZ21_PICTO/2-149--------------------------------------------------------------------------------
Q828M5_STRAW/15-174--------------------------------------------------------------------------------
UBS3B_MOUSE/374-572--------------------------------------------------------------------------------
GPMA_METMA/6-194--------------------------------------------------------------------------------
Q8G5N9_BIFLO/7-171--------------------------------------------------------------------------------
PGAM5_CAEEL/96-232--------------------------------------------------------------------------------
Q6MWZ7_MYCTU/7-154--------------------------------------------------------------------------------
Q7V2G5_PROMP/228-384--------------------------------------------------------------------------------
Q8GWG7_ARATH/18-200--------------------------------------------------------------------------------
Q8DU47_STRMU/4-153--------------------------------------------------------------------------------
Q6MA06_PARUW/9-167--------------------------------------------------------------------------------
Q722Z3_LISMF/7-184--------------------------------------------------------------------------------
YO283_YEAST/18-173--------------------------------------------------------------------------------
Q7XTB5_ORYSJ/18-214--------------------------------------------------------------------------------
Q73JH0_TREDE/2-153--------------------------------------------------------------------------------
Q6HF65_BACHK/4-150--------------------------------------------------------------------------------
Q830V5_ENTFA/2-160--------------------------------------------------------------------------------
Q9A8K2_CAUCR/1-157--------------------------------------------------------------------------------
GPMA_BORBU/3-189--------------------------------------------------------------------------------
Q8TLM8_METAC/12-167--------------------------------------------------------------------------------
Q890L1_CLOTE/6-160--------------------------------------------------------------------------------
Q9KSL6_VIBCH/3-151--------------------------------------------------------------------------------
Q74L54_LACJO/3-97--------------------------------------------------------------------------------
Q9KG30_BACHD/3-141--------------------------------------------------------------------------------
Q9CEL7_LACLA/2-151--------------------------------------------------------------------------------
Q8IG34_CAEEL/84-241--------------------------------------------------------------------------------
Q885W5_PSESM/4-154--------------------------------------------------------------------------------
Q8EI22_SHEON/5-200--------------------------------------------------------------------------------
GPMA1_NITEU/9-195--------------------------------------------------------------------------------
Q89HY2_BRAJA/10-128--------------------------------------------------------------------------------
Q73K38_TREDE/2-150--------------------------------------------------------------------------------
O69984_STRCO/6-166--------------------------------------------------------------------------------
Q6FCM2_ACIAD/2-111--------------------------------------------------------------------------------
SHB17_YEAST/7-183--------------------------------------------------------------------------------
Q6C9Q2_YARLI/4-181--------------------------------------------------------------------------------
Q8KG77_CHLTE/3-117--------------------------------------------------------------------------------
Q7NLX7_GLOVI/47-172--------------------------------------------------------------------------------
Q7MTE1_PORGI/2-150--------------------------------------------------------------------------------
Q8Z077_NOSS1/2-117--------------------------------------------------------------------------------
GPMB_SHIFL/3-157--------------------------------------------------------------------------------
Q745R9_MYCPA/2-150--------------------------------------------------------------------------------
Q743X7_MYCPA/6-146--------------------------------------------------------------------------------
Q9AAS0_CAUCR/3-115--------------------------------------------------------------------------------
Q6C8W1_YARLI/9-209--------------------------------------------------------------------------------
Q79VT0_SALTM/49-158--------------------------------------------------------------------------------
Q97AR8_THEVO/3-140--------------------------------------------------------------------------------
Q92WT9_RHIME/4-157--------------------------------------------------------------------------------
Q97AG4_THEVO/21-171--------------------------------------------------------------------------------
Q7NT51_CHRVO/7-162--------------------------------------------------------------------------------
Q7VNP3_HAEDU/2-126--------------------------------------------------------------------------------
GPMA_CHLTR/3-186--------------------------------------------------------------------------------
Q6NB37_RHOPA/6-148--------------------------------------------------------------------------------
Q9RRC8_DEIRA/41-217--------------------------------------------------------------------------------
Q9RVD2_DEIRA/22-177--------------------------------------------------------------------------------
Y2419_MYCTU/5-166--------------------------------------------------------------------------------
A9CKF0_AGRT5/3-149--------------------------------------------------------------------------------

PF00328

Q9BL40_CAEEL/16-290HFPRGYSQ...........--LTQR.GFRQAKEVG-VF------LR.NQYK.................DLID--------
PPA6_HUMAN/49-379KGGMFAGQ...........--LTKV.GMQQMFALG-ER------LR.KNYVE..............DIPFLS--------
PHYA_ASPFU/71-425NYTLGADD...........--LTPF.GEQQLVNSG-IK------FY.QRYK.................ALAR--------
VIP1_CAEEL/363-914LLILKWGG..........E--LTTA.GNMQAEALG-RL------FR.TLYPGIRRTDGKSSPEDTQGLGFLR--------
Q22525_CAEEL/28-375FGGGGWGQ...........--LTPI.GMRQHMQLG-QK------LR.ARYVNG............QPYKFLN--------
Q6BUR8_DEBHA/63-396MYDLEVSPS........NS--RSPYAGTTNALKHG-AA------FR.ARYN.................SLYN--------
VIP1_HUMAN/390-910LLVLKWGG..........E--LTPA.GRVQAEELG-RA------FR.CMYPGGQGDY.....AGFPGCGLLR--------
P90949_CAEEL/21-327AWSRGWGQ...........--LTSI.GMQQLHELG-EF------FR.HQYVD...............SSFIP--------
PPAX_CAEEL/28-365FGGGGLGE...........--LTPM.GMSEMNNLG-TI------FR.RRYVE..............DQQFLS--------
Q6BWV9_DEBHA/521-1079QLILKWGG..........E--PTHS.AQFQANDVG-EQ------LR.QNIK.................LLNR--------
VIP2_HUMAN/379-894LLVLKWGG..........E--LTPA.GRVQAEELG-RA------FR.CMYPGGQGDY.....AGFPGCGLLR--------
VIP1_DROME/402-926VLILKWGG..........E--LTPA.GRIQAEELG-RI------FR.CMYPGGQGRSD...YSGTQGLGLLR--------
PHYB_EMENI/70-422NYTLGADD...........--LTIF.GENQMVDSG-AK------FY.RRYK.................NLAR--------
Q7SEH2_NEUCR/194-548KYQMGTEI...........--LVPR.GRQELFDSG-VL------HA.YMYS.................SLYD--------
Q7S8D6_NEUCR/949-1549QLIVKWGG..........E--PTHS.ARYQAQELG-ES------MR.SDLG.................LMNR--------
ACPL2_DANRE/88-449HSTCEMGE...........--LTQT.GVVRQLKNG-DH------LR.QAYIS..............RHNLLA--------
Q9U5U6_DROSU/56-354FWPTGWGQ...........--LTNL.GKEQHYELG-KW------LR.NRYK.................SLLG--------
PPA_ECOLI/29-375TWPVKLGW...........--LTPR.GGELIAYLG-HY------QR.QRLVA..............DGLLAK--------
Q6BM75_DEBHA/63-397NYEKETTPS........NS--EGPFSGADNALRHG-TT------FR.SKYN.................EIYN--------
PHYA1_ASPTE/72-427NYSLDSEE...........--LTPF.GRNQLRDLG-AQ------FY.ERYN.................ALTR--------
A8BDL2_GIAIC/21-353PGTCYQGQ...........--LTSV.GLAEQYLLG-TK------YR.YKYIH..............ALRFAP--------
PPAD_YEAST/66-400TLQNSIDV...........--LNPYTGEMNAKRHA-RE------FL.AKYG.................KLME--------
Q6CZF4_ERWCT/34-372QWVTREGE...........--LTGH.GYAATVIKG-HY------EG.EYYRQ...............QHLFA--------
Q96VH9_9HOMO/61-394VYKFGVAD...........--LLPF.GANQSHQTG-TD------MY.TRYS.................TLFE--------
Q19390_CAEEL/17-320YQQIAWPG..........E--LTKR.GILEEFQLG-QR------LR.KIYG.................EHFG--------
VIP1_YEAST/538-1047QFILKWGG..........E--PTHS.AKYQATELG-EQ------MR.QDFD.................LLNK--------
O93838_ASPNG/72-427NYSLGADD...........--LTPF.GEQELVNSG-VK------FY.QRYE.................SLTR--------
Q6FJ21_CANGA/510-1016QFILKWGG..........E--PTHS.ARYQATELG-EQ------MR.QDFD.................LLNK--------
PHYB_ASPNG/72-404PNECYYNAET.......TS--GPYA.GLLDAYNHG-ND------YK.ARYG.................HLWN--------
PPA1_PICPA/74-409AWYEQETT...........--KGFYSGLNTAFDFG-TT------LR.ERYD.................HLIN--------
Q8PF53_XANAC/34-377HFGVPAGH...........--LTAN.GAQLERLFG-DY------YR.AHYTA..............LGLLNG--------
Q6CYI2_KLULA/67-401TNSSDVDP...........--SNPYMGSKTAEILG-KY------IA.FNYG.................ELFG--------
Q6CWN2_KLULA/534-1048QFILKWGG..........E--PTHS.AHFQAEELG-EQ------MR.QDFD.................LLNK--------
Q6CES1_YARLI/413-907QLVAKWGG..........E--PTHS.ARYQAQDMG-DQ------MR.QDLM.................IVNK--------
Q6AVJ1_ORYSJ/361-950LMILKYGG..........V--LTHA.GRKQAEELG-RF------FRNNIYPGE.............GTGLLR--------
Q8SQJ1_ENCCU/48-332RKGCGEGD...........--LTYR.GFEQMVTLG-RF------IK.KNYK.................PLLF--------
Q90XY1_TAKRU/74-416QWTMWYTEDM......DGR--LVQK.GVDDLKNLA-VR------LS.KLFP.................SMIS--------
O17373_CAEEL/52-377AWPNGWGE...........--LTQL.GMRQQYALG-RL------LY.KKYVNST...........GPSKLLS--------
Q757D1_ASHGO/560-1065QFILKWGG..........E--PTHS.ARYQAQELG-EQ------MR.QDFD.................LLNK--------
Q9APF7_LEGPN/24-324QWQEGLGQ...........--LTAE.GMQQEYKMG-VA------FR.KKYIE..............ELHLLP--------
Q8MY06_DROVI/44-342YWPTGWGQ...........--LTNR.GKQQHYELG-KW------LR.KRYS.................SLLD--------
Q9GUF1_CAEEL/33-333GIDRSWGQEG......SLE--LTSI.GKRQGYGLG-VE------LR.KFIG.................NLTT--------
Q9AAQ4_CAUCR/24-359RFEVPAGH...........--LTAR.GETLVARMG-DY------YR.RHYAA...............QGLLK--------
Q6YNE9_PENOX/62-418NYTLGSED...........--LTSF.GEHQMINSG-IK------FY.QRYA.................ALTR--------
PPAL_HUMAN/32-330EWPQGFGQ...........--LTKE.GMLQHWELG-QA------LR.QRYH.................GFLN--------
Q8I0P9_DROME/64-362FWPTGWGD...........--LTNL.GKQEHYDLG-KW------LR.NRYS.................NLLP--------
PPA6_MOUSE/42-371HYDTEYRKTTLRGGVLAGQ--LTKV.GMQQMFALG-EK------LR.KNYVE..............DIPFLS--------
Q19175_CAEEL/28-376FGGGGWGQ...........--LSPL.GMNQHLTLG-KK------LR.NRYVNTG..........NSTHNFLP--------
Q6GPK4_XENLA/34-333AWPQGYGQ...........--LTQV.GMKQHWDLG-QE------LR.ARYK.................GFLN--------
Q6CLW3_KLULA/69-406TNSSNVDG...........--SNPYMGSKTAQQLG-NY------IA.VHYG.................ELIG--------
Q95WU2_GIAIN/15-344GGSCIQGI...........--LTRE.GRLQHEQLG-KA------FR.QKYG.................DFFP--------
PHO11_CAEEL/25-364YGGGGLGE...........--LTAI.GMGEMNELG-WL------IR.KRYVT..............KLKFLT--------
Q8GD20_PSESX/30-365KWSVPDGQ...........--LTGH.GYAAAVEMG-RY------RG.QVLRT...............AGLLP--------
Q8PPX6_XANAC/29-351HWPVAAGQ...........--LTPH.GRAGMQALG-AR------YR.LRLAP..............PLGLAA--------
PPA5_YEAST/65-399TFANSDDV...........--LNPYTGEMNAKRHA-RD------FL.AQYG.................YMVE--------
Q9GNT0_9TRYP/33-338CGGEPCGS...........--LTRE.GLTMLINTG-KF------LR.EHYNNA............SSVPFFP--------
Q7YWJ0_MELIC/28-378DWPQGWGQ...........--LTPT.GMAQHVELG-RR------LR.QRYIE..............ELKFVG--------
PPA4_SCHPO/25-385SGVCIHGE...........--LTDF.GRVTTRTLG-EY------LR.ERYVK..............QLKFLP--------
Q19460_CAEEL/78-372FFPRDYGQ...........--LTDQ.GYNHSFMMG-RF------LK.KRYVD...............TGFLS--------
PHYA_THIHE/65-447DYTLGADE...........--LTRT.GQQQMVNSG-IK------FY.RRYR.................ALAR--------
Q8P330_XANCP/64-389QWSTPASL...........--VTPH.GRKAVQLSG-EY------LR.QWLMQ..............QALLPR--------
PPA1_SCHPO/59-395TWTPVIEAAN......ADA--LSSS.GRVELFDMG-RQ------FY.ERYH.................ELFN--------
ACP1_CAEEL/19-323YFYRGLGQ...........--LTDE.GFEQARLMG-KV------LR.DRYV................NSFVD--------
Q6TAQ8_9ENTR/42-388EWPVKLGY...........--ITPR.GEHLASLMG-GF------YR.QKFQQ..............LGILSK--------
Q6NY36_DANRE/54-394MWYTEDMDG.........R--LVEK.GRDDHRHLA-MR------LA.KSFP.................TLIS--------
Q25327_LEIME/33-349EFPCGF.............--LNYE.GQAMLVNLG-KY------LH.HRYTEN.............PSVVSK--------
PHYA_ASPOR/71-426NYSLGADD...........--LTPF.GENQLVDSG-IK------FY.QRYE.................ELAK--------
Q96VF5_TRAPU/64-400TYSLGQDS...........--LVEL.GATQSSEAG-QE------AF.TRYS.................SLVS--------
PPAP_HUMAN/34-332SWPQGFGQ...........--LTQL.GMEQHYELG-EY------IR.KRYR.................KFLN--------
O00096_TALTH/69-423RYQLGAND...........--LTPF.GENQMIQLG-IK------FY.NHYK.................SLAR--------
Q6CSM6_KLULA/63-401TSKNSLDP...........--LNPYTGEQSARTHA-RQ------FI.SLYG.................DLLE--------
Q6CCS5_YARLI/180-538HWNYLLERE.........L--LVPR.GYSTEFAAG-AQ------FW.SSHG................RHLFN--------
Q19076_CAEEL/26-371FGGGGWGQ...........--LSPA.GMKQHLNLG-KM------LR.NRYVT..............NYNFLP--------
Q9VW00_DROME/55-355YEPFGWGA...........--LTNG.AKVELYKIG-KQ------LR.QRYK.................DFLP--------
O74677_PICAN/61-383PDSDNYELE........TT--RGLYSGLLNAFKFG-TY------LR.ERYD.................SLVD--------
Q96VT0_9AGAR/59-411TYTLGHDD...........--LVPF.GALQSSQAG-EE------TF.QRYS.................FLVS--------
PHO5_CAEEL/30-322KWPEGLGE...........--LTEQ.GAAQQYRLG-QW------LK.RRYG.................SWLG--------
Q9VD68_DROME/41-345DWQGGMGA...........--LTPK.GSLQAYNLG-RN------LR.MRYY.................RLLP--------
ACPL2_HUMAN/87-424HPLCEMGE...........--LTQT.GVVQHLQNG-QL------LR.DIYLK..............KHKLLP--------
Q84TX6_ORYSJ/68-441GWESPWKGRVK.....GGE--LVSE.GEEELYNLA-IR------VK.ERFQ.................GLFD--------
Q8VQS2_KLEPN/30-355PWLCRRGQ...........--QRAC.GRPALPP.A-RP------AA......................GRMP--------
Q84WW3_ARATH/362-953LMVLKYGG..........V--LTHA.GRKQAEELG-RY------FRNNMYPGE.............GTGLLR--------
Q57QN8_SALCH/30-362AWDVPGGQ...........--LTTK.GGVLEVYMG-HY------TR.EWLVA..............QGLIPS--------
Q9VW01_DROME/61-361FKPTGWGH...........--VTNS.GKRELFEMG-RW------LN.RRYG.................EFMG--------
Q8X1W7_MONPU/76-407PNHCAYNAE........TS--TGPYAGLLEGFKRG-SD------YR.ARYG.................HLWD--------
PPA2_SCHPO/59-405HWTPVIKAEN......ADQ--LSSS.GRIELFDLG-RQ------VF.ERYY.................ELFD--------
VIP1_SCHPO/387-861QLIIKWGG..........E--FTHS.ARYQSKDLG-EQ------FHKDLY..................IMNR--------
PPA3_SCHPO/59-405QWTPVIDAEN......ADQ--LSSR.GRLELFDLG-RQ------LY.QRYY.................KLFD--------
PPAT_HUMAN/31-338LWPRGLGQ...........--LTTE.GVRQQLELG-RF------LR.SRYE.................AFLS--------
Q7WSY1_RAOTE/31-357EWTTHDGE...........--LTGH.GYAAVVNKG-RE------EG.QHYRQ...............LGLLQ--------
Q25332_LEIME/26-334LYPCGE.............--LTGE.GVEMVRAIG-EF------AR.SRYNNLS..........LVESPLFP--------
AGP_PRORE/32-365DWDAKSGY...........--LTTQ.GGALEVYMG-HY------FR.EWIDQ..............NKLLAD--------
Q96VK8_9APHY/60-397TYDLGTSD...........--LVPF.GAAQSFDAG-LE------VF.ARYS.................KLVS--------

PF00300

Q7QC58_ANOGA/471-664..WQKDSP.............LTNV-GRYQARLVG.EG......LK-D......................A.........
Q6BI57_DEBHA/3-214FKDYKEYD.....P.S.....LASS-AIEQLETVG.KE......IL-GQT.................QVF.DDT......
Q6C210_YARLI/6-172..VNRHTSN..HRI.K.....LTAN-GEEQARDAG.KR......LA-D.....................M.V........
Q6BIM7_DEBHA/15-162..LQGHLD.....I.D.....MNKT-GHNQSQLVG.EA......LK-.................................
Q6BJ83_DEBHA/95-281NSTMEWYD.....A.L.....LTDN-GHDQINTLS.DS......WK-SQ....................L.YT.......
Q9WWA7_AGRRK/32-170..IQGQLD.....V.A.....LDQV-GREQATHAG.VL......LK-.................................
TIGRB_DANRE/5-190..LQGQGI.....DTP.....LSDT-GHQQAAAAG.RY......LK-.................................
Q6C0R4_YARLI/4-173SPTGIESD.....P.A.....LAEK-GVVQAKELG.EY......LK-D................................
Q7SB57_NEUCR/5-199..PTGIAA.....DPA.....LTAH-GVDQAKELG.QR......LV-A................................
PMGE_HUMAN/5-195..FCSWVD.....Q.K.....LNSE-GMEEARNCG.KQ......LK-A................................
PMG2_YEAST/11-249..FCGWID.....A.K.....LTEK-GKEQARHSA..ELI..EQYC-K.....................A.N........
Q7U5E4_SYNPX/4-170..IQGRDDL..SN........LSEE-GHEQARRLG.AS......LT-.................................
Q8XP82_CLOPE/2-158..FQGWKD.....S.E.....LTEN-GVKRAELLG.KK......FN-.................................
Q6FCF7_ACIAD/10-173..VNGQGLAGYDLQ.......LTAP-GRELAQEWG.SY......LI-A.......................N........
Q8DJJ5_THEEB/2-154..MLGRQD.....V.P.....LTER-GRQQALALR.EK........-.................................
Q9F3Q7_STRCO/2-156..LKHLLDTAEPGP.G.....LTAL-GQEQAAALP.GA......LA-.................................
Q720T2_LISMF/2-154..YCGQLDV...A........LNEN-GIRQMEQLR.EK......LE-.................................
Q7RS23_PLAYO/107-246..RKNRNDENSKK........LTKE-GCKQADITG.KK......LK-D.....................I.L........
P96241_MYCTU/4-163..VERRLDTLPPGT.A.....LTPL-GRDQARAFA.RS........-.................................
Q883Y2_PSESM/2-110..ARSDAE.....R.E.....LTAH-GREEVQKSA.LH......LT-.................................
Q74HS5_LACJO/3-176..MQGWCD.....T.P.....LTDE-GIQGAKDAG.KA......LS-.................................
Q9CEU3_LACLA/2-155..LQGQKG.....DSP.....LLPE-SYEAIERVH.KF......LE-.................................
Q87CY4_XYLFT/2-158..YQGQID.....I.P.....LSSV-GEAQARALG.ER......LR-.................................
Q8Y237_RALSO/16-171..LQGQLD.....V.P.....LNAQ-GREQAAQLG..R.....ALA-.................................
GPMA_RHIEC/3-164..GNARGEFTGTSDVP.....LTQE-GWSESRRAG.SL......LA-N................................
Q8XXU8_RALSO/11-172..FDATGRPILPETVP.....LNED-GRRQAAAAG.QT......FA-A................................
Q6N2V9_RHOPA/3-118..RDAPSGKDHDRR.......LEDR-GRSDAAEIA.AW......LA-A................................
Q6FQW7_CANGA/5-175.GIAGDVQ.............LAQH-GIKQAHELG..RFL..LTLD-.................................
Q72JY3_THET2/2-111..AQGEGEAADDAR.P.....LAPE-GVRRFRKVV.RG......LK-A................................
Q6E597_XENNE/2-159..FCGKTD.....L.P.....LTQT-GINQALYVS..E.....ALK-.................................
Q86HD1_DICDI/259-430..LSAYTEEFKKKHSSV..YRLTDK-GVLQAKIAG.KW......VR-E.......................N........
A9CJY0_AGRT5/2-161..LQGQKD.....I.P.....LNDF-GRQQAVGNG.RILA..RLLG-E................................
Q8FUA9_COREF/10-122..AEPEPD....HARP.....LNKR-GHRDGKAAG.QW......LA-E................................
Q6ZG49_ORYSJ/77-245FGEKLW...............LGKL-GRINDSLVG..H......LD-.................................
Q6NEM7_CORDI/3-167..AAKVLDTRPPGA.E.....LSVI-GRTQADDAG.RSL...ATLS-.................................
Q87UC2_PSESM/3-156..ANAGQPSVDHATIP.....LTLK-GVEQAQSVA.RS......FT-.................................
O67797_AQUAE/3-157..YQGLLD.....P.D.....LTER-GVEQARRLA.KA......LK-.................................
Q9AAW6_CAUCR/25-130..PNGDPD.............LSDA-GKARAQALA.AA......LA-.................................
Q8G0Q3_BRUSU/3-115..GMKDFD.....R.P.....LDEE-GIASLMRLA.RS......MK-E................................
PMU1_YEAST/55-227..HGEWLD.....S.K.....LTPL-GKDQVRRTG.SNVL..LPMA-K.......................Q........
Q6MNJ9_BDEBA/2-119..FSGDPD.............LTAE-GHAQASKLL.DK.....VLK-E................................
Q8XLK3_CLOPE/2-156..YCGISD.....V.P.....LSEE-GKKELEEKR.KS......VS-.................................
Q6BTP4_DEBHA/103-303..TDGELTWGPDAG.......LTEL-GIRQAKENNMVWK...EQMS-K................................
Q8PBP4_XANCP/19-193..RDADVP.............LSAL-GERQARALG.AW......MA-G.....................L.P........
O29260_ARCFU/2-108..VDPERN.............LSEE-GVKEVERVA.AF......LE-K................................
Q7YTB0_BOMMO/111-267..YVKDTP.............LTRL-GWFQAQLVG.EG......MR-M................................
Q8YLU6_NOSS1/32-195..YQGSSDE..SV........LTEV-GRRDARITG..E.....FLQ-.................................
Q6FRI4_CANGA/10-264..SESNKDKKINEVTPNHLIPLTPY-GKKQAHNAG.LK......LL-RLLNMADASV...IEKLGEEYAL.PATSTNTLE
Q6HKL4_BACHK/3-144..YTKEER.....GRP.....LSEK-GHCDAENVT.SL......LK-.................................
Q6AAY7_PROAC/6-160..LYGCMAG...YH.......LSPL-GRRMAARAA.EH......FA-.................................
AIS_ECOLI/55-165..LSDKTG.............ITVK-GTQDARELG.NA......FS-A................................
Q8G4E1_BIFLO/4-202..LQGQID.....V.P.....LDIV-GQWQVDQTG.FA......LA-SRYYWAKVN......RLAEHPEA.IAQPGPDAA
Q6BRZ2_DEBHA/5-194..FCGWID.....I.P.....LSEK-GRDEAKFAG..HLI..QKYN-.................................
Q83FQ2_TROWT/180-278..THGEDA.............LSPL-GMQRSQTLP.VE......LS-.................................
Q6HBT6_BACHK/3-143..ATGQER.....DAE.....LTTD-GKKQANTLA.TF......LL-E................................
Q83MP8_TROWT/3-153..LYGRLP.....NYR.....ITES-GECDARRVA.DF......FS-.................................
Q726G1_DESVH/226-380..IGGDPE.............LTAH-GKEQADALA.RH......FS-.................................
Q8DRP1_STRR6/23-174..ERSYIGFGIDLA.P.....LSEM-GRQQVQKLS.KN........-P................................
Q74L50_LACJO/4-181..VQGWAD.....S.P.....LTVK-GINDLKVTA.SN......LS-.................................
Q6MP54_BDEBA/2-119....DYLR.....P.......LTLK-GRKRMQKVC.VN......LR-D................................
Q6C302_YARLI/61-286.TWGPDPE.............LTEL-GIEQARDAH.KAWK..QQLE-S.....................F.D........
Q6GB32_STAAS/4-153..IQGFGD.....S.P.....LTEL-GIAQAQKAR..S.....YYE-T................................
Q7XSW9_ORYSJ/19-188..ENGTKP.....EFG.....LAPQ-GVEQARLAG.ES......LR-KE....................L.E........
Q72VE8_LEPIC/2-114..LDGTDR.....SRP.....LTAK-GEADVRKMG.NF......FK-.................................
Q98MW8_RHILO/4-147..RRGSFP....LDEP.....LEPR-SLTRAKAMR.GT......LR-.................................
Q8CPX4_STAES/10-160..IQGASD.....S.P.....LTAL-GVQQANAAQ..Q.....YFK-T................................
Q9CEX0_LACLA/3-144..AYDDMD.....V.P.....LTAE-GEKRALILA.DA......FA-.................................
Q9RWR4_DEIRA/2-154..DEGVCEGRYDSP.......LTEV-GREHARKLA.AY......WA-A................................
Q6HJQ4_BACHK/2-150..HEGRADF...E........LTEK-GREQVQRLV.QK......VK-.................................
P73454_SYNY3/4-160..TGGYCGTPENDP.G.....LTPE-GILMAKEFA.EA......YA-.................................
Q7P7V2_FUSNV/2-159..FQGLSD.....S.P.....LTEL-GITQAKLLG.EK......LK-.................................
Q6BZ00_DEBHA/5-181..HPPNPTGIDSDP.P.....LASH-GIDQAKQLA.GY......LN-S.....................L.P........
Q9BL94_CAEEL/8-173..NRNWRKLDGADGLTSDNSMLSVR-GRQQAKECK.NR......FE-.................................
Q8YSV8_NOSS1/4-164..ERRYDP.......P.....LSDD-GMVQAQQLA.QR......LR-.................................
COBC_SALTY/2-156..YSGHAP.....T.P.....LTEK-GIGQAKTLH.TL......LR-.................................
Q86BN5_DROME/6-194..FCGWHD.....A.P.....LSEF-GVQEALTVA.IP.....ALV-Q................................
YA03_SCHPO/8-174..VGPDEDHNIRDPV......LTSE-GIEQCEALA.KE......LE-S................................
Q6HJT5_BACHK/4-158..MQGRKN.....S.T.....LTEN-GILQAKQLG.ER......MK-.................................
Y2622_SYNP2/2-116..AADRADYAEDGDRP.....LTTK-GETRTKLVA.QR......LQ-Q................................
Q8P6B2_XANCP/4-152..YRGQLD......DP.....LTAT-GWQQLREAT...........-.................................
Q74JW8_LACJO/2-163..QGGSGN.....S.P.....LLPE-SYEDIKKLA.GY......LK-.................................
Q82LG3_STRAW/4-147.EARFDDG.....C.R.....LDAS-GAAHAESAA.GT......L.-.................................
Q74A29_GEOSL/2-115..AIAEED.....R.W.....LTPR-GRASFATSV.RV......IA-R................................
Q8RA82_THETN/4-158..MQGMKD.....I.E.....LTQL-GLEQAELLA.KR......LK-.................................
Q82W48_NITEU/2-106..PDATRK.............LTEK-GLKQAQKMA.RW......LE-P................................
Q7BKI0_PRB01/3-117..NQKDFD.....R.P.....LARK-GIEEANKIS.CY......CK-S................................
Q722Z4_LISMF/8-186..VQGWAD.....S.P.....LTEE-GALVAHDLG..R.....GLK-.................................
Q7VY96_BORPE/3-161..LQGWQD......IP.....LNES-GREQARLLA.ER......LR-D.....................T.A........
Q6BUK7_DEBHA/10-192..KSGQYTSITDLP.......LTDF-GVKQMRNTG.KHLIGPSPFQ-L.......................I........
Q6LIL4_PHOPR/7-157..LRGHTDF...A........ITST-GLIQMATAI.AD......LD-.................................
Q7S800_NEUCR/250-403..YKSDAP.............LSEE-GRSYAQKMT.ET.....LLR-HREQE..............RKAN.SEQA.....
Q6NJJ1_CORDI/5-157..LYGRIP.....DYH.....LSSR-GRSMAARTA.AS......FA-.................................
Q8DRV1_STRMU/2-148.CTSDEFN.............QACK-KYDGADIVA...FQ..GSLE-.................................
Q9FNJ9_ARATH/49-203..IQGSSDF..SV........LTKK-GESQAEISR.QM......LI-.................................
Q98M20_RHILO/3-114..GMRDFD.....R.P.....LDAA-GRADAEIMG.AA......MR-S................................
Q6SGN8_9BACT/3-117..SDRERE.............LNKR-GRRDAPRMG.AA......LA-.................................
PHOE_BACSU/3-146..CQGKTD.....I.P.....LNAT-GERQARETG.EY......VK-.................................
P72649_SYNY3/132-291..FQGIRD.....I.P.....LNDN-GRHQAQKAA..E.....FLK-.................................
Q8G5U1_BIFLO/6-177..GDNSLYTQDNVTVPDRSWRLTAT-GRKQADCIG.RW......LV-S................................
Q93CQ7_LACSK/5-178..MQGWSD......SP.....LTEK-GIADAELAG.KQ......LS-.................................
Q6KZ44_PICTO/3-140..RSGILS.....R.EMNKYGLTDN-GIEQAKFTA.YQ......LK-.................................
O04035_ARATH/11-189..SAGNIDAGAYATTPDHKIPLTEE-GRAQAREAG.KK......MR-ALI..................ST.QSG......
A8B7W8_GIAIC/5-160..IRGHV......PNP.....LNEI-GRLHAKEAS.AA......LK-.................................
Q6PY96_9TRYP/451-652..IGGDSP.............LSPE-GEQDTIELL..EFV..ASLT-QYVEQERNDTDSCVCETAHTAGDGDGRVREGSG
O06240_MYCTU/2-159..LAGRSG.....V.D.....LDEK-GREQATGLI.DR......IG-.................................
Q82LK1_STRAW/3-156..HTGSTD.....I.P.....LTEN-GREQARRLA.PL......IA-.................................
Q8K620_STRP3/5-182..AQGWSD......TP.....LTKK-GEEGIRELG.LG......LK-D................................
O69483_MYCLE/173-327..YSGRGN.....P.A.....LNNV-GWRQARAAA.RY......FA-.................................
Q73U87_MYCPA/36-190..ASGTIDTEVPGPG......LSPE-GKGQAEQVA.HQ......LG-.................................
Q89WM0_BRAJA/39-171..MSAQRQ.............LSEK-GRDMARQIG.AA......VK-E................................
Q7MLF0_VIBVY/2-151..LFGRTD....A........KVPA-DRQQAIAEA.........LF-A................................
A9CJ67_AGRT5/8-120..GERDFD.....R.G.....LNEA-GFAEAEIIA..D......LA-A.......................D........
Q6CHK2_YARLI/4-192..EYGYNP.......P.....LADL-GHSQATEAG.RY......IR-S.......................L........
Q7NMJ4_GLOVI/2-158..VQGRTD.....RSV.....LSEA-GVAQARATA.AV......LE-.................................
GPMA_CAUCR/3-186..FTGWVDV...D........LTAE-GEAQARKGG.EL......IA-A................................
Q82HM5_STRAW/8-150..ATADEDA..GE........LTAN-GRRQAELLG.DR......LR-.................................
Q92PF7_RHIME/10-122..LPGQSDFD.RA........LDDI-GFAEAELTA.QS......AA-D................................
SIXA_HAEIN/2-122..VMANSDKA.RH........LTVY-GSKQAFLQG.QW......LK-QH....................L.ST.......
GPMA2_LACJO/7-189..YTGWND......VP.....LSKK-GIAQAKNAG.........LK-V.....................E.K........
Q6AJL1_DESPS/3-117..EYADYD.....R.P.....LSKR-GKENSREMG.RR......LR-G................................
Q7MUJ7_PORGI/236-394..FIGSTNA...I........LSEH-GRIQAEQVA.DF......IS-.................................
Q746P6_THET2/2-140..LLGWTD.....L.P.....LTAE-GEAQARRLK.GA........-.................................
Q97MM8_CLOAB/5-183..VQGWCD.....G.V.....LTDE-GIRVAEYAG.EG......LS-.................................
O67630_AQUAE/20-173..FQGRLDS...D........LTPL-GFVQSRLLV.KQ......FE-.................................
Q721Q6_LISMF/6-181..MQGWAD.....T.P.....LTPE-GIEIVKESG.RG......LA-.................................
PGAM5_DROME/88-228..DVGDSDDT.HH........LTER-GRKQAEFTG.KR......LC-E................................
Q826X4_STRAW/13-125..PAGVAD....HDRP.....LAPR-GRRDAPAAG.RV......LA-E................................
Q94BY1_ARATH/44-166..SLRDHD.....R.P.....LSKT-GEADAAKVA.QI......LS-S................................
Q6M6A8_CORGL/20-172..LPGQTPG..LH........LSDK-GEEQAREVA.QR......LA-.................................
Q897L7_CLOTE/2-155..YYGNLD.....V.G.....LNEK-GKMQCEYLR.EK......LR-.................................
Q6A9K1_PROAC/2-175..QQGRKP.....DPE.....LTEL-GRRQAQALG.KW......IG-S................................
Q8G704_BIFLO/5-171..RLPDFH.............LSDL-GRRMAQATA.AY......LA-N.....................S.P........
Q72U60_LEPIC/3-113..SQGENYD...L........LTSL-GKNQSFALG.KY......MA-H................................
Q7UQ84_RHOBA/2-196..AKPVQNRVCDPS.......ITAR-GRLQADCLG.KW......MS-.................................
Q72H77_THET2/3-155..FQGHLD.....V.P.....LSPV-GIGQAFRLA.ER......LS-R................................
Q92L77_RHIME/11-123..PDGVAD....HRRP.....LSER-GRKAAPVVG.AF......MA-R................................
Q748J5_GEOSL/23-177..YNGHNDV...G........LSER-GKAQYLELR.KR......FD-.................................
Q6AAP8_PROAC/49-201..IQGQTM.....GVR.....LTMR-GRSQARQAA.RT......VA-D................................
Q6GC97_STAAS/2-167..FCGQLD.....V.P.....LTDT-GTKSADDLC.DY......FK-.................................
Q82ZR6_ENTFA/1-148..ICGHAEA...Q........LTEK-GYQQAELVA.EK......IA-K................................
Q72G92_THET2/16-169..LYSHPG.....L.P.....LSPE-GRSALLALL.PL......LQ-.................................
O68088_RHOCA/12-153..LAGRRD.....V.P.....CDLP-GEEVLASLR.AA........-.................................
Q74HK6_LACJO/2-158..ISGGTS.....NPN.....LSQA-GVKQVEEVS.KL......ID-.................................
Q9KEW3_BACHD/2-150..LMKWVE.............EYDA-SEVEANEVD.........LR-.................................
Q6ALU2_DESPS/17-166..LTGTYVGSTDCG.......LSAQ-GVEQIQAVA.AS........-P................................
Q9A6W6_CAUCR/3-145..WGGADE.....DPG.....LDEF-GLAQARAVA.DE......IL-S.....................L.P........
Q7V6P3_PROMM/5-151..HTGSTD.....L.P.....LLPQ-GEEEAKALA.PV......LK-.................................
Q22323_CAEEL/5-201KRADGWQGFAADTP.......LTEI-GYLQSKLTG.RA......LR-D................................
Q75FR3_LEPIC/10-168..LQGHLEI...S........INKQ-GKLQSKSLA.LI......LK-.................................
Q8G5W7_BIFLO/22-200..LQGWSN.....S.P.....LTES-GVADAVKAG.ER......LK-.................................
Q9X194_THEMA/2-156..WQGVTD.....V.P.....LNER-GREQARKLA.NS......LK-.................................
Q82CU3_STRAW/4-153..HTGRTD.....I.P.....LLEE-GRRGAKLLG..ERLHRAPFD-.................................
Q756M6_ASHGO/9-242..FCGWID.....A.H.....LTDK-GKDQARSSA..SLI..ASFC-R.....................E.H........
Q97JA1_CLOAB/3-152..YLGWTD.....V.E.....LNEK-GIAEAEMVR.DK......LR-.................................
Q72BT4_DESVH/21-170..AIGRT......PLP.....LSPE-GLRQAAALC.KV......MR-.................................
Q723D3_LISMF/42-225..VQGWSD.....A.V.....LTPA-GEEVVKSAG.KG......LK-.................................
Y525_MYCTU/6-158..LYGRLPG..FH........LSAT-GAAQAAAVA.DA......LA-.................................
O24559_MAIZE/141-292..VGGDTV.............LSET-GELYAKKLA.NFIE..KRLK-.................................
YL345_YEAST/293-466..YIHDEE.............LNEE-GIHYSQVLKDFV......LQ-RIKQK..............RQAK.KNSDS....
Q8DIP9_THEEB/22-190..VQGHSD.....A.S....LLTER-GRWMAAQVG.LA......LR-.................................
Q8EIT5_SHEON/52-156..TAGDPP.............LSAN-GNLRAQALI.SA......LK-.................................
Q724D7_LISMF/7-163..MQGWGD.....S.P.....LVAE-GIDGAKAVG.EV......LK-.................................
Q7P810_FUSNV/3-153..YFGKLN.....P.P.....LNDL-GINQAYEAK.NK......LL-.................................
Q829E2_STRAW/8-119..PQVSDH.....ERP.....LADR-GRTDAAVAG.RK......LA-D................................
Q9RXN2_DEIRA/7-157..WQGWTD.....N.P.....LGDA-GRAQARALR.EE......LA-.................................
Q7UH13_RHOBA/12-156..HTGSTD......MP.....LTPK-GERNATQLQ.GR......LE-.................................
Q72M33_LEPIC/2-151..CYGQTD.....I.P.....LISD-FNSEFQFLL.QK......IN-.................................
F263_RAT/248-395GKIGGDSG.............LSSR-GKKFANALS..K.....FVE-E................................
Q7MBR9_VIBVY/3-157..LQGHCN.....S.P.....LTEK-GQHQALSVG.RVLQ..AHLE-.................................
Q6AME6_DESPS/37-191..IQGCQD.....S.P.....LTAT-GSQTSALWG.PL......LQ-.................................
Q9RSI0_DEIRA/4-149..AHEWH..............LAPD-ALDGLPDLL.AR......LD-.................................
GPMA1_GLOVI/3-191..FTGWVD.....V.P.....LSER-GRAEATIAS.CK......LR-.................................
Q8LE79_ARATH/14-208..ERPWDP.......P.....LVQD-GMIRAFRTG.QR......IR-S.......................Q........
Q74HK7_LACJO/2-158..IQGSNV.....DPD.....LSKE-GRAYAEKAA.KN......FD-.................................
Q876B1_SACEX/5-177..EQPLSRTGIPNDLP.....LSDH-GINQSQELA.HY......LL-S................................
YQGD_SCHPO/55-208..VRGIRAGARIDSE......LTVH-GYNQAKKLA.KS......IR-.................................
YFFL_SCHPO/2-149..LQGSVDT...N........LNET-GRLQAKLLA.QR......LL-.................................
Q970Q5_SULTO/3-117..IEGKDDKD.RK........LVKK-GIKQMKRIA.TF......LD-E................................
Q7WY90_MYXXA/7-116..VLGDEA.....R.A.....LTPE-GRAAFRHHA.RK......LA-.................................
Q8EQG8_OCEIH/3-144..AEGQHP.....DAP.....LTNL-GLQQANELS.LF......LQ-N................................
Q7MWC4_PORGI/2-148..CYGQSD.....V.P.....LRAS-FEEEAEVVR.RR......LS-.................................
6P21_YEAST/398-572..IGGNSH.............LTPR-GLRFAKSLP.KF......IA-RQRE...............IFYQ.NLMQ.....
Q82C73_STRAW/18-172..FQGTTD.....V.E.....LTET-GVGQARRAA.RL......LA-.................................
Q87HE6_VIBPA/2-157..ADERCMTQLEKD.......YAPL-DRAYLSELH.QK......LT-.................................
UBS3A_HUMAN/397-595PRRSRGIKDFENDP.P.....LSSC-GIFQSRIAG.DA.....LLD-.................................
Q97ET5_CLOAB/4-158..FQGCHDI...N........LTDN-GIEQAKRVA.KR......LE-.................................
Q8YRV4_NOSS1/3-172.GRADVST.............LTER-GRSDASKVG..K.....ALT-.................................
Q88KP7_PSEPK/26-164..KNGRLHHTDDGI.......LPLA-HQSDADRSG.VQ........-.................................
Q752M0_ASHGO/18-169..IQGHKD.....T.A.....LNAV-GMQQAEQLG..R.....FLK-M................................
GPMA_BLOFL/5-191..FTGWIDV...D........LSNQ-GYSEAKRAG.QL......LK-K................................
Q6FD82_ACIAD/1-156..VNARCTSHASIA.......LTEH-GILQAEQLT.QQ........-.................................
Q6HEN0_BACHK/5-149..IQGRED.....I.P.....LNEV-GKKQASQSAAA.......LQ-.................................
Q878F8_STRPQ/2-160.GAGGDSP.............LLEE-AKDEIHLLG.KE......LA-.................................
Q87Q43_VIBPA/5-154..LHGQTD.............LKVK-EAEQQQIAM.AW........-K.......................T........
Q9FYE8_ARATH/21-178..IQGQIE.....S.D.....LNEV-GLKQAVAIA.ER......LG-.................................
PGAM5_XENTR/89-226..QDGKTDFD.RV........LTPL-GREQADLTG.KR......LS-S................................
YNK8_YEAST/5-175..PYPPPPTGIDNDVP.....LSEH-GVEQAHELA.NY......IS-K................................
Q7MA12_WOLSU/5-120..REAWKLDDLSRP.......LLPK-GHKKAEGLA.EL......LV-K................................
Q9ZAX0_AMYME/2-161..VAKKLDTALPGP.P.....LTEL-GHEQARQLA.EK......LA-.................................
Q9KCH8_BACHD/6-157..YNGWKDE...H........LSPN-GRAAAQMLS.QR........-.................................
YKJ2_SCHPO/9-173..HDVDENGVHREHDP....LLNDE-GRKQALQLQ.HD......LD-A................................
Q8XWS5_RALSO/2-152..CYGRTD.....L.P.....LDEP-MDPDAASIA.DK......LA-.................................
Q7VGN6_HELHP/3-123..DKSDIF.....R.P.....LSKL-GKTQSKHIA..H......LA-A................................
Q9CN14_PASMU/5-159..LQGNGD.....S.P.....LTQE-GIEGAKRTA.KA......LS-.................................
Y400_SYNY3/2-117..PDGDRQ.............LTKK-GKDKTQRVA.QR......LQ-A................................
Q8DJF9_THEEB/5-120..FAGSES.....DRP.....LTAK-GEKKTQQIA.QR......LL-N................................
Q6HFU7_BACHK/12-186..AQGWAD.....S.P.....LVEK-GVEVATNLG.TG......LK-.................................
Q6N4Q1_RHOPA/27-181..IYGQID.............IDCD-CSDRVVFDA.VSR...VL..-.................................
Q6LTK1_PHOPR/2-117..APSDAE.....R.P.....LTTR-GEQQSKQVA.SQLA..THLE-.................................
Q6CVE6_KLULA/56-257ALQPGVHEVTLVDA.Q.....LTEL-GKQQVRSTG.KELL..LPMV-E................................
Q930B9_RHIME/3-151..LQGQAD.....I.G.....LSAR-GEAQATALR.AT......IE-.................................
Q6KZ21_PICTO/2-149..LSHDIDN..NK........LTER-GIKQVERTA.EQ......LI-.................................
Q828M5_STRAW/15-174..LAGWTP.....GVA.....LDER-GAAQAAALP.GR......LA-.................................
UBS3B_MOUSE/374-572GFRDYEKD.....A.P.....ITVF-GCMQARLVG..E.....ALL-E................................
GPMA_METMA/6-194..LSGWID.....I.P.....LSRK-GIEEALECA.KA......LE-.................................
Q8G5N9_BIFLO/7-171..LQGQVD.....I.P.....LDAV-GEWQVKQTA.AA......LK-SL...................YV.DR.......
PGAM5_CAEEL/96-232..HLDHEV.....K.M.....LTPL-GREQAELLG.KR......LA-N................................
Q6MWZ7_MYCTU/7-154..HTGGTE.....V.E.....LTDT-GRTQAELAG..QLL..GELE-.................................
Q7V2G5_PROMP/228-384..FQGQIN......IP.....LNNN-GKDQAGKAS.KY......LE-.................................
Q8GWG7_ARATH/18-200..EKPESEKLFDAH.......LSPK-GLQQVSERRNQI......LE-S.......................G........
Q8DU47_STRMU/4-153..VQGWCD......SP.....LTDL-GITQAKLVR.DY......FQ-E................................
Q6MA06_PARUW/9-167..LQGHIDI...S........LNSS-GKIQARNLQ.KQ......LN-.................................
Q722Z3_LISMF/7-184..VQGWSD......TP.....LTNE-GIEVAEFLG.RG......LR-.................................
YO283_YEAST/18-173..LQGHKD.....T.S.....INPT-GEEQATKLG..H.....YLR-S................................
Q7XTB5_ORYSJ/18-214..VEGEKDHSAYMSPQLFDAHLTPL-GWNQVDCLR.EH......VK-K.....................S.G........
Q73JH0_TREDE/2-153..ACGVSE.....A.L.....LTEK-GKNQAKELA.ER......LA-A.....................E.Q........
Q6HF65_BACHK/4-150..DGGERTR...G........LTEK-GSLDVHKVT.DI......LK-.................................
Q830V5_ENTFA/2-160.GMTGDSP.............LLPT-SYDEIKQLG.QY......LQ-.................................
Q9A8K2_CAUCR/1-157..LQGRTE.....S.D.....LTPL-GLLQAQAMG.QLLG..DLVR-R................................
GPMA_BORBU/3-189..FTGWTDV...K........LSDK-GIDEAVEAG.LL......LK-Q................................
Q8TLM8_METAC/12-167..IGAWTDW...E........LTAL-GKQQAFNIG.EA......LR-K.......................E........
Q890L1_CLOTE/6-160..MQGWND.....S.P.....LTKL-GMEQAKRLG.KR......LD-.................................
Q9KSL6_VIBCH/3-151..LNGITD....V........AVKP-SVQQAIASQ.........LS-.................................
Q74L54_LACJO/3-97..LSNHNDLT.RD........LTPK-GIEDRKFLI.DY......FK-.................................
Q9KG30_BACHD/3-141..AEGQPP.....ESP.....LTNK-GLKQAIDLA.AF......FD-.................................
Q9CEL7_LACLA/2-151..LTGWLN.....S.P.....LTGT-GIQQSEILA.DK......LS-.................................
Q8IG34_CAEEL/84-241..YTRDTC.............ITRS-GAVLAQMIG.RG......LL-M................................
Q885W5_PSESM/4-154..LRGSLD.....D.A.....LTDL-GWQQMRSAV.ID........-.................................
Q8EI22_SHEON/5-200..LRGRVD.....V.P.....LSAK-GWRQMSAAV.AL........-.................................
GPMA1_NITEU/9-195..FTGWGD.....I.V.....LSPQ-GEQEALRAG.HL......LK-Q................................
Q89HY2_BRAJA/10-128..TDAPSGRDQDRR.......LDDR-GHRDAAEIG.DW......IA-S................................
Q73K38_TREDE/2-150..FSFDDS.....L.......LAEE-AYPMLDGLK.PK......LK-.................................
O69984_STRCO/6-166..SIGNVDDTVYEREPDHALALTDR-GRAQAEETG.EG......LR-E.......................V........
Q6FCM2_ACIAD/2-111..IDGNDT.....KRP.....LTAR-GHAQAKQTA.EY......LK-.................................
SHB17_YEAST/7-183..YTGLTD.....L.P.....LTPY-GEGQMLRTG.ESVFRNNQFL-.................................
Q6C9Q2_YARLI/4-181..WSKSGQHTSVTDLP.....LTEN-GVKRVRATG.RALVGRNRLV-.................................
Q8KG77_CHLTE/3-117..AQSDFDR...S........LTKQ-GRRQAEEMS.ER......LR-K................................
Q7NLX7_GLOVI/47-172..AQADTDTLNLDNIKAQ.RQLTAE-GRSQAKATG.ES......MR-A................................
Q7MTE1_PORGI/2-150..GFTDVD.............VRDT-FEEEAAAAC.AR......LK-.................................
Q8Z077_NOSS1/2-117..KTGIKDEE.RE........LTQE-GKQKTEKVA.YR......LV-K................................
GPMB_SHIFL/3-157..IQGQSD.....S.P.....LTAK-GEQQAMQVA.TR......AK-.................................
Q745R9_MYCPA/2-150..QGSDPD.............LSAD-GLAQIERLP.KA......LE-.................................
Q743X7_MYCPA/6-146..TDAMADGRFPADEP.....LNEL-GRRQVQPIA.AQ......LG-.................................
Q9AAS0_CAUCR/3-115..SGGDFE.....R.A.....LAES-GRADASLMG..RVL..AGLA-.................................
Q6C8W1_YARLI/9-209..IQGQTD.....I.P.....LNDE-GRRQARDCG.KKIR..EVLA-GFGDSVGADLD.FSDSVGDTDRN.SNSNRLSTP
Q79VT0_SALTM/49-158..RCDRSDMPCYSDKS....GITIT-GTEKAQQEG.IK......FA-T................................
Q97AR8_THEVO/3-140..LYGIISSDYDRY.P.....LTQY-GREQVTFIA.PK......LA-.................................
Q92WT9_RHIME/4-157..LAGRTG.....DVP.....LGIA-GREQAQRLA.AR......LA-.................................
Q97AG4_THEVO/21-171..WQGRSDS...D........ILPG-AIEKLLSSI.KS......IE-.................................
Q7NT51_CHRVO/7-162..LQGHTD.....I.P.....LNHA-GLEQASQLA.HA......FR-.................................
Q7VNP3_HAEDU/2-126..FNATSDSQ.RS........LTPL-GQQMAERQG.RW......LA-ER....................L.Q........
GPMA_CHLTR/3-186..FTGWVDI...P........LSQQ-GIQEAIAAG.ES......IK-.................................
Q6NB37_RHOPA/6-148..PKGVIH.....A.P.....DAPV-DLGDSAALG..A......LR-E................................
Q9RRC8_DEIRA/41-217..SEGRSA.....DPP.....LTEL-GHAQARALA.EFARTDETLR-.................................
Q9RVD2_DEIRA/22-177..MQGQVD.....T.P.....LDET-GQRQARLLA.AH......LR-R................................
Y2419_MYCTU/5-166..MQGQLDT...E........LSEL-GRTQAVAAA.EV......LG-.................................
A9CKF0_AGRT5/3-149..VPEWG..............LSER-GAERAREAS.RL........-P................................

PF00328

Q9BL40_CAEEL/16-290--------------G.FDR.....KETLIRSSDKDRCIET----AMGITQTLFPDDI.......................
PPA6_HUMAN/49-379--------------PTFNP.....QEVFIRSTNIFRNLES----TRCLLAGLF.QCQ.......................
PHYA_ASPFU/71-425--------------S.........VVPFIRASGSDRVIAS----GEKFIEGFQQAKL....................ADP
VIP1_CAEEL/363-914--------------LHSTY....RHDLKIYASDEGRVQTT----AAAFAKGLLALEGELTPILMQM.VKSANTDGLLDDD
Q22525_CAEEL/28-375--------------TRYNQ.....QEIFVRSTDKNRTLLS----AFSNMVGMYGNTAQENASI........AGVDYPDVV
Q6BUR8_DEBHA/63-396--------------DS........NTIPVFTTSNTRVYDT----SQSFIRGFMGQEY.......................
VIP1_HUMAN/390-910--------------LHSTF....RHDLKIYASDEGRVQMT----AAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDG
P90949_CAEEL/21-327--------------SNFSV.....KEVYLRSSDSDRALVS----AQAFLYGLYPASGG...................YQW
PPAX_CAEEL/28-365--------------HRYAA.....KEIYIRSTNLNRTIIS----AMSLLYGMFPPGAWN................IQGVD
Q6BWV9_DEBHA/521-1079--------------DAL.......KDVKVFTSSERRVIAS----AHLSTLALLGLDKEHEEL..........PDDFLIIR
VIP2_HUMAN/379-894--------------LHSTY....RHDLKIYASDEGRVQMT----AAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDS
VIP1_DROME/402-926--------------LHSTF....RHDLKIYASDEGRVQMT----AAAFAKGLLALEGELTPILVQM.VKSANTNGLLDND
PHYB_EMENI/70-422--------------K.........NTPFIRASGSDRVVAS----AEKFINGFRKAQL.....................HD
Q7SEH2_NEUCR/194-548--------------PN........TKIIARTTTQDRMLRS----AENFLAGMF.GLE.......................
Q7S8D6_NEUCR/949-1549--------------DIL.......EEVHVFSSSERRVVTS----AQIWAASFCKKKELPP..............DFITIR
ACPL2_DANRE/88-449--------------ADWLP.....RQLWAETTGKSRTLQS----GLAFLFGFL.PHF.......................
Q9U5U6_DROSU/56-354--------------SRYTN.....EDIFVQSTDVDRTLMS----AQSDLAGLYEPQGD...................DIW
PPA_ECOLI/29-375--------------KGCPQ....SGQVAIIADVDERTRKT----GEAFAAGLA.PDCAITVH..........TQADTSSP
Q6BM75_DEBHA/63-397--------------PD........KPLPVFAANYDRVALT----AQYFARGFLGQDY.......................
PHYA1_ASPTE/72-427--------------H.........INPFVRATDASRVHES----AEKFVEGFQTARQD...................DHH
A8BDL2_GIAIC/21-353--------------KEFDP.....SFFRLRSTDITRTRQS----LASQLLGWYGDSI.......................
PPAD_YEAST/66-400--------------NC........TNFPIFTTNSKRIYDT----AQYFAEALGDGFN.......................
Q6CZF4_ERWCT/34-372--------------SGCPA....EQQIYVLASPLQRTRAT----AQAYMDGMFPGCGVTTH............AVEDEKQ
Q96VH9_9HOMO/61-394--------------GG........DVPFVRAAGDQRVVDS----STNWTAGFGDASG.......................
Q19390_CAEEL/17-320--------------DTYQP.....RDFHVYTGKDNRTSAS----AQAMFAGFLPPNED...................QTW
VIP1_YEAST/538-1047--------------SIL.......QNIKIFSSSERRVLHT----AQYWTRALFGADELGS..............DEISIR
O93838_ASPNG/72-427--------------N.........IVPFIRSSGSSRVIAS----GNKFIEGFQSTKLK...................DPR
Q6FJ21_CANGA/510-1016--------------NIL.......QDIKIFSSSERRVLVS----AQYWATALFGADEFSS..............DEINIR
PHYB_ASPNG/72-404--------------GE........TVVPFFSSGYGRVIET----ARKFGEGFF.GYN.......................
PPA1_PICPA/74-409--------------TSEEG.....KKLSVWAGSQERVVDT----AKYFAQGFMKSNY.......................
Q8PF53_XANAC/34-377--------------DGC.......NQAYYWANRTQRTIAS----AQALASTLT.PGCA...................DPV
Q6CYI2_KLULA/67-401--------------..........NYTPVFTSSSGRVYQT----AKYAVSALEEELN.......................
Q6CWN2_KLULA/534-1048--------------NIL.......HNIKIFSSSERRVLVS----AQIWATALFGADEISS..............DEISIR
Q6CES1_YARLI/413-907--------------NLL.......KNVKCLSSSERRVIAS----AKIWAAAFL.GVEEVS.............DDFIVVR
Q6AVJ1_ORYSJ/361-950--------------LHSTY....RHDLKIYSSDEGRVQMS----AAAFAKGLLDLEGQLTPI..........LVSLVSKD
Q8SQJ1_ENCCU/48-332--------------DKKIK....KENIKMRATKIPRTHSS----LAGVMKGLT.GDT.......................
Q90XY1_TAKRU/74-416--------------EEKLR....AGMIKFITSSKHRCVNS----TLSFKAGLTELWA.......................
O17373_CAEEL/52-377--------------SSYNS.....KEVYIRSTDVNRTLVS----ALANLAGMFENGNRGA..............DYPDSK
Q757D1_ASHGO/560-1065--------------NIL.......RNIKIFSSSERRVLAS----AQLWAMALFGADELGS..............DEISIR
Q9APF7_LEGPN/24-324--------------EHYEY.....GTIYVRSTDYARTLMS----AQSLLMGLYPPGTGPS..............IPAGTS
Q8MY06_DROVI/44-342--------------A.RYD....REQVFVQSTDVDRTLMS----AQSNLAGLYEPVGN...................DVW
Q9GUF1_CAEEL/33-333--------------TNFNA.....SEVKYYSSSANRCQMT----LQVAIAGLHPPQTYN.................DWNT
Q9AAQ4_CAUCR/24-359--------------PGDC......ASVYAWANVTQRTIAT----AKAYRETLA.PGCPVT.............VNTVGEG
Q6YNE9_PENOX/62-418--------------D.........HVPFIRSSDSSRVVAS----GQLFIQGYEQSKAQ...................DCD
PPAL_HUMAN/32-330--------------TSYHR.....QEVYVRSTDFDRTLMS----AEANLAGLFPPNGM...................QRF
Q8I0P9_DROME/64-362--------------PIYSN.....ENIYVQSTDVDRTLMS----AQSNLAGLYEPQGE...................DIW
PPA6_MOUSE/42-371--------------PVYNP.....QEVFIRSTNMFRNLES----TRCLLAGLFQHQK.......................
Q19175_CAEEL/28-376--------------AVYDQ.....KTMYIRSTGINRTLIS----ATSNMLGMYGQDGYGSSA..........GTDFPDAQ
Q6GPK4_XENLA/34-333--------------ESYNR.....HEIYVRSTDVDRTLMS----AEANLAGLYPPKGS...................QIF
Q6CLW3_KLULA/69-406--------------..........DSLPIFSSSAGRVYET----AKNVIIGLQEELG.......................
Q95WU2_GIAIN/15-344--------------RRFVQ.....EAFYIRSTNYERTKQS----AMSFLIGMYPELG.......................
PHO11_CAEEL/25-364--------------PKYAS.....REVYFRSTNFNRTIIS----AQSLLYGLFPPSLYDV..............KNVDYP
Q8GD20_PSESX/30-365--------------NGCPA....PGEVFVRASPLQRTRAT----ASALLDGLF.PGCGLQP............SVVQGDQ
Q8PPX6_XANAC/29-351--------------SGCAG....TEQIVTIADSAARNHAS----AQALLQGMA.PGC......................A
PPA5_YEAST/65-399--------------NQ........TSFAVFTSNSKRCHDT----AQYFIDGLGDQFN.......................
Q9GNT0_9TRYP/33-338--------------STSYN....LSVSHTESTYVNRTIQS----AEGLLKGLF.PDE.......................
Q7YWJ0_MELIC/28-378--------------PRYNS.....HEIYVRSTDWNRTLTS----AISNFIGFYGPGNDDEY............PKDLGAN
PPA4_SCHPO/25-385--------------DELNN....YADVYMRATPMVRALES----LEHVFSGLY.PES.......................
Q19460_CAEEL/78-372--------------SFVKP.....NEMEWRSRDINRCLST----ASTVAAGMFKTEN.......................
PHYA_THIHE/65-447--------------K.........SIPFVRTAGQDRVVHS----AENFTQGFHSALLA...................DRG
Q8P330_XANCP/64-389--------------NGCPA....RGSLTVWANTDQRTIDS----GALLADALAPGCNVQA..............GHRAVG
PPA1_SCHPO/59-395--------------A.........STYNIYTAAQQRVVDS----ALWYGYGMF.GED.......................
ACP1_CAEEL/19-323--------------ARMLS.....SQLLFRSSPVERCLMT----LQTVGNTMF.PNA.......................
Q6TAQ8_9ENTR/42-388--------------DRCPT....ANDVYVWADVDQRTRKT----GEAFLAGLA.PEC.......................
Q6NY36_DANRE/54-394--------------ADHLR....ANRIEFMTSSKHRCVDS----VKAFQEGLHRLWD.......................
Q25327_LEIME/33-349--------------PYFPYSWYNLSISYTRSTDVLRTLQS----ANGLLQGLFPNMS.......................
PHYA_ASPOR/71-426--------------N.........VVPFIRASGSDRVIAS----GEKFIEGFQKAKLG...................DSK
Q96VF5_TRAPU/64-400--------------AD........ELPFVRASGSDRVVAT----ANNWTAGFALASS.......................
PPAP_HUMAN/34-332--------------ESYKH.....EQVYIRSTDVDRTLMS----AMTNLAALFPPEGV...................SIW
O00096_TALTH/69-423--------------N.........AVPFVRCSGSDRVIAS----GRLFIEGFQSAKVL...................DPH
Q6CSM6_KLULA/63-401--------------EN........STLELFTTNSKRVHDT----AAFFAEELDNAVK.......................
Q6CCS5_YARLI/180-538--------------EGSLLGKWSHDPIVIRATEQERIRDS----AQAWSEGFF.AKN.......................
Q19076_CAEEL/26-371--------------NKYNA.....KQIYVRSTDVNRTIIS----AMSNLLGQYGQNDNSSTP..........GLDYPDVD
Q9VW00_DROME/55-355--------------AYYQP.....DAIRAQSSESPRTLMS----MQMVLAGLFPPENT..................PMEW
O74677_PICAN/61-383--------------TS........SVLPIFAASEDRVVDT----ARSFGRGFFGPDY.......................
Q96VT0_9AGAR/59-411--------------KE........NLPFVRASSSNRVVDS----ATNWTEGFSAASH.......................
PHO5_CAEEL/30-322--------------EKFNR.....NAIYIRSSDYNRTLMS----AQANMAGLFPPKY.....................PI
Q9VD68_DROME/41-345--------------PNSLYT...QQQVNVLSSAAERCVMS----AQSVLAGMMPPLE....................NKN
ACPL2_HUMAN/87-424--------------NDWSA.....DQLYLETTGKSRTLQS----GLALLYGFLPDFD.......................
Q84TX6_ORYSJ/68-441--------------EEYHP.....DVYSIRATQVPRASAS----AVAFGLGLLSGKG.......................
Q8VQS2_KLEPN/30-355--------------D.........GGVDIRARQSAAAYAS----DRPGAGGWRLPRLRRR.............YPLCQRG
Q84WW3_ARATH/362-953--------------LHSTY....RHDLKIYSSDEGRVQMS----AAAFAKGLLDLEGQLTPI..........LVSLVSKD
Q57QN8_SALCH/30-362--------------GECPA....PDTVYAYANSLQRTVAT----AQFFITGAF.PGC.......................
Q9VW01_DROME/61-361--------------PYYRP.....DRLHAQATASPRAMMS----LQTTLASMFEPRGT..................PMEW
Q8X1W7_MONPU/76-407--------------GE........SIVPIFAAGYQRIIAT----SRKFGEGFFGANY.......................
PPA2_SCHPO/59-405--------------T.........DVYDINTAAQERVVDS----AEWFSYGMFGDDM.......................
VIP1_SCHPO/387-861--------------DCL.......KDVEIYTSSERRVSAS----AEIFAMAFLEQETIPS..............DLLKVR
PPA3_SCHPO/59-405--------------S.........YVYDINTAEQERVVES----AKWFTYGLFGDKM.......................
PPAT_HUMAN/31-338--------------PEYRR.....EEVYIRSTDFDRTLES----AQANLAGLFPEAA.....................PG
Q7WSY1_RAOTE/31-357--------------AGCPT....AESIYVRASPLQRTRAT----AQALVDGAFPGCGVAI..............HYVNGD
Q25332_LEIME/26-334--------------STRYN....SSVVHTRSTHTQRTIQS----ATAFLRGLFQDDYFYPV...........VYSTNRTT
AGP_PRORE/32-365--------------ELCPTS...NEDIYLYTNSLQRTIAT----AQFFAAGAF.PGC.......................
Q96VK8_9APHY/60-397--------------SD........NLPFIRSDGSDRVVDT----ATNWTAGFASASR.......................

PF00300

Q7QC58_ANOGA/471-664...............GVQIAR.......AYCSPSFRCIQT....ATS.VLE.............................
Q6BI57_DEBHA/3-214...........ESGSVRKNVF.......IHFSPYLRCCQT....ADLLVSDLKARFE..................EKYPN
Q6C210_YARLI/6-172..............NKDDTLL.......FYTSPYQRTRQT....TQL.ICE.............................
Q6BIM7_DEBHA/15-162...............DMQFDG.......FSTSDLIRCQNT....SKE.ILE.............................
Q6BJ83_DEBHA/95-281.............NNAPLPQS.......YYVSPMRRCLQTYNHTWSS.ILN.............................
Q9WWA7_AGRRK/32-170...............RSGVTR.......IVSSDLSRALET....AKI.AAR.............................
TIGRB_DANRE/5-190...............DLHFTN.......VFVSNLQRAIQT....AEIILGN.............................
Q6C0R4_YARLI/4-173..............IKPPIQR.......IYASPFYRCIET....ATP.TAD.............................
Q7SB57_NEUCR/5-199..............VDPPIER.......VYSSLYYRCLQT....VEPFVRAVSTSPSSLP...........EEAKEGTRH
PMGE_HUMAN/5-195..............LNFEFDL.......VFTSVLNRSIHT....AWL.ILE.............................
PMG2_YEAST/11-249..............NLRLPQI.......GYTSRLIRTQQT....IET.MCEEFKLKPQLQVVYD....FNKIKLGDEFGS
Q7U5E4_SYNPX/4-170...............EVPFDA.......IYSSPLQRAAST....TAS.LLEG............................
Q8XP82_CLOPE/2-158...............DIKIDK.......IFTSPIKRAKRT....AYL.IKG.............................
Q6FCF7_ACIAD/10-173..............TDRMIQH.......CISSPIQRCIDT....AALMIEG.............................
Q8DJJ5_THEEB/2-154...............LPRPNA.......IYTSPLQRCHDT....ATL.MNP.............................
Q9F3Q7_STRCO/2-156...............SEEIGA.......LYASTLVRTQLT....AAP.LAS.............................
Q720T2_LISMF/2-154...............NYSIDL.......VVTSDLMRVKQS....ANI.LSN.............................
Q7RS23_PLAYO/107-246..............NNKKISV.......IYHSDLIRAKET....AEI.ISK.............................
P96241_MYCTU/4-163..............GCRRPAL.......LAHSVAIRAYQT....AAV.VAA.............................
Q883Y2_PSESM/2-110...............GKPLQR.......ILASPYVRAQQT....AEL.VRQ.............................
Q74HS5_LACJO/3-176...............EVPFDI.......AISSDLKRASDT....CDYIINEN............................
Q9CEU3_LACLA/2-155...............PIEFDK.......VLSSPQKRALIT....ADL.LTN.............................
Q87CY4_XYLFT/2-158...............DVVIAR.......AVASPLLRAQYT....AQLALGE.............................
Q8Y237_RALSO/16-171...............REPFDA.......IYASDLSRARET....AQA.LAG.............................
GPMA_RHIEC/3-164..............LGISFDI.......AFSSALLRTVDT....CRAILNE.............................
Q8XXU8_RALSO/11-172..............ERIVFDR.......VIVSGLPRTVET....AQRVLAE.............................
Q6N2V9_RHOPA/3-118..............EHLMPDQ.......VLISTATRTRQT....WDV.LSE.............................
Q6FQW7_CANGA/5-175................DQPEM.......IFSSPFYRCLET....STP.IAEL............................
Q72JY3_THET2/2-111..............LGVALDL.......VLASPKRRARET....ADL.LAP.............................
Q6E597_XENNE/2-159...............NIPFQS.......IHCSERKRTRQT....AQI.ISPS............................
Q86HD1_DICDI/259-430..............ISEVFDR.......YYTSEYVRAMET....ASL.LGL.............................
A9CJY0_AGRT5/2-161..............RATDFD........YVASPLGRTRET....MEL.MRGA............................
Q8FUA9_COREF/10-122..............NIGPVDH.......VLCSTATRTRLT........................................
Q6ZG49_ORYSJ/77-245............................VELNEIGRQQAV...AVWYDIFQ.............................
Q6NEM7_CORDI/3-167................RDIRT.......VTCSIAIRTQQT....AVA.VLKSYEE......................TLG
Q87UC2_PSESM/3-156................HAPAL.......IVASPFSRAQAT....AMATVST.............................
O67797_AQUAE/3-157...............KENIQV.......LFSSPLKRTFKT....AKI.IGE.............................
Q9AAW6_CAUCR/25-130...............GARVST.......VLATPLKRTQQT....AQP.TAD.............................
Q8G0Q3_BRUSU/3-115..............TGLFPDR.......VVLSASVRTRET....AFG.LIER............................
PMU1_YEAST/55-227..............LGMLPHV.......FFSSPMRRCLET........FIE.............................
Q6MNJ9_BDEBA/2-119..............ELPRPTE.......LWVSPKKRTHST....FRP.LSQ.............................
Q8XLK3_CLOPE/2-156...............LPICKR.......NFTSGAKRANET....FNILYPN.............................
Q6BTP4_DEBHA/103-303..............GAPIPSK.......FYVSPLRRSCHTL.NYTWEDINI.............................
Q8PBP4_XANCP/19-193..............EHERPTL.......ILSSTYVRACQT....ALA.VAR.............................
O29260_ARCFU/2-108..............AGIRVER.......IYHSGKRRAEQT....AEI.VAK.............................
Q7YTB0_BOMMO/111-267..............AGVSIKH.......VYASPALRCVET....AQGFLDG.............................
Q8YLU6_NOSS1/32-195...............GICFDA.......VYVSSLKRAQET....AKE.ILEV............................
Q6FRI4_CANGA/10-264L....RGYKPNGKHMDDNII........FYTSPYKRTRET....LKG.VLE.............................
Q6HKL4_BACHK/3-144...............DKHIDV.......VISSPYKRAIQT....VQG.IAN.............................
Q6AAY7_PROAC/6-160...............GAELSA.......LVSSPLERARET....MAPIAAL.............................
AIS_ECOLI/55-165..............DIPDFD........LYSSNTVRTIQS....ATWFSAG.............................
Q8G4E1_BIFLO/4-202......ERTDTRQFE.EAPAAGR..RMVVMTSDLFRAQQT....AHA.FADIL..........................G
Q6BRZ2_DEBHA/5-194................LKPTI.......TYTSKLTRSIQT....GDIILEEL............................
Q83FQ2_TROWT/180-278...............PWAPEK.......IYCSPKQRCIQT....VHP.LSK.............................
Q6HBT6_BACHK/3-143..............HHPQIDH.......IISSPFVRAIDS....IRP.YAR.............................
Q83MP8_TROWT/3-153...............SRKVSA.......LYASPLLRTQLS....AKP.ISE.............................
Q726G1_DESVH/226-380...............RVEVTH.......IFTSTRRRSSMT....AAPLKAA.............................
Q8DRP1_STRR6/23-174..............LLSSAEI.......IVSSAVTRALET....ASYVVCA.............................
Q74L50_LACJO/4-181...............QVHFDK.......MYSSDLKRAIDT....VHL.IAD.............................
Q6MP54_BDEBA/2-119..............YVKEIDL.......IVSSPLTRARQT....AEI.ISQ.............................
Q6C302_YARLI/61-286..............PVPMPQA.......FYVSPFSRACDT....LAI.................................
Q6GB32_STAAS/4-153..............KGINFDL.......YASSTQERASDT....LEN.VAPN............................
Q7XSW9_ORYSJ/19-188.............ELGVPLDSV.....QIRYSPFSRTMET....ARE.VAR.............................
Q72VE8_LEPIC/2-114..............TGFKITK.......IYHSPYERTKNT....AKI.YTD.............................
Q98MW8_RHILO/4-147.................HADR.......AWTAPALRARQI....AEA.LS..............................
Q8CPX4_STAES/10-160..............KNIHFDY.......LYSSPQQRACDT....LENAVPN.............................
Q9CEX0_LACLA/3-144...............NVSIEQ.......IFSSPFQRSVRT....LNP.LAH.............................
Q9RWR4_DEIRA/2-154..............HPPGFDQ.......AYCSTLSRASET....AAL.VTA.............................
Q6HJQ4_BACHK/2-150..............ADFPPDF.......IWASTLKRARET....GET.LAE.............................
P73454_SYNY3/4-160...............QHPWQA.......VYVSPLQRARQT....VQP.LCD.............................
Q7P7V2_FUSNV/2-159...............DIKFDK.......FYSTSLKRANDT....ANY.IKG.............................
Q6BZ00_DEBHA/5-181..............AKEQPQF.......ILSSPFYRCVQT....SEP.ICD.............................
Q9BL94_CAEEL/8-173...............NAQISH.......TFASPFDRTIET....AST.IIE.............................
Q8YSV8_NOSS1/4-164...............GEKIAH.......IFASPFLRTVQT....ANA.VAE.............................
COBC_SALTY/2-156...............HAPFDR.......VLCSELERARHT....ARL.VLE.............................
Q86BN5_DROME/6-194..............SELEFDV.......VYSSVLSRSRQT....AEL.ILS.............................
YA03_SCHPO/8-174..............KQIPIDG.......IVCSPMRRTLQT....MEIALKK.............................
Q6HJT5_BACHK/4-158...............DLSIHA.......IYSSPSERTLHT....AEL.IKGER..........................D
Y2622_SYNP2/2-116..............LGLHFEG.......ILTSPLLRARQT....AEILAAA.............................
Q8P6B2_XANCP/4-152..............AAGEWDV.......VVASTLQRCALF....AAE.FAT.............................
Q74JW8_LACJO/2-163...............GTKFRA.......FYSSPLQRALTT....AVM.LRDD............................
Q82LG3_STRAW/4-147................PAADR.......VWVSPTARCRET....ASA.LGL.............................
Q74A29_GEOSL/2-115..............RRMSLDL.......IVTSPLVRAVQT....AEL.LAA.............................
Q8RA82_THETN/4-158...............GENIDC.......IYSSDLKRAYTT....AEI.ISK.............................
Q82W48_NITEU/2-106..............KLPKDTR.......IIVSPATRTQQT....VSA.LTH.............................
Q7BKI0_PRB01/3-117..............HSILVDK.......IFCSTAERTKQT....FDI.CSD.............................
Q722Z4_LISMF/8-186...............GTNFVA.......AYASDRGRAIET....ARI.VMKESD.......................NHH
Q7VY96_BORPE/3-161..............SEHPFAA.......LYSSDLKRAHDT....AAS.LSA.............................
Q6BUK7_DEBHA/10-192..............KPENLKN.......VFTSPRLRAKQT....VEL.LLE.............................
Q6LIL4_PHOPR/7-157.................SVDV.......VVTSSLQRCSDF....AQQ.TAK.............................
Q7S800_NEUCR/250-403..........GHEIR.LRPLT.......VWTSTRLRTIQT....ADP..LK.............................
Q6NJJ1_CORDI/5-157...............GHDVVA.......LYSSPLERAQET....AQP.FAE.............................
Q8DRV1_STRMU/2-148................LPVSN.......IYTSELIRTKQT....AQQ.LFPL............................
Q9FNJ9_ARATH/49-203...............DDSFDV.......CFTSPLKRSKKT....AEI.IWG.............................
Q98M20_RHILO/3-114..............RGYVPDL.......TLCSNARRAKET....LEG.LAG.............................
Q6SGN8_9BACT/3-117..............HQLAPQS.......IVASPARRAQLT........LFG.............................
PHOE_BACSU/3-146...............DFSWDI.......IVTSPLKRAKRT....AEI.INE.............................
P72649_SYNY3/132-291...............DVPINL.......GISSPMARPKET....AEIILQY.............................
Q8G5U1_BIFLO/6-177..............QQQLFDR.......YMVSPYVRTRET...AATMALPK.............................
Q93CQ7_LACSK/5-178...............KVNFAQ.......AYSSDRSRAMDT....AKIILKK.............................
Q6KZ44_PICTO/3-140...............SMNFDM.......IISSPVLRARET....ARI.IAN.............................
O04035_ARATH/11-189............GACGENWRV......YFYVSPYERTRTTL.REVGKGFSR.............................
A8B7W8_GIAIC/5-160...............DVKFDA.......IFYSRIPRAKET....AEAIRAN.............................
Q6PY96_9TRYP/451-652TCASTDTHNAYGFPDSPQRVV.......IWTSQLYRAIQTV.EKCEQ.LLG.............................
O06240_MYCTU/2-159...............DLPIRA.......VASSPMLRCQRT....VEP.LAE.............................
Q82LK1_STRAW/3-156...............SHHVGA.......AFVSPMRRARET....ARL.AGL.............................
Q8K620_STRP3/5-182..............ATIPFKA.......AFSSDSGRTMQT....IEIILRE.............................
O69483_MYCLE/173-327..............QRGGIAG.......VVSSPLQRAYDT....AAT.VAD.............................
Q73U87_MYCPA/36-190...............RKDYDS.......VYASTMTRAQQT....AAP.LAA.............................
Q89WM0_BRAJA/39-171..............LAIPIGD.......VYTSRLNRAIET....GKL.ISG.............................
Q7MLF0_VIBVY/2-151..............QHDDVEL.......IVSSPLSRCHEL....AEL.LGQ.............................
A9CJ67_AGRT5/8-120..............RRYRPDL.......ILSSTAARCRQT....TQA.................................
Q6CHK2_YARLI/4-192..............MHQQPTRV.....MVHTSPFLRCVQT....AAHIAEE.............................
Q7NMJ4_GLOVI/2-158...............TVAFGA.......AFCSPLQRARQT....VDLLLAG.............................
GPMA_CAUCR/3-186..............AGIEIDR.......LFTSVQTRAIRT....GNLALDA.............................
Q82HM5_STRAW/8-150...............DVPLAA.......IHHGPLPRAAQT....ARL.IGD.............................
Q92PF7_RHIME/10-122..............HRIRPDL.......ILCSTAVRCRQT....AEP.LYR.............................
SIXA_HAEIN/2-122.............LVINSLDR.......ILVSPYVRAQET....FHQ.VNQ.............................
GPMA2_LACJO/7-189.............IAEFAPTH.......IHTSVLSRAIMT....ANI.IAD.............................
Q6AJL1_DESPS/3-117..............AGLAFDL.......IISSPAKRARST....TRR.IAK.............................
Q7MUJ7_PORGI/236-394..............KKGKIDL.......IYTSPLLRCLET....AQV.IQQ.............................
Q746P6_THET2/2-140................LPSLP.......AFSSDLLRARQT....AEL.AGFS............................
Q97MM8_CLOAB/5-183...............DIEFKA.......FYSSDLGRAIKT....ARIVLGKN............................
O67630_AQUAE/20-173...............REKPEV.......IITSPQRRAYKT....ALT.LSD.............................
Q721Q6_LISMF/6-181...............ETEFVA.......AYSSDLHRTIAT....AGHLLKE.............................
PGAM5_DROME/88-228..............LGIKWDK.......VVASTMVRAQET....SDIILKQ.............................
Q826X4_STRAW/13-125..............ADLLPDL.......ALCSTAVRARQT....WEL.................................
Q94BY1_ARATH/44-166..............LGWLPQL.......ILSSDATRTRET....LKS.MQA.............................
Q6M6A8_CORGL/20-172...............EVPITA.......VYSSPMERAQET....AAPTVSAH............................
Q897L7_CLOTE/2-155...............NIELDK.......VYTSEMKRAIET....ANIILQDR...........................E
Q6A9K1_PROAC/2-175..............VSPRPTK.......LYASPMMRTIQT....ADP.VAE.............................
Q8G704_BIFLO/5-171..............QTNTISA.......VYSSPLDRTRET....ADAILDAL............................
Q72U60_LEPIC/3-113..............NGELPDR.......IVTGTLRRHLET....ADW.FMK.............................
Q7UQ84_RHOBA/2-196...............GLAIDQ.......LITSPFLRTLET....TRSILQH.............................
Q72H77_THET2/3-155..............SRISFDR.......LYASDLRRARQT....AEP.LAQ.............................
Q92L77_RHIME/11-123..............QGLAPDL.......ALVSTARRAQET....WEL.VAG.............................
Q748J5_GEOSL/23-177...............GVRIAA.......CYTSDLTRCVWG....AES.LAA.............................
Q6AAP8_PROAC/49-201..............LVPHGTP.......TIASDQKRAVQT....ARP.IAR.............................
Q6GC97_STAAS/2-167...............EKQIKH.......VYVSDLLRTQQT....FEHIFPY.............................
Q82ZR6_ENTFA/1-148..............QGIQIDR.......LLASPLKRAQET....ARK.IAE.............................
Q72G92_THET2/16-169...............GFPVAH.......VYAADSLAEAEA....ARL.FAE.............................
O68088_RHOCA/12-153................VGMAS.......LVCSPAARCQQT....AAA.LWPG............................
Q74HK6_LACJO/2-158...............NSKLDR.......VYASPLIRAKRT....AQI.LTD.............................
Q9KEW3_BACHD/2-150...............GIEWEK.......CYSSDLPRAIQT....AEA.VYD.............................
Q6ALU2_DESPS/17-166..............ALQEATR.......IIASPMLRCVQT....VAELTGK.............................
Q9A6W6_CAUCR/3-145..............EHERPSR.......VVSSPLRRCRET....AAP.LAE.............................
Q7V6P3_PROMM/5-151...............GVTFAA.......VLSSPLQRAIRTC.ALAELEIPA.............................
Q22323_CAEEL/5-201..............NGIEINH.......VFCSPALRCIQT....TVG.LLK.............................
Q75FR3_LEPIC/10-168...............RLGIEV.......LLSSDLKRAQET....SQI.ISD.............................
Q8G5W7_BIFLO/22-200...............GLTFAA.......AYCSDTTRAQQT....AEK.ILDI............................
Q9X194_THEMA/2-156.................RVDA.......IYSSPLKRSLET....AEE.IAR.............................
Q82CU3_STRAW/4-153...............GLFDAE.......IRTSPLARARET....CEL.AGFG............................
Q756M6_ASHGO/9-242..............GIEPPLV.......GYTSRLLRTIET....MQV.IMKELRRAAVFQT.........VVDTADALAV
Q97JA1_CLOAB/3-152...............DTKFDF.......VISSPLKRAKAT....AKI.IRD.............................
Q72BT4_DESVH/21-170...............QCRPAA.......LYASPASRARDT....LGPLLDE.............................
Q723D3_LISMF/42-225...............DVDFSA.......AYSSDSGRAIQT....ANL.ILKESDK......................SAD
Y525_MYCTU/6-158...............DRDIVA.......VIASPLQRAQET....AAP.IAA.............................
O24559_MAIZE/141-292...............CEKTAT.......IWTSTLQRTILT....ASP.IVGF............................
YL345_YEAST/293-466..........LVEVIDGSHDEDLKTSLIVWTGPRKRTHDT....ALF.FSK.............................
Q8DIP9_THEEB/22-190...............GIPIRK.......IYTSPLKRAQET....AEV.IHA.............................
Q8EIT5_SHEON/52-156...............RTPISQ.......LIATQYQRTQQT....LLPISTV.............................
Q724D7_LISMF/7-163...............DTPIDA.......VYTSTSKRTQDT....AAY.ILG.............................
Q7P810_FUSNV/3-153...............NIDYDK.......IYSSPLERAKQTA.EICNY.LDK.............................
Q829E2_STRAW/8-119..............TGIPVDL.......ALCSTATRTRET....WKLAVHE.............................
Q9RXN2_DEIRA/7-157...............GQTFDA.......VYSSDLTRARQT....AELALPG.............................
Q7UH13_RHOBA/12-156...............GIRFNE.......VWTSPLQRAKRT....CELAGYG.............................
Q72M33_LEPIC/2-151................VVFDL.......IYSSPSSRCRKL....SEF.LNN.............................
F263_RAT/248-395..............QNLKDLR.......VWTSQLKSTIQT....AEA.LRL.............................
Q7MBR9_VIBVY/3-157................SGSYR.......VYSSSLGRALQT....AEI.VCQQ............................
Q6AME6_DESPS/37-191...............RYSFDH.......LFSSPQGRAQAT....AAI.INR.............................
Q9RSI0_DEIRA/4-149................PRPDF.......VVCSEEPKAKAT....AQA.LAAA............................
GPMA1_GLOVI/3-191...............DYRVNV.......CFTSMLMRAIET....AVITLTECDDICGGKIPIIKHEADDENWHGWDNYDG
Q8LE79_ARATH/14-208..............IGFPIHR.......VFVSPFLRCLQT....ASEVVAALSAVNVDP.............NAMSSKDV
Q74HK7_LACJO/2-158...............PSQFDA.......VYASPLKRAQQT....ARIFVGD.............................
Q876B1_SACEX/5-177..............VDTQPDI.......IITSPFYSCVET....SQC.IAK.............................
YQGD_SCHPO/55-208...............NLDIVC.......VYSSPQKRAKRT....AEE.ITK.............................
YFFL_SCHPO/2-149...............PLDIDQ.......IFCSSMKRCRET....IAPYLEL.............................
Q970Q5_SULTO/3-117..............MGIKIDK.......VVSSPYLRAYQS....AEAILDK.............................
Q7WY90_MYXXA/7-116..............RLTPLRG.......IITSPLVRAVQT....AEL.LAE.............................
Q8EQG8_OCEIH/3-144..............TNESFCG.......IWSSPYLRAIDT....IKP.FSN.............................
Q7MWC4_PORGI/2-148...............GMDFDA.......VYTSPLSRCARL....AHF.CGY.............................
6P21_YEAST/398-572...........QKKNNENTDGNIYNDFFVWTSMRARTIGT....AQY.FNE.............................
Q82C73_STRAW/18-172...............SLKPDA.......IVASDLRRAAAT....ATE.LAA.............................
Q87HE6_VIBPA/2-157...............NAVFDDA....QAIICSPYTRALQT....AEI.LNR.............................
UBS3A_HUMAN/397-595..............SGIRISS.......VFASPALRCVQT....AKL.ILEELKL......................EKK
Q97ET5_CLOAB/4-158................GSFDC.......VYASPLKRAFNT....AKL.IAS.............................
Q8YRV4_NOSS1/3-172...............NISFKA.......IYTSPLQRAKQT....AEI.IHSELANE....................AVQS
Q88KP7_PSEPK/26-164............................LLSAPERRACET....AAW.LTG.............................
Q752M0_ASHGO/18-169..............HGVQFER.......VVCSDLRRCRET....IAQ.VLAHHAG......................APK
GPMA_BLOFL/5-191..............YKFIFDY.......GYTSVLKRTIHT....LWVILDQ.............................
Q6FD82_ACIAD/1-156...............LPLADR.......VFISPFLRTFQT....ARPLLLR.............................
Q6HEN0_BACHK/5-149...............AEAWDV.......IISSPLIRAQET....AKE.IAE.............................
Q878F8_STRPQ/2-160...............KVAFDA.......VYTSDLQRAMAT....AAI.ILDA............................
Q87Q43_VIBPA/5-154..............KGYDVAG.......IISSPLSRCHDL....AQI.LAE.............................
Q9FYE8_ARATH/21-178..............KEERPVA.......VYSSDLKRAKDT....ALM.IAK.............................
PGAM5_XENTR/89-226..............LGFKYNH.......IVYSTMTRAKET....TEI.ISK.............................
YNK8_YEAST/5-175..............LDVKPEM.......IFSSPFYRCLET....SKPTVEA.............................
Q7MA12_WOLSU/5-120..............RYPSIDV.......IFASPATRTKET....AQS.IAR.............................
Q9ZAX0_AMYME/2-161...............TEPVEA.......VYASHATRAQQT....AAP.LAQ.............................
Q9KCH8_BACHD/6-157...............MPLVDR.......VCSSDLTRACET....ASILFPG.............................
YKJ2_SCHPO/9-173..............EKLPIEL.......ILVSPMRRALET....MKIGFQH.............................
Q8XWS5_RALSO/2-152...............AHPPQR.......LLASPLQRSVLT....AQA.LAR.............................
Q7VGN6_HELHP/3-123..............QHLHFDV.......IFCSPAKRTQQT....LKP.LSK.............................
Q9CN14_PASMU/5-159...............NIDFTA.......AYSSVLPRAIST....ANM.ILA.............................
Y400_SYNY3/2-117..............IGVEFDL.......ILTSPLVRAQQT....AQILMDQ.............................
Q8DJF9_THEEB/5-120..............LGIEAEL.......ILASPLVRARQT....AEI.LLE.............................
Q6HFU7_BACHK/12-186...............DIHFMN.......AYSSDSGRAIET....ANL.VLKY............................
Q6N4Q1_RHOPA/27-181................PQNAV.......WYASKLKRTHMT....AEAIVAAG............................
Q6LTK1_PHOPR/2-117................GNLDL.......VWVSPYLRAQQT....WQV.MTA.............................
Q6CVE6_KLULA/56-257..............KIGFPEK.......FYSSPLRRCLET........YMESWGQ......................VFT
Q930B9_RHIME/3-151...............AMRPDH.......VIASDLLRARHT....AAL.LGY.............................
Q6KZ21_PICTO/2-149...............GLKIDR.......IVSSPVKRAAQT....ADI.IGK.............................
Q828M5_STRAW/15-174...............EVPVSE.......IVTSPLQRCRET....VQPLLDA.............................
UBS3B_MOUSE/374-572..............SNTVIDH.......VYCSPSLRCVQT....AHN.ILKGLQQ......................DNH
GPMA_METMA/6-194...............NIEIDI.......AFASDLVRTQET....LFIILSGQKKTGVVVHEKTE....DKVPPEKLDWYS
Q8G5N9_BIFLO/7-171.............RPEINHRF.......IVCSDLKRAHAT....AQA.FAD.............................
PGAM5_CAEEL/96-232..............SDIKFTN.......MTMSTMVRATET....ANI.ILK.............................
Q6MWZ7_MYCTU/7-154................LDDPI.......VICSPRRRTLDTA.KLAGL.TVN.............................
Q7V2G5_PROMP/228-384...............EINFNK.......AFSSSMDRPYET....AQIILQN.............................
Q8GWG7_ARATH/18-200..............LLNTVEL.......VITSPLCRAMET....SIGIFRGQG..........................Y
Q8DU47_STRMU/4-153..............KGITFDK.......VYSSTQERATDT....LKL.ITN.............................
Q6MA06_PARUW/9-167...............HINFAA.......AFSSDLSRARQT....AEI.VLE.............................
Q722Z3_LISMF/7-184...............ETPFDA.......IYTSDRGRTIET....AGIILRE.............................
YO283_YEAST/18-173..............RGIHFDK.......VVSSDLKRCRQT....TAL.VLKH............................
Q7XTB5_ORYSJ/18-214..............LAQKIEL.......VITSPLLRTMQT....AVGVFGG.............................
Q73JH0_TREDE/2-153..............DKNKIRV.......IYVSPLKRAVAT....AAY.IEK.............................
Q6HF65_BACHK/4-150...............TEGIDT.......FISSPYKRAVLT....IEK.TAN.............................
Q830V5_ENTFA/2-160...............DIPFEK.......IYSSPLLRAKNT....ARG.IQQE............................
Q9A8K2_CAUCR/1-157..............EPPAPWR.......LVASPLRRARRT....AEA.IGE.............................
GPMA_BORBU/3-189..............EGYSFDI.......AFSSLLSRANDT....LNIILRE.............................
Q8TLM8_METAC/12-167..............VTDQHYV.......MYASDLLRTKQT....ADI.VAS.............................
Q890L1_CLOTE/6-160...............NNNIDI.......IYSSPLGRAIKT....AKI.VRG.............................
Q9KSL6_VIBCH/3-151...............TLPFTR.......VISSPLRRCADL....ARLLQSA.............................
Q74L54_LACJO/3-97...............NKKLDV.......AFSSPFRRAIRT....IEP.VAK.............................
Q9KG30_BACHD/3-141...............NIKVER.......IISSPYKRAIQT....IQP.LAK.............................
Q9CEL7_LACLA/2-151...............SVKFDL.......ILSSDLQGAKET....AMI.ISN.............................
Q8IG34_CAEEL/84-241..............TDNTPDV.......IYCSPSLRCIQT....ATW.VRE.............................
Q885W5_PSESM/4-154...............GGPWDR.......IVSSPLQRCARF....SEE.LAQ.............................
Q8EI22_SHEON/5-200..............QVCECHG.......IYSSTSRRCAEF....AKV.LATKHASASVSSSF.......ASASSNCISSN
GPMA1_NITEU/9-195..............AGFTFDA.......CFCSELQRASDT....LAI.VQSV............................
Q89HY2_BRAJA/10-128..............HPPFPDT.......VLVSHAVRARQT....WDIAWAT.............................
Q73K38_TREDE/2-150...............DFSSFK.......VYSSPFKRALQT....AEY.LGL.............................
O69984_STRCO/6-166..............FGSERIS.......VYVSPYRRTHET....LRAFRLD.............................
Q6FCM2_ACIAD/2-111..............ELIVPDV.......FVVSPLLRAQETL.GHIQKFFPD.............................
SHB17_YEAST/7-183..............NPDNITY.......IFTSPRLRARQT....VDL.VLKPLSD......................EQR
Q6C9Q2_YARLI/4-181..............NPAYVEH.......IFVSPRSRAQQT....LKLFFED.............................
Q8KG77_CHLTE/3-117..............KGITPER.......LISSPAHRALET....AEI.FAD.............................
Q7NLX7_GLOVI/47-172..............LSIPIGK.......VISSKYSRATEA....AQL.................................
Q7MTE1_PORGI/2-150...............GLDPEA.......VFTSPLQRAAKL....AAF.CGY.............................
Q8Z077_NOSS1/2-117..............LGRQFDL.......IVTSPLIRARQT....AEILLAS.............................
GPMB_SHIFL/3-157...............ELGITH.......IISSDLGRTRRT....AEI.IAQ.............................
Q745R9_MYCPA/2-150...............RFPISR.......VVSSPQRRAVQT....AAP.VAA.............................
Q743X7_MYCPA/6-146.................GAAS.......YFVAPELRTRQT....AGL.LGC.............................
Q9AAS0_CAUCR/3-115................YEPDL.......FLVSSARRTRET....AEQ.VAA.............................
Q6C8W1_YARLI/9-209TA.APTTDWNPKNPFNGPISA.......VYTSDLKRCVET....TDILLAT.............................
Q79VT0_SALTM/49-158..............IFSEYD........IYSSNAVRTIQT....AKF.FSG.............................
Q97AR8_THEVO/3-140...............ELKFDG.......IITSPILRAVQT....ARI.IAN.............................
Q92WT9_RHIME/4-157...............GEGIGS.......IYASPRKRTQET....AAA.IAA.............................
Q97AG4_THEVO/21-171...............NEGINK.......IYSSCIGRAIKS....AAA.AAN.............................
Q7NT51_CHRVO/7-162..............PDHAFQA.......LYVSDLIRTRQT....SAP.LQT.............................
Q7VNP3_HAEDU/2-126.............AQQQILDK.......ILVSPLLRTQQT....LTY.INK.............................
GPMA_CHLTR/3-186...............HLPIDC.......IFTSTLVRSLIT....ALLAMTN.............................
Q6NB37_RHOPA/6-148..............KLPRDAA.......IFASPSRRTRDT....AAA.LGL.............................
Q9RRC8_DEIRA/41-217.................GLTH.......LYCSLTTRAVQT....AAP.LAA.............................
Q9RVD2_DEIRA/22-177..............LGVQAPR.......IHASDLSRAHAT....AEA.LHR.............................
Y2419_MYCTU/5-166...............KRQPLL.......IVSSDLRRAYDT....AVK.LGE.............................
A9CKF0_AGRT5/3-149..............WAKALRR.......IVSSAETKAIET....AHM.LAE.............................

PF00328

Q9BL40_CAEEL/16-290........VPVHTYSH..YKHDLLLKPNS.........VRCRRVDE...................LVNADKSWLSAQVDI
PPA6_HUMAN/49-379....KEGPIIIHTDEA....DSEVLYPNY.........QSCWSLRQ.....................RTRGRRQTASLQP
PHYA_ASPFU/71-425GATNRAAPAISVIIPE...SETFNNTLDH.........GVCTKFEA.....................SQLGDEVAANFTA
VIP1_CAEEL/363-914CQARLYQTELKRYLHKALQADRDFTPQDYLELNPNGLRAITAAMEF..................IKNPRKMCHEIAGYVE
Q22525_CAEEL/28-375GWPVGFVPIPIHTIPD....AEDHLLSVD.........NYCPLQDT.................IWNLAKTTDTVSNYFNS
Q6BUR8_DEBHA/63-396....DGRKVDTVILSEGSEMGANSLTPAS..........ACSAWDS......................EENKSILSQYSN
VIP1_HUMAN/390-910DSLSSCQHRVKARLHHILQQDAPFGPEDY.........DQLAPTRSTSLL.........NSMTIIQNPVKVCDQVFALIE
P90949_CAEEL/21-327SSDIDWQPLPVHASTP..GEPDLVCKPTA.........IKCARHEV...................LVAQGDQESNAYYSV
PPAX_CAEEL/28-365YPNDVDWQQGFTFIPVHVDGIDQCAVAQL.........CNCRRFQE.....................LQEKWAELDEVKN
Q6BWV9_DEBHA/521-1079KDLLDDSNAAKDLMDKVKKKLKPLIRQGA.........EAPPQFTWPPK...........MPQPFVVIKRVCQLMNYHQQ
VIP2_HUMAN/379-894DSLSSCQQRVKARLHEILQKDRDFTAEDY.........EKLTPSGSISLI.........KSMHLIKNPVKTCDKVYSLIQ
VIP1_DROME/402-926CDSSKYQNLAKGRLHELMQNDREFSKEDREL....INPCNSKSITQAL..............DFVKNPVDCCHHVHLLIR
PHYB_EMENI/70-422HGSKRATPVVNVIIPE...IDGFNNTLDH.........STCVSFEN.....................DERADEIEANFTA
Q7SEH2_NEUCR/194-548....WPNNVTLEVIIE..GSNLNNSLAGY.........MNCPNERE.....................DGLGSAARDIWVG
Q7S8D6_NEUCR/949-1549KDLLDDSNAAKDEMDKVKKKLKGLLRKGN.........ERPPQFAWPEN...........MPEPSEVQTRVVQLMNFHRK
ACPL2_DANRE/88-449.......DWSRLTVRQ...QWSTLFCGQS.........CDCPARNR.................YLDQEQRRQYRQRIADA
Q9U5U6_DROSU/56-354NPRIDWQPVPVHTVPE....KDDSILAAK.........ASCPAYDY..................ELATLEASSEFQALYV
PPA_ECOLI/29-375DPLFNPLKTGVCQLDNANVTDAILSRAGGSI....ADFTGHRQTAFRE.............LERVLNFPQSNLCLKREKQ
Q6BM75_DEBHA/63-397....DESNVEYVLIDEDGELGANSLTPRY..........GCKKFES..................DPHTDYVDGFSDQYLK
PHYA1_ASPTE/72-427ANPHQPSPRVDVAIPE...GSAYNNTLEH.........SLCTAFES.....................STVGDDAVANFTA
A8BDL2_GIAIC/21-353...SHKHLHPVINIQE....KDTDPLADQ.........SWCIAFSS....................VKKRLQVTNLDLIA
PPAD_YEAST/66-400........ISLQTLSENSSSGANTLAAKS..........SCPNWNS......................NANNDILMSYSR
Q6CZF4_ERWCT/34-372DPLFHGDKMGIGTLDPEQAKAAVLKAMGG.........DLDLAYQRLK..............PSIEQLKQIVCGEDKPCP
Q96VH9_9HOMO/61-394...ETVLPTLQVVLQE.....EGNCTLCN.........NMCPNEVD.........................GDESTTWLG
Q19390_CAEEL/17-320NYELKWQPVAQLTDES....IDWVSLGAI.........DNCPVYGEAQ..............RKSSEYAEVMDQMEKYDA
VIP1_YEAST/538-1047KDLLDDSNAAKDLMDKVKKKLKPLLREGK.........EAPPQFAWPSK...........MPEPYLVIKRVVELMNYHKK
O93838_ASPNG/72-427AQPGQSSPKIDVVISE...ASTSNNTLDP.........GTCTVFED.....................SELADDIEANFTA
Q6FJ21_CANGA/510-1016KDLLDDSNAAKDIMDKVKKKLKPLLREGK.........ETPPQFAWPAK...........MPEPYLVIKRVVELMNYHKK
PHYB_ASPNG/72-404....YSTNAALNIISE.SEVMGADSLTPT...........CDTDND......................QTTCDNLTYQLP
PPA1_PICPA/74-409......TDMVEVVALEEEKSQGLNSLTAR.........ISCPNYNS...................HIYKDGD.....FPN
Q8PF53_XANAC/34-377HHVPTGSSDVLFDGTAALRQPQARARMQAAI....AGRIGGDAQAWNA..............TQSDALDTLEHLLLQCAQ
Q6CYI2_KLULA/67-401......VQLDLQIIQENETAGANSLTPGD..........SCVSYNG..................DLGDEYFENVTLSYLT
Q6CWN2_KLULA/534-1048KDLLDDSNAAKDLMDKVKKKLKPLLRMGK.........EAPPQFAWPAK...........MPEPYLVIKRVVDLMNYHKK
Q6CES1_YARLI/413-907KGLLDDSNAAKDLMDKVKKELKPLLRKGT.........PPPPHFTWPDK...........IPEPFIVLQRVVELMKYHHK
Q6AVJ1_ORYSJ/361-950SSMLDGLEDASIEMDEAKARLHEIIITNAKA....KNTNEPVEFPWMVDGAGLPANASQLLPKMAKLTKEVTAQVKLLAE
Q8SQJ1_ENCCU/48-332............VVENVEVPENNDTLLNM.........LGCKTQKD.....................RDDVTKLFDRPSI
Q90XY1_TAKRU/74-416...........ISDQEIEHTVNDALMRFF.........DQCTRFVQEVD............GNPSALSEVESFRLGPEMR
O17373_CAEEL/52-377RWPTNWTPIPIHTLAEKDDPVGNVF.............APCARAEE..................LTRQIYAGSGFQKFVA
Q757D1_ASHGO/560-1065KDLLDDSNAAKDLMDKVKKQLKALLREGK.........EAPPQFAWPLK...........MPQPYLVIKRVVELMNYHKK
Q9APF7_LEGPN/24-324ALPHAFQPIPVFSAPSKYDEVIIQQVDRK.........ERKKLMEQ..................YVFSTREWQQKNNELK
Q8MY06_DROVI/44-342NPLIKWQPIPVHSVPE...KDDPVLAAKA..........PCPAFDY..................YLENFKASAEFQAKWA
Q9GUF1_CAEEL/33-333QRFDDWSPIPYTISDPILRMYSV...............KSCKKSDEV................WKPVDNDDLPELENLKN
Q9AAQ4_CAUCR/24-359NIDPMFEPVKAGIVKA.DHALARAAVAGR.........VGGDLTAWSA..............SHNQEAEQLDALLMQCDK
Q6YNE9_PENOX/62-418ADHSQDHAAINVLISE...APGANNTLNH.........NTCAAFEA.....................DKLGDQVSAKYTA
PPAL_HUMAN/32-330NPNISWQPIPVHTVPI...TEDRLLKFPL.........GPCPRYEQ..................LQNETRQTPEYQNESS
Q8I0P9_DROME/64-362NTDINWQPIPIHTSPE...REDPILAAKA..........PCPAYDY..................ELASLESSPEFKALTE
PPA6_MOUSE/42-371.......GSAVIHTDE...ASSEVLYPNY.........QSCWVLKE.....................KTRGRKKAAISQP
Q19175_CAEEL/28-376GWPRGFVPIPVHTVDYDSDHIGNMD.............CICPRREW.................LWNIAQQSDEMKNWRSS
Q6GPK4_XENLA/34-333NPNIPWQPVPVHTVPE...SEDQLLKFPL.........TNCPAYVK..................LQEETRQSVDYINMTR
Q6CLW3_KLULA/69-406....FNVDVQLQIISEDQASGANSLTPRN..........SCKNYNS..................EFAKQVLGSVNDSQLK
Q95WU2_GIAIN/15-344..QGSYHDGHQITMPAIHIAETDDWLELM..........DCPSMDK..................AKKYFSRDPDYVQLLE
PHO11_CAEEL/25-364YSPLTWFP.GFTFVPVHVDGPDQCAASQN.........CPCTRYDL.....................LQGQMLTLPEVLP
Q8GD20_PSESX/30-365DALFQADKMPFARLDPQRAEDSVLARMGG.........SVAGAQAR........................YQDAQQQLRK
Q8PPX6_XANAC/29-351MRYQALPEGERNALFDGGKAPAPPVRLEA.........ETRAQLAHLQ..............AVLSACQHGRCATAPPTR
PPA5_YEAST/65-399........ITLQTVSEAESAGANTLSACN..........SCPAWDY......................DANDDIVNEYDT
Q9GNT0_9TRYP/33-338.....NTFFPVVYTRY...DRGNVLQRSY.........SNPYTYAFLN..............LDVEWWRNVCNPTTDKFI
Q7YWJ0_MELIC/28-378KWPGWFFPIAIHSLPG....NEDFMAPGE.........SECKRFEQ....................IKERITLTEEYNST
PPA4_SCHPO/25-385...KRKMGLPVIFTRN...WSDENLLPNE.........NNCPRLVQ...................LYEEFAERAAKLYDP
Q19460_CAEEL/78-372...QIWLTVPIVTNLG...INDVLLNLPI.........RGCNFTRN..................SRIKQCPKTEKVNRDE
PHYA_THIHE/65-447STVRPTLPYDMVVIPE...TAGANNTLHN.........DLCTAFEE..................GPYSTIGDDAQDTYLS
Q8P330_XANCP/64-389SNDPLFRPIEAGAVPFDANAAVAAIQRET.........GGPAALLQGHGAE.......LQALQQILGCTKTPCEFARMPS
PPA1_SCHPO/59-395.....VHNFTNYILVSENATAGSNSLSSY.........NACPASDA.....................DDFTTPALEAWRN
ACP1_CAEEL/19-323.......TPPVQTVAK....PDDFLLVPK.........LDCDFQLGEW..............DNYFNLTESDKKMARKNP
Q6TAQ8_9ENTR/42-388.......HLSIHHQQDIKQVDSLFHPVKA.........GVCTMEKAQ...............VQQAVEQQAGMPIAQLNQ
Q6NY36_DANRE/54-394...........VQDMDYQHYVDDSLMRYF.........DHCEKFVEGVE............NNKTALKEVQRFKSSSEMD
Q25327_LEIME/33-349....TFFPAIHAVGRKEDVLLHSYMVPMI.........RARFNYAK..........................EELRAVCD
PHYA_ASPOR/71-426SKRGQPAPIVNVVITE...TEGFNNTLDH.........SLCTAFEN.....................STTGDDAEDKFTA
Q96VF5_TRAPU/64-400...NSITPVLSVIISE.....AGNDTLDD.........NMCPAAGD........................SDPQVNQWLA
PPAP_HUMAN/34-332NPILLWQPIPVHTVPL...SEDQLLYLPF.........RNCPRFQE..................LESETLKSEEFQKRLH
O00096_TALTH/69-423SDKHDAPPTINVIIEE...GPSYNNTLDT.........GSCPVFED.....................SSGGHDAQEKFAK
Q6CSM6_KLULA/63-401.......STHMNIISEDSSSGANNLSPGY..........SCLPWDE......................DENEEYLSKYSS
Q6CCS5_YARLI/180-538.......NDLFTLSLQPEKDGENATLASY.........FSCKNAYN..................NPKSVSGKQKEAEWID
Q19076_CAEEL/26-371GWPAGYVPIAVHTVDDDTDHLGNME.............STCPFKDQ.................VWELAKTSDEVKSFVNS
Q9VW00_DROME/55-355NQLLNWQPIPIVMEPE....ETDVHIRMK.........APCPRYDE..................SVLEVIELPEVKKLHA
O74677_PICAN/61-383.....ATSCSIQVVNETDTSKGANALTTK.........DNCPTYNS.........................SFYDYSFGD
Q96VT0_9AGAR/59-411...HVLNPILFVILSE.....SLNDTLDD.........AMCPNAGS........................SDPQTGIWTS
PHO5_CAEEL/30-322AGGLMWQPIPVHTISK....PTDKELYEE.........ASCPTAEI..........................EMNAQWKS
Q9VD68_DROME/41-345VLPIPWQPVAVNTLSR....NEDILLAQK.........KPCLKYDHI................LQKLYKSPPPELQKLNE
ACPL2_HUMAN/87-424.....WKKIYFRHQPS......ALFCSGS.........CYCPVRNQ.................YLEKEQRRQYLLRLKNS
Q84TX6_ORYSJ/68-441.KLGPVKNRAFSVLSE..SRASDICLRFF.........DSCETYKD....................YRKRKEPDVEKQKE
Q8VQS2_KLEPN/30-355CRSPVSDRQVRRHANRPRPPAGGGEREGR.........GSGAASAGLA..............PTIQLLKQAVCQADKSCP
Q84WW3_ARATH/362-953SSMLDGLDNASSEMEAAKAQLNEIITAGSKM....VHDHVSSELPWMTDGAGLPPHADEHLPELVKLAKKVTEQVRLLAQ
Q57QN8_SALCH/30-362.......DIPVHHQEKMGTMDPTFNPVIT.........DDSAAFRQQ...............AVQAMEKARSQLHLDESY
Q9VW01_DROME/61-361NKHLNWQPIPIVSEPL....DEDSLLLVR.........TPCPRYFE..................ALEEVFKRPEVIAETE
Q8X1W7_MONPU/76-407.....STNAAINIISEAKEMGANSLT............PTCDHDND......................TSTCNSLTTVWP
PPA2_SCHPO/59-405.....QNKTNFIVLPEDDSAGANSLAMYY..........SCPVYED.................NNIDENTTEAAHTSWRN
VIP1_SCHPO/387-861KDLLDDSNAAKDTMDKVKKHLKSLLRVGD.........TARKEFTWPEN...........MPKPCEVMQQVVQLMKYHRA
PPA3_SCHPO/59-405.....YEKTNFILISEGKAAGANSLSMYN..........ACPVFKD.................NNFHKNATDAAHAVWRN
PPAT_HUMAN/31-338SPEARWRPIPVHTVPV...AEDKLLRFPM.........RSCPRYHE..................LLREATEAAEYQEALE
Q7WSY1_RAOTE/31-357ADPLFQTDKFAATQTDPARQLAAVKEKAG.........DLAQRRQALE..............PTIQLLKVAVCQADKPCP
Q25332_LEIME/26-334ETLLSTDAVPSVVGRSWLDNPALHAALNP.........VIDEHLSW.....................DAIQSAAKDAWVE
AGP_PRORE/32-365.......KVNIHHQPEIGKMDPVFNPIIT.........NGSPEFKQK...............ALAAMDDYLKGLSLKAGY
Q96VK8_9APHY/60-397...NAIQPKLDLILPQ.....TGNDTLED.........NMCPAAGE........................SDPQVDAWLA

PF00300

Q7QC58_ANOGA/471-664.GLGLK.......................---------.............................ATVPICIEPGL..
Q6BI57_DEBHA/3-214YKVR.........................---------...............................FQLLGDFAL..
Q6C210_YARLI/6-172.GIEEK.......................---------............................NISYKVHEEPRL..
Q6BIM7_DEBHA/15-162.HHQ.........................---------..............................NIEVRYTQNL..
Q6BJ83_DEBHA/95-281.DTQ.........................---------...............................VPLIKELAR..
Q9WWA7_AGRRK/32-170.EIG.........................---------..............................ISAPLADARL..
TIGRB_DANRE/5-190.NLHS........................---------.............................SATEMILDPLL..
Q6C0R4_YARLI/4-173.HLD.........................---------...............................LAIYPEGGC..
Q7SB57_NEUCR/5-199CQRQ.........................---------...............................LRVRGETGI..
PMGE_HUMAN/5-195.ELGQ........................---------.............................EWVPVESSWRL..
PMG2_YEAST/11-249DDKDN........................---------.............................MKIPILQTWRL..
Q7U5E4_SYNPX/4-170RGGSAP.......................---------............................TPVFD....DGL..
Q8XP82_CLOPE/2-158.DKD.........................---------...............................IEVEEVEGL..
Q6FCF7_ACIAD/10-173.ADQ.........................---------...............................IKTHSNTHTIE
Q8DJJ5_THEEB/2-154.............................---------...............................CPDLKIQELAE
Q9F3Q7_STRCO/2-156.ATG.........................---------...............................LEVRVRAGI..
Q720T2_LISMF/2-154.............................---------...............................AKTLRFPAL..
Q7RS23_PLAYO/107-246.YFP.........................---------..............................NAKLINDPNL..
P96241_MYCTU/4-163.ELD.........................---------...............................MVAHEVAGI..
Q883Y2_PSESM/2-110.SLG.........................---------..........................................
Q74HS5_LACJO/3-176CNRDEL.......................---------............................QHIAT....PFF..
Q9CEU3_LACLA/2-155.............................---------...............................QSVSTDKRL..
Q87CY4_XYLFT/2-158.SRI.........................---------...............................AQLLIEPDL..
Q8Y237_RALSO/16-171.EVG.........................---------...............................KAVRDDTGL..
GPMA_RHIEC/3-164.TNGD........................---------..............................LLEPIRRTEL..
Q8XXU8_RALSO/11-172.............................---------....................................MPAM..
Q6N2V9_RHOPA/3-118.............................---------..........................................
Q6FQW7_CANGA/5-175L............................---------...............................EV....PVY..
Q72JY3_THET2/2-111.LLQ.........................---------..........................................
Q6E597_XENNE/2-159SILSLP.......................---------............................KIISD....YRL..
Q86HD1_DICDI/259-430....P........................---------..............................DADWLTEIQL..
A9CJY0_AGRT5/2-161MGLDPL.......................---------............................AYRTD....DRL..
Q8FUA9_COREF/10-122.............................---------..........................................
Q6ZG49_ORYSJ/77-245.............................---------...............................IAVVFDPAL..
Q6NEM7_CORDI/3-167IAPGTI.......................---------............................PLSIN....ADL..
Q87UC2_PSESM/3-156....F........................---------..............................PATPFETWPI..
O67797_AQUAE/3-157.EIG.........................---------...............................LEPIPEERV..
Q9AAW6_CAUCR/25-130.AAG.........................---------.....................................LVI..
Q8G0Q3_BRUSU/3-115LGID.........................---------...............................VE....TII..
PMU1_YEAST/55-227.SWT.........................---------.....................................PVLAE
Q6MNJ9_BDEBA/2-119.HLG.........................---------...............................LPLITQDAL..
Q8XLK3_CLOPE/2-156.............................---------...............................KKYEVIKEF..
Q6BTP4_DEBHA/103-303.............................---------...............................PKPIVNEKLRE
Q8PBP4_XANCP/19-193.AMGQ........................---------.............................PDTAVSVDERL..
O29260_ARCFU/2-108.HLG.........................---------...............................VEAKMAEGLDP
Q7YTB0_BOMMO/111-267.LRAD........................---------.............................PSVKIKVEPGLFE
Q8YLU6_NOSS1/32-195INFPQN.......................---------............................AVFID....EKL..
Q6FRI4_CANGA/10-264.VIDRYNELKSGINMCAEQTYNPYGKQKH---------AIWPHDLENSGIYENDESTHCGPEREGTYIRYRIIDEPRL..
Q6HKL4_BACHK/3-144.TYH.........................---------...............................VSIEIEEDL..
Q6AAY7_PROAC/6-160.HPG.........................---------...............................LEVRIDSDVIE
AIS_ECOLI/55-165.............................---------...............................KKLTVDKRL..
Q8G4E1_BIFLO/4-202LPVT.........................---------...............................CD....QRL..
Q6BRZ2_DEBHA/5-194GRLW.........................---------...............................CDVVKTWRL..
Q83FQ2_TROWT/180-278....T........................---------..............................GIDVLNDPAL..
Q6HBT6_BACHK/3-143.QAN.........................---------...............................LSIQEDERL..
Q83MP8_TROWT/3-153.ALN.........................---------...............................LEIKTDNRL..
Q726G1_DESVH/226-380.RPD.........................---------...............................CRIMALPEF..
Q8DRP1_STRR6/23-174....T........................---------..............................GLPLRVEPLL..
Q74L50_LACJO/4-181.TNEVS.......................---------............................EIGKI....KKLPA
Q6MP54_BDEBA/2-119.............................---------...............................IY.........
Q6C302_YARLI/61-286.TWGFE.......................---------............................TKHIQPRDEERL..
Q6GB32_STAAS/4-153QSYQ.........................---------...............................RF....KGL..
Q7XSW9_ORYSJ/19-188.VLGVP.......................---------............................FDTPSCIPAVEL..
Q72VE8_LEPIC/2-114.ILQ.........................---------..........................................
Q98MW8_RHILO/4-147.............................---------...............................LEAAVEPLL..
Q8CPX4_STAES/10-160.............................---------...............................QQYWCVKDL..
Q9CEX0_LACLA/3-144.SKN.........................---------...............................LEIQLISDF..
Q9RWR4_DEIRA/2-154.PLG.........................---------...............................LVPMPSDLL..
Q6HJQ4_BACHK/2-150.GIG.........................---------...............................CPVQLEEEL..
P73454_SYNY3/4-160.RLG.........................---------...............................IEMQIRPGL..
Q7P7V2_FUSNV/2-159.NRK.........................---------...............................QEVEIFDDF..
Q6BZ00_DEBHA/5-181.MLS.........................---------...............................VPLVLERGV..
Q9BL94_CAEEL/8-173.DKG.........................---------...............................MKVKADGGL..
Q8YSV8_NOSS1/4-164.ILD.........................---------...............................LPINLETGL..
COBC_SALTY/2-156.GRD.........................---------...............................VPQHILPEL..
Q86BN5_DROME/6-194.KLNC........................---------.............................AYVPIKEDWRL..
YA03_SCHPO/8-174.YLAEGG......................---------............................PDKVPVYISPFF..
Q6HJT5_BACHK/4-158IPII.........................---------...............................AD....EHF..
Y2622_SYNP2/2-116.ELG.........................---------...............................PHPQVFQGL..
Q8P6B2_XANCP/4-152.ARG.........................---------...............................LPLQLDPRL..
Q74JW8_LACJO/2-163MGIT.........................---------...............................VPVIIDDRL..
Q82LG3_STRAW/4-147.TAM.........................---------...............................EA....PEL..
Q74A29_GEOSL/2-115.GLD.........................---------...............................YD....GELAV
Q8RA82_THETN/4-158.EIN.........................---------...............................APIVKIEEF..
Q82W48_NITEU/2-106.............................---------..........................................
Q7BKI0_PRB01/3-117.............................---------..........................................
Q722Z4_LISMF/8-186LKLE.........................---------...............................KL....AEM..
Q7VY96_BORPE/3-161.ALQ.........................---------...............................LRVRTEPGI..
Q6BUK7_DEBHA/10-192.GLNDMA......................---------............................KAKLLTTEEDNL..
Q6LIL4_PHOPR/7-157.............................---------...............................QHSVPLHLLDC
Q7S800_NEUCR/250-403.EQG.........................---------...............................YNVRQRSQM..
Q6NJJ1_CORDI/5-157.TLG.........................---------...............................LDVRIDDRLLE
Q8DRV1_STRMU/2-148QSYQ.........................---------...............................ID....KRL..
Q9FNJ9_ARATH/49-203.SRE.........................---------...............................SEMIFDYDL..
Q98M20_RHILO/3-114.QTD.........................---------..........................................
Q6SGN8_9BACT/3-117.............................---------..........................................
PHOE_BACSU/3-146.YLH.........................---------...............................LPIVEMDDF..
P72649_SYNY3/132-291.HPS.........................---------...............................IELDLQPEL..
Q8G5U1_BIFLO/6-177.............................---------...............................AKWEENRVL..
Q93CQ7_LACSK/5-178.SFYL........................---------..............................DTPYTITPHF..
Q6KZ44_PICTO/3-140.ETN.........................---------...............................LKLKIDDRA..
O04035_ARATH/11-189.KRV.........................---------...............................IGVREECRI..
A8B7W8_GIAIC/5-160.QPQ.........................---------...............................ARFEEEPLV..
Q6PY96_9TRYP/451-652.............................---------...............................IKTTRCHSL..
O06240_MYCTU/2-159.ALC.........................---------...............................LEPLIDDRF..
Q82LK1_STRAW/3-156.............................---------...............................DGARVDADL..
Q8K620_STRP3/5-182.SENE........................---------..............................FLPYTKDNRI..
O69483_MYCLE/173-327.LLG.........................---------...............................ANLTVDDDL..
Q73U87_MYCPA/36-190.ELG.........................---------...............................KQVEVLPGI..
Q89WM0_BRAJA/39-171.............................---------...............................REVRPVDAL..
Q7MLF0_VIBVY/2-151.QHH.........................---------...............................WPIQLQADL..
A9CJ67_AGRT5/8-120.............................---------..........................................
Q6CHK2_YARLI/4-192.LIGC........................---------..............................NPKIRMDAAL..
Q7NMJ4_GLOVI/2-158.RSP.........................---------...............................VVVEYCESL..
GPMA_CAUCR/3-186.AKQS........................---------..............................FVPVTKDWRL..
Q82HM5_STRAW/8-150.RLK.........................---------..............................EVPVRAAEAA..
Q92PF7_RHIME/10-122.AFG.........................---------..........................................
SIXA_HAEIN/2-122.AFD.........................---------..........................................
GPMA2_LACJO/7-189.VCSF........................---------.............................LYLPITKTWRL..
Q6AJL1_DESPS/3-117.RLG.........................---------.....................................YPR..
Q7MUJ7_PORGI/236-394.KVQ.........................---------...............................SHLLKNDDL..
Q746P6_THET2/2-140PRLY.........................---------.....................................PEL..
Q97MM8_CLOAB/5-183KRSENA.......................---------............................ELKEV....PEL..
O67630_AQUAE/20-173.VLG.........................---------...............................IDLIVDERI..
Q721Q6_LISMF/6-181.NKH.........................---------...............................AFGLTLEPLSE
PGAM5_DROME/88-228.............................---------...............................IDFEKEKVV..
Q826X4_STRAW/13-125.............................---------..........................................
Q94BY1_ARATH/44-166.QV..........................---------.....................................DGF..
Q6M6A8_CORGL/20-172G............................---------...............................LELTVEPGL..
Q897L7_CLOTE/2-155YKIT.........................---------...............................KD....NRL..
Q6A9K1_PROAC/2-175.ALD.........................---------...............................LPIIINDLI..
Q8G704_BIFLO/5-171NPVR.........................---------...............................EARGEAPLMLT
Q72U60_LEPIC/3-113.............................---------..........................................
Q7UQ84_RHOBA/2-196.AHAPPRRY....................---------.........................PVSVWHDVFENGGCYHG
Q72H77_THET2/3-155.VLG.........................---------...............................LPIATTPLL..
Q92L77_RHIME/11-123.ALP.........................---------.....................................HKI..
Q748J5_GEOSL/23-177.HLN.........................---------...............................VQPQRHPEL..
Q6AAP8_PROAC/49-201.VLG.........................---------...............................VQVMTDPRL..
Q6GC97_STAAS/2-167.............................---------..............................DIASTTTPLL..
Q82ZR6_ENTFA/1-148.RNQ.........................---------...............................LTIETEPRL..
Q72G92_THET2/16-169.ALG.........................---------...............................VPYTLLPEL..
O68088_RHOCA/12-153VEPR.........................---------...............................LD....ARL..
Q74HK6_LACJO/2-158..FQ.........................---------...............................KEIITDDRL..
Q9KEW3_BACHD/2-150.............................---------...............................GEIERMEAL..
Q6ALU2_DESPS/17-166.............................---------...............................YQVSYHPLL..
Q9A6W6_CAUCR/3-145.ALG.........................---------...............................VALVIDPRV..
Q7V6P3_PROMM/5-151.EIM.........................---------.....................................PEL..
Q22323_CAEEL/5-201.GMGLD.......................---------.............................KRIQFSVEPGL..
Q75FR3_LEPIC/10-168.ELN.........................---------...............................LNPIFNPGF..
Q8G5W7_BIFLO/22-200NEAA.........................---------...............................GN....PRPAL
Q9X194_THEMA/2-156.RFE.........................---------...............................KEIIVEEDL..
Q82CU3_STRAW/4-153DRAT.........................---------...............................SW....DPL..
Q756M6_ASHGO/9-242VDKVTA.......................---------............................AGQTPVLQVWTL..
Q97JA1_CLOAB/3-152.............................---------...............................TNIIYEDAL..
Q72BT4_DESVH/21-170.............................---------...............................CTVHLIDDM..
Q723D3_LISMF/42-225KEVQ.........................---------...............................TD....PRF..
Y525_MYCTU/6-158.RHD.........................---------...............................LAVETDPDL..
O24559_MAIZE/141-292PKIQ.........................---------..............................W......RAL..
YL345_YEAST/293-466....E........................---------..............................GIKVQQRSEL..
Q8DIP9_THEEB/22-190.QLQNP.......................---------............................ELKPP....HALDL
Q8EIT5_SHEON/52-156.............................---------..........................................
Q724D7_LISMF/7-163.DRE.........................---------...............................IEIQPLEEL..
Q7P810_FUSNV/3-153.DII.........................---------...............................FD....SNL..
Q829E2_STRAW/8-119.............................---------...............................LPHRPKTVY..
Q9RXN2_DEIRA/7-157.............................---------...............................RALRLDARL..
Q7UH13_RHOBA/12-156.............................---------...............................ERARVVTEL..
Q72M33_LEPIC/2-151.QYL.........................---------...............................SKLEYSDLL..
F263_RAT/248-395.PYE.........................---------...............................QW....KAL..
Q7MBR9_VIBVY/3-157LGYAVD.......................---------............................EIIAD....DRL..
Q6AME6_DESPS/37-191.SLG.........................---------...............................LETIVHRAL..
Q9RSI0_DEIRA/4-149LGVP.........................---------...............................CR....PMLGL
GPMA1_GLOVI/3-191DPAAEL.......................---------............................PIYPT....ATL..
Q8LE79_ARATH/14-208PSIDK........................---------.............................SKLKVSIELGL..
Q74HK7_LACJO/2-158.............................---------..............................KTPIITDKRI..
Q876B1_SACEX/5-177.LLD.........................---------...............................IPVYLDNGL..
YQGD_SCHPO/55-208.VAN.........................---------...............................CPLYISDFL..
YFFL_SCHPO/2-149.KPE.........................---------...............................VPIVYTDLI..
Q970Q5_SULTO/3-117.............................---------.....................................MGV..
Q7WY90_MYXXA/7-116.............................---------..........................................
Q8EQG8_OCEIH/3-144.YLN.........................---------...............................LEINIDDRL..
Q7MWC4_PORGI/2-148.............................---------...............................PDAIQDGRL..
6P21_YEAST/398-572....D........................---------..............................DYPIKQMKML..
Q82C73_STRAW/18-172.LTG.........................---------...............................LDVTHDEGL..
Q87HE6_VIBPA/2-157.RHG.........................---------...............................FELFVEHDL..
UBS3A_HUMAN/397-595IKIR.........................---------...............................VE....PGI..
Q97ET5_CLOAB/4-158.TKG.........................---------...............................ISPIIEDDL..
Q8YRV4_NOSS1/3-172ADVQ.........................---------...............................IS....ELL..
Q88KP7_PSEPK/26-164.AVQ.........................---------...............................IE....PGL..
Q752M0_ASHGO/18-169TELT.........................---------.....................................EGL..
GPMA_BLOFL/5-191.LNQT........................---------..............................WLPIQKVWQL..
Q6FD82_ACIAD/1-156DHLQ.........................---------.....................................PEVVE
Q6HEN0_BACHK/5-149.ATG.........................---------..............................LQSILLDERF..
Q878F8_STRPQ/2-160FDQQ.........................---------...............................PKLYHTDQL..
Q87Q43_VIBPA/5-154.QQL.........................---------...............................LPMTTEDDL..
Q9FYE8_ARATH/21-178.TCFCP.......................---------............................EVIEV....PDL..
PGAM5_XENTR/89-226.............................---------...................................YLPDV..
YNK8_YEAST/5-175....L........................---------..............................KIPLYVDRGV..
Q7MA12_WOLSU/5-120.............................---------..........................................
Q9ZAX0_AMYME/2-161.ALG.........................---------...............................MTVKRVEGV..
Q9KCH8_BACHD/6-157.............................---------...............................HEIQAFPEF..
YKJ2_SCHPO/9-173.YIED........................---------.............................KHIPVKVIPLLQD
Q8XWS5_RALSO/2-152.ATR.........................---------..............................LPMPELDARL..
Q7VGN6_HELHP/3-123.YVR.........................---------..........................................
Q9CN14_PASMU/5-159.HKT.........................---------...............................TPLICHAGL..
Y400_SYNY3/2-117.GLA.........................---------.....................................PQL..
Q8DJF9_THEEB/5-120.............................---------..........................................
Q6HFU7_BACHK/12-186SEQSKL.......................---------............................KLEQR....KKL..
Q6N4Q1_RHOPA/27-181FPRP.........................---------...............................DTITQDADL..
Q6LTK1_PHOPR/2-117.ELP.........................---------..........................................
Q6CVE6_KLULA/56-257SELVSS.......................---------............................STEVS....VYV..
Q930B9_RHIME/3-151.............................---------...............................PHAQLSPAL..
Q6KZ21_PICTO/2-149.IIN.........................---------...............................VNVVYDDRL..
Q828M5_STRAW/15-174.RPG.........................---------...............................LRAHTEERI..
UBS3B_MOUSE/374-572LKIR.........................---------...............................VE....PGLFE
GPMA_METMA/6-194YPEKLG.......................---------............................EDLIPVYTTPAL..
Q8G5N9_BIFLO/7-171.VLGGI.......................---------............................EPVDD....RRV..
PGAM5_CAEEL/96-232.HLP.........................---------.....................................DDLTR
Q6MWZ7_MYCTU/7-154.EVT.........................---------.....................................GLL..
Q7V2G5_PROMP/228-384.KSD.........................---------...............................LEIKKIENL..
Q8GWG7_ARATH/18-200VNIS.........................---------...............................EDFAKANNFPP
Q8DU47_STRMU/4-153.............................---------...............................QSYQQLKGL..
Q6MA06_PARUW/9-167.SKD.........................---------...............................IKIEETAVL..
Q722Z3_LISMF/7-184.SKQT........................---------..............................HLEINELRDF..
YO283_YEAST/18-173SKQENV.......................---------............................PTSYT....SGL..
Q7XTB5_ORYSJ/18-214.ENS.........................---------...............................VDGVSAPPL..
Q73JH0_TREDE/2-153.ALG.........................---------...............................IKAVIDDRL..
Q6HF65_BACHK/4-150.LYE.........................---------...............................REILIYENL..
Q830V5_ENTFA/2-160LTHP.........................---------...............................VEIVYTDTL..
Q9A8K2_CAUCR/1-157.HLG.........................---------...............................LAVDFDERL..
GPMA_BORBU/3-189....LG.......................---------............................QSYISVKKTWRL..
Q8TLM8_METAC/12-167.SLE.........................---------...............................IVPIYKKEL..
Q890L1_CLOTE/6-160.ERD.........................---------...............................IPIVCDNRL..
Q9KSL6_VIBCH/3-151.RPH.........................---------...............................VMLDFDPQL..
Q74L54_LACJO/3-97.............................---------..........................................
Q9KG30_BACHD/3-141.KLN.........................---------...............................VEIEINSQL..
Q9CEL7_LACLA/2-151.KIG.........................---------...............................ALLLFEPLL..
Q8IG34_CAEEL/84-241.MSGS........................---------..............................KALLRVEPGLFE
Q885W5_PSESM/4-154.RLS.........................---------...............................LPLQLEPGL..
Q8EI22_SHEON/5-200NFAAPT.......................---------............................SSPLEVSLLEDL..
GPMA1_NITEU/9-195MGLNHL.......................---------............................STYRT....WRL..
Q89HY2_BRAJA/10-128.............................---------..........................................
Q73K38_TREDE/2-150.............................---------...............................KNIQTDKRL..
O69984_STRCO/6-166.PDL.........................---------...............................IRIREEPRL..
Q6FCM2_ACIAD/2-111.............................---------...............................VPVLLCDKI..
SHB17_YEAST/7-183AKIRV........................---------..............................VVD....DDL..
Q6C9Q2_YARLI/4-181.EPEAL.......................---------.............................AKIPQTVTEDI..
Q8KG77_CHLTE/3-117.............................---------..........................................
Q7NLX7_GLOVI/47-172.............................---------.....................................AGF..
Q7MTE1_PORGI/2-150.............................---------...............................PDAIRDDRL..
Q8Z077_NOSS1/2-117.............................---------..........................................
GPMB_SHIFL/3-157.ACG.........................---------...............................CDIIFDSRL..
Q745R9_MYCPA/2-150.DRG.........................---------...............................LSVEIDDRF..
Q743X7_MYCPA/6-146.............................---------................................DGAPEPLL..
Q9AAS0_CAUCR/3-115.HFS.........................---------..........................................
Q6C8W1_YARLI/9-209AGID.........................---------...............................TKAARTPLL..
Q79VT0_SALTM/49-158.............................---------..........................................
Q97AR8_THEVO/3-140.KCG.........................---------...............................LEILTDDRV..
Q92WT9_RHIME/4-157.ASDVA.......................---------............................EVVTT....EAL..
Q97AG4_THEVO/21-171.VLG.........................---------...............................LNSIFLDCRFN
Q7NT51_CHRVO/7-162.RLQ.........................---------...............................LNAHYTPQL..
Q7VNP3_HAEDU/2-126.............................---------......................................GM..
GPMA_CHLTR/3-186.HSSQKVPYIVHEERPD............---------..................MSRIHSQKEMEQMIPLFQSSAL..
Q6NB37_RHOPA/6-148.EPH.........................---------...............................LD....PDF..
Q9RRC8_DEIRA/41-217.VLG.........................---------...............................LGVQGLTHAHE
Q9RVD2_DEIRA/22-177.ELG.........................---------...............................GTLATFPEL..
Y2419_MYCTU/5-166.RTG.........................---------...............................LVVRVDTRL..
A9CKF0_AGRT5/3-149.TSG.........................---------...............................AAIEIIEAM..

PF00328

Q9BL40_CAEEL/16-290EHRDLFS.........LLSQK...................................TG...W.HVTGSKISDVFNVLYRK
PPA6_HUMAN/49-379GISEDLK.........KVKDR...................................MG...IDSSDKVDFFILLDNVAAE
PHYA_ASPFU/71-425LFAPDIR........ARAEKH..................................LPG...V.TLTDEDVVSLMDMCSFD
VIP1_CAEEL/363-914KMCGVIV.........EYSQTRPT...........................GSTLYLQ...ESMDLAQRRWNKELREFRR
Q22525_CAEEL/28-375SAVTSLM........GNLTNY...................................CG...E.EINPDNLWILYNALKIE
Q6BUR8_DEBHA/63-396EYLHNAL........KRLLKL..................................NPG....LNLTTDDVYNMFGWCAYE
VIP1_HUMAN/390-910NLTHQIR........ERMQDPRSV...........................DLQLYHS...ETLELMLQRWSKLERDFRQ
P90949_CAEEL/21-327KYADFFS.........ELSQT...................................TG...FKHCSYMDINGLFDIQREL
PPAX_CAEEL/28-365ATVAMIAL......NRRVAAF..................................YNV...TDQPEKFNRYTDAWKCQRN
Q6BWV9_DEBHA/521-1079IMDYNFE.......KHNVDEFQK..............................NWCCG...EDPVLFKERWDKLFQEFTT
VIP2_HUMAN/379-894SLTSQIR........HRMEDPKSS...........................DIQLYHS...ETLELMLRRWSKLEKDFKT
VIP1_DROME/402-926ELLHIIS........IKKDDP..................................KTK...DAILYHGETWDLM.RCRWE
PHYB_EMENI/70-422IMGPPIR........KRLEND..................................LPG...I.KLTNENVIYLMDMCSFD
Q7SEH2_NEUCR/194-548HYLQNAT........ERFSKL..................................VTG...Y.NWTLDDTYAAQTLCAYD
Q7S8D6_NEUCR/949-1549VMQHNYAKLY.SGAVNSLNAINNPSMEMISETSSSSLSSLGSSHVNAVNSIQARWCCG...EDAELFKERWEKLFAEFCD
ACPL2_DANRE/88-449ELERTYV.........TMAKT..................................LGV...ATKTLRAANPVDALLCHFC
Q9U5U6_DROSU/56-354RYRELLS.........YLTQN...................................SG...RLVKSFIDAQYLNNTLFIE
PPA_ECOLI/29-375DESCSLT........QALPSEL...............................KVSAD...NVSLTGAVSLASMLTEIFL
Q6BM75_DEBHA/63-397DALTRFQ........KSNPNL..........................................DLDTDDVNSLFDWCAYE
PHYA1_ASPTE/72-427VFAPAIA........QRLEAD..................................LPG....VQLSTDDVVNLMAMCPFE
A8BDL2_GIAIC/21-353VHSDRLH.........ELQNIL................................GYGG...DEGDDEYDLWYTIWDNLIT
PPAD_YEAST/66-400DYLENIS........DRLNDE..................................NKG....LNLSRKDAAALFSWCAFE
Q6CZF4_ERWCT/34-372VFDKPWA..........LKQD..................................KDG...STSISGLNTLANMSEVFLL
Q96VH9_9HOMO/61-394VFAPNIT........ARLNAA..................................APS....ANLSDSDALTLMDMCPFD
Q19390_CAEEL/17-320ELLQLVR........NHADEP..................................IVE.....AVKYNHVIDSLKVRYIL
VIP1_YEAST/538-1047IMDNNFA.......KKDVNSMQT..............................RWCTS...EDPSLFKERWDKLFKEFNN
O93838_ASPNG/72-427TFVPSIR........QRLEND..................................LSG....VSLTDTEVTYLMDMCSFD
Q6FJ21_CANGA/510-1016IMDHNFETK....DVSKLQER.................................WCTS...EDPGLFKERWNKLFKEFVS
PHYB_ASPNG/72-404QFKVAAA.........RLNSQ..................................NPG...M.NLTASDVYNLIVMASFE
PPA1_PICPA/74-409DIAEREA........DRLNTL..................................SPG....FNITADDIPTIALYCGFE
Q8PF53_XANAC/34-377RPCPAQAAP....GKLRLTTVPA.............................GLDDAG...P.SIPGLDGPAAAASGITE
Q6CYI2_KLULA/67-401DIKNRWM........KKNSNL........................................NLTLEQDDIELLVDWCAFV
Q6CWN2_KLULA/534-1048IMDHNFA.......TKNVEEMQT.............................CWCCAE...D.SMLFKERWDKLFKEFVT
Q6CES1_YARLI/413-907VMERNFNNH....TPEEVEAFQT.............................RWCCQE...T.PFLFRERWDKLFSEFTS
Q6AVJ1_ORYSJ/361-950DEDEKLALTNSFSRYDQAKAFGKTTIDV...................ARIAAGLPCGS...ESFLLMFARWKKLERDLYN
Q8SQJ1_ENCCU/48-332VQDNQVF........TRHPKP..............................................QERADHYYACLCS
Q90XY1_TAKRU/74-416RVQEKIA........ERLRVP........................................YSDITCDSAEAAFYLCAYE
O17373_CAEEL/52-377ENQEFLD.........FVSEK...................................SG...K.KVIMPEIYMVNDVHFIE
Q757D1_ASHGO/560-1065IMDHNFS.......HKSLEEMQR..............................RWCCG...EDPTLFKERWDKLFKEFVS
Q9APF7_LEGPN/24-324DKYPLWS.........RLTGI..........................................NIDTLEDLETVGHTLYV
Q8MY06_DROVI/44-342RYKDLFD.........YLGQN...................................SG...R.PIKSFMDAQYFNNTLFI
Q9GUF1_CAEEL/33-333DNAQVLT.........YLSAE...................................TG...WNMTENLGKAADLADNLIQ
Q9AAQ4_CAUCR/24-359GPCPPAPG......KRRVFDA..................................KPGFVDGEELAGLSGPEAFASGVTE
Q6YNE9_PENOX/62-418LIAPPMA........QRLHHD..................................LPG....VTLTDDQVIYLMDMCAYD
PPAL_HUMAN/32-330RNAQFLD.........MVANE...................................TG...LTDLTLETVWNVYDTLFCE
Q8I0P9_DROME/64-362KHRNLFA.........YLSEK....................................G...GRPVKTFIDAQYLNNTLFI
PPA6_MOUSE/42-371GISEDLE.........KVKTG...................................VG...INNGDDVDFFVLLDNVAAE
Q19175_CAEEL/28-376VPVSSVI........DKLTSL..................................VNQ.....TWSLEDFWTVPDALFIE
Q6GPK4_XENLA/34-333DNKGFLE.........MVADN...................................TG...LSDCSLESVWSIYDTLFCE
Q6CLW3_KLULA/69-406KIRERLM........KKNSQL........................................PLKLKNKDIKQLISWCAYE
Q95WU2_GIAIN/15-344LHQESQQ.........RLSRL.........................................AGFNETVGWGVLRDNLIA
PHO11_CAEEL/25-364KYTQVVLL......NRRVGGY..................................YNM...TSGLDSFTTYPDTWKCQRA
Q8GD20_PSESX/30-365VICNGISACAYTDEPWQLAQD..................................DDG...RLAVKGLNTQTNLGETFRL
Q8PPX6_XANAC/29-351LLYEPAT........RDGSPA..........................................AASTLKLAGGLAENLML
PPA5_YEAST/65-399TYLDDIA........KRLNKE..................................NKG....LNLTSTDASTLFSWCAFE
Q9GNT0_9TRYP/33-338KYDTLLS.........ISKEV..................................FSE...G....MCANPEDRCKCAQT
Q7YWJ0_MELIC/28-378LIKYKWL.......LDFLSEK...................................TG...Q.NVDPFDMWMINDAFYIE
PPA4_SCHPO/25-385LLAGRAS........EMMSQF..................................MNG...Q.PVRVVSSHPRLSGLLDT
Q19460_CAEEL/78-372MYAVLYE...............................................CMGG.....NHSIFQEIKIDDCDRYI
PHYA_THIHE/65-447TFAGPIT........ARVNAN..................................LPG....ANLTDADTVALMDLCPFE
Q8P330_XANCP/64-389TLKPSAD........GRGLAL........................................GGPIDLASGTGEVLLLQYA
PPA1_SCHPO/59-395VYMPPIR........QRLNPY..................................FSN...Y.NLTNDDILNLYGICSYE
ACP1_CAEEL/19-323WFVSDKAL......RKAVTKT..........................................DFLQDRGGENLPALILE
Q6TAQ8_9ENTR/42-388HYRPALA.........LMSNV..................................LNF...P.TSAYCQQHSAEQTCNFA
Q6NY36_DANRE/54-394SVRRKIS........SRLQIP........................................YDRITADMAEAAFFLCSYE
Q25327_LEIME/33-349EVLDRLMS......FDQLQAV..................................AAE...VHSQRFCANYTLRSRCAKR
PHYA_ASPOR/71-426VFTPSIV........ERLEKD..................................LPG....TTLSSKEVVYLMDMCSFD
Q96VF5_TRAPU/64-400QFAPPMT........ARLNAG..................................APG....ANLTDTDTYNLLTLCPFE
PPAP_HUMAN/34-332PYKDFIA.........TLGKL...................................SG...LHGQDLFGIWSKVYDPLYC
O00096_TALTH/69-423QFAPAIL........EKIKDH..................................LPG....VDLAVSDVPYLMDLCPFE
Q6CSM6_KLULA/63-401EYLEDIA........DRLNNEN...............................KNLPL.....NLTATDASSLFVWCGFE
Q6CCS5_YARLI/180-538NYLNKAS........LRFQEL..................................IPG...FENFTAHDAFQMQQLCAFE
Q19076_CAEEL/26-371ADVQAVL........GNLTNY..................................CGQ.....PVDIDNLWIITNALYIE
Q9VW00_DROME/55-355ESSDLLR.........ELTTH...................................TG...LNITHAHDVTNVFITLLCE
O74677_PICAN/61-383EIFQREA........DRLNEL..................................SPG...F.NITADDIITMGTYCAYE
Q96VT0_9AGAR/59-411IYGTPIA........NRLNQQ..................................APG....ANITAADVSNLIPLCAFE
PHO5_CAEEL/30-322TKANGIR........KKFAREL...............................SFFSQKLNLPNMELKATWRIFDNLFCE
Q9VD68_DROME/41-345DNMELYK.........LLTKN...................................TG...KNISNVLDVELLYGTLKTE
ACPL2_HUMAN/87-424QLEKTYGE......MAKIVDV........................................PTKQLRAANPIDSMLCHFC
Q84TX6_ORYSJ/68-441PILEHVT........SALVNR....................................Y...HLNFTPKDVSSLWFLCKQE
Q8VQS2_KLEPN/30-355IFDTPWQ..........VEQS..................................KSG...KTTISGLSVMANMVETLRL
Q84WW3_ARATH/362-953DEHENLAEPSAYDVVPPYDQAKALGKSNID................VGRIAAGLPCGS...EGFLLMFARWRKLERDLYN
Q57QN8_SALCH/30-362KLLEQITHYQDSPSCKEKHQCSLID.........................AKDTFSAN...YQQEPGVQGPLKVGNSLVD
Q9VW01_DROME/61-361PYEQMFR.........ELTNL...................................TG...KAIQSAEDINSLYITLLAE
Q8X1W7_MONPU/76-407QFKVAAA.........RLNSQ..................................NPG....LDLNATDIYYLMSMASFE
PPA2_SCHPO/59-405VFLKPIA........NRLNKY..................................FDS...GYNLTVSDVRSLYYICVYE
VIP1_SCHPO/387-861VMRENFII.....LGPEVEQVQS.............................RWCCNE...N.PALFRERWEKLFSEFCD
PPA3_SCHPO/59-405IFIEPIV........NRLAKY..................................FDS...SYKLTINDVRSLFYICEYE
PPAT_HUMAN/31-338GWTGFLS.........RLENF...................................TGLSLV.GEPLRRAWKVLDTLMCQ
Q7WSY1_RAOTE/31-357IFDTPWQ..........VEQS..................................KSG...KTTISGLSVMANMVETLRL
Q25332_LEIME/26-334GLCADYN........ARTNCV...........................................LDMYDVAAAFEAAGRL
AGP_PRORE/32-365EELDTVL.........NIKDSQKCKTDKLC...............NLDSQKNSFIIEA...D.KEPGVSGPLKIANSAVD
Q96VK8_9APHY/60-397SAFPSVT........AQLNAA..................................APG....ANLTDADAFNLVSLCPFM

PF00300

Q7QC58_ANOGA/471-664.FEWLAWY...........QD------------------------------------------GLPEWLTPDELL.....
Q6BI57_DEBHA/3-214.SEWVH.E....RM.....KN------------------------------------------KPPFTDSNDAYHMY...
Q6C210_YARLI/6-172.REQDF...............------------------------------------------GNFQASASEMNK.....
Q6BIM7_DEBHA/15-162.REREM.G....AV.....Q.------------------------------------------GMYLKDALAKYG.....
Q6BJ83_DEBHA/95-281.ETYGI.D....SQ.....SR------------------------------------------RHNKTYIENFVPS....
Q9WWA7_AGRRK/32-170.RERGF.G....AL.....Q.------------------------------------------GKINTHLA.........
TIGRB_DANRE/5-190.RERGF.G....VA.....E.------------------------------------------GRPKEHLKNMAN.....
Q6C0R4_YARLI/4-173.GEWFK.R....ER.....S.------------------------------------------SHPKPASNAVLK.....
Q7SB57_NEUCR/5-199.GEWYGSA....PF.......------------------------------------------EHPVPASLATLE.....
PMGE_HUMAN/5-195.NERHY.G....AL.....I.------------------------------------------GLNREQMALNHG.....
PMG2_YEAST/11-249.NERHY.G....SW.....Q.------------------------------------------GQRKPNVLKEYG.....
Q7U5E4_SYNPX/4-170.LEVDL.E....PW.....S.------------------------------------------GMSIDELTERHP.....
Q8XP82_CLOPE/2-158.KEISF.G....KW.....E.------------------------------------------GMTTEEIKSHDEY....
Q6FCF7_ACIAD/10-173IVEQGLLV...........EP------------------------------------------GSFVLDIKQAAPYF...
Q8DJJ5_THEEB/2-154LIEIDQ.G....IF.....T.------------------------------------------GLTWAQAQSQHP.....
Q9F3Q7_STRCO/2-156.RELTAGD...........LE------------------------------------------MRGDDDAARTYM.....
Q720T2_LISMF/2-154.NEMNF.G....DF.....E.------------------------------------------GYTYQEISTKFP.....
Q7RS23_PLAYO/107-246.....................------------------------------------------NEGTPYLPNPIP.....
P96241_MYCTU/4-163.HEVQV.G....EL.....E.------------------------------------------NRNDDEAVAEFN.....
Q883Y2_PSESM/2-110.FDAPV...............------------------------------------------.................
Q74HS5_LACJO/3-176.REQFY.G....FF.....E.------------------------------------------GMNSDEAWRMIGGPHGY
Q9CEU3_LACLA/2-155.SEWNFGE...........LE------------------------------------------GWFISDAIAKYPK....
Q87CY4_XYLFT/2-158.KEIAH.G....DW.....E.------------------------------------------GLLDTEIHAMDP.....
Q8Y237_RALSO/16-171.RERCY.G....GF.....E.------------------------------------------GLTYAEVAERHP.....
GPMA_RHIEC/3-164.NERDYGQ...........LT------------------------------------------GINKNVARERWG.....
Q8XXU8_RALSO/11-172.QARNL..A.LEPWPELQEIR------------------------------------------GGKLAEIPEH.......
Q6N2V9_RHOPA/3-118.....................------------------------------------------.................
Q6FQW7_CANGA/5-175.IERGF.S....EW.......------------------------------------------YRPDRPVIPVPAD....
Q72JY3_THET2/2-111.GEVRL...............------------------------------------------.................
Q6E597_XENNE/2-159.NELDF.G....AW.....E.------------------------------------------LCHHADIAKDDP.....
Q86HD1_DICDI/259-430.RERDKGK...........MD------------------------------------------NISWTDKKDHFG.....
A9CJY0_AGRT5/2-161.IEVSF.G....DW.....E.------------------------------------------GQTLPDLKKEFP.....
Q8FUA9_COREF/10-122.WERAQAG.............------------------------------------------GAVAKDVH.........
Q6ZG49_ORYSJ/77-245.RERHI.G....DL.....Q.------------------------------------------GLKYEDAGKEKP.....
Q6NEM7_CORDI/3-167.REIDA.G....SI.....E.------------------------------------------GNTDSHSHDLYT.....
Q87UC2_PSESM/3-156.QEFTY...............------------------------------------------LEPARCTNTTVA.....
O67797_AQUAE/3-157.IEIDH.G....KW.....S.------------------------------------------GLLVEEVKQKFP.....
Q9AAW6_CAUCR/25-130.RTIALDG.............------------------------------------------.................
Q8G0Q3_BRUSU/3-115.DETIYSG.............------------------------------------------.................
PMU1_YEAST/55-227TQELPA.G...........T.------------------------------------------KISTRIIEGLRET....
Q6MNJ9_BDEBA/2-119.LEQKGDE.............------------------------------------------.................
Q8XLK3_CLOPE/2-156.GEYNF.G...........DF------------------------------------------ELKSYEMLKEDK.....
Q6BTP4_DEBHA/103-303TIGIHL............CHK------------------------------------------RSTKSEITKTFP.....
Q8PBP4_XANCP/19-193.REKEF.G....VL.....D.------------------------------------------RYTTAGIIATFP.....
O29260_ARCFU/2-108LADIGI...............------------------------------------------.................
Q7YTB0_BOMMO/111-267FKNWHMPKGIDFMTPIELCKA------------------------------------------GLNVDMTYKPYV.....
Q8YLU6_NOSS1/32-195.RENDM.P....AW.....E.------------------------------------------GLAFQYVREIFP.....
Q6FRI4_CANGA/10-264.REQDF...............------------------------------------------GNYQ.EVSSMQD.....
Q6HKL4_BACHK/3-144.RERLLSS...........EP------------------------------------------VADFNDAIEN.......
Q6AAY7_PROAC/6-160AANVFE...............------------------------------------------GQVFGKGNKALR.....
AIS_ECOLI/55-165.LQCGN...............------------------------------------------.................
Q8G4E1_BIFLO/4-202.RERSF.G....EW.....E.------------------------------------------GMTRAEIKAVAA.....
Q6BRZ2_DEBHA/5-194.NERHY.G....AF.....Q.------------------------------------------GRDKNEVYRELG.....
Q83FQ2_TROWT/180-278.....................------------------------------------------.................
Q6HBT6_BACHK/3-143.TERILSDVPMDDW.......------------------------------------------...MQKLESTFT.....
Q83MP8_TROWT/3-153IEPYSY.............FE------------------------------------------GKIVSGSNSALR.....
Q726G1_DESVH/226-380.DEIDA.G....LC.....E.------------------------------------------GMRYEDIQSEMP.....
Q8DRP1_STRR6/23-174.HEWQVYK...........TG------------------------------------------IENFETARRLFL.....
Q74L50_LACJO/4-181FREVFF.G....TF.....E.------------------------------------------GDDIDETWEKVAVAGGM
Q6MP54_BDEBA/2-119.YETKV...............------------------------------------------VEAPELVPHSPP.....
Q6C302_YARLI/61-286.HVIYRVAQGVESRVPTSVDT------------------------------------------GAGSSDVVIHPLLRETI
Q6GB32_STAAS/4-153.KEWHF.G....LF.....E.------------------------------------------GESVYLFDNLYK.....
Q7XSW9_ORYSJ/19-188.RERYF...............------------------------------------------GPSHELLSHE.......
Q72VE8_LEPIC/2-114.PEQET...............------------------------------------------.................
Q98MW8_RHILO/4-147.ADQDH.G....SW......A------------------------------------------GKSFEDVQAEQP.....
Q8CPX4_STAES/10-160.KEWGF.G....LF.....E.------------------------------------------GESIELLRAI.......
Q9CEX0_LACLA/3-144.RERNV...............------------------------------------------GHEIADFWPF.......
Q9RWR4_DEIRA/2-154.REFDNGP...........IA------------------------------------------GLPFAKAEARYP.....
Q6HJQ4_BACHK/2-150.MEFNN.G..........VQA------------------------------------------GLSFEEAKKYPE.....
P73454_SYNY3/4-160.REVAY.G....EW.....E.------------------------------------------GLHPDEVYQRDH.....
Q7P7V2_FUSNV/2-159.VEISM.G....DM.....E.------------------------------------------GIQQEEFKKLYP.....
Q6BZ00_DEBHA/5-181.GEWYKKDRGIVPE.......------------------------------------------PANYDVLKPFFSC....
Q9BL94_CAEEL/8-173.CEALYLCDKPPGF.......------------------------------------------.WETDKLAEKFP.....
Q8YSV8_NOSS1/4-164.SEWLN.P....AWMTEEPE.------------------------------------------KLSTPALAELFP.....
COBC_SALTY/2-156.NEMYF.G....DW.....E.------------------------------------------MRHHRDLTHEDA.....
Q86BN5_DROME/6-194.CERHYGN...........LT------------------------------------------GCRKRVVADRYG.....
YA03_SCHPO/8-174.QEVGHLP..........CDI------------------------------------------GLELDKLNKLYP.....
Q6HJT5_BACHK/4-158.YEINM.G....IW.....E.------------------------------------------GQTIDDIERQYP.....
Y2622_SYNP2/2-116.APRGSLG.............------------------------------------------.................
Q8P6B2_XANCP/4-152.REYHF.G....RW.....Q.------------------------------------------GVPVAEIDRDEG.....
Q74JW8_LACJO/2-163.KEFNL.G....DL.....E.------------------------------------------GMKFVDAESKYPD....
Q82LG3_STRAW/4-147.GGLDV.G....RW.....R.------------------------------------------GRTLDDVSGGEP.....
Q74A29_GEOSL/2-115SRELAP.G.............------------------------------------------.................
Q8RA82_THETN/4-158.REMSF.G....VW.....E.------------------------------------------GLTAKEIEENYQ.....
Q82W48_NITEU/2-106.....................------------------------------------------.................
Q7BKI0_PRB01/3-117.....................------------------------------------------GLNYPIAEAVY......
Q722Z4_LISMF/8-186.REFGF.G....KF.....E.------------------------------------------GEYNQAVLKMVAKAHG.
Q7VY96_BORPE/3-161.RERGFGV...........LE------------------------------------------GLEMENLEQQAP.....
Q6BUK7_DEBHA/10-192.REWEY.GDYEGLLTSQIIE.------------------------------------------LRNKRGLDKDLPK....
Q6LIL4_PHOPR/7-157WKEMDF.G....NW.....D.------------------------------------------GQLQKTLWQEHN.....
Q7S800_NEUCR/250-403.SQINP.G......L...CE.------------------------------------------KLSEHAIRRLYP.....
Q6NJJ1_CORDI/5-157AGNQFE...............------------------------------------------GLRVKGFRSQLW.....
Q8DRV1_STRMU/2-148.NEVPL.K.............------------------------------------------AAFSSKIKLPLIFW...
Q9FNJ9_ARATH/49-203.REIDLYS...........FQ------------------------------------------GLLKKEGKEKFG.....
Q98M20_RHILO/3-114.TGKVL...............------------------------------------------.................
Q6SGN8_9BACT/3-117.....................------------------------------------------.................
PHOE_BACSU/3-146.KERDYGD...........AE------------------------------------------GMPLEERTKRYP.....
P72649_SYNY3/132-291.AEICH.G....LW.....E.------------------------------------------GKLETEIEAEYP.....
Q8G5U1_BIFLO/6-177.RERSW...............------------------------------------------GEINTITKDEFK.....
Q93CQ7_LACSK/5-178.REEFYGY...........YE------------------------------------------GEDSAKAWYMTGA....
Q6KZ44_PICTO/3-140.IESDF.G....QY.....E.------------------------------------------GMHINEIPMKP......
O04035_ARATH/11-189.REQDF...............------------------------------------------GNFQVEERMRVV.....
A8B7W8_GIAIC/5-160.CDISW.G....DW.....E.------------------------------------------GKTYLEAFGTPE.....
Q6PY96_9TRYP/451-652.NELYA.G....VC.....E.------------------------------------------NLTQAELREQCP.....
O06240_MYCTU/2-159.SEVDY.G....EW.....T.------------------------------------------GRKIGDLVDEP......
Q82LK1_STRAW/3-156.SEWDYGG...........YE------------------------------------------GVTTVEIHRTRP.....
Q8K620_STRP3/5-182.REWCF.GSLEGTYDSELFLG------------------------------------------VLPRTKAFENRDNLRDV
O69483_MYCLE/173-327.IEIDF.G....AW.....E.------------------------------------------GLTFAEAAARDP.....
Q73U87_MYCPA/36-190.QEINA......GW.....YN------------------------------------------GKSESMAKSTYL.....
Q89WM0_BRAJA/39-171.TDSSN...............------------------------------------------.................
Q7MLF0_VIBVY/2-151.QEMDFGL...........LD------------------------------------------GVPFDTQDYPWP.....
A9CJ67_AGRT5/8-120.WQRAF.............NE------------------------------------------GIDIV............
Q6CHK2_YARLI/4-192.GEWLTPD....YFANSSPPP------------------------------------------DDNHADLANQAV.....
Q7NMJ4_GLOVI/2-158.MEIDLPG...........WE------------------------------------------GLNHAQLAERFP.....
GPMA_CAUCR/3-186.NERHYGG...........LT------------------------------------------GLNKAETAEKHG.....
Q82HM5_STRAW/8-150.....................------------------------------------------GDYVPYVPGRAE.....
Q92PF7_RHIME/10-122.EDIDI...............------------------------------------------.................
SIXA_HAEIN/2-122.LELEN...............------------------------------------------.................
GPMA2_LACJO/7-189.NERHYGA...........LR------------------------------------------GINKDVSKKIFG.....
Q6AJL1_DESPS/3-117.KNIVF...............------------------------------------------.................
Q7MUJ7_PORGI/236-394.REMDY.G....VW.....E.------------------------------------------GLQREEVKVQFP.....
Q746P6_THET2/2-140.REIHF.G....AL.....E.------------------------------------------GALWETLDPRYK.....
Q97MM8_CLOAB/5-183.REVYC.GKYEGEF.....EK------------------------------------------VMFSDILKYLKVESIEE
O67630_AQUAE/20-173.REMSF.G....VL.....E.------------------------------------------GRHFWTMFEENK.....
Q721Q6_LISMF/6-181FRETFF.G....SY.....E.------------------------------------------GEKGDVAWNEIAHHMGY
PGAM5_DROME/88-228.NCAFL.............RE------------------------------------------GAPIPPQP.........
Q826X4_STRAW/13-125.....................------------------------------------------.................
Q94BY1_ARATH/44-166.MEANV...............------------------------------------------.................
Q6M6A8_CORGL/20-172.IECDF.G....EW.....T.------------------------------------------GRKLTELNALE......
Q897L7_CLOTE/2-155.NEMNM.G....DF.....E.------------------------------------------GKDHKELEKLYP.....
Q6A9K1_PROAC/2-175.FERPGPVQIVDGV.....ET------------------------------------------GHPGSPRSALSA.....
Q8G704_BIFLO/5-171ADERVI.............EA------------------------------------------GNEFRGKRIGHGEG...
Q72U60_LEPIC/3-113.GVISEVG.............------------------------------------------.................
Q7UQ84_RHOBA/2-196HHEKNFAG....ASGLSASAI------------------------------------------ESFFQEIAAQFPDREPP
Q72H77_THET2/3-155.REIHV.G....EL.....A.------------------------------------------GLTRAEAEARFP.....
Q92L77_RHIME/11-123.PERDAVG.............------------------------------------------.................
Q748J5_GEOSL/23-177.REICM.G....EW.....E.------------------------------------------AKSWQELQDRYP.....
Q6AAP8_PROAC/49-201.REQGL.G....AM.....E.------------------------------------------GHTADELEPLPQPT...
Q6GC97_STAAS/2-167.RERSL.GVFEGEY.....KD------------------------------------------EISANPKYEKYFN....
Q82ZR6_ENTFA/1-148.IEMNF...............------------------------------------------GIYDGEPIETT......
Q72G92_THET2/16-169.RERAW.G....AW.....E.------------------------------------------GLSFPEVEARFP.....
O68088_RHOCA/12-153.WEQDF.G....AW.....E.------------------------------------------NRPFAELPD........
Q74HK6_LACJO/2-158.REMNF.G....SW.....D.------------------------------------------GQHAEELKIKYPD....
Q9KEW3_BACHD/2-150.REIRL...............------------------------------------------.APLFRMNVRLP.....
Q6ALU2_DESPS/17-166.KEIDF.G....FW.....E.------------------------------------------GLTFDQVYTKYQ.....
Q9A6W6_CAUCR/3-145.GEIPT.............PA------------------------------------------ALSAEERPAWLR.....
Q7V6P3_PROMM/5-151.IEWNY.G....NY.....E.------------------------------------------GITTAEIRQTVP.....
Q22323_CAEEL/5-201.YEWMV......FARYARPCW------------------------------------------IPPKDLKKLGYPV....
Q75FR3_LEPIC/10-168.REVFLGD...........GQ------------------------------------------GKLINEVDFYFG.....
Q8G5W7_BIFLO/22-200VTDMHFREQFYGYY.....E.------------------------------------------GLDMAMAWYAAGAPHGV
Q9X194_THEMA/2-156.RECEI.S....LW.....N.------------------------------------------GLTVEEAIREYP.....
Q82CU3_STRAW/4-153.MEWDY.G....AY.....E.------------------------------------------GMTPAEIQKVRP.....
Q756M6_ASHGO/9-242.NERHY.G....SW.....Q.------------------------------------------GQRKSSVLEQFG.....
Q97JA1_CLOAB/3-152.KEINF.G....LW.....D.------------------------------------------NLSYKEIKDKYP.....
Q72BT4_DESVH/21-170.DEIDM.G....QW.....D.------------------------------------------GRTFDSIRQREP.....
Q723D3_LISMF/42-225.REFNF.G....SY.....E.------------------------------------------GDLNENMWTDIAKS...
Y525_MYCTU/6-158IESANF.............FE------------------------------------------GRRVGPGDGAWR.....
O24559_MAIZE/141-292.DEINS.G....VC.....D.------------------------------------------GMTYEEIKKIMP.....
YL345_YEAST/293-466.RQLNPGS...........IA------------------------------------------DLTDQQIMDKFP.....
Q8DIP9_THEEB/22-190LKEIAL.P....AW.....E.------------------------------------------DLPFAEVKAQFP.....
Q8EIT5_SHEON/52-156.RHLPI...............------------------------------------------.................
Q724D7_LISMF/7-163.KEMGF.G....TW.....E.------------------------------------------GIRVTEIDEQHP.....
Q7P810_FUSNV/3-153.EEINF.G....IF.....E.------------------------------------------GLTFKEISEKYP.....
Q829E2_STRAW/8-119.EERLY...............------------------------------------------.................
Q9RXN2_DEIRA/7-157.RELNL.G....DY.....E.------------------------------------------GHTLAQMQAHG......
Q7UH13_RHOBA/12-156.AEWDCGA...........YE------------------------------------------GLTRNEIHQKHP.....
Q72M33_LEPIC/2-151.MELNF.G....SW.....E.------------------------------------------GKPWLEIPKK.......
F263_RAT/248-395.NEIDA.G....VC.....E.------------------------------------------ELTYEEIRDTYP.....
Q7MBR9_VIBVY/3-157.KEFSL.G....DW.....E.------------------------------------------QKTLPELQATRPD....
Q6AME6_DESPS/37-191.REQDW.G....LW.....E.------------------------------------------GLTRAEVEVHFP.....
Q9RSI0_DEIRA/4-149HEHLRY.G.............------------------------------------------....NELVSADEF....
GPMA1_GLOVI/3-191.DERYY.G....DL.....Q.------------------------------------------GLDKAETTAKYG.....
Q8LE79_ARATH/14-208.CEMLNSVAIRRELAPKDGKF------------------------------------------DFTVSDIETMFPEGMVD
Q74HK7_LACJO/2-158.EELSY.G....SW.....D.------------------------------------------GKSSLEYRKKHPD....
Q876B1_SACEX/5-177.GNWFS......KNSNSEITK------------------------------------------PADFDTLNSLFP.....
YQGD_SCHPO/55-208.MEKDL...............------------------------------------------GSLEGTSFRYTA.....
YFFL_SCHPO/2-149.RERVYGD...........LE------------------------------------------GMNVVEAKKLLN.....
Q970Q5_SULTO/3-117.DSLKI...............------------------------------------------ETYDDLIPDKDP.....
Q7WY90_MYXXA/7-116............AF.......------------------------------------------GVSGVEVHPALL.....
Q8EQG8_OCEIH/3-144.KERVLCA...........E.------------------------------------------.................
Q7MWC4_PORGI/2-148.MEINF.G....LW.....E.------------------------------------------MQRYDHIDDP.......
6P21_YEAST/398-572.DELSAGD...........YD------------------------------------------GMTYPEIKNNFP.....
Q82C73_STRAW/18-172.RETYA.G....VW.....Q.------------------------------------------GLTHEEIIAQFG.....
Q87HE6_VIBPA/2-157.REWRA.............DT------------------------------------------AGGYISLAERDR.....
UBS3A_HUMAN/397-595.FEWT.......KW.....EA------------------------------------------GKTTPTLMSLEEL....
Q97ET5_CLOAB/4-158.REINF.G....LW.....E.------------------------------------------GLTIKEMKSKFP.....
Q8YRV4_NOSS1/3-172.REIDL.P....LW.....E.------------------------------------------KLLTSEVKEKFP.....
Q88KP7_PSEPK/26-164.ADCDL.G....RW.....Q.------------------------------------------GVSLKQLQAEQP.....
Q752M0_ASHGO/18-169.RERHM.G....EV.....E.------------------------------------------GMHIEDAE.........
GPMA_BLOFL/5-191.NERHYGA...........LQ------------------------------------------GLNKNEAIKTYG.....
Q6FD82_ACIAD/1-156IQEFSYLS...........DA------------------------------------------KCHNTTIEERKP.....
Q6HEN0_BACHK/5-149.VERNFGE...........AS------------------------------------------GKPVATVRELIA.....
Q878F8_STRPQ/2-160.REWRL.G....KL.....E.------------------------------------------GAKIATMAAIYP.....
Q87Q43_VIBPA/5-154.QEMDFGD...........FD------------------------------------------GMPFDLLTEHWK.....
Q9FYE8_ARATH/21-178.KERHV.G....SL.....Q.------------------------------------------GLYWKEGAEKEP.....
PGAM5_XENTR/89-226.KKSSS.............DL------------------------------------------LREGAPIRPEP......
YNK8_YEAST/5-175.GEWY..............KP------------------------------------------DRPIIPEPATHE.....
Q7MA12_WOLSU/5-120.....................------------------------------------------AFPAAPLVLAEE.....
Q9ZAX0_AMYME/2-161.HEIVVGD...........LE------------------------------------------GRHDREAIEHYL.....
Q9KCH8_BACHD/6-157.REVNF.G....CW.....E.------------------------------------------GKRYDELMDEP......
YKJ2_SCHPO/9-173CGDWAC.............NV------------------------------------------GSYTKDLEKQFP.....
Q8XWS5_RALSO/2-152.VELDF.G....AW.....E.------------------------------------------GCPWDDIPRA.......
Q7VGN6_HELHP/3-123.SDSII...............------------------------------------------.................
Q9CN14_PASMU/5-159.NELCF.G....SW.....E.------------------------------------------GQAIEELSCLP......
Y400_SYNY3/2-117.....................------------------------------------------.................
Q8DJF9_THEEB/5-120.VGIAP...............------------------------------------------ELIISDLLAPSG.....
Q6HFU7_BACHK/12-186.RELNF.G....IF.....E.------------------------------------------GEKLDNMWDAVGKAAG.
Q6N4Q1_RHOPA/27-181.NEQHL.G....DW.....Q.------------------------------------------GTNRAAFFAKLP.....
Q6LTK1_PHOPR/2-117.EAKKV...............------------------------------------------.................
Q6CVE6_KLULA/56-257.KEQCR.E....TLGRHYCDK------------------------------------------RLPHDHVVEQYGEET..
Q930B9_RHIME/3-151.REIDV.G....DW.....T.------------------------------------------GRAIGDLMAEDQ.....
Q6KZ21_PICTO/2-149.KEIDL...............------------------------------------------GSANNHHVSEYR.....
Q828M5_STRAW/15-174.GECHYGD...........WS------------------------------------------GRKLAELKDEP......
UBS3B_MOUSE/374-572WTKWVA.GSTLPAW.......------------------------------------------IPPSELAAANLSV....
GPMA_METMA/6-194.NERYY.G....KL.....Q.------------------------------------------GRKKQKMEEKYG.....
Q8G5N9_BIFLO/7-171.RERSF.G....DW.....D.------------------------------------------GHAVAELAERYP.....
PGAM5_CAEEL/96-232TSSPFI.............EE------------------------------------------GPPYPPVP.........
Q6MWZ7_MYCTU/7-154.AEWDY.G....SY.....E.------------------------------------------GLTTPQIRESEP.....
Q7V2G5_PROMP/228-384.VEISH.G....LW.....E.------------------------------------------GKLENEIKQQWP.....
Q8GWG7_ARATH/18-200IVALEICRERMGLYP...CDR------------------------------------------RASISTRRTFFPEIDF.
Q8DU47_STRMU/4-153.KEMNF...............------------------------------------------GIF