Sequence alignment for CL0071

PF00328

PHYA_ASPFU/71-425RITLVQVLSRHGARYP--------TSSKSKKYKKLVTAIQA.......................................
VIP1_CAEEL/363-914ELRCVVAVIRHGDRTP--------KQKMKLIVTDQRFFALFEKYDGYKKHEIKMKKPNQLMEVLELARALVIEKQRDRHQ
Q22525_CAEEL/28-375KLMMVQAIWRHGDRTP--------TETY....................................................
Q6BUR8_DEBHA/63-396TIEQVQLISRHGERFP--------SSNAGKQYEHIMQKFED.......................................
VIP1_HUMAN/390-910ELRCVIAIIRHGDRTP--------KQKMKMEVKHPRFFALFEKHGGYKTGKLKLKRPEQLQEVLDI..............
PPAX_CAEEL/28-365KLEFVQTIWRHGDRSA--------LEGL....................................................
Q6BWV9_DEBHA/521-1079VFKGMVSVIRHADRTP--------KQKFKYSFRSPLFISLLKGHLEEVIIRDVPDLQVVL....................
VIP2_HUMAN/379-894ELRCVIAVIRHGDRTP--------KQKMKMEVRHQKFFDLFEKCDGYKSGKLKLKKPKQLQEVLDI..............
VIP1_DROME/402-926ELRCVVAVIRHGDRTP--------KQKMKVEVRHPKFFEIFEKYDGYKLGHVKLKRPKQLQEILDI..............
PHYB_EMENI/70-422EVTFVQVLSRHGARYP--------TESKSKAYSGLIEAIQK.......................................
Q7SEH2_NEUCR/194-548EIIWLQMVSRHGSRYP--------TGGSNVESFGARLANAT.......................................
ACPL2_DANRE/88-449KLLSVQVMIRHGDRFP--------LYSIPKTKKPTIDCILSEKRKPSH................................
PPA_ECOLI/29-375KLESVVIVSRHGVRAP--------TKATQ...................................................
Q6BM75_DEBHA/63-397TIEQVQLLSRHGERYP--------SKNVGKALEKINEKFKG.......................................
Q6CZF4_PECAS/34-372LMEKVVEVSRHGVRPP--------TESNTT..................................................
VIP1_YEAST/538-1047VFKGLAIIIRHADRTP--------KQKFKHSFTSPIFISLLKGHKEEVVIRNVNDLKIVL....................
Q6FJ21_CANGA/510-1016VFKGLVTVIRHADRTP--------KQKFKHSFTSPIFISLLKGHKEEVVIRKVNDLKIVL....................
Q6CYI2_KLULA/67-401TVEHVQMLARHGERYP--------TASKGKLMIALWDKLKV.......................................
Q6CWN2_KLULA/534-1048VFKGLVTVIRHADRTP--------KQKLKHSFTSPIFLSLLKGHKEEVVIRNINDLQIVL....................
Q6CES1_YARLI/413-907VLKGQAIVIRHADRTP--------KQKIKVSFKHPLFIDLLKGHKEEVLYREKDRLMEVLE...................
Q6AVJ1_ORYSJ/361-950ELRSVIVVIRHGDRTP--------KQKVKLKVTEEKLLNLMLKYNGGKPRAETKLKSAVQLQDLLDATR...........
Q9AAQ4_CAUCR/24-359TLEKVVILSRHGVRSA--------MSSPE...................................................
Q19175_CAEEL/28-376ELKMVHIVWRHGDRSP--------TTTF....................................................
Q6CLW3_KLULA/69-406IIEQVQMIARHAERFP--------KAAKGEKLEIMWNKFKE.......................................
PHO11_CAEEL/25-364KLEFVQAMWRHGERAS--------QVDQYPIYEKDWI...........................................
PPA4_SCHPO/25-385QLKYLQVIFRHGERAP--------VKERLGSAGIPKDWKLCNNARRFFA...............................
PPA1_SCHPO/59-395KIKQVHTLQRHGSRNP--------TGGNAAFDAVGIANFQQR......................................
PHYA_ASPOR/71-426QVTFAQVLSRHGARYP--------TKSKSEKYAKLIKAVQH.......................................
Q6CCS5_YARLI/180-538TLRQAHVLHRHGERYP--------TDGAADNMVAFADKLKSS......................................
Q19076_CAEEL/26-371DLVFVQTLWRHGDRSP--------TKTF....................................................
Q84TX6_ORYSJ/68-441RVIHLNLVARHGTRAP--------TKKRIKELDRLAVRLKALIDEA..................................
Q84WW3_ARATH/362-953ELRCVIAIVRHGDRTP--------KQKVKLKVTEEKLLNLMLKYNGGKPRAETKLKTAVQLQDLLDAT............
PPA2_SCHPO/59-405AIKQVHLLQRHGSRNP--------TGDDTATDVSSAQYIDIFQN....................................
VIP1_SCHPO/387-861RLKSLVGVLRHADRTP--------KQKFKFSFTSDPFVKLLQGHTEEVILRNEQLNSVLA....................
PPA3_SCHPO/59-405EIQQVHLLQRHGSRNP--------TGDVTATDVYSSQYLNNFQE....................................
A6T657_KLEP7/32-357QLEKVVELSRHGIRPP--------TAGNR...................................................
C4QZN1_PICPG/75-409.IDQAHLLMRHGERYP--------STNVGKQLEALYQKLLDA......................................
E2RTX6_GIAIC/15-344ELKRVQVVTRHGARTT--------LNPFPAETEDWICDGIGTIAF...................................
F1RD51_DANRE/72-409...HMVSVIRHGTRYP--------TTKNVRKIAQLFDLVKS.......................................
G2QKZ0_THIHA/65-455EVTFAQVLSRHGARAP--------TLKRAASYVDLIDRIHH.......................................
G3Y8Z5_ASPNA/73-427.VTFAQVLSRHGARYP--------TDSKGKKYSALIEEIQQ.......................................
G7XM48_ASPKW/72-404EVDQVIMVKRHGERYP--------SPSAGKDIEEALAKVYSI......................................
S8B7A5_PENO1/144-500ELTFVQVLSRHGARYP--------TASKSKKYKSLIQAIQA.......................................

PF00300

D7B452_NOCDD/4-197-----IYLIRHGKASP................------------------------------------------------
D6S4F7_9LACO/3-204-----IYFVRHGKTEW........NLASK...------------------------------------------------
C6VSA5_DYAFD/6-202-----IYLIRHGETDF........NRRGV...------------------------------------------------
A6W5M7_KINRD/8-200-----VHLVRHGEVFN........PDRVL...------------------------------------------------
Q9K466_STRCO/9-189-----LYLARHGEAVP................------------------------------------------------
H2TRY4_TAKRU/250-436-----IYLCRHGESTD........NLEG....------------------------------------------------
Q81XN0_BACAN/4-182-----IIVIRHCSATG................------------------------------------------------
A1VJK7_POLNA/7-200-----IIAIRHGETTW........NVDTR...------------------------------------------------
D4MTA4_9FIRM/3-194-----LYLIRHRQTLW........NSEGK...------------------------------------------------
A9KSK5_CLOPH/3-194-----ILLLRHGESEGDL....MDVHE.....------------------------------------------------
G2TLP8_BACCO/4-199-----FYFVRHGQTEW........NADRN...------------------------------------------------
H8GZF0_DEIGI/4-198-----LFLVRHAETEH........NQRQV...------------------------------------------------
H6L710_SAPGL/6-200-----LYIYRHGRTRY........NLEHR...------------------------------------------------
Q08XQ0_STIAD/8-191-----IVLVRHGETAWSR....SGQHT.....------------------------------------------------
Q82M88_STRAW/4-196-----LILVRHGETEWSL....SGRHT.....------------------------------------------------
E2BWS4_HARSA/250-436-----IYLTRHGESLM........NLEG....------------------------------------------------
D3E804_GEOS4/7-201-----IYLVRHGQTEW........NVQHR...------------------------------------------------
Q039P6_LACC3/4-205-----LYFVRHGKTEW........NNQGR...------------------------------------------------
A9WBR5_CHLAA/16-207-----VLLIRHGMNDW........VHGRL...------------------------------------------------
B1VGF0_CORU7/234-430-----LLLLRHGQTEL........NRDGK...------------------------------------------------
F8DZM7_CORRG/181-377-----FLLLRHGQTQM........SVDGQ...------------------------------------------------
D7WEF3_9CORY/183-379-----FVLLRHGQTEH........SARKA...------------------------------------------------
E2Q4K4_STRC2/5-194-----ILLVRHGQTAWSL....LGRHT.....------------------------------------------------
C3AWM6_BACMY/4-187-----LGIIRHGSTHW........NKEGR...------------------------------------------------
D2SCU2_GEOOG/12-204-----LVLWRHGRTEW........NAAGR...------------------------------------------------
D5G4W9_TUBMM/6-203-----ITLVRHGQAHH........NIGW....------------------------------------------------
F5XRM5_MICPN/4-203-----VLLVRHGRTAA........NSSGI...------------------------------------------------
Q0TY40_PHANO/251-439-----IWLSRHGESQY........NLSG....------------------------------------------------
C6WMA8_ACTMD/193-386-----LHLVRHGQTELSV....ARRYS.....------------------------------------------------
G0G0W4_AMYMS/3-201-----MILLRHAESLG........NVDELA.Y------------------------------------------------
A7MRJ7_CROS8/43-238-----LLLIRHAETEW........NRGGL...------------------------------------------------
C0ZX17_RHOE4/16-202-----VVLMRHGETEWAR....TGKHT.....------------------------------------------------
D7E1I0_NOSA0/5-202-----IWIARHANRLDFVNPDWFMTAE.....------------------------------------------------
H8MW52_CORCM/8-191-----VVLVRHGETEWSR....SSQHT.....------------------------------------------------
F3Z271_DESAF/7-196-----IILARHGQVIQ........NSPRR...------------------------------------------------
G2NEA0_9ACTO/5-193-----ILLARHGQTQWSV....QGNHT.....------------------------------------------------
Q1CZG8_MYXXD/11-196-----VVLVRHGETEWSR....AGRHT.....------------------------------------------------
D3E7L5_GEOS4/3-187-----IGLVRHGLTDW........NALGK...------------------------------------------------
F6CII3_DESK7/6-199-----IILARHGATEWNR....ISRYQ.....------------------------------------------------
H2K063_STRHJ/266-462-----LVLLRHGETPL........TPQKRF..------------------------------------------------
B1HXM2_LYSSC/4-198-----FYLVRHGETQW........NQEQR...------------------------------------------------
E0UC66_CYAP2/32-226-----VWIARHGNRLDFVN.PEWFNTA.....------------------------------------------------
E1F6I1_GIAIA/6-200-----IYLVRHGETDF........NTDPEP..------------------------------------------------
Q8ETC4_OCEIH/4-185-----IYLVRHGETNW........NKEGR...------------------------------------------------
B0JTX1_MICAN/5-201-----LYFLRHGQTAY........SKTGGY..------------------------------------------------
D7LXF7_ARALL/27-219-----IVLVRHGETTW........NAAGR...------------------------------------------------
D3FUL6_BACPE/3-195-----LYLIRHGESEG........NRLGK...------------------------------------------------
D2B5L7_STRRD/253-447-----LLLLRHGETPL........SVERR...------------------------------------------------
C4ZPB7_THASP/15-211-----ICLVRHGETAW........NAERR...------------------------------------------------
B2A0N3_NATTJ/4-199-----LYLTRHGETEW........NLQKK...------------------------------------------------
Q11U91_CYTH3/15-208-----IYLVRHGQTEF........NKRGI...------------------------------------------------
B9DS14_STRU0/3-188-----CFLMRHGQTLF........NTQGR...------------------------------------------------
G8LVK0_CLOCD/3-197-----IYITRHGETEW........NVKGL...------------------------------------------------
Q2GMW9_CHAGB/228-418-----VWLSRHGESMF........NLDG....------------------------------------------------
F6EEJ9_AMYSD/159-353-----LLLLRHGQTQL........SIERR...------------------------------------------------
E3KVQ6_PUCGT/3-193-----ITLIRHGETDD........NRNQI...------------------------------------------------
Q1IXX4_DEIGD/21-217-----FWVVRHGESIW........NADGR...------------------------------------------------
E3DP32_HALPG/5-198-----LYLLRHGQTDW........NKQSI...------------------------------------------------
D9SXD1_CLOC7/4-198-----VLLIRHGETHF........NIQKR...------------------------------------------------
D7GCX1_PROFC/7-200-----LVLWRHGQTDW........NLAGR...------------------------------------------------
C7PMV1_CHIPD/4-187-----IALIRHGSTAW........NKEGK...------------------------------------------------
YO283_YEAST/19-212-----LFIIRHGQTEH........NVKKI...------------------------------------------------
A8MF31_ALKOO/4-198-----IYLTRHGETEW........NIQGK...------------------------------------------------
D8SNQ5_SELML/4-199-----LICVRHGETTW........NASGK...------------------------------------------------
D7C7F5_STRBB/4-196-----LVLIRHGETEWSR....SGRHT.....------------------------------------------------
Q5YQW5_NOCFA/13-199-----LVLLRHGETEWSA....LGRHT.....------------------------------------------------
C5CF58_KOSOT/4-198-----LYITRHGQTEW........NLEGR...------------------------------------------------
Q745R9_MYCPA/3-188-----VLLVRHALPLR........SEH.....------------------------------------------------
C8W6P5_DESAS/6-197-----IYLMRHGEILT........QAKR....------------------------------------------------
F4CRR8_PSEUX/8-197-----VYLLRHGETEWSQ....SGRHT.....------------------------------------------------
Q0KEC8_CUPNH/15-208-----LIVIRHGETAW........NRERR...------------------------------------------------
D0LB07_GORB4/15-213-----VILLRHGQTALSV....DRRYS.....------------------------------------------------
Q2JD27_FRASC/178-366-----TVLLRHGQTPL........SVEKR...------------------------------------------------
H2JNB2_STRHJ/4-202-----LILVRHGRSTA........NTSGV...------------------------------------------------
Q8DU48_STRMU/5-191-----FYLMRHGQTRF........NEQRR...------------------------------------------------
D2UBJ8_XANAP/3-199-----ILLARHGETPW........NAEGR...------------------------------------------------
Q3A796_PELCD/6-199-----VYLIRHGDTGE........ALKGR...------------------------------------------------
D2PPT8_KRIFD/4-202-----VILVRHGRSSA........NTSGV...------------------------------------------------
Q220I7_ALBFT/6-199-----IIAIRHGETAW........NVDTR...------------------------------------------------
A0R642_MYCS2/5-204-----LVLVRHGQSRA........NVD.....------------------------------------------------
G2KUE1_LACSM/18-218-----LYFVRHGKTEW........NLESR...------------------------------------------------
D8UL08_VOLCA/9-201-----VVLVRHGQTNW........NAEMR...------------------------------------------------
A6TKP0_ALKMQ/4-198-----LYIVRHGETEW........NTQRR...------------------------------------------------
Q6LIL4_PHOPR/8-199-----IDILRHGLPEG........D.GC....------------------------------------------------
A4J5S6_DESRM/6-199-----MYLVRHGETQW........NADGR...------------------------------------------------
A5D2P8_PELTS/5-198-----IFLVRHGETEW........NALMK...------------------------------------------------
D9QVX4_ACEAZ/5-198-----IILVRHGETLW........NKESR...------------------------------------------------
D3FA36_CONWI/9-192-----LWLVRHGETEWSR....SRRHT.....------------------------------------------------
F2N9U4_CORGP/5-198-----LYLMRHGETEF........NRADL...------------------------------------------------
G4L641_TETHN/3-201-----LYFTRHGKTEW........NEQGR...------------------------------------------------
B8E2M6_DICTD/4-197-----IYLIRHGETDW........NREAK...------------------------------------------------
F2F0S7_SOLSS/5-199-----VYLTRHGETVW........NTKKL...------------------------------------------------
A4T0I6_POLSQ/6-201-----FCLVRHGETDW........NVERR...------------------------------------------------
G2SPT2_LACRR/4-203-----LYFVRHGKTEW........NLEGR...------------------------------------------------
E6W2F2_DESIS/10-204-----YYLARHGQVEE........A.FHG...------------------------------------------------
Q9X194_THEMA/3-195-----LYLIRHGETIW........NEKGL...------------------------------------------------
G8LUT1_CLOCD/4-197-----IYLVRHGETDW........NKEDR...------------------------------------------------
C7QH56_CATAD/8-200-----VHLMRHGEVYN........PDGIL...------------------------------------------------
F8A8I3_THEID/6-196-----LFLVRHGQVDG........PKGV....------------------------------------------------
A0D7F1_PARTE/11-207-----IWLVRHGQTEG........NKLQI...------------------------------------------------
Q22T38_TETTS/22-202-----VLLVRHGQSMG........NYSGT...------------------------------------------------
E3IV15_FRASU/3-196-----LLLLRHGRTEW........NNDGR...------------------------------------------------
Q9SCS3_ARATH/16-210-----IVVVRHGETSW........NAERK...------------------------------------------------
Q2RJH0_MOOTA/6-199-----VYLVRHGETEWNN....SGRYQ.....------------------------------------------------
Q47IH2_DECAR/12-205-----ICLVRHGETEW........NAERR...------------------------------------------------
Q113G3_TRIEI/6-202-----VWIARHGNRIDFVN.PEWFNTA.....------------------------------------------------
C7R5L5_JONDD/6-202-----IVLVRHGRTAY........NAAMR...------------------------------------------------
F4L0A7_HALH1/4-197-----IFIIRHGETEL........NRKGI...------------------------------------------------
B1Y6N8_LEPCP/4-197-----LTLVRHGETDW........NRIRR...------------------------------------------------
B1Y8E3_LEPCP/9-202-----VLAIRHGETAW........NRDAR...------------------------------------------------
E1R062_OLSUV/8-199-----ILVMRHPETVA........NVRHF...------------------------------------------------
C6WAU4_ACTMD/4-201-----VILLRHARSTA........NGSAI...------------------------------------------------
E3H7F6_ILYPC/4-201-----IYFVRHGETEW........NIKGI...------------------------------------------------
Q5P7P2_AROAE/9-203-----LCLVRHGETAW........NAERR...------------------------------------------------
Q3A802_PELCD/11-203-----LYLVRHGDSRQ.......DK.LKR...------------------------------------------------
C7RK71_ACCPU/6-200-----ICLVRHGETNW........NAQQR...------------------------------------------------
C4L115_EXISA/4-189-----LCLVRHGQTDW........NRLEI...------------------------------------------------
Q46GR1_PROMT/229-424-----IILVRHGETDW........NKQGR...------------------------------------------------
C8W3Q4_DESAS/5-198-----VYLVRHGETVW........NANMR...------------------------------------------------
Q03YB7_LEUMM/4-203-----FYFVRHGQTEW........NLERR...------------------------------------------------
G4L012_OSCVS/4-198-----LYLIRHAEAEG........NLYRI...------------------------------------------------
D1CI13_THET1/4-198-----VWLARHGQTVW........GDEDR...------------------------------------------------
Q47LB4_THEFY/7-197-----IHLLRHGEVHN........PEGIL...------------------------------------------------
G8QLS4_AZOSU/8-203-----ICVIRHGETFW........NADRR...------------------------------------------------
H6RJR9_BLASD/4-199-----VILLRHGRTTA........NTGGV...------------------------------------------------
D1BKR1_SANKS/4-203-----VLLVRHGRTTA........NATGV...------------------------------------------------
E4N2L1_KITSK/4-203-----LLLVRHGRSTA........NSAGI...------------------------------------------------
F8L9A3_SIMNZ/4-204-----LIIVRHGNTFE........KGETPR..------------------------------------------------
A2SH69_METPP/10-209-----LYLMRHGSVDYF......LPDGT....------------------------------------------------
A8L509_FRASN/4-197-----LVLVRHGETEWSL....SRQHT.....------------------------------------------------
G0JM27_9GAMM/6-189-----IMLVRHGTSTWSA....SGQHT.....------------------------------------------------
E3HZR3_RHOVT/3-207-----LILARHGNTFE........AGEKPV..------------------------------------------------
A8L9X3_FRASN/6-204-----LLLVRHGEAHC........DTAG....------------------------------------------------
Q3ISX8_NATPD/4-201-----IVAVRHGETDW........NRNGR...------------------------------------------------
C5D2R4_GEOSW/4-198-----LYLTRHGETRW........NVEKR...------------------------------------------------
A4FA31_SACEN/162-361-----FLLLRHGQTAMSV....DRRYS.....------------------------------------------------
D1CEC2_THET1/5-199-----LILVRHGESEA........NAIGI...------------------------------------------------
H0PY04_9RHOO/14-208-----LCLVRHGETAW........NTEQR...------------------------------------------------
H2ANA8_KAZAF/21-215-----LFVIRHGQTEH........NVLKI...------------------------------------------------
Q65LP2_BACLD/4-185-----ICLIRHGETDW........NALGK...------------------------------------------------
C6XW10_PEDHD/5-199-----IYIIRHGETDL........NKQGI...------------------------------------------------
G8NTU1_GRAMM/8-195-----LWLVRHGETEWSL....DGRHT.....------------------------------------------------
B7KKU2_CYAP7/5-199-----LYFLRHGETTA........SQTGT...------------------------------------------------
A4FFP0_SACEN/15-212-----LILLRHARSAA........NGSGT...------------------------------------------------
D2PUU5_KRIFD/6-202-----LIVWRHGRTSW........NLQDK...------------------------------------------------
G0VP45_MEGEL/4-198-----LYLARHGETAG........NVQQW...------------------------------------------------
H5WTP9_9BURK/4-198-----LVVIRHGETDW........NRQLR...------------------------------------------------
I0HZE4_CALAS/7-199-----VLLIRHGENEYV......AT.HKL...------------------------------------------------
A5UTN8_ROSS1/4-200-----FYIIRHGQTDW........NLQGR...------------------------------------------------
E9T3E9_COREQ/12-198-----LVLLRHGETEWAR....LGRHT.....------------------------------------------------
E6U5E4_ETHHY/4-198-----IYLIRHAEAEG........NLRRI...------------------------------------------------
B0TIL4_HELMI/4-197-----VYLIRHGETEW........NLARR...------------------------------------------------
D7B3J6_NOCDD/7-195-----VLFWRHGRTSW........NVENR...------------------------------------------------
E5S5V1_TRISP/288-477-----IFLTRHGESEF........NRMA....------------------------------------------------
A8QBY9_MALGO/432-619-----IFISRHGESQY........NVEG....------------------------------------------------
D5X1T7_THIK1/3-197-----IILTRHGEVEGIH....PERFR.....------------------------------------------------
Q2W9Y0_MAGSA/8-200-----WWLLRHAPVPC........PHGR....------------------------------------------------
A4G1U3_HERAR/4-201-----ILLIRHGETDW........NVEKR...------------------------------------------------
A0RZ16_CENSY/25-219-----VIFLRHGQARN........NTERV...------------------------------------------------
B1WZ22_CYAA5/5-199-----LYFLRHGETES........SLKDS...------------------------------------------------
G2I053_GLUMN/23-220-----FWLIRHALVEQ........NARMR...------------------------------------------------
A4XA48_SALTO/210-405-----LVLVRHGATDY........TEQRR...------------------------------------------------
C0QQJ5_PERMH/4-196-----LILCRHGESEY........NAKRI...------------------------------------------------
F2NE04_DESAR/4-197-----IILVRHGQTPW........NKDKI...------------------------------------------------
E3CWY7_9BACT/18-211-----ILLVRHGECAG........NREGR...------------------------------------------------
G7V8B5_THELD/7-201-----LILARHGQTDW........NAQRR...------------------------------------------------
F6EE93_AMYSD/5-202-----LVLVRHAESES........NIL.....------------------------------------------------
G0HE54_CORVD/27-224-----LLLLRHGQTPM........SVAGV...------------------------------------------------
D7CTF2_TRURR/4-192-----LWLIRHGETDW........NREGR...------------------------------------------------
C4XRN5_DESMR/4-195-----LYLMRHGAIVQ........SHPRR...------------------------------------------------
D5DCI5_BACMD/2-191-----LYLIRHGQTDW........NKNKL...------------------------------------------------
F8L7X0_SIMNZ/6-189-----IFLVRHGETEWSK....SGQHT.....------------------------------------------------
C6WJD9_ACTMD/6-206-----IILLRHGQSLG........NVDELA.Y------------------------------------------------
Q01QD4_SOLUE/4-187-----LWLIRHGETEWSL....SGAHT.....------------------------------------------------
O67630_AQUAE/21-213-----IYLIRHAQSEY........NEKGI...------------------------------------------------
D3E7U3_GEOS4/4-184-----IYFVRHAESPF........IEG.....------------------------------------------------
F5WRW0_ERYRF/5-198-----IYLIRHGKTLW........NQEHR...------------------------------------------------
Q0BPI2_GRABC/16-203-----LILLCHAATDA........TRQA....------------------------------------------------
Q8DV19_STRMU/3-202-----LYFVRHGKTEW........NLEGR...------------------------------------------------
C6WJ12_ACTMD/7-195-----LYLVRHGQTAWSE....SGRHT.....------------------------------------------------
I0JQ97_HALH3/4-186-----IGLIRHGSTPW........NKEKR...------------------------------------------------
Q890L1_CLOTE/7-201-----LYITRHGQTEW........NTERR...------------------------------------------------
A4G6G7_HERAR/9-205-----VYLMRHGSVTY........FDADG...------------------------------------------------
Q67MI2_SYMTH/5-185-----IALVRHGVTDW........NYDGR...------------------------------------------------
B0RD00_CLAMS/47-237-----IVMVRHGQTEWSV....NGRHT.....------------------------------------------------
B7GKQ4_ANOFW/31-225-----LYVIRHAETEW........NAQQR...------------------------------------------------
B8EKJ6_METSB/5-199-----FCLVRHGETDW........NAEGR...------------------------------------------------
I0K575_9BACT/6-202-----LYIIRHGETDY........NRRGV...------------------------------------------------
F9ZSH9_ACICS/8-193-----ITLVRHGTTEWAA....SGRHT.....------------------------------------------------
F4GUJ2_PUSST/6-198-----FWLIRHGETQW........NAERR...------------------------------------------------
E6TZD4_BACCJ/4-202-----IFITRHGETKW........NIEKR...------------------------------------------------
A3QAT5_SHELP/6-198-----LYLMRHGECEG.......GNLL.....------------------------------------------------
F0YIY5_AURAN/82-285-----VILVRHGAVDRAGG..GVKP.DGL...------------------------------------------------
A8LFW3_FRASN/5-200-----LLFARHGEAHC........NLRRV...------------------------------------------------
F4CMY4_PSEUX/3-194-----LVLVRHALPTRIQP..GTVNVA.....------------------------------------------------
Q6FKJ4_CANGA/19-215-----IFIIRHGQTDH........NVKKI...------------------------------------------------
Q5WIH4_BACSK/3-196-----LYMIRHGESEG........NRLGK...------------------------------------------------
A0LTB5_ACIC1/211-404-----LLLVRHGVTSF........TLEKR...------------------------------------------------
F4PSW8_DICFS/370-558-----IWLCRAGASEWE......VLRK.....------------------------------------------------
G0VB21_NAUCC/21-215-----VFIIRHGQTDH........NVKKI...------------------------------------------------
Q5FS21_GLUOX/26-223-----FWLIRHAVVEA........SARKT...------------------------------------------------
F4B9W0_ACIHW/4-190-----VLFVRHGHSVS........NQNKI...------------------------------------------------
D1C2P1_SPHTD/5-200-----IIFVRHGETAG........NLDGR...------------------------------------------------
A9HYX7_BORPD/4-199-----IWFIRHGETSW........NREGR...------------------------------------------------
D9R017_CLOSW/3-192-----IYLIRHGRQNS.........KL.....------------------------------------------------
Q7NT51_CHRVO/8-202-----FCLVRHGETDW........NREYR...------------------------------------------------
D7CND1_SYNLT/3-196-----VYLVRHGETIW........NEKGR...------------------------------------------------
F8EAH6_RUNSL/6-202-----IYLIRHGETDY........NRRGV...------------------------------------------------
H8L495_FRAAD/3-195-----ILMARHGQTEW........NLAGR...------------------------------------------------
F4C717_SPHS2/5-199-----FYIIRHGETDL........NKQGI...------------------------------------------------
F4A2A2_MAHA5/4-197-----WYMVRHGQTLW........NLEGK...------------------------------------------------
A6TRG4_ALKMQ/4-197-----LFLLRHGETNW........NLEGR...------------------------------------------------
E3LC61_PUCGT/216-403-----IFFTRHGESQY........NVEG....------------------------------------------------
A0LHV7_SYNFM/386-579-----IFLIRHGAIRL........PEKPK...------------------------------------------------
D7FIE0_ECTSI/94-289-----IFLARHGQTDL........NKLGV...------------------------------------------------
B9S8J7_RICCO/19-213-----IIVVRHGETEW........NANGR...------------------------------------------------
F0RNH1_DEIPM/22-219-----FWVVRHGESSW........NASGR...------------------------------------------------
A9TAW0_PHYPA/4-197-----LLVVRHGETSWNV....LGRLQ.....------------------------------------------------
A8FBP0_BACP2/4-185-----ICLVRHGETDW........NAAKR...------------------------------------------------
C1CYM6_DEIDV/6-197-----LTLVRHGATEW........NEGGR...------------------------------------------------
E8V8F6_TERSS/7-190-----IWLVRHGETEWSL....SGAHT.....------------------------------------------------
Q8YXV2_NOSS1/5-199-----LYLLRHGQTEC.......SR.NNA...------------------------------------------------
H1YC42_9SPHI/6-200-----LYIIRHGQTDF........NKKGI...------------------------------------------------
D0NUL9_PHYIT/63-266-----LILVRHGESEG........NIDPLL.Y------------------------------------------------
H6RPL7_BLASD/7-199-----VHLLRHGEVHN........PGGVL...------------------------------------------------
E3PRT5_CLOSD/4-195-----YYIVRHGKTVW........NTEKR...------------------------------------------------
F4CPL7_PSEUX/29-222-----LLLLRHGQTALSV....ERRYS.....------------------------------------------------
E3GIM0_EUBLK/4-197-----LYLIRHGTTDA........NANGI...------------------------------------------------
F2RLZ2_STRVP/28-222-----LLLIRHGATEWSA....SGRHT.....------------------------------------------------
A1AP89_PELPD/13-205-----VFLMRHGDIRQ.......DNVRR....------------------------------------------------
A0D5U7_PARTE/23-205-----ILFVRHGQTNQ........NLSNT...------------------------------------------------
D7CRA3_TRURR/4-190-----LSLIRHAETHW........NLEGR...------------------------------------------------
F0S1R0_DESTD/4-200-----IILVRHGKTVW........NAEGR...------------------------------------------------
A6LX68_CLOB8/5-196-----VYLTRHGQTEW........NIERR...------------------------------------------------
A1SI90_NOCSJ/187-388-----VVLVRHGVTPH........TTEKRF.S------------------------------------------------
C1DZ31_MICSR/6-219-----FVLLRHGQTRW........NREGI...------------------------------------------------
A1K9A9_AZOSB/15-209-----ICLVRHGETPW........NAERR...------------------------------------------------
F0RK66_DEIPM/8-205-----LILIRHGQTAL........NAQGR...------------------------------------------------
H2J7Y6_MARPK/3-195-----IFLIRHGMTDW........NLKRK...------------------------------------------------
D3SL81_THEAH/4-197-----LFVVRHAESTW........NPEGR...------------------------------------------------
I0H0L2_ACTM4/169-364-----IALVRHGATPM........TAQGR...------------------------------------------------
D2PWV1_KRIFD/7-199-----VHLMRHGEVHN........PTGVL...------------------------------------------------
H8KQQ2_SOLCM/26-220-----LYIVRHGETDF........NRSGV...------------------------------------------------
D4M9J9_9BACT/3-199-----LFIVRHGETAW........NREGR...------------------------------------------------
D6GQ74_FILAD/4-199-----LYVTRHGQTVW........NVERK...------------------------------------------------
C6D8K0_PAESJ/4-200-----IILVQHCQSEH........HVNGM...------------------------------------------------
YQGD_SCHPO/56-250-----CLLVRHAESEH........NVRGI...------------------------------------------------
Q6CU83_KLULA/19-210-----LFVIRHGQTEE........NLKKI...------------------------------------------------
H5WQ77_9BURK/7-200-----IVAIRHGETAW........NVDTR...------------------------------------------------
D8K089_DEHLB/3-197-----LILVRHGEIAS........AGTGI...------------------------------------------------
Q752M0_ASHGO/19-204-----LFVIRHGQTDE........NVNKI...------------------------------------------------
A5GRZ9_SYNR3/7-190-----IWLLRHGATEWSR....NGRHT.....------------------------------------------------
G8PCV9_PEDCP/4-209-----LYFIRHGKTKW........NLERR...------------------------------------------------
C5AAI7_BURGB/12-209-----IYLMRHGDVTYFD....AARQA.....------------------------------------------------
A6LYX0_CLOB8/6-201-----LYLIRHGQTKW........NLEKR...------------------------------------------------
G8PKK2_PSEUV/5-200-----LILLRHGESEH........LLQGV...------------------------------------------------
G0HCC2_CORVD/15-213-----LLLIRHGQTEF........NKAGR...------------------------------------------------
D1B6G9_THEAS/4-191-----LLLVRHGETGA........PRGIM...------------------------------------------------
A9WMJ6_RENSM/7-207-----ILMLRHGQSEA........NRDQTI.Y------------------------------------------------
D7CRM6_TRURR/14-202-----LWLVRHGESLW........NLEGR...------------------------------------------------
E1VYH9_ARTAR/6-206-----VHLLRHGEVFN........PDRML...------------------------------------------------
A3I0N5_9BACT/6-199-----IYLVRHGQTDF........NLKGV...------------------------------------------------
F5XXJ6_RAMTT/6-200-----IIAVRHGETAW........NVDGR...------------------------------------------------
E4TVK9_MARTH/5-199-----IYIVRHGQTDY........NLRGI...------------------------------------------------
D7CTF3_TRURR/6-194-----LWLVCHGETPWSR....EGRAQ.....------------------------------------------------
A8NEW8_COPC7/6-200-----VYIVRHGETAE........NRNGI...------------------------------------------------
C9LWB8_SELS3/4-197-----IYLVRHGLTEW........NSGGR...------------------------------------------------
A2SCK3_METPP/9-202-----IVAVRHGETAW........NVDTR...------------------------------------------------
I0I391_CALAS/7-202-----VILVRHGETTA........NHEQR...------------------------------------------------
D7GDV6_PROFC/6-200-----FVLMRHGETDW........NTKNQ...------------------------------------------------
F0SCC4_PEDSD/9-205-----IYIIRHGETDY........NKAGL...------------------------------------------------
Q82HM5_STRAW/9-190-----LYLARHGEATA................------------------------------------------------
F5YTK7_MYCSD/3-188-----LLLIRHALPLR........SEY.....------------------------------------------------
A9B597_HERA2/3-196-----LIVVRHGETAW........NAERR...------------------------------------------------
F8C410_THEGP/11-201-----LIFIRHGFIAE........EYRKI...------------------------------------------------
E8U708_DEIML/12-204-----LTLVRHGVTAW........NTEGR...------------------------------------------------
A1RBG3_ARTAT/3-197-----LLLIRHGQTPG........NVA.....------------------------------------------------
B4U6G2_HYDS0/4-195-----IYLIRHAQSEY........NEKGI...------------------------------------------------
A9GMF5_SORC5/6-203-----LVLVRHGHTAG........NRAGPA.T------------------------------------------------
A0C4I4_PARTE/221-414-----IYLSRHGESQY........NVGH....------------------------------------------------
Q8RA82_THETN/5-198-----LYIARHGQSKW........NLESR...------------------------------------------------
D3SNK7_THEAH/4-196-----LYLIRHAQSEY........NEKGI...------------------------------------------------
E3PXR0_CLOSD/4-193-----IYLIRHAQTVD........NLSKK...------------------------------------------------
C7MXW3_SACVD/6-193-----VFLLRHALTEWSS....PGRYV.....------------------------------------------------
F2UB54_SALR5/10-206-----LILVRHGETTW........NVERR...------------------------------------------------
G8LZ21_CLOCD/5-199-----LIFVRHAEAEG........NYYRI...------------------------------------------------
F5Z355_MYCSD/10-196-----VALVRHGLPLR........VEG.....------------------------------------------------
A9KNM7_CLOPH/3-193-----IFLIRHGRQSS.........QL.....------------------------------------------------
D5UTB9_TSUPD/21-219-----LILLRHGQTAS........NAEGR...------------------------------------------------
D3QBR8_STANL/4-188-----IVLVRHGQTEWSR....SGRHT.....------------------------------------------------
E4RUN0_LEAB4/6-202-----IYLIRHGETEY........NKSGA...------------------------------------------------
PSPA_HYDTT/4-197-----LILVRHAESEWNP....VGRYQ.....------------------------------------------------
A1TUY5_ACIAC/7-200-----IIAIRHGETAW........NVDTR...------------------------------------------------
A3DDB3_CLOTH/4-198-----LYLVRHGQTDW........NKENR...------------------------------------------------
A3DE01_CLOTH/7-201-----IIFVRHAEAEG........NLNRV...------------------------------------------------
A4XKT7_CALS8/6-197-----VYLIRHAEAEG........NFIRR...------------------------------------------------
A5N4L6_CLOK5/4-199-----LYLVRHGETIW........NIERK...------------------------------------------------
A8AW93_STRGC/3-202-----LYFIRHGKTEW........NLEGR...------------------------------------------------
A9BUH9_DELAS/6-199-----IIAIRHGETAW........NVDAR...------------------------------------------------
A9WDJ8_CHLAA/4-198-----VYLIRHGETDW........NMQGR...------------------------------------------------
A9WI66_CHLAA/3-196-----LILVRHGETPW........NQTLQ...------------------------------------------------
B2GB95_LACF3/4-204-----IYFIRHGKTEW........NLAAR...------------------------------------------------
B2TR14_CLOBB/4-195-----LFLTRHGETEW........NIAGR...------------------------------------------------
B4EET0_BURCJ/6-203-----ILFIRHGETAW........NRIKR...------------------------------------------------
B7J3Q1_ACIF2/6-188-----ITLVRHGATEW........ADSGK...------------------------------------------------
B7K5Q7_CYAP8/5-197-----IYFLRHGETTA........SQTGT...------------------------------------------------
B7K5Q8_CYAP8/5-198-----LYFLRHGQTAY........SKTGG...------------------------------------------------
C1A1J7_RHOE4/16-207-----LILLRHGQTEY........NADSR...------------------------------------------------
C4M5P9_ENTHI/4-193-----LILIRHGETEW........NLLGK...------------------------------------------------
C8WXI8_ALIAD/3-178-----IWLVRHGETDW........NVEGR...------------------------------------------------
D0J8B8_COMT2/6-200-----IIAIRHGETTW........NVDGR...------------------------------------------------
D0MFF3_RHOM4/6-203-----LYFVRHGETDY........NRNGI...------------------------------------------------
PSPB_HYDTT/4-194-----LYLVRHAQSEY........NEKGI...------------------------------------------------
D3EF23_GEOS4/3-199-----IYFVRHGQDEE........GYR.....------------------------------------------------
D4ZU25_ARTPN/5-201-----VWIARHGNRIDFVN.PEWFNTA.....------------------------------------------------
D4ZY14_ARTPN/5-199-----LWIARHGDRQD........HADSNWYR------------------------------------------------
D5X3R0_THIK1/11-204-----IIAIRHGETDW........NAAAR...------------------------------------------------
D9QBM8_CORP2/186-379-----FLLLRHGQTPM........SAARQ...------------------------------------------------
D9TCE6_MICAI/4-187-----ILLIRHGETTW........SAAHR...------------------------------------------------
E2Q1Y3_STRC2/296-492-----FVLLRHGETAL........TPEKRF.S------------------------------------------------
E3HNV8_ACHXA/4-200-----IWFIRHGETDW........NRQRR...------------------------------------------------
E9T6R4_COREQ/181-372-----.LLLRHGQTEL........SVERR...------------------------------------------------
E9T8C0_COREQ/5-201-----LILVRHGQTEA........NVERR...------------------------------------------------
F3Z543_9ACTO/9-196-----VLLVRHGQTAW........SRSGQ...------------------------------------------------
F3ZAP6_9ACTO/8-184-----.HLVRHAEPAP........D.......------------------------------------------------
F6B5X8_DESCC/5-197-----ICLVRHGETVW........NSNGK...------------------------------------------------
F9UQA5_LACPL/4-204-----LLFVRHGKTEW........NLEGR...------------------------------------------------
G2J5B1_PSEUL/9-203-----FCFVRHGETDW........NRERR...------------------------------------------------
H0UKK7_9BACT/8-199-----IVLLRHGVTDW........NCQSR...------------------------------------------------
H6MTJ9_GORPV/7-199-----IVLVRHGQTAL........SVDRR...------------------------------------------------
I2BB94_SHIBC/3-198-----LWFIRHGETEA........NLAGL...------------------------------------------------
J3MTT3_ORYBR/86-279-----.VVVRHGETAW........NASRI...------------------------------------------------
J9RE89_9ACTO/4-200-----LHLVRHGETTS........NVMRR...------------------------------------------------
K0I0L2_9BURK/7-205-----LILIRHGETDW........NRELR...------------------------------------------------
M9X0U0_PASHA/5-206-----IYLVRHGRTVW........NLEGR...------------------------------------------------
PHOE_BACSU/4-184-----VCLVRHGETDW........NLQQK...------------------------------------------------
COBC_SALTY/3-195-----LWLVRHGETEA........NVAGL...------------------------------------------------
P73454_SYNY3/5-196-----LYFLRHAQTAY........SATGG...------------------------------------------------
Q142E5_BURXL/12-206-----IFLMRHGDVTY.......FDDSGR...------------------------------------------------
Q1D982_MYXXD/5-197-----FILLRHGETEW........NSLGR...------------------------------------------------
Q1GAS0_LACDA/3-202-----IYFVRHGKTQW........NLEQR...------------------------------------------------
Q2S2V8_SALRD/16-213-----LYLVRHGETEY........NRRGI...------------------------------------------------
Q31LG1_SYNE7/5-198-----LYLVRHGETTA........SREGG...------------------------------------------------
Q3Z6L9_DEHM1/5-197-----.YLIRHGETDW........NNKRR...------------------------------------------------
Q53WE2_THET8/5-190-----LLLLRHGEVDY........FPQGR...------------------------------------------------
Q55734_SYNY3/5-198-----LYFLRHGETTS........SQTGT...------------------------------------------------
Q5KZY5_GEOKA/9-198-----LYLTRHGETKW........NVERR...------------------------------------------------
Q5M513_STRT2/3-202-----LYFVRHGKTQW........NLEGR...------------------------------------------------
Q5SM93_THET8/17-207-----LLLTRAGPVEN........PRH.V...------------------------------------------------
Q63WA7_BURPS/3-184-----VVLIRHPAVAL.........GTGV...------------------------------------------------
Q65KU1_BACLD/4-191-----LYIARHGQTEW........NIEKR...------------------------------------------------
Q6AAY7_PROAC/7-194-----VHLLRHGEVDN........PTGVL...------------------------------------------------
Q6MWZ7_MYCTU/8-191-----LLLLRHGETAW........STLGR...------------------------------------------------
Q6NG55_CORDI/177-370-----FVLLRHGQTAM........SAARQ...------------------------------------------------
Q74JW8_LACJO/3-202-----LYFVRHGKTKW........NLEGR...------------------------------------------------
Q7V6P3_PROMM/6-190-----LWIIRHGATEW........ALQGR...------------------------------------------------
Q819N7_BACCR/4-184-----ICLVRHGQTDW........NFQEI...------------------------------------------------
Q81RH1_BACAN/3-190-----ILLIRHGESEA........DILNV...------------------------------------------------
Q8FNL1_COREF/236-428-----LLLLRHGQTAM........SAARQ...------------------------------------------------
Q8NT72_CORGL/6-197-----VHLVRHGEVHN........PEKIL...------------------------------------------------
Q8RFA7_FUSNN/3-199-----IYFVRHGQTIW........NVEKR...------------------------------------------------
Q8XP82_CLOPE/3-199-----IYFTRHGETLW........NLEHR...------------------------------------------------
Q8Y237_RALSO/17-210-----IVLVRHGETDW........NRERR...------------------------------------------------
Q8YA91_LISMO/8-204-----IYFVRHGKTEW........NMTGQ...------------------------------------------------
GPMB_YERPE/4-194-----VYLVRHGETLW........NAARR...------------------------------------------------
Q97ET5_CLOAB/5-198-----VLLVRHGETEW........NVQGR...------------------------------------------------
Q9PC95_XYLFA/3-198-----ILLARHGETLW........NAEGR...------------------------------------------------
Q9RKV8_STRCO/4-195-----LFLVRHGETEW........SRSGR...------------------------------------------------
R5J9E3_9FIRM/5-197-----.YLVRHGQTEW........NTQGR...------------------------------------------------
R5RIR8_9FIRM/3-193-----IYLTRHSKTLW........NQEKR...------------------------------------------------
R5T6S4_9FIRM/4-197-----IILIRHGETTW........NVEGR...------------------------------------------------
R5TTE8_9CLOT/3-188-----LYLIRHGQTDW........NIQGK...------------------------------------------------
R5XAL3_9CLOT/4-198-----LILVRHVLTED........NELAK...------------------------------------------------
R5XCV5_9CLOT/5-198-----IYIVRHGQTEW........NLLGK...------------------------------------------------
R6G925_9FIRM/3-196-----LYLVRHGETAL........NEKGC...------------------------------------------------
R6JTD2_9CLOT/3-186-----LFLIRHGRQCS........KLC.....------------------------------------------------
R6ULZ9_9FIRM/4-196-----FYFVRHGETLS........NIWHT...------------------------------------------------
R7FT81_9FIRM/32-228-----LYLVRHGETDW........NKVKK...------------------------------------------------
R7G8S3_9FIRM/4-195-----LYFIRHGETLS........NTWHT...------------------------------------------------
U4KIP7_9VIBR/4-197-----IHIFRHGQTQW........NLEKR...------------------------------------------------
U5L4S7_9BACI/4-197-----LYFVRHGETEW........NKSGR...------------------------------------------------
U5L644_9BACI/4-196-----LLLIRHGQSEA........DLLNV...------------------------------------------------
U5LDT0_9BACI/4-184-----ICLVRHGQTDW........NAEGR...------------------------------------------------
V6K5U9_STRNV/6-198-----LVFVRHGQAQC........NADGL...------------------------------------------------
W0E7D0_9FIRM/4-193-----VILTRHGETQW........NLEGR...------------------------------------------------

PF00328

PHYA_ASPFU/71-425.................................NATDFKGKFAFLKTY................................
VIP1_CAEEL/363-914ILEKLREGTGEEEIHKSEHDLEVCEEEMKKWEQMRTVLEMYGHFSGINRKVQMKYLKERET......KTSDEELRREGPA
Q22525_CAEEL/28-375..................................HNDQFTENYWM...................................
Q6BUR8_DEBHA/63-396.................................YNGTFKGQLSFLNDYTYF.........................VSNS
VIP1_HUMAN/390-910........TRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMYGHFSGINRKVQLTYYPHGVKA...SNEGQDPQRETLAPS
PPAX_CAEEL/28-365....................................FPISEKNWT...................................
Q6BWV9_DEBHA/521-1079..............ETVKIAEEKKLEDLKKLKQLRGALEKKMDFPGTKIQLKPSLN...............SENPETVEK
VIP2_HUMAN/379-894........ARQLLMELGQNNDSEIEENKPKLEQLKTVLEMYGHFSGINRKVQLTYLPHGCPK....TSSEEEDSRREEPS
VIP1_DROME/402-926........ARFLLSEIHTKAHAEIEEKESKLEQLKNVLEMYGHFSGINRKVQMKYQPKGRPRGSSSDDTNLAADQPVEPS
PHYB_EMENI/70-422.................................NATSFWGQYAFLESY................................
Q7SEH2_NEUCR/194-548.................................GKFNATGELEFLNNW................................
ACPL2_DANRE/88-449..........................PLLASFISHMALGGRGHWDASLGSL.........................PRLP
PPA_ECOLI/29-375..................................LMQDVTPDAWP...................................
Q6BM75_DEBHA/63-397.................................YNGTFKGELSFLNDYTYF.........................VEDK
Q6CZF4_PECAS/34-372..................................ALESGTARQWP...................................
VIP1_YEAST/538-1047..............QALRIALDEKAGNPAKIKVLANALEKKLNFPGTKIQLKPVL.................NKENEVEK
Q6FJ21_CANGA/510-1016..............QALRIALEEKAGNPTKIKLLANTLEKKLELPGTKIQLKPVL.................TQNNEVEK
Q6CYI2_KLULA/67-401.................................FQGQFDGPLEIFNDYEFFVSD....................TKYFDQ
Q6CWN2_KLULA/534-1048..............QALKIAQEENAEDPAKLAVLANALEKKISFPGTKIQLKPVL.................NKDNEVEK
Q6CES1_YARLI/413-907..............TTRRATREATDEDPQKMANLIIALEKKMDFPGTKVQIKPTIN................KSTGEVEK
Q6AVJ1_ORYSJ/361-950......QLVPPTRSGRESDSDAEDLEHIEKLRQVKAVLEEGGHFSGIYRKVQLKPLKWIRV.....PKRCGDGEEERPIE
Q9AAQ4_CAUCR/24-359..................................RLEEASARPWP...................................
Q19175_CAEEL/28-376..................................NVDPFQEDSWT...................................
Q6CLW3_KLULA/69-406.................................MKGEFKGPLAIFNEYEYLVED....................NIYLDQ
PHO11_CAEEL/25-364................................................................................
PPA4_SCHPO/25-385.........................QIKGEKEWSVLGFERKVESPVDTSLAAP......................TSDNS
PPA1_SCHPO/59-395................................LLNGSVPIDYSVSGNPLS............................FV
PHYA_ASPOR/71-426.................................NATSFSGKYAFLKSY................................
Q6CCS5_YARLI/180-538.................................INNQTDEMFAWVD..................................
Q19076_CAEEL/26-371..................................KTDPFQEDAWQ...................................
Q84TX6_ORYSJ/68-441.............................KQGPESDSLKKIPSWMK..................................
Q84WW3_ARATH/362-953......RMLIPRARSGESDSDAEDLEHADKLRQVKAVLEEGGHFSGIYRKVQLKPLKWVNV.....PKSDGEGEEERPVE
PPA2_SCHPO/59-405...............................KLLNGSIPVNFSYPENPLY............................FV
VIP1_SCHPO/387-861...............ATNLATELKCEDINKLKQLRLALETKKDLPGTKVQLKPAY.................SPEGKLLK
PPA3_SCHPO/59-405...............................KLLNGSIPVNFSYPENPLC............................FI
A6T657_KLEP7/32-357.................................EAIEAATGRPWT...................................
C4QZN1_PICPG/75-409.................................DVEVPTGPLSFFQDYDYF.........................VSDA
E2RTX6_GIAIC/15-344..............................STLQAGSTAHTKHFLAVYNTP..........................HPT
F1RD51_DANRE/72-409...................................DSLRSASSWLNDLKT............................WK
G2QKZ0_THIHA/65-455.................................GAISYGPGYEFLRTY................................
G3Y8Z5_ASPNA/73-427.................................NATTFEGKYAFLKTY................................
G7XM48_ASPKW/72-404.................................NTTEYKGDLAFLNDWTYY.........................VPNE
S8B7A5_PENO1/144-500.................................NATAYNGQSVFLRAY................................

PF00300

D7B452_NOCDD/4-197--------------------------------------------------------------------------------
D6S4F7_9LACO/3-204--------------------------------------------------------------------------------
C6VSA5_DYAFD/6-202--------------------------------------------------------------------------------
A6W5M7_KINRD/8-200--------------------------------------------------------------------------------
Q9K466_STRCO/9-189--------------------------------------------------------------------------------
H2TRY4_TAKRU/250-436--------------------------------------------------------------------------------
Q81XN0_BACAN/4-182--------------------------------------------------------------------------------
A1VJK7_POLNA/7-200--------------------------------------------------------------------------------
D4MTA4_9FIRM/3-194--------------------------------------------------------------------------------
A9KSK5_CLOPH/3-194--------------------------------------------------------------------------------
G2TLP8_BACCO/4-199--------------------------------------------------------------------------------
H8GZF0_DEIGI/4-198--------------------------------------------------------------------------------
H6L710_SAPGL/6-200--------------------------------------------------------------------------------
Q08XQ0_STIAD/8-191--------------------------------------------------------------------------------
Q82M88_STRAW/4-196--------------------------------------------------------------------------------
E2BWS4_HARSA/250-436--------------------------------------------------------------------------------
D3E804_GEOS4/7-201--------------------------------------------------------------------------------
Q039P6_LACC3/4-205--------------------------------------------------------------------------------
A9WBR5_CHLAA/16-207--------------------------------------------------------------------------------
B1VGF0_CORU7/234-430--------------------------------------------------------------------------------
F8DZM7_CORRG/181-377--------------------------------------------------------------------------------
D7WEF3_9CORY/183-379--------------------------------------------------------------------------------
E2Q4K4_STRC2/5-194--------------------------------------------------------------------------------
C3AWM6_BACMY/4-187--------------------------------------------------------------------------------
D2SCU2_GEOOG/12-204--------------------------------------------------------------------------------
D5G4W9_TUBMM/6-203--------------------------------------------------------------------------------
F5XRM5_MICPN/4-203--------------------------------------------------------------------------------
Q0TY40_PHANO/251-439--------------------------------------------------------------------------------
C6WMA8_ACTMD/193-386--------------------------------------------------------------------------------
G0G0W4_AMYMS/3-201--------------------------------------------------------------------------------
A7MRJ7_CROS8/43-238--------------------------------------------------------------------------------
C0ZX17_RHOE4/16-202--------------------------------------------------------------------------------
D7E1I0_NOSA0/5-202--------------------------------------------------------------------------------
H8MW52_CORCM/8-191--------------------------------------------------------------------------------
F3Z271_DESAF/7-196--------------------------------------------------------------------------------
G2NEA0_9ACTO/5-193--------------------------------------------------------------------------------
Q1CZG8_MYXXD/11-196--------------------------------------------------------------------------------
D3E7L5_GEOS4/3-187--------------------------------------------------------------------------------
F6CII3_DESK7/6-199--------------------------------------------------------------------------------
H2K063_STRHJ/266-462--------------------------------------------------------------------------------
B1HXM2_LYSSC/4-198--------------------------------------------------------------------------------
E0UC66_CYAP2/32-226--------------------------------------------------------------------------------
E1F6I1_GIAIA/6-200--------------------------------------------------------------------------------
Q8ETC4_OCEIH/4-185--------------------------------------------------------------------------------
B0JTX1_MICAN/5-201--------------------------------------------------------------------------------
D7LXF7_ARALL/27-219--------------------------------------------------------------------------------
D3FUL6_BACPE/3-195--------------------------------------------------------------------------------
D2B5L7_STRRD/253-447--------------------------------------------------------------------------------
C4ZPB7_THASP/15-211--------------------------------------------------------------------------------
B2A0N3_NATTJ/4-199--------------------------------------------------------------------------------
Q11U91_CYTH3/15-208--------------------------------------------------------------------------------
B9DS14_STRU0/3-188--------------------------------------------------------------------------------
G8LVK0_CLOCD/3-197--------------------------------------------------------------------------------
Q2GMW9_CHAGB/228-418--------------------------------------------------------------------------------
F6EEJ9_AMYSD/159-353--------------------------------------------------------------------------------
E3KVQ6_PUCGT/3-193--------------------------------------------------------------------------------
Q1IXX4_DEIGD/21-217--------------------------------------------------------------------------------
E3DP32_HALPG/5-198--------------------------------------------------------------------------------
D9SXD1_CLOC7/4-198--------------------------------------------------------------------------------
D7GCX1_PROFC/7-200--------------------------------------------------------------------------------
C7PMV1_CHIPD/4-187--------------------------------------------------------------------------------
YO283_YEAST/19-212--------------------------------------------------------------------------------
A8MF31_ALKOO/4-198--------------------------------------------------------------------------------
D8SNQ5_SELML/4-199--------------------------------------------------------------------------------
D7C7F5_STRBB/4-196--------------------------------------------------------------------------------
Q5YQW5_NOCFA/13-199--------------------------------------------------------------------------------
C5CF58_KOSOT/4-198--------------------------------------------------------------------------------
Q745R9_MYCPA/3-188--------------------------------------------------------------------------------
C8W6P5_DESAS/6-197--------------------------------------------------------------------------------
F4CRR8_PSEUX/8-197--------------------------------------------------------------------------------
Q0KEC8_CUPNH/15-208--------------------------------------------------------------------------------
D0LB07_GORB4/15-213--------------------------------------------------------------------------------
Q2JD27_FRASC/178-366--------------------------------------------------------------------------------
H2JNB2_STRHJ/4-202--------------------------------------------------------------------------------
Q8DU48_STRMU/5-191--------------------------------------------------------------------------------
D2UBJ8_XANAP/3-199--------------------------------------------------------------------------------
Q3A796_PELCD/6-199--------------------------------------------------------------------------------
D2PPT8_KRIFD/4-202--------------------------------------------------------------------------------
Q220I7_ALBFT/6-199--------------------------------------------------------------------------------
A0R642_MYCS2/5-204--------------------------------------------------------------------------------
G2KUE1_LACSM/18-218--------------------------------------------------------------------------------
D8UL08_VOLCA/9-201--------------------------------------------------------------------------------
A6TKP0_ALKMQ/4-198--------------------------------------------------------------------------------
Q6LIL4_PHOPR/8-199--------------------------------------------------------------------------------
A4J5S6_DESRM/6-199--------------------------------------------------------------------------------
A5D2P8_PELTS/5-198--------------------------------------------------------------------------------
D9QVX4_ACEAZ/5-198--------------------------------------------------------------------------------
D3FA36_CONWI/9-192--------------------------------------------------------------------------------
F2N9U4_CORGP/5-198--------------------------------------------------------------------------------
G4L641_TETHN/3-201--------------------------------------------------------------------------------
B8E2M6_DICTD/4-197--------------------------------------------------------------------------------
F2F0S7_SOLSS/5-199--------------------------------------------------------------------------------
A4T0I6_POLSQ/6-201--------------------------------------------------------------------------------
G2SPT2_LACRR/4-203--------------------------------------------------------------------------------
E6W2F2_DESIS/10-204--------------------------------------------------------------------------------
Q9X194_THEMA/3-195--------------------------------------------------------------------------------
G8LUT1_CLOCD/4-197--------------------------------------------------------------------------------
C7QH56_CATAD/8-200--------------------------------------------------------------------------------
F8A8I3_THEID/6-196--------------------------------------------------------------------------------
A0D7F1_PARTE/11-207--------------------------------------------------------------------------------
Q22T38_TETTS/22-202--------------------------------------------------------------------------------
E3IV15_FRASU/3-196--------------------------------------------------------------------------------
Q9SCS3_ARATH/16-210--------------------------------------------------------------------------------
Q2RJH0_MOOTA/6-199--------------------------------------------------------------------------------
Q47IH2_DECAR/12-205--------------------------------------------------------------------------------
Q113G3_TRIEI/6-202--------------------------------------------------------------------------------
C7R5L5_JONDD/6-202--------------------------------------------------------------------------------
F4L0A7_HALH1/4-197--------------------------------------------------------------------------------
B1Y6N8_LEPCP/4-197--------------------------------------------------------------------------------
B1Y8E3_LEPCP/9-202--------------------------------------------------------------------------------
E1R062_OLSUV/8-199--------------------------------------------------------------------------------
C6WAU4_ACTMD/4-201--------------------------------------------------------------------------------
E3H7F6_ILYPC/4-201--------------------------------------------------------------------------------
Q5P7P2_AROAE/9-203--------------------------------------------------------------------------------
Q3A802_PELCD/11-203--------------------------------------------------------------------------------
C7RK71_ACCPU/6-200--------------------------------------------------------------------------------
C4L115_EXISA/4-189--------------------------------------------------------------------------------
Q46GR1_PROMT/229-424--------------------------------------------------------------------------------
C8W3Q4_DESAS/5-198--------------------------------------------------------------------------------
Q03YB7_LEUMM/4-203--------------------------------------------------------------------------------
G4L012_OSCVS/4-198--------------------------------------------------------------------------------
D1CI13_THET1/4-198--------------------------------------------------------------------------------
Q47LB4_THEFY/7-197--------------------------------------------------------------------------------
G8QLS4_AZOSU/8-203--------------------------------------------------------------------------------
H6RJR9_BLASD/4-199--------------------------------------------------------------------------------
D1BKR1_SANKS/4-203--------------------------------------------------------------------------------
E4N2L1_KITSK/4-203--------------------------------------------------------------------------------
F8L9A3_SIMNZ/4-204--------------------------------------------------------------------------------
A2SH69_METPP/10-209--------------------------------------------------------------------------------
A8L509_FRASN/4-197--------------------------------------------------------------------------------
G0JM27_9GAMM/6-189--------------------------------------------------------------------------------
E3HZR3_RHOVT/3-207--------------------------------------------------------------------------------
A8L9X3_FRASN/6-204--------------------------------------------------------------------------------
Q3ISX8_NATPD/4-201--------------------------------------------------------------------------------
C5D2R4_GEOSW/4-198--------------------------------------------------------------------------------
A4FA31_SACEN/162-361--------------------------------------------------------------------------------
D1CEC2_THET1/5-199--------------------------------------------------------------------------------
H0PY04_9RHOO/14-208--------------------------------------------------------------------------------
H2ANA8_KAZAF/21-215--------------------------------------------------------------------------------
Q65LP2_BACLD/4-185--------------------------------------------------------------------------------
C6XW10_PEDHD/5-199--------------------------------------------------------------------------------
G8NTU1_GRAMM/8-195--------------------------------------------------------------------------------
B7KKU2_CYAP7/5-199--------------------------------------------------------------------------------
A4FFP0_SACEN/15-212--------------------------------------------------------------------------------
D2PUU5_KRIFD/6-202--------------------------------------------------------------------------------
G0VP45_MEGEL/4-198--------------------------------------------------------------------------------
H5WTP9_9BURK/4-198--------------------------------------------------------------------------------
I0HZE4_CALAS/7-199--------------------------------------------------------------------------------
A5UTN8_ROSS1/4-200--------------------------------------------------------------------------------
E9T3E9_COREQ/12-198--------------------------------------------------------------------------------
E6U5E4_ETHHY/4-198--------------------------------------------------------------------------------
B0TIL4_HELMI/4-197--------------------------------------------------------------------------------
D7B3J6_NOCDD/7-195--------------------------------------------------------------------------------
E5S5V1_TRISP/288-477--------------------------------------------------------------------------------
A8QBY9_MALGO/432-619--------------------------------------------------------------------------------
D5X1T7_THIK1/3-197--------------------------------------------------------------------------------
Q2W9Y0_MAGSA/8-200--------------------------------------------------------------------------------
A4G1U3_HERAR/4-201--------------------------------------------------------------------------------
A0RZ16_CENSY/25-219--------------------------------------------------------------------------------
B1WZ22_CYAA5/5-199--------------------------------------------------------------------------------
G2I053_GLUMN/23-220--------------------------------------------------------------------------------
A4XA48_SALTO/210-405--------------------------------------------------------------------------------
C0QQJ5_PERMH/4-196--------------------------------------------------------------------------------
F2NE04_DESAR/4-197--------------------------------------------------------------------------------
E3CWY7_9BACT/18-211--------------------------------------------------------------------------------
G7V8B5_THELD/7-201--------------------------------------------------------------------------------
F6EE93_AMYSD/5-202--------------------------------------------------------------------------------
G0HE54_CORVD/27-224--------------------------------------------------------------------------------
D7CTF2_TRURR/4-192--------------------------------------------------------------------------------
C4XRN5_DESMR/4-195--------------------------------------------------------------------------------
D5DCI5_BACMD/2-191--------------------------------------------------------------------------------
F8L7X0_SIMNZ/6-189--------------------------------------------------------------------------------
C6WJD9_ACTMD/6-206--------------------------------------------------------------------------------
Q01QD4_SOLUE/4-187--------------------------------------------------------------------------------
O67630_AQUAE/21-213--------------------------------------------------------------------------------
D3E7U3_GEOS4/4-184--------------------------------------------------------------------------------
F5WRW0_ERYRF/5-198--------------------------------------------------------------------------------
Q0BPI2_GRABC/16-203--------------------------------------------------------------------------------
Q8DV19_STRMU/3-202--------------------------------------------------------------------------------
C6WJ12_ACTMD/7-195--------------------------------------------------------------------------------
I0JQ97_HALH3/4-186--------------------------------------------------------------------------------
Q890L1_CLOTE/7-201--------------------------------------------------------------------------------
A4G6G7_HERAR/9-205--------------------------------------------------------------------------------
Q67MI2_SYMTH/5-185--------------------------------------------------------------------------------
B0RD00_CLAMS/47-237--------------------------------------------------------------------------------
B7GKQ4_ANOFW/31-225--------------------------------------------------------------------------------
B8EKJ6_METSB/5-199--------------------------------------------------------------------------------
I0K575_9BACT/6-202--------------------------------------------------------------------------------
F9ZSH9_ACICS/8-193--------------------------------------------------------------------------------
F4GUJ2_PUSST/6-198--------------------------------------------------------------------------------
E6TZD4_BACCJ/4-202--------------------------------------------------------------------------------
A3QAT5_SHELP/6-198--------------------------------------------------------------------------------
F0YIY5_AURAN/82-285--------------------------------------------------------------------------------
A8LFW3_FRASN/5-200--------------------------------------------------------------------------------
F4CMY4_PSEUX/3-194--------------------------------------------------------------------------------
Q6FKJ4_CANGA/19-215--------------------------------------------------------------------------------
Q5WIH4_BACSK/3-196--------------------------------------------------------------------------------
A0LTB5_ACIC1/211-404--------------------------------------------------------------------------------
F4PSW8_DICFS/370-558--------------------------------------------------------------------------------
G0VB21_NAUCC/21-215--------------------------------------------------------------------------------
Q5FS21_GLUOX/26-223--------------------------------------------------------------------------------
F4B9W0_ACIHW/4-190--------------------------------------------------------------------------------
D1C2P1_SPHTD/5-200--------------------------------------------------------------------------------
A9HYX7_BORPD/4-199--------------------------------------------------------------------------------
D9R017_CLOSW/3-192--------------------------------------------------------------------------------
Q7NT51_CHRVO/8-202--------------------------------------------------------------------------------
D7CND1_SYNLT/3-196--------------------------------------------------------------------------------
F8EAH6_RUNSL/6-202--------------------------------------------------------------------------------
H8L495_FRAAD/3-195--------------------------------------------------------------------------------
F4C717_SPHS2/5-199--------------------------------------------------------------------------------
F4A2A2_MAHA5/4-197--------------------------------------------------------------------------------
A6TRG4_ALKMQ/4-197--------------------------------------------------------------------------------
E3LC61_PUCGT/216-403--------------------------------------------------------------------------------
A0LHV7_SYNFM/386-579--------------------------------------------------------------------------------
D7FIE0_ECTSI/94-289--------------------------------------------------------------------------------
B9S8J7_RICCO/19-213--------------------------------------------------------------------------------
F0RNH1_DEIPM/22-219--------------------------------------------------------------------------------
A9TAW0_PHYPA/4-197--------------------------------------------------------------------------------
A8FBP0_BACP2/4-185--------------------------------------------------------------------------------
C1CYM6_DEIDV/6-197--------------------------------------------------------------------------------
E8V8F6_TERSS/7-190--------------------------------------------------------------------------------
Q8YXV2_NOSS1/5-199--------------------------------------------------------------------------------
H1YC42_9SPHI/6-200--------------------------------------------------------------------------------
D0NUL9_PHYIT/63-266--------------------------------------------------------------------------------
H6RPL7_BLASD/7-199--------------------------------------------------------------------------------
E3PRT5_CLOSD/4-195--------------------------------------------------------------------------------
F4CPL7_PSEUX/29-222--------------------------------------------------------------------------------
E3GIM0_EUBLK/4-197--------------------------------------------------------------------------------
F2RLZ2_STRVP/28-222--------------------------------------------------------------------------------
A1AP89_PELPD/13-205--------------------------------------------------------------------------------
A0D5U7_PARTE/23-205--------------------------------------------------------------------------------
D7CRA3_TRURR/4-190--------------------------------------------------------------------------------
F0S1R0_DESTD/4-200--------------------------------------------------------------------------------
A6LX68_CLOB8/5-196--------------------------------------------------------------------------------
A1SI90_NOCSJ/187-388--------------------------------------------------------------------------------
C1DZ31_MICSR/6-219--------------------------------------------------------------------------------
A1K9A9_AZOSB/15-209--------------------------------------------------------------------------------
F0RK66_DEIPM/8-205--------------------------------------------------------------------------------
H2J7Y6_MARPK/3-195--------------------------------------------------------------------------------
D3SL81_THEAH/4-197--------------------------------------------------------------------------------
I0H0L2_ACTM4/169-364--------------------------------------------------------------------------------
D2PWV1_KRIFD/7-199--------------------------------------------------------------------------------
H8KQQ2_SOLCM/26-220--------------------------------------------------------------------------------
D4M9J9_9BACT/3-199--------------------------------------------------------------------------------
D6GQ74_FILAD/4-199--------------------------------------------------------------------------------
C6D8K0_PAESJ/4-200--------------------------------------------------------------------------------
YQGD_SCHPO/56-250--------------------------------------------------------------------------------
Q6CU83_KLULA/19-210--------------------------------------------------------------------------------
H5WQ77_9BURK/7-200--------------------------------------------------------------------------------
D8K089_DEHLB/3-197--------------------------------------------------------------------------------
Q752M0_ASHGO/19-204--------------------------------------------------------------------------------
A5GRZ9_SYNR3/7-190--------------------------------------------------------------------------------
G8PCV9_PEDCP/4-209--------------------------------------------------------------------------------
C5AAI7_BURGB/12-209--------------------------------------------------------------------------------
A6LYX0_CLOB8/6-201--------------------------------------------------------------------------------
G8PKK2_PSEUV/5-200--------------------------------------------------------------------------------
G0HCC2_CORVD/15-213--------------------------------------------------------------------------------
D1B6G9_THEAS/4-191--------------------------------------------------------------------------------
A9WMJ6_RENSM/7-207--------------------------------------------------------------------------------
D7CRM6_TRURR/14-202--------------------------------------------------------------------------------
E1VYH9_ARTAR/6-206--------------------------------------------------------------------------------
A3I0N5_9BACT/6-199--------------------------------------------------------------------------------
F5XXJ6_RAMTT/6-200--------------------------------------------------------------------------------
E4TVK9_MARTH/5-199--------------------------------------------------------------------------------
D7CTF3_TRURR/6-194--------------------------------------------------------------------------------
A8NEW8_COPC7/6-200--------------------------------------------------------------------------------
C9LWB8_SELS3/4-197--------------------------------------------------------------------------------
A2SCK3_METPP/9-202--------------------------------------------------------------------------------
I0I391_CALAS/7-202--------------------------------------------------------------------------------
D7GDV6_PROFC/6-200--------------------------------------------------------------------------------
F0SCC4_PEDSD/9-205--------------------------------------------------------------------------------
Q82HM5_STRAW/9-190--------------------------------------------------------------------------------
F5YTK7_MYCSD/3-188--------------------------------------------------------------------------------
A9B597_HERA2/3-196--------------------------------------------------------------------------------
F8C410_THEGP/11-201--------------------------------------------------------------------------------
E8U708_DEIML/12-204--------------------------------------------------------------------------------
A1RBG3_ARTAT/3-197--------------------------------------------------------------------------------
B4U6G2_HYDS0/4-195--------------------------------------------------------------------------------
A9GMF5_SORC5/6-203--------------------------------------------------------------------------------
A0C4I4_PARTE/221-414--------------------------------------------------------------------------------
Q8RA82_THETN/5-198--------------------------------------------------------------------------------
D3SNK7_THEAH/4-196--------------------------------------------------------------------------------
E3PXR0_CLOSD/4-193--------------------------------------------------------------------------------
C7MXW3_SACVD/6-193--------------------------------------------------------------------------------
F2UB54_SALR5/10-206--------------------------------------------------------------------------------
G8LZ21_CLOCD/5-199--------------------------------------------------------------------------------
F5Z355_MYCSD/10-196--------------------------------------------------------------------------------
A9KNM7_CLOPH/3-193--------------------------------------------------------------------------------
D5UTB9_TSUPD/21-219--------------------------------------------------------------------------------
D3QBR8_STANL/4-188--------------------------------------------------------------------------------
E4RUN0_LEAB4/6-202--------------------------------------------------------------------------------
PSPA_HYDTT/4-197--------------------------------------------------------------------------------
A1TUY5_ACIAC/7-200--------------------------------------------------------------------------------
A3DDB3_CLOTH/4-198--------------------------------------------------------------------------------
A3DE01_CLOTH/7-201--------------------------------------------------------------------------------
A4XKT7_CALS8/6-197--------------------------------------------------------------------------------
A5N4L6_CLOK5/4-199--------------------------------------------------------------------------------
A8AW93_STRGC/3-202--------------------------------------------------------------------------------
A9BUH9_DELAS/6-199--------------------------------------------------------------------------------
A9WDJ8_CHLAA/4-198--------------------------------------------------------------------------------
A9WI66_CHLAA/3-196--------------------------------------------------------------------------------
B2GB95_LACF3/4-204--------------------------------------------------------------------------------
B2TR14_CLOBB/4-195--------------------------------------------------------------------------------
B4EET0_BURCJ/6-203--------------------------------------------------------------------------------
B7J3Q1_ACIF2/6-188--------------------------------------------------------------------------------
B7K5Q7_CYAP8/5-197--------------------------------------------------------------------------------
B7K5Q8_CYAP8/5-198--------------------------------------------------------------------------------
C1A1J7_RHOE4/16-207--------------------------------------------------------------------------------
C4M5P9_ENTHI/4-193--------------------------------------------------------------------------------
C8WXI8_ALIAD/3-178--------------------------------------------------------------------------------
D0J8B8_COMT2/6-200--------------------------------------------------------------------------------
D0MFF3_RHOM4/6-203--------------------------------------------------------------------------------
PSPB_HYDTT/4-194--------------------------------------------------------------------------------
D3EF23_GEOS4/3-199--------------------------------------------------------------------------------
D4ZU25_ARTPN/5-201--------------------------------------------------------------------------------
D4ZY14_ARTPN/5-199--------------------------------------------------------------------------------
D5X3R0_THIK1/11-204--------------------------------------------------------------------------------
D9QBM8_CORP2/186-379--------------------------------------------------------------------------------
D9TCE6_MICAI/4-187--------------------------------------------------------------------------------
E2Q1Y3_STRC2/296-492--------------------------------------------------------------------------------
E3HNV8_ACHXA/4-200--------------------------------------------------------------------------------
E9T6R4_COREQ/181-372--------------------------------------------------------------------------------
E9T8C0_COREQ/5-201--------------------------------------------------------------------------------
F3Z543_9ACTO/9-196--------------------------------------------------------------------------------
F3ZAP6_9ACTO/8-184--------------------------------------------------------------------------------
F6B5X8_DESCC/5-197--------------------------------------------------------------------------------
F9UQA5_LACPL/4-204--------------------------------------------------------------------------------
G2J5B1_PSEUL/9-203--------------------------------------------------------------------------------
H0UKK7_9BACT/8-199--------------------------------------------------------------------------------
H6MTJ9_GORPV/7-199--------------------------------------------------------------------------------
I2BB94_SHIBC/3-198--------------------------------------------------------------------------------
J3MTT3_ORYBR/86-279--------------------------------------------------------------------------------
J9RE89_9ACTO/4-200--------------------------------------------------------------------------------
K0I0L2_9BURK/7-205--------------------------------------------------------------------------------
M9X0U0_PASHA/5-206--------------------------------------------------------------------------------
PHOE_BACSU/4-184--------------------------------------------------------------------------------
COBC_SALTY/3-195--------------------------------------------------------------------------------
P73454_SYNY3/5-196--------------------------------------------------------------------------------
Q142E5_BURXL/12-206--------------------------------------------------------------------------------
Q1D982_MYXXD/5-197--------------------------------------------------------------------------------
Q1GAS0_LACDA/3-202--------------------------------------------------------------------------------
Q2S2V8_SALRD/16-213--------------------------------------------------------------------------------
Q31LG1_SYNE7/5-198--------------------------------------------------------------------------------
Q3Z6L9_DEHM1/5-197--------------------------------------------------------------------------------
Q53WE2_THET8/5-190--------------------------------------------------------------------------------
Q55734_SYNY3/5-198--------------------------------------------------------------------------------
Q5KZY5_GEOKA/9-198--------------------------------------------------------------------------------
Q5M513_STRT2/3-202--------------------------------------------------------------------------------
Q5SM93_THET8/17-207--------------------------------------------------------------------------------
Q63WA7_BURPS/3-184--------------------------------------------------------------------------------
Q65KU1_BACLD/4-191--------------------------------------------------------------------------------
Q6AAY7_PROAC/7-194--------------------------------------------------------------------------------
Q6MWZ7_MYCTU/8-191--------------------------------------------------------------------------------
Q6NG55_CORDI/177-370--------------------------------------------------------------------------------
Q74JW8_LACJO/3-202--------------------------------------------------------------------------------
Q7V6P3_PROMM/6-190--------------------------------------------------------------------------------
Q819N7_BACCR/4-184--------------------------------------------------------------------------------
Q81RH1_BACAN/3-190--------------------------------------------------------------------------------
Q8FNL1_COREF/236-428--------------------------------------------------------------------------------
Q8NT72_CORGL/6-197--------------------------------------------------------------------------------
Q8RFA7_FUSNN/3-199--------------------------------------------------------------------------------
Q8XP82_CLOPE/3-199--------------------------------------------------------------------------------
Q8Y237_RALSO/17-210--------------------------------------------------------------------------------
Q8YA91_LISMO/8-204--------------------------------------------------------------------------------
GPMB_YERPE/4-194--------------------------------------------------------------------------------
Q97ET5_CLOAB/5-198--------------------------------------------------------------------------------
Q9PC95_XYLFA/3-198--------------------------------------------------------------------------------
Q9RKV8_STRCO/4-195--------------------------------------------------------------------------------
R5J9E3_9FIRM/5-197--------------------------------------------------------------------------------
R5RIR8_9FIRM/3-193--------------------------------------------------------------------------------
R5T6S4_9FIRM/4-197--------------------------------------------------------------------------------
R5TTE8_9CLOT/3-188--------------------------------------------------------------------------------
R5XAL3_9CLOT/4-198--------------------------------------------------------------------------------
R5XCV5_9CLOT/5-198--------------------------------------------------------------------------------
R6G925_9FIRM/3-196--------------------------------------------------------------------------------
R6JTD2_9CLOT/3-186--------------------------------------------------------------------------------
R6ULZ9_9FIRM/4-196--------------------------------------------------------------------------------
R7FT81_9FIRM/32-228--------------------------------------------------------------------------------
R7G8S3_9FIRM/4-195--------------------------------------------------------------------------------
U4KIP7_9VIBR/4-197--------------------------------------------------------------------------------
U5L4S7_9BACI/4-197--------------------------------------------------------------------------------
U5L644_9BACI/4-196--------------------------------------------------------------------------------
U5LDT0_9BACI/4-184--------------------------------------------------------------------------------
V6K5U9_STRNV/6-198--------------------------------------------------------------------------------
W0E7D0_9FIRM/4-193--------------------------------------------------------------------------------

PF00328

PHYA_ASPFU/71-425.NYTL--G--ADD......LTPF.GEQQLVNSGIK---FY.QRYK.................ALARS.........VVPF
VIP1_CAEEL/363-914LLLIL--K--WGG.....ELTTA.GNMQAEALGRL---FR.TLYPGIRRTDGKSSPEDTQGLGFLRLHSTY....RHDLK
Q22525_CAEEL/28-375.FGGG--G--WGQ......LTPI.GMRQHMQLGQK---LR.ARYVNG............QPYKFLNTRYNQ.....QEIF
Q6BUR8_DEBHA/63-396DMYDL--E--VSPS...NSRSPYAGTTNALKHGAA---FR.ARYN.................SLYNDS........NTIP
VIP1_HUMAN/390-910LLLVL--K--WGG.....ELTPA.GRVQAEELGRA---FR.CMYPGGQGDY.....AGFPGCGLLRLHSTF....RHDLK
PPAX_CAEEL/28-365.FGGG--G--LGE......LTPM.GMSEMNNLGTI---FR.RRYVE..............DQQFLSHRYAA.....KEIY
Q6BWV9_DEBHA/521-1079VQLIL--K--WGG.....EPTHS.AQFQANDVGEQ---LR.QNIK.................LLNRDAL.......KDVK
VIP2_HUMAN/379-894LLLVL--K--WGG.....ELTPA.GRVQAEELGRA---FR.CMYPGGQGDY.....AGFPGCGLLRLHSTY....RHDLK
VIP1_DROME/402-926LVLIL--K--WGG.....ELTPA.GRIQAEELGRI---FR.CMYPGGQGRSD...YSGTQGLGLLRLHSTF....RHDLK
PHYB_EMENI/70-422.NYTL--G--ADD......LTIF.GENQMVDSGAK---FY.RRYK.................NLARK.........NTPF
Q7SEH2_NEUCR/194-548.KYQM--G--TEI......LVPR.GRQELFDSGVL---HA.YMYS.................SLYDPN........TKII
ACPL2_DANRE/88-449SHSTC--E--MGE......LTQT.GVVRQLKNGDH---LR.QAYIS..............RHNLLAADWLP.....RQLW
PPA_ECOLI/29-375.TWPV--K--LGW......LTPR.GGELIAYLGHY---QR.QRLVA..............DGLLAKKGCPQ....SGQVA
Q6BM75_DEBHA/63-397DNYEK--E--TTPS...NSEGPFSGADNALRHGTT---FR.SKYN.................EIYNPD........KPLP
Q6CZF4_PECAS/34-372.QWVT--R--EGE......LTGH.GYAATVIKGHY---EG.EYYRQ...............QHLFASGCPA....EQQIY
VIP1_YEAST/538-1047VQFIL--K--WGG.....EPTHS.AKYQATELGEQ---MR.QDFD.................LLNKSIL.......QNIK
Q6FJ21_CANGA/510-1016VQFIL--K--WGG.....EPTHS.ARYQATELGEQ---MR.QDFD.................LLNKNIL.......QDIK
Q6CYI2_KLULA/67-401LTNSS--D--VDP......SNPYMGSKTAEILGKY---IA.FNYG.................ELFG..........NYTP
Q6CWN2_KLULA/534-1048VQFIL--K--WGG.....EPTHS.AHFQAEELGEQ---MR.QDFD.................LLNKNIL.......HNIK
Q6CES1_YARLI/413-907VQLVA--K--WGG.....EPTHS.ARYQAQDMGDQ---MR.QDLM.................IVNKNLL.......KNVK
Q6AVJ1_ORYSJ/361-950ALMIL--K--YGG.....VLTHA.GRKQAEELGRF---FRNNIYPGE.............GTGLLRLHSTY....RHDLK
Q9AAQ4_CAUCR/24-359.RFEV--P--AGH......LTAR.GETLVARMGDY---YR.RHYAA...............QGLLKPGDC......ASVY
Q19175_CAEEL/28-376.FGGG--G--WGQ......LSPL.GMNQHLTLGKK---LR.NRYVNTG..........NSTHNFLPAVYDQ.....KTMY
Q6CLW3_KLULA/69-406MTNSS--N--VDG......SNPYMGSKTAQQLGNY---IA.VHYG.................ELIG..........DSLP
PHO11_CAEEL/25-364.YGGG--G--LGE......LTAI.GMGEMNELGWL---IR.KRYVT..............KLKFLTPKYAS.....REVY
PPA4_SCHPO/25-385PSGVC--I--HGE......LTDF.GRVTTRTLGEY---LR.ERYVK..............QLKFLPDELNN....YADVY
PPA1_SCHPO/59-395PTWTP--V--IEAAN.ADALSSS.GRVELFDMGRQ---FY.ERYH.................ELFNA.........STYN
PHYA_ASPOR/71-426.NYSL--G--ADD......LTPF.GENQLVDSGIK---FY.QRYE.................ELAKN.........VVPF
Q6CCS5_YARLI/180-538.HWNY--L--LERE....LLVPR.GYSTEFAAGAQ---FW.SSHG................RHLFNEGSLLGKWSHDPIV
Q19076_CAEEL/26-371.FGGG--G--WGQ......LSPA.GMKQHLNLGKM---LR.NRYVT..............NYNFLPNKYNA.....KQIY
Q84TX6_ORYSJ/68-441.GWES--P--WKGRVKGGELVSE.GEEELYNLAIR---VK.ERFQ.................GLFDEEYHP.....DVYS
Q84WW3_ARATH/362-953ALMVL--K--YGG.....VLTHA.GRKQAEELGRY---FRNNMYPGE.............GTGLLRLHSTY....RHDLK
PPA2_SCHPO/59-405KHWTP--V--IKAEN.ADQLSSS.GRIELFDLGRQ---VF.ERYY.................ELFDT.........DVYD
VIP1_SCHPO/387-861LQLII--K--WGG.....EFTHS.ARYQSKDLGEQ---FHKDLY..................IMNRDCL.......KDVE
PPA3_SCHPO/59-405KQWTP--V--IDAEN.ADQLSSR.GRLELFDLGRQ---LY.QRYY.................KLFDS.........YVYD
A6T657_KLEP7/32-357.EWTT--H--DGE......LTGH.GYAAVVNKGRA---EG.QHYRQ...............LGLLQAGCPT....AESIY
C4QZN1_PICPG/75-409AWYEQ--E--TTK......GFYS.GLNTAFDFGTT---LR.ERYD.................HLINTSE.E....GKKLS
E2RTX6_GIAIC/15-344LKGGS--C--IQG.....ILTRE.GRLQHEQLGKA---FR.QKYG.................DFFPRRFVQ.....EAFY
F1RD51_DANRE/72-409MWYTE--D--MDG.....RLVEK.GRDDHRHLAMR---LA.KSFP................TLISADHLRA.....NRIE
G2QKZ0_THIHA/65-455.DYTL--G--ADE......LTRT.GQQQMVNSGIK---FY.RRYR.................ALARN.........SIPF
G3Y8Z5_ASPNA/73-427.NYSL--G--ADD......LTPF.GEQELVNSGVK---FY.QRYE.................SLTRNI.........VPF
G7XM48_ASPKW/72-404CYYNA--E--TTS......GPYA.GLLDAYNHGND---YK.ARYG.................HLWNGE........TVVP
S8B7A5_PENO1/144-500.NYTL--G--SED......LTSF.GEHQMINSGIK---FY.QRYA.................ALTRD.........HVPF

PF00300

D7B452_NOCDD/4-197-...E..A..EDYD....ELSPT-GYEQARLLGAE...LR----------------------R.....RGPRVGR.....
D6S4F7_9LACO/3-204-FQGG..H..GDSP.....LLPE-SYEDIKKLGNY...LK----------------------G.....TKFRGI......
C6VSA5_DYAFD/6-202-VQGS..G..VDSL.....LNEW-GEAQAAAFFNA...YQ----------------------H.....VPFDKV......
A6W5M7_KINRD/8-200-.YGR..L..PGFR.....LSER-GQAMATRLGEF...FA----------------------D.....RDVASV......
Q9K466_STRCO/9-189-.........DESG.....LTDA-GRRQAALLGRR...LS----------------------D.....IPFDAV......
H2TRY4_TAKRU/250-436-..RL..G..GDAG.....LSPR-GQQFSVALAQF...MK----------------------E.....QQLKDLK.....
Q81XN0_BACAN/4-182-...Q..E..RDAE.....LTTD-GKKQANTLATF...LL----------------------E.....HHPQIDH.....
A1VJK7_POLNA/7-200-.IQG..H..LDIP.....LNDT-GRLQAARLALA...LK----------------------E.....EPITAV......
D4MTA4_9FIRM/3-194-.IQG..K..TDIP.....LNEA-GLLQAELLAEA...ME----------------------R.....YPVTAV......
A9KSK5_CLOPH/3-194-...G..R..ADFP.....LTDR-GREQAGKAAKW...IS----------------------K......NYSVNR.....
G2TLP8_BACCO/4-199-RYCG..R..SDIG.....LSET-GVRQAKLAAGF...LK----------------------D.....IPFDAV......
H8GZF0_DEIGI/4-198-.LQG..A..ASAPG...VISAR-GEAQARACGLA...LA----------------------A.....LALPDPR.....
H6L710_SAPGL/6-200-VQGR..G..VNSS.....LDAH-GLAQRDAFFEH...YK----------------------S.....EGFELL......
Q08XQ0_STIAD/8-191-...G..R..TDIP.....LLEE-GKRMGAALSAP...LK----------------------A.....WRFDAV......
Q82M88_STRAW/4-196-...S..R..TDLP.....LTHH-GEEQAKSLAPF...FA----------------------G.....RSFARV......
E2BWS4_HARSA/250-436-..RI..G..GDSD.....LSDR-GREYSKALANF...IA----------------------S.....QDIQGLR.....
D3E804_GEOS4/7-201-.FQG..H..KDSP.....LTKL-GIRQAEWLGEA...LQ----------------------H.....DPFDFI......
Q039P6_LACC3/4-205-YQGA..N..GDSP.....LLPE-SYAQIKALAGY...LQ----------------------G.....IPFMHA......
A9WBR5_CHLAA/16-207-.AGW..L..PGVH.....LSEE-GRRQAAALSER...LG----------------------D.....LPITAL......
B1VGF0_CORU7/234-430-.YSG..R..GNPE.....LTDL-GKKQIAHAARH...IS----------------------E....RGDVDV.......
F8DZM7_CORRG/181-377-.FSG..L..SNPE.....LTGY-GQWQADRVAEF...IA----------------------R.....RGEIAT......
D7WEF3_9CORY/183-379-.YSG..S..SDPA.....LTET-GQEQARRAAAA...LA----------------------E.....MGTIDT......
E2Q4K4_STRC2/5-194-...G..R..TDIP.....LLEE-GRRGAGLLGER...LR----------------------R.....APWSGLPD..VE
C3AWM6_BACMY/4-187-.AQG..N..SNIP.....LDQA-GLSEAYKLAER...LA----------------------T.....EKWNVI......
D2SCU2_GEOOG/12-204-.FQG..Q..LDPP.....LDEV-GRRQARRAAPH...LA----------------------A.....PLPEGTL.....
D5G4W9_TUBMM/6-203-.KFD..W..HDPY.....LTPL-GETQCHELSER...FP----------------------S......EPPVDL.....
F5XRM5_MICPN/4-203-LAGR..S..PGVE.....LDEV-GRAQVGTLGER...LA----------------------P.....VPLARL......
Q0TY40_PHANO/251-439-..QI..G..GDAD.....LSER-GDAYAHALPGL...VA----------------------K....SVGDGRQL....T
C6WMA8_ACTMD/193-386-...G..R..GNPP.....LTEV-GLGQARAAAAR...LS----------------------T.....LDGVAA......
G0G0W4_AMYMS/3-201-TRIP..D..HALP.....LTAK-GEREARAVAPE...IA----------------------R....LLDGSRPA.....
A7MRJ7_CROS8/43-238-.IQG..H..HDSA.....LTAR-GLQETTALLTA...LA----------------------H.....EFPSVDA.....
C0ZX17_RHOE4/16-202-...G..R..TEVP.....LTPL-GEMQATATGNR...LR----------------------T.....LDLRNPM.....
D7E1I0_NOSA0/5-202-...K..P..YDPP.....LSDD-GMVQAKQLAKR...LK----------------------G.....EKISQI......
H8MW52_CORCM/8-191-...G..R..TDLP.....LLEE-GRQMAERLRAP...LG----------------------K.....WRFAAV......
F3Z271_DESAF/7-196-.FIG..Q..RDVP.....LDKV-GRLQAETLAQA...LA----------------------N.....THLDGI......
G2NEA0_9ACTO/5-193-...G..R..TDIP.....LLDD-GRAGAKLLGER...LH----------------------R.....EPWGGLPG..VE
Q1CZG8_MYXXD/11-196-...G..R..TDIP.....LLDS-GREMGRLLGAP...LK----------------------A.....WRFDTV......
D3E7L5_GEOS4/3-187-.IQG..Q..TDIP.....LNEE-GRRQARLLGER...LL----------------------Q.....EPFRWDF.....
F6CII3_DESK7/6-199-...G..Q..LDAP.....LSRE-GLEQSRALAGA...LA----------------------A.....LPLKAV......
H2K063_STRHJ/266-462-SGSG..G..TDPS.....LSAA-GREQAHRVAEA...LA----------------------R.....RGTIQA......
B1HXM2_LYSSC/4-198-.LQG..W..LDSP.....LTDN-GREAAARLQQQ...LQ----------------------S.....IPFAAA......
E0UC66_CYAP2/32-226-..IR..R..YDPP.....LSED-GIIQAQQLGQR...LK----------------------S.....ENIAHI......
E1F6I1_GIAIA/6-200-RIRG..H..VPNP.....LNET-GRLHAKETSTA...LK----------------------D.....VKFDAI......
Q8ETC4_OCEIH/4-185-.VQG..R..TDIP.....LNET-GRMQAKLCFNG...VK----------------------E.....FEPTIL......
B0JTX1_MICAN/5-201-CGTP..E..NDPG.....LTAE-GIEMAEEFADV...YR----------------------S.....LPWRAA......
D7LXF7_ARALL/27-219-.IQG..Q..IESD.....LNEV-GQKQAVAIAER...LG----------------------K.....EERPVA......
D3FUL6_BACPE/3-195-.IQG..W..SDFP.....LSEI-GKKQALKLGDF...FQ----------------------G.....IQLDYL......
D2B5L7_STRRD/253-447-.FSG..L..GDPE.....LTPN-GIAQAEAAAAR...LS----------------------R.....EPYGIQV.....
C4ZPB7_THASP/15-211-.LQG..H..IDVP.....LNPR-GLSQAEATARS...LA----------------------R.....AGERFAA.....
B2A0N3_NATTJ/4-199-.MQG..W..HNSP.....LTQL-GEKQAKWLGDR...LA----------------------E.....VELETI......
Q11U91_CYTH3/15-208-VQGS..A..VNSS.....LNDT-GRAQADAFYQA...YR----------------------H.....IPFDVV......
B9DS14_STRU0/3-188-.VQG..A..CDSP.....LTEL-GIEQALLAKRY...FE----------------------E.....QQITFDR.....
G8LVK0_CLOCD/3-197-.MQG..W..KDSE.....LTEK-GIDNAKRLGER...LK----------------------D.....VNFDVI......
Q2GMW9_CHAGB/228-418-..RI..G..GDAT.....LSHR-GEEYALKLPEL...VR----------------------E....SVGSDRPL....T
F6EEJ9_AMYSD/159-353-.YSG..R..GDHA.....LTPE-GHRQARFAAER...LA----------------------R.....QRGRIAA.....
E3KVQ6_PUCGT/3-193-.IQG..H..KDTP.....LNEL-GIQQARLTGQF...LH----------------------Q.....SQIGFDQ.....
Q1IXX4_DEIGD/21-217-.YQG..Q..TDVP.....LSHV-GILQASSLAER...LT----------------------G.....QHFDAV......
E3DP32_HALPG/5-198-.FQG..Q..TDIE.....LNET-GIAEAKKAATI...FT----------------------E.....IKLDHI......
D9SXD1_CLOC7/4-198-.FQG..F..MDSP.....LTEK-GIAQAKLLSER...LK----------------------N.....THIDVI......
D7GCX1_PROFC/7-200-.FQG..Q..TDMP.....LNVA-GLSQAEAAAGH...VA----------------------A.....LGPEAI......
C7PMV1_CHIPD/4-187-.MQG..S..TDIA.....LDNE-GLEQARKLGIR...LS----------------------D.....ESWDIV......
YO283_YEAST/19-212-.LQG..H..KDTS.....INPT-GEEQATKLGHY...LR----------------------S.....RGIHFDK.....
A8MF31_ALKOO/4-198-.LQG..W..NDSN.....LTEN-GIEGAYALHHH...LS----------------------D.....INIDAI......
D8SNQ5_SELML/4-199-.LQG..Q..LETD.....LNDA-GRKQASALAEH...LA----------------------K.....QSSQKIT....A
D7C7F5_STRBB/4-196-...S..W..TDLP.....LTPH-GEEQARSLRPL...LA----------------------D.....RKIALA......
Q5YQW5_NOCFA/13-199-...G..R..TDLP.....LTER-GEAQARAAGAL...LA----------------------R.....LDLLDPF.....
C5CF58_KOSOT/4-198-.IQG..Q..KDSK.....LTTL-GEKQAEWLGER...LK----------------------N.....VEIDVI......
Q745R9_MYCPA/3-188-..GQ..G..SDPD.....LSAD-GLAQIERLPKA...LE----------------------R.....FPISRV......
C8W6P5_DESAS/6-197-.FIG..Q..TDLP.....LNNR-GLKQAYWWRQK...LS----------------------G.....VIFSRI......
F4CRR8_PSEUX/8-197-...G..R..TDIE.....LTTR-GRERAAAAGSVLPRLR----------------------G.....TTDPPAL.....
Q0KEC8_CUPNH/15-208-.LQG..Q..LDIP.....LNET-GRAQARALATA...LA----------------------G.....EPIDAV......
D0LB07_GORB4/15-213-...G..R..GNPE.....LTET-GRRQAQAAAAAFGSLA----------------------H.....AGDGEIA....A
Q2JD27_FRASC/178-366-.FSG..T..VEAA.....LTDV-GLGQAAAVANR...LR----------------------D.....EPFDLV......
H2JNB2_STRHJ/4-202-LAGR..T..PGVA.....LDER-GAAQAAALPAR...LA----------------------G.....LPLAEV......
Q8DU48_STRMU/5-191-.IQG..V..CDSP.....LTEL-GIKQAQQAADY...FK----------------------D.....KGIVFEE.....
D2UBJ8_XANAP/3-199-.YQG..Q..IDIP.....LSPV-GEAQAQALGTR...LR----------------------E.....VPLSRA......
Q3A796_PELCD/6-199-.FVG..R..QDVP.....LSSL-GQRQSAALGQC...SE----------------------L.....KSCKEA......
D2PPT8_KRIFD/4-202-LAGR..T..PGVK.....LDET-GVLQAAAVGER...LA----------------------E.....LPLASI......
Q220I7_ALBFT/6-199-.IQG..Q..LDIE.....LNAK-GRWQVHRLAKA...LA----------------------R.....EPISAI......
A0R642_MYCS2/5-204-...R..R..LDTRPPGAELTDL-GHDQARRVVTA...FP----------------------R.....RPALV.......
G2KUE1_LACSM/18-218-YQGA..G..GDSP.....LLPQ-SYTEMALVGKY...LN----------------------P.....VKFKHI......
D8UL08_VOLCA/9-201-.LQG..H..MDPE.....LNEQ-GRQQAAELAAA...LR----------------------E.....EPFDAV......
A6TKP0_ALKMQ/4-198-.MQG..W..QDSN.....LTER-GIEDARALHDH...LI----------------------K.....VEFDSI......
Q6LIL4_PHOPR/8-199-.LRG..H..TDFA.....ITST-GLIQMATAIAD...LD----------------------S.........VDV.....
A4J5S6_DESRM/6-199-.FQG..H..SDVP.....LSVL-GRSQVETLTTK...LS----------------------Q.....LKIDAF......
A5D2P8_PELTS/5-198-.YQG..Q..TDVP.....LSEK-GRQQAELIGRR...LA----------------------A.....EKLHGV......
D9QVX4_ACEAZ/5-198-.FQG..S..ADVK.....LSSD-GVKQAERLAER...FA----------------------D.....FRLDMV......
D3FA36_CONWI/9-192-...G..R..TDMP.....LTPR-GEAQAAALTDR...LR----------------------D.....VDFALV......
F2N9U4_CORGP/5-198-.VQG..R..CDSP.....LTAC-GIAQAHIAARW...LA----------------------D.....RGADFDQ.....
G4L641_TETHN/3-201-FQGM..N..GDSP.....LLPT-SFTQIRALGNH...LK----------------------D.....IPFGAV......
B8E2M6_DICTD/4-197-.FQG..R..TDIP.....LNSK-GKSQAELLSDY...LA----------------------K.....EKFDYI......
F2F0S7_SOLSS/5-199-.MQG..W..KDSS.....LTDK-GIKQAKQLAQR...LS----------------------E.....VPFDAI......
A4T0I6_POLSQ/6-201-.LQG..F..TDIP.....LNEK-GVRQANQMASA...LQ----------------------A.....IDLQFDV.....
G2SPT2_LACRR/4-203-YQGA..H..GDSP.....LLAQ-SYLEIGLLAEY...LN----------------------N.....VKFAKA......
E6W2F2_DESIS/10-204-IFYG..W..LDPG.....LSDL-GHQQAGRLAHH...LN----------------------T.....LELAFDA.....
Q9X194_THEMA/3-195-.WQG..V..TDVP.....LNER-GREQARKLANS...LK----------------------R.......VDAI......
G8LUT1_CLOCD/4-197-.CQG..C..TDTD.....LNSE-GIRQAELVAER...LM----------------------R.....EEIHVI......
C7QH56_CATAD/8-200-.YGR..L..PGFR.....LSDL-GRKMAERVADH...LA----------------------D.....HDVKAV......
F8A8I3_THEID/6-196-.LYS..Q..KDVP.....LSKE-GLRQSELLTEL...FA----------------------G.....ISLAAV......
A0D7F1_PARTE/11-207-.LQG..Q..DDGQ.....LSAL-GIKQAEALGKR...IK----------------------K.....EIFDVV......
Q22T38_TETTS/22-202-.VTG..W..TDTK.....LTLK-GRAQANKLFQG...FV----------------------G.....SVDKFTS.....
E3IV15_FRASU/3-196-.FQG..Q..ADPP.....LDEV-GQAQAERVGPV...IA----------------------A.....MRPDLI......
Q9SCS3_ARATH/16-210-.IQG..H..LDVE.....LNDA-GRQQAQRVAER...LS----------------------K....EQKISHV......
Q2RJH0_MOOTA/6-199-...G..H..SDIA.....LSPN-GRRQAELLRER...FC----------------------R.....VHLDAV......
Q47IH2_DECAR/12-205-.IQG..Q..IDIC.....LNET-GQRQAVAAGRW...LK----------------------Q.....AGIIAL......
Q113G3_TRIEI/6-202-..KR..P..YDPH.....LSDD-GVVQAQQLAKR...LI----------------------G.....ENITQI......
C7R5L5_JONDD/6-202-.LQG..Q..VDIP.....LDDI-GRWQAAEAAKV...LA----------------------Q.....SPLATPF.....
F4L0A7_HALH1/4-197-VQGS..G..VDTH.....LNEL-GQKQAQSFFAR...YR----------------------A.....EPFEVV......
B1Y6N8_LEPCP/4-197-.FQG..Q..LDVP.....LNEL-GHLQAGRLPQA...LA----------------------G.....DHFDLV......
B1Y8E3_LEPCP/9-202-.IQG..Q..IDIP.....LNDA-GLAQARSLAQA...LA----------------------E.....DALAAV......
E1R062_OLSUV/8-199-.LSG..R..VDVD.....LTPR-GERQMWRAIDA...LV----------------------A.....WTPTRI......
C6WAU4_ACTMD/4-201-LAGR..Q..PGVR.....LAED-GERQARALVDR...LA----------------------G.....VRLDAV......
E3H7F6_ILYPC/4-201-.LQG..S..KNSH.....LTEK-GKAQAYKLRDK...LE----------------------G.....IHFEGI......
Q5P7P2_AROAE/9-203-.LQG..H..LDVP.....LNEI-GHIQAEATAAS...LA----------------------G.....HRFTAL......
Q3A802_PELCD/11-203-.YIG..Q..CDPP.....LNPR-GRAQARFLRLQ...LA----------------------D.....IDLHRV......
C7RK71_ACCPU/6-200-.IQG..Q..IDIG.....LNAA-GLAQAAAAARW...LV----------------------G.....QPVVAL......
C4L115_EXISA/4-189-.IQG..R..EDNP.....LNAL-GRQQAEESATF...LS----------------------Q.....EKWDVI......
Q46GR1_PROMT/229-424-.FQG..Q..IDIP.....LNKN-GKSQAKAASEF...LK----------------------T.....NILQKA......
C8W3Q4_DESAS/5-198-.FQG..H..ADIA.....LTQT-GREQAEALAER...LS----------------------D.....KTFHAV......
Q03YB7_LEUMM/4-203-FQGG..H..GDSE.....LLPS-SYNDMKKVGKF...LS----------------------K.....IKFDHI......
G4L012_OSCVS/4-198-.AQG..Q..CDSI.....ITDR-GYQQIAALAER...FR----------------------D.....ELIDAV......
D1CI13_THET1/4-198-.FCG..R..TDLE.....LSER-GYAQAEALARR...LA----------------------A.....EPLVAV......
Q47LB4_THEFY/7-197-.YGR..L..PNFH.....LSER-GRQMAELAAKW...FT----------------------G.....RDIAVL......
G8QLS4_AZOSU/8-203-.IQG..H..LDIG.....LNPT-GLRQARAAARR...LA----------------------A.....EAGTVTA.....
H6RJR9_BLASD/4-199-LAGW..T..PGVQ.....LDET-GQAQVRAVGER...LA----------------------K.....VPLAAV......
D1BKR1_SANKS/4-203-LAGR..A..AGVA.....LDQV-GHDQAALTGER...LA----------------------A.....VPLVGV......
E4N2L1_KITSK/4-203-LAGW..T..PGID.....LDDT-GRAQAAGLPER...LA----------------------G.....LPIARL......
F8L9A3_SIMNZ/4-204-RVGG..R..TDIP.....LVSS-GVYQAQCIGRY...LQ----------------------K.....MNISLDA.....
A2SH69_METPP/10-209-.PVA..P..DSVP.....LNAE-GERQADAAGQL...FA----------------------Q.....CGVRFDR.....
A8L509_FRASN/4-197-...S..Y..TDLP.....LTAR-GEAQARAVAPL...LL----------------------R.....RHIALA......
G0JM27_9GAMM/6-189-...S..L..TDIG.....LTVQ-GEQEAHALRDI...LN----------------------L.....RHYDMV......
E3HZR3_RHOVT/3-207-WVGA..R..TDLP.....LTAK-GREQAAALGEA...LK----------------------P.....FAPRIRR.....
A8L9X3_FRASN/6-204-..IA..G..GDLGC..TGLTRR-GRSQAERAARRLTVMH----------------------T.....MERRVDA.....
Q3ISX8_NATPD/4-201-.MQG..W..APVP.....LNET-GHEQAAAAASW...LS----------------------D....TY..DIDR.....
C5D2R4_GEOSW/4-198-.MQG..W..QDSP.....LTEK-GRQDAMRLGKR...LE----------------------E.....VDLTAI......
A4FA31_SACEN/162-361-...G..R..GDVV.....LTDF-GERQARAAGRR...LA----------------------G.....MDGVVTDAGAAP
D1CEC2_THET1/5-199-.MQG..R..MDSP.....LTRK-GRQQAEAVAQK...LA----------------------K.....ILVPSN......
H0PY04_9RHOO/14-208-.LQG..H..LDIP.....LNPT-GEAQALATAAS...LA----------------------T.....EHFAAV......
H2ANA8_KAZAF/21-215-.LQG..H..KDIS.....INST-GYKQAEKLGMY...LK----------------------E.....HNIKFDK.....
Q65LP2_BACLD/4-185-.LQG..R..TDIP.....LNET-GKKQAKETGAF...LK----------------------G.....SDWDVI......
C6XW10_PEDHD/5-199-VQGR..G..INSD.....LNDT-GKAQAAAFYEA...YK----------------------N.....IPFDKV......
G8NTU1_GRAMM/8-195-...S..W..TDIP.....LTDH-GRQRAVELREF...LA----------------------G.....KKFAAV......
B7KKU2_CYAP7/5-199-.YCG..K..LDVE.....LTPQ-GLQMAEDFANA...YQ----------------------D.....FPWTGI......
A4FFP0_SACEN/15-212-LAGR..T..AGVG.....LDET-GRVQAEGLAGR...LS----------------------G.....IPVSAL......
D2PUU5_KRIFD/6-202-.IQG..Q..ADIP.....LDEV-GQAQARAAAAR...LA----------------------S.....LAPTRL......
G0VP45_MEGEL/4-198-.YQG..S..TDVP.....LNDH-GLEQAKCLGEF...FR----------------------H.....VHLDAV......
H5WTP9_9BURK/4-198-.FQG..Q..IDVP.....LNAA-GEEQAQRLARR...LA----------------------R.....EKFDAV......
I0HZE4_CALAS/7-199-.AGR..T..PGVH.....LNDR-GRAQAEALVKH...LE----------------------E.....QPLTAI......
A5UTN8_ROSS1/4-200-.WQG..K..ADIP.....LNDA-GRLQAQRLARR...LF----------------------A.....RRIRFDA.....
E9T3E9_COREQ/12-198-...S..T..TEVP.....LTER-GAAQARAVGAQ...LT----------------------E.....LALDDPL.....
E6U5E4_ETHHY/4-198-.FQG..H..TDAD.....ISTN-GQRQLERLSER...FE----------------------P.....VHLDAL......
B0TIL4_HELMI/4-197-.YQG..H..SDVL.....LSEK-GREQARLLVRR...LA----------------------G.....EKIDRV......
D7B3J6_NOCDD/7-195-.FQG..Q..TDIA.....LDPV-GHAQARRAGEL...LA----------------------S.....LNPDVI......
E5S5V1_TRISP/288-477-..RL..G..GDSP.....LSQR-GLEYAERLADY...FK----------------------G.....ENVPELR.....
A8QBY9_MALGO/432-619-..KI..G..GDSD.....LSER-GWAYARALPQL...IQ----------------------D....HIGDEPLT.....
D5X1T7_THIK1/3-197-...G..R..MELE.....LTAL-GRQQAKAVAQR...IA----------------------A......EFSPQA.....
Q2W9Y0_MAGSA/8-200-.ITG..R..LDVA.....CDTS-EDEVFQSLARA...LP----------------------V.....NPVLVE......
A4G1U3_HERAR/4-201-.LQG..H..HDID.....LNRE-GVRQVAALGRA...LL----------------------D.....EPLDAI......
A0RZ16_CENSY/25-219-LSGR..T..PGVP.....LTEK-GMDQARKAAEL...VG----------------------R.....MDVARI......
B1WZ22_CYAA5/5-199-.FCG..T..LDPD.....LTPQ-GKEMAKAFADA...YK----------------------S.....FDWSAI......
G2I053_GLUMN/23-220-.LYG..T..MDVA.....LCPD-SLKAQRWMYEA...LA----------------------R.....RLPQQAL.....
A4XA48_SALTO/210-405-.YSG..R..FDVS.....LSDQ-GRAQAEATANR...VA----------------------A.....LAPSAAA.....
C0QQJ5_PERMH/4-196-.IQG..H..IDTD.....LTPA-GVVQARLAGEE...LK----------------------K.....FNIQRV......
F2NE04_DESAR/4-197-.FRG..S..KDIP.....LNEQ-GREEARLAGEW...LQ----------------------E.....ETIHAA......
E3CWY7_9BACT/18-211-.FRG..R..VDFP.....LNET-GLAQARALAGA...LK----------------------S.....VPLDRI......
G7V8B5_THELD/7-201-.FQG..K..TDVP.....LNEA-GLNEAKALAER...LK----------------------N.....WPFDVI......
F6EE93_AMYSD/5-202-...Q..K..LDTRPPGAGLTAR-GHEQASALAKD...AQ----------------------S.....WTCNAL......
G0HE54_CORVD/27-224-.FSG..R..SDPA.....LTDL-GNAQVARAASW...LR----------------------TR..QDQGEGIDA.....
D7CTF2_TRURR/4-192-.IQG..Q..QHNP.....LSAL-GELQARRLGGR...LM----------------------G.....ERFDIV......
C4XRN5_DESMR/4-195-.FVG..Q..TDHP.....LTDE-GRAQAALWREA...LA----------------------D.....VPFTAA......
D5DCI5_BACMD/2-191-.IQG..H..ADIP.....LNEA-GKQQAKRVAER...FR----------------------D.....IHIDVI......
F8L7X0_SIMNZ/6-189-...G..L..TDLP.....LTEN-GISQAKHLGKR...LE----------------------R.....VTFDHV......
C6WJD9_ACTMD/6-206-CRVP..D..HTMP.....LTPL-GEREAKEAGDR...VK----------------------A....LLQDVPAA.....
Q01QD4_SOLUE/4-187-...G..R..TDIP.....LTAN-GRENAATIGRY...LG----------------------G.....RQFALV......
O67630_AQUAE/21-213-.FQG..R..LDSD.....LTPL-GFVQSRLLVKQ...FE----------------------R.....EKPEVI......
D3E7U3_GEOS4/4-184-...K..E..RSRG.....LSAQ-GSLAAERVKEM...LR----------------------D.....EGIDAI......
F5WRW0_ERYRF/5-198-.MQG..S..KNSP.....LTAE-GKEQAMLLQKR...LE----------------------S.....IDFDEV......
Q0BPI2_GRABC/16-203-..RF..P..GDEP.....IEER-ERRRLAIWNPS...LP----------------------A......RMG..H.....
Q8DV19_STRMU/3-202-FQGA..H..GDSP.....LLST-SIIELRALGHY...LK----------------------D.....ITFDHI......
C6WJ12_ACTMD/7-195-...G..I..SDVP.....LTTH-GVQQARRAGAVLARLR----------------------G.....TDLPPAL.....
I0JQ97_HALH3/4-186-.AQG..K..SDIP.....LNQE-GISDAEKLAER...LH----------------------T.....EEWEVL......
Q890L1_CLOTE/7-201-.MQG..W..NDSP.....LTKL-GMEQAKRLGKR...LD----------------------N.....NNIDII......
A4G6G7_HERAR/9-205-MPYA..P..DEVP.....LNEQ-GCRQTSAAGRV...FA----------------------Q.....QDIRFDR.....
Q67MI2_SYMTH/5-185-.AQG..Q..VDIP.....LNAE-GERQAGAVAAR...LA----------------------T.....ERWDAV......
B0RD00_CLAMS/47-237-...G..T..TDIP.....LTET-GEEQARAVGGV...LA----------------------G.....TEFGLV......
B7GKQ4_ANOFW/31-225-.MQG..W..KDSP.....LTEK-GKKQAALLHDR...FR----------------------T.....VPFTAA......
B8EKJ6_METSB/5-199-.LQG..Q..LDIG.....LNAS-GRAQAAAVAAR...LT----------------------A.....CRFDAI......
I0K575_9BACT/6-202-VQGS..G..VDAS.....LNDM-GRAQAAAFFQA...YQ----------------------H.....VPFAKI......
F9ZSH9_ACICS/8-193-...S..V..TDIG.....LTPD-GRAEAMALWPF...FR----------------------D.....RGRNFDG.....
F4GUJ2_PUSST/6-198-.LQG..S..LDIP.....LNTT-GIEQAERLGQY...LR----------------------SP...LFSTRIDT.....
E6TZD4_BACCJ/4-202-.LQG..A..LDSE.....LTEK-GVANAIALGER...LK----------------------N.....INFHAI......
A3QAT5_SHELP/6-198-..RG..H..SDQP.....LTEI-GFAQMQLAYAK...L.----------------------.......PQAVDR.....
F0YIY5_AURAN/82-285-.YGG..D..VDVP.....LSAR-GEAEARAAAAY...VA----------------------D....AYGAATTA.....
A8LFW3_FRASN/5-200-AGGE..I..GCTG.....LTER-GRDQARQLGRR...LR----------------------RM...HDDQSFDA.....
F4CMY4_PSEUX/3-194-...G..A..ADPA.....LTEL-GHRQAATLVTA...LA----------------------G.....EPVEGV......
Q6FKJ4_CANGA/19-215-.LQG..H..RDTS.....LNVT-GVDQGHKLGKY...LK----------------------N....DRNIKFER.....
Q5WIH4_BACSK/3-196-.IQG..S..MDFP.....LSDL-GEKQAQAVARF...CT----------------------T.....LAADYL......
A0LTB5_ACIC1/211-404-.FSG..V..GDPP.....LVDQ-GRWQAKLLAQR...LA----------------------G....RGGIDVV......
F4PSW8_DICFS/370-558-...K..G..GDPD.....LNHD-GELFSHTLASW...VT----------------------E....HAKNQEIT.....
G0VB21_NAUCC/21-215-.LQG..H..KDTS.....LNGT-GVKQAEQLGSY...LK----------------------E.....RSIVFDK.....
Q5FS21_GLUOX/26-223-.MYG..A..LDVP.....LCRE-AMASQQG.GYA..TLA----------------------R.....RLPTDAL.....
F4B9W0_ACIHW/4-190-LSHD..V..NNYP.....LTEE-GQSQAKNTAKE...LL----------------------K.....LKITKI......
D1C2P1_SPHTD/5-200-.LHG..R..TDLP.....LTER-GRLQAQRVAER...LA----------------------G....LTDIGAL......
A9HYX7_BORPD/4-199-.LQG..W..QDID.....LNAA-GREQAAQLAAR...IG----------------------A.....AGQAFGA.....
D9R017_CLOSW/3-192-...C..N..IDVA.....LSKE-GLLQSALVGKR...LA----------------------S.....KGIEAV......
Q7NT51_CHRVO/8-202-.LQG..H..TDIP.....LNHA-GLEQASQLAHA...FR----------------------P....DHAFQAL......
D7CND1_SYNLT/3-196-.YQG..A..TDVP.....LSER-GIWQATRLASR...FR----------------------Q.....APLSAV......
F8EAH6_RUNSL/6-202-VQGS..G..IDAH.....LNEL-GVAQANAFFEV...YQ----------------------N.....VPFDKV......
H8L495_FRAAD/3-195-.IQG..I..EDSP.....LTAL-GIEQARAVGQA...WR----------------------G.....SGIRHI......
F4C717_SPHS2/5-199-VQGR..G..VNTP.....LNDL-GNQQAQAFYEA...YQ----------------------A.....IKFDKI......
F4A2A2_MAHA5/4-197-.TQG..Q..CDIP.....LSDK-GRQQACAVAKA...FE----------------------G.....YDVSNI......
A6TRG4_ALKMQ/4-197-.TQG..R..RDSR.....LTPG-GLQQAELAGQK...LM----------------------N.....NKIQVI......
E3LC61_PUCGT/216-403-..KI..G..GDSQ.....LSER-GMEYAKALPKL...IA----------------------D....AIGGTPLT.....
A0LHV7_SYNFM/386-579-RFVG..Q..LDLA.....LSDR-GIEQSEQLRER...LR----------------------H.....VRLSAV......
D7FIE0_ECTSI/94-289-CQGR..K..LNPP.....LNEN-GRRQART...L...LI----------------------D.....VELDAI......
B9S8J7_RICCO/19-213-.LQG..H..LDVE.....LNDA-GRQQAALVADR...LS----------------------K....EHKISAV......
F0RNH1_DEIPM/22-219-.YQG..Q..TDVP.....LSPL-GEQQVAALAQR...LA----------------------G.....RQFAAV......
A9TAW0_PHYPA/4-197-...G..H..AESD.....LNEA-GKKQAQAAAEK...LA----------------------S.....MGLEFAA.....
A8FBP0_BACP2/4-185-.IQG..R..TDIP.....LNDT-GKWQAEQTGLY...LK----------------------D.....AHWDVV......
C1CYM6_DEIDV/6-197-.WQG..V..TDNP.....LGDR-GERQSRRLARR...LR----------------------N.....QVFDQV......
E8V8F6_TERSS/7-190-...S..R..TDIP.....LTEQ-GKERAVTLKPY...LA----------------------R.....QDFSLV......
Q8YXV2_NOSS1/5-199-.FCG..S..IDSS.....LTPE-GLEMAKAFAST...YS----------------------S.....VSWTAI......
H1YC42_9SPHI/6-200-IQGR..G..INAE.....LNDR-GIIQGKAFYDA...YH----------------------N.....VPFDKI......
D0NUL9_PHYIT/63-266-GRVP..D..NAMH.....LTEL-GYEQAVAAGES...IK----------------------K....IVGNETMR.....
H6RPL7_BLASD/7-199-.YGR..L..PGYR.....LSDA-GEQMAVRAADW...FA----------------------G.....RDVVHL......
E3PRT5_CLOSD/4-195-.TQG..Q..KNSE.....LTEQ-GVEHARQFSRE...IS----------------------H.....MHIDEV......
F4CPL7_PSEUX/29-222-...G..Q..GDPE.....LTEL-GLRQAAGAAAR...LA----------------------T....DGSITA.......
E3GIM0_EUBLK/4-197-.FQG..V..LDLP.....LNDL-GLKQARALGER...FK----------------------D.....IDVDVL......
F2RLZ2_STRVP/28-222-...G..R..TDLP.....LTPD-GEAEARTLAAS...FS----------------------G.....RSFAFV......
A1AP89_PELPD/13-205-.YIG..Q..ADIE.....LNAT-GRAQAISWRTE...LA----------------------N.....IPLKRI......
A0D5U7_PARTE/23-205-.ICG..W..TDSR.....LTIR-GREQANQLLQA...LL----------------------P.....FRDQFKG.....
D7CRA3_TRURR/4-190-.VQG..H..SDVP.....LSAR-GRRQAEALRGR...FQ----------------------G.....A...EIV.....
F0S1R0_DESTD/4-200-.YQG..K..MDIP.....LNEE-GKEQARRVGEA...LK----------------------D.....FPVKAV......
A6LX68_CLOB8/5-196-.LQG..R..GNSP.....LTQA-GIARAMELRDR...IK----------------------D.....IDIDVI......
A1SI90_NOCSJ/187-388-GGLA..S..ANPG.....LSEE-GRAQVRAVADW...LA----------------------P.....LAERVDV.....
C1DZ31_MICSR/6-219-.IQG..Q..EDAE.....LDGD-GVTQAEALGAA...LA----------------------G.....GRFGTID....A
A1K9A9_AZOSB/15-209-.LQG..H..LDVP.....LNEV-GHTQAEATARS...LR----------------------G.....GRFAAI......
F0RK66_DEIPM/8-205-.FQG..Q..TDTP.....LDAT-GRAQVQATAQR...LR----------------------A.....EGVRSPL.....
H2J7Y6_MARPK/3-195-.WQG..T..VDIE.....LNDI-GKEQARNLGKR...FK----------------------R.....EKYSKV......
D3SL81_THEAH/4-197-.YQG..L..LDPE.....LSQR-GLQQARLLAEA...LR----------------------N.....VPFDVI......
I0H0L2_ACTM4/169-364-.YSG..R..GDVP.....LTDE-GEAQAMAAAGR...VA----------------------G.....IFPEVAA.....
D2PWV1_KRIFD/7-199-.YGR..I..PDFH.....LSEL-GRKMADRVAEH...VA----------------------G.....RDVVHL......
H8KQQ2_SOLCM/26-220-VQGR..G..VNTD.....LNDL-GREQAQRFFET...YR----------------------T.....VPFDKV......
D4M9J9_9BACT/3-199-.FQG..Q..LDVP.....LNEA-GMLQADRVAER...FR----------------------G.....YPLAAV......
D6GQ74_FILAD/4-199-.FQG..R..KDSP.....LTEL-GKMQALLFHER...LK----------------------K.....LDVDII......
C6D8K0_PAESJ/4-200-.SGG..W..TDTP.....LTEL-GRKQAEIIGSK...LR----------------------D....SLNSSDYV.....
YQGD_SCHPO/56-250-RAGA..R..IDSE.....LTVH-GYNQAKKLAKS...IR----------------------N.....LDIVCV......
Q6CU83_KLULA/19-210-.LQG..H..MDTE.....LNET-GQDQASKLGEY...LA----------------------N....DRHLKFDK.....
H5WQ77_9BURK/7-200-.LQG..Q..LDIP.....LNDT-GRWQAARLAAA...LA----------------------D.....EQLDLV......
D8K089_DEHLB/3-197-.CYG..S..TDVP.....LSEK-GRTQAAALQKR...FA----------------------M.....ERIETF......
Q752M0_ASHGO/19-204-.IQG..H..KDTA.....LNAV-GMQQAEQLGRF...LK----------------------M.....HGVQFER.....
A5GRZ9_SYNR3/7-190-...G..S..SDIP.....LLPE-GEEEAKALAPR...LR----------------------G.....QSFAQV......
G8PCV9_PEDCP/4-209-YQGA..K..GDSE.....LLPS-SFVEIKELASF...LS----------------------E.....NSFKRI......
C5AAI7_BURGB/12-209-..ID..P..DTVP.....LNEL-GRAQACAAGRA...FA----------------------S.....QSIRFDR.....
A6LYX0_CLOB8/6-201-.MQG..H..KDSP.....LTKV-GISQAQKLSYR...LM----------------------N.....EKVDLI......
G8PKK2_PSEUV/5-200-.VGG..W..TDTA.....LTPH-GIDQAKRTAEY...LA----------------------E....DARFLSAP.....
G0HCC2_CORVD/15-213-.MQG..Q..LDTP.....LSDA-GRDEAIRVAEG...LA----------------------D.....WPIGTV......
D1B6G9_THEAS/4-191-.LGG..R..TDVP.....LSEE-GERMSRALGGL...LR----------------------S.....LGAGSA......
A9WMJ6_RENSM/7-207-NRVP..D..YRIP.....LTDI-GLAQATAAGEN...IR----------------------R....RLDGQQVC.....
D7CRM6_TRURR/14-202-.VQG..Q..GDPA.....LSDR-GREAARRLRPR...LQ----------------------R.....AAFDAV......
E1VYH9_ARTAR/6-206-.YGR..I..PGFG.....LSEL-GFQMADGAGEY...FA----------------------K.....RQAEGGNV..VR
A3I0N5_9BACT/6-199-VQGS..G..INAD.....INET-GRKQAACFFEA...YK----------------------G.....VKFDQL......
F5XXJ6_RAMTT/6-200-.IQG..Q..LDIA.....LNDR-GRWQAQRAGEA...LA----------------------G.....EAITAV......
E4TVK9_MARTH/5-199-VQGS..G..VDAS.....LNDN-GRKQAEEFFKA...YG----------------------G.....FPFDKL......
D7CTF3_TRURR/6-194-...G..Q..SDPP.....LSEL-GVRQAELLGRR...LA----------------------S.....TPFDEV......
A8NEW8_COPC7/6-200-.LQG..H..LDTE.....LNDE-GYRQAELVADA...LK----------------------D.....VSFKVA......
C9LWB8_SELS3/4-197-.FQG..H..SDIA.....LAEK-GVKQAECLARH...FP----------------------A.....EKIDAI......
A2SCK3_METPP/9-202-.IQG..Q..LDIG.....LNDK-GRWQAGRVAQA...LS----------------------G.....EGLDVV......
I0I391_CALAS/7-202-.WYG..A..LDAP.....LTER-GRLQVQATGER...FR----------------------RC...RQQEPVDA.....
D7GDV6_PROFC/6-200-.YQG..S..SDIP.....LNAV-GRAQAGAAAGW...IA----------------------H.....LNPVAI......
F0SCC4_PEDSD/9-205-VQGR..G..IDAD.....LNEK-GRAQGRAFFEF...YK----------------------S.....VPFDKV......
Q82HM5_STRAW/9-190-......D..EDAG....ELTAN-GRRQAELLGDR...LR----------------------D.....VPLAAI......
F5YTK7_MYCSD/3-188-..GQ..G..SDPE.....LSET-GLEQALRLPDA...LQ----------------------R.....YPITRL......
A9B597_HERA2/3-196-.YQG..H..LPIP.....LNQR-GREQALCAGQR...LA----------------------N.....LAIDHL......
F8C410_THEGP/11-201-.FYG..Q..LDVP.....LSEE-GKIKSLKVVDE...LS----------------------N.....YSIKAI......
E8U708_DEIML/12-204-.WQG..H..SDTP.....LSAE-GEAQARLLARR...LR----------------------A.....SDFDEV......
A1RBG3_ARTAT/3-197-...G..Q..LDTAFPGPGLTEL-GERQAAALPEA...LA----------------------D.....EAIEAL......
B4U6G2_HYDS0/4-195-.FQG..S..LDSE.....LTPL-GYMQAKLLSLA...FK----------------------N.....KKINII......
A9GMF5_SORC5/6-203-PMSG..W..TDTP.....LDAR-GRDEAEALRRR...LA----------------------G......GPALDA.....
A0C4I4_PARTE/221-414-..KV..G..GDSD.....LTQT-GLMYAKQLGKY...FV----------------------QE...LEGNRNIK.....
Q8RA82_THETN/5-198-.MQG..M..KDIE.....LTQL-GLEQAELLAKR...LK----------------------G.....ENIDCI......
D3SNK7_THEAH/4-196-.FQG..R..LDSD.....LTPL-GFVQARLCALA...LK----------------------D.....KGISVI......
E3PXR0_CLOSD/4-193-.FSG..Y..TDCK.....ISDF-GFLQLEKLSDK...MK----------------------N.....IKVDYV......
C7MXW3_SACVD/6-193-...G..R..TDPP.....LTAV-GERQAHAAGRTYALM.----------------------......ADDSPAL.....
F2UB54_SALR5/10-206-.LQG..H..RDVD.....LNEK-GKQQAMCVARA...LQ----------------------D.....RHVHAV......
G8LZ21_CLOCD/5-199-.FHG..W..TDSG.....ITEK-GHVQAKKVAER...LK----------------------D.....IDIDVL......
F5Z355_MYCSD/10-196-..VT..R..PDPQ.....LSES-GLAQARAVAEV...MT----------------------L.....LPVSVI......
A9KNM7_CLOPH/3-193-...C..N..VDVD.....LAVE-GREQAKLLGKR...LS----------------------E.....YGIDCL......
D5UTB9_TSUPD/21-219-.MQG..Q..LDTD.....LTEL-GRRQAVAAAGA...LA----------------------D.....REPLTI......
D3QBR8_STANL/4-188-...S..V..TDLD.....LTDD-GERQARNLAPA...LT----------------------P.....YRFTAV......
E4RUN0_LEAB4/6-202-VQGR..G..INAD.....LNET-GQMQARAFYEH...YK----------------------D.....IPFQKV......
PSPA_HYDTT/4-197-...G..L..LDPD.....LSER-GKKQAKLLAQE...LS----------------------R.....EHLDVI......
A1TUY5_ACIAC/7-200-.IQG..H..LDIP.....LNDT-GLWQARQLGRA...LA----------------------D.....EPVAAI......
A3DDB3_CLOTH/4-198-.CQG..R..IDTE.....LNSE-GILQAEAIAQR...LA----------------------G.....ENIDVI......
A3DE01_CLOTH/7-201-.FHG..W..TDSS.....ITER-GHLQAQRVAQR...LK----------------------D.....VDIDVI......
A4XKT7_CALS8/6-197-.FHG..I..TDSN.....VTEK-GKLQAQKLAER...LK----------------------N.....VHFDVI......
A5N4L6_CLOK5/4-199-MQGG..M..KDSP.....LTKK-GIEQANLLKNR...ME----------------------N.....INFDII......
A8AW93_STRGC/3-202-FQGA..G..GDSP.....LLPT-AIEELHVLGNH...LA----------------------K.....TRFDKI......
A9BUH9_DELAS/6-199-.IQG..H..LDIP.....LNDM-GLWQAAQAGKA...LA----------------------G.....EPVAAI......
A9WDJ8_CHLAA/4-198-.WQG..H..ADVP.....LNEI-GYQQARLLARR...LA----------------------NE...GVTFSAI......
A9WI66_CHLAA/3-196-.YQG..H..APIP.....LNER-GREQARRAGIR...LV----------------------R.....SGAVAL......
B2GB95_LACF3/4-204-YQGA..H..GDSP.....LLEA-SHQDIRSLAAS...LA----------------------G.....VKFIHA......
B2TR14_CLOBB/4-195-.LQG..S..KDSP.....LTER-GLNQAKSLRDR...LK----------------------N.....EKIDII......
B4EET0_BURCJ/6-203-.IQG..H..IDIP.....LADT-GLEQAQRLAAR...LA----------------------REARDGARIDAV......
B7J3Q1_ACIF2/6-188-.HTS..V..TDVA.....LTAE-GRKDAQALWNH...FV----------------------E....QGHFDGI......
B7K5Q7_CYAP8/5-197-.YCG..R..LDID.....LTSE-GLAMAEEFAKS...YQ----------------------D.....LPWKAV......
B7K5Q8_CYAP8/5-198-.YCG..RLENDPG.....LTPE-GLEMAQAFADT...YC----------------------S.....LPWKAA......
C1A1J7_RHOE4/16-207-.MQG..Q..LDTD.....LSEL-GRTQAKSAGPV...IA----------------------D.....RRPLTI......
C4M5P9_ENTHI/4-193-.IQG..C..TDIE.....LTPN-GIQQANEVAQQ...IK----------------------G......NFDII......
C8WXI8_ALIAD/3-178-.VQG..W..TDVP.....LNEV-GRRQADRLAAW...LR----------------------P.....VHIDHI......
D0J8B8_COMT2/6-200-.IQG..H..LDIP.....LNDT-GLWQAEQAAQA...LA----------------------D.....ESIAAI......
D0MFF3_RHOM4/6-203-VQGR..G..VDAP.....LNER-GRRQAEALARR...FA----------------------A.....VPLDAI......
PSPB_HYDTT/4-194-.FQG..R..LDSD.....LTPL-GFVQARLLARE...FL----------------------K.....KKVDII......
D3EF23_GEOS4/3-199-..GG..W..SQRG.....LIDE-GIRQAEKLGQY...LD----------------------E.....HKHDFNIH...R
D4ZU25_ARTPN/5-201-..ER..R..YDPY.....LSPD-GLVQAKQLARR...LV----------------------G.....EGITQI......
D4ZY14_ARTPN/5-199-SSSN..P..FDPP.....LSAK-GEKQAIALAQR...LG----------------------E.....EKINYI......
D5X3R0_THIK1/11-204-.IQG..H..TDIP.....LNAR-GLEQAQLAARA...LA----------------------D.....EAIDAV......
D9QBM8_CORP2/186-379-.YSG..L..SNPS.....LSDL-GRYQAECAAQY...FA----------------------S....RGGIDVI......
D9TCE6_MICAI/4-187-.HTS..Y..TDLD.....LTPD-GERQARALAPL...LA----------------------G.....RHLARV......
E2Q1Y3_STRC2/296-492-GSGG..S..ADPE.....LSPA-GRRQAEAVASA...LA----------------------A....RGTVQEI......
E3HNV8_ACHXA/4-200-.LQG..W..QDIP.....LNEF-GVNQASLLAAR...MR----------------------EEA.RHTPIHAI......
E9T6R4_COREQ/181-372-.YSG..R..GNPP.....LTAF-GRTQARSAAQR...IA----------------------D....KGAIAAV......
E9T8C0_COREQ/5-201-LDTR..L..PGAR.....LTDL-GRTQAQSLGSR...LA----------------------L.....RPPTAL......
F3Z543_9ACTO/9-196-.HTG..R..TDIP.....LLDD-GRRDAALLGKR...LR----------------------E.....EPFAGLTD..AV
F3ZAP6_9ACTO/8-184-..........GSG.....LTAR-GRGQAELLGER...LK----------------------R.....LPLTSL......
F6B5X8_DESCC/5-197-.FQG..H..SDVP.....LSDV-GREQARALALR...LS----------------------Q.....EKIDAF......
F9UQA5_LACPL/4-204-YQGS..Q..GDSP.....LLPT-SYQEIHELAAA...LQ----------------------D.....IRFSHI......
G2J5B1_PSEUL/9-203-.LQG..Q..IDTP.....LNTT-GQEQAQTLSLA...LT----------------------AR...ALRFDAL......
H0UKK7_9BACT/8-199-.YQG..R..SDVS.....LNED-GRRQAAACRDV...VQ----------------------G.....WNPQLI......
H6MTJ9_GORPV/7-199-.YSG..R..GNPP.....LTDL-GVTQALRAAQR...AA----------------------S....EQPIAAV......
I2BB94_SHIBC/3-198-.YSG..I..SETP.....LTAR-GERQACALQQM...LA----------------------A.....VPFDRV......
J3MTT3_ORYBR/86-279-.IQG..H..LDVE.....LNEV-GRQQAVAVARR...LS----------------------N....EAKPAAI......
J9RE89_9ACTO/4-200-LDTA..L..PGAA.....LTDF-GARQGVRFGLE...NT----------------------P.....EHHAVL......
K0I0L2_9BURK/7-205-.FQG..H..VDVP.....LNAI-GHEQARRLAER...LA----------------------A.....ERPVVHH.....
M9X0U0_PASHA/5-206-.LQG..S..GDSA.....LVEE-GIIGAKKTGIA...LK----------------------H.....IPFTAA......
PHOE_BACSU/4-184-.CQG..K..TDIP.....LNAT-GERQARETGEY...VK----------------------D.....FSWDII......
COBC_SALTY/3-195-.YSG..H..APTP.....LTEK-GIGQAKTLHTL...LR----------------------H.....APFDRV......
P73454_SYNY3/5-196-.YCGTPE..NDPG.....LTPE-GILMAKEFAEA...YA----------------------Q.....HPWQAV......
Q142E5_BURXL/12-206-.AID..P..ETVP.....LNAN-GREQASAAGRE...FA----------------------AQ...QIRFDRV......
Q1D982_MYXXD/5-197-.LQG..H..QDST.....LSQV-GLRQADALAAR...LE----------------------P.....VRFSAL......
Q1GAS0_LACDA/3-202-FQGG..Q..GDSK.....LLPE-SLADIEKLGRY...LQ----------------------G.....KHFKAV......
Q2S2V8_SALRD/16-213-MQGG..G..IDST.....LNAT-GREQARALARR...FA----------------------S.....ADIDAL......
Q31LG1_SYNE7/5-198-.YSG..S..GNPP.....LTEA-GQQMAQALADT...YA----------------------D.....LNWQAA......
Q3Z6L9_DEHM1/5-197-LQGG..L..SDTP.....LNEN-GLRQTRNLALR...LK----------------------D.....EKLSAI......
Q53WE2_THET8/5-190-.PVP..P..EGVG.....LTER-GRAQARAVGVL...LR----------------------E.....VPLDLA......
Q55734_SYNY3/5-198-.FCG..R..LDID.....LTSH-GYQMAHQFAEA...YK----------------------D.....VSWTAI......
Q5KZY5_GEOKA/9-198-.MQG..W..QDSP.....LTEK-GRQDAMRLGKR...LE----------------------A.....VELAAI......
Q5M513_STRT2/3-202-LQGS..K..GDSP.....LLKE-SIEQVSELGHY...LS----------------------D.....THFDLV......
Q5SM93_THET8/17-207-.LYS..H..PGLP.....LSPK-GRSALLALLPL...LQ----------------------G.....FPVAHV......
Q63WA7_BURPS/3-184-.CYG..A..SDVP.....LAAG-AAAGAAGIRRR...LR----------------------S.....LGVARAS....R
Q65KU1_BACLD/4-191-.MQG..W..EDSN.....LTAL-GLANANALGER...LK----------------------D.....VQFQAA......
Q6AAY7_PROAC/7-194-.YGC..M..AGYH.....LSPL-GRRMAARAAEH...FA----------------------G.....AELSAL......
Q6MWZ7_MYCTU/8-191-.HTG..G..TEVE.....LTDT-GRTQAELAGQL...LG----------------------E.....LELDDPI.....
Q6NG55_CORDI/177-370-.YSG..R..SNPE.....LTSV-GLEQARRAAAF...IG----------------------R....RGGIDAI......
Q74JW8_LACJO/3-202-YQGG..S..GNSP.....LLPE-SYEDIKKLAGY...LK----------------------G.....TKFRAF......
Q7V6P3_PROMM/6-190-.HTG..S..TDLP.....LLPQ-GEEEAKALAPV...LK----------------------G.....VTFAAV......
Q819N7_BACCR/4-184-.IQG..R..EDIP.....LNEV-GKKQASQSAAA...LQ----------------------E.....ETWDII......
Q81RH1_BACAN/3-190-.HEG..R..ADFE.....LTEK-GRQQVQRLVQK...VK----------------------A....DFPPDFI......
Q8FNL1_COREF/236-428-.YSG..R..SNPE.....LSEL-GQRQVQAAARK...LA----------------------E....RGGIDVI......
Q8NT72_CORGL/6-197-.YGR..M..PGYR.....LSSR-GRSQAARTAAS...FE----------------------G.....HDVTYI......
Q8RFA7_FUSNN/3-199-.FQG..L..SDSP.....LTEL-GIIQAKLLGEK...LK----------------------D.....IKFDKF......
Q8XP82_CLOPE/3-199-.FQG..W..KDSE.....LTEN-GVKRAELLGKK...FN----------------------D.....IKIDKI......
Q8Y237_RALSO/17-210-.LQG..Q..LDVP.....LNAQ-GREQAAQLGRA...LA----------------------R.....EPFDAI......
Q8YA91_LISMO/8-204-.MQG..W..GDSP.....LVAE-GIDGAKAVGEV...LK----------------------D.....MQIDAV......
GPMB_YERPE/4-194-.IQG..Q..SDSP.....LTEI-GIRQAHLVAQR...VR----------------------N.....QGITHI......
Q97ET5_CLOAB/5-198-.FQG..C..HDIN.....LTDN-GIEQAKRVAKR...LE----------------------G......SFDCV......
Q9PC95_XYLFA/3-198-.YQG..Q..IDIP.....LSSV-GEAQARALGER...LR----------------------D.....VVIARA......
Q9RKV8_STRCO/4-195-.HTG..L..TDVP.....LTEK-GREQARSLVPL...IR----------------------S.....HRIGAA......
R5J9E3_9FIRM/5-197-.TQG..H..GNSP.....LTDL-GVKQAENLAKA...IK----------------------K.....YPIDLI......
R5RIR8_9FIRM/3-193-.LQG..W..QDSP.....LTAE-GIEDAKLLKAR...IT----------------------E.....LKIDYC......
R5T6S4_9FIRM/4-197-.YQG..Q..EDIP.....LSPT-GIAQGKAAGLA...LK----------------------D.....ISIDAA......
R5TTE8_9CLOT/3-188-.IQG..S..HDIP.....LNDT-GRAQAKLVAEG...MD----------------------S.....RPVTKI......
R5XAL3_9CLOT/4-198-.LSG..H..IDSK.....VSEE-GKKQIEKITEF...LK----------------------Y.....EKIDRI......
R5XCV5_9CLOT/5-198-.TQG..H..GNSD.....LTPK-GIEQAELLADS...MT----------------------K.....YPIDYI......
R6G925_9FIRM/3-196-.YYG..K..TDAV.....LSVR-GIEQAKYLQHI...FK----------------------E.....VSFDYV......
R6JTD2_9CLOT/3-186-......N..VDVD.....LSEE-GYRQASLLGER...LF----------------------H.....ENIQVV......
R6ULZ9_9FIRM/4-196-.LQG..W..SDTP.....LTEK-GIAQGKALGRG...LA----------------------N.....TPFEKI......
R7FT81_9FIRM/32-228-.IQG..Q..VDIP.....LNQF-GKRLAEETAEG...LR----------------------D.....IPFDLC......
R7G8S3_9FIRM/4-195-.LQG..W..SDTP.....LTAN-GIMQGKALGRG...LA----------------------D.....IPFLKA......
U4KIP7_9VIBR/4-197-.LQG..H..DDSP.....LTQL-GIEQAELARER...LS----------------------Q.....VSFDAV......
U5L4S7_9BACI/4-197-.MQG..R..LDSN.....LTEK-GLGDAERLREY...LG----------------------E.....MQFDEI......
U5L644_9BACI/4-196-.HEG..R..ADFP.....LTSL-GRRQAGLLAEF...IT----------------------E....HYPPDII......
U5LDT0_9BACI/4-184-.IQG..R..TDIE.....LNEM-GVRQAAACRDH...LA----------------------N.....ENWDII......
V6K5U9_STRNV/6-198-VGGP..R..TCTG.....LTNL-GYAQAEQAARR...LA----------------------TEH.LKKPFDVI......
W0E7D0_9FIRM/4-193-.VQG..A..MDSP.....LTDK-GIWQAQVLANR...LH----------------------D.....EGISVI......

PF00328

PHYA_ASPFU/71-425IRASGSDRVIASGEKFIEGFQQAKL....................ADPGATNRAAPAISVIIPE...SETFNNTLDH...
VIP1_CAEEL/363-914IYASDEGRVQTTAAAFAKGLLALEGELTPILMQM.VKSANTDGLLDDDCQARLYQTELKRYLHKALQADRDFTPQDYLEL
Q22525_CAEEL/28-375VRSTDKNRTLLSAFSNMVGMYGNTAQENASI........AGVDYPDVVGWPVGFVPIPIHTIPD....AEDHLLSVD...
Q6BUR8_DEBHA/63-396VFTTSNTRVYDTSQSFIRGFMGQEY...........................DGRKVDTVILSEGSEMGANSLTPAS...
VIP1_HUMAN/390-910IYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDGDSLSSCQHRVKARLHHILQQDAPFGPEDY...
PPAX_CAEEL/28-365IRSTNLNRTIISAMSLLYGMFPPGAWN................IQGVDYPNDVDWQQGFTFIPVHVDGIDQCAVAQL...
Q6BWV9_DEBHA/521-1079VFTSSERRVIASAHLSTLALLGLDKEHEEL..........PDDFLIIRKDLLDDSNAAKDLMDKVKKKLKPLIRQGA...
VIP2_HUMAN/379-894IYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDSDSLSSCQQRVKARLHEILQKDRDFTAEDY...
VIP1_DROME/402-926IYASDEGRVQMTAAAFAKGLLALEGELTPILVQM.VKSANTNGLLDNDCDSSKYQNLAKGRLHELMQNDREFSKEDREL.
PHYB_EMENI/70-422IRASGSDRVVASAEKFINGFRKAQL.....................HDHGSKRATPVVNVIIPE...IDGFNNTLDH...
Q7SEH2_NEUCR/194-548ARTTTQDRMLRSAENFLAGMF.GLE...........................WPNNVTLEVIIE..GSNLNNSLAGY...
ACPL2_DANRE/88-449AETTGKSRTLQSGLAFLFGFL.PHF..............................DWSRLTVRQ...QWSTLFCGQS...
PPA_ECOLI/29-375IIADVDERTRKTGEAFAAGLA.PDCAITVH..........TQADTSSPDPLFNPLKTGVCQLDNANVTDAILSRAGGSI.
Q6BM75_DEBHA/63-397VFAANYDRVALTAQYFARGFLGQDY...........................DESNVEYVLIDEDGELGANSLTPRY...
Q6CZF4_PECAS/34-372VLASPLQRTRATAQAYMDGMFPGCGVTTH............AVEDEKQDPLFHGDKMGIGTLDPEQAKAAVLKAMGG...
VIP1_YEAST/538-1047IFSSSERRVLHTAQYWTRALFGADELGS..............DEISIRKDLLDDSNAAKDLMDKVKKKLKPLLREGK...
Q6FJ21_CANGA/510-1016IFSSSERRVLVSAQYWATALFGADEFSS..............DEINIRKDLLDDSNAAKDIMDKVKKKLKPLLREGK...
Q6CYI2_KLULA/67-401VFTSSSGRVYQTAKYAVSALEEELN.............................VQLDLQIIQENETAGANSLTPGD...
Q6CWN2_KLULA/534-1048IFSSSERRVLVSAQIWATALFGADEISS..............DEISIRKDLLDDSNAAKDLMDKVKKKLKPLLRMGK...
Q6CES1_YARLI/413-907CLSSSERRVIASAKIWAAAFL.GVEEVS.............DDFIVVRKGLLDDSNAAKDLMDKVKKELKPLLRKGT...
Q6AVJ1_ORYSJ/361-950IYSSDEGRVQMSAAAFAKGLLDLEGQLTPI..........LVSLVSKDSSMLDGLEDASIEMDEAKARLHEIIITNAKA.
Q9AAQ4_CAUCR/24-359AWANVTQRTIATAKAYRETLA.PGCPVT.............VNTVGEGNIDPMFEPVKAGIVKA.DHALARAAVAGR...
Q19175_CAEEL/28-376IRSTGINRTLISATSNMLGMYGQDGYGSSA..........GTDFPDAQGWPRGFVPIPVHTVDYDSDHIGNMD.......
Q6CLW3_KLULA/69-406IFSSSAGRVYETAKNVIIGLQEELG...........................FNVDVQLQIISEDQASGANSLTPRN...
PHO11_CAEEL/25-364FRSTNFNRTIISAQSLLYGLFPPSLYDV..............KNVDYPYSPLTWFP.GFTFVPVHVDGPDQCAASQN...
PPA4_SCHPO/25-385MRATPMVRALESLEHVFSGLY.PES..........................KRKMGLPVIFTRN...WSDENLLPNE...
PPA1_SCHPO/59-395IYTAAQQRVVDSALWYGYGMF.GED............................VHNFTNYILVSENATAGSNSLSSY...
PHYA_ASPOR/71-426IRASGSDRVIASGEKFIEGFQKAKLG...................DSKSKRGQPAPIVNVVITE...TEGFNNTLDH...
Q6CCS5_YARLI/180-538IRATEQERIRDSAQAWSEGFF.AKN..............................NDLFTLSLQPEKDGENATLASY...
Q19076_CAEEL/26-371VRSTDVNRTIISAMSNLLGQYGQNDNSSTP..........GLDYPDVDGWPAGYVPIAVHTVDDDTDHLGNME.......
Q84TX6_ORYSJ/68-441IRATQVPRASASAVAFGLGLLSGKG........................KLGPVKNRAFSVLSE..SRASDICLRFF...
Q84WW3_ARATH/362-953IYSSDEGRVQMSAAAFAKGLLDLEGQLTPI..........LVSLVSKDSSMLDGLDNASSEMEAAKAQLNEIITAGSKM.
PPA2_SCHPO/59-405INTAAQERVVDSAEWFSYGMFGDDM............................QNKTNFIVLPEDDSAGANSLAMYY...
VIP1_SCHPO/387-861IYTSSERRVSASAEIFAMAFLEQETIPS..............DLLKVRKDLLDDSNAAKDTMDKVKKHLKSLLRVGD...
PPA3_SCHPO/59-405INTAEQERVVESAKWFTYGLFGDKM............................YEKTNFILISEGKAAGANSLSMYN...
A6T657_KLEP7/32-357VRASPLQRTRATAQALVDGAFPGCGVAI..............HYVSGDADPLFQTDKFAATQTDPARQLAAVK.EKA...
C4QZN1_PICPG/75-409VWAGSQERVVDTAKYFAQGFMKSNY............................TDMVEVVALEEEK.SQGLNSLTAR...
E2RTX6_GIAIC/15-344IRSTNYERTKQSAMSFLIGMYPELG.........................QGSYHDGHQITMPAIHIAETDDWLELM...
F1RD51_DANRE/72-409FMTSSKHRCVDSVKAFQEGLHRLWD..............................VQDMDYQHY....VDDSLMRYF...
G2QKZ0_THIHA/65-455VRTAGQDRVVHSAENFTQGFHSALL...................ADRGSTVRPTLPYDMVVIPE...TAGANNTLHN...
G3Y8Z5_ASPNA/73-427IRSSGSSRVIASGNKFIEGFQSTKL...................KDPRAQPGQSSPKIDVVISE...ASTSNNTLDP...
G7XM48_ASPKW/72-404FFSSGYGRVIETARKFGEGFFGYNY............................STNAALNIISESEVMGADSLT......
S8B7A5_PENO1/144-500IRSSDSSRVVASGQLFIQGYEQSKA...................QDCDADHSQDHAAINVLISE...APGANNTLNH...

PF00300

D7B452_NOCDD/4-197VVTGALRRQRQTAAAALAEAGL...-------------------------------------------------------
D6S4F7_9LACO/3-204.YASPLKRAFDTAQGVQQSMGI...-------------------------------------------------------
C6VSA5_DYAFD/6-202.YTSDLRRTHQTVAGFIR.RG....-------------------------------------------------------
A6W5M7_KINRD/8-200.TASPLQRAQETAAPIARTHG....-------------------------------------------------------
Q9K466_STRCO/9-189.HHGPLPRAVQTARLIADELK....-------------------------------------------------------
H2TRY4_TAKRU/250-436VWTSQLCGAIQTAEHLG........-------------------------------------------------------
Q81XN0_BACAN/4-182IISSPFVRAIDSIRPYARQAN....-------------------------------------------------------
A1VJK7_POLNA/7-200.YASDLARAWETAEYLGRARG....-------------------------------------------------------
D4MTA4_9FIRM/3-194.YASPLKRAYQTAECVAGRQG....-------------------------------------------------------
A9KSK5_CLOPH/3-194IYSSTLLRAEETASLVSMETK....-------------------------------------------------------
G2TLP8_BACCO/4-199.YASTLGRAVRTAEILVKGRN....-------------------------------------------------------
H8GZF0_DEIGI/4-198VYASTYRRAQQTAGAIADALG....-------------------------------------------------------
H6L710_SAPGL/6-200.LASSLKRSQESIAPFGLQLE....-------------------------------------------------------
Q08XQ0_STIAD/8-191.WTSPLSRARETCALA..GYG....-------------------------------------------------------
Q82M88_STRAW/4-196.LTSPLDRAVRTAELAGL.......-------------------------------------------------------
E2BWS4_HARSA/250-436VWTSWLKRTIQTAADVK........-------------------------------------------------------
D3E804_GEOS4/7-201.FSSTSSRAYHTAELIKGNRN....-------------------------------------------------------
Q039P6_LACC3/4-205.YVSPLKRARTTAQTLIKDLDE...-------------------------------------------------------
A9WBR5_CHLAA/16-207.YTSPLDRCIETARAIAEPRG....-------------------------------------------------------
B1VGF0_CORU7/234-430ILSSPLGRCQETARAAAEALGM...-------------------------------------------------------
F8DZM7_CORRG/181-377IVSSPLKRATQTADAVARALRM...-------------------------------------------------------
D7WEF3_9CORY/183-379IIASPATRAQETAAACAEALGM...-------------------------------------------------------
E2Q4K4_STRC2/5-194VRTSPLARAAQTCAL..AGFG....-------------------------------------------------------
C3AWM6_BACMY/4-187.YSSDLLRAKQTAEAIEKNIE....-------------------------------------------------------
D2SCU2_GEOOG/12-204VVSSDLGRAAETAVALTDVLG....-------------------------------------------------------
D5G4W9_TUBMM/6-203LVSSPLRRTIQTT.LLGFKQQIK..-------------------------------------------------------
F5XRM5_MICPN/4-203.VSSPLQRCRQTAHALLAGRAV...-------------------------------------------------------
Q0TY40_PHANO/251-439VWTSTLKRTIQTARFLT........-------------------------------------------------------
C6WMA8_ACTMD/193-386VVASPLQRTRQTAGEIAAALG....-------------------------------------------------------
G0G0W4_AMYMS/3-201VYVSPYLRTRETLRLLDIQTS....-------------------------------------------------------
A7MRJ7_CROS8/43-238VYTSPAGRARHMGDAIASHFR....-------------------------------------------------------
C0ZX17_RHOE4/16-202ILTSPRLRAQLTGDLAGL.......-------------------------------------------------------
D7E1I0_NOSA0/5-202.FASPFLRTVQTANAVAEVLD....-------------------------------------------------------
H8MW52_CORCM/8-191.WTSPLTRALETC..VLAGYG....-------------------------------------------------------
F3Z271_DESAF/7-196.WASDLSRAMDTAKPTAAG......-------------------------------------------------------
G2NEA0_9ACTO/5-193VRTSPLVRASETCEIAGF..G....-------------------------------------------------------
Q1CZG8_MYXXD/11-196.YTSPLSRAADTCALAG..YG....-------------------------------------------------------
D3E7L5_GEOS4/3-187AISSGLSRAEETAKIISSMLN....-------------------------------------------------------
F6CII3_DESK7/6-199.YTSPLSRARICAEMVAAQHG....-------------------------------------------------------
H2K063_STRHJ/266-462IVASPLARTRETAEIVAARLN....-------------------------------------------------------
B1HXM2_LYSSC/4-198.YSSSSGRAKETMDILTAQRQ....-------------------------------------------------------
E0UC66_CYAP2/32-226.FASPFLRTIQTANQVAEALD....-------------------------------------------------------
E1F6I1_GIAIA/6-200.FYSRIPRAKETAEAIQANQP....-------------------------------------------------------
Q8ETC4_OCEIH/4-185.IASPLQRAKVTAEILNEQWG....-------------------------------------------------------
B0JTX1_MICAN/5-201.YVSPLQRAIQTAKPLCEAVG....-------------------------------------------------------
D7LXF7_ARALL/27-219VYSSDLKRAKDTALMIAKTCF....-------------------------------------------------------
D3FUL6_BACPE/3-195.YSSDLTRAHDTALAIGSEKD....-------------------------------------------------------
D2B5L7_STRRD/253-447VVSSPLKRARATAEIVAARLG....-------------------------------------------------------
C4ZPB7_THASP/15-211LYSSDLQRARQTADAVTRAHG....-------------------------------------------------------
B2A0N3_NATTJ/4-199.YTSTSGRTQRTAELIRGNRN....-------------------------------------------------------
Q11U91_CYTH3/15-208.YTSALNRSIESVQSFIDQP.....-------------------------------------------------------
B9DS14_STRU0/3-188VYSSTQERATDTAKLLAD.......-------------------------------------------------------
G8LVK0_CLOCD/3-197.YTSPLKRAVDTAKYINGEKN....-------------------------------------------------------
Q2GMW9_CHAGB/228-418VWTSTLKRTIATARHLPKH......-------------------------------------------------------
F6EEJ9_AMYSD/159-353VVSSPLTRAQQTAHAVAEGLG....-------------------------------------------------------
E3KVQ6_PUCGT/3-193IWSSDLQRAQKTAQVISEQIKD...-------------------------------------------------------
Q1IXX4_DEIGD/21-217.YSSDLARALQTAEIVAERLAG...-------------------------------------------------------
E3DP32_HALPG/5-198.YSSDLKRAQKTASFVAAQKN....-------------------------------------------------------
D9SXD1_CLOC7/4-198.YTSSLGRAVETAALIKGDKD....-------------------------------------------------------
D7GCX1_PROFC/7-200.VSSPLRRALETADTLAELTG....-------------------------------------------------------
C7PMV1_CHIPD/4-187.YTSHLSRAKRTGEIIAAELG....-------------------------------------------------------
YO283_YEAST/19-212VVSSDLKRCRQTTALVLKHSKQ...-------------------------------------------------------
A8MF31_ALKOO/4-198.YSSPLGRAMKTSEIIAGERG....-------------------------------------------------------
D8SNQ5_SELML/4-199VYSSDLRRASDTAQTIAEKLG....-------------------------------------------------------
D7C7F5_STRBB/4-196.LVSPMSRAVATARLAGI.......-------------------------------------------------------
Q5YQW5_NOCFA/13-199VLTSPRLRAVRTAELVGF.......-------------------------------------------------------
C5CF58_KOSOT/4-198.ISSSSGRAIRTAEIIRGKRN....-------------------------------------------------------
Q745R9_MYCPA/3-188.VSSPQRRAVQTAAPVAADRG....-------------------------------------------------------
C8W6P5_DESAS/6-197.FCSDLLRSRQTAQIIAAERL....-------------------------------------------------------
F4CRR8_PSEUX/8-197VIASPRVRARDTAELAG........-------------------------------------------------------
Q0KEC8_CUPNH/15-208.YASDLSRAMETAAPLAEVLG....-------------------------------------------------------
D0LB07_GORB4/15-213VVSSPLRRTLQTAGAVAERIG....-------------------------------------------------------
Q2JD27_FRASC/178-366.VSSPLKRARQTAEALG........-------------------------------------------------------
H2JNB2_STRHJ/4-202.VTSPLQRCQETVQPLLEARP....-------------------------------------------------------
Q8DU48_STRMU/5-191IYSSTQERACDTAEIVSGR......-------------------------------------------------------
D2UBJ8_XANAP/3-199.VASPLSRAQRTACLALGAER....-------------------------------------------------------
Q3A796_PELCD/6-199.FCSPMLRVRETVGH..SKLD....-------------------------------------------------------
D2PPT8_KRIFD/4-202.VTSPLDRCKQTAAAIAKHHP....-------------------------------------------------------
Q220I7_ALBFT/6-199.YSSHLRRAHDTARAISSATG....-------------------------------------------------------
A0R642_MYCS2/5-204.AHSVARRAAQTASGIAGEIG....-------------------------------------------------------
G2KUE1_LACSM/18-218.YASPIKRTRITAEHIKAELNN...-------------------------------------------------------
D8UL08_VOLCA/9-201.YSSDLKRALQTAEAIVAGRPS...-------------------------------------------------------
A6TKP0_ALKMQ/4-198.YASPSSRAFKTAELIKGERK....-------------------------------------------------------
Q6LIL4_PHOPR/8-199VVTSSLQRCSDFAQQTAKQHS....-------------------------------------------------------
A4J5S6_DESRM/6-199.YSSDLSRAMETAEILAKKHQ....-------------------------------------------------------
A5D2P8_PELTS/5-198.YSSDLKRAYETAEYISKYHG....-------------------------------------------------------
D9QVX4_ACEAZ/5-198.YASDLQRAAKTAEIVADQHG....-------------------------------------------------------
D3FA36_CONWI/9-192.LASPLQRARRTAELAGF..D....-------------------------------------------------------
F2N9U4_CORGP/5-198LVSSPLGRARSTAELIRDDLIERGR-------------------------------------------------------
G4L641_TETHN/3-201.YSSPSQRARQTAEGIVQQWQN...-------------------------------------------------------
B8E2M6_DICTD/4-197.YSSPLKRAIETAIPLSKKLN....-------------------------------------------------------
F2F0S7_SOLSS/5-199.YSSTSDRAVKTAEIIKGKRP....-------------------------------------------------------
A4T0I6_POLSQ/6-201LYASDLQRAAQTAQAIEKVFG....-------------------------------------------------------
G2SPT2_LACRR/4-203.YCSPIKRARVTAQKLVSLLDQ...-------------------------------------------------------
E6W2F2_DESIS/10-204CYSSDLQRCHHSLQTMALHG.A...-------------------------------------------------------
Q9X194_THEMA/3-195.YSSPLKRSLETAEEIARRFE....-------------------------------------------------------
G8LUT1_CLOCD/4-197.YCSNLRRAYRTAQIIADKFG....-------------------------------------------------------
C7QH56_CATAD/8-200.VASPLQRAQETAAPIAARHD....-------------------------------------------------------
F8A8I3_THEID/6-196.YTSDLSRAKLPGELLKERKD....-------------------------------------------------------
A0D7F1_PARTE/11-207.YVSDLARTKQTFELIQKHHSK...-------------------------------------------------------
Q22T38_TETTS/22-202INSSDLIRSLDTAYISLAFPE....-------------------------------------------------------
E3IV15_FRASU/3-196.VSSDLQRCRATADQIG........-------------------------------------------------------
Q9SCS3_ARATH/16-210.YSSDLKRAFETAQIIAAKCG....-------------------------------------------------------
Q2RJH0_MOOTA/6-199.FTSDLRRARETAAIIAAPHG....-------------------------------------------------------
Q47IH2_DECAR/12-205.YSSDLKRAWTTALAIGAELG....-------------------------------------------------------
Q113G3_TRIEI/6-202.FASPFLRTVQTANEIAKVLD....-------------------------------------------------------
C7R5L5_JONDD/6-202ILASDLERARDTARVIGDALG....-------------------------------------------------------
F4L0A7_HALH1/4-197.LTSALRRTHQTVQGFIE.MG....-------------------------------------------------------
B1Y6N8_LEPCP/4-197.LASDLARVRATAAPLLAQRG....-------------------------------------------------------
B1Y8E3_LEPCP/9-202.YSSDLLRAHQTAEAVAAAQG....-------------------------------------------------------
E1R062_OLSUV/8-199.WSSPLKRCQAIAREAADRLD....-------------------------------------------------------
C6WAU4_ACTMD/4-201.VTSPLERCGQTLEPLLAERG....-------------------------------------------------------
E3H7F6_ILYPC/4-201.YTSPLQRAYETAEILRGHKD....-------------------------------------------------------
Q5P7P2_AROAE/9-203.YCSDLRRAQQTAAAAGRTLG....-------------------------------------------------------
Q3A802_PELCD/11-203.YCSDLRRCRETARIVAGGRG....-------------------------------------------------------
C7RK71_ACCPU/6-200.YSSDLLRARQTAESIATTLK....-------------------------------------------------------
C4L115_EXISA/4-189.VSSPLSRAVHTAQAIATACGI...-------------------------------------------------------
Q46GR1_PROMT/229-424.FSSSLSRPKETAQIILNEHP....-------------------------------------------------------
C8W3Q4_DESAS/5-198.YSSDLLRAYETAAILAETHS....-------------------------------------------------------
Q03YB7_LEUMM/4-203.YASPIRRARITAINIAKQLKY...-------------------------------------------------------
G4L012_OSCVS/4-198.YSSDLTRTCITAGAIANTKH....-------------------------------------------------------
D1CI13_THET1/4-198.YASPLRRALATAEAVARSQG....-------------------------------------------------------
Q47LB4_THEFY/7-197.YSSPLERARETAEPISAAFG....-------------------------------------------------------
G8QLS4_AZOSU/8-203VYSSDLARARVTAEAIAAHLG....-------------------------------------------------------
H6RJR9_BLASD/4-199.VSSPLERCRQTVGAVVAGRE....-------------------------------------------------------
D1BKR1_SANKS/4-203.VSSPLERCQQTAQHILDRQQG...-------------------------------------------------------
E4N2L1_KITSK/4-203.VSSPLERCRQTLEPLAAARPE...-------------------------------------------------------
F8L9A3_SIMNZ/4-204VYSSPLLRTRKSADIILEVLGS...-------------------------------------------------------
A2SH69_METPP/10-209VLVSGLPRTVQTAQRVLSASGQ...-------------------------------------------------------
A8L509_FRASN/4-197.LTSPLQRAARTAELAGL.......-------------------------------------------------------
G0JM27_9GAMM/6-189.YSSTLRRAHDTARLAGF.......-------------------------------------------------------
E3HZR3_RHOVT/3-207IAAGPLARTREHAEIAAATAGL...-------------------------------------------------------
A8L9X3_FRASN/6-204VYADPRRRVRETAEIIAGRLR....-------------------------------------------------------
Q3ISX8_NATPD/4-201VIASDLHRTEQTAERILDATE....-------------------------------------------------------
C5D2R4_GEOSW/4-198.YASTSGRALETAQLIRGERL....-------------------------------------------------------
A4FA31_SACEN/162-361VIASPLSRTRQTAQAVVDATG....-------------------------------------------------------
D1CEC2_THET1/5-199VFSSPLSRALETAKIIATKFE....-------------------------------------------------------
H0PY04_9RHOO/14-208.YCSDLQRAKQTAAAIARQRK....-------------------------------------------------------
H2ANA8_KAZAF/21-215VFSSDLKRCQETNTEVLRFSGQ...-------------------------------------------------------
Q65LP2_BACLD/4-185.ITSPLRRAKETAEIINQYLG....-------------------------------------------------------
C6XW10_PEDHD/5-199.YTSELKRTHQTVKGFIDA.G....-------------------------------------------------------
G8NTU1_GRAMM/8-195.FVSPRQRARETCEIAGY..G....-------------------------------------------------------
B7KKU2_CYAP7/5-199.FSSPLKRAYYTASPLAQSVG....-------------------------------------------------------
A4FFP0_SACEN/15-212.VASPLQRCQDTVAGLAEKLG....-------------------------------------------------------
D2PUU5_KRIFD/6-202.FSSDLQRAASTAAELAALTG....-------------------------------------------------------
G0VP45_MEGEL/4-198.YSSTLQRAKTTAECVAAPHH....-------------------------------------------------------
H5WTP9_9BURK/4-198.LASDLQRAHRTAELAAAKWK....-------------------------------------------------------
I0HZE4_CALAS/7-199.YSSPLVRCVETARPLAAARN....-------------------------------------------------------
A5UTN8_ROSS1/4-200LYSSDLKRAWETAALLSERLG....-------------------------------------------------------
E9T3E9_COREQ/12-198VVTSPRRRAHVTATLAGL.......-------------------------------------------------------
E6U5E4_ETHHY/4-198.YASPLKRAYKTAQAVDAVRH....-------------------------------------------------------
B0TIL4_HELMI/4-197.FASDLSRAIETARAIAEGHN....-------------------------------------------------------
D7B3J6_NOCDD/7-195.VASDLTRAADTAGYLSRASG....-------------------------------------------------------
E5S5V1_TRISP/288-477VWSSQKIRAVQTAF.FLKDTA....-------------------------------------------------------
A8QBY9_MALGO/432-619VWHSSLRRTAQTA.GFLK.......-------------------------------------------------------
D5X1T7_THIK1/3-197VYTSPMGRCRETGADIAAACG....-------------------------------------------------------
Q2W9Y0_MAGSA/8-200...SGLIRCRQTAGA.LEAGGL...-------------------------------------------------------
A4G1U3_HERAR/4-201.FSSDLKRALGTAQGIAIPRG....-------------------------------------------------------
A0RZ16_CENSY/25-219.YTSPIQRARQTADTVGSANN....-------------------------------------------------------
B1WZ22_CYAA5/5-199.YVSPMKRTIATAKPLCDATG....-------------------------------------------------------
G2I053_GLUMN/23-220WFTSPLSRTQQTAHAIQEAG.Y...-------------------------------------------------------
A4XA48_SALTO/210-405VVSSPLSRCRHTAEAIAAALG....-------------------------------------------------------
C0QQJ5_PERMH/4-196.FSSDLKRAFRTAQIIADVLD....-------------------------------------------------------
F2NE04_DESAR/4-197.YTSPLSRSRDTARAIAQHHY....-------------------------------------------------------
E3CWY7_9BACT/18-211.FTSPLLRARQTADCLAEGRD....-------------------------------------------------------
G7V8B5_THELD/7-201.YASPLSRALKTAQIISEVNVN...-------------------------------------------------------
F6EE93_AMYSD/5-202.VSSIALRAQQTADPLSRTLG....-------------------------------------------------------
G0HE54_CORVD/27-224IYSSPLLRARQTAESAAEALD....-------------------------------------------------------
D7CTF2_TRURR/4-192.YCSDLRRAVQTAELALP..G....-------------------------------------------------------
C4XRN5_DESMR/4-195.VSSDLSRCRETAAIVLGGRD....-------------------------------------------------------
D5DCI5_BACMD/2-191.YTSDLLRAQETAREIAAAAK....-------------------------------------------------------
F8L7X0_SIMNZ/6-189.FTSPLKRAYDTC..CLCGLK....-------------------------------------------------------
C6WJD9_ACTMD/6-206VYVSPYTRTRSTLRLLGLGAL....-------------------------------------------------------
Q01QD4_SOLUE/4-187.LVSPRQRALDTCRLAGYE......-------------------------------------------------------
O67630_AQUAE/21-213.ITSPQRRAYKTALTLSDVLG....-------------------------------------------------------
D3E7U3_GEOS4/4-184.LSSPYQRAKDTVQPLADALG....-------------------------------------------------------
F5WRW0_ERYRF/5-198.IVSTSERAQETAALVFPQ......-------------------------------------------------------
Q0BPI2_GRABC/16-203LFLSPELRVWQTAEVLRLPER....-------------------------------------------------------
Q8DV19_STRMU/3-202.YSSDLKRAKLTSQIINQENKH...-------------------------------------------------------
C6WJ12_ACTMD/7-195ALCSPRERSWRTAELVG........-------------------------------------------------------
I0JQ97_HALH3/4-186.YTSPLKRAAQTAQIISNRLG....-------------------------------------------------------
Q890L1_CLOTE/7-201.YSSPLGRAIKTAKIVRGERD....-------------------------------------------------------
A4G6G7_HERAR/9-205VIVSNLPRTIESALRVLAETGQ...-------------------------------------------------------
Q67MI2_SYMTH/5-185.YSSDLARARATAEAICRLTG....-------------------------------------------------------
B0RD00_CLAMS/47-237.LASPRSRAQRTAELIGYG......-------------------------------------------------------
B7GKQ4_ANOFW/31-225.YCSPSDRTKETAQIVLGQRH....-------------------------------------------------------
B8EKJ6_METSB/5-199.FSSDLKRAYDTAVPAGRALG....-------------------------------------------------------
I0K575_9BACT/6-202.YTSTLIRTYQTVESFIE.LG....-------------------------------------------------------
F9ZSH9_ACICS/8-193IYTSPLKRARHTA..ILAGF.....-------------------------------------------------------
F4GUJ2_PUSST/6-198VVSSDLGRAYDTALAAAGHFQ....-------------------------------------------------------
E6TZD4_BACCJ/4-202.HSSTSQRAFHTAQLISSKNK....-------------------------------------------------------
A3QAT5_SHELP/6-198VISSPLKRCRVFAEHLTAKNQ....-------------------------------------------------------
F0YIY5_AURAN/82-285VFASPMKRAVFGARRCAEACG....-------------------------------------------------------
A8LFW3_FRASN/5-200VYVSSRRRARETAELATGGLG....-------------------------------------------------------
F4CMY4_PSEUX/3-194.YSSTMTRAVQTLAPLAAALG....-------------------------------------------------------
Q6FKJ4_CANGA/19-215VVSSDLIRCRQTTEAFLSEMDCD.L-------------------------------------------------------
Q5WIH4_BACSK/3-196.YTSDLTRAANTAQAISEETQ....-------------------------------------------------------
A0LTB5_ACIC1/211-404.VSSPRQRCRQTAELIADVLQ....-------------------------------------------------------
F4PSW8_DICFS/370-558VWTSTFKRAIRTAQYIS........-------------------------------------------------------
G0VB21_NAUCC/21-215VASSDLKRCKETTDTLLNFAKMT..-------------------------------------------------------
Q5FS21_GLUOX/26-223WYSSPLQRAQDTAAEIRKAGAF...-------------------------------------------------------
F4B9W0_ACIHW/4-190.FTSPILRAYQTATIIANELG....-------------------------------------------------------
D1C2P1_SPHTD/5-200.YSSPLQRARATAETIGRRLS....-------------------------------------------------------
A9HYX7_BORPD/4-199LYSSDLRRAYATAEPLSAGLG....-------------------------------------------------------
D9R017_CLOSW/3-192.YSSHLIRAVETAGEANRYWN....-------------------------------------------------------
Q7NT51_CHRVO/8-202.YVSDLIRTRQTSAPLQTRLQ....-------------------------------------------------------
D7CND1_SYNLT/3-196.YSSDLSRAYQTACIIAQPHG....-------------------------------------------------------
F8EAH6_RUNSL/6-202.YTSKLIRTVQSVRGFLD.KG....-------------------------------------------------------
H8L495_FRAAD/3-195.HSSPLGRAMDTARHAAEGLG....-------------------------------------------------------
F4C717_SPHS2/5-199.YTSTLIRTHQTVANFIN.QG....-------------------------------------------------------
F4A2A2_MAHA5/4-197.FCSDLERARETAEIIGEKID....-------------------------------------------------------
A6TRG4_ALKMQ/4-197.YSSNLNRAKSTAMIIKEQLG....-------------------------------------------------------
E3LC61_PUCGT/216-403VWTSTLKRTIQTARDLP........-------------------------------------------------------
A0LHV7_SYNFM/386-579.FCSDLARSRETAAIIARPHG....-------------------------------------------------------
D7FIE0_ECTSI/94-289.LCSPLRRARETAGIVRESHPL...-------------------------------------------------------
B9S8J7_RICCO/19-213.YSSDLKRALVTAEIIAASCG....-------------------------------------------------------
F0RNH1_DEIPM/22-219.YSSDLERARVTAQELAAALDG...-------------------------------------------------------
A9TAW0_PHYPA/4-197IYSSDLKRALDTAQAIADKCQ....-------------------------------------------------------
A8FBP0_BACP2/4-185.ISSPLTRAKETAHLILKHVD....-------------------------------------------------------
C1CYM6_DEIDV/6-197.DSSDLQRAVQTAQLALPGQG....-------------------------------------------------------
E8V8F6_TERSS/7-190.LTSPRQRAQETCKLAG..MG....-------------------------------------------------------
Q8YXV2_NOSS1/5-199.FSSPMQRTMDTAKPLSEAIG....-------------------------------------------------------
H1YC42_9SPHI/6-200.YISCLKRTEQTVHEFIE.AG....-------------------------------------------------------
D0NUL9_PHYIT/63-266FIVSPYVRTIETFCGILKAWGFE.G-------------------------------------------------------
H6RPL7_BLASD/7-199.VSSPLERAQQTARPLAKAFG....-------------------------------------------------------
E3PRT5_CLOSD/4-195.YSSDLKRAYETAKIIKPS......-------------------------------------------------------
F4CPL7_PSEUX/29-222VLTSPLRRTRQTAQAVADATG....-------------------------------------------------------
E3GIM0_EUBLK/4-197.YCTPLQRTRQTAEGLRGDKD....-------------------------------------------------------
F2RLZ2_STRVP/28-222.LTSPLRRARHTAELAGL.......-------------------------------------------------------
A1AP89_PELPD/13-205.YCSDLCRSHETACIIAEGRN....-------------------------------------------------------
A0D5U7_PARTE/23-205VYTSDLRRAKETAQISLG.FPH...-------------------------------------------------------
D7CRA3_TRURR/4-190VYSSPLVRALQTAELAFPG......-------------------------------------------------------
F0S1R0_DESTD/4-200.YSSPLSRCKDTALEIAKHHN....-------------------------------------------------------
A6LX68_CLOB8/5-196.YSSPIERALVTANIIKGEKK....-------------------------------------------------------
A1SI90_NOCSJ/187-388VLSSPVRRTRESAELVAERLG....-------------------------------------------------------
C1DZ31_MICSR/6-219VASSDLSRASETAYRVADALNM...-------------------------------------------------------
A1K9A9_AZOSB/15-209.YASDLTRALQTAAPAARDLG....-------------------------------------------------------
F0RK66_DEIPM/8-205ILSSDLPRAVQTAQAVQAEVG....-------------------------------------------------------
H2J7Y6_MARPK/3-195.YASPLSRAYNTALEISKNIN....-------------------------------------------------------
D3SL81_THEAH/4-197.YSSPLRRTYLTALEIAKGRD....-------------------------------------------------------
I0H0L2_ACTM4/169-364VLSSPLSRCVRTAEHIAAQVG....-------------------------------------------------------
D2PWV1_KRIFD/7-199.VSSPLERAQETMEPIARTFG....-------------------------------------------------------
H8KQQ2_SOLCM/26-220.YTSTLKRTHQTMHPFIEG.G....-------------------------------------------------------
D4M9J9_9BACT/3-199.LASPLSRARVTGERIFDAAD....-------------------------------------------------------
D6GQ74_FILAD/4-199.YCSPSQRTIETMRLMKGELE....-------------------------------------------------------
C6D8K0_PAESJ/4-200LYSSDLLRSSQTAEIIGGLLG....-------------------------------------------------------
YQGD_SCHPO/56-250.YSSPQKRAKRTAEEITKVAN....-------------------------------------------------------
Q6CU83_KLULA/19-210IYSSDLKRCQQTINTALEHFNT...-------------------------------------------------------
H5WQ77_9BURK/7-200.YASDLSRAMDTALALARPLG....-------------------------------------------------------
D8K089_DEHLB/3-197.YSSTLQRGRDTADIVSRLHS....-------------------------------------------------------
Q752M0_ASHGO/19-204VVCSDLRRCRETIAQVLAHHAG...-------------------------------------------------------
A5GRZ9_SYNR3/7-190.WVSPLQRARRTCELA..GLG....-------------------------------------------------------
G8PCV9_PEDCP/4-209.YTSPLRRARITGRTLQHELEVIQG-------------------------------------------------------
C5AAI7_BURGB/12-209VITSGLHRTVETAALVLAQTGQ...-------------------------------------------------------
A6LYX0_CLOB8/6-201.YSSESKRAYDTAKIIQHNRN....-------------------------------------------------------
G8PKK2_PSEUV/5-200IFTSDLKRASQTSEWIAARTG....-------------------------------------------------------
G0HCC2_CORVD/15-213.VSSDLERAVDTAAALAGALFA...-------------------------------------------------------
D1B6G9_THEAS/4-191.VSSPMVRCTATARLAG........-------------------------------------------------------
A9WMJ6_RENSM/7-207VYVSPYLRAYQTLEALNLGNL....-------------------------------------------------------
D7CRM6_TRURR/14-202.FTSDLARARETARLALPG......-------------------------------------------------------
E1VYH9_ARTAR/6-206LVASPLVRAQQTAAPASKALG....-------------------------------------------------------
A3I0N5_9BACT/6-199.YHTALIRTQQSIQSFLD.LG....-------------------------------------------------------
F5XXJ6_RAMTT/6-200.YTSDLERAQATARSIAAAFG....-------------------------------------------------------
E4TVK9_MARTH/5-199.YISNLKRTQESVQGFID.KG....-------------------------------------------------------
D7CTF3_TRURR/6-194.YASDLARARYTARLALPA......-------------------------------------------------------
A8NEW8_COPC7/6-200.FSSDLKRAKMTAERILKNKP....-------------------------------------------------------
C9LWB8_SELS3/4-197.YSSDLQRAASTAGFIAERFG....-------------------------------------------------------
A2SCK3_METPP/9-202.YASDLARAHDTALAIGAAAG....-------------------------------------------------------
I0I391_CALAS/7-202IYVSPLPRARSTAAAIAAALG....-------------------------------------------------------
D7GDV6_PROFC/6-200.WASPLERALDTARAVASFTG....-------------------------------------------------------
F0SCC4_PEDSD/9-205.YTSKLKRTHQTVRDFLA.IP....-------------------------------------------------------
Q82HM5_STRAW/9-190.HHGPLPRAAQTARLIGDRLK....-------------------------------------------------------
F5YTK7_MYCSD/3-188.VSSPQRRAVQTAEPLARRRA....-------------------------------------------------------
A9B597_HERA2/3-196.YASDIARAWETATIIGEQIG....-------------------------------------------------------
F8C410_THEGP/11-201.FSSPLQRAFFPAKILSERKK....-------------------------------------------------------
E8U708_DEIML/12-204.HCSDLQRAVRTANLALP..G....-------------------------------------------------------
A1RBG3_ARTAT/3-197.YTSTLLRTHRTVAPLARATG....-------------------------------------------------------
B4U6G2_HYDS0/4-195.YSSFQKRALKTAIFLSKALN....-------------------------------------------------------
A9GMF5_SORC5/6-203VYSSPLSRALETARIAAGAWG....-------------------------------------------------------
A0C4I4_PARTE/221-414MITSTMQRALRTSNEVCELLG....-------------------------------------------------------
Q8RA82_THETN/5-198.YSSDLKRAYTTAEIISKEIN....-------------------------------------------------------
D3SNK7_THEAH/4-196.YTSPQRRAYKTALTISDILQ....-------------------------------------------------------
E3PXR0_CLOSD/4-193.YSSPLERATLTGNSFS........-------------------------------------------------------
C7MXW3_SACVD/6-193VLSSPRRAALRTAELAGL.......-------------------------------------------------------
F2UB54_SALR5/10-206.YSSDLKRAHDTARHITDIHPTF..-------------------------------------------------------
G8LZ21_CLOCD/5-199.YSSSLKRTIQTAQYIADIKG....-------------------------------------------------------
F5Z355_MYCSD/10-196.ASSDLARAQQTAAPTAEKLG....-------------------------------------------------------
A9KNM7_CLOPH/3-193.YTSDLLRARETAEIAKIYLG....-------------------------------------------------------
D5UTB9_TSUPD/21-219.ISSDLRRARDTAEALSVATG....-------------------------------------------------------
D3QBR8_STANL/4-188.WCSPMRRARHTAALAGL.......-------------------------------------------------------
E4RUN0_LEAB4/6-202.YISTLKRTYQTAYGFID.AG....-------------------------------------------------------
PSPA_HYDTT/4-197.YSSPLKRTYLTALEIAEAKN....-------------------------------------------------------
A1TUY5_ACIAC/7-200.YASDLRRAHATAQAVADATG....-------------------------------------------------------
A3DDB3_CLOTH/4-198.YSSALKRAYTTAEIINRKLS....-------------------------------------------------------
A3DE01_CLOTH/7-201.YSSSLKRTLQTAQYIADVKN....-------------------------------------------------------
A4XKT7_CALS8/6-197.YSSPLKRAFYTASKIAEGRD....-------------------------------------------------------
A5N4L6_CLOK5/4-199.YSSPLERAVKTSRIVAAQRN....-------------------------------------------------------
A8AW93_STRGC/3-202.FSSDLSRAVKTAEIINSENQF...-------------------------------------------------------
A9BUH9_DELAS/6-199.YSSDLLRAYVTAEAVAASTG....-------------------------------------------------------
A9WDJ8_CHLAA/4-198.YSSDLARAYQTAWEIGAALR....-------------------------------------------------------
A9WI66_CHLAA/3-196.YSSDLPRAWETAEIIGSHVN....-------------------------------------------------------
B2GB95_LACF3/4-204.YTSPLKRARQTAEELIAQLPT...-------------------------------------------------------
B2TR14_CLOBB/4-195.YASPIKRALDTAKIISEPNN....-------------------------------------------------------
B4EET0_BURCJ/6-203.YSSDLMRAQQTAQPFADALG....-------------------------------------------------------
B7J3Q1_ACIF2/6-188.YSSPMLRAHHTAILAGF.......-------------------------------------------------------
B7K5Q7_CYAP8/5-197.YCSPFKRTMATAQPLCDRLG....-------------------------------------------------------
B7K5Q8_CYAP8/5-198.YVSPLRRTIQTATPLCEAVG....-------------------------------------------------------
C1A1J7_RHOE4/16-207.VSSDLRRAYFTAVAVGDAAG....-------------------------------------------------------
C4M5P9_ENTHI/4-193.YSSPLHRALITAQKIAG..D....-------------------------------------------------------
C8WXI8_ALIAD/3-178.YSSDLERALETARRVSRTTG....-------------------------------------------------------
D0J8B8_COMT2/6-200.YSSDLQRAHVTAQAIAQRSG....-------------------------------------------------------
D0MFF3_RHOM4/6-203.YASPLRRALETAEAVRRYHP....-------------------------------------------------------
PSPB_HYDTT/4-194.YSSPQRRAYKTALTISDMLG....-------------------------------------------------------
D3EF23_GEOS4/3-199IICSDLQRACQTAAIIADKLS....-------------------------------------------------------
D4ZU25_ARTPN/5-201.FSSPFLRTVQTAEAIAKILD....-------------------------------------------------------
D4ZY14_ARTPN/5-199.FASPFLRTVATAHAVAEVLD....-------------------------------------------------------
D5X3R0_THIK1/11-204.YASDLQRAWQTAEAIAAPHG....-------------------------------------------------------
D9QBM8_CORP2/186-379.VASPLKRCQETAAAVARSLR....-------------------------------------------------------
D9TCE6_MICAI/4-187.LSSPRQRATRTAALAGLTVD....-------------------------------------------------------
E2Q1Y3_STRC2/296-492.VSSPLRRCRQTAEAVAARLG....-------------------------------------------------------
E3HNV8_ACHXA/4-200.YSSDLQRAHATAVPVSEQLG....-------------------------------------------------------
E9T6R4_COREQ/181-372.VSSPLGRARETAAAAAEALG....-------------------------------------------------------
E9T8C0_COREQ/5-201.VSSQALRARETAGFVETESG....-------------------------------------------------------
F3Z543_9ACTO/9-196VRTSPLARAAETCEVAG..FG....-------------------------------------------------------
F3ZAP6_9ACTO/8-184.HHGPLPRAAETARIVGERAG....-------------------------------------------------------
F6B5X8_DESCC/5-197.YSSDLARARETAEILANPHN....-------------------------------------------------------
F9UQA5_LACPL/4-204.YVSPLKRARDTAMTLRNDLTQ...-------------------------------------------------------
G2J5B1_PSEUL/9-203.YCSDLVRTRQTAAPIGQATG....-------------------------------------------------------
H0UKK7_9BACT/8-199.FTSPLSRATETAVLASGRSV....-------------------------------------------------------
H6MTJ9_GORPV/7-199.VSSPLDRARQTAQAITDLVG....-------------------------------------------------------
I2BB94_SHIBC/3-198.LSSELTRAGHTARLALAGRD....-------------------------------------------------------
J3MTT3_ORYBR/86-279.YSSDLKRAAETAEIIAKACN....-------------------------------------------------------
J9RE89_9ACTO/4-200.LSSRALRARQTAELIGSVWD....-------------------------------------------------------
K0I0L2_9BURK/7-205LICSDLIRTQQTATPSLKVLFPQ..-------------------------------------------------------
M9X0U0_PASHA/5-206.YSSMQKRAQDTANYILAENER...-------------------------------------------------------
PHOE_BACSU/4-184.VTSPLKRAKRTAEIINEYLH....-------------------------------------------------------
COBC_SALTY/3-195.LCSELERARHTARLVLEGRD....-------------------------------------------------------
P73454_SYNY3/5-196.YVSPLQRARQTVQPLCDRLG....-------------------------------------------------------
Q142E5_BURXL/12-206.IVSGLPRTVETARRVLAETGQ...-------------------------------------------------------
Q1D982_MYXXD/5-197.YCSDLGRAQETARRIAIRTG....-------------------------------------------------------
Q1GAS0_LACDA/3-202.YASPLDRARMTAQGLIGAAGI...-------------------------------------------------------
Q2S2V8_SALRD/16-213.YASTLRRATQTADILATGHD....-------------------------------------------------------
Q31LG1_SYNE7/5-198.YVSPMLRAQETAQPLCQQAK....-------------------------------------------------------
Q3Z6L9_DEHM1/5-197.YSSPLSRAKVTAEVIALEHS....-------------------------------------------------------
Q53WE2_THET8/5-190.VHTGLRRTEETLALVLEGRA....-------------------------------------------------------
Q55734_SYNY3/5-198.FASPLHRTMATATPLSKLIN....-------------------------------------------------------
Q5KZY5_GEOKA/9-198.YTSTSGRALETAEIVRGGRL....-------------------------------------------------------
Q5M513_STRT2/3-202.LSSDLPRAKKTTELIMESQKT...-------------------------------------------------------
Q5SM93_THET8/17-207.YAADSLAEAEAARLFAEALG....-------------------------------------------------------
Q63WA7_BURPS/3-184VWSSPLARCADVARALAGGVR....-------------------------------------------------------
Q65KU1_BACLD/4-191.YSSPSGRAVDSARAMLQNRS....-------------------------------------------------------
Q6AAY7_PROAC/7-194.VSSPLERARETMAPIAALHP....-------------------------------------------------------
Q6MWZ7_MYCTU/8-191VICSPRRRTLDTAKLAGLT......-------------------------------------------------------
Q6NG55_CORDI/177-370.VASPLQRCQQTAHEVSEQLG....-------------------------------------------------------
Q74JW8_LACJO/3-202.YSSPLQRALTTAVMLRDDMGI...-------------------------------------------------------
Q7V6P3_PROMM/6-190.LSSPLQRAIRTCALAE..LE....-------------------------------------------------------
Q819N7_BACCR/4-184.ISSPLIRAQETANEIAKTVG....-------------------------------------------------------
Q81RH1_BACAN/3-190.WASTLKRARETGETLAEGIG....-------------------------------------------------------
Q8FNL1_COREF/236-428.VSSPLRRCVQTAGAAADQMG....-------------------------------------------------------
Q8NT72_CORGL/6-197.AASPLQRVQETSEPFIKVTG....-------------------------------------------------------
Q8RFA7_FUSNN/3-199.YSTSLKRANDTANYIKGNRK....-------------------------------------------------------
Q8XP82_CLOPE/3-199.FTSPIKRAKRTAYLIKGDKD....-------------------------------------------------------
Q8Y237_RALSO/17-210.YASDLSRARETAQALAGEVG....-------------------------------------------------------
Q8YA91_LISMO/8-204.YTSTSKRTQDTAAYILGDRE....-------------------------------------------------------
GPMB_YERPE/4-194.ISSDLGRTQQTAKIIADACG....-------------------------------------------------------
Q97ET5_CLOAB/5-198.YASPLKRAFNTAKLIASTKG....-------------------------------------------------------
Q9PC95_XYLFA/3-198.VASPLVRAQYTAQLALGESR....-------------------------------------------------------
Q9RKV8_STRCO/4-195.FVSPFQRARETAELIGL.......-------------------------------------------------------
R5J9E3_9FIRM/5-197.YCSDLGRAIQTAEIVGQNLG....-------------------------------------------------------
R5RIR8_9FIRM/3-193.YSSPIERAKATSEILFD.......-------------------------------------------------------
R5T6S4_9FIRM/4-197.VSGPLSRAFDTCRFITEYHH....-------------------------------------------------------
R5TTE8_9CLOT/3-188.FSSTLMRAVETARMIGDRQH....-------------------------------------------------------
R5XAL3_9CLOT/4-198.YTTTSSRTKETVKNLANINS....-------------------------------------------------------
R5XCV5_9CLOT/5-198.YSSDLGRAYQTAEIIGNKLN....-------------------------------------------------------
R6G925_9FIRM/3-196.VASPLVRAYNTAQIIIEERK....-------------------------------------------------------
R6JTD2_9CLOT/3-186.YSSNLLRAVETAQAANLYWN....-------------------------------------------------------
R6ULZ9_9FIRM/4-196.YSSTSERAYDTACYIRGKRN....-------------------------------------------------------
R7FT81_9FIRM/32-228.ISSPLSRAHETARIILYGKD....-------------------------------------------------------
R7G8S3_9FIRM/4-195.YTSTSERAYDTACYALGKRN....-------------------------------------------------------
U4KIP7_9VIBR/4-197.LSSPSGRTVHTANILTGLPK....-------------------------------------------------------
U5L4S7_9BACI/4-197.ISSPSSRTIQTAEKLAGSST....-------------------------------------------------------
U5L644_9BACI/4-196.WASTLKRAYETAVITADRVG....-------------------------------------------------------
U5LDT0_9BACI/4-184.ISSPLQRARQTAEIINQNIQ....-------------------------------------------------------
V6K5U9_STRNV/6-198.YTGPRIRLVQTGEIIAQTLQ....-------------------------------------------------------
W0E7D0_9FIRM/4-193.YSSDLPRAIATADEIRKMLN....-------------------------------------------------------

PF00328

PHYA_ASPFU/71-425......GVCTKFEA.....................SQLGDEVAANFTALFAP-DIR........ARAEKH..........
VIP1_CAEEL/363-914NPNGLRAITAAMEF..................IKNPRKMCHEIAGYVEKMCG-VIV.........EYSQTRPT.......
Q22525_CAEEL/28-375......NYCPLQDT.................IWNLAKTTDTVSNYFNSSAVT-SLM........GNLTNY..........
Q6BUR8_DEBHA/63-396.......ACSAWDS......................EENKSILSQYSNEYLH-NAL........KRLLKL..........
VIP1_HUMAN/390-910......DQLAPTRSTSLL.........NSMTIIQNPVKVCDQVFALIENLTH-QIR........ERMQDPRSV.......
PPAX_CAEEL/28-365......CNCRRFQE.....................LQEKWAELDEVKNATVA-MIAL......NRRVAAF..........
Q6BWV9_DEBHA/521-1079......EAPPQFTWPPK...........MPQPFVVIKRVCQLMNYHQQIMDY-NFE.......KHNVDEFQK........
VIP2_HUMAN/379-894......EKLTPSGSISLI.........KSMHLIKNPVKTCDKVYSLIQSLTS-QIR........HRMEDPKSS.......
VIP1_DROME/402-926...INPCNSKSITQAL..............DFVKNPVDCCHHVHLLIRELLH-IIS........IKKDDP..........
PHYB_EMENI/70-422......STCVSFEN.....................DERADEIEANFTAIMGP-PIR........KRLEND..........
Q7SEH2_NEUCR/194-548......MNCPNERE.....................DGLGSAARDIWVGHYLQ-NAT........ERFSKL..........
ACPL2_DANRE/88-449......CDCPARNR.................YLDQEQRRQYRQRIADAELER-TYV.........TMAKT..........
PPA_ECOLI/29-375...ADFTGHRQTAFRE.............LERVLNFPQSNLCLKREKQDESC-SLT........QALPSEL.........
Q6BM75_DEBHA/63-397.......GCKKFES..................DPHTDYVDGFSDQYLKDALT-RFQ........KSNPNL..........
Q6CZF4_PECAS/34-372......DLDLAYQRLK..............PSIEQLKQIVCGEDKPCPVFDK-PWA..........LKQD..........
VIP1_YEAST/538-1047......EAPPQFAWPSK...........MPEPYLVIKRVVELMNYHKKIMDN-NFA.......KKDVNSMQT........
Q6FJ21_CANGA/510-1016......ETPPQFAWPAK...........MPEPYLVIKRVVELMNYHKKIMDH-NFETK....DVSKLQER..........
Q6CYI2_KLULA/67-401.......SCVSYNG..................DLGDEYFENVTLSYLTDIKN-RWM........KKNSNL..........
Q6CWN2_KLULA/534-1048......EAPPQFAWPAK...........MPEPYLVIKRVVDLMNYHKKIMDH-NFA.......TKNVEEMQT........
Q6CES1_YARLI/413-907......PPPPHFTWPDK...........IPEPFIVLQRVVELMKYHHKVMER-NFNNH....TPEEVEAFQT........
Q6AVJ1_ORYSJ/361-950...KNTNEPVEFPWMVDGAGLPANASQLLPKMAKLTKEVTAQVKLLAEDEDE-KLALTNSFSRYDQAKAFGKTTIDV...
Q9AAQ4_CAUCR/24-359......VGGDLTAWSA..............SHNQEAEQLDALLMQCDKGPCP-PAPG......KRRVFDA..........
Q19175_CAEEL/28-376......CICPRREW.................LWNIAQQSDEMKNWRSSVPVS-SVI........DKLTSL..........
Q6CLW3_KLULA/69-406.......SCKNYNS..................EFAKQVLGSVNDSQLKKIRE-RLM........KKNSQL..........
PHO11_CAEEL/25-364......CPCTRYDL.....................LQGQMLTLPEVLPKYTQ-VVLL......NRRVGGY..........
PPA4_SCHPO/25-385......NNCPRLVQ...................LYEEFAERAAKLYDPLLAG-RAS........EMMSQF..........
PPA1_SCHPO/59-395......NACPASDA.....................DDFTTPALEAWRNVYMP-PIR........QRLNPY..........
PHYA_ASPOR/71-426......SLCTAFEN.....................STTGDDAEDKFTAVFTP-SIV........ERLEKD..........
Q6CCS5_YARLI/180-538......FSCKNAYN..................NPKSVSGKQKEAEWIDNYLN-KAS........LRFQEL..........
Q19076_CAEEL/26-371......STCPFKDQ.................VWELAKTSDEVKSFVNSADVQ-AVL........GNLTNY..........
Q84TX6_ORYSJ/68-441......DSCETYKD....................YRKRKEPDVEKQKEPILE-HVT........SALVNR..........
Q84WW3_ARATH/362-953...VHDHVSSELPWMTDGAGLPPHADEHLPELVKLAKKVTEQVRLLAQDEHE-NLAEPSAYDVVPPYDQAKALGKSNIDV
PPA2_SCHPO/59-405.......SCPVYED.................NNIDENTTEAAHTSWRNVFLK-PIA........NRLNKY..........
VIP1_SCHPO/387-861......TARKEFTWPEN...........MPKPCEVMQQVVQLMKYHRAVMRE-NFII.....LGPEVEQVQS........
PPA3_SCHPO/59-405.......ACPVFKD.................NNFHKNATDAAHAVWRNIFIE-PIV........NRLAKY..........
A6T657_KLEP7/32-357......GDLAQRRQAL.............APTIQLLKQAVCQADKSCPIFDT-PWQ..........VEQS..........
C4QZN1_PICPG/75-409......ISCPNYNS...................HIYKD.....GDFPNDIAE-REA........DRLNTL..........
E2RTX6_GIAIC/15-344.......DCPSMDK..................AKKYFSRDPDYVQLLELHQE-SQQ.........RLSRL..........
F1RD51_DANRE/72-409......DHCEKFVEGVE............NNKTALKEVQRFKSSSEMDSVRR-KIS........SRLQIP..........
G2QKZ0_THIHA/65-455......DLCTAFEE..................GPYSTIGDDAQDTYLSTFAG-PIT........ARVNAN..........
G3Y8Z5_ASPNA/73-427......GTCTVFED.....................SELADDIEANFTATFVP-SIR........QRLEND..........
G7XM48_ASPKW/72-404......PTCDTD......................NDQTTCDNLTYQLPQFKV-AAA.........RLNSQ..........
S8B7A5_PENO1/144-500......NTCAAFEA.....................DKLGDQVSAKYTALIAP-PMA........QRLHHD..........

PF00300

D7B452_NOCDD/4-197----------------------------------.DLEP.VGDERWNEYDHL.GLL------------------------
D6S4F7_9LACO/3-204----------------------------------.SLPV.RVEERLREFNLG.NLE------------------------
C6VSA5_DYAFD/6-202----------------------------------..IPH.ESYAGLNEISWG.DRE------------------------
A6W5M7_KINRD/8-200----------------------------------..LPL.GTEPRIIE..AGNRFE------------------------
Q9K466_STRCO/9-189----------------------------------......GVTPRVSE.AAG.DYV------------------------
H2TRY4_TAKRU/250-436----------------------------------..GVY.EQWKVLNELDAG.LCE------------------------
Q81XN0_BACAN/4-182----------------------------------..LSI.QEDERLAERILS.DVP------------------------
A1VJK7_POLNA/7-200----------------------------------..LPV.TPETGLRERCFG.DFE------------------------
D4MTA4_9FIRM/3-194----------------------------------..LSV.IAEEGLREVDFG.FWE------------------------
A9KSK5_CLOPH/3-194----------------------------------..VPI.ELREGLMEFNNG.KLA------------------------
G2TLP8_BACCO/4-199----------------------------------..LEI.HQDPRLVETDFG.AWE------------------------
H8GZF0_DEIGI/4-198----------------------------------..VGL.TVLDGLQEMEVG.DWA------------------------
H6L710_SAPGL/6-200----------------------------------..QDI.WHWPELDEVSWG.IFE------------------------
Q08XQ0_STIAD/8-191----------------------------------..GAA.KLRPELMEWDYG.AYE------------------------
Q82M88_STRAW/4-196----------------------------------..TGA.VTDPDLHEWDYG.GYE------------------------
E2BWS4_HARSA/250-436----------------------------------..APQ.ERWKALNEIDAG.ICE------------------------
D3E804_GEOS4/7-201----------------------------------..VQI.TACDKFREINLG.VWE------------------------
Q039P6_LACC3/4-205----------------------------------.SIPL.TIMPALREFNLG.KME------------------------
A9WBR5_CHLAA/16-207----------------------------------..LPL.RIVEQIGEVRYG.DWE------------------------
B1VGF0_CORU7/234-430----------------------------------GKDAI.TTDEAIIEMDFG.AWE------------------------
F8DZM7_CORRG/181-377----------------------------------GDGAV.EVDERLIEMDFG.HWE------------------------
D7WEF3_9CORY/183-379----------------------------------PAEKI.ETVEGFREVDFG.SFE------------------------
E2Q4K4_STRC2/5-194----------------------------------..ERA.TSWDALMEWDYG.AYE------------------------
C3AWM6_BACMY/4-187----------------------------------.NIEI.HLDPRLREVSGG.QIE------------------------
D2SCU2_GEOOG/12-204----------------------------------..VPL.RLDPRLREVDMG.SWE------------------------
D5G4W9_TUBMM/6-203----------------------------------SGVKM.ELLAELQESSEMPCDT------------------------
F5XRM5_MICPN/4-203----------------------------------.PVPN.SIESRLTECGYG.DWT------------------------
Q0TY40_PHANO/251-439----------------------------------..FEK.LEWKALDELDSG.VCD------------------------
C6WMA8_ACTMD/193-386----------------------------------..LEV.DVREDLIEVDFG.EWE------------------------
G0G0W4_AMYMS/3-201----------------------------------.CERL.VQEPRLREQDWG.NLQ------------------------
A7MRJ7_CROS8/43-238----------------------------------..CPL.SVEPLLREQAFG.DYE------------------------
C0ZX17_RHOE4/16-202----------------------------------..PEE.RTWDALSEWDYG.DYE------------------------
D7E1I0_NOSA0/5-202----------------------------------..LPI.KLETGLSEWLNP.EWM------------------------
H8MW52_CORCM/8-191----------------------------------..DVA.QKKNDLMELDYG.DYE------------------------
F3Z271_DESAF/7-196----------------------------------..REI.TTVPELREICLG.DWE------------------------
G2NEA0_9ACTO/5-193----------------------------------..DRA.TPWDALMEWDYG.DYE------------------------
Q1CZG8_MYXXD/11-196----------------------------------..DYA.QLREDLMEWDYG.DYE------------------------
D3E7L5_GEOS4/3-187----------------------------------.IPLA.PPDNRLRERKYG.QVE------------------------
F6CII3_DESK7/6-199----------------------------------..LAV.TPLPGLIEICHG.EWE------------------------
H2K063_STRHJ/266-462----------------------------------..LDV.TLDDGLRETDFG.AWE------------------------
B1HXM2_LYSSC/4-198----------------------------------..LPV.YYEDNLREICLG.NWQ------------------------
E0UC66_CYAP2/32-226----------------------------------..LPI.KLEAGLSEWLNP.AWM------------------------
E1F6I1_GIAIA/6-200----------------------------------.QARF.EEEPLVCDISWG.DWE------------------------
Q8ETC4_OCEIH/4-185----------------------------------..LPI.IEMEEFKERSYG.DAE------------------------
B0JTX1_MICAN/5-201----------------------------------..LKL.EIRQGLQEIGYG.LWE------------------------
D7LXF7_ARALL/27-219----------------------------------.CPEV.IEVPDLKERHVG.SLQ------------------------
D3FUL6_BACPE/3-195----------------------------------..LTV.HKWEKVREVNLG.PFQ------------------------
D2B5L7_STRRD/253-447----------------------------------..LEV.VVEEGLREADFG.DWE------------------------
C4ZPB7_THASP/15-211----------------------------------..LAA.THDARLRERHYG.VLQ------------------------
B2A0N3_NATTJ/4-199----------------------------------..IDL.IPKDNLREINLG.DWE------------------------
Q11U91_CYTH3/15-208----------------------------------..IPH.FIRPGLNEISWG.EMD------------------------
B9DS14_STRU0/3-188----------------------------------..QEV.LQLKGLKEMDFG.RFE------------------------
G8LVK0_CLOCD/3-197----------------------------------..TKI.VLVESLKEMGFG.VWE------------------------
Q2GMW9_CHAGB/228-418----------------------------------..YNQ.LQWKALDELDAG.VCD------------------------
F6EEJ9_AMYSD/159-353----------------------------------..VDV.HVQDGFIETDFG.EWE------------------------
E3KVQ6_PUCGT/3-193----------------------------------.PPSL.KTDPRLRERFLG.DLE------------------------
Q1IXX4_DEIGD/21-217----------------------------------.HPPV.HPDPGLREIDVG.QLS------------------------
E3DP32_HALPG/5-198----------------------------------..LDV.QEDINIREMNFG.DWE------------------------
D9SXD1_CLOC7/4-198----------------------------------..IKI.IENDNLREMNLD.RME------------------------
D7GCX1_PROFC/7-200----------------------------------..LAV.TTDDRLQEINVG.QWS------------------------
C7PMV1_CHIPD/4-187----------------------------------.IEDV.REDKRIMEVSGG.QTE------------------------
YO283_YEAST/19-212----------------------------------ENVPT.SYTSGLRERYMG.VIE------------------------
A8MF31_ALKOO/4-198----------------------------------..IEI.IEEPNFKEVYLG.DWE------------------------
D8SNQ5_SELML/4-199----------------------------------.LSQV.STTPLLRERHLG.RLQ------------------------
D7C7F5_STRBB/4-196----------------------------------..EGA.GIEPDLQEWDYG.GYE------------------------
Q5YQW5_NOCFA/13-199----------------------------------..GGS.PVDDDLAEWDYG.DYE------------------------
C5CF58_KOSOT/4-198----------------------------------..IEI.VPNDNLREIHFG.QWE------------------------
Q745R9_MYCPA/3-188----------------------------------..LSV.EIDDRFAE......YD------------------------
C8W6P5_DESAS/6-197----------------------------------..ASV.HIIPSLREIFLG.EWD------------------------
F4CRR8_PSEUX/8-197----------------------------------..LRIDRIDERLAEWDYG.DYE------------------------
Q0KEC8_CUPNH/15-208----------------------------------..LQV.RPDARLRERSYG.TLQ------------------------
D0LB07_GORB4/15-213----------------------------------..VDV.DEHEGLIETDFG.EWE------------------------
Q2JD27_FRASC/178-366----------------------------------..RDY.VVVDDLRETDFG.AWE------------------------
H2JNB2_STRHJ/4-202----------------------------------.GLSA.HTEERIGECDYG.DWS------------------------
Q8DU48_STRMU/5-191----------------------------------..KDI.IRLKGLKEWDFG.TFE------------------------
D2UBJ8_XANAP/3-199----------------------------------.EAML.QTEPDLQEIAHG.EWE------------------------
Q3A796_PELCD/6-199----------------------------------..LLC.RQDEDLREIDFG.RWE------------------------
D2PPT8_KRIFD/4-202----------------------------------.QLRP.ATDRRLTECGYG.DWT------------------------
Q220I7_ALBFT/6-199----------------------------------..RTL.QTHAGLRERGFG.VFE------------------------
A0R642_MYCS2/5-204----------------------------------..LTP.QEFDGVHEVQVG.ELE------------------------
G2KUE1_LACSM/18-218----------------------------------.NVPL.SLDNRLEEFKLG.KME------------------------
D8UL08_VOLCA/9-201----------------------------------.VVQI.HTSIALRERALG.VLE------------------------
A6TKP0_ALKMQ/4-198----------------------------------..LKI.IKDDNIREIGLG.NWE------------------------
Q6LIL4_PHOPR/8-199----------------------------------..VPL.HLLDCWKEMDFG.NWD------------------------
A4J5S6_DESRM/6-199----------------------------------..CQI.YYLPDLREINFG.EWE------------------------
A5D2P8_PELTS/5-198----------------------------------..LNV.NTVPELRELNFG.AWE------------------------
D9QVX4_ACEAZ/5-198----------------------------------..INI.NTEAKLREANFG.VWE------------------------
D3FA36_CONWI/9-192----------------------------------..GRL.TLEPDLMEVDYG.EYE------------------------
F2N9U4_CORGP/5-198----------------------------------SVPPA.VALDGLIERSYG.SLE------------------------
G4L641_TETHN/3-201----------------------------------.SVPI.YYDSNLREMGYG.KLE------------------------
B8E2M6_DICTD/4-197----------------------------------..KEI.LIRENWIEFDFG.EWE------------------------
F2F0S7_SOLSS/5-199----------------------------------..VQV.IQTDTLRELSFG.NWE------------------------
A4T0I6_POLSQ/6-201----------------------------------..VSA.IAHKALRERNLG.ALQ------------------------
G2SPT2_LACRR/4-203----------------------------------.PIKL.ESDRAFQEFDLG.KME------------------------
E6W2F2_DESIS/10-204----------------------------------RLPDP.LVLPGLREKNMG.KAE------------------------
Q9X194_THEMA/3-195----------------------------------..KEI.IVEEDLRECEIS.LWN------------------------
G8LUT1_CLOCD/4-197----------------------------------..LNV.IKSEALNEISFG.DWE------------------------
C7QH56_CATAD/8-200----------------------------------..LEI.GTDERLIE.AAN.FFE------------------------
F8A8I3_THEID/6-196----------------------------------..VPL.FIKKELREIDFG.SWS------------------------
A0D7F1_PARTE/11-207----------------------------------.QMMP.NFEPLLREKHAG....------------------------
Q22T38_TETTS/22-202----------------------------------.KSII.KVDPLLRELNFG.KEE------------------------
E3IV15_FRASU/3-196----------------------------------..PLY.RSDARLREIDLG.GWS------------------------
Q9SCS3_ARATH/16-210----------------------------------.KLEV.LTDRDLRERHLG.DMQ------------------------
Q2RJH0_MOOTA/6-199----------------------------------..LKI.NEVPALREINFG.VWE------------------------
Q47IH2_DECAR/12-205----------------------------------..LQP.TAVPEMRERRYG.VFE------------------------
Q113G3_TRIEI/6-202----------------------------------..LAI.KLDWGLCEWLNP.KWM------------------------
C7R5L5_JONDD/6-202----------------------------------..VEV.HTDARLRERGFG.PWE------------------------
F4L0A7_HALH1/4-197----------------------------------..IPW.EQWAEINEISWG.IHE------------------------
B1Y6N8_LEPCP/4-197----------------------------------..WTA.HHDARWREQHYG.AFE------------------------
B1Y8E3_LEPCP/9-202----------------------------------..LVV.QADVGLRERHFG.DFE------------------------
E1R062_OLSUV/8-199----------------------------------..VPV.EVREDLAEIEFG.SVQ------------------------
C6WAU4_ACTMD/4-201----------------------------------..LTA.AVEPDLAEVEYG.DWT------------------------
E3H7F6_ILYPC/4-201----------------------------------..EAF.YVVDDLREMSFG.EME------------------------
Q5P7P2_AROAE/9-203----------------------------------..FEA.TLEPELRERHYG.VFQ------------------------
Q3A802_PELCD/11-203----------------------------------..LRV.RSLRALREIALG.RWE------------------------
C7RK71_ACCPU/6-200----------------------------------..LLP.ILRPEFRERRYG.LFE------------------------
C4L115_EXISA/4-189----------------------------------EHKAI.LLDERFIEREFG.AAS------------------------
Q46GR1_PROMT/229-424----------------------------------.GIEI.SLKDNLIEIGHG.KWE------------------------
C8W3Q4_DESAS/5-198----------------------------------..LRV.HKRPNLREINFG.KWE------------------------
Q03YB7_LEUMM/4-203----------------------------------.KPAL.SLRSNLAEVGLG.AWE------------------------
G4L012_OSCVS/4-198----------------------------------..LPI.QKRKDLREICVG.EWE------------------------
D1CI13_THET1/4-198----------------------------------..LPV.EALEGLVEMDFG.RWE------------------------
Q47LB4_THEFY/7-197----------------------------------..LPI.TVDERLVE.AAN.HFQ------------------------
G8QLS4_AZOSU/8-203----------------------------------..RPV.CLRPALRERSYG.IFE------------------------
H6RJR9_BLASD/4-199----------------------------------..LEP.QTDDRLGEAHYG.DWT------------------------
D1BKR1_SANKS/4-203----------------------------------.TTPV.LEEPDITECDYG.HWQ------------------------
E4N2L1_KITSK/4-203----------------------------------.LAAP.ELDERLGECHYG.DWT------------------------
F8L9A3_SIMNZ/4-204----------------------------------.NTSV.IPLEIFKEIDYG.PDE------------------------
A2SH69_METPP/10-209----------------------------------.ALTL.DHEAALQEIRGG.RLA------------------------
A8L509_FRASN/4-197----------------------------------..TDI.QIDHDLHEWDYG.SYE------------------------
G0JM27_9GAMM/6-189----------------------------------..PDA.QLDDDLCEWRYG.QYE------------------------
E3HZR3_RHOVT/3-207----------------------------------.SAPV.DIDDRLREIDYG.DWE------------------------
A8L9X3_FRASN/6-204----------------------------------..MPV.ILEPRLAEAGHG.SAD------------------------
Q3ISX8_NATPD/4-201----------------------------------.PADV.RFDPGWRERDLG.VYQ------------------------
C5D2R4_GEOSW/4-198----------------------------------..IPI.YTEEQLREIHLG.DWE------------------------
A4FA31_SACEN/162-361----------------------------------..GEL.LFHDGLLETDFG.DWE------------------------
D1CEC2_THET1/5-199----------------------------------..LEP.VIIPELQERDLG.LAT------------------------
H0PY04_9RHOO/14-208----------------------------------..SRI.EYQPHLRERHYG.HFQ------------------------
H2ANA8_KAZAF/21-215----------------------------------EDVPV.ELDSDLRERFMG.IIE------------------------
Q65LP2_BACLD/4-185----------------------------------..LEI.IEMEDFIERNYG.DAE------------------------
C6XW10_PEDHD/5-199----------------------------------..TPW.EQLAGLDELAWG.IWE------------------------
G8NTU1_GRAMM/8-195----------------------------------..DVA.VIEDGLQEWNYG.ESE------------------------
B7KKU2_CYAP7/5-199----------------------------------..LDI.QVREGLREIHYG.LWE------------------------
A4FFP0_SACEN/15-212----------------------------------..VPV.AVEDRLAEVDYG.QWT------------------------
D2PUU5_KRIFD/6-202----------------------------------..LTV.EYDKALREIDVD.DWA------------------------
G0VP45_MEGEL/4-198----------------------------------..LDV.IAYDELKEADFG.VWE------------------------
H5WTP9_9BURK/4-198----------------------------------..LPI.QTSPLWREQAFG.ILE------------------------
I0HZE4_CALAS/7-199----------------------------------..LPI.IEEPAFLEVDYG.DWH------------------------
A5UTN8_ROSS1/4-200----------------------------------..VIP.EPLPALREIDVG.AWS------------------------
E9T3E9_COREQ/12-198----------------------------------..THD.RHWDALTEWDYG.EFE------------------------
E6U5E4_ETHHY/4-198----------------------------------..LPI.ITLEGLMEINGG.CWE------------------------
B0TIL4_HELMI/4-197----------------------------------..TAL.ILEPRFRECNFG.AWE------------------------
D7B3J6_NOCDD/7-195----------------------------------..VPV.EFDEGLRERFGG.SWE------------------------
E5S5V1_TRISP/288-477----------------------------------..AYI.EHWKALDEIDAG.ICE------------------------
A8QBY9_MALGO/432-619----------------------------------..YPK.LMWKSLDELDAG.VCD------------------------
D5X1T7_THIK1/3-197----------------------------------..LSA.QVLEGVNDLDYG.QWQ------------------------
Q2W9Y0_MAGSA/8-200----------------------------------LLPPP.MVEPDLAEQDFG.RWQ------------------------
A4G1U3_HERAR/4-201----------------------------------..MSV.QLHKGLRERCFG.ALE------------------------
A0RZ16_CENSY/25-219----------------------------------..IEV.VEDDRLIELEMG.RFT------------------------
B1WZ22_CYAA5/5-199----------------------------------..MEM.QIKDGLKEMNFG.QWE------------------------
G2I053_GLUMN/23-220----------------------------------GPHAM.HVEPDLIEQSLG.EWH------------------------
A4XA48_SALTO/210-405----------------------------------.GKPV.RDNDDLVECDFG.VWE------------------------
C0QQJ5_PERMH/4-196----------------------------------..MDI.TKDKRIREMSFG.EWE------------------------
F2NE04_DESAR/4-197----------------------------------..VEV.QDLPGLTDLCYG.DWE------------------------
E3CWY7_9BACT/18-211----------------------------------..LPV.EVREGFTNVALG.PWE------------------------
G7V8B5_THELD/7-201----------------------------------.GGSI.KVCNELEEMGFG.IWE------------------------
F6EE93_AMYSD/5-202----------------------------------..REL.QIVEGIHEIQAG.ELE------------------------
G0HE54_CORVD/27-224----------------------------------..LDV.TGADDLIETDFG.VWE------------------------
D7CTF2_TRURR/4-192----------------------------------..VPL.TLDERLREISRG.TLE------------------------
C4XRN5_DESMR/4-195----------------------------------..LMV.RPEPRLREIALG.AFE------------------------
D5DCI5_BACMD/2-191----------------------------------.VEKI.EVCEQLRERSFG.ELE------------------------
F8L7X0_SIMNZ/6-189----------------------------------..SQA.KITDALLEWNYG.DYE------------------------
C6WJD9_ACTMD/6-206----------------------------------.AERV.VAEPRLREQDWG.NLQ------------------------
Q01QD4_SOLUE/4-187----------------------------------..RDA.VIDPNLCEWDYG.DYE------------------------
O67630_AQUAE/21-213----------------------------------..IDL.IVDERIREMSFG.VLE------------------------
D3E7U3_GEOS4/4-184----------------------------------..LPI.AEQEDLRERMAG.DLQ------------------------
F5WRW0_ERYRF/5-198----------------------------------..TPI.RLEPGIREIEMG.VWE------------------------
Q0BPI2_GRABC/16-203----------------------------------.AEQT.EITATLADLEYG.TWR------------------------
Q8DV19_STRMU/3-202----------------------------------.SVKI.EYTKALREWNLG.SLE------------------------
C6WJ12_ACTMD/7-195----------------------------------..LEA.EKTEALAEWDYG.DYE------------------------
I0JQ97_HALH3/4-186----------------------------------..LEI.SYDIRLQEVDGG.LIE------------------------
Q890L1_CLOTE/7-201----------------------------------..IPI.VCDNRLKEIKLG.KWE------------------------
A4G6G7_HERAR/9-205----------------------------------.HIEL.EQWPEFQEVRGG.VLE------------------------
Q67MI2_SYMTH/5-185----------------------------------..HAL.ITDERLRERSMG.PAE------------------------
B0RD00_CLAMS/47-237----------------------------------..DQA.EVDDRLVEFDYG.AYE------------------------
B7GKQ4_ANOFW/31-225----------------------------------..VPI.YFDERLREIYLG.DWE------------------------
B8EKJ6_METSB/5-199----------------------------------..LPV.EPTPALRERFFG.AFQ------------------------
I0K575_9BACT/6-202----------------------------------..IPF.EKLSGLNEISWG.IME------------------------
F9ZSH9_ACICS/8-193----------------------------------..TDA.DPHDGLREWHYG.RYE------------------------
F4GUJ2_PUSST/6-198----------------------------------..LPI.ERNPRLRERCYG.IYE------------------------
E6TZD4_BACCJ/4-202----------------------------------.GIPI.IKEENLREISFG.DWE------------------------
A3QAT5_SHELP/6-198----------------------------------..VKV.ALDAGLKEIYFG.RWD------------------------
F0YIY5_AURAN/82-285----------------------------------.VAAV.EEREAFREVKRG.AWV------------------------
A8LFW3_FRASN/5-200----------------------------------..VPV.TVEPALEGPQHG.VAD------------------------
F4CMY4_PSEUX/3-194----------------------------------..LEP.VRRADLAEYDVD.DPH------------------------
Q6FKJ4_CANGA/19-215----------------------------------SEKDV.FFLGGLRERFMG.PIE------------------------
Q5WIH4_BACSK/3-196----------------------------------..LPP.RKWELLREVHLG.PLQ------------------------
A0LTB5_ACIC1/211-404----------------------------------..QPV.LLDDDLREVDFG.RWE------------------------
F4PSW8_DICFS/370-558----------------------------------..YPK.VHVRGLDDIERG.EWE------------------------
G0VB21_NAUCC/21-215----------------------------------PVPPV.EYFYGLRERFMG.VIE------------------------
Q5FS21_GLUOX/26-223----------------------------------.SQDV.TIDGRFIEQSIG.KWH------------------------
F4B9W0_ACIHW/4-190----------------------------------..LIP.IIDDRLRERYLG.DLN------------------------
D1C2P1_SPHTD/5-200----------------------------------..LTP.TLHDDLMELNFG.DME------------------------
A9HYX7_BORPD/4-199----------------------------------..LRL.RSEPGLRERSYG.VLE------------------------
D9R017_CLOSW/3-192----------------------------------..AEH.IIRQELKEISFG.EME------------------------
Q7NT51_CHRVO/8-202----------------------------------..LNA.HYTPQLRERHMG.ALQ------------------------
D7CND1_SYNLT/3-196----------------------------------..LEV.GVMPEFREMNFG.EWE------------------------
F8EAH6_RUNSL/6-202----------------------------------..LAH.EAYEGLNEISWG.VRE------------------------
H8L495_FRAAD/3-195----------------------------------..AEC.FDDPGLVERAFG.RYE------------------------
F4C717_SPHS2/5-199----------------------------------..IPW.EQLEGLDEISWG.IYE------------------------
F4A2A2_MAHA5/4-197----------------------------------..API.DFLPELREMNLG.CWQ------------------------
A6TRG4_ALKMQ/4-197----------------------------------..IPC.HYDHGLSEMNFG.EWE------------------------
E3LC61_PUCGT/216-403----------------------------------..YPK.LTWKSLDELDAG.VCD------------------------
A0LHV7_SYNFM/386-579----------------------------------..LCP.EARPEMREIALG.EWD------------------------
D7FIE0_ECTSI/94-289----------------------------------.ATSF.AVSEDLNEVDFG.GAE------------------------
B9S8J7_RICCO/19-213----------------------------------.GLEV.IKDADLRERHLG.DLQ------------------------
F0RNH1_DEIPM/22-219----------------------------------.APPV.QLEPGLREIQVG.ELA------------------------
A9TAW0_PHYPA/4-197----------------------------------.CSNV.IVRENLRERCLG.DLE------------------------
A8FBP0_BACP2/4-185----------------------------------..APL.VLMDDFIERDYG.DAE------------------------
C1CYM6_DEIDV/6-197----------------------------------....I.TLDPRLREIHFG.VFE------------------------
E8V8F6_TERSS/7-190----------------------------------..DQA.EVDANLAEWDYG.IYE------------------------
Q8YXV2_NOSS1/5-199----------------------------------..IKP.ELRDGLKEINYG.QWE------------------------
H1YC42_9SPHI/6-200----------------------------------..IPY.DKLSGLDELAWG.IYE------------------------
D0NUL9_PHYIT/63-266----------------------------------KSIPW.SEEPRIREQDFG.NFQ------------------------
H6RPL7_BLASD/7-199----------------------------------..LEV.ATDERIIE..AGNAFE------------------------
E3PRT5_CLOSD/4-195----------------------------------..SEI.HLEKGFREINFG.LWE------------------------
F4CPL7_PSEUX/29-222----------------------------------..VPL.VVRDGLIETNFG.EWD------------------------
E3GIM0_EUBLK/4-197----------------------------------..LPI.LVEPGIVEVDGG.LME------------------------
F2RLZ2_STRVP/28-222----------------------------------..RGA.VADEDLCEWDYG.GYE------------------------
A1AP89_PELPD/13-205----------------------------------..APV.QPLSKLREINMG.AWD------------------------
A0D5U7_PARTE/23-205----------------------------------.DTLI.IEDPRLRELNFG.KHE------------------------
D7CRA3_TRURR/4-190----------------------------------..RAI.VRDARLKEVHFG.HFE------------------------
F0S1R0_DESTD/4-200----------------------------------..LPV.EERDGFKEIDHG.EWE------------------------
A6LX68_CLOB8/5-196----------------------------------..IEV.ITNDGLMEMCFG.DYE------------------------
A1SI90_NOCSJ/187-388----------------------------------..QEV.RVEPGFAEMEFG.AWD------------------------
C1DZ31_MICSR/6-219----------------------------------PASTV.TLHKELRERHMG.VLQ------------------------
A1K9A9_AZOSB/15-209----------------------------------..LET.QPSAALRERHYG.LFQ------------------------
F0RK66_DEIPM/8-205----------------------------------..GQL.ETSPALREIAFG.DWD------------------------
H2J7Y6_MARPK/3-195----------------------------------..KKP.IIHEGLKEAHVE.LWN------------------------
D3SL81_THEAH/4-197----------------------------------..VHV.VKDERIREIDHG.VWS------------------------
I0H0L2_ACTM4/169-364----------------------------------.GVPV.TVMEDLIECDFG.AWE------------------------
D2PWV1_KRIFD/7-199----------------------------------..LTP.DLDERVIE.AAN.LFE------------------------
H8KQQ2_SOLCM/26-220----------------------------------..LQW.EQHPGFDELDWG.ENE------------------------
D4M9J9_9BACT/3-199----------------------------------.CDAF.VVDDGFQEINHG.AWE------------------------
D6GQ74_FILAD/4-199----------------------------------..IPV.VFSEKLYEMGFG.DWE------------------------
C6D8K0_PAESJ/4-200----------------------------------..LEV.NINKELREINTG.DAA------------------------
YQGD_SCHPO/56-250----------------------------------..CPL.YISDFLMEKDLG.SLE------------------------
Q6CU83_KLULA/19-210----------------------------------.PTKL.VTTDKLRERCMG.VIE------------------------
H5WQ77_9BURK/7-200----------------------------------..LPV.RAEPLLRERAFG.VLE------------------------
D8K089_DEHLB/3-197----------------------------------..KTV.KVDEAINEVNFG.RIE------------------------
Q752M0_ASHGO/19-204----------------------------------.APKT.ELTEGLRERHMG.EVE------------------------
A5GRZ9_SYNR3/7-190----------------------------------..AQA.DVHPDLREWDYG.DYE------------------------
G8PCV9_PEDCP/4-209----------------------------------YPTPI.SVESRLREFNLG.LME------------------------
C5AAI7_BURGB/12-209----------------------------------.SIDL.EVEPAWREIRGG.HLA------------------------
A6LYX0_CLOB8/6-201----------------------------------