Sequence alignment for CL0072

PF14847

M7PB55_PNEMU/186-282--------------------------------------------------------------------------------
W1QDG0_OGAPD/127-224--------------------------------------------------------------------------------
D5GAF3_TUBMM/216-317--------------------------------------------------------------------------------
R7Z1R1_CONA1/301-403--------------------------------------------------------------------------------
E4UTJ7_ARTGP/289-390--------------------------------------------------------------------------------
G8BDY4_CANPC/178-286--------------------------------------------------------------------------------
G3ALG9_SPAPN/136-236--------------------------------------------------------------------------------
I2GWW6_TETBL/102-209--------------------------------------------------------------------------------
C4Y2B8_CLAL4/115-213--------------------------------------------------------------------------------
G0VKN8_NAUCC/126-229--------------------------------------------------------------------------------
S2JNI8_MUCC1/248-344--------------------------------------------------------------------------------
F2Z643_YARLI/352-450--------------------------------------------------------------------------------
L8GC22_PSED2/285-387--------------------------------------------------------------------------------
Q6BX89_DEBHA/150-251--------------------------------------------------------------------------------
H6BXQ7_EXODN/280-382--------------------------------------------------------------------------------
H2ANV4_KAZAF/134-238--------------------------------------------------------------------------------
A5DK85_PICGU/161-259--------------------------------------------------------------------------------
E6ZNN4_SPORE/435-552--------------------------------------------------------------------------------
D8PT48_SCHCM/422-535--------------------------------------------------------------------------------
H0EHG6_GLAL7/228-330--------------------------------------------------------------------------------
U1HLA1_ENDPU/281-383--------------------------------------------------------------------------------
Q6FXI1_CANGA/99-207--------------------------------------------------------------------------------
G0WH13_NAUDC/132-239--------------------------------------------------------------------------------
U4LSK1_PYROM/267-369--------------------------------------------------------------------------------
B6Q1Q5_PENMQ/258-360--------------------------------------------------------------------------------
M7WSY6_RHOT1/447-544--------------------------------------------------------------------------------
A5DV77_LODEL/166-274--------------------------------------------------------------------------------
Q0UKQ0_PHANO/223-325--------------------------------------------------------------------------------
E7QIG4_YEASZ/130-238--------------------------------------------------------------------------------
K5W752_AGABU/448-565--------------------------------------------------------------------------------
J4HWJ7_FIBRA/104-215--------------------------------------------------------------------------------
G8BQH6_TETPH/102-210--------------------------------------------------------------------------------
R1GKA3_BOTPV/69-171--------------------------------------------------------------------------------
G1XUM9_ARTOA/274-374--------------------------------------------------------------------------------
G3B1K7_CANTC/122-220--------------------------------------------------------------------------------
J7S422_KAZNA/144-264--------------------------------------------------------------------------------
Q6CVC4_KLULA/111-220--------------------------------------------------------------------------------
N1QC72_MYCFI/275-377--------------------------------------------------------------------------------
G2QC44_THIHA/265-367--------------------------------------------------------------------------------
M2LQE5_BAUCO/287-389--------------------------------------------------------------------------------
C4R4N2_PICPG/137-232--------------------------------------------------------------------------------
J3K7Q4_COCIM/253-355--------------------------------------------------------------------------------
K0KA50_WICCF/115-210--------------------------------------------------------------------------------
M3K819_CANMX/171-279--------------------------------------------------------------------------------
N1JCR8_BLUG1/286-388--------------------------------------------------------------------------------
A3LRR0_PICST/165-286--------------------------------------------------------------------------------
Q5KHP6_CRYNJ/473-586--------------------------------------------------------------------------------
Q4WTX3_ASPFU/277-379--------------------------------------------------------------------------------
G8YTP8_PICSO/145-244--------------------------------------------------------------------------------
M7TTL7_BOTF1/295-397--------------------------------------------------------------------------------

PF00788

PLCE1_MOUSE/2115-2218--------------------------------------------------------------------------------
GNDS_MOUSE/736-823--------------------------------------------------------------------------------
Q19852_CAEEL/752-845--------------------------------------------------------------------------------
ARAP3_MOUSE/1113-1206--------------------------------------------------------------------------------
RPGF6_HUMAN/749-835--------------------------------------------------------------------------------
MYO9A_HUMAN/14-112--------------------------------------------------------------------------------
DGKQ_HUMAN/395-494--------------------------------------------------------------------------------
SNX27_RAT/271-360--------------------------------------------------------------------------------
ARAP1_HUMAN/1172-1261--------------------------------------------------------------------------------
RHG20_MOUSE/194-283--------------------------------------------------------------------------------
RIN2_HUMAN/787-878--------------------------------------------------------------------------------
Q22744_CAEEL/396-496--------------------------------------------------------------------------------
Q8IPP4_DROME/256-348--------------------------------------------------------------------------------
GRB7_MOUSE/99-185--------------------------------------------------------------------------------
AB1IP_MOUSE/179-266--------------------------------------------------------------------------------
Q9VCQ7_DROME/659-748--------------------------------------------------------------------------------
RASF3_MOUSE/78-181--------------------------------------------------------------------------------
RADIL_MOUSE/90-193--------------------------------------------------------------------------------
STE4_SCHPO/176-264--------------------------------------------------------------------------------
RASF1_HUMAN/202-292--------------------------------------------------------------------------------
RGL2_HUMAN/648-735--------------------------------------------------------------------------------
AFAD_RAT/246-348--------------------------------------------------------------------------------
Q17860_CAEEL/355-454--------------------------------------------------------------------------------
Q9VCF2_DROME/831-922--------------------------------------------------------------------------------
GRB14_RAT/104-190--------------------------------------------------------------------------------
Q9VML8_DROME/60-155--------------------------------------------------------------------------------
AFAD_RAT/39-133--------------------------------------------------------------------------------
MYO9B_RAT/15-114--------------------------------------------------------------------------------
Q8IQW0_DROME/238-324--------------------------------------------------------------------------------
Q9VCF2_DROME/923-1024--------------------------------------------------------------------------------
Q9BIC1_CAEEL/215-319--------------------------------------------------------------------------------
RASF2_MOUSE/176-264--------------------------------------------------------------------------------
P91575_CAEEL/70-167--------------------------------------------------------------------------------
Q9W486_DROME/277-365--------------------------------------------------------------------------------
STE50_YEAST/235-327--------------------------------------------------------------------------------
Q17860_CAEEL/264-353--------------------------------------------------------------------------------
RASF7_HUMAN/6-89--------------------------------------------------------------------------------
G4UMY9_NEUT9/261-348--------------------------------------------------------------------------------
M7PB55_PNEMU/184-268--------------------------------------------------------------------------------
Q2M017_DROPS/881-970--------------------------------------------------------------------------------

PF00794

AGE1_CAEEL/241-361--------------------------------------------------------------------------------
PI3K3_DICDI/724-826--------------------------------------------------------------------------------
PI3K1_DICDI/688-792--------------------------------------------------------------------------------
PI3K2_DICDI/808-917--------------------------------------------------------------------------------
P3C2A_HUMAN/409-512--------------------------------------------------------------------------------
PK3CD_HUMAN/175-281--------------------------------------------------------------------------------
P3C2B_HUMAN/364-466--------------------------------------------------------------------------------
P91634_DROME/200-307--------------------------------------------------------------------------------
PK3CG_PIG/203-312--------------------------------------------------------------------------------
PK3CB_HUMAN/180-288--------------------------------------------------------------------------------
B4HEY7_DROSE/434-538--------------------------------------------------------------------------------
U3IZV1_ANAPL/174-291--------------------------------------------------------------------------------

PF11470

G8C071_TETPH/6-74--------------------------------------------------------------------------------
E7QJ70_YEASZ/4-69--------------------------------------------------------------------------------
A2ABZ8_MOUSE/4-63--------------------------------------------------------------------------------
Q759X3_ASHGO/6-71--------------------------------------------------------------------------------
M2YL46_MYCP1/8-72--------------------------------------------------------------------------------
B6HV28_PENCW/8-71--------------------------------------------------------------------------------
H0VS36_CAVPO/16-79--------------------------------------------------------------------------------
K7JBH2_NASVI/10-73--------------------------------------------------------------------------------
S9W532_SCHCR/6-69--------------------------------------------------------------------------------
C5DDI6_LACTC/6-71--------------------------------------------------------------------------------
UBX4_SCHPO/6-69--------------------------------------------------------------------------------
Q59YG7_CANAL/76-140--------------------------------------------------------------------------------
W4W295_ATTCE/10-73--------------------------------------------------------------------------------
U1GGT5_ENDPU/8-71--------------------------------------------------------------------------------
N4VAY1_COLOR/8-71--------------------------------------------------------------------------------
B2ABE5_PODAN/9-72--------------------------------------------------------------------------------
S6DZG7_ZYGB2/6-72--------------------------------------------------------------------------------
Q2HDX9_CHAGB/8-71--------------------------------------------------------------------------------
M3AUN0_SPHMS/8-73--------------------------------------------------------------------------------
Q7SEP0_NEUCR/8-71--------------------------------------------------------------------------------
R7YXW3_CONA1/8-71--------------------------------------------------------------------------------
C5GFX1_AJEDR/8-71--------------------------------------------------------------------------------
E9C497_CAPO3/8-71--------------------------------------------------------------------------------
G8JRX7_ERECY/6-71--------------------------------------------------------------------------------
B0WHV7_CULQU/11-74--------------------------------------------------------------------------------
F2SGW6_TRIRC/8-71--------------------------------------------------------------------------------
J8PYG8_SACAR/6-71--------------------------------------------------------------------------------
H2XR59_CIOIN/5-68--------------------------------------------------------------------------------
G3B806_CANTC/10-69--------------------------------------------------------------------------------
I2H0J6_TETBL/5-71--------------------------------------------------------------------------------
E5S2D9_TRISP/6-68--------------------------------------------------------------------------------
K1PBF8_CRAGI/7-71--------------------------------------------------------------------------------
D5GPN6_TUBMM/8-71--------------------------------------------------------------------------------
Q0UWT0_PHANO/7-70--------------------------------------------------------------------------------
H3G2K2_PRIPA/9-72--------------------------------------------------------------------------------
G6D1N1_DANPL/8-71--------------------------------------------------------------------------------
H6BLI9_EXODN/8-71--------------------------------------------------------------------------------
A9UPU1_MONBE/9-71--------------------------------------------------------------------------------
B6JVS4_SCHJY/21-83--------------------------------------------------------------------------------
G3AMH5_SPAPN/8-73--------------------------------------------------------------------------------
B0DC11_LACBS/297-358--------------------------------------------------------------------------------
T1H152_MEGSC/10-73--------------------------------------------------------------------------------
C5E3X2_ZYGRC/6-73--------------------------------------------------------------------------------
M4FRN0_MAGP6/8-71--------------------------------------------------------------------------------
U4LXJ5_PYROM/8-70--------------------------------------------------------------------------------
K1WUK5_MARBU/8-71--------------------------------------------------------------------------------
L0PAT2_PNEJ8/7-71--------------------------------------------------------------------------------
R8BC58_TOGMI/8-71--------------------------------------------------------------------------------
E9DSD2_METAQ/8-71--------------------------------------------------------------------------------
D7FT66_ECTSI/8-73--------------------------------------------------------------------------------
F0YAZ5_AURAN/5-73--------------------------------------------------------------------------------
C4R030_PICPG/5-68--------------------------------------------------------------------------------
H2AM67_KAZAF/6-70--------------------------------------------------------------------------------
W1QGK9_OGAPD/6-69--------------------------------------------------------------------------------
M3A5M0_MYCFI/7-71--------------------------------------------------------------------------------
G7X6P9_ASPKW/8-71--------------------------------------------------------------------------------
D3BSC7_POLPA/6-69--------------------------------------------------------------------------------
X1WYJ5_ACYPI/10-71--------------------------------------------------------------------------------
M7SCZ0_EUTLA/8-71--------------------------------------------------------------------------------
K2RQG8_MACPH/8-71--------------------------------------------------------------------------------
A7RUJ0_NEMVE/10-73--------------------------------------------------------------------------------
U9SZH2_RHIID/10-72--------------------------------------------------------------------------------
E4ZFZ7_LEPMJ/8-70--------------------------------------------------------------------------------
Q6BW80_DEBHA/8-71--------------------------------------------------------------------------------
N1JEA9_BLUG1/8-71--------------------------------------------------------------------------------
D6WEX9_TRICA/9-72--------------------------------------------------------------------------------
A5DEW0_PICGU/22-86--------------------------------------------------------------------------------
V5G6B0_BYSSN/8-71--------------------------------------------------------------------------------
C4YB10_CLAL4/7-70--------------------------------------------------------------------------------
J5J9U8_BEAB2/8-71--------------------------------------------------------------------------------
M2M3Z6_BAUCO/9-73--------------------------------------------------------------------------------
H2M9W5_ORYLA/11-74--------------------------------------------------------------------------------
A3LU13_PICST/8-73--------------------------------------------------------------------------------
G0RDR3_HYPJQ/8-71--------------------------------------------------------------------------------
C8V8J0_EMENI/8-71--------------------------------------------------------------------------------
F0ZDH6_DICPU/7-69--------------------------------------------------------------------------------
H3GCB5_PHYRM/5-69--------------------------------------------------------------------------------
F4PAU1_BATDJ/15-74--------------------------------------------------------------------------------
F7EJY1_XENTR/15-78--------------------------------------------------------------------------------
G2XN35_BOTF4/8-72--------------------------------------------------------------------------------
Q6FU38_CANGA/6-69--------------------------------------------------------------------------------
D8TTA0_VOLCA/15-77--------------------------------------------------------------------------------
M3IS18_CANMX/7-72--------------------------------------------------------------------------------
S3CS22_OPHP1/8-71--------------------------------------------------------------------------------
S8C614_DACHA/9-69--------------------------------------------------------------------------------
Q16M15_AEDAE/9-72--------------------------------------------------------------------------------
M4BXT6_HYAAE/5-69--------------------------------------------------------------------------------
S3DE83_GLAL2/9-71--------------------------------------------------------------------------------
G8YPU0_PICSO/8-69--------------------------------------------------------------------------------
G4MS61_MAGO7/8-71--------------------------------------------------------------------------------
G8ZQG7_TORDC/6-76--------------------------------------------------------------------------------
G0SBN2_CHATD/8-71--------------------------------------------------------------------------------
G8BAN3_CANPC/8-75--------------------------------------------------------------------------------
Q54X06_DICDI/6-68--------------------------------------------------------------------------------
H3D967_TETNG/11-74--------------------------------------------------------------------------------
J7RE34_KAZNA/6-71--------------------------------------------------------------------------------
U6IXM3_HYMMI/8-70--------------------------------------------------------------------------------
W5JQG4_ANODA/16-77--------------------------------------------------------------------------------
A8QGX0_BRUMA/7-70--------------------------------------------------------------------------------
G0VDE5_NAUCC/6-72--------------------------------------------------------------------------------
R4XKU1_TAPDE/7-70--------------------------------------------------------------------------------
J7SB01_NAUDC/6-73--------------------------------------------------------------------------------
B4NGN6_DROWI/8-71--------------------------------------------------------------------------------
Q7QFB4_ANOGA/7-70--------------------------------------------------------------------------------
Q6C499_YARLI/4-76--------------------------------------------------------------------------------
A7TPS2_VANPO/6-74--------------------------------------------------------------------------------
G1KJW8_ANOCA/16-79--------------------------------------------------------------------------------
F0XHC8_GROCL/8-71--------------------------------------------------------------------------------
L8G0J8_PSED2/9-71--------------------------------------------------------------------------------
C3Y9C0_BRAFL/10-73--------------------------------------------------------------------------------
A8X8R5_CAEBR/7-71--------------------------------------------------------------------------------
F9XFB7_MYCGM/9-73--------------------------------------------------------------------------------
T1J1W1_STRMM/9-72--------------------------------------------------------------------------------

PF02196

T1HJK8_RHOPR/111-177--------------------------------------------------------------------------------
F7DHK5_MACMU/432-500--------------------------------------------------------------------------------
Q6T9C1_DANRE/993-1061--------------------------------------------------------------------------------
B7PJL0_IXOSC/959-1025--------------------------------------------------------------------------------
F7CRV0_XENTR/7-78--------------------------------------------------------------------------------
F1QRN2_DANRE/55-128--------------------------------------------------------------------------------
E9QCV1_DANRE/716-780--------------------------------------------------------------------------------
F1QAG9_DANRE/321-389--------------------------------------------------------------------------------
H2XPX2_CIOIN/391-453--------------------------------------------------------------------------------
G3Q715_GASAC/938-1006--------------------------------------------------------------------------------
T1JJ02_STRMM/111-176--------------------------------------------------------------------------------
T1HAL7_RHOPR/218-283--------------------------------------------------------------------------------
F6UAR3_XENTR/958-1026--------------------------------------------------------------------------------
J9BDH4_WUCBA/54-127--------------------------------------------------------------------------------
B4LBF4_DROVI/138-203--------------------------------------------------------------------------------
K1PN87_CRAGI/492-557--------------------------------------------------------------------------------
X1WZN3_ACYPI/1063-1128--------------------------------------------------------------------------------
H9IT00_BOMMO/623-687--------------------------------------------------------------------------------
K7ITS2_NASVI/197-267--------------------------------------------------------------------------------
W5LIQ9_ASTMX/299-368--------------------------------------------------------------------------------
D6X4G2_TRICA/102-169--------------------------------------------------------------------------------
K1PN87_CRAGI/420-488--------------------------------------------------------------------------------
K7GLK7_PIG/20-90--------------------------------------------------------------------------------
E9GLD9_DAPPU/202-266--------------------------------------------------------------------------------
F7CJL2_CALJA/57-133--------------------------------------------------------------------------------
A7RN75_NEMVE/102-169--------------------------------------------------------------------------------
W4ZH62_STRPU/118-185--------------------------------------------------------------------------------
I3JW49_ORENI/36-106--------------------------------------------------------------------------------
E0VUE7_PEDHC/288-356--------------------------------------------------------------------------------
F6VWF2_XENTR/765-830--------------------------------------------------------------------------------
G3W060_SARHA/767-832--------------------------------------------------------------------------------
V8NG58_OPHHA/62-133--------------------------------------------------------------------------------
E5S4H8_TRISP/137-210--------------------------------------------------------------------------------
G6D175_DANPL/130-197--------------------------------------------------------------------------------
Q1DH71_AEDAE/21-87--------------------------------------------------------------------------------
B4I9U9_DROSE/142-211--------------------------------------------------------------------------------
H2SV15_TAKRU/9-82--------------------------------------------------------------------------------
H3B9F0_LATCH/311-380--------------------------------------------------------------------------------
W5MYH0_LEPOC/313-381--------------------------------------------------------------------------------
F7DHK5_MACMU/360-428--------------------------------------------------------------------------------
H2ZT51_LATCH/91-159--------------------------------------------------------------------------------
E9J425_SOLIN/13-83--------------------------------------------------------------------------------
I3ITJ6_DANRE/13-82--------------------------------------------------------------------------------
C3Y437_BRAFL/1150-1218--------------------------------------------------------------------------------
G7YGF3_CLOSI/132-200--------------------------------------------------------------------------------
E9GAH4_DAPPU/167-235--------------------------------------------------------------------------------
V8PGN4_OPHHA/701-766--------------------------------------------------------------------------------
H3CKM2_TETNG/894-961--------------------------------------------------------------------------------
B7Q903_IXOSC/98-165--------------------------------------------------------------------------------
G4VG61_SCHMA/189-258--------------------------------------------------------------------------------
T1HM15_RHOPR/885-952--------------------------------------------------------------------------------
T1KNL1_TETUR/39-106--------------------------------------------------------------------------------
G3Q1T0_GASAC/295-364--------------------------------------------------------------------------------
B0X8R8_CULQU/539-607--------------------------------------------------------------------------------
G1P9K1_MYOLU/144-214--------------------------------------------------------------------------------
B3DFX5_DANRE/166-236--------------------------------------------------------------------------------
B4HER1_DROSE/707-775--------------------------------------------------------------------------------
T1JE93_STRMM/309-377--------------------------------------------------------------------------------
E9FUH4_DAPPU/1091-1158--------------------------------------------------------------------------------
E9C1M5_CAPO3/280-346--------------------------------------------------------------------------------
G3UWG2_MOUSE/766-831--------------------------------------------------------------------------------
H9JZ93_APIME/1117-1182--------------------------------------------------------------------------------
J9KA65_ACYPI/92-159--------------------------------------------------------------------------------
F1QV08_DANRE/935-1003--------------------------------------------------------------------------------
I1FZW1_AMPQE/139-206--------------------------------------------------------------------------------
E2B9S9_HARSA/115-186--------------------------------------------------------------------------------
G3RVK1_GORGO/57-130--------------------------------------------------------------------------------
T1ITC4_STRMM/455-518--------------------------------------------------------------------------------
F1NCP8_CHICK/960-1027--------------------------------------------------------------------------------
W4WGR9_ATTCE/210-279--------------------------------------------------------------------------------
F7CWM8_XENTR/308-377--------------------------------------------------------------------------------
H9KF32_APIME/279-344--------------------------------------------------------------------------------
E7F520_DANRE/721-786--------------------------------------------------------------------------------
H9GAK2_ANOCA/954-1022--------------------------------------------------------------------------------
K1PUV0_CRAGI/130-196--------------------------------------------------------------------------------
G1KFE4_ANOCA/301-370--------------------------------------------------------------------------------
D6WL93_TRICA/480-545--------------------------------------------------------------------------------
H3ALP8_LATCH/58-131--------------------------------------------------------------------------------
V6CM34_CAEEL/42-116--------------------------------------------------------------------------------
D6WPU0_TRICA/901-969--------------------------------------------------------------------------------
F1S3D6_PIG/303-372--------------------------------------------------------------------------------
H3AED1_LATCH/53-126--------------------------------------------------------------------------------
E1BBL0_BOVIN/57-130--------------------------------------------------------------------------------
G1KFE4_ANOCA/379-442--------------------------------------------------------------------------------

PF09379

TLN1_MOUSE/90-186--------------------------------------------------------------------------------
FRPD2_HUMAN/346-408--------------------------------------------------------------------------------
O17905_CAEEL/29-92--------------------------------------------------------------------------------
TALB_DICDI/89-151--------------------------------------------------------------------------------
PTN3_HUMAN/33-97--------------------------------------------------------------------------------
PTN14_HUMAN/25-88--------------------------------------------------------------------------------
Q29ET4_DROPS/39-103--------------------------------------------------------------------------------
Q29JN5_DROPS/24-91--------------------------------------------------------------------------------
Q7Q844_ANOGA/16-80--------------------------------------------------------------------------------
MOES_RAT/9-71--------------------------------------------------------------------------------
E41L2_HUMAN/222-285--------------------------------------------------------------------------------
E41L4_DANRE/15-83--------------------------------------------------------------------------------
FARP2_HUMAN/48-110--------------------------------------------------------------------------------
PTP1_CAEEL/33-100--------------------------------------------------------------------------------
PTN13_HUMAN/576-638--------------------------------------------------------------------------------
MYLIA_DANRE/5-68--------------------------------------------------------------------------------
Q41460_SOLTU/282-357--------------------------------------------------------------------------------
Q4CR63_TRYCC/37-105--------------------------------------------------------------------------------
FRMA_DICDI/221-288--------------------------------------------------------------------------------
FRMD1_HUMAN/58-120--------------------------------------------------------------------------------
A8WR66_CAEBR/715-777--------------------------------------------------------------------------------
F6YGI4_CIOIN/40-104--------------------------------------------------------------------------------
H3CKH1_TETNG/20-83--------------------------------------------------------------------------------
H3DKS5_TETNG/24-87--------------------------------------------------------------------------------
H9JD20_BOMMO/60-123--------------------------------------------------------------------------------
M4AKM5_XIPMA/20-82--------------------------------------------------------------------------------

PF09469

COBL1_HUMAN/174-265--------------------------------------------------------------------------------
COBL_HUMAN/144-235--------------------------------------------------------------------------------
B4F6M3_XENTR/140-231--------------------------------------------------------------------------------
H3DP68_TETNG/147-251--------------------------------------------------------------------------------

PF02017

G3WSD8_SARHA/53-127--------------------------------------------------------------------------------
H3A209_LATCH/35-110--------------------------------------------------------------------------------
F7EHI4_XENTR/12-86--------------------------------------------------------------------------------
H3DCI9_TETNG/5-81--------------------------------------------------------------------------------
H9KHC3_APIME/9-83--------------------------------------------------------------------------------
C3ZIK3_BRAFL/7-82--------------------------------------------------------------------------------
B7PJN6_IXOSC/9-84--------------------------------------------------------------------------------
CIDEB_MOUSE/35-109--------------------------------------------------------------------------------
G1N6M4_MELGA/38-112--------------------------------------------------------------------------------
B4MR20_DROWI/115-188--------------------------------------------------------------------------------
Q1L9C6_DANRE/7-81--------------------------------------------------------------------------------
T1HLF5_RHOPR/6-82--------------------------------------------------------------------------------
I3K6T4_ORENI/43-118--------------------------------------------------------------------------------
H0YYL4_TAEGU/17-93--------------------------------------------------------------------------------
F7F2F7_MONDO/8-82--------------------------------------------------------------------------------
K7J7X5_NASVI/23-95--------------------------------------------------------------------------------
G3Q650_GASAC/32-109--------------------------------------------------------------------------------
D6WZ60_TRICA/49-125--------------------------------------------------------------------------------
H9K1S5_APIME/14-88--------------------------------------------------------------------------------
K1P4N7_CRAGI/2-86--------------------------------------------------------------------------------
F6YFD3_MONDO/40-116--------------------------------------------------------------------------------
R4G377_RHOPR/9-81--------------------------------------------------------------------------------
H2MYH3_ORYLA/5-77--------------------------------------------------------------------------------
G3P5B4_GASAC/42-116--------------------------------------------------------------------------------
T1GCE2_MEGSC/27-100--------------------------------------------------------------------------------
J9K9T7_ACYPI/9-85--------------------------------------------------------------------------------
F1QDE3_DANRE/33-108--------------------------------------------------------------------------------
H2UGF9_TAKRU/38-112--------------------------------------------------------------------------------
H1A2E6_TAEGU/18-92--------------------------------------------------------------------------------
W5L818_ASTMX/36-110--------------------------------------------------------------------------------
H9JNA5_BOMMO/6-81--------------------------------------------------------------------------------
A7SSA1_NEMVE/8-82--------------------------------------------------------------------------------
H3AY23_LATCH/5-82--------------------------------------------------------------------------------
F1NBS6_CHICK/5-82--------------------------------------------------------------------------------
B4HNX1_DROSE/11-86--------------------------------------------------------------------------------
W5LI82_ASTMX/44-119--------------------------------------------------------------------------------
W5N2P9_LEPOC/39-114--------------------------------------------------------------------------------
D6WW09_TRICA/3-77--------------------------------------------------------------------------------
M4AA15_XIPMA/21-96--------------------------------------------------------------------------------
I3JHL3_ORENI/8-82--------------------------------------------------------------------------------
B4HSQ8_DROSE/9-85--------------------------------------------------------------------------------
CIDEC_MOUSE/42-117--------------------------------------------------------------------------------
Q66K97_XENTR/41-116--------------------------------------------------------------------------------
H2LTA3_ORYLA/20-97--------------------------------------------------------------------------------
I3J220_ORENI/3-79--------------------------------------------------------------------------------
K1QGB0_CRAGI/73-145--------------------------------------------------------------------------------
H0UTL9_CAVPO/9-81--------------------------------------------------------------------------------
J9KG38_ACYPI/2-74--------------------------------------------------------------------------------
G1RE60_NOMLE/18-95--------------------------------------------------------------------------------
E9GQM1_DAPPU/5-81--------------------------------------------------------------------------------
G3NPN2_GASAC/9-83--------------------------------------------------------------------------------
W5NBD2_LEPOC/38-112--------------------------------------------------------------------------------
H2MQQ5_ORYLA/41-115--------------------------------------------------------------------------------
M4A767_XIPMA/48-122--------------------------------------------------------------------------------
E0VAJ8_PEDHC/2-72--------------------------------------------------------------------------------
H3AQT6_LATCH/41-115--------------------------------------------------------------------------------
H0YWX9_TAEGU/5-79--------------------------------------------------------------------------------
F8W414_DANRE/20-94--------------------------------------------------------------------------------
H9GDK6_ANOCA/4-77--------------------------------------------------------------------------------
W5K8J5_ASTMX/22-96--------------------------------------------------------------------------------
H3D014_TETNG/5-79--------------------------------------------------------------------------------
H2V7W9_TAKRU/8-82--------------------------------------------------------------------------------
Q0P4E5_DANRE/37-111--------------------------------------------------------------------------------
C3YR00_BRAFL/3-78--------------------------------------------------------------------------------
DFFB_MOUSE/8-82--------------------------------------------------------------------------------
I3M3Q6_SPETR/8-82--------------------------------------------------------------------------------
D6WA34_TRICA/9-83--------------------------------------------------------------------------------
H2PXW1_PANTR/5-79--------------------------------------------------------------------------------
J9JNI3_ACYPI/9-84--------------------------------------------------------------------------------
K1RJK1_CRAGI/5-81--------------------------------------------------------------------------------
W5L119_ASTMX/3-79--------------------------------------------------------------------------------
CIDEA_MOUSE/34-109--------------------------------------------------------------------------------
U3IID5_ANAPL/37-111--------------------------------------------------------------------------------
G3U5M0_LOXAF/18-95--------------------------------------------------------------------------------
E9H9J0_DAPPU/1-78--------------------------------------------------------------------------------
L5M7U1_MYODS/42-117--------------------------------------------------------------------------------
H9KF38_APIME/6-82--------------------------------------------------------------------------------
H9GIB0_ANOCA/12-88--------------------------------------------------------------------------------
W5MFN3_LEPOC/10-84--------------------------------------------------------------------------------
H9J7Z7_BOMMO/2-77--------------------------------------------------------------------------------
W5LKE6_ASTMX/11-85--------------------------------------------------------------------------------
E0VWD7_PEDHC/15-90--------------------------------------------------------------------------------
T1IVD0_STRMM/426-500--------------------------------------------------------------------------------
Q4S0S9_TETNG/16-93--------------------------------------------------------------------------------
H2LKD5_ORYLA/5-80--------------------------------------------------------------------------------
U3JVG4_FICAL/38-112--------------------------------------------------------------------------------
F1R3G3_DANRE/4-80--------------------------------------------------------------------------------
H9G8X7_ANOCA/84-158--------------------------------------------------------------------------------
F4WNU5_ACREC/7-80--------------------------------------------------------------------------------
B0WG49_CULQU/5-75--------------------------------------------------------------------------------
Q66IL3_XENTR/38-112--------------------------------------------------------------------------------
I3LN88_PIG/8-82--------------------------------------------------------------------------------
W5MHN8_LEPOC/4-80--------------------------------------------------------------------------------
G6DK22_DANPL/2-77--------------------------------------------------------------------------------
Q5CZL3_XENTR/20-97--------------------------------------------------------------------------------
M3ZSJ8_XIPMA/8-82--------------------------------------------------------------------------------
H9GEE2_ANOCA/31-105--------------------------------------------------------------------------------
H3BIK5_LATCH/10-84--------------------------------------------------------------------------------
M3XLB3_LATCH/37-111--------------------------------------------------------------------------------
T1KZJ4_TETUR/5-83--------------------------------------------------------------------------------

PF11973

NQRA_NEIMB/262-312--------------------------------------------------------------------------------
NQRA_HAEDU/259-309--------------------------------------------------------------------------------
NQRA_VIBVY/261-311--------------------------------------------------------------------------------
A2U3T1_9FLAO/261-310--------------------------------------------------------------------------------
NQRA_ALCBS/263-313--------------------------------------------------------------------------------
A8ZWA6_DESOH/264-312--------------------------------------------------------------------------------
NQRA_ACTSZ/259-309--------------------------------------------------------------------------------
Q8EIE0_SHEON/270-320--------------------------------------------------------------------------------
A4ATH7_MARSH/262-312--------------------------------------------------------------------------------
NQRA_PSYIN/261-311--------------------------------------------------------------------------------
A1U1Z3_MARAV/265-316--------------------------------------------------------------------------------
NQRA_CHRSD/263-314--------------------------------------------------------------------------------
Q4FPV7_PSYA2/265-315--------------------------------------------------------------------------------
A3UAF5_CROAH/263-312--------------------------------------------------------------------------------
Q8A8K7_BACTN/262-312--------------------------------------------------------------------------------
NQRA_PHOLL/262-312--------------------------------------------------------------------------------
Q6AM94_DESPS/260-310--------------------------------------------------------------------------------
A4CPG3_ROBBH/263-313--------------------------------------------------------------------------------
Q15YQ6_PSEA6/272-322--------------------------------------------------------------------------------
B3EPP3_CHLPB/267-316--------------------------------------------------------------------------------
Q487E1_COLP3/260-310--------------------------------------------------------------------------------
NQRA_RHOBA/270-321--------------------------------------------------------------------------------
A5WBL9_PSYWF/269-319--------------------------------------------------------------------------------
NQRA_SERP5/264-314--------------------------------------------------------------------------------
NQRA_KLEP7/262-312--------------------------------------------------------------------------------
A0LYE0_GRAFK/263-310--------------------------------------------------------------------------------
A3QGH7_SHELP/270-320--------------------------------------------------------------------------------
Q604Z5_METCA/264-315--------------------------------------------------------------------------------
NQRA_HAHCH/262-312--------------------------------------------------------------------------------
A6LB24_PARD8/261-311--------------------------------------------------------------------------------
Q6MF30_PARUW/276-328--------------------------------------------------------------------------------
Q82SE3_NITEU/265-316--------------------------------------------------------------------------------
A6L599_BACV8/262-312--------------------------------------------------------------------------------
Q5LLJ1_RUEPO/262-313--------------------------------------------------------------------------------
NQRA_CHLTR/269-322--------------------------------------------------------------------------------
A5EUU8_DICNV/264-314--------------------------------------------------------------------------------
NQRA_SACD2/262-312--------------------------------------------------------------------------------
B4S5U5_PROA2/264-313--------------------------------------------------------------------------------
A3I2B1_9BACT/266-315--------------------------------------------------------------------------------
A0KHC6_AERHH/262-311--------------------------------------------------------------------------------
F5HFB1_PORGI/261-312--------------------------------------------------------------------------------
NQRA_HAEIN/263-312--------------------------------------------------------------------------------
NQRA_PSEHT/262-309--------------------------------------------------------------------------------
Q6LTY9_PHOPR/263-309--------------------------------------------------------------------------------
NQRA_YERPE/262-310--------------------------------------------------------------------------------
NQRA_PSEAE/260-309--------------------------------------------------------------------------------

PF10531

TCO2_MOUSE/332-387--------------------------------------------------------------------------------
M9NGQ5_DROME/486-550--------------------------------------------------------------------------------
A6ASG9_VIBCY/280-335--------------------------------------------------------------------------------
Q2BP71_NEPCE/290-339--------------------------------------------------------------------------------
A6FCN1_9GAMM/240-290--------------------------------------------------------------------------------
Q475D3_CUPPJ/342-393--------------------------------------------------------------------------------
E4I500_ENTFC/96-151--------------------------------------------------------------------------------
Q3AHI3_SYNSC/235-290--------------------------------------------------------------------------------
Q3D625_STRAG/74-129--------------------------------------------------------------------------------
A4XKH1_CALS8/69-124--------------------------------------------------------------------------------
A0A017LMV3_ECOLX/296-345--------------------------------------------------------------------------------
Q82SN2_NITEU/194-247--------------------------------------------------------------------------------
Q9WZA6_THEMA/882-937--------------------------------------------------------------------------------
A3MYN9_ACTP2/304-353--------------------------------------------------------------------------------
A3DI53_CLOTH/284-333--------------------------------------------------------------------------------
NUOF_RICFE/241-293--------------------------------------------------------------------------------
Q1DDC8_MYXXD/245-298--------------------------------------------------------------------------------
A5ZM69_9FIRM/173-221--------------------------------------------------------------------------------
D4Q627_LISMN/162-210--------------------------------------------------------------------------------
A3I1W9_9BACT/255-308--------------------------------------------------------------------------------
Q12W77_METBU/282-330--------------------------------------------------------------------------------
Q609Q6_METCA/79-130--------------------------------------------------------------------------------
Q21I18_SACD2/289-338--------------------------------------------------------------------------------
A5N7M5_CLOK5/285-334--------------------------------------------------------------------------------
Q9WZA6_THEMA/803-855--------------------------------------------------------------------------------
A1RI08_SHESW/299-352--------------------------------------------------------------------------------
Q1Q5X5_9BACT/295-343--------------------------------------------------------------------------------
Q67R12_SYMTH/291-339--------------------------------------------------------------------------------
A3N5S8_BURP6/206-259--------------------------------------------------------------------------------
A0LFM7_SYNFM/525-578--------------------------------------------------------------------------------
A9CJA6_AGRT5/241-293--------------------------------------------------------------------------------
B7RVX5_9GAMM/244-295--------------------------------------------------------------------------------
A6EKA2_9SPHI/240-293--------------------------------------------------------------------------------
Q5E6B8_VIBF1/298-348--------------------------------------------------------------------------------
Q47GW4_DECAR/292-339--------------------------------------------------------------------------------
A6F1J2_9ALTE/288-341--------------------------------------------------------------------------------
Q21PI3_SACD2/121-177--------------------------------------------------------------------------------
A5I658_CLOBH/60-115--------------------------------------------------------------------------------
B9M3Y3_GEODF/240-291--------------------------------------------------------------------------------
A0A029S529_STRPY/76-131--------------------------------------------------------------------------------
Q2SIM3_HAHCH/127-183--------------------------------------------------------------------------------
A6LNB4_THEM4/284-336--------------------------------------------------------------------------------
Q0AYU9_SYNWW/231-282--------------------------------------------------------------------------------
A3JTW2_9RHOB/400-450--------------------------------------------------------------------------------
A7BZP7_9GAMM/182-236--------------------------------------------------------------------------------
Q0AAI4_ALKEH/188-241--------------------------------------------------------------------------------
A9BJD0_PETMO/286-335--------------------------------------------------------------------------------
A9A0G2_DESOH/202-255--------------------------------------------------------------------------------
A1U014_MARAV/165-213--------------------------------------------------------------------------------
E8VDQ7_BACST/63-118--------------------------------------------------------------------------------
Q0AAG9_ALKEH/297-346--------------------------------------------------------------------------------
Q30W86_DESAG/164-212--------------------------------------------------------------------------------
Q039L8_LACC3/72-127--------------------------------------------------------------------------------
A7BVF4_9GAMM/51-103--------------------------------------------------------------------------------
Q603B2_METCA/290-339--------------------------------------------------------------------------------
B2T2F2_BURPP/247-297--------------------------------------------------------------------------------
A8F8Q9_THELT/182-235--------------------------------------------------------------------------------
G7QMP4_LEPII/240-291--------------------------------------------------------------------------------
A7HJ14_FERNB/961-1016--------------------------------------------------------------------------------
Q7MFC7_VIBVY/104-156--------------------------------------------------------------------------------
Q6AQ74_DESPS/290-339--------------------------------------------------------------------------------
NQO1_THET8/251-300--------------------------------------------------------------------------------
Q7MKZ6_VIBVY/298-351--------------------------------------------------------------------------------
A4XAF1_SALTO/138-193--------------------------------------------------------------------------------
A0LNJ0_SYNFM/239-294--------------------------------------------------------------------------------
B8G0F4_DESHD/163-211--------------------------------------------------------------------------------
B8CY15_HALOH/287-336--------------------------------------------------------------------------------
A1WT48_HALHL/293-342--------------------------------------------------------------------------------
A5PAR8_9SPHN/137-189--------------------------------------------------------------------------------
Q1YW52_PHOPR/370-423--------------------------------------------------------------------------------
A0AZV6_BURCH/310-367--------------------------------------------------------------------------------
Q64UZ9_BACFR/254-306--------------------------------------------------------------------------------
A4VJ61_PSEU5/289-338--------------------------------------------------------------------------------
Q39VZ5_GEOMG/27-80--------------------------------------------------------------------------------
A6VTE9_MARMS/539-594--------------------------------------------------------------------------------
Q9CER3_LACLA/70-125--------------------------------------------------------------------------------
Q31HF5_THICR/243-293--------------------------------------------------------------------------------
Q8NN61_CORGL/59-113--------------------------------------------------------------------------------
Q03VU1_LEUMM/70-125--------------------------------------------------------------------------------
D2BG77_DEHMV/240-288--------------------------------------------------------------------------------
F0KCN0_CLOAE/61-116--------------------------------------------------------------------------------
A0A022P5J0_PSEAI/288-337--------------------------------------------------------------------------------
Q5E801_VIBF1/122-174--------------------------------------------------------------------------------
Q5NLH4_ZYMMO/289-338--------------------------------------------------------------------------------
Q1IN17_KORVE/292-347--------------------------------------------------------------------------------
A3Z0U5_9SYNE/352-403--------------------------------------------------------------------------------
A6FK42_9RHOB/117-172--------------------------------------------------------------------------------
A0A008ASR0_STAAU/83-137--------------------------------------------------------------------------------
B8G1Q5_DESHD/161-209--------------------------------------------------------------------------------
Q5WHH4_BACSK/63-118--------------------------------------------------------------------------------
TCO1_HUMAN/339-395--------------------------------------------------------------------------------
A0XZ21_9GAMM/281-333--------------------------------------------------------------------------------
E2XBA8_SHIDY/256-313--------------------------------------------------------------------------------
A5HYR2_CLOBH/286-335--------------------------------------------------------------------------------
Q3ETX3_BACTI/15-81--------------------------------------------------------------------------------
B1KGW6_SHEWM/303-352--------------------------------------------------------------------------------
Q7NII2_GLOVI/252-307--------------------------------------------------------------------------------
Q7P7D0_FUSNV/128-177--------------------------------------------------------------------------------
A0YJY0_LYNSP/655-710--------------------------------------------------------------------------------
A5IKH7_THEP1/283-332--------------------------------------------------------------------------------
A9B4Z9_HERA2/244-296--------------------------------------------------------------------------------
Q8KX81_AERHY/147-201--------------------------------------------------------------------------------
Q1RPC7_ECOLX/169-217--------------------------------------------------------------------------------
A0YXY1_LYNSP/357-413--------------------------------------------------------------------------------
Q6MDR1_PARUW/241-291--------------------------------------------------------------------------------
Q608R0_METCA/226-280--------------------------------------------------------------------------------
A6TJY1_ALKMQ/161-209--------------------------------------------------------------------------------
H3UIV4_STAEP/81-135--------------------------------------------------------------------------------
A6BIL3_9FIRM/286-335--------------------------------------------------------------------------------
Q3KCF0_PSEPF/103-155--------------------------------------------------------------------------------
B3EJT6_CHLPB/286-335--------------------------------------------------------------------------------
A2SJE9_METPP/201-256--------------------------------------------------------------------------------
Q02B56_SOLUE/158-206--------------------------------------------------------------------------------
A8ZSV2_DESOH/302-351--------------------------------------------------------------------------------
A9KHN6_CLOPH/85-140--------------------------------------------------------------------------------
A8FXR3_SHESH/299-352--------------------------------------------------------------------------------
A5ZMX0_9FIRM/436-485--------------------------------------------------------------------------------
Q0F0I1_9PROT/304-353--------------------------------------------------------------------------------
C8K0R7_LISMN/71-126--------------------------------------------------------------------------------
A0A016B2Y3_BACFG/359-411--------------------------------------------------------------------------------
Q8DI24_THEEB/259-315--------------------------------------------------------------------------------
B5E8N7_GEOBB/420-475--------------------------------------------------------------------------------
A1WTR7_HALHL/292-341--------------------------------------------------------------------------------
A4BYL4_9FLAO/317-369--------------------------------------------------------------------------------
Q2S4Z6_SALRD/572-633--------------------------------------------------------------------------------
A6VTE9_MARMS/281-333--------------------------------------------------------------------------------
Q6SGV1_9BACT/105-157--------------------------------------------------------------------------------
A5ZDD7_9BACE/288-337--------------------------------------------------------------------------------
A5EVI2_DICNV/295-343--------------------------------------------------------------------------------
A5N6H2_CLOK5/161-209--------------------------------------------------------------------------------
Q46SE6_CUPPJ/239-290--------------------------------------------------------------------------------
Q603I4_METCA/299-348--------------------------------------------------------------------------------
A7B491_RUMGN/68-123--------------------------------------------------------------------------------
A3ERW5_9BACT/117-169--------------------------------------------------------------------------------
F4AFD3_LACJH/80-135--------------------------------------------------------------------------------
C0FSK0_9FIRM/164-212--------------------------------------------------------------------------------
B4SFP0_PELPB/166-219--------------------------------------------------------------------------------
Q0VR45_ALCBS/173-226--------------------------------------------------------------------------------
C3F778_BACTU/64-119--------------------------------------------------------------------------------

PF06251

Q15QX9_PSEA6/17-247SCVTSANVTIKWN.EVDYTFDSTVRLTDVLSKLD............LNTNIYWPSAALF.IPNDVTLERARRSSLSNLNI
Q6D778_PECAS/20-259SAQLTVKSPQETI..AVVKLDDGTRLEKFYEQVS............WPQNINWQTAFISDFATTQKVRVQGDVLLQKLAE
Q7MPN4_VIBVY/33-265HIQQPTEVVLLNY.GLQLNYPQPVRLEQVLLDAQQQNRQQNGSPNAQALSFH.EGFQLFNLDKQAEADAQLQHVRQQLIE
Q5E8J3_VIBF1/22-253SSTQAVSVTLPNQ.NLVLNYSQPVRLEQVILDAN............AQVNFYSLGAALSDNQLQKDIDNLRNNSIEQLSS
GFCC_ECOLI/21-248FAQGTVTIYLPGE.QQTLSVGPVENVVQLVTQPQ............LRDRLWWPGALLTDSAAKAKALKDYQHVMAQLAS
A0KM78_AERHH/18-252WADATISIWWKGKPVKDLYYAKQITLSSALSDPAI...........LSYDSYWPVGQISTPARQQELEHQRQVLLADLTV
F7YJH4_VIBA7/59-287..ASVVEVRSADTPALSLSFASVPRVDELVINALNAS.......AQLPADIDWLSSALFDV...SSPYQKKQQVLLAITH
Q328Y3_SHIDS/20-245.AAGTVKVFSNGS.SEAKTLTGAEHLIDLVGQP.............RLANSWWPGAVISEELATAAALRQQQALLTRLAE
Q8ZKI2_SALTY/20-244.ASGTVTVFTQGN.SEPKTLTDAERLLDLVGQP.............RLATSWWPAAVIGEEQATVTARQQQQELLGRLAV

PF13019

Q4WLQ9_ASPFU/6-176--------------------------------------------------------------------------------
A2QLN4_ASPNC/6-175--------------------------------------------------------------------------------
B6HPD9_PENCW/6-174--------------------------------------------------------------------------------
B6QDL0_PENMQ/6-178--------------------------------------------------------------------------------
C1GB64_PARBD/6-177--------------------------------------------------------------------------------
C4JSH4_UNCRE/6-176--------------------------------------------------------------------------------
D4ATG1_ARTBC/6-181--------------------------------------------------------------------------------
A8NTG8_COPC7/7-164--------------------------------------------------------------------------------
B8NZC7_POSPM/1-158--------------------------------------------------------------------------------
Q5KEV9_CRYNJ/4-154--------------------------------------------------------------------------------
SDE2_SCHPO/4-160--------------------------------------------------------------------------------
Q0UKG5_PHANO/9-167--------------------------------------------------------------------------------
C9SK56_VERA1/6-169--------------------------------------------------------------------------------
B2B1E0_PODAN/8-174--------------------------------------------------------------------------------
Q2GVT4_CHAGB/6-186--------------------------------------------------------------------------------
C7YPG6_NECH7/6-168--------------------------------------------------------------------------------
Q8LHF3_ORYSJ/7-183--------------------------------------------------------------------------------

PF06071

D3F2Y1_CONWI/274-357--------------------------------------------------------------------------------
B3EMH3_CHLPB/279-362--------------------------------------------------------------------------------
D9QUL3_ACEAZ/281-364--------------------------------------------------------------------------------
F2I8P1_AERUA/281-364--------------------------------------------------------------------------------
A9UXF4_MONBE/310-392--------------------------------------------------------------------------------
W8GT98_9MOLU/282-365--------------------------------------------------------------------------------
W0E025_MARPU/279-362--------------------------------------------------------------------------------
W0A4A4_9SPHN/282-365--------------------------------------------------------------------------------
C3PFE0_CORA7/277-359--------------------------------------------------------------------------------
R6D6P6_9CLOT/281-364--------------------------------------------------------------------------------
H2J4X8_MARPK/275-358--------------------------------------------------------------------------------
V9TUB2_9PROT/283-366--------------------------------------------------------------------------------
E4TSF1_MARTH/281-364--------------------------------------------------------------------------------
V5EAH6_PSEBG/373-454--------------------------------------------------------------------------------
B9L9L4_NAUPA/280-363--------------------------------------------------------------------------------
Q586U4_TRYB2/304-387--------------------------------------------------------------------------------
C7NA33_LEPBD/283-366--------------------------------------------------------------------------------
R5MCX8_9MOLU/282-365--------------------------------------------------------------------------------
A1AM06_PELPD/280-363--------------------------------------------------------------------------------
H8KRC3_SOLCM/281-364--------------------------------------------------------------------------------
C8X2N0_DESRD/283-366--------------------------------------------------------------------------------
C7M399_ACIFD/275-356--------------------------------------------------------------------------------
R6H3G3_9FIRM/281-364--------------------------------------------------------------------------------
E1SSA2_FERBD/279-362--------------------------------------------------------------------------------
R5QDB9_9FIRM/282-365--------------------------------------------------------------------------------
K9RN32_9CYAN/279-362--------------------------------------------------------------------------------
B8E098_DICTD/250-332--------------------------------------------------------------------------------
A0LQI7_SYNFM/263-346--------------------------------------------------------------------------------
A5DLY4_PICGU/309-393--------------------------------------------------------------------------------
G1WZS2_ARTOA/306-388--------------------------------------------------------------------------------
F2I0I7_PELSM/257-340--------------------------------------------------------------------------------
T2G6H0_DESGI/282-365--------------------------------------------------------------------------------
W1Q8V5_OGAPD/307-390--------------------------------------------------------------------------------
D8LZH2_BLAHO/323-406--------------------------------------------------------------------------------
F7QF94_9BRAD/281-364--------------------------------------------------------------------------------
A5IYH1_MYCAP/283-365--------------------------------------------------------------------------------
R7PR57_9FIRM/284-367--------------------------------------------------------------------------------
C0QTJ3_PERMH/286-369--------------------------------------------------------------------------------
I2F4B2_9THEM/275-358--------------------------------------------------------------------------------
X6M6X9_RETFI/358-441--------------------------------------------------------------------------------
Q82TQ7_NITEU/279-362--------------------------------------------------------------------------------
I1RGA6_GIBZE/307-389--------------------------------------------------------------------------------
A4S253_OSTLU/312-397--------------------------------------------------------------------------------
D6YVQ6_WADCW/282-363--------------------------------------------------------------------------------
D5E4T2_MYCCM/283-365--------------------------------------------------------------------------------
R7GN86_9FIRM/282-365--------------------------------------------------------------------------------
F2NH69_DESAR/147-228--------------------------------------------------------------------------------
B6K7Z9_SCHJY/307-389--------------------------------------------------------------------------------
B5YKH5_THEYD/265-347--------------------------------------------------------------------------------
D6ZK59_MOBCV/277-360--------------------------------------------------------------------------------
A7TM36_VANPO/320-405--------------------------------------------------------------------------------
F6FHR6_MYCHI/270-353--------------------------------------------------------------------------------
L0B6G4_9PROT/279-362--------------------------------------------------------------------------------
D7G6Q9_ECTSI/329-412--------------------------------------------------------------------------------
D5EDD8_AMICL/278-362--------------------------------------------------------------------------------
A0A023BDA3_GRENI/290-373--------------------------------------------------------------------------------
F0NXV5_WEEVC/279-362--------------------------------------------------------------------------------
B3QT44_CHLT3/279-362--------------------------------------------------------------------------------
D6Y1K7_BACIE/282-365--------------------------------------------------------------------------------
F0T2X8_SYNGF/282-365--------------------------------------------------------------------------------
L2GMJ2_VITCO/311-394--------------------------------------------------------------------------------
F5WVB5_ERYRF/283-366--------------------------------------------------------------------------------
K9UF02_9CHRO/279-360--------------------------------------------------------------------------------
D4KAZ8_9FIRM/292-376--------------------------------------------------------------------------------
E1QY66_OLSUV/269-352--------------------------------------------------------------------------------
A2ER05_TRIVA/299-380--------------------------------------------------------------------------------
I4BBW7_TURPD/295-377--------------------------------------------------------------------------------
A7HIW6_ANADF/286-369--------------------------------------------------------------------------------
C5LL77_PERM5/329-407--------------------------------------------------------------------------------
J9D7U5_EDHAE/284-367--------------------------------------------------------------------------------
I5B0B9_9DELT/272-354--------------------------------------------------------------------------------
V5RWG0_9BACT/274-357--------------------------------------------------------------------------------
U9TTS5_RHIID/309-390--------------------------------------------------------------------------------
C4YB69_CLAL4/348-432--------------------------------------------------------------------------------
B9E8Y7_MACCJ/282-365--------------------------------------------------------------------------------
B1ZVL1_OPITP/150-232--------------------------------------------------------------------------------
O84094_CHLTR/283-366--------------------------------------------------------------------------------
B9I0J5_POPTR/198-293--------------------------------------------------------------------------------
R6YXQ1_9FIRM/284-367--------------------------------------------------------------------------------
R7K926_9FIRM/277-360--------------------------------------------------------------------------------
I0IMR1_LEPFC/280-363--------------------------------------------------------------------------------
C5DGQ9_LACTC/324-409--------------------------------------------------------------------------------
A9B1D6_HERA2/276-359--------------------------------------------------------------------------------
E4RL97_HALHG/279-362--------------------------------------------------------------------------------
E1ZG20_CHLVA/300-383--------------------------------------------------------------------------------
R5SPF1_9CLOT/280-363--------------------------------------------------------------------------------
S6A8B7_9SPIO/284-367--------------------------------------------------------------------------------
W0J8V0_9BACT/283-366--------------------------------------------------------------------------------
Q6BIE5_DEBHA/325-409--------------------------------------------------------------------------------
A0DJ80_PARTE/285-367--------------------------------------------------------------------------------
B8F988_DESAA/260-341--------------------------------------------------------------------------------
U6B8Z6_9RHIZ/283-366--------------------------------------------------------------------------------
C4VA82_NOSCE/288-371--------------------------------------------------------------------------------
R6GSX4_9FIRM/278-361--------------------------------------------------------------------------------
V6DKP8_9DELT/287-370--------------------------------------------------------------------------------
Q2GIK1_ANAPZ/279-362--------------------------------------------------------------------------------
U5T808_9GAMM/267-350--------------------------------------------------------------------------------
E1X178_BACMS/285-368--------------------------------------------------------------------------------
G8JSA7_ERECY/342-427--------------------------------------------------------------------------------
R7MFV1_9CLOT/282-365--------------------------------------------------------------------------------
A9NG41_ACHLI/282-365--------------------------------------------------------------------------------
I0FC09_BORCA/284-367--------------------------------------------------------------------------------
F7XTT7_MIDMI/280-360--------------------------------------------------------------------------------
V5RTD1_9BACT/287-369--------------------------------------------------------------------------------
E1R4R3_SPISS/285-368--------------------------------------------------------------------------------
F8F3Y1_TRECH/285-368--------------------------------------------------------------------------------
A9BG26_PETMO/276-357--------------------------------------------------------------------------------
Q3B243_PELLD/279-362--------------------------------------------------------------------------------
F4NZZ0_BATDJ/306-392--------------------------------------------------------------------------------
F9YQL1_CAPCC/279-362--------------------------------------------------------------------------------
R5B3D9_9CLOT/290-373--------------------------------------------------------------------------------
J9YZ29_9PROT/278-360--------------------------------------------------------------------------------
S7W5T3_SPRLO/363-450--------------------------------------------------------------------------------
R6UP56_9FIRM/283-366--------------------------------------------------------------------------------
F0S3E0_DESTD/282-365--------------------------------------------------------------------------------
L0EJH8_THECK/282-365--------------------------------------------------------------------------------
W5V146_9MOLU/283-366--------------------------------------------------------------------------------
G8B8Y4_CANPC/306-389--------------------------------------------------------------------------------
K3WZY0_PYTUL/274-356--------------------------------------------------------------------------------
A3M0J8_PICST/310-394--------------------------------------------------------------------------------
C7RHW3_ANAPD/281-364--------------------------------------------------------------------------------
V6F6N6_9PROT/283-366--------------------------------------------------------------------------------
G0NDJ2_CAEBE/301-384--------------------------------------------------------------------------------
F9ZMP0_ACICS/279-362--------------------------------------------------------------------------------
B8C5C0_THAPS/279-362--------------------------------------------------------------------------------
R7DN82_9FIRM/284-367--------------------------------------------------------------------------------
D8LSE9_ECTSI/307-390--------------------------------------------------------------------------------
B0S0L2_FINM2/281-364--------------------------------------------------------------------------------
R7F2W9_9BACI/282-365--------------------------------------------------------------------------------
Q54CY8_DICDI/325-409--------------------------------------------------------------------------------
K7SB96_GLUOY/280-363--------------------------------------------------------------------------------
D6GR42_FILAD/280-364--------------------------------------------------------------------------------
Q7AQ18_MYCLE/273-354--------------------------------------------------------------------------------
E1QKV3_DESB2/256-338--------------------------------------------------------------------------------
C1F914_ACIC5/281-364--------------------------------------------------------------------------------
A5EX41_DICNV/279-362--------------------------------------------------------------------------------
A0RQ41_CAMFF/283-366--------------------------------------------------------------------------------
R5ZA97_9FIRM/283-366--------------------------------------------------------------------------------
G0W5Y9_NAUDC/321-406--------------------------------------------------------------------------------
C6X7S9_METGS/277-360--------------------------------------------------------------------------------
Q6F0F7_MESFL/280-363--------------------------------------------------------------------------------
G7LZR1_9CLOT/281-364--------------------------------------------------------------------------------
S9XHW5_SCHCR/326-408--------------------------------------------------------------------------------
E6SJG6_THEM7/272-355--------------------------------------------------------------------------------
F0RSY8_SPHGB/285-367--------------------------------------------------------------------------------
R5T189_9CLOT/282-365--------------------------------------------------------------------------------
I3VVL8_THESW/279-362--------------------------------------------------------------------------------
R7FLB9_9CLOT/283-366--------------------------------------------------------------------------------
D8M6E3_BLAHO/213-294--------------------------------------------------------------------------------
Q6AQ62_DESPS/281-364--------------------------------------------------------------------------------
K3W730_PYTUL/305-388--------------------------------------------------------------------------------
M4ZTG7_9FLAO/256-338--------------------------------------------------------------------------------
D0MK23_RHOM4/282-365--------------------------------------------------------------------------------
F8KXZ5_PARAV/281-364--------------------------------------------------------------------------------
Q1QXD4_CHRSD/279-362--------------------------------------------------------------------------------
B2A457_NATTJ/284-367--------------------------------------------------------------------------------
G8YL69_PICSO/324-409--------------------------------------------------------------------------------
D2VQZ2_NAEGR/269-352--------------------------------------------------------------------------------
E1F5U1_GIAIA/316-399--------------------------------------------------------------------------------
Q8RDX8_FUSNN/280-363--------------------------------------------------------------------------------
Q0AXS2_SYNWW/270-353--------------------------------------------------------------------------------
L0KEJ1_HALHC/281-364--------------------------------------------------------------------------------
A9V629_MONBE/305-388--------------------------------------------------------------------------------
R7EYQ8_9BACT/45-128--------------------------------------------------------------------------------
E9CH21_CAPO3/369-450--------------------------------------------------------------------------------
F6CLX4_DESK7/279-362--------------------------------------------------------------------------------
A0DV36_PARTE/299-382--------------------------------------------------------------------------------
C5K9C2_PERM5/306-389--------------------------------------------------------------------------------
W0RI91_9BACT/282-365--------------------------------------------------------------------------------
I0IBH8_PHYMF/287-368--------------------------------------------------------------------------------
K7RVB6_PROA4/273-355--------------------------------------------------------------------------------
R6FY26_9FIRM/281-364--------------------------------------------------------------------------------
U3U9L5_9BACT/279-361--------------------------------------------------------------------------------
G8BQR8_TETPH/329-415--------------------------------------------------------------------------------
I4C2Y3_DESTA/274-356--------------------------------------------------------------------------------
J3TGB2_9ENTR/278-361--------------------------------------------------------------------------------
A5CF36_ORITB/282-365--------------------------------------------------------------------------------
F4Q953_DICFS/302-377--------------------------------------------------------------------------------
A8I882_CHLRE/310-396--------------------------------------------------------------------------------
O83161_TREPA/284-367--------------------------------------------------------------------------------
L0DL94_SINAD/257-337--------------------------------------------------------------------------------
G8ZQ73_TORDC/314-399--------------------------------------------------------------------------------
D2RNC2_ACIFV/285-368--------------------------------------------------------------------------------
U5H5A4_USTV1/312-395--------------------------------------------------------------------------------
E1ZJW4_CHLVA/286-368--------------------------------------------------------------------------------
E4XHS9_OIKDI/309-392--------------------------------------------------------------------------------
R5MDR3_9FIRM/280-363--------------------------------------------------------------------------------
M9W913_9MOLU/280-363--------------------------------------------------------------------------------
YCHF_BUCAI/278-361--------------------------------------------------------------------------------
K4L8N3_9FIRM/282-365--------------------------------------------------------------------------------
R5EKF0_9CLOT/280-363--------------------------------------------------------------------------------
G2LG11_CHLTF/268-351--------------------------------------------------------------------------------
F7XXR9_MOREP/279-362--------------------------------------------------------------------------------
H0UXC5_CAVPO/11-94--------------------------------------------------------------------------------
O25293_HELPY/282-365--------------------------------------------------------------------------------
I1CE69_RHIO9/280-363--------------------------------------------------------------------------------
W8T635_EUBAC/280-363--------------------------------------------------------------------------------
R5AJL3_9BACT/283-366--------------------------------------------------------------------------------
R4XCI1_TAPDE/310-392--------------------------------------------------------------------------------
D1CD91_THET1/266-349--------------------------------------------------------------------------------
B5HXP7_9ACTO/278-361--------------------------------------------------------------------------------
B1I6T3_DESAP/239-322--------------------------------------------------------------------------------
G0GFI9_SPITZ/285-368--------------------------------------------------------------------------------
F0JHI3_DESDE/253-336--------------------------------------------------------------------------------
O51251_BORBU/284-367--------------------------------------------------------------------------------
D0LU81_HALO1/264-347--------------------------------------------------------------------------------
W0GNM5_9MOLU/282-365--------------------------------------------------------------------------------
F6B731_DESCC/282-365--------------------------------------------------------------------------------
Q6FN34_CANGA/336-421--------------------------------------------------------------------------------
I0I5D3_CALAS/282-365--------------------------------------------------------------------------------
Q3ZAE8_DEHM1/283-366--------------------------------------------------------------------------------
U5Q2B8_9BACT/283-366--------------------------------------------------------------------------------
B0TA60_HELMI/282-365--------------------------------------------------------------------------------
F7YWD8_9THEM/277-359--------------------------------------------------------------------------------
Q1MS23_LAWIP/282-365--------------------------------------------------------------------------------
K7X980_MYCHR/283-365--------------------------------------------------------------------------------
A8ESS4_ARCB4/283-366--------------------------------------------------------------------------------
Q83AN9_COXBU/283-365--------------------------------------------------------------------------------
R6R1F6_9FIRM/283-366--------------------------------------------------------------------------------
D4H1D1_DENA2/280-363--------------------------------------------------------------------------------
A5DLV3_PICGU/110-192--------------------------------------------------------------------------------
D9S1Y0_THEOJ/280-363--------------------------------------------------------------------------------
D7CTW4_TRURR/277-360--------------------------------------------------------------------------------
G3AWM5_CANTC/311-398--------------------------------------------------------------------------------
R5WIC9_9DELT/279-362--------------------------------------------------------------------------------
R6UK31_9CLOT/280-363--------------------------------------------------------------------------------
R6P360_9FIRM/280-363--------------------------------------------------------------------------------
K8EW69_CARML/282-365--------------------------------------------------------------------------------
Q02B74_SOLUE/274-355--------------------------------------------------------------------------------
Q83MS1_TROWT/260-342--------------------------------------------------------------------------------
Q2LYC3_SYNAS/268-351--------------------------------------------------------------------------------
F0ZZE8_DICPU/305-387--------------------------------------------------------------------------------
K1WK47_MARBU/310-392--------------------------------------------------------------------------------
R6XEA3_9FIRM/281-364--------------------------------------------------------------------------------
B3QZQ1_PHYMT/281-364--------------------------------------------------------------------------------
C5E4G3_ZYGRC/313-398--------------------------------------------------------------------------------
G0QUP8_ICHMG/271-352--------------------------------------------------------------------------------
Q2NAN6_ERYLH/282-365--------------------------------------------------------------------------------
T1JKL5_STRMM/43-119--------------------------------------------------------------------------------
A9WPD9_RENSM/341-424--------------------------------------------------------------------------------
F2NI66_DESAR/279-361--------------------------------------------------------------------------------
Q057U9_BUCCC/263-346--------------------------------------------------------------------------------
R6H5S9_9ACTN/270-353--------------------------------------------------------------------------------
I6Z8V7_MELRP/276-359--------------------------------------------------------------------------------
B0VG33_CLOAI/275-357--------------------------------------------------------------------------------
F4PFB4_BATDJ/317-399--------------------------------------------------------------------------------
R7NEX9_9MOLU/282-365--------------------------------------------------------------------------------
Q01ER9_OSTTA/336-419--------------------------------------------------------------------------------
X5DSP8_9CORY/277-360--------------------------------------------------------------------------------
A1WVQ0_HALHL/279-362--------------------------------------------------------------------------------
H9UG17_SPIAZ/285-368--------------------------------------------------------------------------------
F8I0K9_WEIKK/282-365--------------------------------------------------------------------------------
L8FWM9_PSED2/310-397--------------------------------------------------------------------------------
F0Y4G9_AURAN/312-399--------------------------------------------------------------------------------
B8D1D0_HALOH/280-363--------------------------------------------------------------------------------
YEAD_SCHPO/323-405--------------------------------------------------------------------------------
A5V637_SPHWW/282-365--------------------------------------------------------------------------------
Q59RJ0_CANAL/313-396--------------------------------------------------------------------------------
F8AD90_THEID/260-342--------------------------------------------------------------------------------
Q0BPN6_GRABC/280-363--------------------------------------------------------------------------------
YCHF_BUCBP/279-361--------------------------------------------------------------------------------
L0A0C6_DEIPD/281-364--------------------------------------------------------------------------------
M1E5Z2_9FIRM/264-346--------------------------------------------------------------------------------
D2QKU9_SPILD/282-363--------------------------------------------------------------------------------
Q73HU8_WOLPM/281-363--------------------------------------------------------------------------------
Q4DNY5_TRYCC/284-362--------------------------------------------------------------------------------
R6DY10_9FIRM/241-325--------------------------------------------------------------------------------
U4L290_PYROM/309-395--------------------------------------------------------------------------------
A8F5U9_THELT/277-359--------------------------------------------------------------------------------
R6P3U8_9CLOT/281-363--------------------------------------------------------------------------------
D2UZT5_NAEGR/294-377--------------------------------------------------------------------------------
B6H8T7_PENCW/307-389--------------------------------------------------------------------------------
A9CTA6_ENTBH/281-364--------------------------------------------------------------------------------
Q2RFN0_MOOTA/273-356--------------------------------------------------------------------------------
S5MKM8_9MOLU/281-364--------------------------------------------------------------------------------
B9L188_THERP/283-366--------------------------------------------------------------------------------
Q92N65_RHIME/283-366--------------------------------------------------------------------------------
R5JM46_9FIRM/281-364--------------------------------------------------------------------------------
R6XQ89_9BACT/283-366--------------------------------------------------------------------------------
I7LUN5_TETTS/312-393--------------------------------------------------------------------------------
A7TEI5_VANPO/306-388--------------------------------------------------------------------------------
K0AYF5_CLOA9/279-362--------------------------------------------------------------------------------
W5X0E3_BDEBC/282-365--------------------------------------------------------------------------------
I4BY84_ANAMD/281-365--------------------------------------------------------------------------------
Q2S6K6_SALRD/316-399--------------------------------------------------------------------------------
F4GKC3_SPICD/280-363--------------------------------------------------------------------------------
R5JB25_9FIRM/281-364--------------------------------------------------------------------------------
W1QJ12_OGAPD/294-376--------------------------------------------------------------------------------
C4LSZ7_ENTHI/305-388--------------------------------------------------------------------------------
R7P7S5_9CLOT/282-365--------------------------------------------------------------------------------
D1AX95_STRM9/282-365--------------------------------------------------------------------------------
Q5NGZ7_FRATT/279-362--------------------------------------------------------------------------------
M4BZR8_HYAAE/232-314--------------------------------------------------------------------------------
Q099K6_STIAD/285-368--------------------------------------------------------------------------------
R7JUV4_9FIRM/281-364--------------------------------------------------------------------------------
Q8SRN9_ENCCU/277-360--------------------------------------------------------------------------------
Q1ILQ1_KORVE/277-357--------------------------------------------------------------------------------
F8WJY6_MYCGA/283-366--------------------------------------------------------------------------------
E6TZX7_BACCJ/282-365--------------------------------------------------------------------------------
F8E3U9_FLESM/279-362--------------------------------------------------------------------------------
R7CL44_9FIRM/284-367--------------------------------------------------------------------------------
V4J9W5_9DELT/60-141--------------------------------------------------------------------------------
R7GJ72_9CLOT/283-365--------------------------------------------------------------------------------
D3PR84_MEIRD/288-371--------------------------------------------------------------------------------
F0STA0_PLABD/280-362--------------------------------------------------------------------------------
V5WKG7_9SPIO/285-368--------------------------------------------------------------------------------
Q8EKV3_OCEIH/282-365--------------------------------------------------------------------------------
Q4FPG8_PELUB/273-356--------------------------------------------------------------------------------
U6ILW8_HYMMI/303-386--------------------------------------------------------------------------------
R7D511_9ACTN/274-357--------------------------------------------------------------------------------
Q47Y86_COLP3/279-362--------------------------------------------------------------------------------
D1C700_SPHTD/284-367--------------------------------------------------------------------------------
R7JPR2_9BACT/282-365--------------------------------------------------------------------------------
R5I0D4_9BACT/282-365--------------------------------------------------------------------------------
M5A5E8_9ACTN/278-361--------------------------------------------------------------------------------
K4IMK0_PSYTT/281-363--------------------------------------------------------------------------------
E9ADG1_LEIMA/286-363--------------------------------------------------------------------------------
E8RJ73_DESPD/281-364--------------------------------------------------------------------------------
Q8IBM9_PLAF7/303-386--------------------------------------------------------------------------------
M1NEP0_DESSD/281-364--------------------------------------------------------------------------------
M5EC44_MALS4/312-394--------------------------------------------------------------------------------
I4AQ11_FLELS/281-364--------------------------------------------------------------------------------
H0UMJ2_9BACT/278-361--------------------------------------------------------------------------------
Q6CBV0_YARLI/356-439--------------------------------------------------------------------------------
E0UT48_SULAO/282-365--------------------------------------------------------------------------------
Q75DI5_ASHGO/322-407--------------------------------------------------------------------------------
G4T5T2_PIRID/309-391--------------------------------------------------------------------------------
C0Q8X2_DESAH/285-368--------------------------------------------------------------------------------
D5EJM3_CORAD/283-366--------------------------------------------------------------------------------
G8PB02_PEDCP/284-367--------------------------------------------------------------------------------
F2LU33_HIPMA/279-362--------------------------------------------------------------------------------
A6TS78_ALKMQ/280-363--------------------------------------------------------------------------------
W0F649_9SPHI/281-364--------------------------------------------------------------------------------
R7ITH9_9CLOT/279-362--------------------------------------------------------------------------------
Q4AA46_MYCHJ/283-365--------------------------------------------------------------------------------
Q7VB66_PROMA/279-362--------------------------------------------------------------------------------
A6LLV7_THEM4/271-354--------------------------------------------------------------------------------
F1TJU6_COREQ/275-358--------------------------------------------------------------------------------
L7K0I6_TRAHO/268-351--------------------------------------------------------------------------------
F8I4L3_SULAT/294-376--------------------------------------------------------------------------------
I1C290_RHIO9/307-390--------------------------------------------------------------------------------
E8RMK2_ASTEC/286-369--------------------------------------------------------------------------------
S0EV28_CHTCT/279-362--------------------------------------------------------------------------------
G2TIG7_BACCO/282-365--------------------------------------------------------------------------------
G0VR22_MEGEL/284-367--------------------------------------------------------------------------------
R5Q1I6_9PROT/283-366--------------------------------------------------------------------------------
C4L007_EXISA/282-365--------------------------------------------------------------------------------
C5CIW5_KOSOT/275-358--------------------------------------------------------------------------------
Q8R9F4_THETN/279-362--------------------------------------------------------------------------------
C0ZA48_BREBN/282-365--------------------------------------------------------------------------------
Q24MB6_DESHY/282-365--------------------------------------------------------------------------------
W5X647_9BACT/268-349--------------------------------------------------------------------------------
C5YIF5_SORBI/15-98--------------------------------------------------------------------------------
B9GJZ9_POPTR/344-427--------------------------------------------------------------------------------
A5USV6_ROSS1/276-359--------------------------------------------------------------------------------
C4XI32_DESMR/285-368--------------------------------------------------------------------------------
Q9ZCV5_RICPR/281-364--------------------------------------------------------------------------------
R6G0M1_9FIRM/281-364--------------------------------------------------------------------------------
F6IPG0_9SPHN/282-365--------------------------------------------------------------------------------
B1WC04_RAT/449-526--------------------------------------------------------------------------------
Q98R45_MYCPU/285-367--------------------------------------------------------------------------------
B4U7U1_HYDS0/284-367--------------------------------------------------------------------------------
Q6CIM0_KLULA/319-404--------------------------------------------------------------------------------
C4QXB1_PICPG/305-390--------------------------------------------------------------------------------
X5H510_9RICK/246-327--------------------------------------------------------------------------------
Q8EU98_MYCPE/281-364--------------------------------------------------------------------------------
F0Y8J3_AURAN/372-454--------------------------------------------------------------------------------
I2EVP1_EMTOG/283-366--------------------------------------------------------------------------------
D5MEU1_9BACT/276-358--------------------------------------------------------------------------------
K0K9D8_WICCF/316-401--------------------------------------------------------------------------------
G0V8L9_NAUCC/321-406--------------------------------------------------------------------------------
H6LAU8_SAPGL/283-366--------------------------------------------------------------------------------
W6AB65_9MOLU/281-364--------------------------------------------------------------------------------
D5GNQ9_TUBMM/307-389--------------------------------------------------------------------------------
Q12R18_SHEDO/279-362--------------------------------------------------------------------------------
E9C9A1_CAPO3/302-385--------------------------------------------------------------------------------
G7V7D7_THELD/279-363--------------------------------------------------------------------------------
I7MIE8_TETTS/291-374--------------------------------------------------------------------------------
A9KM89_CLOPH/281-364--------------------------------------------------------------------------------
Q1ATZ1_RUBXD/285-368--------------------------------------------------------------------------------
E6W1V2_DESIS/283-366--------------------------------------------------------------------------------
Q7VR78_BLOFL/264-346--------------------------------------------------------------------------------
K2SLS5_MACPH/307-388--------------------------------------------------------------------------------
K1R8Y1_CRAGI/317-400--------------------------------------------------------------------------------
G7US16_PSEUP/279-362--------------------------------------------------------------------------------
A1AXW6_RUTMC/279-361--------------------------------------------------------------------------------
F8C387_THEGP/284-367--------------------------------------------------------------------------------
R7IIC0_9BURK/280-363--------------------------------------------------------------------------------
Q6YR35_ONYPE/279-362--------------------------------------------------------------------------------
D9R4H6_CLOSW/281-364--------------------------------------------------------------------------------
B2IY39_NOSP7/279-362--------------------------------------------------------------------------------
R7JA46_9PORP/283-366--------------------------------------------------------------------------------
A5E7H7_LODEL/320-403--------------------------------------------------------------------------------
F0YE04_AURAN/314-397--------------------------------------------------------------------------------
D8K232_DEHLB/277-360--------------------------------------------------------------------------------
D3SNA0_THEAH/284-367--------------------------------------------------------------------------------
B1GZF3_UNCTG/279-362--------------------------------------------------------------------------------
K0TBD2_THAOC/427-514--------------------------------------------------------------------------------
R5FVU8_9FIRM/281-364--------------------------------------------------------------------------------
A8L199_FRASN/274-357--------------------------------------------------------------------------------
H1XTJ5_9BACT/275-358--------------------------------------------------------------------------------
D5C3Z3_NITHN/278-361--------------------------------------------------------------------------------
B5Y9Z6_COPPD/260-342--------------------------------------------------------------------------------
D1J7J3_MYCHP/285-365--------------------------------------------------------------------------------
R5ZSG0_9CLOT/285-367--------------------------------------------------------------------------------
I0GU95_SELRL/284-367--------------------------------------------------------------------------------
K0P6D0_9BACT/281-364--------------------------------------------------------------------------------
D8TM54_VOLCA/282-365--------------------------------------------------------------------------------
Q586V0_TRYB2/283-360--------------------------------------------------------------------------------
G3USV4_MELGA/294-380--------------------------------------------------------------------------------
G2ISN5_9SPHN/282-363--------------------------------------------------------------------------------
D5BP00_PUNMI/282-365--------------------------------------------------------------------------------
Q9PPP4_UREPA/282-365--------------------------------------------------------------------------------
I3EES6_NEMP3/291-373--------------------------------------------------------------------------------
I0GIA8_CALEA/261-345--------------------------------------------------------------------------------
T0TPT9_9STRE/294-377--------------------------------------------------------------------------------
Q6MD73_PARUW/282-363--------------------------------------------------------------------------------
C5J6P9_MYCCR/300-382--------------------------------------------------------------------------------
C9RBT8_AMMDK/275-357--------------------------------------------------------------------------------
Q1LTH0_BAUCH/272-355--------------------------------------------------------------------------------
F9VKM6_ARTSS/280-363--------------------------------------------------------------------------------
D6Z0J3_DESAT/280-363--------------------------------------------------------------------------------
K9YDF5_HALP7/279-362--------------------------------------------------------------------------------
A8ZSN9_DESOH/253-336--------------------------------------------------------------------------------
Q6KH43_MYCMO/282-364--------------------------------------------------------------------------------
S5R8D6_9PROT/279-362--------------------------------------------------------------------------------
R6IVH6_9PROT/286-369--------------------------------------------------------------------------------
R5VWF7_9FIRM/283-366--------------------------------------------------------------------------------
Q7V0W4_PROMP/279-362--------------------------------------------------------------------------------
Q0C0W8_HYPNA/281-364--------------------------------------------------------------------------------
F4BRI6_CARS1/282-365--------------------------------------------------------------------------------
B6YQR1_AZOPC/283-365--------------------------------------------------------------------------------
B7J503_ACIF2/279-362--------------------------------------------------------------------------------
Q7NGD8_GLOVI/280-363--------------------------------------------------------------------------------
M7X6R9_RHOT1/406-488--------------------------------------------------------------------------------
Q5LV85_RUEPO/281-364--------------------------------------------------------------------------------
B2KB10_ELUMP/272-356--------------------------------------------------------------------------------
E7LV53_YEASV/148-233--------------------------------------------------------------------------------
Q8F3S1_LEPIN/281-364--------------------------------------------------------------------------------
I3THA7_TISMK/282-365--------------------------------------------------------------------------------
E6K1G8_PARDN/277-360--------------------------------------------------------------------------------
B8DPA4_DESVM/282-365--------------------------------------------------------------------------------
B2GF26_LACF3/281-364--------------------------------------------------------------------------------
Q2GHV2_EHRCR/279-361--------------------------------------------------------------------------------
J3VS97_9ENTR/279-362--------------------------------------------------------------------------------
A5I1T1_CLOBH/281-364--------------------------------------------------------------------------------
F7WZ63_9ENTR/278-362--------------------------------------------------------------------------------
B6AI40_CRYMR/306-389--------------------------------------------------------------------------------
B3DWJ0_METI4/284-367--------------------------------------------------------------------------------
L0RUS0_MYCC1/282-364--------------------------------------------------------------------------------
M7NKX8_PNEMU/820-902--------------------------------------------------------------------------------
E0TD90_PARBH/281-363--------------------------------------------------------------------------------
F4PR24_DICFS/337-421--------------------------------------------------------------------------------
C9RM43_FIBSS/281-364--------------------------------------------------------------------------------
D2R7G2_PIRSD/279-362--------------------------------------------------------------------------------
E8R3Q6_ISOPI/259-341--------------------------------------------------------------------------------
H6LK20_ACEWD/281-364--------------------------------------------------------------------------------
R6TJH4_9FIRM/285-368--------------------------------------------------------------------------------
R7G3P5_9PROT/281-364--------------------------------------------------------------------------------
B2UNH1_AKKM8/289-372--------------------------------------------------------------------------------
A9EY40_SORC5/279-362--------------------------------------------------------------------------------
R5LDY5_9SPIR/282-365--------------------------------------------------------------------------------
Q8D2K3_WIGBR/273-356--------------------------------------------------------------------------------
C6XPG7_HIRBI/283-366--------------------------------------------------------------------------------
F8L9T8_SIMNZ/282-363--------------------------------------------------------------------------------
R5YFW0_9MOLU/281-364--------------------------------------------------------------------------------
D1B915_THEAS/278-362--------------------------------------------------------------------------------
I4YEH6_WALSC/321-404--------------------------------------------------------------------------------
E8MZE8_ANATU/272-355--------------------------------------------------------------------------------
Q03ZA0_LEUMM/282-365--------------------------------------------------------------------------------
Q9X0W7_THEMA/273-355--------------------------------------------------------------------------------

PF02824

DRG1_ARATH/290-366--------------------------------------------------------------------------------
SYT2_BACSU/5-64--------------------------------------------------------------------------------
RELA_BACSU/394-453--------------------------------------------------------------------------------
Q9YA87_AERPE/316-388--------------------------------------------------------------------------------
RELA_CORGL/420-479--------------------------------------------------------------------------------
SYTC_SCHPO/49-109--------------------------------------------------------------------------------
SYTC_HUMAN/83-143--------------------------------------------------------------------------------
SYT_DEIRA/1-60--------------------------------------------------------------------------------
Q9WZI8_THEMA/437-496--------------------------------------------------------------------------------
SYT1_BACSU/5-64--------------------------------------------------------------------------------
RELA_STRCO/505-564--------------------------------------------------------------------------------
128UP_DROME/292-366--------------------------------------------------------------------------------
DRG1_HUMAN/292-366--------------------------------------------------------------------------------
SYTC_YEAST/75-135--------------------------------------------------------------------------------
Y1332_METJA/331-390--------------------------------------------------------------------------------
O27559_METTH/338-397--------------------------------------------------------------------------------
Y1111_HALSA/295-368--------------------------------------------------------------------------------
RBG2_YEAST/294-367--------------------------------------------------------------------------------
YFY7_SCHPO/291-365--------------------------------------------------------------------------------
SYT_THEMA/3-59--------------------------------------------------------------------------------
DRG2_MOUSE/290-363--------------------------------------------------------------------------------
SYT_RICPR/2-61--------------------------------------------------------------------------------
Q9RTC7_DEIRA/456-515--------------------------------------------------------------------------------
SYTM_ARATH/75-135--------------------------------------------------------------------------------
Q9VDV2_DROME/289-362--------------------------------------------------------------------------------
Y1326_METJA/316-389--------------------------------------------------------------------------------
SPOT_SYNY3/423-482--------------------------------------------------------------------------------
RBG1_YEAST/294-368--------------------------------------------------------------------------------
O27658_METTH/305-378--------------------------------------------------------------------------------
SYTC_CAEEL/82-142--------------------------------------------------------------------------------
Q9YCU8_AERPE/346-405--------------------------------------------------------------------------------
SYT_THET8/1-60--------------------------------------------------------------------------------
SYT_CHLTR/1-58--------------------------------------------------------------------------------
O28136_ARCFU/282-355--------------------------------------------------------------------------------
GTP1_SCHPO/289-363--------------------------------------------------------------------------------
YKK3_CAEEL/290-365--------------------------------------------------------------------------------
SPOT_AQUAE/387-446--------------------------------------------------------------------------------
SPOT_HAEIN/362-421--------------------------------------------------------------------------------
SPOT_BORBU/403-462--------------------------------------------------------------------------------
SYT_HAEIN/2-61--------------------------------------------------------------------------------
DRG3_ARATH/293-367--------------------------------------------------------------------------------
O69970_STRCO/446-505--------------------------------------------------------------------------------
O28907_ARCFU/326-385--------------------------------------------------------------------------------
D5C946_ENTCC/405-464--------------------------------------------------------------------------------
F4JHA4_ARATH/566-625--------------------------------------------------------------------------------
H2IYA3_RAHAC/388-447--------------------------------------------------------------------------------
H3ZMI2_THELN/314-385--------------------------------------------------------------------------------
I1MJZ5_SOYBN/290-366--------------------------------------------------------------------------------
O25466_HELPY/418-477--------------------------------------------------------------------------------
SYT_ECOLI/4-61--------------------------------------------------------------------------------
Q1D7G8_MYXXD/404-463--------------------------------------------------------------------------------
Q2FXU1_STAA8/395-454--------------------------------------------------------------------------------
Q741P2_MYCPA/450-509--------------------------------------------------------------------------------
Q7LXL0_SULSO/345-401--------------------------------------------------------------------------------
Q9HI56_THEAC/285-357--------------------------------------------------------------------------------
R4UJ80_9MOLU/409-468--------------------------------------------------------------------------------
T0TBD7_9STRE/395-454--------------------------------------------------------------------------------

PF03658

E5AR18_BURRH/17-99--------------------------------------------------------------------------------
M5DTB5_9GAMM/5-89--------------------------------------------------------------------------------
L0E0Q0_THIND/13-95--------------------------------------------------------------------------------
U5T367_9GAMM/13-95--------------------------------------------------------------------------------
Q2Y9R7_NITMU/8-90--------------------------------------------------------------------------------
Y850_VIBCH/6-88--------------------------------------------------------------------------------
Q5NFP6_FRATT/1-83--------------------------------------------------------------------------------
RNFH_BURXL/6-87--------------------------------------------------------------------------------
C7RLY3_ACCPU/5-87--------------------------------------------------------------------------------
K4KND4_SIMAS/7-96--------------------------------------------------------------------------------
RNFH_PSEHT/2-84--------------------------------------------------------------------------------
L0GTI6_9GAMM/1-80--------------------------------------------------------------------------------
Q0A7D6_ALKEH/6-89--------------------------------------------------------------------------------
A3QCE2_SHELP/8-89--------------------------------------------------------------------------------
D3RPX7_ALLVD/1-83--------------------------------------------------------------------------------
F6AE55_PSEF1/6-90--------------------------------------------------------------------------------
I3YE52_THIV6/1-83--------------------------------------------------------------------------------
Q5NLH8_ZYMMO/1-83--------------------------------------------------------------------------------
C6WVC1_METML/7-89--------------------------------------------------------------------------------
F9ZZ10_METMM/1-83--------------------------------------------------------------------------------
B8GNW4_THISH/12-94--------------------------------------------------------------------------------
I3UC04_ADVKW/6-89--------------------------------------------------------------------------------
X4YVS6_9BORD/5-87--------------------------------------------------------------------------------
M1S836_MORMO/4-86--------------------------------------------------------------------------------
RNFH_PROMH/4-86--------------------------------------------------------------------------------
I0HTV1_RUBGI/1-83--------------------------------------------------------------------------------
G0A3A9_METMM/6-88--------------------------------------------------------------------------------
L0GZM4_9GAMM/6-88--------------------------------------------------------------------------------
Q21W45_ALBFT/7-90--------------------------------------------------------------------------------
RNFH_PSEMY/6-90--------------------------------------------------------------------------------
H8L5G4_FRAAD/6-88--------------------------------------------------------------------------------
H0PTJ3_9RHOO/7-90--------------------------------------------------------------------------------
S5R8P5_9PROT/5-84--------------------------------------------------------------------------------
A1VNT4_POLNA/13-96--------------------------------------------------------------------------------
C4KA01_THASP/5-88--------------------------------------------------------------------------------
RATB_ECOLI/5-87--------------------------------------------------------------------------------
Q1H276_METFK/6-87--------------------------------------------------------------------------------
B2UBC6_RALPJ/10-91--------------------------------------------------------------------------------
Q3SI26_THIDA/3-85--------------------------------------------------------------------------------
I1YEL1_METFJ/9-91--------------------------------------------------------------------------------
D3HPP7_LEGLN/2-83--------------------------------------------------------------------------------
Q085W6_SHEFN/9-90--------------------------------------------------------------------------------
Q5E3A1_VIBF1/8-90--------------------------------------------------------------------------------
RNFH_AZOVD/1-83--------------------------------------------------------------------------------
RNFH_TOLAT/5-87--------------------------------------------------------------------------------
A0KI82_AERHH/5-87--------------------------------------------------------------------------------
F2K845_PSEBN/2-86--------------------------------------------------------------------------------
D5CPG1_SIDLE/1-82--------------------------------------------------------------------------------
Q7VYA6_BORPE/2-81--------------------------------------------------------------------------------
Y234_BUCBP/2-78--------------------------------------------------------------------------------
E3HTN3_ACHXA/10-92--------------------------------------------------------------------------------
RNFH_ERWT9/4-86--------------------------------------------------------------------------------
D7DHI7_METV0/6-88--------------------------------------------------------------------------------
C5BQH3_TERTT/7-96--------------------------------------------------------------------------------
Q47XI0_COLP3/21-102--------------------------------------------------------------------------------
W0DUM3_9GAMM/11-91--------------------------------------------------------------------------------
W8KKU5_HALHR/1-83--------------------------------------------------------------------------------
RNFH_PSYIN/5-87--------------------------------------------------------------------------------
G0AB63_COLFT/18-100--------------------------------------------------------------------------------
B8F4V6_HAEPS/8-90--------------------------------------------------------------------------------
Q6FDQ4_ACIAD/6-85--------------------------------------------------------------------------------
Q12AT5_POLSJ/1-84--------------------------------------------------------------------------------
Q2L133_BORA1/5-87--------------------------------------------------------------------------------
D5ARZ5_RHOCB/1-83--------------------------------------------------------------------------------
A5WGN6_PSYWF/19-107--------------------------------------------------------------------------------
RNFH_PSEF5/6-90--------------------------------------------------------------------------------
Q1LND5_RALME/15-96--------------------------------------------------------------------------------
W0E312_MARPU/1-83--------------------------------------------------------------------------------
C5BAL1_EDWI9/1-83--------------------------------------------------------------------------------
A1TSJ2_ACIAC/16-92--------------------------------------------------------------------------------
G9AMP8_PANAN/4-86--------------------------------------------------------------------------------
B8CKP1_SHEPW/9-90--------------------------------------------------------------------------------
V5ULJ6_9BURK/6-87--------------------------------------------------------------------------------
K0I5X7_9BURK/13-90--------------------------------------------------------------------------------
C6XD50_METGS/7-89--------------------------------------------------------------------------------
RNFH_METCA/1-83--------------------------------------------------------------------------------
RNFH_HAHCH/6-89--------------------------------------------------------------------------------
B2FMX7_STRMK/2-79--------------------------------------------------------------------------------
Q6LUB2_PHOPR/8-90--------------------------------------------------------------------------------
B3PF46_CELJU/7-96--------------------------------------------------------------------------------
B1Y227_LEPCP/11-95--------------------------------------------------------------------------------
G8M860_9BURK/2-85--------------------------------------------------------------------------------
Q5QW49_IDILO/10-91--------------------------------------------------------------------------------
Y4512_PSESM/6-90--------------------------------------------------------------------------------
W0E0J7_MARPU/5-87--------------------------------------------------------------------------------
E6WTK4_PSEUU/1-78--------------------------------------------------------------------------------
E1SSV5_FERBD/5-87--------------------------------------------------------------------------------
M1FM03_9ALTE/3-86--------------------------------------------------------------------------------
V4J5I6_9GAMM/1-83--------------------------------------------------------------------------------
F8GED8_NITSI/6-87--------------------------------------------------------------------------------
RNFH_PSEA6/6-88--------------------------------------------------------------------------------
L0B5B2_9PROT/10-92--------------------------------------------------------------------------------
I1XKS4_METNJ/9-91--------------------------------------------------------------------------------
G4QHA1_GLANF/5-87--------------------------------------------------------------------------------
F4HCN9_GALAU/4-86--------------------------------------------------------------------------------
RNFH_ALCBS/6-90--------------------------------------------------------------------------------
Q21H31_SACD2/7-96--------------------------------------------------------------------------------
Y166_PASMU/4-86--------------------------------------------------------------------------------
I3Y7K1_THIV6/6-88--------------------------------------------------------------------------------
Q5P533_AROAE/3-85--------------------------------------------------------------------------------
A2SG91_METPP/10-92--------------------------------------------------------------------------------
W8WY01_CASDE/1-83--------------------------------------------------------------------------------
E0SB11_DICD3/4-86--------------------------------------------------------------------------------
W0LA05_SERFO/4-86--------------------------------------------------------------------------------
H5WIL6_9BURK/8-91--------------------------------------------------------------------------------
F4GS42_PUSST/5-87--------------------------------------------------------------------------------
X2H0C2_9GAMM/4-83--------------------------------------------------------------------------------
RNFH_ACTSZ/4-86--------------------------------------------------------------------------------
A5EXZ3_DICNV/4-86--------------------------------------------------------------------------------
W8U6C4_YEREN/4-86--------------------------------------------------------------------------------
H2J085_RAHAC/4-86--------------------------------------------------------------------------------
S6AAF8_9PROT/1-83--------------------------------------------------------------------------------
D9SGG9_GALCS/5-87--------------------------------------------------------------------------------
Q47DK5_DECAR/5-87--------------------------------------------------------------------------------
F5XXS5_RAMTT/9-91--------------------------------------------------------------------------------
D0L0Y6_HALNC/11-93--------------------------------------------------------------------------------
Q4FV25_PSYA2/33-129--------------------------------------------------------------------------------
E4PPI0_MARAH/2-85--------------------------------------------------------------------------------
Q5ZYK1_LEGPH/2-83--------------------------------------------------------------------------------
K0C2E1_CYCSP/3-84--------------------------------------------------------------------------------
Y796_NEIMB/2-84--------------------------------------------------------------------------------
Q8PAL5_XANCP/1-78--------------------------------------------------------------------------------
Q5NYE2_AROAE/5-88--------------------------------------------------------------------------------
Y1828_HAEDU/8-90--------------------------------------------------------------------------------
A4G4U3_HERAR/12-94--------------------------------------------------------------------------------
G2IZ07_PSEUL/5-87--------------------------------------------------------------------------------
X2H4Y7_9NEIS/4-86--------------------------------------------------------------------------------
H0PV88_9RHOO/1-83--------------------------------------------------------------------------------
D5WYV7_THIK1/3-85--------------------------------------------------------------------------------
C7R6J7_KANKD/7-89--------------------------------------------------------------------------------
M4U771_9GAMM/5-87--------------------------------------------------------------------------------
D5BY77_NITHN/2-84--------------------------------------------------------------------------------
Q63T36_BURPS/3-84--------------------------------------------------------------------------------
B4EC76_BURCJ/3-84--------------------------------------------------------------------------------
A1WPQ1_VEREI/18-107--------------------------------------------------------------------------------
Y3462_CHRVO/5-87--------------------------------------------------------------------------------
D8IU41_HERSS/7-89--------------------------------------------------------------------------------
C7RRB2_ACCPU/1-83--------------------------------------------------------------------------------
F5Z797_ALTSS/6-88--------------------------------------------------------------------------------
Q82X67_NITEU/10-92--------------------------------------------------------------------------------
Q6D8Y3_PECAS/1-83--------------------------------------------------------------------------------
D5CSC8_SIDLE/6-88--------------------------------------------------------------------------------
S6BII7_9GAMM/6-88--------------------------------------------------------------------------------
E1VM45_9GAMM/1-85--------------------------------------------------------------------------------
K0CKL9_ALCDB/5-89--------------------------------------------------------------------------------
A9INN7_BORPD/9-90--------------------------------------------------------------------------------
Y1475_SHEON/10-90--------------------------------------------------------------------------------
Q0KA38_CUPNH/12-93--------------------------------------------------------------------------------
E6WFL4_PANSA/4-86--------------------------------------------------------------------------------
RNFH_MAGSA/1-83--------------------------------------------------------------------------------
C4L9I0_TOLAT/1-83--------------------------------------------------------------------------------
Y253_BUCAI/4-86--------------------------------------------------------------------------------
H8GJC1_METAL/13-93--------------------------------------------------------------------------------
A6W2D7_MARMS/1-85--------------------------------------------------------------------------------
S6BNN8_PSERE/6-90--------------------------------------------------------------------------------
M4NH40_9GAMM/6-88--------------------------------------------------------------------------------
U3U649_9BACT/4-86--------------------------------------------------------------------------------
H2FST8_OCESG/4-86--------------------------------------------------------------------------------
D3RMP7_ALLVD/5-87--------------------------------------------------------------------------------
Q1QSW5_CHRSD/6-92--------------------------------------------------------------------------------
C4KB18_THASP/1-82--------------------------------------------------------------------------------
A0L9F7_MAGSM/1-83--------------------------------------------------------------------------------
D2UAW5_XANAP/1-78--------------------------------------------------------------------------------
A1AXM6_RUTMC/1-83--------------------------------------------------------------------------------
D3SC43_THISK/17-99--------------------------------------------------------------------------------
I2B6A6_SHIBC/2-79--------------------------------------------------------------------------------
W0B658_9GAMM/2-83--------------------------------------------------------------------------------
Y395_HAEIN/4-86--------------------------------------------------------------------------------
Q47FY6_DECAR/1-83--------------------------------------------------------------------------------
Q1LSR8_BAUCH/22-102--------------------------------------------------------------------------------
A1K5U0_AZOSB/7-90--------------------------------------------------------------------------------
I3Y587_THIV6/1-81--------------------------------------------------------------------------------
G8QPC2_AZOSU/5-87--------------------------------------------------------------------------------
E1VAU9_HALED/2-88--------------------------------------------------------------------------------
G4T3F4_META2/6-88--------------------------------------------------------------------------------
Y1303_COXBU/2-83--------------------------------------------------------------------------------
C5AEX8_BURGB/3-84--------------------------------------------------------------------------------
RNFH_HALHL/8-89--------------------------------------------------------------------------------
D3VLH2_XENNA/4-86--------------------------------------------------------------------------------
Q12PU9_SHEDO/9-90--------------------------------------------------------------------------------
F2GB67_ALTMD/6-88--------------------------------------------------------------------------------
M9X4G7_PASHA/29-111--------------------------------------------------------------------------------
A1S884_SHEAM/10-90--------------------------------------------------------------------------------
D8MVV3_ERWBE/4-86--------------------------------------------------------------------------------
G7UVA3_PSEUP/1-78--------------------------------------------------------------------------------
S6AGG4_9PROT/2-81--------------------------------------------------------------------------------
K6ZX54_9ALTE/6-88--------------------------------------------------------------------------------
Q31FS1_THICR/1-81--------------------------------------------------------------------------------
RNFH_BURP8/6-87--------------------------------------------------------------------------------
M4X3E7_PSEDE/7-91--------------------------------------------------------------------------------
A3MYY0_ACTP2/7-89--------------------------------------------------------------------------------
V4IZ77_9GAMM/6-88--------------------------------------------------------------------------------
F2K0E2_MARM1/4-88--------------------------------------------------------------------------------
RNFH_LARHH/7-89--------------------------------------------------------------------------------

PF07715

Q8E8C4_SHEON/58-157--------------------------------------------------------------------------------
Q8E8X7_SHEON/49-160--------------------------------------------------------------------------------
Q8ECU0_SHEON/79-182--------------------------------------------------------------------------------
FCT_DICD3/78-182--------------------------------------------------------------------------------
Q8EXD4_LEPIN/153-260--------------------------------------------------------------------------------
Q8F194_LEPIN/126-228--------------------------------------------------------------------------------
Q8F6F1_LEPIN/52-159--------------------------------------------------------------------------------
Q8F8I4_LEPIN/202-315--------------------------------------------------------------------------------
Q7CTM1_AGRT5/59-169--------------------------------------------------------------------------------
Q7CT31_AGRT5/152-260--------------------------------------------------------------------------------
O25395_HELPY/45-160--------------------------------------------------------------------------------
O25487_HELPY/58-173--------------------------------------------------------------------------------
O25543_HELPY/31-142--------------------------------------------------------------------------------
O25574_HELPY/57-162--------------------------------------------------------------------------------
O25950_HELPY/64-179--------------------------------------------------------------------------------
O26042_HELPY/37-141--------------------------------------------------------------------------------
O66812_AQUAE/22-129--------------------------------------------------------------------------------
TDHA_HAEDU/39-144--------------------------------------------------------------------------------
FEPA_ECOLI/43-163--------------------------------------------------------------------------------
FECA_ECOLI/129-244--------------------------------------------------------------------------------
FHUE_ECOLI/74-177--------------------------------------------------------------------------------
CIRA_ECOLI/43-152--------------------------------------------------------------------------------
FPTA_PSEAE/75-175--------------------------------------------------------------------------------
TDHA_HAEIN/46-151--------------------------------------------------------------------------------
HXUC1_HAEIN/37-141--------------------------------------------------------------------------------
HGP1_HAEIN/75-194--------------------------------------------------------------------------------
TBPA_HAEIN/64-182--------------------------------------------------------------------------------
Y1217_HAEIN/46-159--------------------------------------------------------------------------------
Y1369_HAEIN/80-211--------------------------------------------------------------------------------
Y1466_HAEIN/62-161--------------------------------------------------------------------------------
FYUA_YERPE/43-149--------------------------------------------------------------------------------
FPVA_PSEAE/161-265--------------------------------------------------------------------------------
P72594_SYNY3/185-289--------------------------------------------------------------------------------
P72599_SYNY3/217-321--------------------------------------------------------------------------------
P72602_SYNY3/190-290--------------------------------------------------------------------------------
P72609_SYNY3/218-317--------------------------------------------------------------------------------
FIU_ECOLI/67-169--------------------------------------------------------------------------------
YNCD_ECOLI/39-151--------------------------------------------------------------------------------
BFRD_BORPE/62-162--------------------------------------------------------------------------------
VIUA_VIBCH/62-178--------------------------------------------------------------------------------
HGBA_HAEDU/38-161--------------------------------------------------------------------------------
FOXA_SALTY/55-162--------------------------------------------------------------------------------
HGP4_HAEIN/70-189--------------------------------------------------------------------------------
Q7M8J9_WOLSU/43-150--------------------------------------------------------------------------------
Q7M8T8_WOLSU/144-247--------------------------------------------------------------------------------
Q7M930_WOLSU/57-169--------------------------------------------------------------------------------
Q7M977_WOLSU/36-141--------------------------------------------------------------------------------
Q7M9D6_WOLSU/46-150--------------------------------------------------------------------------------
Q7M9H6_WOLSU/36-147--------------------------------------------------------------------------------
Q7M9Y3_WOLSU/138-238--------------------------------------------------------------------------------
Q7MAF6_WOLSU/73-171--------------------------------------------------------------------------------
Q7MB83_PHOLL/151-259--------------------------------------------------------------------------------
Q7MC79_VIBVY/47-151--------------------------------------------------------------------------------
Q7MFF8_VIBVY/41-151--------------------------------------------------------------------------------
Q7MFP2_VIBVY/51-161--------------------------------------------------------------------------------
Q7MPW2_VIBVY/48-167--------------------------------------------------------------------------------
BTUB_VIBVY/41-148--------------------------------------------------------------------------------
Q7MQW5_WOLSU/41-147--------------------------------------------------------------------------------
Q7MRE4_WOLSU/43-145--------------------------------------------------------------------------------
Q7MTP7_PORGI/90-201--------------------------------------------------------------------------------
Q7MUS3_PORGI/125-235--------------------------------------------------------------------------------
Q7MVP2_PORGI/189-288--------------------------------------------------------------------------------
Q7MXJ7_PORGI/114-223--------------------------------------------------------------------------------
BTUB_PHOLL/43-151--------------------------------------------------------------------------------
Q7MYQ3_PHOLL/88-191--------------------------------------------------------------------------------
Q7N0P3_PHOLL/52-162--------------------------------------------------------------------------------
Q7N1F7_PHOLL/33-146--------------------------------------------------------------------------------
Q7N1G3_PHOLL/80-191--------------------------------------------------------------------------------
Q7N369_PHOLL/43-154--------------------------------------------------------------------------------
Q7N3K1_PHOLL/52-162--------------------------------------------------------------------------------
Q7N3T1_PHOLL/54-159--------------------------------------------------------------------------------
Q7N4L5_PHOLL/42-147--------------------------------------------------------------------------------
Q7N7B7_PHOLL/75-179--------------------------------------------------------------------------------
Q7NDD9_GLOVI/129-238--------------------------------------------------------------------------------
Q7NEA4_GLOVI/107-208--------------------------------------------------------------------------------
Q7NEA6_GLOVI/95-195--------------------------------------------------------------------------------
Q7NF46_GLOVI/89-197--------------------------------------------------------------------------------
Q7NFC5_GLOVI/90-203--------------------------------------------------------------------------------
Q7NG22_GLOVI/140-248--------------------------------------------------------------------------------
Q7NGR5_GLOVI/172-282--------------------------------------------------------------------------------
Q7NIR6_GLOVI/75-186--------------------------------------------------------------------------------
Q7NIY1_GLOVI/55-161--------------------------------------------------------------------------------
Q7NJ54_GLOVI/81-181--------------------------------------------------------------------------------
Q7NJ59_GLOVI/134-244--------------------------------------------------------------------------------
Q7NJ70_GLOVI/124-232--------------------------------------------------------------------------------
Q7NJC3_GLOVI/97-200--------------------------------------------------------------------------------
Q7NK68_GLOVI/88-195--------------------------------------------------------------------------------
Q7NKI9_GLOVI/78-186--------------------------------------------------------------------------------
Q7NKM5_GLOVI/105-213--------------------------------------------------------------------------------
Q7NKU0_GLOVI/141-249--------------------------------------------------------------------------------
Q7NKU6_GLOVI/116-224--------------------------------------------------------------------------------
Q7NL22_GLOVI/133-241--------------------------------------------------------------------------------
Q7NL50_GLOVI/131-239--------------------------------------------------------------------------------
Q7NM72_GLOVI/83-193--------------------------------------------------------------------------------
Q7NNP9_GLOVI/89-187--------------------------------------------------------------------------------
Q7NNR1_GLOVI/144-243--------------------------------------------------------------------------------
Q7NNR7_GLOVI/107-209--------------------------------------------------------------------------------
Q7NNT3_GLOVI/186-294--------------------------------------------------------------------------------
Q7NNU0_GLOVI/140-239--------------------------------------------------------------------------------
Q7NNU6_GLOVI/111-210--------------------------------------------------------------------------------
Q7NNU8_GLOVI/124-223--------------------------------------------------------------------------------
Q7NNV6_GLOVI/112-214--------------------------------------------------------------------------------
Q7NNX8_GLOVI/67-175--------------------------------------------------------------------------------
Q7NR88_CHRVO/41-155--------------------------------------------------------------------------------
Q7NT73_CHRVO/48-158--------------------------------------------------------------------------------
Q7NVU1_CHRVO/84-183--------------------------------------------------------------------------------
Q7NWK4_CHRVO/48-162--------------------------------------------------------------------------------
Q7NWL3_CHRVO/55-169--------------------------------------------------------------------------------
Q7NXC8_CHRVO/28-147--------------------------------------------------------------------------------
Q7NXY5_CHRVO/51-162--------------------------------------------------------------------------------
Q7NZA3_CHRVO/47-166--------------------------------------------------------------------------------
Q7NZM7_CHRVO/36-143--------------------------------------------------------------------------------
Q7P0S2_CHRVO/42-149--------------------------------------------------------------------------------
Q7P1Y5_CHRVO/44-158--------------------------------------------------------------------------------
Q7VF32_HELHP/43-147--------------------------------------------------------------------------------
Q7VFY4_HELHP/46-150--------------------------------------------------------------------------------
Q7VI87_HELHP/66-181--------------------------------------------------------------------------------
Q7VJ32_HELHP/37-143--------------------------------------------------------------------------------
Q7VNB0_HAEDU/33-172--------------------------------------------------------------------------------
Q7VR34_BLOFL/76-178--------------------------------------------------------------------------------
Q7VSG8_BORPE/46-152--------------------------------------------------------------------------------
Q7VSQ4_BORPE/124-230--------------------------------------------------------------------------------
Q7VTE7_BORPE/49-156--------------------------------------------------------------------------------
Q7VUK9_BORPE/69-175--------------------------------------------------------------------------------
Q7VUZ3_BORPE/63-165--------------------------------------------------------------------------------
Q7VX53_BORPE/74-174--------------------------------------------------------------------------------
Q7VXJ8_BORPE/120-247--------------------------------------------------------------------------------
Q7VZ08_BORPE/157-259--------------------------------------------------------------------------------
Q7VZP0_BORPE/67-167--------------------------------------------------------------------------------
Q7VZY3_BORPE/161-265--------------------------------------------------------------------------------
Q7WXJ8_CUPNH/70-167--------------------------------------------------------------------------------
Q7WXT8_CUPNH/85-201--------------------------------------------------------------------------------
Q82SB3_NITEU/179-279--------------------------------------------------------------------------------
Q82SY1_NITEU/175-276--------------------------------------------------------------------------------
Q82T03_NITEU/135-245--------------------------------------------------------------------------------
Q82TZ3_NITEU/58-164--------------------------------------------------------------------------------
Q82UF0_NITEU/63-168--------------------------------------------------------------------------------
Q82UF4_NITEU/110-222--------------------------------------------------------------------------------
Q82UF7_NITEU/77-188--------------------------------------------------------------------------------
Q82V93_NITEU/69-181--------------------------------------------------------------------------------
Q82VI7_NITEU/165-266--------------------------------------------------------------------------------
Q82VJ4_NITEU/168-275--------------------------------------------------------------------------------
Q82VJ5_NITEU/173-278--------------------------------------------------------------------------------
Q82VK9_NITEU/147-247--------------------------------------------------------------------------------
Q82WD2_NITEU/53-167--------------------------------------------------------------------------------
Q82WF0_NITEU/69-169--------------------------------------------------------------------------------
Q82WN2_NITEU/44-151--------------------------------------------------------------------------------
Q82WN8_NITEU/69-180--------------------------------------------------------------------------------
Q82WP7_NITEU/39-147--------------------------------------------------------------------------------
Q82WU8_NITEU/145-245--------------------------------------------------------------------------------
Q82WV1_NITEU/138-236--------------------------------------------------------------------------------
Q82WV8_NITEU/139-239--------------------------------------------------------------------------------
Q82WX2_NITEU/175-272--------------------------------------------------------------------------------
Q82XF3_NITEU/71-173--------------------------------------------------------------------------------
Q87FM2_VIBPA/63-162--------------------------------------------------------------------------------
Q87FM3_VIBPA/65-177--------------------------------------------------------------------------------
Q87G51_VIBPA/41-151--------------------------------------------------------------------------------
Q87G82_VIBPA/54-155--------------------------------------------------------------------------------
Q87HI4_VIBPA/52-156--------------------------------------------------------------------------------
Q87HS4_VIBPA/40-151--------------------------------------------------------------------------------
Q87IE2_VIBPA/44-144--------------------------------------------------------------------------------
BTUB_VIBPA/42-148--------------------------------------------------------------------------------
Q87LK9_VIBPA/45-156--------------------------------------------------------------------------------
Q87TA2_VIBPA/50-165--------------------------------------------------------------------------------
Q87TW0_PSESM/88-193--------------------------------------------------------------------------------
Q87XP8_PSESM/153-256--------------------------------------------------------------------------------
Q87YV0_PSESM/81-183--------------------------------------------------------------------------------
Q87Z57_PSESM/67-166--------------------------------------------------------------------------------
Q87ZG7_PSESM/76-176--------------------------------------------------------------------------------
Q87ZX8_PSESM/70-170--------------------------------------------------------------------------------
Q880C9_PSESM/53-159--------------------------------------------------------------------------------
Q880Y5_PSESM/67-188--------------------------------------------------------------------------------
Q881N5_PSESM/124-225--------------------------------------------------------------------------------
Q881P1_PSESM/85-186--------------------------------------------------------------------------------
Q882L9_PSESM/60-181--------------------------------------------------------------------------------
Q882M1_PSESM/57-162--------------------------------------------------------------------------------
Q882Y8_PSESM/59-181--------------------------------------------------------------------------------
Q883A9_PSESM/67-167--------------------------------------------------------------------------------
Q884E1_PSESM/91-194--------------------------------------------------------------------------------
Q884E2_PSESM/175-278--------------------------------------------------------------------------------
Q885H8_PSESM/64-175--------------------------------------------------------------------------------
Q886G9_PSESM/65-165--------------------------------------------------------------------------------
Q887T0_PSESM/158-260--------------------------------------------------------------------------------
Q888K4_PSESM/46-154--------------------------------------------------------------------------------
Q889G6_PSESM/54-164--------------------------------------------------------------------------------
Q889S8_PSESM/60-178--------------------------------------------------------------------------------
Q88AW5_PSESM/47-168--------------------------------------------------------------------------------
Q88DI7_PSEPK/51-160--------------------------------------------------------------------------------
Q88DR8_PSEPK/170-269--------------------------------------------------------------------------------
Q88E62_PSEPK/143-242--------------------------------------------------------------------------------
Q88F81_PSEPK/155-255--------------------------------------------------------------------------------
Q88FC7_PSEPK/46-156--------------------------------------------------------------------------------
Q88FF9_PSEPK/50-161--------------------------------------------------------------------------------
Q88GV5_PSEPK/124-221--------------------------------------------------------------------------------
Q88GZ0_PSEPK/156-256--------------------------------------------------------------------------------
Q88HM8_PSEPK/63-163--------------------------------------------------------------------------------
Q88IB5_PSEPK/165-265--------------------------------------------------------------------------------
Q88JQ9_PSEPK/127-228--------------------------------------------------------------------------------
Q88K71_PSEPK/81-186--------------------------------------------------------------------------------
Q88KU6_PSEPK/152-256--------------------------------------------------------------------------------
Q88MX2_PSEPK/38-144--------------------------------------------------------------------------------
Q88PI3_PSEPK/137-252--------------------------------------------------------------------------------
Q88PI9_PSEPK/87-187--------------------------------------------------------------------------------
Q88Q29_PSEPK/156-260--------------------------------------------------------------------------------
Q88QF9_PSEPK/83-183--------------------------------------------------------------------------------
Q88QG8_PSEPK/68-175--------------------------------------------------------------------------------
Q88QY4_PSEPK/153-254--------------------------------------------------------------------------------
Q88R62_PSEPK/80-184--------------------------------------------------------------------------------
Q88RH0_PSEPK/172-279--------------------------------------------------------------------------------
Q89C30_BRADU/122-221--------------------------------------------------------------------------------
Q89EK1_BRADU/100-209--------------------------------------------------------------------------------
Q89EX1_BRADU/91-207--------------------------------------------------------------------------------
Q89H12_BRADU/102-215--------------------------------------------------------------------------------
Q89KM4_BRADU/121-237--------------------------------------------------------------------------------
Q89KY2_BRADU/91-205--------------------------------------------------------------------------------
Q89LN9_BRADU/126-232--------------------------------------------------------------------------------
Q89ND8_BRADU/131-231--------------------------------------------------------------------------------
Q89PC7_BRADU/142-245--------------------------------------------------------------------------------
Q89Q52_BRADU/116-218--------------------------------------------------------------------------------
Q89SE0_BRADU/105-212--------------------------------------------------------------------------------
Q89YK7_BACTN/215-322--------------------------------------------------------------------------------
Q89YM4_BACTN/201-329--------------------------------------------------------------------------------
Q89YR0_BACTN/126-243--------------------------------------------------------------------------------
Q89YS1_BACTN/121-228--------------------------------------------------------------------------------
Q89YU7_BACTN/203-312--------------------------------------------------------------------------------
Q89ZA7_BACTN/132-263--------------------------------------------------------------------------------
Q89ZH3_BACTN/211-338--------------------------------------------------------------------------------
Q89ZM0_BACTN/228-336--------------------------------------------------------------------------------
Q89ZS8_BACTN/120-226--------------------------------------------------------------------------------
Q89ZX4_BACTN/209-317--------------------------------------------------------------------------------
Q8A053_BACTN/122-241--------------------------------------------------------------------------------
Q8A057_BACTN/134-258--------------------------------------------------------------------------------
Q8A086_BACTN/116-226--------------------------------------------------------------------------------
Q8A0A0_BACTN/125-247--------------------------------------------------------------------------------
Q8A0A7_BACTN/118-225--------------------------------------------------------------------------------
Q8A0D1_BACTN/111-222--------------------------------------------------------------------------------
Q8A0D3_BACTN/132-258--------------------------------------------------------------------------------
Q8A0E0_BACTN/117-223--------------------------------------------------------------------------------
Q8A0G6_BACTN/135-237--------------------------------------------------------------------------------
Q8A0I2_BACTN/116-223--------------------------------------------------------------------------------
Q8A0N8_BACTN/217-342--------------------------------------------------------------------------------
Q8A0R3_BACTN/122-229--------------------------------------------------------------------------------
Q8A117_BACTN/95-199--------------------------------------------------------------------------------
Q8A178_BACTN/123-230--------------------------------------------------------------------------------
Q8A1B6_BACTN/227-350--------------------------------------------------------------------------------
Q8A1J1_BACTN/131-237--------------------------------------------------------------------------------
Q8A1M6_BACTN/120-236--------------------------------------------------------------------------------
Q8A1Q5_BACTN/125-232--------------------------------------------------------------------------------
Q8A1T9_BACTN/132-237--------------------------------------------------------------------------------
Q8A1U3_BACTN/132-231--------------------------------------------------------------------------------
Q8A1Y9_BACTN/225-330--------------------------------------------------------------------------------
Q8A203_BACTN/115-223--------------------------------------------------------------------------------
Q8A225_BACTN/115-222--------------------------------------------------------------------------------
Q8A231_BACTN/116-222--------------------------------------------------------------------------------
Q8A2F9_BACTN/118-224--------------------------------------------------------------------------------
Q8A2H3_BACTN/109-219--------------------------------------------------------------------------------
Q8A2J5_BACTN/120-227--------------------------------------------------------------------------------
Q8A2M6_BACTN/206-334--------------------------------------------------------------------------------
Q8A2N4_BACTN/204-331--------------------------------------------------------------------------------
Q8A2R5_BACTN/65-193--------------------------------------------------------------------------------
Q8A2Y1_BACTN/115-226--------------------------------------------------------------------------------
Q8A2Z9_BACTN/124-233--------------------------------------------------------------------------------
Q8A352_BACTN/132-257--------------------------------------------------------------------------------
Q8A365_BACTN/121-227--------------------------------------------------------------------------------
Q8A3A8_BACTN/116-222--------------------------------------------------------------------------------
Q8A3D0_BACTN/115-220--------------------------------------------------------------------------------
Q8A3D8_BACTN/133-239--------------------------------------------------------------------------------
Q8A3E2_BACTN/210-319--------------------------------------------------------------------------------
Q8A3I6_BACTN/133-242--------------------------------------------------------------------------------
Q8A3K2_BACTN/133-243--------------------------------------------------------------------------------
Q8A3N4_BACTN/140-249--------------------------------------------------------------------------------
Q8A3P9_BACTN/139-248--------------------------------------------------------------------------------
Q8A3R0_BACTN/118-224--------------------------------------------------------------------------------
Q8A3Y6_BACTN/123-231--------------------------------------------------------------------------------
Q8A3Z9_BACTN/134-243--------------------------------------------------------------------------------
Q8A4H3_BACTN/116-222--------------------------------------------------------------------------------
Q8A4N9_BACTN/203-336--------------------------------------------------------------------------------
Q8A4R6_BACTN/120-226--------------------------------------------------------------------------------
Q8A4Y6_BACTN/220-325--------------------------------------------------------------------------------
Q8A535_BACTN/41-146--------------------------------------------------------------------------------
Q8A549_BACTN/123-229--------------------------------------------------------------------------------
Q8A552_BACTN/43-154--------------------------------------------------------------------------------
Q8A578_BACTN/121-248--------------------------------------------------------------------------------
Q8A580_BACTN/137-243--------------------------------------------------------------------------------
Q8A5H1_BACTN/109-229--------------------------------------------------------------------------------
Q8A5H5_BACTN/36-161--------------------------------------------------------------------------------
Q8A5H9_BACTN/36-160--------------------------------------------------------------------------------
Q8A5N6_BACTN/120-228--------------------------------------------------------------------------------
Q8A5P2_BACTN/201-307--------------------------------------------------------------------------------
Q8A5R6_BACTN/212-318--------------------------------------------------------------------------------
Q8A5X9_BACTN/127-236--------------------------------------------------------------------------------
Q8A5Z2_BACTN/30-136--------------------------------------------------------------------------------
Q8A621_BACTN/122-227--------------------------------------------------------------------------------
Q8A654_BACTN/6-135--------------------------------------------------------------------------------
Q8A6E5_BACTN/126-268--------------------------------------------------------------------------------
Q8A6K6_BACTN/199-324--------------------------------------------------------------------------------
Q8A6S7_BACTN/119-225--------------------------------------------------------------------------------
Q8A6V2_BACTN/127-246--------------------------------------------------------------------------------
Q8A6W3_BACTN/118-224--------------------------------------------------------------------------------
Q8A742_BACTN/142-257--------------------------------------------------------------------------------
Q8A794_BACTN/121-232--------------------------------------------------------------------------------
Q8A7A6_BACTN/218-324--------------------------------------------------------------------------------
Q8A7H2_BACTN/129-256--------------------------------------------------------------------------------
Q8A7N5_BACTN/50-157--------------------------------------------------------------------------------
Q8A7T4_BACTN/116-224--------------------------------------------------------------------------------
Q8A7V4_BACTN/44-149--------------------------------------------------------------------------------
Q8A894_BACTN/211-335--------------------------------------------------------------------------------
Q8A8P8_BACTN/29-142--------------------------------------------------------------------------------
Q8A8X1_BACTN/46-171--------------------------------------------------------------------------------
Q8A8X5_BACTN/206-333--------------------------------------------------------------------------------
Q8A8X7_BACTN/21-147--------------------------------------------------------------------------------
Q8A8Y8_BACTN/115-234--------------------------------------------------------------------------------
Q8A8Z2_BACTN/115-234--------------------------------------------------------------------------------
Q8A957_BACTN/30-147--------------------------------------------------------------------------------
Q8A9E8_BACTN/144-250--------------------------------------------------------------------------------
Q8A9R1_BACTN/208-315--------------------------------------------------------------------------------
Q8AAG1_BACTN/130-237--------------------------------------------------------------------------------
Q8AAG9_BACTN/121-227--------------------------------------------------------------------------------
Q8AAL2_BACTN/125-227--------------------------------------------------------------------------------
Q8AAM5_BACTN/141-246--------------------------------------------------------------------------------
Q8AAV0_BACTN/111-218--------------------------------------------------------------------------------
Q8AAV2_BACTN/127-235--------------------------------------------------------------------------------
Q8AAZ5_BACTN/130-254--------------------------------------------------------------------------------
Q8AB39_BACTN/123-258--------------------------------------------------------------------------------
Q8AB43_BACTN/65-199--------------------------------------------------------------------------------
Q8ABA4_BACTN/119-228--------------------------------------------------------------------------------
Q8ABC0_BACTN/215-323--------------------------------------------------------------------------------
Q8ABG0_BACTN/120-231--------------------------------------------------------------------------------
Q8ABH0_BACTN/160-271--------------------------------------------------------------------------------
Q8ABT1_BACTN/117-222--------------------------------------------------------------------------------
Q8E8Y4_SHEON/48-161--------------------------------------------------------------------------------
Q8EA32_SHEON/37-144--------------------------------------------------------------------------------
Q8EAI8_SHEON/70-170--------------------------------------------------------------------------------
Q8EB65_SHEON/60-165--------------------------------------------------------------------------------
Q8EBK0_SHEON/60-171--------------------------------------------------------------------------------
Q8ED60_SHEON/52-167--------------------------------------------------------------------------------
Q8EDM8_SHEON/63-171--------------------------------------------------------------------------------
Q8EE66_SHEON/153-259--------------------------------------------------------------------------------
Q8EEB8_SHEON/53-170--------------------------------------------------------------------------------
Q8EEF5_SHEON/51-166--------------------------------------------------------------------------------
Q8EFZ2_SHEON/54-165--------------------------------------------------------------------------------
Q8EGM0_SHEON/55-160--------------------------------------------------------------------------------
Q8EGV9_SHEON/63-165--------------------------------------------------------------------------------
Q8EHB9_SHEON/64-181--------------------------------------------------------------------------------
Q8EHR1_SHEON/59-163--------------------------------------------------------------------------------
Q8EIM3_SHEON/48-156--------------------------------------------------------------------------------
Q8EIN9_SHEON/49-156--------------------------------------------------------------------------------
Q8EIW0_SHEON/43-155--------------------------------------------------------------------------------
Q8EJ43_SHEON/47-154--------------------------------------------------------------------------------
Q8EXL7_LEPIN/92-196--------------------------------------------------------------------------------
Q8F0M4_LEPIN/66-176--------------------------------------------------------------------------------
Q8F179_LEPIN/134-264--------------------------------------------------------------------------------
Q8F1I6_LEPIN/123-228--------------------------------------------------------------------------------
Q8F2X2_LEPIN/89-193--------------------------------------------------------------------------------
Q8F406_LEPIN/99-205--------------------------------------------------------------------------------
Q8F853_LEPIN/182-310--------------------------------------------------------------------------------
Q8GF28_ZYMMO/44-148--------------------------------------------------------------------------------
Q8GF63_ZYMMO/92-191--------------------------------------------------------------------------------
Q8KB41_CHLTE/133-246--------------------------------------------------------------------------------
Q8KBM4_CHLTE/41-147--------------------------------------------------------------------------------
Q8KBN2_CHLTE/72-178--------------------------------------------------------------------------------
Q8KDV9_CHLTE/69-177--------------------------------------------------------------------------------
Q8KFA4_CHLTE/127-235--------------------------------------------------------------------------------
Q8P331_XANCP/70-189--------------------------------------------------------------------------------
Q8P341_XANCP/126-230--------------------------------------------------------------------------------
Q8P343_XANCP/60-178--------------------------------------------------------------------------------
Q8P356_XANCP/49-168--------------------------------------------------------------------------------
Q8P3B4_XANCP/68-170--------------------------------------------------------------------------------
Q8P3F1_XANCP/54-168--------------------------------------------------------------------------------
Q8P3L9_XANCP/72-180--------------------------------------------------------------------------------
Q8P3V6_XANCP/68-180--------------------------------------------------------------------------------
Q8P4J3_XANCP/63-167--------------------------------------------------------------------------------
Q8P4S2_XANCP/103-215--------------------------------------------------------------------------------
Q8P4W1_XANCP/165-268--------------------------------------------------------------------------------
Q8P529_XANCP/82-185--------------------------------------------------------------------------------
Q8P569_XANCP/58-172--------------------------------------------------------------------------------
Q8P5B4_XANCP/65-168--------------------------------------------------------------------------------
Q8P5D3_XANCP/59-172--------------------------------------------------------------------------------
Q8P5D6_XANCP/52-180--------------------------------------------------------------------------------
Q8P5I3_XANCP/67-181--------------------------------------------------------------------------------
Q8P5M2_XANCP/55-169--------------------------------------------------------------------------------
Q8P5Q7_XANCP/53-169--------------------------------------------------------------------------------
Q8P5R5_XANCP/125-234--------------------------------------------------------------------------------
Q8P5W7_XANCP/78-181--------------------------------------------------------------------------------
Q8P5X4_XANCP/125-239--------------------------------------------------------------------------------
Q8P605_XANCP/62-173--------------------------------------------------------------------------------
Q8P621_XANCP/60-173--------------------------------------------------------------------------------
Q8P691_XANCP/47-171--------------------------------------------------------------------------------
Q8P6A3_XANCP/47-154--------------------------------------------------------------------------------
Q8P6C0_XANCP/60-172--------------------------------------------------------------------------------
Q8P6C4_XANCP/2-122--------------------------------------------------------------------------------
Q8P6D4_XANCP/59-177--------------------------------------------------------------------------------
Q8P6M3_XANCP/51-162--------------------------------------------------------------------------------
Q8P6U8_XANCP/54-165--------------------------------------------------------------------------------
Q8P6Y7_XANCP/62-182--------------------------------------------------------------------------------
Q8P742_XANCP/57-158--------------------------------------------------------------------------------
Q8P7E6_XANCP/54-167--------------------------------------------------------------------------------
Q8P7N8_XANCP/136-242--------------------------------------------------------------------------------
Q8P7N9_XANCP/57-173--------------------------------------------------------------------------------
Q8P7Y6_XANCP/86-192--------------------------------------------------------------------------------
Q8P848_XANCP/73-191--------------------------------------------------------------------------------
Q8P853_XANCP/69-176--------------------------------------------------------------------------------
Q8P861_XANCP/47-154--------------------------------------------------------------------------------
Q8P920_XANCP/44-155--------------------------------------------------------------------------------
Q8P976_XANCP/55-157--------------------------------------------------------------------------------
Q8P9H2_XANCP/50-159--------------------------------------------------------------------------------
Q8P9U7_XANCP/132-235--------------------------------------------------------------------------------
Q8P9U8_XANCP/74-186--------------------------------------------------------------------------------
Q8P9X4_XANCP/96-205--------------------------------------------------------------------------------
Q8PAY6_XANCP/69-192--------------------------------------------------------------------------------
Q8PB66_XANCP/80-185--------------------------------------------------------------------------------
Q8PBE3_XANCP/77-189--------------------------------------------------------------------------------
Q8PBS8_XANCP/22-141--------------------------------------------------------------------------------
Q8PBT2_XANCP/51-162--------------------------------------------------------------------------------
Q8PC09_XANCP/85-203--------------------------------------------------------------------------------
Q8PCG6_XANCP/53-165--------------------------------------------------------------------------------
Q8PD15_XANCP/77-195--------------------------------------------------------------------------------
Q8PDE2_XANCP/55-177--------------------------------------------------------------------------------
Q8PDE5_XANCP/64-168--------------------------------------------------------------------------------
Q8PDN0_XANCP/70-181--------------------------------------------------------------------------------
Q8PE25_XANCP/72-171--------------------------------------------------------------------------------
Q8PE61_XANCP/70-183--------------------------------------------------------------------------------
Q8PE62_XANCP/61-176--------------------------------------------------------------------------------
Q8PE83_XANCP/67-177--------------------------------------------------------------------------------
Q8PED1_XANCP/75-181--------------------------------------------------------------------------------
Q8RF34_FUSNN/39-142--------------------------------------------------------------------------------
Q8RF85_FUSNN/37-146--------------------------------------------------------------------------------
Q8RG20_FUSNN/34-142--------------------------------------------------------------------------------
A9CGK7_AGRT5/56-168--------------------------------------------------------------------------------
Q7CSB9_AGRT5/173-291--------------------------------------------------------------------------------
Q7D3D9_AGRT5/166-271--------------------------------------------------------------------------------
Q8XQF6_RALSO/66-180--------------------------------------------------------------------------------
Q8XR06_RALSO/53-150--------------------------------------------------------------------------------
Q8XRM0_RALSO/41-153--------------------------------------------------------------------------------
Q8XSQ1_RALSO/132-236--------------------------------------------------------------------------------
Q8XSQ3_RALSO/101-204--------------------------------------------------------------------------------
Q8XT71_RALSO/46-170--------------------------------------------------------------------------------
Q8XTK8_RALSO/60-165--------------------------------------------------------------------------------
Q8XVA9_RALSO/46-162--------------------------------------------------------------------------------
Q8XVB1_RALSO/150-251--------------------------------------------------------------------------------
Q8XVU8_RALSO/47-151--------------------------------------------------------------------------------
Q8XWS0_RALSO/45-152--------------------------------------------------------------------------------
Q8XYF1_RALSO/52-157--------------------------------------------------------------------------------
Q8Y190_RALSO/71-172--------------------------------------------------------------------------------
Q8Y1U4_RALSO/72-172--------------------------------------------------------------------------------
Q8YMK9_NOSS1/215-315--------------------------------------------------------------------------------
Q8YQ12_NOSS1/92-201--------------------------------------------------------------------------------
Q8YQ14_NOSS1/199-309--------------------------------------------------------------------------------
Q8YRY2_NOSS1/92-203--------------------------------------------------------------------------------
Q8YS49_NOSS1/164-273--------------------------------------------------------------------------------
Q8YTT7_NOSS1/228-330--------------------------------------------------------------------------------
Q8YTU3_NOSS1/193-298--------------------------------------------------------------------------------
Q8YTV3_NOSS1/226-325--------------------------------------------------------------------------------
Q8YTW7_NOSS1/187-286--------------------------------------------------------------------------------
Q8YTX1_NOSS1/211-313--------------------------------------------------------------------------------
Q8YTX5_NOSS1/216-314--------------------------------------------------------------------------------
Q8YTY2_NOSS1/201-306--------------------------------------------------------------------------------
Q8YTY5_NOSS1/151-256--------------------------------------------------------------------------------
Q8YUU5_NOSS1/221-322--------------------------------------------------------------------------------
Q8YUX2_NOSS1/204-311--------------------------------------------------------------------------------
Q8YUZ6_NOSS1/218-317--------------------------------------------------------------------------------
Q8YV02_NOSS1/239-340--------------------------------------------------------------------------------
Q8YV06_NOSS1/223-326--------------------------------------------------------------------------------
Q8YV23_NOSS1/244-343--------------------------------------------------------------------------------
Q8YV28_NOSS1/113-223--------------------------------------------------------------------------------
Q8YV33_NOSS1/226-325--------------------------------------------------------------------------------
Q8YXV8_NOSS1/247-346--------------------------------------------------------------------------------
Q8YZR0_NOSS1/197-301--------------------------------------------------------------------------------
Q926C6_RHIME/77-181--------------------------------------------------------------------------------
Q926C7_RHIME/75-180--------------------------------------------------------------------------------
Q92N43_RHIME/62-175--------------------------------------------------------------------------------
Q92N47_RHIME/50-161--------------------------------------------------------------------------------
Q92NX4_RHIME/168-278--------------------------------------------------------------------------------
Q92SY3_RHIME/47-153--------------------------------------------------------------------------------
Q92YC1_RHIME/89-189--------------------------------------------------------------------------------
Q98L70_RHILO/96-205--------------------------------------------------------------------------------
Q9A2Q6_CAUCR/84-194--------------------------------------------------------------------------------
Q9A2U5_CAUCR/104-216--------------------------------------------------------------------------------
Q9A3K9_CAUCR/178-299--------------------------------------------------------------------------------
Q9A3P1_CAUCR/49-158--------------------------------------------------------------------------------
Q9A3Q5_CAUCR/62-176--------------------------------------------------------------------------------
Q9A3S5_CAUCR/53-164--------------------------------------------------------------------------------
Q9A430_CAUCR/66-183--------------------------------------------------------------------------------
Q9A442_CAUCR/58-172--------------------------------------------------------------------------------
Q9A4A9_CAUCR/66-165--------------------------------------------------------------------------------
Q9A4B3_CAUCR/103-219--------------------------------------------------------------------------------
Q9A4J9_CAUCR/61-176--------------------------------------------------------------------------------
Q9A4L1_CAUCR/51-163--------------------------------------------------------------------------------
Q9A4M6_CAUCR/69-180--------------------------------------------------------------------------------
Q9A4W6_CAUCR/174-296--------------------------------------------------------------------------------
Q9A511_CAUCR/64-162--------------------------------------------------------------------------------
Q9A5P9_CAUCR/43-156--------------------------------------------------------------------------------
Q9A608_CAUCR/63-167--------------------------------------------------------------------------------
Q9A6A0_CAUCR/49-170--------------------------------------------------------------------------------
Q9A6E5_CAUCR/134-252--------------------------------------------------------------------------------
Q9A6W2_CAUCR/106-217--------------------------------------------------------------------------------
Q9A7B5_CAUCR/110-218--------------------------------------------------------------------------------
Q9A7D2_CAUCR/38-150--------------------------------------------------------------------------------
Q9A7E2_CAUCR/52-163--------------------------------------------------------------------------------
Q9A7E5_CAUCR/95-196--------------------------------------------------------------------------------
Q9A7G9_CAUCR/69-174--------------------------------------------------------------------------------
Q9A7H3_CAUCR/54-163--------------------------------------------------------------------------------
Q9A7Q4_CAUCR/47-169--------------------------------------------------------------------------------
Q9A7U6_CAUCR/64-185--------------------------------------------------------------------------------
Q9A847_CAUCR/53-157--------------------------------------------------------------------------------
Q9A949_CAUCR/36-151--------------------------------------------------------------------------------
Q9A952_CAUCR/60-164--------------------------------------------------------------------------------
Q9A958_CAUCR/51-165--------------------------------------------------------------------------------
Q9A963_CAUCR/164-276--------------------------------------------------------------------------------
Q9A981_CAUCR/71-177--------------------------------------------------------------------------------
Q9A995_CAUCR/77-199--------------------------------------------------------------------------------
Q9A9A1_CAUCR/61-180--------------------------------------------------------------------------------
Q9A9I1_CAUCR/55-176--------------------------------------------------------------------------------
Q9A9I5_CAUCR/63-165--------------------------------------------------------------------------------
Q9A9I9_CAUCR/45-154--------------------------------------------------------------------------------
Q9A9J7_CAUCR/204-330--------------------------------------------------------------------------------
Q9A9L0_CAUCR/52-154--------------------------------------------------------------------------------
Q9A9P9_CAUCR/148-261--------------------------------------------------------------------------------
Q9A9Z6_CAUCR/61-161--------------------------------------------------------------------------------
Q9AA84_CAUCR/56-171--------------------------------------------------------------------------------
Q9AAL8_CAUCR/93-216--------------------------------------------------------------------------------
Q9AAN4_CAUCR/74-187--------------------------------------------------------------------------------
Q9AAN5_CAUCR/165-283--------------------------------------------------------------------------------
Q9AAQ7_CAUCR/117-223--------------------------------------------------------------------------------
Q9AAY8_CAUCR/54-162--------------------------------------------------------------------------------
Q9AAZ6_CAUCR/51-162--------------------------------------------------------------------------------
Q9AB00_CAUCR/62-177--------------------------------------------------------------------------------
Q9AB96_CAUCR/127-237--------------------------------------------------------------------------------
Q9ABL3_CAUCR/57-163--------------------------------------------------------------------------------
Q9ABL7_CAUCR/91-201--------------------------------------------------------------------------------
Q9ABP1_CAUCR/43-153--------------------------------------------------------------------------------
Q9ABQ5_CAUCR/71-173--------------------------------------------------------------------------------
Q9ABT1_CAUCR/57-168--------------------------------------------------------------------------------
Q9AC38_CAUCR/154-254--------------------------------------------------------------------------------
Q9CKJ4_PASMU/57-168--------------------------------------------------------------------------------
Q9CL20_PASMU/52-158--------------------------------------------------------------------------------
Q9CLF3_PASMU/37-145--------------------------------------------------------------------------------
Q9CLW8_PASMU/64-169--------------------------------------------------------------------------------
Q9CML6_PASMU/51-182--------------------------------------------------------------------------------
Q9CMR7_PASMU/92-196--------------------------------------------------------------------------------
Q9CMS1_PASMU/45-158--------------------------------------------------------------------------------
Q9CPJ7_PASMU/33-147--------------------------------------------------------------------------------
Q9HUR6_PSEAE/174-282--------------------------------------------------------------------------------
Q9HUX3_PSEAE/63-163--------------------------------------------------------------------------------
Q9HVC0_PSEAE/46-150--------------------------------------------------------------------------------
Q9HWL3_PSEAE/148-251--------------------------------------------------------------------------------
Q9HWM5_PSEAE/55-171--------------------------------------------------------------------------------
Q9HYJ7_PSEAE/147-257--------------------------------------------------------------------------------
Q9HZT6_PSEAE/69-174--------------------------------------------------------------------------------
Q9I0P7_PSEAE/146-267--------------------------------------------------------------------------------
Q9I116_PSEAE/171-278--------------------------------------------------------------------------------
Q9I1E3_PSEAE/72-180--------------------------------------------------------------------------------
Q9I1I6_PSEAE/50-163--------------------------------------------------------------------------------
Q9I226_PSEAE/146-267--------------------------------------------------------------------------------
Q9I245_PSEAE/55-170--------------------------------------------------------------------------------
Q9I258_PSEAE/10-129--------------------------------------------------------------------------------
Q9I2I2_PSEAE/49-158--------------------------------------------------------------------------------
Q9I3X9_PSEAE/134-238--------------------------------------------------------------------------------
Q9I442_PSEAE/128-235--------------------------------------------------------------------------------
Q9I473_PSEAE/40-147--------------------------------------------------------------------------------
Q9I683_PSEAE/67-168--------------------------------------------------------------------------------
Q9I6Y1_PSEAE/143-242--------------------------------------------------------------------------------
Q9JXZ0_NEIMB/69-169--------------------------------------------------------------------------------
Q9KNA1_VIBCH/41-151--------------------------------------------------------------------------------
Q9KVE6_VIBCH/77-178--------------------------------------------------------------------------------
BTUB_VIBCH/41-148--------------------------------------------------------------------------------
RHTA_RHIME/52-157--------------------------------------------------------------------------------
A1TTI7_ACIAC/81-184--------------------------------------------------------------------------------
A4VNV4_PSEU5/90-193--------------------------------------------------------------------------------
A4XDV4_NOVAD/55-160--------------------------------------------------------------------------------
A4XDV5_NOVAD/65-177--------------------------------------------------------------------------------
A4XWA6_PSEMY/71-176--------------------------------------------------------------------------------
A6VN36_ACTSZ/47-145--------------------------------------------------------------------------------
A8AF53_CITK8/45-146--------------------------------------------------------------------------------
B2FLT5_STRMK/52-169--------------------------------------------------------------------------------
B2VCR0_ERWT9/63-167--------------------------------------------------------------------------------
B4E998_BURCJ/104-203--------------------------------------------------------------------------------
B8CQB0_SHEPW/54-167--------------------------------------------------------------------------------
C9R5Y6_AGGAD/36-136--------------------------------------------------------------------------------
D4Z7L1_SPHJU/71-183--------------------------------------------------------------------------------
D5V9Y8_MORCR/88-194--------------------------------------------------------------------------------
D5VAR1_MORCR/46-145--------------------------------------------------------------------------------
F5HE36_PORGI/126-229--------------------------------------------------------------------------------
F5HFX8_PORGI/126-231--------------------------------------------------------------------------------
F5HHM2_PORGI/134-237--------------------------------------------------------------------------------
F7YKH8_VIBA7/54-164--------------------------------------------------------------------------------
G8UJD9_TANFA/120-235--------------------------------------------------------------------------------
G9ALJ3_PANAN/79-181--------------------------------------------------------------------------------
FHUA_ECOLI/76-180--------------------------------------------------------------------------------
BTUB_SALTY/41-146--------------------------------------------------------------------------------
HGP2_HAEIN/84-194--------------------------------------------------------------------------------
YOEA_ECOLI/54-159--------------------------------------------------------------------------------
LBPA_NEIMB/62-172--------------------------------------------------------------------------------
Q08NI0_STIAD/190-293--------------------------------------------------------------------------------
Q0PAD4_CAMJE/39-151--------------------------------------------------------------------------------
Q1D485_MYXXD/260-363--------------------------------------------------------------------------------
Q2JYH7_RHIEC/85-186--------------------------------------------------------------------------------
Q2KUB6_BORA1/106-208--------------------------------------------------------------------------------
Q2YQD0_BRUA2/49-155--------------------------------------------------------------------------------
Q32AX7_SHIDS/45-147--------------------------------------------------------------------------------
Q32H19_SHIDS/38-139--------------------------------------------------------------------------------
Q4KED3_PSEF5/159-262--------------------------------------------------------------------------------
Q5L9X3_BACFN/203-327--------------------------------------------------------------------------------
Q5LDZ9_BACFN/124-253--------------------------------------------------------------------------------
Q5LED6_BACFN/48-156--------------------------------------------------------------------------------
Q5LGH2_BACFN/54-158--------------------------------------------------------------------------------
Q5LHT9_BACFN/200-325--------------------------------------------------------------------------------
Q5NM05_ZYMMO/78-184--------------------------------------------------------------------------------
Q74QP1_YERPE/47-150--------------------------------------------------------------------------------
Y1497_NEIMB/58-167--------------------------------------------------------------------------------
Q7ME89_VIBVY/42-152--------------------------------------------------------------------------------
Q7VT87_BORPE/85-185--------------------------------------------------------------------------------
Q7VV12_BORPE/56-172--------------------------------------------------------------------------------
Q7VX10_BORPE/75-173--------------------------------------------------------------------------------
Q89KI5_BRADU/114-217--------------------------------------------------------------------------------
SUSC_BACTN/117-232--------------------------------------------------------------------------------
Q8P6C7_XANCP/50-170--------------------------------------------------------------------------------
Q8RFD8_FUSNN/34-142--------------------------------------------------------------------------------
Q8RHN9_FUSNN/42-147--------------------------------------------------------------------------------
Q8ZMN0_SALTY/51-165--------------------------------------------------------------------------------
Q8ZRQ2_SALTY/76-181--------------------------------------------------------------------------------
Q9HV88_PSEAE/46-155--------------------------------------------------------------------------------
Q9I2J4_PSEAE/162-260--------------------------------------------------------------------------------
Q9I422_PSEAE/71-169--------------------------------------------------------------------------------
Q9I648_PSEAE/150-248--------------------------------------------------------------------------------
Q9JXL3_NEIMB/44-144--------------------------------------------------------------------------------
Q9JYA8_NEIMB/47-158--------------------------------------------------------------------------------
Q9KM13_VIBCH/47-156--------------------------------------------------------------------------------
Q9PBA7_XYLFA/58-166--------------------------------------------------------------------------------
Q9PBL0_XYLFA/49-168--------------------------------------------------------------------------------
Q9PD83_XYLFA/60-165--------------------------------------------------------------------------------
Q9PFQ8_XYLFA/87-188--------------------------------------------------------------------------------
Q9PFV7_XYLFA/73-193--------------------------------------------------------------------------------
Q9PGB8_XYLFA/70-173--------------------------------------------------------------------------------
Q9PGG3_XYLFA/59-175--------------------------------------------------------------------------------
W8UAT3_YEREN/60-162--------------------------------------------------------------------------------
W8UKL4_YEREN/65-167--------------------------------------------------------------------------------
X4Z9R1_9BORD/82-182--------------------------------------------------------------------------------

PF02597

A0A038FGD1_MYCTX/5-93--------------------------------------------------------------------------------
A0A022NT57_PSEAI/4-83--------------------------------------------------------------------------------
MOC2A_ARATH/20-96--------------------------------------------------------------------------------
A0A017I2D4_ECOLX/3-66--------------------------------------------------------------------------------
Q8YP47_NOSS1/10-86--------------------------------------------------------------------------------
F5XAY1_PORGT/3-66--------------------------------------------------------------------------------
F7USZ2_SYNYG/7-81--------------------------------------------------------------------------------
A0A016XBE1_VIBCL/4-81--------------------------------------------------------------------------------
A0A008B1Z7_STAAU/3-77--------------------------------------------------------------------------------
D0KV26_SULS9/6-86--------------------------------------------------------------------------------
Q8DK83_THEEB/5-91--------------------------------------------------------------------------------
Q7VIB7_HELHP/5-68--------------------------------------------------------------------------------
D5TY59_BACT1/4-77--------------------------------------------------------------------------------
B1V4U2_CLOPF/1-64--------------------------------------------------------------------------------
A0A038G856_PSESF/3-66--------------------------------------------------------------------------------
Q82D24_STRAW/5-93--------------------------------------------------------------------------------
Q8EEE0_SHEON/4-67--------------------------------------------------------------------------------
A0A038HKU6_BORBO/3-66--------------------------------------------------------------------------------
J7JLX0_BACIU/2-66--------------------------------------------------------------------------------
B8GWX4_CAUCN/4-79--------------------------------------------------------------------------------
Q8PYN0_METMA/6-97--------------------------------------------------------------------------------
B9DLY4_STACT/3-77--------------------------------------------------------------------------------
Q84HF7_PSEFL/3-88--------------------------------------------------------------------------------
Q7MM72_VIBVY/4-81--------------------------------------------------------------------------------
Q7US82_RHOBA/7-70--------------------------------------------------------------------------------
Q97AK2_THEVO/5-91--------------------------------------------------------------------------------
A1F6D2_VIBCL/22-85--------------------------------------------------------------------------------
Q82GG4_STRAW/5-91--------------------------------------------------------------------------------
E2M8J3_PSEUB/5-81--------------------------------------------------------------------------------
Q82SH5_NITEU/5-90--------------------------------------------------------------------------------
Q7MQQ8_WOLSU/13-76--------------------------------------------------------------------------------
A0A011RSZ0_VIBPH/4-67--------------------------------------------------------------------------------
F0DZB4_PSEDT/5-90--------------------------------------------------------------------------------
Q82AG4_STRAW/3-66--------------------------------------------------------------------------------
Q8YX71_NOSS1/7-70--------------------------------------------------------------------------------
E1RM89_XYLFG/3-66--------------------------------------------------------------------------------
MOC2A_CAEEL/6-84--------------------------------------------------------------------------------
Q9HJR9_THEAC/4-90--------------------------------------------------------------------------------
Q984P1_RHILO/5-85--------------------------------------------------------------------------------
Q7P1M7_CHRVO/5-83--------------------------------------------------------------------------------
A0A038FH16_9BRAD/3-83--------------------------------------------------------------------------------
Q8KJ36_RHILI/3-65--------------------------------------------------------------------------------
Q7VLN3_HAEDU/4-81--------------------------------------------------------------------------------
O25482_HELPY/5-74--------------------------------------------------------------------------------
Q3M386_ANAVT/5-91--------------------------------------------------------------------------------
A4QFA7_CORGB/4-65--------------------------------------------------------------------------------
F0K5I9_CLOAE/1-64--------------------------------------------------------------------------------
Q7NNK9_GLOVI/5-68--------------------------------------------------------------------------------
Q8U1Z3_PYRFU/6-69--------------------------------------------------------------------------------
Q8ZVT4_PYRAE/5-93--------------------------------------------------------------------------------
Q88NB9_PSEPK/6-82--------------------------------------------------------------------------------
A0A038FHU0_MYCTX/15-92--------------------------------------------------------------------------------
Y552_ARCFU/5-88--------------------------------------------------------------------------------
B8GWN1_CAUCN/3-66--------------------------------------------------------------------------------
D5AP66_RHOCB/4-82--------------------------------------------------------------------------------
Q7VAV4_PROMA/3-69--------------------------------------------------------------------------------
Q9KCY7_BACHD/3-65--------------------------------------------------------------------------------
Q7MSI9_WOLSU/5-76--------------------------------------------------------------------------------
YCF40_PORPU/8-71--------------------------------------------------------------------------------
Q9HJF0_THEAC/10-85--------------------------------------------------------------------------------
Q7U5U0_SYNPX/5-71--------------------------------------------------------------------------------
A0A038HHS0_BORBO/8-83--------------------------------------------------------------------------------
Q9V034_PYRAB/6-84--------------------------------------------------------------------------------
Q7N6P4_PHOLL/4-81--------------------------------------------------------------------------------
C6IGS4_9BACE/3-66--------------------------------------------------------------------------------
Q0K9G1_CUPNH/5-85--------------------------------------------------------------------------------
D2P0W6_LISM1/5-82--------------------------------------------------------------------------------
Q8GGC8_9PSED/5-80--------------------------------------------------------------------------------
A0A038FJL0_MYCTX/3-68--------------------------------------------------------------------------------
E8VU59_VIBVM/6-69--------------------------------------------------------------------------------
Q8PTR8_METMA/5-94--------------------------------------------------------------------------------
A0A017ISQ7_ECOLX/4-81--------------------------------------------------------------------------------
A0A011VH90_BACTI/3-67--------------------------------------------------------------------------------
O27775_METTH/5-70--------------------------------------------------------------------------------
I6TV05_9EURY/3-82--------------------------------------------------------------------------------
Q7BNS2_PSEST/5-90--------------------------------------------------------------------------------
A9CHN0_AGRT5/3-65--------------------------------------------------------------------------------
A0A015NL64_BACTU/4-77--------------------------------------------------------------------------------
Q8DJ67_THEEB/13-87--------------------------------------------------------------------------------
Q7U3F9_SYNPX/5-76--------------------------------------------------------------------------------
Q9HP17_HALSA/12-100--------------------------------------------------------------------------------
Q85G19_CYAME/4-67--------------------------------------------------------------------------------
I6UZY7_9EURY/5-73--------------------------------------------------------------------------------
Q7MRV7_WOLSU/3-68--------------------------------------------------------------------------------
Q8E943_SHEON/4-83--------------------------------------------------------------------------------
D5CGI2_ENTCC/4-81--------------------------------------------------------------------------------
Q8Y370_RALSO/5-75--------------------------------------------------------------------------------
Q7ND70_GLOVI/5-81--------------------------------------------------------------------------------
B6J1X6_COXB2/4-67--------------------------------------------------------------------------------
Q9TLZ4_CYACA/10-73--------------------------------------------------------------------------------
Q8DKP8_THEEB/10-73--------------------------------------------------------------------------------
Q7NFW1_GLOVI/5-91--------------------------------------------------------------------------------
Q970H2_SULTO/5-68--------------------------------------------------------------------------------
YCF40_ODOSI/10-73--------------------------------------------------------------------------------
A0A011QUA6_VIBPH/4-85--------------------------------------------------------------------------------
D8N4T3_RALSL/7-87--------------------------------------------------------------------------------
A0A014P9L1_BRUML/5-85--------------------------------------------------------------------------------
Q9RR88_DEIRA/5-78--------------------------------------------------------------------------------
Q9UYT7_PYRAB/5-89--------------------------------------------------------------------------------
Q7CZX6_AGRT5/4-84--------------------------------------------------------------------------------
F7THR2_PASMD/4-81--------------------------------------------------------------------------------
F7USD8_SYNYG/8-71--------------------------------------------------------------------------------
Q8NTT7_CORGL/25-107--------------------------------------------------------------------------------
Q97B89_THEVO/15-90--------------------------------------------------------------------------------
A0A024EQ91_BRUCA/3-65--------------------------------------------------------------------------------
F7UQ97_SYNYG/23-109--------------------------------------------------------------------------------
Q7MRM6_WOLSU/4-73--------------------------------------------------------------------------------
I6TVI3_9EURY/6-90--------------------------------------------------------------------------------
C2RR67_BACCE/4-78--------------------------------------------------------------------------------
Q89FP3_BRADU/3-65--------------------------------------------------------------------------------
Q8FP53_COREF/3-66--------------------------------------------------------------------------------
C3WR59_FUSNV/2-64--------------------------------------------------------------------------------
Q8ZUW0_PYRAE/5-86--------------------------------------------------------------------------------
O28175_ARCFU/5-89--------------------------------------------------------------------------------
C5QCI6_STAEP/3-77--------------------------------------------------------------------------------
Q7MRW5_WOLSU/20-80--------------------------------------------------------------------------------
O28649_ARCFU/4-86--------------------------------------------------------------------------------
A0A021WPJ6_SALET/3-66--------------------------------------------------------------------------------
Q9K8I8_BACHD/4-78--------------------------------------------------------------------------------
A0A028Y4Y7_STAEP/3-66--------------------------------------------------------------------------------
Q82XI6_NITEU/3-66--------------------------------------------------------------------------------
Q7URF4_RHOBA/9-86--------------------------------------------------------------------------------
Q88CS5_PSEPK/29-92--------------------------------------------------------------------------------
Q7V0I2_PROMP/3-69--------------------------------------------------------------------------------
Q8ZYL1_PYRAE/5-81--------------------------------------------------------------------------------
Q7N965_PHOLL/3-66--------------------------------------------------------------------------------
Q8GAH3_ARTNI/3-88--------------------------------------------------------------------------------
F6BRJ2_SINMB/6-86--------------------------------------------------------------------------------
Q8FU31_COREF/3-85--------------------------------------------------------------------------------
MOC2A_HUMAN/9-88--------------------------------------------------------------------------------
Q8TQ39_METAC/5-94--------------------------------------------------------------------------------
Y022_ARCFU/5-91--------------------------------------------------------------------------------
A4N5Q8_HAEIF/4-81--------------------------------------------------------------------------------
Q8R7E6_THETN/3-64--------------------------------------------------------------------------------
Q9RYY0_DEIRA/28-91--------------------------------------------------------------------------------
B3DSY5_BIFLD/1-64--------------------------------------------------------------------------------
A2CB22_PROM3/3-69--------------------------------------------------------------------------------
Q4UXY3_XANC8/3-66--------------------------------------------------------------------------------
E8VKH1_BACST/4-77--------------------------------------------------------------------------------
I6UA38_9EURY/3-75--------------------------------------------------------------------------------
Q8KEJ0_CHLTE/42-105--------------------------------------------------------------------------------
Q7NIX1_GLOVI/5-91--------------------------------------------------------------------------------
Q7NRL3_CHRVO/6-69--------------------------------------------------------------------------------
Q7VK46_HELHP/4-74--------------------------------------------------------------------------------
Q4URN3_XANC8/7-81--------------------------------------------------------------------------------

PF14451

Q47PR4_THEFY/3-83--------------------------------------------------------------------------------
Q82I67_STRAW/3-83--------------------------------------------------------------------------------
B2J5U8_NOSP7/1-81--------------------------------------------------------------------------------
Q5YVW4_NOCFA/3-83--------------------------------------------------------------------------------
Q8XQV9_RALSO/1-81--------------------------------------------------------------------------------
C1DSE4_AZOVD/1-81--------------------------------------------------------------------------------
Q13TC6_BURXL/1-81--------------------------------------------------------------------------------
Q3SGY2_THIDA/13-93--------------------------------------------------------------------------------
Q1LS16_RALME/1-81--------------------------------------------------------------------------------
O53776_MYCTU/4-82--------------------------------------------------------------------------------
Q63PX0_BURPS/1-81--------------------------------------------------------------------------------
Q9EWH1_STRCO/4-82--------------------------------------------------------------------------------
Q9WZN6_THEMA/5-81--------------------------------------------------------------------------------

PF06805

Q6XQC0_BPT1/3-88--------------------------------------------------------------------------------
TIPI_LAMBD/14-97--------------------------------------------------------------------------------
Q72A44_DESVH/2-86--------------------------------------------------------------------------------
V6F1V8_9PROT/2-81--------------------------------------------------------------------------------

PF14453

B3E965_GEOLS/1-57--------------------------------------------------------------------------------
A1AQ25_PELPD/2-58--------------------------------------------------------------------------------
W6SIN0_9CLOT/1-57--------------------------------------------------------------------------------
D3UJA0_HELM1/1-57--------------------------------------------------------------------------------
M1P9Z0_DESSD/2-56--------------------------------------------------------------------------------
A5N8P9_CLOK5/1-57--------------------------------------------------------------------------------
E4TIG1_CALNY/2-57--------------------------------------------------------------------------------
M4YP45_9EURY/1-54--------------------------------------------------------------------------------
R6PJT0_9FIRM/1-56--------------------------------------------------------------------------------
A6LR54_CLOB8/1-57--------------------------------------------------------------------------------
U5MSK2_CLOSA/1-58--------------------------------------------------------------------------------
R5XCB2_9CLOT/1-57--------------------------------------------------------------------------------
D4H1A3_DENA2/1-57--------------------------------------------------------------------------------
Q3A6Y7_PELCD/1-57--------------------------------------------------------------------------------
Q8XK01_CLOPE/1-57--------------------------------------------------------------------------------
G7MA46_9CLOT/1-57--------------------------------------------------------------------------------
Q893R1_CLOTE/1-57--------------------------------------------------------------------------------
F8E5V0_FLESM/2-58--------------------------------------------------------------------------------
Q186R2_PEPD6/4-60--------------------------------------------------------------------------------
G0VMM4_MEGEL/1-55--------------------------------------------------------------------------------
Q97F32_CLOAB/1-57--------------------------------------------------------------------------------
R6FQV9_9CLOT/1-57--------------------------------------------------------------------------------
R6U3J4_9CLOT/1-57--------------------------------------------------------------------------------
M1LZE0_9CLOT/1-58--------------------------------------------------------------------------------
Q0P9K6_CAMJE/2-58--------------------------------------------------------------------------------
A7I2J2_CAMHC/1-56--------------------------------------------------------------------------------
D3P9R0_DEFDS/2-58--------------------------------------------------------------------------------
A6TVU8_ALKMQ/1-57--------------------------------------------------------------------------------

PF09138

URM1_DROME/7-101--------------------------------------------------------------------------------
URM1_NEUCR/10-109--------------------------------------------------------------------------------
A8B2R1_GIAIC/2-95--------------------------------------------------------------------------------
Q5K8K6_CRYNJ/41-142--------------------------------------------------------------------------------
Q4Z149_PLABA/4-125--------------------------------------------------------------------------------
URM11_ARATH/2-101--------------------------------------------------------------------------------
URM1_MOUSE/6-101--------------------------------------------------------------------------------
URM1_KLULA/3-101--------------------------------------------------------------------------------
URM1_CANGA/3-98--------------------------------------------------------------------------------
Q8IHY3_PLAF7/4-126--------------------------------------------------------------------------------
Q4D6P3_TRYCC/6-102--------------------------------------------------------------------------------
URM11_CANAL/4-101--------------------------------------------------------------------------------
URM1_ASHGO/3-100--------------------------------------------------------------------------------
URM1_DICDI/2-96--------------------------------------------------------------------------------
Q5CN54_CRYHO/2-97--------------------------------------------------------------------------------
URM1_YEAST/3-99--------------------------------------------------------------------------------
URM1_ASPOR/21-120--------------------------------------------------------------------------------
URM1_ORYSJ/2-100--------------------------------------------------------------------------------
G4VFM6_SCHMA/3-95--------------------------------------------------------------------------------

PF14478

C7MMP4_CRYCD/746-832--------------------------------------------------------------------------------
D4LDD7_RUMC1/89-166--------------------------------------------------------------------------------
D4N187_9FIRM/6-74--------------------------------------------------------------------------------
Q8EQ92_OCEIH/72-139--------------------------------------------------------------------------------
D1BTM7_XYLCX/65-136--------------------------------------------------------------------------------
A5D262_PELTS/142-210--------------------------------------------------------------------------------
Q0AY48_SYNWW/141-213--------------------------------------------------------------------------------
C8W7I0_ATOPD/630-709--------------------------------------------------------------------------------
C8VYB8_DESAS/548-628--------------------------------------------------------------------------------
C8W7H9_ATOPD/146-218--------------------------------------------------------------------------------
C3Z2V8_BRAFL/39-132--------------------------------------------------------------------------------
E1BCU6_BOVIN/349-426--------------------------------------------------------------------------------
Q03P33_LACBA/161-232--------------------------------------------------------------------------------
B9DRL5_STRU0/59-125--------------------------------------------------------------------------------
E2RF44_CANFA/355-432--------------------------------------------------------------------------------
D4JDA1_9FIRM/58-136--------------------------------------------------------------------------------
D9S0W5_THEOJ/194-262--------------------------------------------------------------------------------
C6CYP6_PAESJ/885-963--------------------------------------------------------------------------------
Q897G6_CLOTE/191-267--------------------------------------------------------------------------------
A5VM59_LACRD/58-124--------------------------------------------------------------------------------
D7CJZ8_SYNLT/139-211--------------------------------------------------------------------------------
C7MMP5_CRYCD/172-244--------------------------------------------------------------------------------
E6TWS8_BACCJ/81-147--------------------------------------------------------------------------------
D4LH84_9FIRM/85-163--------------------------------------------------------------------------------
C4L3C0_EXISA/57-129--------------------------------------------------------------------------------
D4LS03_9FIRM/322-400--------------------------------------------------------------------------------
B1YLV0_EXIS2/57-129--------------------------------------------------------------------------------
A9NFJ8_ACHLI/65-136--------------------------------------------------------------------------------
B0S0B7_FINM2/82-148--------------------------------------------------------------------------------
C9A5V7_ENTCA/62-128--------------------------------------------------------------------------------
E4TW85_SULKY/41-110--------------------------------------------------------------------------------
E6U4M0_ETHHY/55-133--------------------------------------------------------------------------------
C3Z2V9_BRAFL/82-162--------------------------------------------------------------------------------
C2X0V8_BACCE/60-129--------------------------------------------------------------------------------
C3AMY9_BACMY/203-274--------------------------------------------------------------------------------
C3AMZ0_BACMY/48-120--------------------------------------------------------------------------------
C9A8K6_ENTCA/71-137--------------------------------------------------------------------------------
F2Z4S3_DANRE/346-421--------------------------------------------------------------------------------
Q1G7W1_LACDA/78-147--------------------------------------------------------------------------------
Q5M4Z4_STRT2/63-128--------------------------------------------------------------------------------
Q7UMM4_RHOBA/104-174--------------------------------------------------------------------------------
Q8DV11_STRMU/58-123--------------------------------------------------------------------------------
Q9CGC6_LACLA/63-128--------------------------------------------------------------------------------
R5LCD0_9FIRM/51-125--------------------------------------------------------------------------------
R5LUQ9_9FIRM/402-479--------------------------------------------------------------------------------
R5QRV1_9FIRM/146-222--------------------------------------------------------------------------------
R5X475_9CLOT/226-302--------------------------------------------------------------------------------
R5ZPE1_9ACTN/227-298--------------------------------------------------------------------------------
R6A543_9ACTN/175-257--------------------------------------------------------------------------------
R6UZP2_9FIRM/64-142--------------------------------------------------------------------------------
R7GLI8_9FIRM/172-246--------------------------------------------------------------------------------
T0UC21_9ENTE/71-137--------------------------------------------------------------------------------
U5RPA7_9CLOT/740-812--------------------------------------------------------------------------------

PF14452

Q8ZSK8_NOSS1/51-119--------------------------------------------------------------------------------
Q8ZSK8_NOSS1/123-190--------------------------------------------------------------------------------
A1VQ26_POLNA/38-106--------------------------------------------------------------------------------
K9SQ45_9CYAN/79-146--------------------------------------------------------------------------------
Q98A60_RHILO/152-223--------------------------------------------------------------------------------
Q87QR5_VIBPA/99-165--------------------------------------------------------------------------------
A5FFE8_FLAJ1/164-237--------------------------------------------------------------------------------
Q1QNK3_NITHX/22-88--------------------------------------------------------------------------------
J9ZBT4_LEPFM/82-155--------------------------------------------------------------------------------
Q1LHZ6_RALME/2-65--------------------------------------------------------------------------------
K0NPI0_DESTT/8-76--------------------------------------------------------------------------------
Q87QR5_VIBPA/30-95--------------------------------------------------------------------------------
Q87QR5_VIBPA/170-244--------------------------------------------------------------------------------
F8ERC4_RUNSL/157-230--------------------------------------------------------------------------------
Q1QNK3_NITHX/92-158--------------------------------------------------------------------------------
Q6N2C3_RHOPA/163-236--------------------------------------------------------------------------------
C5ASL5_METEA/12-78--------------------------------------------------------------------------------
C5ASL5_METEA/83-149--------------------------------------------------------------------------------
K0NPI0_DESTT/151-223--------------------------------------------------------------------------------
E8V187_TERSS/105-171--------------------------------------------------------------------------------
K0NPI0_DESTT/80-147--------------------------------------------------------------------------------
G0G1X0_AMYMS/16-81--------------------------------------------------------------------------------
A0M1R9_GRAFK/14-86--------------------------------------------------------------------------------
F8ERC4_RUNSL/86-153--------------------------------------------------------------------------------
D9T1T9_MICAI/19-88--------------------------------------------------------------------------------
Q6N2C3_RHOPA/24-87--------------------------------------------------------------------------------
L0A1Z4_DEIPD/18-91--------------------------------------------------------------------------------
C6XP90_HIRBI/105-170--------------------------------------------------------------------------------
H5WU01_9BURK/95-161--------------------------------------------------------------------------------
E8V187_TERSS/176-248--------------------------------------------------------------------------------
D4Z2N9_SPHJU/105-170--------------------------------------------------------------------------------
A1VQ26_POLNA/110-176--------------------------------------------------------------------------------
F2G4I8_ALTMD/17-89--------------------------------------------------------------------------------
C1F6N5_ACIC5/174-247--------------------------------------------------------------------------------
Q0RFW0_FRAAA/14-81--------------------------------------------------------------------------------
Q6N2C3_RHOPA/92-159--------------------------------------------------------------------------------
Q1LHZ6_RALME/69-135--------------------------------------------------------------------------------
Q0BZ50_HYPNA/100-166--------------------------------------------------------------------------------
F4CXB8_PSEUX/23-96--------------------------------------------------------------------------------
Q6YRU9_SYNY3/80-147--------------------------------------------------------------------------------
Q0BZ50_HYPNA/31-96--------------------------------------------------------------------------------
F4GZU7_CELFA/20-92--------------------------------------------------------------------------------
A5FFE8_FLAJ1/93-158--------------------------------------------------------------------------------
E6W9I5_PANSA/105-171--------------------------------------------------------------------------------
Q98A60_RHILO/14-81--------------------------------------------------------------------------------
E6W9I5_PANSA/176-249--------------------------------------------------------------------------------
K9SQ45_9CYAN/7-75--------------------------------------------------------------------------------
H6RP70_BLASD/18-91--------------------------------------------------------------------------------
B0T6R0_CAUSK/65-131--------------------------------------------------------------------------------
Q2JEM4_FRASC/16-89--------------------------------------------------------------------------------
D2QVE6_SPILD/30-94--------------------------------------------------------------------------------
Q6YRU9_SYNY3/8-76--------------------------------------------------------------------------------
Q1LHZ6_RALME/140-213--------------------------------------------------------------------------------
E6W9I5_PANSA/35-101--------------------------------------------------------------------------------
C6XP90_HIRBI/36-101--------------------------------------------------------------------------------
B8EPP1_METSB/40-107--------------------------------------------------------------------------------
D2QVE6_SPILD/97-161--------------------------------------------------------------------------------
N0B0S6_9RHIZ/26-96--------------------------------------------------------------------------------
E8V187_TERSS/37-101--------------------------------------------------------------------------------
C7R645_KANKD/14-78--------------------------------------------------------------------------------
C6WWR7_METML/15-88--------------------------------------------------------------------------------
C1F6N5_ACIC5/105-170--------------------------------------------------------------------------------
C6XP90_HIRBI/176-248--------------------------------------------------------------------------------

PF02991

ATG8H_ARATH/16-119--------------------------------------------------------------------------------
ATG8C_ARATH/14-117--------------------------------------------------------------------------------
MLP3B_RAT/15-120--------------------------------------------------------------------------------
Q9VEG5_DROME/15-118--------------------------------------------------------------------------------
LGG1_CAEEL/13-116--------------------------------------------------------------------------------
LGG2_CAEEL/25-130--------------------------------------------------------------------------------
GBRL2_RAT/13-116--------------------------------------------------------------------------------
ATG8_YEAST/13-116--------------------------------------------------------------------------------
G7DYK3_MIXOS/37-140--------------------------------------------------------------------------------

PF04110

ATG12_HUMAN/54-140--------------------------------------------------------------------------------
ATG12_SCHPO/46-132--------------------------------------------------------------------------------
ATG12_YEAST/103-186--------------------------------------------------------------------------------
AT12B_ARATH/11-94--------------------------------------------------------------------------------
APG12_DROME/25-111--------------------------------------------------------------------------------
Q10931_CAEEL/28-118--------------------------------------------------------------------------------

PF11976

A5DMB3_PICGU/325-398--------------------------------------------------------------------------------
Q0UWJ0_PHANO/370-441--------------------------------------------------------------------------------
A2EJ42_TRIVA/1-71--------------------------------------------------------------------------------
ESC2_ASHGO/335-406--------------------------------------------------------------------------------
Q5KPV6_CRYNJ/339-412--------------------------------------------------------------------------------
A0D2P6_PARTE/10-80--------------------------------------------------------------------------------
Q4UIN2_THEAN/19-89--------------------------------------------------------------------------------
Q59WH5_CANAL/410-485--------------------------------------------------------------------------------
Q6CMC6_KLULA/320-391--------------------------------------------------------------------------------
Q6CB36_YARLI/328-398--------------------------------------------------------------------------------
A7TQN0_VANPO/370-441--------------------------------------------------------------------------------
Q6FY59_CANGA/297-368--------------------------------------------------------------------------------
A8BJ08_GIAIC/6-76--------------------------------------------------------------------------------
A1CE20_ASPCL/324-395--------------------------------------------------------------------------------
SUMO4_PIG/18-88--------------------------------------------------------------------------------
PMT3_SCHPO/36-106--------------------------------------------------------------------------------
A0BY18_PARTE/5-77--------------------------------------------------------------------------------
A5KAY6_PLAVS/22-92--------------------------------------------------------------------------------
A6R362_AJECN/428-499--------------------------------------------------------------------------------
Q5CEM0_CRYHO/43-113--------------------------------------------------------------------------------
Q4UDK2_THEAN/95-165--------------------------------------------------------------------------------
Q55FZ7_DICDI/484-556--------------------------------------------------------------------------------
A0C2N0_PARTE/1-71--------------------------------------------------------------------------------
A4H5B4_LEIBR/36-106--------------------------------------------------------------------------------
Q4P200_USTMA/17-87--------------------------------------------------------------------------------
Q7S928_NEUCR/476-549--------------------------------------------------------------------------------
Q5KL85_CRYNJ/25-95--------------------------------------------------------------------------------
RAD60_SCHPO/334-405--------------------------------------------------------------------------------
Q0CFY2_ASPTN/303-374--------------------------------------------------------------------------------
A0C7A7_PARTE/6-78--------------------------------------------------------------------------------
A7F5M5_SCLS1/396-469--------------------------------------------------------------------------------
A8P2N1_COPC7/22-92--------------------------------------------------------------------------------
C6T142_SOYBN/21-91--------------------------------------------------------------------------------
C8VFD0_EMENI/322-392--------------------------------------------------------------------------------
E7KM21_YEASL/384-455--------------------------------------------------------------------------------

PF00240

RD23A_MOUSE/8-80--------------------------------------------------------------------------------
UBP6_SCHPO/8-75--------------------------------------------------------------------------------
DSK2_YEAST/8-75--------------------------------------------------------------------------------
UBFD1_HUMAN/89-157--------------------------------------------------------------------------------
Y2010_ARATH/18-85--------------------------------------------------------------------------------
RAD23_DICDI/6-75--------------------------------------------------------------------------------
Q23451_CAEEL/8-79--------------------------------------------------------------------------------
ISG15_HUMAN/87-155--------------------------------------------------------------------------------
ISG15_BOVIN/84-152--------------------------------------------------------------------------------
ISG15_MOUSE/85-153--------------------------------------------------------------------------------
UBQL1_HUMAN/42-109--------------------------------------------------------------------------------
OASL_HUMAN/439-506--------------------------------------------------------------------------------
UBQ8_ARATH/84-152--------------------------------------------------------------------------------
MDY2_YEAST/79-152--------------------------------------------------------------------------------
YKA4_CAEEL/346-415--------------------------------------------------------------------------------
Q18231_CAEEL/6-69--------------------------------------------------------------------------------
Q9VWD9_DROME/14-81--------------------------------------------------------------------------------
SUMO_CAEEL/18-88--------------------------------------------------------------------------------
RUB1_YEAST/6-74--------------------------------------------------------------------------------
Q9VNB2_DROME/164-237--------------------------------------------------------------------------------
UBQ8_ARATH/398-466--------------------------------------------------------------------------------
Q9TZ84_CAEEL/186-257--------------------------------------------------------------------------------
YB92_SCHPO/9-79--------------------------------------------------------------------------------
Q9ZQZ4_ARATH/6-74--------------------------------------------------------------------------------
UBQ8_ARATH/243-316--------------------------------------------------------------------------------
NEDD8_HUMAN/6-74--------------------------------------------------------------------------------
RAD23_YEAST/7-76--------------------------------------------------------------------------------
Q9ZQZ5_ARATH/7-75--------------------------------------------------------------------------------
Q20899_CAEEL/25-98--------------------------------------------------------------------------------
Q9VCD5_DROME/6-78--------------------------------------------------------------------------------
RUB3_ARATH/6-74--------------------------------------------------------------------------------
UBL4A_MOUSE/6-74--------------------------------------------------------------------------------
Q9SV28_ARATH/14-85--------------------------------------------------------------------------------
SF3A1_HUMAN/712-788--------------------------------------------------------------------------------
DSK2A_ARATH/23-91--------------------------------------------------------------------------------
UPL5_ARATH/100-171--------------------------------------------------------------------------------
UBQ8_ARATH/160-235--------------------------------------------------------------------------------
RHP23_SCHPO/6-76--------------------------------------------------------------------------------
SUMO1_ARATH/21-91--------------------------------------------------------------------------------
UBQ8_ARATH/474-549--------------------------------------------------------------------------------
UBIM_HUMAN/6-72--------------------------------------------------------------------------------
P91050_CAEEL/147-214--------------------------------------------------------------------------------
Q9VS82_DROME/8-75--------------------------------------------------------------------------------
SMT3_YEAST/27-96--------------------------------------------------------------------------------
HERP1_HUMAN/15-89--------------------------------------------------------------------------------
Q9VEC8_DROME/6-75--------------------------------------------------------------------------------
SUMO1_MOUSE/25-95--------------------------------------------------------------------------------
Q9V3W9_DROME/6-77--------------------------------------------------------------------------------
P4KG4_ARATH/36-108--------------------------------------------------------------------------------
DSK2_SCHPO/9-77--------------------------------------------------------------------------------
UHRF1_MOUSE/6-76--------------------------------------------------------------------------------
YQ77_SCHPO/6-72--------------------------------------------------------------------------------
PMT3_SCHPO/39-109--------------------------------------------------------------------------------
Q9ZT95_ARATH/6-74--------------------------------------------------------------------------------
PRKN2_MOUSE/6-74--------------------------------------------------------------------------------
Q9VXF9_DROME/6-75--------------------------------------------------------------------------------
B0BLT8_XENTR/34-100--------------------------------------------------------------------------------
D7LEX6_ARALL/83-146--------------------------------------------------------------------------------
F1M2K3_RAT/25-89--------------------------------------------------------------------------------
F4HTF5_ARATH/147-211--------------------------------------------------------------------------------
G5EG66_CAEEL/15-80--------------------------------------------------------------------------------
H9L0X6_CHICK/398-463--------------------------------------------------------------------------------
P4KG2_ARATH/42-107--------------------------------------------------------------------------------
R5RDZ3_9PROT/26-94--------------------------------------------------------------------------------

PF13881

UBL3_RAT/8-114--------------------------------------------------------------------------------
B7P3D8_IXOSC/8-114--------------------------------------------------------------------------------
A7SNL0_NEMVE/14-120--------------------------------------------------------------------------------
B9RJE5_RICCO/5-116--------------------------------------------------------------------------------
B9GF64_POPTR/6-117--------------------------------------------------------------------------------
C5WWH9_SORBI/6-116--------------------------------------------------------------------------------
A9TF62_PHYPA/5-115--------------------------------------------------------------------------------
MUB6_ARATH/6-117--------------------------------------------------------------------------------
B9IK46_POPTR/6-115--------------------------------------------------------------------------------
MUB5_ARATH/5-118--------------------------------------------------------------------------------
MUB2_ARATH/6-118--------------------------------------------------------------------------------
A8XAJ2_CAEBR/12-118--------------------------------------------------------------------------------
B9IFG4_POPTR/5-117--------------------------------------------------------------------------------
MUB3_ARATH/5-116--------------------------------------------------------------------------------
MUB1_ARATH/6-115--------------------------------------------------------------------------------
A8HXJ7_CHLRE/4-120--------------------------------------------------------------------------------
D0MVT8_PHYIT/6-119--------------------------------------------------------------------------------
A4S711_OSTLU/19-146--------------------------------------------------------------------------------
B6TK57_MAIZE/24-136--------------------------------------------------------------------------------
K7MUX4_SOYBN/6-115--------------------------------------------------------------------------------
MUB2_ORYSJ/12-124--------------------------------------------------------------------------------
MUB3_ORYSJ/6-117--------------------------------------------------------------------------------

PF14560

D3AYP4_POLPA/29-122--------------------------------------------------------------------------------
B0CT99_LACBS/2-86--------------------------------------------------------------------------------
TBCB_CAEEL/4-88--------------------------------------------------------------------------------
B9ST41_RICCO/13-98--------------------------------------------------------------------------------
Q8I381_PLAF7/105-193--------------------------------------------------------------------------------
D7TIM7_VITVI/12-97--------------------------------------------------------------------------------
A8QD00_MALGO/2-88--------------------------------------------------------------------------------
Q7QES0_ANOGA/12-96--------------------------------------------------------------------------------
B7G0L2_PHATC/3-94--------------------------------------------------------------------------------
F2TYI5_SALR5/3-87--------------------------------------------------------------------------------
A5DRW7_LODEL/3-93--------------------------------------------------------------------------------
Q4E5F9_TRYCC/3-88--------------------------------------------------------------------------------
A9VB86_MONBE/3-87--------------------------------------------------------------------------------
C4Y9W0_CLAL4/29-113--------------------------------------------------------------------------------
E4WR04_OIKDI/28-114--------------------------------------------------------------------------------
A7AQV3_BABBO/7-95--------------------------------------------------------------------------------
F0ZFR0_DICPU/29-119--------------------------------------------------------------------------------
A5K6D9_PLAVS/111-199--------------------------------------------------------------------------------
Q4D968_TRYCC/425-511--------------------------------------------------------------------------------
D6WA48_TRICA/11-96--------------------------------------------------------------------------------
A9PB57_POPTR/13-98--------------------------------------------------------------------------------
A4RTP2_OSTLU/25-110--------------------------------------------------------------------------------
TBCB_DICDI/31-122--------------------------------------------------------------------------------
E2LU49_MONPE/3-87--------------------------------------------------------------------------------
E5A082_LEPMJ/8-92--------------------------------------------------------------------------------
A8N8L9_COPC7/4-88--------------------------------------------------------------------------------
A0EFU1_PARTE/11-96--------------------------------------------------------------------------------
B4GBE4_DROPE/12-96--------------------------------------------------------------------------------
D8LXA1_BLAHO/32-117--------------------------------------------------------------------------------
E3L3Z6_PUCGT/7-93--------------------------------------------------------------------------------
D8Q214_SCHCM/4-88--------------------------------------------------------------------------------
E9CJT9_CAPO3/3-89--------------------------------------------------------------------------------
C5M440_CANTT/3-95--------------------------------------------------------------------------------
D8UA87_VOLCA/31-116--------------------------------------------------------------------------------
C4QWK8_PICPG/3-87--------------------------------------------------------------------------------
A7S7S7_NEMVE/9-93--------------------------------------------------------------------------------
E0VWL2_PEDHC/12-98--------------------------------------------------------------------------------
Q4XX52_PLACH/72-160--------------------------------------------------------------------------------
D8LGT0_ECTSI/27-111--------------------------------------------------------------------------------
C3XZL1_BRAFL/11-95--------------------------------------------------------------------------------
D0P2Q6_PHYIT/27-112--------------------------------------------------------------------------------
TBCB_BOVIN/10-94--------------------------------------------------------------------------------
B7Q3F7_IXOSC/11-98--------------------------------------------------------------------------------
C1FG26_MICSR/32-117--------------------------------------------------------------------------------
Q17J51_AEDAE/12-96--------------------------------------------------------------------------------
D2VPM1_NAEGR/1-88--------------------------------------------------------------------------------
Q6C047_YARLI/3-92--------------------------------------------------------------------------------
E9HZB4_DAPPU/11-95--------------------------------------------------------------------------------
Q6BPZ3_DEBHA/3-95--------------------------------------------------------------------------------
B4KMF4_DROMO/14-98--------------------------------------------------------------------------------
A8JDW7_CHLRE/32-117--------------------------------------------------------------------------------
Q5KME4_CRYNJ/3-89--------------------------------------------------------------------------------
B4MRR4_DROWI/10-94--------------------------------------------------------------------------------
E1ZH27_CHLVA/13-98--------------------------------------------------------------------------------
F2CRA1_HORVD/11-96--------------------------------------------------------------------------------
E2B379_HARSA/11-96--------------------------------------------------------------------------------
E1F2L3_GIAIA/2-86--------------------------------------------------------------------------------
E3QMX8_COLGM/3-86--------------------------------------------------------------------------------
B4J617_DROGR/14-98--------------------------------------------------------------------------------
Q7REC1_PLAYO/4-92--------------------------------------------------------------------------------
A4HXS1_LEIIN/3-87--------------------------------------------------------------------------------
A8DZJ0_DANRE/13-95--------------------------------------------------------------------------------
B4HPH4_DROSE/12-94--------------------------------------------------------------------------------
C4WTY8_ACYPI/11-91--------------------------------------------------------------------------------
C5YB52_SORBI/14-98--------------------------------------------------------------------------------
F7BMV7_XENTR/12-93--------------------------------------------------------------------------------
H3CQM7_TETNG/12-94--------------------------------------------------------------------------------
I1K6P5_SOYBN/14-98--------------------------------------------------------------------------------
Q0J8Q8_ORYSJ/16-100--------------------------------------------------------------------------------
Q388K4_TRYB2/3-87--------------------------------------------------------------------------------
TBCB_ARATH/14-98--------------------------------------------------------------------------------
U1LZQ6_ASCSU/5-83--------------------------------------------------------------------------------
W5JKD0_ANODA/13-95--------------------------------------------------------------------------------

PF10302

A1CI10_ASPCL/260-366--------------------------------------------------------------------------------
A2QJ66_ASPNC/25-140--------------------------------------------------------------------------------
A5DLW1_PICGU/37-143--------------------------------------------------------------------------------
A7F9T3_SCLS1/16-115--------------------------------------------------------------------------------
B0D8Q9_LACBS/33-127--------------------------------------------------------------------------------
B2W632_PYRTR/12-153--------------------------------------------------------------------------------
B5RUY7_DEBHA/3-107--------------------------------------------------------------------------------
B6HQJ4_PENCW/19-129--------------------------------------------------------------------------------
B6K0Y5_SCHJY/7-95--------------------------------------------------------------------------------
B6QQ66_PENMQ/20-135--------------------------------------------------------------------------------
B7G821_PHATC/41-148--------------------------------------------------------------------------------
B8LWP7_TALSN/20-117--------------------------------------------------------------------------------
C0NJZ5_AJECG/126-251--------------------------------------------------------------------------------
C1G3X7_PARBD/13-131--------------------------------------------------------------------------------
C4JRN4_UNCRE/16-123--------------------------------------------------------------------------------
C4Y478_CLAL4/3-108--------------------------------------------------------------------------------
C5DXP2_ZYGRC/20-121--------------------------------------------------------------------------------
C5GV26_AJEDR/8-136--------------------------------------------------------------------------------
C7YVY9_NECH7/2-98--------------------------------------------------------------------------------
C9SJU8_VERA1/13-122--------------------------------------------------------------------------------
Q0TY45_PHANO/12-134--------------------------------------------------------------------------------
Q2UJM9_ASPOR/22-133--------------------------------------------------------------------------------
Q4PB65_USTMA/356-575--------------------------------------------------------------------------------
Q6C2G8_YARLI/43-132--------------------------------------------------------------------------------
Q6FPG1_CANGA/22-119--------------------------------------------------------------------------------
DSC3_SCHPO/9-99--------------------------------------------------------------------------------
C8VL46_EMENI/21-140--------------------------------------------------------------------------------
D4B1D7_ARTBC/32-176--------------------------------------------------------------------------------
E9CW75_COCPS/17-124--------------------------------------------------------------------------------
G4UUP9_NEUT9/17-128--------------------------------------------------------------------------------
YO223_YEAST/25-125--------------------------------------------------------------------------------
Q5K714_CRYNJ/447-560--------------------------------------------------------------------------------

PF11543

Q380R2_ANOGA/8-82--------------------------------------------------------------------------------
NPL4_MOUSE/1-80--------------------------------------------------------------------------------
Q4N4S7_THEPA/1-79--------------------------------------------------------------------------------
NPL4_DROME/32-106--------------------------------------------------------------------------------
A7T2C7_NEMVE/1-79--------------------------------------------------------------------------------
Q5CYK6_CRYPI/2-68--------------------------------------------------------------------------------
Q177R9_AEDAE/3-82--------------------------------------------------------------------------------
Q7ZVI8_DANRE/1-79--------------------------------------------------------------------------------

PF08817

I0HJ43_ACTM4/5-81--------------------------------------------------------------------------------
F5Z3J8_MYCSD/22-104--------------------------------------------------------------------------------
Q0RSD8_FRAAA/14-92--------------------------------------------------------------------------------
H6MY52_GORPV/8-91--------------------------------------------------------------------------------
D5URC2_TSUPD/32-108--------------------------------------------------------------------------------
R6GEM6_9FIRM/5-81--------------------------------------------------------------------------------
D7WAS4_9CORY/25-99--------------------------------------------------------------------------------
O86654_STRCO/11-85--------------------------------------------------------------------------------
H6MTE2_GORPV/25-116--------------------------------------------------------------------------------
D5D9J9_BACMD/2-78--------------------------------------------------------------------------------
F5YXS0_MYCSD/9-91--------------------------------------------------------------------------------
D3Q4G3_STANL/7-88--------------------------------------------------------------------------------
A1SDG7_NOCSJ/11-85--------------------------------------------------------------------------------
H5X096_9PSEU/10-85--------------------------------------------------------------------------------
E8QWN3_ISOPI/13-89--------------------------------------------------------------------------------
V5XIZ3_MYCNE/17-91--------------------------------------------------------------------------------
ECCD1_MYCTU/22-107--------------------------------------------------------------------------------
R5QBR8_9FIRM/6-78--------------------------------------------------------------------------------
G2P2R8_STRVO/34-107--------------------------------------------------------------------------------
ECCD4_MYCTU/9-83--------------------------------------------------------------------------------
B1MG86_MYCA9/17-99--------------------------------------------------------------------------------
B2HCY5_MYCMM/9-83--------------------------------------------------------------------------------
F4H1C5_CELFA/12-86--------------------------------------------------------------------------------
D6Z7A5_SEGRD/18-100--------------------------------------------------------------------------------
F5YYY3_MYCSD/14-97--------------------------------------------------------------------------------
D5UUC8_TSUPD/16-93--------------------------------------------------------------------------------
Q9CBV2_MYCLE/21-103--------------------------------------------------------------------------------
Q73S36_MYCPA/8-80--------------------------------------------------------------------------------
Q82K76_STRAW/27-101--------------------------------------------------------------------------------
Q5Z1L9_NOCFA/16-100--------------------------------------------------------------------------------
R5IVV9_9FIRM/8-84--------------------------------------------------------------------------------
C4ZCP3_EUBR3/7-82--------------------------------------------------------------------------------
F8B202_FRADG/9-85--------------------------------------------------------------------------------
Q2G186_STAA8/17-92--------------------------------------------------------------------------------
J7KZZ2_NOCAA/9-88--------------------------------------------------------------------------------
G8RNC1_MYCRN/22-101--------------------------------------------------------------------------------
F7ZZ13_CELGA/13-87--------------------------------------------------------------------------------
E8MZT1_ANATU/21-96--------------------------------------------------------------------------------
D2AX28_STRRD/28-103--------------------------------------------------------------------------------
K8E361_CARML/6-82--------------------------------------------------------------------------------
E4NHX2_KITSK/9-83--------------------------------------------------------------------------------
K0K9X2_SACES/9-84--------------------------------------------------------------------------------
R4TCV7_AMYOR/10-84--------------------------------------------------------------------------------
E2Q4G7_STRC2/12-85--------------------------------------------------------------------------------
Q97N01_CLOAB/6-80--------------------------------------------------------------------------------
T0TU21_9STRE/4-77--------------------------------------------------------------------------------
W5WE05_9PSEU/6-80--------------------------------------------------------------------------------
K0F048_9NOCA/12-92--------------------------------------------------------------------------------
A4FKY4_SACEN/26-102--------------------------------------------------------------------------------
C7MTY5_SACVD/9-84--------------------------------------------------------------------------------
Q73TD2_MYCPA/9-98--------------------------------------------------------------------------------
H6R6K7_NOCCG/26-105--------------------------------------------------------------------------------
L0J766_MYCSM/9-92--------------------------------------------------------------------------------
J7LBA4_NOCAA/6-77--------------------------------------------------------------------------------
B5HEU1_STRPR/9-83--------------------------------------------------------------------------------
A3DD42_CLOTH/5-81--------------------------------------------------------------------------------
B1MAN6_MYCA9/9-84--------------------------------------------------------------------------------
Q8ERI8_OCEIH/6-83--------------------------------------------------------------------------------
G2NJB4_9ACTO/9-85--------------------------------------------------------------------------------
G8SAX6_ACTS5/5-81--------------------------------------------------------------------------------
C7PYM2_CATAD/12-86--------------------------------------------------------------------------------
K0EHZ7_9NOCA/23-106--------------------------------------------------------------------------------
V5X7J2_MYCNE/9-93--------------------------------------------------------------------------------
C7QFC9_CATAD/10-89--------------------------------------------------------------------------------
M1MJU7_9CLOT/7-82--------------------------------------------------------------------------------
Q8YAQ7_LISMO/6-82--------------------------------------------------------------------------------
A4X4V5_SALTO/22-96--------------------------------------------------------------------------------
F4F308_VERMA/10-84--------------------------------------------------------------------------------
R4TD90_AMYOR/6-82--------------------------------------------------------------------------------
F8JY92_STREN/5-79--------------------------------------------------------------------------------
C7PYH6_CATAD/12-88--------------------------------------------------------------------------------
I6Y5I3_PROPF/7-78--------------------------------------------------------------------------------
L0J9A2_MYCSM/24-103--------------------------------------------------------------------------------
W6RVF1_9CLOT/5-80--------------------------------------------------------------------------------
Q9KE83_BACHD/2-79--------------------------------------------------------------------------------
G8S820_ACTS5/9-85--------------------------------------------------------------------------------
D3Q707_STANL/9-85--------------------------------------------------------------------------------
E9T2Q7_COREQ/22-104--------------------------------------------------------------------------------
A0QNJ8_MYCS2/20-105--------------------------------------------------------------------------------
A0QQ46_MYCS2/9-96--------------------------------------------------------------------------------
B0RGC2_CLAMS/4-77--------------------------------------------------------------------------------
J9S0Q8_9ACTO/34-126--------------------------------------------------------------------------------
V9XB55_9NOCA/16-99--------------------------------------------------------------------------------
D2R3V0_PIRSD/12-88--------------------------------------------------------------------------------
Q8DZR3_STRA5/4-76--------------------------------------------------------------------------------
B1W5M3_STRGG/9-85--------------------------------------------------------------------------------
R5IT54_9FIRM/7-79--------------------------------------------------------------------------------
D7B9F2_NOCDD/4-78--------------------------------------------------------------------------------
D3Q6Z2_STANL/9-89--------------------------------------------------------------------------------
F8JQT1_STREN/18-91--------------------------------------------------------------------------------
YUKD_BACSU/2-78--------------------------------------------------------------------------------
D6ZDG4_SEGRD/32-109--------------------------------------------------------------------------------
B2HNX1_MYCMM/8-90--------------------------------------------------------------------------------
A1T268_MYCVP/16-102--------------------------------------------------------------------------------
B5I6U4_9ACTO/9-83--------------------------------------------------------------------------------
D1A4G8_THECD/9-85--------------------------------------------------------------------------------
A3CR36_STRSV/4-76--------------------------------------------------------------------------------
F2JHU8_CELLD/5-75--------------------------------------------------------------------------------
A8FGZ7_BACP2/2-78--------------------------------------------------------------------------------
I6T5S0_ENTHA/7-80--------------------------------------------------------------------------------
D9T0M7_MICAI/5-81--------------------------------------------------------------------------------
ECCD2_MYCTU/12-93--------------------------------------------------------------------------------
R7I8P8_9CLOT/4-81--------------------------------------------------------------------------------
G8RGR5_MYCRN/18-102--------------------------------------------------------------------------------
C5C0Q2_BEUC1/14-88--------------------------------------------------------------------------------
W5T8U5_9NOCA/16-99--------------------------------------------------------------------------------
A1T530_MYCVP/28-104--------------------------------------------------------------------------------
L0D9N4_SINAD/12-90--------------------------------------------------------------------------------
I0H0Q6_ACTM4/9-83--------------------------------------------------------------------------------
D2Q4J7_KRIFD/6-78--------------------------------------------------------------------------------
Q73ZU1_MYCPA/20-103--------------------------------------------------------------------------------
F4FHX1_VERMA/5-81--------------------------------------------------------------------------------
V6KDQ0_STRNV/30-104--------------------------------------------------------------------------------
D7B227_NOCDD/15-95--------------------------------------------------------------------------------
Y3711_CLOAB/4-76--------------------------------------------------------------------------------
D2PYM9_KRIFD/7-82--------------------------------------------------------------------------------
Q5WK77_BACSK/2-78--------------------------------------------------------------------------------
Q65FF5_BACLD/2-78--------------------------------------------------------------------------------
F2F0F0_SOLSS/2-78--------------------------------------------------------------------------------
C0ZW63_RHOE4/36-119--------------------------------------------------------------------------------
B5H2D6_STRC2/9-85--------------------------------------------------------------------------------
D9T7U5_MICAI/11-85--------------------------------------------------------------------------------
A0QSM9_MYCS2/6-82--------------------------------------------------------------------------------
F4CWA5_PSEUX/46-119--------------------------------------------------------------------------------
C8X8Y8_NAKMY/39-113--------------------------------------------------------------------------------
I6XP66_PROPF/4-75--------------------------------------------------------------------------------
A1T182_MYCVP/20-105--------------------------------------------------------------------------------
D0L7T9_GORB4/32-124--------------------------------------------------------------------------------

PF12754

A1C5H4_ASPCL/6-226--------------------------------------------------------------------------------
A1D0D7_NEOFI/6-229--------------------------------------------------------------------------------
A2R6X2_ASPNC/6-231--------------------------------------------------------------------------------
A6RC71_AJECN/6-229--------------------------------------------------------------------------------
B0Y1Y8_ASPFC/48-271--------------------------------------------------------------------------------
B2VVL2_PYRTR/6-230--------------------------------------------------------------------------------
B6HHQ6_PENCW/6-229--------------------------------------------------------------------------------
B6K4K2_SCHJY/19-545--------------------------------------------------------------------------------
B6QPQ8_PENMQ/6-236--------------------------------------------------------------------------------
B8LWV3_TALSN/6-236--------------------------------------------------------------------------------
B8N2W4_ASPFN/15-183--------------------------------------------------------------------------------
C0NLN4_AJECG/6-246--------------------------------------------------------------------------------
C0RX47_PARBP/6-92--------------------------------------------------------------------------------
C1G5D3_PARBD/6-245--------------------------------------------------------------------------------
C1HCI6_PARBA/6-244--------------------------------------------------------------------------------
C4JMG4_UNCRE/6-245--------------------------------------------------------------------------------
C5G7Z8_AJEDR/6-237--------------------------------------------------------------------------------
C5KBY1_PERM5/85-421--------------------------------------------------------------------------------
BLT1_SCHPO/6-663--------------------------------------------------------------------------------
Q0C940_ASPTN/6-226--------------------------------------------------------------------------------
Q0TVJ1_PHANO/6-226--------------------------------------------------------------------------------
Q2GP72_CHAGB/7-247--------------------------------------------------------------------------------
Q2UJ58_ASPOR/6-175--------------------------------------------------------------------------------
Q4WE50_ASPFU/48-271--------------------------------------------------------------------------------
Q5AUF8_EMENI/6-243--------------------------------------------------------------------------------
Q7RXG4_NEUCR/7-287--------------------------------------------------------------------------------

PF00789

FAF1_MOUSE/567-647--------------------------------------------------------------------------------
NSF1C_RAT/290-369--------------------------------------------------------------------------------
UBXN4_CAEEL/277-358--------------------------------------------------------------------------------
UBXN1_HUMAN/208-293--------------------------------------------------------------------------------
UCP10_SCHPO/323-425--------------------------------------------------------------------------------
UBX6_YEAST/185-266--------------------------------------------------------------------------------
UBX7_YEAST/211-292--------------------------------------------------------------------------------
UBXN8_HUMAN/186-265--------------------------------------------------------------------------------
UBX5_YEAST/414-494--------------------------------------------------------------------------------
UBX1_YEAST/343-422--------------------------------------------------------------------------------
UBX3_YEAST/355-452--------------------------------------------------------------------------------
Q9ZW74_ARATH/311-392--------------------------------------------------------------------------------
UBX2_SCHPO/348-426--------------------------------------------------------------------------------
UBXN4_HUMAN/314-395--------------------------------------------------------------------------------
UBX4_YEAST/272-351--------------------------------------------------------------------------------
UBXN7_HUMAN/407-487--------------------------------------------------------------------------------
Q8RWU7_ARATH/225-302--------------------------------------------------------------------------------
Q9C5G7_ARATH/444-523--------------------------------------------------------------------------------
Q9M0N1_ARATH/399-478--------------------------------------------------------------------------------

PF03671

UFM1_DICDI/3-77--------------------------------------------------------------------------------
D8M3B1_BLAHO/366-443--------------------------------------------------------------------------------
E1ZE22_CHLVA/5-79--------------------------------------------------------------------------------
B6AI44_CRYMR/11-85--------------------------------------------------------------------------------
Q23KE9_TETTS/6-80--------------------------------------------------------------------------------
D2UYB9_NAEGR/8-82--------------------------------------------------------------------------------
U6HZQ3_ECHMU/3-77--------------------------------------------------------------------------------
A0BV18_PARTE/4-78--------------------------------------------------------------------------------
A8B2C3_GIAIC/25-93--------------------------------------------------------------------------------
F0VMY8_NEOCL/7-81--------------------------------------------------------------------------------
F1Q2H2_CANFA/2-76--------------------------------------------------------------------------------
J9KB02_ACYPI/7-81--------------------------------------------------------------------------------
UFM1_THEPA/9-83--------------------------------------------------------------------------------
F0ZPA9_DICPU/3-77--------------------------------------------------------------------------------
Q57UL0_TRYB2/14-89--------------------------------------------------------------------------------

PF00564

NLP2_ARATH/862-945--------------------------------------------------------------------------------
Q9GRV1_CAEEL/137-218--------------------------------------------------------------------------------
Y5064_ARATH/413-498--------------------------------------------------------------------------------
NCF4_MOUSE/237-329--------------------------------------------------------------------------------
NLP6_ARATH/741-823--------------------------------------------------------------------------------
NBR1_HUMAN/4-85--------------------------------------------------------------------------------
NOXA1_HUMAN/315-395--------------------------------------------------------------------------------
M3K3_HUMAN/44-123--------------------------------------------------------------------------------
M3K2_HUMAN/43-122--------------------------------------------------------------------------------
NCF2_HUMAN/351-429--------------------------------------------------------------------------------
NCF2_MOUSE/350-428--------------------------------------------------------------------------------
KPCZ_HUMAN/15-98--------------------------------------------------------------------------------
KPC3_CAEEL/12-95--------------------------------------------------------------------------------
SCD1_SCHPO/774-871--------------------------------------------------------------------------------
Y5349_ARATH/404-489--------------------------------------------------------------------------------
Y3295_ARATH/416-502--------------------------------------------------------------------------------
Y2650_ARATH/408-489--------------------------------------------------------------------------------
MUG70_SCHPO/574-653--------------------------------------------------------------------------------
NLP8_ARATH/847-929--------------------------------------------------------------------------------
NLP7_ARATH/863-945--------------------------------------------------------------------------------
NLP3_ARATH/673-759--------------------------------------------------------------------------------
NLP4_ARATH/744-827--------------------------------------------------------------------------------
Q9SB64_ARATH/7-92--------------------------------------------------------------------------------
SQSTM_MOUSE/20-102--------------------------------------------------------------------------------
O49385_ARATH/317-396--------------------------------------------------------------------------------
Q9FML0_ARATH/29-112--------------------------------------------------------------------------------
Q9STK4_ARATH/28-111--------------------------------------------------------------------------------
Q9S843_ARATH/22-106--------------------------------------------------------------------------------
Q9STG4_ARATH/89-178--------------------------------------------------------------------------------
Q9LRY7_ARATH/190-277--------------------------------------------------------------------------------
O64768_ARATH/191-277--------------------------------------------------------------------------------
Q9SA26_ARATH/179-266--------------------------------------------------------------------------------
Q9FGF3_ARATH/59-153--------------------------------------------------------------------------------
Q9ZU48_ARATH/89-181--------------------------------------------------------------------------------
Q9FRH9_ARATH/25-110--------------------------------------------------------------------------------
Q9LF06_ARATH/45-138--------------------------------------------------------------------------------
PAR6B_HUMAN/16-96--------------------------------------------------------------------------------
PAR6G_HUMAN/18-98--------------------------------------------------------------------------------
PAR6A_HUMAN/15-95--------------------------------------------------------------------------------
O97111_DROME/19-101--------------------------------------------------------------------------------
PAR6_CAEEL/14-96--------------------------------------------------------------------------------
MP2K5_MOUSE/18-97--------------------------------------------------------------------------------
MKKA_DICDI/15-101--------------------------------------------------------------------------------
REF2P_DROME/3-88--------------------------------------------------------------------------------
F4I5S1_ARATH/138-222--------------------------------------------------------------------------------
O48802_ARATH/290-381--------------------------------------------------------------------------------
Q6ID88_ARATH/26-111--------------------------------------------------------------------------------

PF06234

F8JFV6_HYPSM/4-85--------------------------------------------------------------------------------
B9L556_THERP/3-80--------------------------------------------------------------------------------
F4CK64_PSEUX/3-78--------------------------------------------------------------------------------
F4CQQ2_PSEUX/18-95--------------------------------------------------------------------------------
D5WR27_KYRT2/3-80--------------------------------------------------------------------------------
V5UCV8_9BURK/3-83--------------------------------------------------------------------------------
X4ZNE4_9BORD/10-87--------------------------------------------------------------------------------
Q9ZET6_XANP2/3-86--------------------------------------------------------------------------------
A2SDY8_METPP/3-83--------------------------------------------------------------------------------
F8I8D8_SULAT/1-78--------------------------------------------------------------------------------
F4CTZ5_PSEUX/3-86--------------------------------------------------------------------------------
Q2JGJ1_FRASC/3-80--------------------------------------------------------------------------------
H6MYN1_GORPV/6-83--------------------------------------------------------------------------------
F4CQX7_PSEUX/13-90--------------------------------------------------------------------------------
B2UJG7_RALPJ/3-83--------------------------------------------------------------------------------

PF14836

F1RZR1_PIG/260-347--------------------------------------------------------------------------------
UBP15_HUMAN/135-222--------------------------------------------------------------------------------
GGNB1_MOUSE/281-368--------------------------------------------------------------------------------
GGNB1_HUMAN/7-108--------------------------------------------------------------------------------
B7QDB1_IXOSC/149-236--------------------------------------------------------------------------------

PF08783

E7KEX9_YEASA/5-78--------------------------------------------------------------------------------
K4CKX8_SOLLC/3-77--------------------------------------------------------------------------------
C4LSG0_ENTHI/7-79--------------------------------------------------------------------------------
I1GHG5_AMPQE/4-77--------------------------------------------------------------------------------
E9QG41_DANRE/4-74--------------------------------------------------------------------------------
F7BCW9_MONDO/4-76--------------------------------------------------------------------------------
E5SG79_TRISP/114-186--------------------------------------------------------------------------------
T1J1G3_STRMM/3-76--------------------------------------------------------------------------------
F4PH93_DICFS/3-76--------------------------------------------------------------------------------
E9C1T8_CAPO3/4-75--------------------------------------------------------------------------------
A8Q3B4_MALGO/6-79--------------------------------------------------------------------------------
H2YGK3_CIOSA/4-76--------------------------------------------------------------------------------
C4QXH8_PICPG/5-78--------------------------------------------------------------------------------
C5YSI3_SORBI/4-82--------------------------------------------------------------------------------
M4EBT9_BRARP/82-155--------------------------------------------------------------------------------
D2UYX3_NAEGR/3-76--------------------------------------------------------------------------------
M7PBG1_PNEMU/5-78--------------------------------------------------------------------------------
Q5CJD9_CRYHO/3-79--------------------------------------------------------------------------------
B8C0N4_THAPS/5-81--------------------------------------------------------------------------------
I3EI73_NEMP3/3-75--------------------------------------------------------------------------------
U6HYA8_ECHMU/5-76--------------------------------------------------------------------------------
Q6CHE1_YARLI/4-78--------------------------------------------------------------------------------
C1E7Z5_MICSR/5-78--------------------------------------------------------------------------------
B0WN42_CULQU/3-76--------------------------------------------------------------------------------
Q5KID1_CRYNJ/4-77--------------------------------------------------------------------------------
A9UQZ7_MONBE/5-76--------------------------------------------------------------------------------
Q0IXI6_ORYSJ/3-76--------------------------------------------------------------------------------
F0YFC7_AURAN/5-79--------------------------------------------------------------------------------
F7HV68_CALJA/4-76--------------------------------------------------------------------------------
U4KWY3_PYROM/5-78--------------------------------------------------------------------------------
U9T1U9_RHIID/4-76--------------------------------------------------------------------------------
B3RPV3_TRIAD/4-77--------------------------------------------------------------------------------
G1XH20_ARTOA/5-78--------------------------------------------------------------------------------
L7JVZ0_TRAHO/5-75--------------------------------------------------------------------------------
H6C972_EXODN/5-78--------------------------------------------------------------------------------
Q850T7_ORYSJ/4-82--------------------------------------------------------------------------------
B2WNT2_PYRTR/5-79--------------------------------------------------------------------------------
F8Q3V1_SERL3/5-78--------------------------------------------------------------------------------
G4VSS0_SCHMA/5-76--------------------------------------------------------------------------------
G7E4R9_MIXOS/5-79--------------------------------------------------------------------------------
B7G0Q1_PHATC/5-80--------------------------------------------------------------------------------
K3X144_PYTUL/3-76--------------------------------------------------------------------------------
D8R0H2_SELML/3-77--------------------------------------------------------------------------------
J7S441_KAZNA/5-78--------------------------------------------------------------------------------
E5AF53_LEPMJ/5-79--------------------------------------------------------------------------------
G8YIX2_PICSO/5-79--------------------------------------------------------------------------------
A7SLE2_NEMVE/4-77--------------------------------------------------------------------------------
H2LXG6_ORYLA/4-76--------------------------------------------------------------------------------
B6K0V3_SCHJY/5-79--------------------------------------------------------------------------------
A9TBI2_PHYPA/4-83--------------------------------------------------------------------------------
Q0UY72_PHANO/5-79--------------------------------------------------------------------------------
E9FQX1_DAPPU/3-76--------------------------------------------------------------------------------
A4S5D9_OSTLU/6-79--------------------------------------------------------------------------------
D8Q1G9_SCHCM/3-76--------------------------------------------------------------------------------
H3D7C7_TETNG/4-75--------------------------------------------------------------------------------
T1KXB2_TETUR/3-75--------------------------------------------------------------------------------
C5M2B2_CANTT/5-79--------------------------------------------------------------------------------
T1EDG0_HELRO/5-78--------------------------------------------------------------------------------
F2TXI3_SALR5/5-73--------------------------------------------------------------------------------
M0ZMT3_SOLTU/3-76--------------------------------------------------------------------------------
K7IXU3_NASVI/3-76--------------------------------------------------------------------------------
C5E4J3_ZYGRC/5-78--------------------------------------------------------------------------------
E0VYL4_PEDHC/3-76--------------------------------------------------------------------------------
R1G7K1_BOTPV/5-78--------------------------------------------------------------------------------
K1QWD9_CRAGI/4-76--------------------------------------------------------------------------------
S2JLG5_MUCC1/4-79--------------------------------------------------------------------------------
M3D3U9_SPHMS/5-78--------------------------------------------------------------------------------
R4XH77_TAPDE/5-80--------------------------------------------------------------------------------
M9LV78_PSEA3/6-79--------------------------------------------------------------------------------
Q54XF1_DICDI/3-75--------------------------------------------------------------------------------
W1NEA7_AMBTC/3-74--------------------------------------------------------------------------------
Q38G51_CAEEL/4-75--------------------------------------------------------------------------------
K1WLJ4_MARBU/5-86--------------------------------------------------------------------------------
E4X3M1_OIKDI/4-76--------------------------------------------------------------------------------
W1QI44_OGAPD/4-79--------------------------------------------------------------------------------
K4BEZ9_SOLLC/3-76--------------------------------------------------------------------------------
N1JLT6_BLUG1/4-77--------------------------------------------------------------------------------
W1PT53_AMBTC/4-76--------------------------------------------------------------------------------
A8N917_COPC7/5-77--------------------------------------------------------------------------------
L8WJF0_THACA/5-79--------------------------------------------------------------------------------
A8IY15_CHLRE/6-77--------------------------------------------------------------------------------
R0M4Y6_NOSB1/5-77--------------------------------------------------------------------------------
F9XDD8_MYCGM/5-78--------------------------------------------------------------------------------
G4TBQ9_PIRID/5-77--------------------------------------------------------------------------------
I4YBQ9_WALSC/4-80--------------------------------------------------------------------------------
G4UH68_NEUT9/5-79--------------------------------------------------------------------------------
A7AQ80_BABBO/8-88--------------------------------------------------------------------------------
Q4N712_THEPA/7-87--------------------------------------------------------------------------------
B8LT93_TALSN/5-78--------------------------------------------------------------------------------
V2XS00_MONRO/5-78--------------------------------------------------------------------------------
J3LNI7_ORYBR/3-80--------------------------------------------------------------------------------
G1PYZ7_MYOLU/4-76--------------------------------------------------------------------------------
W5EE84_WHEAT/5-82--------------------------------------------------------------------------------
A9T0S6_PHYPA/3-76--------------------------------------------------------------------------------
Q6CTG7_KLULA/5-78--------------------------------------------------------------------------------
C3Z7Q5_BRAFL/4-77--------------------------------------------------------------------------------
F4RI56_MELLP/5-78--------------------------------------------------------------------------------
D8QPP8_SELML/3-78--------------------------------------------------------------------------------
M7XTT3_RHOT1/6-79--------------------------------------------------------------------------------
C5K6D3_PERM5/17-98--------------------------------------------------------------------------------
J0M465_LOALO/4-75--------------------------------------------------------------------------------
D8RGV2_SELML/3-76--------------------------------------------------------------------------------
E1Z6U7_CHLVA/5-78--------------------------------------------------------------------------------
K5VUJ1_PHACS/5-77--------------------------------------------------------------------------------
F4PCR3_BATDJ/4-77--------------------------------------------------------------------------------
B4J6F7_DROGR/3-76--------------------------------------------------------------------------------
A2G2N0_TRIVA/6-78--------------------------------------------------------------------------------
J9D2S5_EDHAE/5-75--------------------------------------------------------------------------------
Q75DF6_ASHGO/5-78--------------------------------------------------------------------------------
C5WQF5_SORBI/4-82--------------------------------------------------------------------------------
Q8STW4_ENCCU/5-77--------------------------------------------------------------------------------
D3B3S4_POLPA/3-76--------------------------------------------------------------------------------
B7XHA5_ENTBH/5-77--------------------------------------------------------------------------------
M2ZQF3_MYCFI/5-78--------------------------------------------------------------------------------
Q00Y87_OSTTA/59-132--------------------------------------------------------------------------------
U6IMX0_HYMMI/5-76--------------------------------------------------------------------------------
B6AIS0_CRYMR/3-79--------------------------------------------------------------------------------
K3XQZ3_SETIT/4-81--------------------------------------------------------------------------------
S7W6T4_SPRLO/5-77--------------------------------------------------------------------------------
R7Z176_CONA1/5-78--------------------------------------------------------------------------------
K5XEH7_AGABU/5-78--------------------------------------------------------------------------------
T1HT26_RHOPR/3-76--------------------------------------------------------------------------------
B9SM30_RICCO/3-86--------------------------------------------------------------------------------
M2NB19_BAUCO/5-78--------------------------------------------------------------------------------
I1K0S2_SOYBN/3-76--------------------------------------------------------------------------------
G3BCI1_CANTC/5-79--------------------------------------------------------------------------------
D7STW2_VITVI/4-77--------------------------------------------------------------------------------
T1IH94_STRMM/3-76--------------------------------------------------------------------------------
K4AJG4_SETIT/3-81--------------------------------------------------------------------------------
W4XS20_STRPU/36-108--------------------------------------------------------------------------------
K0KM75_WICCF/29-102--------------------------------------------------------------------------------
L2GLT9_VITCO/5-77--------------------------------------------------------------------------------

PF14454

E4RTC9_LEAB4/4-70--------------------------------------------------------------------------------
Q8A4F3_BACTN/4-71--------------------------------------------------------------------------------
D4Z238_SPHJU/2-66--------------------------------------------------------------------------------
Q7WX32_CUPNH/4-67--------------------------------------------------------------------------------
I0KAY7_9BACT/5-70--------------------------------------------------------------------------------
A0R7U5_PELPD/2-65--------------------------------------------------------------------------------
Q21Q50_ALBFT/6-68--------------------------------------------------------------------------------
F0R4F6_BACSH/4-70--------------------------------------------------------------------------------
Q120W5_POLSJ/5-66--------------------------------------------------------------------------------
F0R4S2_BACSH/4-70--------------------------------------------------------------------------------
W0EQT1_9PORP/4-71--------------------------------------------------------------------------------
F9ZRY7_ACICS/4-65--------------------------------------------------------------------------------
B2UDC3_RALPJ/4-67--------------------------------------------------------------------------------
R6RVN1_9BACE/4-71--------------------------------------------------------------------------------
I4A2G6_ORNRL/4-70--------------------------------------------------------------------------------
D9SEQ0_GALCS/4-67--------------------------------------------------------------------------------
A5FFL1_FLAJ1/4-70--------------------------------------------------------------------------------
A1VV98_POLNA/5-67--------------------------------------------------------------------------------
Q47D08_DECAR/4-66--------------------------------------------------------------------------------
H8H183_DEIGI/21-82--------------------------------------------------------------------------------
H1Y620_9SPHI/3-70--------------------------------------------------------------------------------
Q11ZC9_POLSJ/9-72--------------------------------------------------------------------------------
A1W6B1_ACISJ/4-66--------------------------------------------------------------------------------
Q8XYU5_RALSO/2-65--------------------------------------------------------------------------------
C7PQS5_CHIPD/4-72--------------------------------------------------------------------------------
A6KYA4_BACV8/4-71--------------------------------------------------------------------------------
F0RQC2_DEIPM/2-65--------------------------------------------------------------------------------
A6L0J4_BACV8/4-70--------------------------------------------------------------------------------
H8H2R3_DEIGI/8-71--------------------------------------------------------------------------------

PF14847

M7PB55_PNEMU/186-282-----------------------------------------------------------------CLKFI-GE-------
W1QDG0_OGAPD/127-224-----------------------------------------------------------------CVTII-GP-------
D5GAF3_TUBMM/216-317-----------------------------------------------------------------AIKVI-GD-------
R7Z1R1_CONA1/301-403-----------------------------------------------------------------LIRVI-FP-------
E4UTJ7_ARTGP/289-390-----------------------------------------------------------------VIRVI-HT-------
G8BDY4_CANPC/178-286-----------------------------------------------------------------TITFI-LQ-------
G3ALG9_SPAPN/136-236-----------------------------------------------------------------NIMFI-LQ-------
I2GWW6_TETBL/102-209-----------------------------------------------------------------SVIFI-LN-------
C4Y2B8_CLAL4/115-213-----------------------------------------------------------------VVTFI-LP-------
G0VKN8_NAUCC/126-229-----------------------------------------------------------------.VIFI-LN-------
S2JNI8_MUCC1/248-344-----------------------------------------------------------------CVKVF-GE-------
F2Z643_YARLI/352-450-----------------------------------------------------------------TVKFI-YT-------
L8GC22_PSED2/285-387-----------------------------------------------------------------MIRVI-AK-------
Q6BX89_DEBHA/150-251-----------------------------------------------------------------NVTFI-LQ-------
H6BXQ7_EXODN/280-382-----------------------------------------------------------------VIKII-HN-------
H2ANV4_KAZAF/134-238-----------------------------------------------------------------HVIFI-LN-------
A5DK85_PICGU/161-259-----------------------------------------------------------------TVSFI-LS-------
E6ZNN4_SPORE/435-552-----------------------------------------------------------------.IKFI-SE-------
D8PT48_SCHCM/422-535-----------------------------------------------------------------.....-.P-------
H0EHG6_GLAL7/228-330-----------------------------------------------------------------VVRVI-SS-------
U1HLA1_ENDPU/281-383-----------------------------------------------------------------VVRII-HA-------
Q6FXI1_CANGA/99-207-----------------------------------------------------------------CVIFI-LN-------
G0WH13_NAUDC/132-239-----------------------------------------------------------------HVIFI-LN-------
U4LSK1_PYROM/267-369-----------------------------------------------------------------CIRVI-GE-------
B6Q1Q5_PENMQ/258-360-----------------------------------------------------------------VIRII-YT-------
M7WSY6_RHOT1/447-544-----------------------------------------------------------------.VKFT-SA-------
A5DV77_LODEL/166-274-----------------------------------------------------------------NITFI-LQ-------
Q0UKQ0_PHANO/223-325-----------------------------------------------------------------LVRVI-FD-------
E7QIG4_YEASZ/130-238-----------------------------------------------------------------CVIFI-LN-------
K5W752_AGABU/448-565-----------------------------------------------------------------.IKFV-LP-------
J4HWJ7_FIBRA/104-215-----------------------------------------------------------------.VKFT-LP-------
G8BQH6_TETPH/102-210-----------------------------------------------------------------SSIFI-LN-------
R1GKA3_BOTPV/69-171-----------------------------------------------------------------LIRVI-FD-------
G1XUM9_ARTOA/274-374-----------------------------------------------------------------YVKFI-GS-------
G3B1K7_CANTC/122-220-----------------------------------------------------------------NITFI-LA-------
J7S422_KAZNA/144-264-----------------------------------------------------------------HVIFV-LN-------
Q6CVC4_KLULA/111-220-----------------------------------------------------------------SVIFI-LN-------
N1QC72_MYCFI/275-377-----------------------------------------------------------------LIRVI-FE-------
G2QC44_THIHA/265-367-----------------------------------------------------------------VIRVI-ST-------
M2LQE5_BAUCO/287-389-----------------------------------------------------------------LIRVV-YE-------
C4R4N2_PICPG/137-232-----------------------------------------------------------------.ATFI-NL-------
J3K7Q4_COCIM/253-355-----------------------------------------------------------------VIRVI-YT-------
K0KA50_WICCF/115-210-----------------------------------------------------------------LVSFI-LQ-------
M3K819_CANMX/171-279-----------------------------------------------------------------NITFI-LQ-------
N1JCR8_BLUG1/286-388-----------------------------------------------------------------IIRVI-SS-------
A3LRR0_PICST/165-286-----------------------------------------------------------------TATFI-FQ-------
Q5KHP6_CRYNJ/473-586-----------------------------------------------------------------.VKFI-NT-------
Q4WTX3_ASPFU/277-379-----------------------------------------------------------------VIRVI-YT-------
G8YTP8_PICSO/145-244-----------------------------------------------------------------NITFI-LQ-------
M7TTL7_BOTF1/295-397-----------------------------------------------------------------VIRVI-SS-------

PF00788

PLCE1_MOUSE/2115-2218--------------------------------------------------------------ESFFVQVH-DV-------
GNDS_MOUSE/736-823--------------------------------------------------------------DCCIIRVS-LD-------
Q19852_CAEEL/752-845--------------------------------------------------------------SFYLARVG-LD-------
ARAP3_MOUSE/1113-1206--------------------------------------------------------------GDLIMEVY-IE-------
RPGF6_HUMAN/749-835--------------------------------------------------------------PDQVIRVF-KV-------
MYO9A_HUMAN/14-112--------------------------------------------------------------NEHTLRIY-PG-------
DGKQ_HUMAN/395-494--------------------------------------------------------------AQEVLKIY-PG-------
SNX27_RAT/271-360--------------------------------------------------------------SDVELRVA-LP-------
ARAP1_HUMAN/1172-1261--------------------------------------------------------------GDFICTVY-LE-------
RHG20_MOUSE/194-283--------------------------------------------------------------KSIPLKIF-AK-------
RIN2_HUMAN/787-878--------------------------------------------------------------FQNYLRVA-FQ-------
Q22744_CAEEL/396-496--------------------------------------------------------------KTTSLRTI-TS-------
Q8IPP4_DROME/256-348--------------------------------------------------------------TGGTLKIY-GE-------
GRB7_MOUSE/99-185--------------------------------------------------------------RLCVVKVY-SE-------
AB1IP_MOUSE/179-266--------------------------------------------------------------KKLVVKVH-MD-------
Q9VCQ7_DROME/659-748--------------------------------------------------------------YNRETSFF-TP-------
RASF3_MOUSE/78-181--------------------------------------------------------------YTGFIKVQ-ME-------
RADIL_MOUSE/90-193--------------------------------------------------------------APGVLKVF-GD-------
STE4_SCHPO/176-264--------------------------------------------------------------GSFDLEVN-DS-------
RASF1_HUMAN/202-292--------------------------------------------------------------VRRRTSFY-LP-------
RGL2_HUMAN/648-735--------------------------------------------------------------DCRIIRVQ-ME-------
AFAD_RAT/246-348--------------------------------------------------------------SGGTLRIY-AD-------
Q17860_CAEEL/355-454--------------------------------------------------------------DKDEVKVY-GG-------
Q9VCF2_DROME/831-922--------------------------------------------------------------DIEMIKVF-DG-------
GRB14_RAT/104-190--------------------------------------------------------------KKQVIKVY-SE-------
Q9VML8_DROME/60-155--------------------------------------------------------------PQTTIKVY-TN-------
AFAD_RAT/39-133--------------------------------------------------------------FHGVMRFY-FQ-------
MYO9B_RAT/15-114--------------------------------------------------------------ATFHLHIY-PQ-------
Q8IQW0_DROME/238-324--------------------------------------------------------------RRLFVKAF-TS-------
Q9VCF2_DROME/923-1024--------------------------------------------------------------DRGHVRVY-PG-------
Q9BIC1_CAEEL/215-319--------------------------------------------------------------FGGSLKVY-GG-------
RASF2_MOUSE/176-264--------------------------------------------------------------YNHKTSVF-TP-------
P91575_CAEEL/70-167--------------------------------------------------------------DVGVLKVD-TR-------
Q9W486_DROME/277-365--------------------------------------------------------------SPVDIKVM-LP-------
STE50_YEAST/235-327--------------------------------------------------------------HPSAVSTA-NT-------
Q17860_CAEEL/264-353--------------------------------------------------------------DFEIIRVF-DG-------
RASF7_HUMAN/6-89--------------------------------------------------------------AAMELKVW-VD-------
G4UMY9_NEUT9/261-348--------------------------------------------------------------.QDVIRVI-ST-------
M7PB55_PNEMU/184-268--------------------------------------------------------------.KNCLKFI-GE-------
Q2M017_DROPS/881-970--------------------------------------------------------------.FYIIRVT-YE-------

PF00794

AGE1_CAEEL/241-361-------------------------------------------------VGESCPKDLESKVKAAKLSYQ-MF-------
PI3K3_DICDI/724-826-------------------------------------------------AARLTPYPPP.KTIPEFFVIR-VH-------
PI3K1_DICDI/688-792-------------------------------------------------LVRLSPLPIP..IVGNKILIS-IF-------
PI3K2_DICDI/808-917-------------------------------------------------MIYVSSEPLP.LTIPNKITIM-VL-------
P3C2A_HUMAN/409-512-------------------------------------------------SPVTAQRNIC..GENASVKVS-ID-------
PK3CD_HUMAN/175-281-------------------------------------------------AQTWGPGTLR..LPNRALLVN-VK-------
P3C2B_HUMAN/364-466-------------------------------------------------AVTPSPEHLG...DEVNLKVT-VL-------
P91634_DROME/200-307-------------------------------------------------NSTKMPELIRERHPTRTFLIV-VK-------
PK3CG_PIG/203-312-------------------------------------------------TSKPLPEYLLKKITNNCVFIV-IH-------
PK3CB_HUMAN/180-288-------------------------------------------------HEPSIPENLEDKLYGGKLIVA-VH-------
B4HEY7_DROSE/434-538-------------------------------------------------.IKVIVHPALNTLQSNVLAAS-MG-------
U3IZV1_ANAPL/174-291-------------------------------------------------.SPELPKHIYNKLDKGQIIVV-IW-------

PF11470

G8C071_TETPH/6-74----------------------------------------------------------------VD-----YK-------
E7QJ70_YEASZ/4-69----------------------------------------------------------------VK-----YN-------
A2ABZ8_MOUSE/4-63----------------------------------------------------------------LH-----KD-------
Q759X3_ASHGO/6-71----------------------------------------------------------------VE-----YG-------
M2YL46_MYCP1/8-72----------------------------------------------------------------VD-----SG-------
B6HV28_PENCW/8-71----------------------------------------------------------------ID-----AT-------
H0VS36_CAVPO/16-79----------------------------------------------------------------LA-----PN-------
K7JBH2_NASVI/10-73----------------------------------------------------------------LT-----PN-------
S9W532_SCHCR/6-69----------------------------------------------------------------AC-----KG-------
C5DDI6_LACTC/6-71----------------------------------------------------------------VV-----YK-------
UBX4_SCHPO/6-69----------------------------------------------------------------AC-----RG-------
Q59YG7_CANAL/76-140----------------------------------------------------------------.N-----QP-------
W4W295_ATTCE/10-73----------------------------------------------------------------LA-----PN-------
U1GGT5_ENDPU/8-71----------------------------------------------------------------ID-----ST-------
N4VAY1_COLOR/8-71----------------------------------------------------------------IG-----TD-------
B2ABE5_PODAN/9-72----------------------------------------------------------------IS-----TD-------
S6DZG7_ZYGB2/6-72----------------------------------------------------------------IC-----YN-------
Q2HDX9_CHAGB/8-71----------------------------------------------------------------VS-----TD-------
M3AUN0_SPHMS/8-73----------------------------------------------------------------VD-----ST-------
Q7SEP0_NEUCR/8-71----------------------------------------------------------------LS-----TD-------
R7YXW3_CONA1/8-71----------------------------------------------------------------VD-----ST-------
C5GFX1_AJEDR/8-71----------------------------------------------------------------ID-----SA-------
E9C497_CAPO3/8-71----------------------------------------------------------------LL-----PN-------
G8JRX7_ERECY/6-71----------------------------------------------------------------VQ-----YG-------
B0WHV7_CULQU/11-74----------------------------------------------------------------LT-----IN-------
F2SGW6_TRIRC/8-71----------------------------------------------------------------LN-----SS-------
J8PYG8_SACAR/6-71----------------------------------------------------------------VK-----HN-------
H2XR59_CIOIN/5-68----------------------------------------------------------------LC-----LS-------
G3B806_CANTC/10-69----------------------------------------------------------------..-----HE-------
I2H0J6_TETBL/5-71----------------------------------------------------------------IQ-----YD-------
E5S2D9_TRISP/6-68----------------------------------------------------------------VY-----PT-------
K1PBF8_CRAGI/7-71----------------------------------------------------------------LC-----PN-------
D5GPN6_TUBMM/8-71----------------------------------------------------------------VI-----YG-------
Q0UWT0_PHANO/7-70----------------------------------------------------------------FN-----SH-------
H3G2K2_PRIPA/9-72----------------------------------------------------------------LC-----PN-------
G6D1N1_DANPL/8-71----------------------------------------------------------------LT-----PN-------
H6BLI9_EXODN/8-71----------------------------------------------------------------ID-----ST-------
A9UPU1_MONBE/9-71----------------------------------------------------------------.G-----DN-------
B6JVS4_SCHJY/21-83----------------------------------------------------------------LC-----SG-------
G3AMH5_SPAPN/8-73----------------------------------------------------------------IT-----YG-------
B0DC11_LACBS/297-358----------------------------------------------------------------..-----.D-------
T1H152_MEGSC/10-73----------------------------------------------------------------LT-----VN-------
C5E3X2_ZYGRC/6-73----------------------------------------------------------------VS-----YN-------
M4FRN0_MAGP6/8-71----------------------------------------------------------------IS-----TD-------
U4LXJ5_PYROM/8-70----------------------------------------------------------------..-----FN-------
K1WUK5_MARBU/8-71----------------------------------------------------------------ID-----SS-------
L0PAT2_PNEJ8/7-71----------------------------------------------------------------IL-----SN-------
R8BC58_TOGMI/8-71----------------------------------------------------------------IA-----TD-------
E9DSD2_METAQ/8-71----------------------------------------------------------------IA-----TD-------
D7FT66_ECTSI/8-73----------------------------------------------------------------IL-----HG-------
F0YAZ5_AURAN/5-73----------------------------------------------------------------IL-----HA-------
C4R030_PICPG/5-68----------------------------------------------------------------VT-----YQ-------
H2AM67_KAZAF/6-70----------------------------------------------------------------VK-----YK-------
W1QGK9_OGAPD/6-69----------------------------------------------------------------VS-----YN-------
M3A5M0_MYCFI/7-71----------------------------------------------------------------VD-----SS-------
G7X6P9_ASPKW/8-71----------------------------------------------------------------LD-----ST-------
D3BSC7_POLPA/6-69----------------------------------------------------------------IL-----YK-------
X1WYJ5_ACYPI/10-71----------------------------------------------------------------..-----EN-------
M7SCZ0_EUTLA/8-71----------------------------------------------------------------VD-----SN-------
K2RQG8_MACPH/8-71----------------------------------------------------------------VD-----TS-------
A7RUJ0_NEMVE/10-73----------------------------------------------------------------VC-----PN-------
U9SZH2_RHIID/10-72----------------------------------------------------------------..-----NG-------
E4ZFZ7_LEPMJ/8-70----------------------------------------------------------------.N-----SY-------
Q6BW80_DEBHA/8-71----------------------------------------------------------------IS-----FS-------
N1JEA9_BLUG1/8-71----------------------------------------------------------------LH-----TS-------
D6WEX9_TRICA/9-72----------------------------------------------------------------LA-----PN-------
A5DEW0_PICGU/22-86----------------------------------------------------------------VV-----YG-------
V5G6B0_BYSSN/8-71----------------------------------------------------------------ID-----ST-------
C4YB10_CLAL4/7-70----------------------------------------------------------------VS-----YQ-------
J5J9U8_BEAB2/8-71----------------------------------------------------------------IA-----SD-------
M2M3Z6_BAUCO/9-73----------------------------------------------------------------VD-----ST-------
H2M9W5_ORYLA/11-74----------------------------------------------------------------LT-----PN-------
A3LU13_PICST/8-73----------------------------------------------------------------VS-----YN-------
G0RDR3_HYPJQ/8-71----------------------------------------------------------------IA-----TD-------
C8V8J0_EMENI/8-71----------------------------------------------------------------LD-----ST-------
F0ZDH6_DICPU/7-69----------------------------------------------------------------II-----YK-------
H3GCB5_PHYRM/5-69----------------------------------------------------------------VE-----FN-------
F4PAU1_BATDJ/15-74----------------------------------------------------------------..-----..-------
F7EJY1_XENTR/15-78----------------------------------------------------------------LA-----PN-------
G2XN35_BOTF4/8-72----------------------------------------------------------------ID-----KS-------
Q6FU38_CANGA/6-69----------------------------------------------------------------VH-----HN-------
D8TTA0_VOLCA/15-77----------------------------------------------------------------..-----..-------
M3IS18_CANMX/7-72----------------------------------------------------------------IT-----YQ-------
S3CS22_OPHP1/8-71----------------------------------------------------------------IA-----TD-------
S8C614_DACHA/9-69----------------------------------------------------------------..-----PN-------
Q16M15_AEDAE/9-72----------------------------------------------------------------LT-----VH-------
M4BXT6_HYAAE/5-69----------------------------------------------------------------VT-----YQ-------
S3DE83_GLAL2/9-71----------------------------------------------------------------.D-----TA-------
G8YPU0_PICSO/8-69----------------------------------------------------------------IS-----FN-------
G4MS61_MAGO7/8-71----------------------------------------------------------------IS-----TD-------
G8ZQG7_TORDC/6-76----------------------------------------------------------------IN-----YN-------
G0SBN2_CHATD/8-71----------------------------------------------------------------VS-----SD-------
G8BAN3_CANPC/8-75----------------------------------------------------------------VT-----YQ-------
Q54X06_DICDI/6-68----------------------------------------------------------------II-----YK-------
H3D967_TETNG/11-74----------------------------------------------------------------LA-----PN-------
J7RE34_KAZNA/6-71----------------------------------------------------------------VQ-----HE-------
U6IXM3_HYMMI/8-70----------------------------------------------------------------.Y-----PT-------
W5JQG4_ANODA/16-77----------------------------------------------------------------..-----MN-------
A8QGX0_BRUMA/7-70----------------------------------------------------------------IC-----PN-------
G0VDE5_NAUCC/6-72----------------------------------------------------------------VH-----YN-------
R4XKU1_TAPDE/7-70----------------------------------------------------------------VI-----HG-------
J7SB01_NAUDC/6-73----------------------------------------------------------------IH-----YN-------
B4NGN6_DROWI/8-71----------------------------------------------------------------LM-----PN-------
Q7QFB4_ANOGA/7-70----------------------------------------------------------------LT-----VH-------
Q6C499_YARLI/4-76----------------------------------------------------------------IT-----WN-------
A7TPS2_VANPO/6-74----------------------------------------------------------------IT-----YH-------
G1KJW8_ANOCA/16-79----------------------------------------------------------------LA-----PN-------
F0XHC8_GROCL/8-71----------------------------------------------------------------IA-----TD-------
L8G0J8_PSED2/9-71----------------------------------------------------------------.D-----TG-------
C3Y9C0_BRAFL/10-73----------------------------------------------------------------LC-----PN-------
A8X8R5_CAEBR/7-71----------------------------------------------------------------IC-----PN-------
F9XFB7_MYCGM/9-73----------------------------------------------------------------LD-----ST-------
T1J1W1_STRMM/9-72----------------------------------------------------------------LC-----PN-------

PF02196

T1HJK8_RHOPR/111-177----------------------------------------------------------------.VRAHL.PN-------
F7DHK5_MACMU/432-500----------------------------------------------------------------.FRLDLVPI-------
Q6T9C1_DANRE/993-1061----------------------------------------------------------------HCNINL.PD-------
B7PJL0_IXOSC/959-1025----------------------------------------------------------------.SRIVL.PD-------
F7CRV0_XENTR/7-78----------------------------------------------------------------TVKVYL.PN-------
F1QRN2_DANRE/55-128----------------------------------------------------------------TIRVFL.PN-------
E9QCV1_DANRE/716-780----------------------------------------------------------------PSWVSL.PD-------
F1QAG9_DANRE/321-389----------------------------------------------------------------YCCVYL.PD-------
H2XPX2_CIOIN/391-453----------------------------------------------------------------.......PV-------
G3Q715_GASAC/938-1006----------------------------------------------------------------HCSVVL.PS-------
T1JJ02_STRMM/111-176----------------------------------------------------------------..RADL.PN-------
T1HAL7_RHOPR/218-283----------------------------------------------------------------SVKVSV.PD-------
F6UAR3_XENTR/958-1026----------------------------------------------------------------QCYISL.PD-------
J9BDH4_WUCBA/54-127----------------------------------------------------------------.ILLHL.PF-------
B4LBF4_DROVI/138-203----------------------------------------------------------------TFKVAM.PD-------
K1PN87_CRAGI/492-557----------------------------------------------------------------.FRMDL.PH-------
X1WZN3_ACYPI/1063-1128----------------------------------------------------------------TVKVSL.PD-------
H9IT00_BOMMO/623-687----------------------------------------------------------------.VRVSL.PE-------
K7ITS2_NASVI/197-267----------------------------------------------------------------.LRAHL.PN-------
W5LIQ9_ASTMX/299-368----------------------------------------------------------------YCCVYL.PD-------
D6X4G2_TRICA/102-169----------------------------------------------------------------FLRAHL.PN-------
K1PN87_CRAGI/420-488----------------------------------------------------------------FCRVIL.PD-------
K7GLK7_PIG/20-90----------------------------------------------------------------TVKVYL.PN-------
E9GLD9_DAPPU/202-266----------------------------------------------------------------.FRVNL.PD-------
F7CJL2_CALJA/57-133----------------------------------------------------------------TIRVFL.PN-------
A7RN75_NEMVE/102-169----------------------------------------------------------------HVRAFL.PN-------
W4ZH62_STRPU/118-185----------------------------------------------------------------.VRAFL.PN-------
I3JW49_ORENI/36-106----------------------------------------------------------------TIRVYL.PN-------
E0VUE7_PEDHC/288-356----------------------------------------------------------------LCRVIL.SD-------
F6VWF2_XENTR/765-830----------------------------------------------------------------PSWVCL.PN-------
G3W060_SARHA/767-832----------------------------------------------------------------PSWFCL.PN-------
V8NG58_OPHHA/62-133----------------------------------------------------------------TIKVDL.PN-------
E5S4H8_TRISP/137-210----------------------------------------------------------------.LKVHL.PF-------
G6D175_DANPL/130-197----------------------------------------------------------------FLRAYL.PN-------
Q1DH71_AEDAE/21-87----------------------------------------------------------------.LRAHL.PN-------
B4I9U9_DROSE/142-211----------------------------------------------------------------LLRAHL.PN-------
H2SV15_TAKRU/9-82----------------------------------------------------------------TIRVYL.PN-------
H3B9F0_LATCH/311-380----------------------------------------------------------------YCCVYL.PD-------
W5MYH0_LEPOC/313-381----------------------------------------------------------------YCCVYL.PD-------
F7DHK5_MACMU/360-428----------------------------------------------------------------HCCIHL.PD-------
H2ZT51_LATCH/91-159----------------------------------------------------------------FCSVSL.PD-------
E9J425_SOLIN/13-83----------------------------------------------------------------ILIVHL.PN-------
I3ITJ6_DANRE/13-82----------------------------------------------------------------TLTVLI.PG-------
C3Y437_BRAFL/1150-1218----------------------------------------------------------------FCRVLL.PD-------
G7YGF3_CLOSI/132-200----------------------------------------------------------------.LRAHL.PN-------
E9GAH4_DAPPU/167-235----------------------------------------------------------------.VRAYL.PN-------
V8PGN4_OPHHA/701-766----------------------------------------------------------------PSWYCL.PN-------
H3CKM2_TETNG/894-961----------------------------------------------------------------.CSVML.PD-------
B7Q903_IXOSC/98-165----------------------------------------------------------------.VRAFL.PN-------
G4VG61_SCHMA/189-258----------------------------------------------------------------.LRAHF.PN-------
T1HM15_RHOPR/885-952----------------------------------------------------------------.TRVGL.PD-------
T1KNL1_TETUR/39-106----------------------------------------------------------------.VRAHL.PN-------
G3Q1T0_GASAC/295-364----------------------------------------------------------------YCCVYL.PD-------
B0X8R8_CULQU/539-607----------------------------------------------------------------LCRVIL.SN-------
G1P9K1_MYOLU/144-214----------------------------------------------------------------IVRVFL.PN-------
B3DFX5_DANRE/166-236----------------------------------------------------------------IVRVFL.PN-------
B4HER1_DROSE/707-775----------------------------------------------------------------LCRVIL.TD-------
T1JE93_STRMM/309-377----------------------------------------------------------------LCRVLL.PD-------
E9FUH4_DAPPU/1091-1158----------------------------------------------------------------LVKVLL.PD-------
E9C1M5_CAPO3/280-346----------------------------------------------------------------.LFVHL.PA-------
G3UWG2_MOUSE/766-831----------------------------------------------------------------PSWFCL.PN-------
H9JZ93_APIME/1117-1182----------------------------------------------------------------TVKVFV.PE-------
J9KA65_ACYPI/92-159----------------------------------------------------------------TIRAYL.PN-------
F1QV08_DANRE/935-1003----------------------------------------------------------------TCTVTL.PD-------
I1FZW1_AMPQE/139-206----------------------------------------------------------------LIRAHL.PE-------
E2B9S9_HARSA/115-186----------------------------------------------------------------TLRAYL.PN-------
G3RVK1_GORGO/57-130----------------------------------------------------------------TIRVFL.PN-------
T1ITC4_STRMM/455-518----------------------------------------------------------------MVKVYL.PD-------
F1NCP8_CHICK/960-1027----------------------------------------------------------------YCSVNL.PD-------
W4WGR9_ATTCE/210-279----------------------------------------------------------------ILMIHL.PN-------
F7CWM8_XENTR/308-377----------------------------------------------------------------YCCVYL.PD-------
H9KF32_APIME/279-344----------------------------------------------------------------LCRVIL.PD-------
E7F520_DANRE/721-786----------------------------------------------------------------PSWVLL.PN-------
H9GAK2_ANOCA/954-1022----------------------------------------------------------------CCNINL.PD-------
K1PUV0_CRAGI/130-196----------------------------------------------------------------IIKAYL.PN-------
G1KFE4_ANOCA/301-370----------------------------------------------------------------YCCVYL.PD-------
D6WL93_TRICA/480-545----------------------------------------------------------------TVKVSL.PD-------
H3ALP8_LATCH/58-131----------------------------------------------------------------TIRVYL.PN-------
V6CM34_CAEEL/42-116----------------------------------------------------------------MIMVHL.PF-------
D6WPU0_TRICA/901-969----------------------------------------------------------------LCRVVL.SN-------
F1S3D6_PIG/303-372----------------------------------------------------------------YCCVYL.PD-------
H3AED1_LATCH/53-126----------------------------------------------------------------TIRVYL.PH-------
E1BBL0_BOVIN/57-130----------------------------------------------------------------TIRVFL.PN-------
G1KFE4_ANOCA/379-442----------------------------------------------------------------.....I.PI-------

PF09379

TLN1_MOUSE/90-186----------------------------------------------------------------IR.M---LD-------
FRPD2_HUMAN/346-408----------------------------------------------------------------VV.L---LN-------
O17905_CAEEL/29-92----------------------------------------------------------------VR.M---LD-------
TALB_DICDI/89-151----------------------------------------------------------------VR.L---MD-------
PTN3_HUMAN/33-97----------------------------------------------------------------IH.F---LD-------
PTN14_HUMAN/25-88----------------------------------------------------------------IR.L---LD-------
Q29ET4_DROPS/39-103----------------------------------------------------------------VL.F---LD-------
Q29JN5_DROPS/24-91----------------------------------------------------------------VHHL---LD-------
Q7Q844_ANOGA/16-80----------------------------------------------------------------VR.L---LE-------
MOES_RAT/9-71----------------------------------------------------------------VT.T---MD-------
E41L2_HUMAN/222-285----------------------------------------------------------------VT.L---LD-------
E41L4_DANRE/15-83----------------------------------------------------------------VL.L---LD-------
FARP2_HUMAN/48-110----------------------------------------------------------------VK.L---LD-------
PTP1_CAEEL/33-100----------------------------------------------------------------VT.F---LD-------
PTN13_HUMAN/576-638----------------------------------------------------------------IM.L---LN-------
MYLIA_DANRE/5-68----------------------------------------------------------------VT.R---PD-------
Q41460_SOLTU/282-357----------------------------------------------------------------IVFF---LD-------
Q4CR63_TRYCC/37-105----------------------------------------------------------------VQ.F---VD-------
FRMA_DICDI/221-288----------------------------------------------------------------QSTM---LD-------
FRMD1_HUMAN/58-120----------------------------------------------------------------VL.L---PS-------
A8WR66_CAEBR/715-777----------------------------------------------------------------VE.L---LN-------
F6YGI4_CIOIN/40-104----------------------------------------------------------------VV.L---LD-------
H3CKH1_TETNG/20-83----------------------------------------------------------------IR.L---LD-------
H3DKS5_TETNG/24-87----------------------------------------------------------------VH.L---LD-------
H9JD20_BOMMO/60-123----------------------------------------------------------------VV.L---LN-------
M4AKM5_XIPMA/20-82----------------------------------------------------------------VF.L---PN-------

PF09469

COBL1_HUMAN/174-265------------------------------------------------------KKPTPIIPEKTVRVVINFK-------
COBL_HUMAN/144-235------------------------------------------------------KPGPPKVPEKSVRLVVNYL-------
B4F6M3_XENTR/140-231------------------------------------------------------KKPAPVIPEKTVRLVVNFL-------
H3DP68_TETNG/147-251------------------------------------------------------RRPAPKIPEKTVRLMVNYH-------

PF02017

G3WSD8_SARHA/53-127----------------------------------------------------------------AHPYRVTNA-------
H3A209_LATCH/35-110----------------------------------------------------------------PRPFRLCNH-------
F7EHI4_XENTR/12-86----------------------------------------------------------------IRCYKIRTL-------
H3DCI9_TETNG/5-81----------------------------------------------------------------KKPCRVCNF-------
H9KHC3_APIME/9-83----------------------------------------------------------------LKGYKVTDV-------
C3ZIK3_BRAFL/7-82----------------------------------------------------------------.KAFRVWDG-------
B7PJN6_IXOSC/9-84----------------------------------------------------------------.KPHKVWSC-------
CIDEB_MOUSE/35-109----------------------------------------------------------------QRPFRVCDH-------
G1N6M4_MELGA/38-112----------------------------------------------------------------PRPFRVCNC-------
B4MR20_DROWI/115-188----------------------------------------------------------------SKPFKVKDI-------
Q1L9C6_DANRE/7-81----------------------------------------------------------------PKLVKIRSA-------
T1HLF5_RHOPR/6-82----------------------------------------------------------------KRPFKIWDS-------
I3K6T4_ORENI/43-118----------------------------------------------------------------PRCFRVCTY-------
H0YYL4_TAEGU/17-93----------------------------------------------------------------.KRCVVRRR-------
F7F2F7_MONDO/8-82----------------------------------------------------------------LRTFKLRAL-------
K7J7X5_NASVI/23-95----------------------------------------------------------------.RGYKVTDV-------
G3Q650_GASAC/32-109----------------------------------------------------------------QRPFRVCRH-------
D6WZ60_TRICA/49-125----------------------------------------------------------------KRPFKLWDG-------
H9K1S5_APIME/14-88----------------------------------------------------------------..PYKIVDH-------
K1P4N7_CRAGI/2-86----------------------------------------------------------------.KAYKVQDV-------
F6YFD3_MONDO/40-116----------------------------------------------------------------ARPYRVSNA-------
R4G377_RHOPR/9-81----------------------------------------------------------------..PYKIVDV-------
H2MYH3_ORYLA/5-77----------------------------------------------------------------.KPVKVRSL-------
G3P5B4_GASAC/42-116----------------------------------------------------------------LKPFRVTNA-------
T1GCE2_MEGSC/27-100----------------------------------------------------------------..SLKIKDV-------
J9K9T7_ACYPI/9-85----------------------------------------------------------------KRPFKIWDG-------
F1QDE3_DANRE/33-108----------------------------------------------------------------PRPYKVCTP-------
H2UGF9_TAKRU/38-112----------------------------------------------------------------PRPFRVTNA-------
H1A2E6_TAEGU/18-92----------------------------------------------------------------.RPFRVSNA-------
W5L818_ASTMX/36-110----------------------------------------------------------------PRPFRVTNS-------
H9JNA5_BOMMO/6-81----------------------------------------------------------------NKPYKICDV-------
A7SSA1_NEMVE/8-82----------------------------------------------------------------RRPFKVCNS-------
H3AY23_LATCH/5-82----------------------------------------------------------------KKPCLVCTV-------
F1NBS6_CHICK/5-82----------------------------------------------------------------LKPCVVRRG-------
B4HNX1_DROSE/11-86----------------------------------------------------------------KKPFKVKDV-------
W5LI82_ASTMX/44-119----------------------------------------------------------------PRPYRVCTQ-------
W5N2P9_LEPOC/39-114----------------------------------------------------------------PRPFRVCTH-------
D6WW09_TRICA/3-77----------------------------------------------------------------TKGFKVTDS-------
M4AA15_XIPMA/21-96----------------------------------------------------------------.RSCKVCNF-------
I3JHL3_ORENI/8-82----------------------------------------------------------------IKPVKVRSC-------
B4HSQ8_DROSE/9-85----------------------------------------------------------------KRPLKIWDS-------
CIDEC_MOUSE/42-117----------------------------------------------------------------ARPCRVSTA-------
Q66K97_XENTR/41-116----------------------------------------------------------------QRPFRVSNS-------
H2LTA3_ORYLA/20-97----------------------------------------------------------------QRPFRVCCQ-------
I3J220_ORENI/3-79----------------------------------------------------------------DKPCKVCNF-------
K1QGB0_CRAGI/73-145----------------------------------------------------------------MKIFKVWNV-------
H0UTL9_CAVPO/9-81----------------------------------------------------------------.RCLLGRAL-------
J9KG38_ACYPI/2-74----------------------------------------------------------------.KGYKITNC-------
G1RE60_NOMLE/18-95----------------------------------------------------------------LKPCLLRRN-------
E9GQM1_DAPPU/5-81----------------------------------------------------------------KKPFRLISH-------
G3NPN2_GASAC/9-83----------------------------------------------------------------NKPVKIRGC-------
W5NBD2_LEPOC/38-112----------------------------------------------------------------PRPFRVASA-------
H2MQQ5_ORYLA/41-115----------------------------------------------------------------PKPFRVTNA-------
M4A767_XIPMA/48-122----------------------------------------------------------------PKPFRVTNA-------
E0VAJ8_PEDHC/2-72----------------------------------------------------------------KKGFKVTDK-------
H3AQT6_LATCH/41-115----------------------------------------------------------------QRPFRVCNH-------
H0YWX9_TAEGU/5-79----------------------------------------------------------------LRPFRLRGC-------
F8W414_DANRE/20-94----------------------------------------------------------------QRPFRVCSW-------
H9GDK6_ANOCA/4-77----------------------------------------------------------------.KAVKVRRP-------
W5K8J5_ASTMX/22-96----------------------------------------------------------------QRPFRVCTF-------
H3D014_TETNG/5-79----------------------------------------------------------------EKPVKIRSY-------
H2V7W9_TAKRU/8-82----------------------------------------------------------------NKPVKIRNY-------
Q0P4E5_DANRE/37-111----------------------------------------------------------------SRPFRVINS-------
C3YR00_BRAFL/3-78----------------------------------------------------------------SKPFKIRSA-------
DFFB_MOUSE/8-82----------------------------------------------------------------PKCVKLRAL-------
I3M3Q6_SPETR/8-82----------------------------------------------------------------LKTVRLRAL-------
D6WA34_TRICA/9-83----------------------------------------------------------------GKPFKITDS-------
H2PXW1_PANTR/5-79----------------------------------------------------------------PKSVKLRAL-------
J9JNI3_ACYPI/9-84----------------------------------------------------------------.KPYKIIDS-------
K1RJK1_CRAGI/5-81----------------------------------------------------------------SRPFKIWNS-------
W5L119_ASTMX/3-79----------------------------------------------------------------VRPCKVCNY-------
CIDEA_MOUSE/34-109----------------------------------------------------------------ARPFRVSNH-------
U3IID5_ANAPL/37-111----------------------------------------------------------------PRPFRVCNW-------
G3U5M0_LOXAF/18-95----------------------------------------------------------------LKPCLLRRN-------
E9H9J0_DAPPU/1-78----------------------------------------------------------------KKPFKLVSQ-------
L5M7U1_MYODS/42-117----------------------------------------------------------------ARPCRVSTQ-------
H9KF38_APIME/6-82----------------------------------------------------------------KRPFKIWDS-------
H9GIB0_ANOCA/12-88----------------------------------------------------------------.KQCLLRSN-------
W5MFN3_LEPOC/10-84----------------------------------------------------------------NKLVKLRGF-------
H9J7Z7_BOMMO/2-77----------------------------------------------------------------KKGYKVTDV-------
W5LKE6_ASTMX/11-85----------------------------------------------------------------PKLFKVRMS-------
E0VWD7_PEDHC/15-90----------------------------------------------------------------.QPFKIMDY-------
T1IVD0_STRMM/426-500----------------------------------------------------------------.RPFKIWSS-------
Q4S0S9_TETNG/16-93----------------------------------------------------------------QRPFRVCCH-------
H2LKD5_ORYLA/5-80----------------------------------------------------------------.KACKVCNF-------
U3JVG4_FICAL/38-112----------------------------------------------------------------RRPYRVCSW-------
F1R3G3_DANRE/4-80----------------------------------------------------------------LKPCKVCNV-------
H9G8X7_ANOCA/84-158----------------------------------------------------------------QRPFRVCDH-------
F4WNU5_ACREC/7-80----------------------------------------------------------------LKGYKVTDV-------
B0WG49_CULQU/5-75----------------------------------------------------------------....KIKDV-------
Q66IL3_XENTR/38-112----------------------------------------------------------------PRPFRVCNS-------
I3LN88_PIG/8-82----------------------------------------------------------------PKTFKLRAL-------
W5MHN8_LEPOC/4-80----------------------------------------------------------------PKPCRVCNY-------
G6DK22_DANPL/2-77----------------------------------------------------------------KKGYKVTDV-------
Q5CZL3_XENTR/20-97----------------------------------------------------------------QKACVVSLP-------
M3ZSJ8_XIPMA/8-82----------------------------------------------------------------NKPVKIRGY-------
H9GEE2_ANOCA/31-105----------------------------------------------------------------PRPFRVTNH-------
H3BIK5_LATCH/10-84----------------------------------------------------------------LKIFKLRSA-------
M3XLB3_LATCH/37-111----------------------------------------------------------------LRPFRVCKS-------
T1KZJ4_TETUR/5-83----------------------------------------------------------------EKPYKVWSC-------

PF11973

NQRA_NEIMB/262-312-------------------------------------------------------------------VIA-LG-------
NQRA_HAEDU/259-309-------------------------------------------------------------------VVA-LA-------
NQRA_VIBVY/261-311-------------------------------------------------------------------VVS-LA-------
A2U3T1_9FLAO/261-310-------------------------------------------------------------------TIA-LT-------
NQRA_ALCBS/263-313-------------------------------------------------------------------VVA-LT-------
A8ZWA6_DESOH/264-312-------------------------------------------------------------------VVA-VS-------
NQRA_ACTSZ/259-309-------------------------------------------------------------------VVS-LA-------
Q8EIE0_SHEON/270-320-------------------------------------------------------------------VVA-LG-------
A4ATH7_MARSH/262-312-------------------------------------------------------------------VVA-LV-------
NQRA_PSYIN/261-311-------------------------------------------------------------------VIS-LA-------
A1U1Z3_MARAV/265-316-------------------------------------------------------------------IVA-IG-------
NQRA_CHRSD/263-314-------------------------------------------------------------------VIA-VG-------
Q4FPV7_PSYA2/265-315-------------------------------------------------------------------LLS-LA-------
A3UAF5_CROAH/263-312-------------------------------------------------------------------QIA-VA-------
Q8A8K7_BACTN/262-312-------------------------------------------------------------------TVA-VT-------
NQRA_PHOLL/262-312-------------------------------------------------------------------VIA-LA-------
Q6AM94_DESPS/260-310-------------------------------------------------------------------IIA-IT-------
A4CPG3_ROBBH/263-313-------------------------------------------------------------------VVA-LA-------
Q15YQ6_PSEA6/272-322-------------------------------------------------------------------VIA-LG-------
B3EPP3_CHLPB/267-316-------------------------------------------------------------------IIT-VG-------
Q487E1_COLP3/260-310-------------------------------------------------------------------VIS-LA-------
NQRA_RHOBA/270-321-------------------------------------------------------------------VIS-LA-------
A5WBL9_PSYWF/269-319-------------------------------------------------------------------LIS-LA-------
NQRA_SERP5/264-314-------------------------------------------------------------------VVA-LA-------
NQRA_KLEP7/262-312-------------------------------------------------------------------IIA-LG-------
A0LYE0_GRAFK/263-310-------------------------------------------------------------------TVA-VT-------
A3QGH7_SHELP/270-320-------------------------------------------------------------------VVA-LG-------
Q604Z5_METCA/264-315-------------------------------------------------------------------IVS-LA-------
NQRA_HAHCH/262-312-------------------------------------------------------------------VVA-LA-------
A6LB24_PARD8/261-311-------------------------------------------------------------------MVA-IT-------
Q6MF30_PARUW/276-328-------------------------------------------------------------------VIS-IA-------
Q82SE3_NITEU/265-316-------------------------------------------------------------------IVA-LG-------
A6L599_BACV8/262-312-------------------------------------------------------------------TIA-LT-------
Q5LLJ1_RUEPO/262-313-------------------------------------------------------------------VIA-LS-------
NQRA_CHLTR/269-322-------------------------------------------------------------------IVA-LA-------
A5EUU8_DICNV/264-314-------------------------------------------------------------------IVA-IA-------
NQRA_SACD2/262-312-------------------------------------------------------------------VVS-LA-------
B4S5U5_PROA2/264-313-------------------------------------------------------------------VMT-VG-------
A3I2B1_9BACT/266-315-------------------------------------------------------------------TIA-IS-------
A0KHC6_AERHH/262-311-------------------------------------------------------------------VIA-LA-------
F5HFB1_PORGI/261-312-------------------------------------------------------------------MIA-MT-------
NQRA_HAEIN/263-312-------------------------------------------------------------------VIS-LA-------
NQRA_PSEHT/262-309-------------------------------------------------------------------VIS-LA-------
Q6LTY9_PHOPR/263-309-------------------------------------------------------------------VVA-LA-------
NQRA_YERPE/262-310-------------------------------------------------------------------IVA-LA-------
NQRA_PSEAE/260-309-------------------------------------------------------------------VIA-LA-------

PF10531

TCO2_MOUSE/332-387-------------------------------------------------------------------VIS-VT-------
M9NGQ5_DROME/486-550-------------------------------------------------------------------TLW-VG-------
A6ASG9_VIBCY/280-335-------------------------------------------------------------------TIA-ID-------
Q2BP71_NEPCE/290-339-------------------------------------------------------------------IVT-LT-------
A6FCN1_9GAMM/240-290-------------------------------------------------------------------LFG-LS-------
Q475D3_CUPPJ/342-393-------------------------------------------------------------------PFQ-LA-------
E4I500_ENTFC/96-151-------------------------------------------------------------------YTD-IK-------
Q3AHI3_SYNSC/235-290-------------------------------------------------------------------NVQ-VV-------
Q3D625_STRAG/74-129-------------------------------------------------------------------TVD-VK-------
A4XKH1_CALS8/69-124-------------------------------------------------------------------VVY-VC-------
A0A017LMV3_ECOLX/296-345-------------------------------------------------------------------VVT-LT-------
Q82SN2_NITEU/194-247-------------------------------------------------------------------RVY-VV-------
Q9WZA6_THEMA/882-937-------------------------------------------------------------------YVY-VL-------
A3MYN9_ACTP2/304-353-------------------------------------------------------------------VVT-LT-------
A3DI53_CLOTH/284-333-------------------------------------------------------------------RVT-VD-------
NUOF_RICFE/241-293-------------------------------------------------------------------IFC-IS-------
Q1DDC8_MYXXD/245-298-------------------------------------------------------------------LVC-LS-------
A5ZM69_9FIRM/173-221-------------------------------------------------------------------YVS-VV-------
D4Q627_LISMN/162-210-------------------------------------------------------------------QLT-VT-------
A3I1W9_9BACT/255-308-------------------------------------------------------------------KVT-MV-------
Q12W77_METBU/282-330-------------------------------------------------------------------VVS-VS-------
Q609Q6_METCA/79-130-------------------------------------------------------------------KYY-IG-------
Q21I18_SACD2/289-338-------------------------------------------------------------------VTT-VV-------
A5N7M5_CLOK5/285-334-------------------------------------------------------------------VTT-LS-------
Q9WZA6_THEMA/803-855-------------------------------------------------------------------FAY-VV-------
A1RI08_SHESW/299-352-------------------------------------------------------------------TVS-VM-------
Q1Q5X5_9BACT/295-343-------------------------------------------------------------------IIT-VT-------
Q67R12_SYMTH/291-339-------------------------------------------------------------------IVT-VT-------
A3N5S8_BURP6/206-259-------------------------------------------------------------------RVQ-VT-------
A0LFM7_SYNFM/525-578-------------------------------------------------------------------MVG-VA-------
A9CJA6_AGRT5/241-293-------------------------------------------------------------------LFM-VS-------
B7RVX5_9GAMM/244-295-------------------------------------------------------------------LYG-VS-------
A6EKA2_9SPHI/240-293-------------------------------------------------------------------LIS-AS-------
Q5E6B8_VIBF1/298-348-------------------------------------------------------------------IVT-LT-------
Q47GW4_DECAR/292-339-------------------------------------------------------------------LVT-IT-------
A6F1J2_9ALTE/288-341-------------------------------------------------------------------RVG-IE-------
Q21PI3_SACD2/121-177-------------------------------------------------------------------RIR-VT-------
A5I658_CLOBH/60-115-------------------------------------------------------------------TVY-VN-------
B9M3Y3_GEODF/240-291-------------------------------------------------------------------LFC-IS-------
A0A029S529_STRPY/76-131-------------------------------------------------------------------LVD-LK-------
Q2SIM3_HAHCH/127-183-------------------------------------------------------------------RVR-VT-------
A6LNB4_THEM4/284-336-------------------------------------------------------------------GLT-VT-------
Q0AYU9_SYNWW/231-282-------------------------------------------------------------------VLT-LT-------
A3JTW2_9RHOB/400-450-------------------------------------------------------------------SYS-IS-------
A7BZP7_9GAMM/182-236-------------------------------------------------------------------LVY-VL-------
Q0AAI4_ALKEH/188-241-------------------------------------------------------------------KVY-VT-------
A9BJD0_PETMO/286-335-------------------------------------------------------------------GIT-LS-------
A9A0G2_DESOH/202-255-------------------------------------------------------------------KIY-VT-------
A1U014_MARAV/165-213-------------------------------------------------------------------MIT-VH-------
E8VDQ7_BACST/63-118-------------------------------------------------------------------VID-IK-------
Q0AAG9_ALKEH/297-346-------------------------------------------------------------------IVT-IT-------
Q30W86_DESAG/164-212-------------------------------------------------------------------YVT-VS-------
Q039L8_LACC3/72-127-------------------------------------------------------------------FVH-IK-------
A7BVF4_9GAMM/51-103-------------------------------------------------------------------KVF-VN-------
Q603B2_METCA/290-339-------------------------------------------------------------------IVT-VT-------
B2T2F2_BURPP/247-297-------------------------------------------------------------------IFS-VA-------
A8F8Q9_THELT/182-235-------------------------------------------------------------------NVK-VL-------
G7QMP4_LEPII/240-291-------------------------------------------------------------------LFS-VS-------
A7HJ14_FERNB/961-1016-------------------------------------------------------------------FAY-VL-------
Q7MFC7_VIBVY/104-156-------------------------------------------------------------------AFY-VN-------
Q6AQ74_DESPS/290-339-------------------------------------------------------------------VIT-VA-------
NQO1_THET8/251-300-------------------------------------------------------------------LYQ-IS-------
Q7MKZ6_VIBVY/298-351-------------------------------------------------------------------TVY-IM-------
A4XAF1_SALTO/138-193-------------------------------------------------------------------VVA-VA-------
A0LNJ0_SYNFM/239-294-------------------------------------------------------------------TIY-VD-------
B8G0F4_DESHD/163-211-------------------------------------------------------------------YLT-LA-------
B8CY15_HALOH/287-336-------------------------------------------------------------------PVT-IT-------
A1WT48_HALHL/293-342-------------------------------------------------------------------VIT-VA-------
A5PAR8_9SPHN/137-189-------------------------------------------------------------------YVV-VL-------
Q1YW52_PHOPR/370-423-------------------------------------------------------------------TIY-VM-------
A0AZV6_BURCH/310-367-------------------------------------------------------------------KVF-VL-------
Q64UZ9_BACFR/254-306-------------------------------------------------------------------LVS-IS-------
A4VJ61_PSEU5/289-338-------------------------------------------------------------------VVT-VA-------
Q39VZ5_GEOMG/27-80-------------------------------------------------------------------VVA-VA-------
A6VTE9_MARMS/539-594-------------------------------------------------------------------VID-VS-------
Q9CER3_LACLA/70-125-------------------------------------------------------------------MVD-LK-------
Q31HF5_THICR/243-293-------------------------------------------------------------------CYS-VS-------
Q8NN61_CORGL/59-113-------------------------------------------------------------------VVS-VV-------
Q03VU1_LEUMM/70-125-------------------------------------------------------------------MVD-VK-------
D2BG77_DEHMV/240-288-------------------------------------------------------------------LFC-LS-------
F0KCN0_CLOAE/61-116-------------------------------------------------------------------SAQ-IF-------
A0A022P5J0_PSEAI/288-337-------------------------------------------------------------------ITT-LA-------
Q5E801_VIBF1/122-174-------------------------------------------------------------------KFF-IS-------
Q5NLH4_ZYMMO/289-338-------------------------------------------------------------------IVT-VS-------
Q1IN17_KORVE/292-347-------------------------------------------------------------------MVA-IS-------
A3Z0U5_9SYNE/352-403-------------------------------------------------------------------VFS-LT-------
A6FK42_9RHOB/117-172-------------------------------------------------------------------PIY-VM-------
A0A008ASR0_STAAU/83-137-------------------------------------------------------------------YVD-VK-------
B8G1Q5_DESHD/161-209-------------------------------------------------------------------YLT-IT-------
Q5WHH4_BACSK/63-118-------------------------------------------------------------------VVD-VK-------
TCO1_HUMAN/339-395-------------------------------------------------------------------SVR-IN-------
A0XZ21_9GAMM/281-333-------------------------------------------------------------------QVT-VD-------
E2XBA8_SHIDY/256-313-------------------------------------------------------------------KVF-VM-------
A5HYR2_CLOBH/286-335-------------------------------------------------------------------IIT-VT-------
Q3ETX3_BACTI/15-81-------------------------------------------------------------------TIS-VK-------
B1KGW6_SHEWM/303-352-------------------------------------------------------------------VVT-IT-------
Q7NII2_GLOVI/252-307-------------------------------------------------------------------SVQ-VA-------
Q7P7D0_FUSNV/128-177-------------------------------------------------------------------VVT-VS-------
A0YJY0_LYNSP/655-710-------------------------------------------------------------------KVN-FV-------
A5IKH7_THEP1/283-332-------------------------------------------------------------------GMT-VS-------
A9B4Z9_HERA2/244-296-------------------------------------------------------------------AVS-IS-------
Q8KX81_AERHY/147-201-------------------------------------------------------------------KIF-VT-------
Q1RPC7_ECOLX/169-217-------------------------------------------------------------------TLT-VN-------
A0YXY1_LYNSP/357-413-------------------------------------------------------------------NVN-VV-------
Q6MDR1_PARUW/241-291-------------------------------------------------------------------IFQ-VS-------
Q608R0_METCA/226-280-------------------------------------------------------------------QVF-VL-------
A6TJY1_ALKMQ/161-209-------------------------------------------------------------------LVT-IL-------
H3UIV4_STAEP/81-135-------------------------------------------------------------------FID-IK-------
A6BIL3_9FIRM/286-335-------------------------------------------------------------------VVT-VS-------
Q3KCF0_PSEPF/103-155-------------------------------------------------------------------SFY-IN-------
B3EJT6_CHLPB/286-335-------------------------------------------------------------------VVT-VS-------
A2SJE9_METPP/201-256-------------------------------------------------------------------TVY-IY-------
Q02B56_SOLUE/158-206-------------------------------------------------------------------FLS-VT-------
A8ZSV2_DESOH/302-351-------------------------------------------------------------------VVC-VT-------
A9KHN6_CLOPH/85-140-------------------------------------------------------------------VIH-VC-------
A8FXR3_SHESH/299-352-------------------------------------------------------------------LVS-VD-------
A5ZMX0_9FIRM/436-485-------------------------------------------------------------------VTT-IT-------
Q0F0I1_9PROT/304-353-------------------------------------------------------------------LVT-VS-------
C8K0R7_LISMN/71-126-------------------------------------------------------------------YID-IK-------
A0A016B2Y3_BACFG/359-411-------------------------------------------------------------------LVQ-IT-------
Q8DI24_THEEB/259-315-------------------------------------------------------------------RVQ-VV-------
B5E8N7_GEOBB/420-475-------------------------------------------------------------------VAG-VA-------
A1WTR7_HALHL/292-341-------------------------------------------------------------------PVT-VG-------
A4BYL4_9FLAO/317-369-------------------------------------------------------------------LVS-VE-------
Q2S4Z6_SALRD/572-633-------------------------------------------------------------------QVR-IT-------
A6VTE9_MARMS/281-333-------------------------------------------------------------------RIT-IE-------
Q6SGV1_9BACT/105-157-------------------------------------------------------------------PFF-IN-------
A5ZDD7_9BACE/288-337-------------------------------------------------------------------VIT-VT-------
A5EVI2_DICNV/295-343-------------------------------------------------------------------YVT-VS-------
A5N6H2_CLOK5/161-209-------------------------------------------------------------------YVT-VV-------
Q46SE6_CUPPJ/239-290-------------------------------------------------------------------LYS-LS-------
Q603I4_METCA/299-348-------------------------------------------------------------------IVT-VS-------
A7B491_RUMGN/68-123-------------------------------------------------------------------FVY-LC-------
A3ERW5_9BACT/117-169-------------------------------------------------------------------FFY-IS-------
F4AFD3_LACJH/80-135-------------------------------------------------------------------TVD-IA-------
C0FSK0_9FIRM/164-212-------------------------------------------------------------------LVS-IV-------
B4SFP0_PELPB/166-219-------------------------------------------------------------------KAF-VL-------
Q0VR45_ALCBS/173-226-------------------------------------------------------------------KIY-VT-------
C3F778_BACTU/64-119-------------------------------------------------------------------VID-MK-------

PF06251

Q15QX9_PSEA6/17-247LASH..LPSDTHEQKSVFTNLINELEHWHLANRLSVKIDYDLARISEAHNPQFDNGYYVVSLHERQESVE-II-------
Q6D778_PECAS/20-259LETRW.RNSGDGDLAISAWLLRKAINPINVAGRIRTNLDPDRVRVYSENNRPL.VGEYALYVAPHDDKLA-LI-------
Q7MPN4_VIBVY/33-265LAK.......DEDYRQASQLLLTLLEKHQYGYRENINLDIDAVRLKADLNPAL.PGHYALKQASRENKVL-LL-------
Q5E8J3_VIBF1/22-253LSRETSLFSANNEFKRSATQIISQLEHHTFVGRIFSSLDLDLIRINEKLNPIL.NADYQLFVHPRPTSVS-FF-------
GFCC_ECOLI/21-248WEA.....EADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPL.VGDYTLYTVQRPVTIT-LL-------
A0KM78_AERHH/18-252LSKMW.SDMGEPSLASATLQLLQQLQQLELTGRFDVSVDPDVNQARAGVDAPILKGHYQLYLAPRHPEVQ-IA-------
F7YJH4_VIBA7/59-287QES.....LAASAHKKRWRQLKEQLRARTFAQRIFTPLDPDITRITASQNPKL.QGQWLLSLNALPTTVS-VL-------
Q328Y3_SHIDS/20-245QGA.....DSSADDAAAINALRQQIQVLKVTGRQKINLDPDIVRVAERANPPL.QGNYTLWVGPPPSTVT-LF-------
Q8ZKI2_SALTY/20-244LSA.....EEDGDAAAAINTLRRQIQAVKVTGRQFVNLDPDVVRVSERGNPPL.QGHYMLWVGPQPTQVT-LF-------

PF13019

Q4WLQ9_ASPFU/6-176VNVLLSSFPGLSLPSTVSFSLPSTSTISDLTDRVSAYLPSSIPLQ...SLVLTTTSNKQLVPSCERLFSL-FG-------
A2QLN4_ASPNC/6-175VNILLSTFPGLSLPSTLSFALPSSSSVADLTDKIASYLPPSLPLN...RLILTTTSNKQLLPSSETLASY-LI-------
B6HPD9_PENCW/6-174VNVLLSSFPGLSLPATLSFTLPSTATTSDLTAKIASYLPESLLLH...SLALTTTNNKHLTATSEC.IRS-FL-------
B6QDL0_PENMQ/6-178INILLSSFSGLALPPTLSFSLPITSTITDLTERIEHYLPESLKRSA.ANLTLTTFGNRQLLPESTLPISS-LL-------
C1GB64_PARBD/6-177INFLLTSFPGLPLPPTLSFALPSTSTVADVVASISSRLPSSLRSVS.PRLILTTTNNKQLLPSSSESVAT-LL-------
C4JSH4_UNCRE/6-176INVLLSAFPGLSFPSTLCIPLPSTSTVADLTEKINSHLPISFPLQS.PSLVLTTLSNAELIPYSSDKLAN-FL-------
D4ATG1_ARTBC/6-181VNVLLSSFPGLALPATLAIPLPSTSSIADLTDRISAHLPFPLTAQS.SPFILTTTNNKQIPFSSSAKLSN-LI-------
A8NTG8_COPC7/7-164TSVLVSTFPPF...PTLNLLVPSSTPVSSVYSLLVDRYPSLPHEL...ASTLLITTQTGYAPDDETTLST-LC-------
B8NZC7_POSPM/1-158.SVLISTFSPF...PTLSLSAPVDAPFHTLYDLLAERYPELPLD.......LVLSPHRGCAPALDAPLSS-LW-------
Q5KEV9_CRYNJ/4-154QTVFLNFPSPL...SSLQLQLPSTTLISSL......PVPPTLASS....SYLRTASSGPL..SLSTPLSD-LI-------
SDE2_SCHPO/4-160KTVFLN...GDFLKNSVNVNLNRLATVETLLRHVLGDSYETVLER....AYLTHQSR...IVHPDIQLCK-LE-------
Q0UKG5_PHANO/9-167ITVIVNSIKG....HDIAFTSPKDASLTSIYDTLYERAPWVQNSS....YILTTNSRRAV.SHDESPVSS-LL-------
C9SK56_VERA1/6-169INVFVSTFPGLGLPSTLVLPIPATTTFSDVRGQIDARLPESGSR.....LILTTISNKEVSATSARPLSD-LL-------
B2B1E0_PODAN/8-174INILITSFTGSSLPPTLSLALPPSTPISTLITTLDSRLPSSSSLLCTRQLLLTTLSSTYLPPSSTSPISS-LL-------
Q2GVT4_CHAGB/6-186INVLITSFAGTGLPPTLSLALPPATPITTLLDELDSRLPPSATTSN.TRLFLTTLSNRSIPLTSTLPISH-YL-------
C7YPG6_NECH7/6-168LNVLVTSFAGLDLPPTLVLPLPSSTTVTELRDRIDERLPTTQSR.....LILTTLSNKQLPSASESPISE-YL-------
Q8LHF3_ORYSJ/7-183YQILVRLLDGRTRCLRFSTTTVSGAALLDAVSALSRVPAAS..........LRLVTG.....RLDVSPSS-VL-------

PF06071

D3F2Y1_CONWI/274-357-----------------------------------------------------------------LNAFF-TV-------
B3EMH3_CHLPB/279-362-----------------------------------------------------------------LHTYF-TA-------
D9QUL3_ACEAZ/281-364-----------------------------------------------------------------LITFF-TA-------
F2I8P1_AERUA/281-364-----------------------------------------------------------------LATYF-TA-------
A9UXF4_MONBE/310-392-----------------------------------------------------------------LLSFF-TA-------
W8GT98_9MOLU/282-365-----------------------------------------------------------------LGTFF-TC-------
W0E025_MARPU/279-362-----------------------------------------------------------------LETYF-TS-------
W0A4A4_9SPHN/282-365-----------------------------------------------------------------LLTFF-TC-------
C3PFE0_CORA7/277-359-----------------------------------------------------------------LQTYL-TA-------
R6D6P6_9CLOT/281-364-----------------------------------------------------------------LQTYF-TA-------
H2J4X8_MARPK/275-358-----------------------------------------------------------------LITFF-TV-------
V9TUB2_9PROT/283-366-----------------------------------------------------------------LLTFF-TV-------
E4TSF1_MARTH/281-364-----------------------------------------------------------------LITYF-TA-------
V5EAH6_PSEBG/373-454-----------------------------------------------------------------LVRYF-TA-------
B9L9L4_NAUPA/280-363-----------------------------------------------------------------LISYF-TA-------
Q586U4_TRYB2/304-387-----------------------------------------------------------------LIHYF-TA-------
C7NA33_LEPBD/283-366-----------------------------------------------------------------LITYF-TA-------
R5MCX8_9MOLU/282-365-----------------------------------------------------------------LQTFF-TV-------
A1AM06_PELPD/280-363-----------------------------------------------------------------LITYF-TA-------
H8KRC3_SOLCM/281-364-----------------------------------------------------------------LATYF-TA-------
C8X2N0_DESRD/283-366-----------------------------------------------------------------LISYF-TA-------
C7M399_ACIFD/275-356-----------------------------------------------------------------..TFF-TS-------
R6H3G3_9FIRM/281-364-----------------------------------------------------------------LVSFL-TA-------
E1SSA2_FERBD/279-362-----------------------------------------------------------------LQTYF-TA-------
R5QDB9_9FIRM/282-365-----------------------------------------------------------------LRTYF-TA-------
K9RN32_9CYAN/279-362-----------------------------------------------------------------LRTYF-TS-------
B8E098_DICTD/250-332-----------------------------------------------------------------LISFF-TA-------
A0LQI7_SYNFM/263-346-----------------------------------------------------------------LATFL-TV-------
A5DLY4_PICGU/309-393-----------------------------------------------------------------LISFY-TC-------
G1WZS2_ARTOA/306-388-----------------------------------------------------------------LGSFF-TC-------
F2I0I7_PELSM/257-340-----------------------------------------------------------------LSTYF-TA-------
T2G6H0_DESGI/282-365-----------------------------------------------------------------LISYF-TA-------
W1Q8V5_OGAPD/307-390-----------------------------------------------------------------LISFF-TA-------
D8LZH2_BLAHO/323-406-----------------------------------------------------------------LIHFF-TA-------
F7QF94_9BRAD/281-364-----------------------------------------------------------------LITYF-TV-------
A5IYH1_MYCAP/283-365-----------------------------------------------------------------LKTYF-TS-------
R7PR57_9FIRM/284-367-----------------------------------------------------------------LINFF-TA-------
C0QTJ3_PERMH/286-369-----------------------------------------------------------------LITYF-TA-------
I2F4B2_9THEM/275-358-----------------------------------------------------------------LISFL-TV-------
X6M6X9_RETFI/358-441-----------------------------------------------------------------LIHFF-TA-------
Q82TQ7_NITEU/279-362-----------------------------------------------------------------LQTYF-TA-------
I1RGA6_GIBZE/307-389-----------------------------------------------------------------LGSFF-TV-------
A4S253_OSTLU/312-397-----------------------------------------------------------------LMYFF-TA-------
D6YVQ6_WADCW/282-363-----------------------------------------------------------------LITFL-TT-------
D5E4T2_MYCCM/283-365-----------------------------------------------------------------LETYF-TA-------
R7GN86_9FIRM/282-365-----------------------------------------------------------------LKTFF-TV-------
F2NH69_DESAR/147-228-----------------------------------------------------------------F..FY-TV-------
B6K7Z9_SCHJY/307-389-----------------------------------------------------------------LINYF-TV-------
B5YKH5_THEYD/265-347-----------------------------------------------------------------.ISFF-TA-------
D6ZK59_MOBCV/277-360-----------------------------------------------------------------LQTFL-TA-------
A7TM36_VANPO/320-405-----------------------------------------------------------------LISFY-TC-------
F6FHR6_MYCHI/270-353-----------------------------------------------------------------LKTFF-TV-------
L0B6G4_9PROT/279-362-----------------------------------------------------------------LQTYF-TV-------
D7G6Q9_ECTSI/329-412-----------------------------------------------------------------LQTYF-TS-------
D5EDD8_AMICL/278-362-----------------------------------------------------------------LISFF-TT-------
A0A023BDA3_GRENI/290-373-----------------------------------------------------------------LIHYF-TC-------
F0NXV5_WEEVC/279-362-----------------------------------------------------------------LETYF-TA-------
B3QT44_CHLT3/279-362-----------------------------------------------------------------LHTYF-TA-------
D6Y1K7_BACIE/282-365-----------------------------------------------------------------LDTFF-TA-------
F0T2X8_SYNGF/282-365-----------------------------------------------------------------LMTFF-TA-------
L2GMJ2_VITCO/311-394-----------------------------------------------------------------LINFF-TA-------
F5WVB5_ERYRF/283-366-----------------------------------------------------------------LRTFF-TA-------
K9UF02_9CHRO/279-360-----------------------------------------------------------------LRTYF-TM-------
D4KAZ8_9FIRM/292-376-----------------------------------------------------------------LISFL-TD-------
E1QY66_OLSUV/269-352-----------------------------------------------------------------LQSFF-TA-------
A2ER05_TRIVA/299-380-----------------------------------------------------------------LINFF-TC-------
I4BBW7_TURPD/295-377-----------------------------------------------------------------.ITFF-TA-------
A7HIW6_ANADF/286-369-----------------------------------------------------------------LITYF-TA-------
C5LL77_PERM5/329-407-----------------------------------------------------------------..HYY-TL-------
J9D7U5_EDHAE/284-367-----------------------------------------------------------------LINFF-TA-------
I5B0B9_9DELT/272-354-----------------------------------------------------------------LISFF-TV-------
V5RWG0_9BACT/274-357-----------------------------------------------------------------LQSYL-TA-------
U9TTS5_RHIID/309-390-----------------------------------------------------------------LMYFF-TC-------
C4YB69_CLAL4/348-432-----------------------------------------------------------------LISFY-TC-------
B9E8Y7_MACCJ/282-365-----------------------------------------------------------------LATYF-TA-------
B1ZVL1_OPITP/150-232-----------------------------------------------------------------.ISFL-TV-------
O84094_CHLTR/283-366-----------------------------------------------------------------LISYF-TT-------
B9I0J5_POPTR/198-293-----------------------------------------------------------------LRTYF-TS-------
R6YXQ1_9FIRM/284-367-----------------------------------------------------------------LKTFF-TV-------
R7K926_9FIRM/277-360-----------------------------------------------------------------LISYL-TA-------
I0IMR1_LEPFC/280-363-----------------------------------------------------------------LLSFL-TA-------
C5DGQ9_LACTC/324-409-----------------------------------------------------------------LISFY-TC-------
A9B1D6_HERA2/276-359-----------------------------------------------------------------LISFL-TA-------
E4RL97_HALHG/279-362-----------------------------------------------------------------LITFL-TA-------
E1ZG20_CHLVA/300-383-----------------------------------------------------------------LIYYF-TA-------
R5SPF1_9CLOT/280-363-----------------------------------------------------------------LISYL-TA-------
S6A8B7_9SPIO/284-367-----------------------------------------------------------------LRTFF-TA-------
W0J8V0_9BACT/283-366-----------------------------------------------------------------LQTYF-TA-------
Q6BIE5_DEBHA/325-409-----------------------------------------------------------------LISFY-TC-------
A0DJ80_PARTE/285-367-----------------------------------------------------------------LIRFF-TV-------
B8F988_DESAA/260-341-----------------------------------------------------------------..SFF-TV-------
U6B8Z6_9RHIZ/283-366-----------------------------------------------------------------LITYF-TV-------
C4VA82_NOSCE/288-371-----------------------------------------------------------------LINFF-TI-------
R6GSX4_9FIRM/278-361-----------------------------------------------------------------LISYL-TA-------
V6DKP8_9DELT/287-370-----------------------------------------------------------------LITFF-TC-------
Q2GIK1_ANAPZ/279-362-----------------------------------------------------------------LITFF-TL-------
U5T808_9GAMM/267-350-----------------------------------------------------------------LQTFF-TA-------
E1X178_BACMS/285-368-----------------------------------------------------------------LRTYF-TA-------
G8JSA7_ERECY/342-427-----------------------------------------------------------------LISFY-TC-------
R7MFV1_9CLOT/282-365-----------------------------------------------------------------LATFF-TV-------
A9NG41_ACHLI/282-365-----------------------------------------------------------------LNTYF-TC-------
I0FC09_BORCA/284-367-----------------------------------------------------------------LRTYF-TA-------
F7XTT7_MIDMI/280-360-----------------------------------------------------------------LITFF-TI-------
V5RTD1_9BACT/287-369-----------------------------------------------------------------LESFL-TM-------
E1R4R3_SPISS/285-368-----------------------------------------------------------------LRTFF-TA-------
F8F3Y1_TRECH/285-368-----------------------------------------------------------------LRTFF-TA-------
A9BG26_PETMO/276-357-----------------------------------------------------------------LISFF-TV-------
Q3B243_PELLD/279-362-----------------------------------------------------------------LQVYF-TA-------
F4NZZ0_BATDJ/306-392-----------------------------------------------------------------LIYFF-TS-------
F9YQL1_CAPCC/279-362-----------------------------------------------------------------LQTYF-TA-------
R5B3D9_9CLOT/290-373-----------------------------------------------------------------LISYL-TA-------
J9YZ29_9PROT/278-360-----------------------------------------------------------------.INFF-TA-------
S7W5T3_SPRLO/363-450-----------------------------------------------------------------LIKFF-TA-------
R6UP56_9FIRM/283-366-----------------------------------------------------------------LCTFL-TA-------
F0S3E0_DESTD/282-365-----------------------------------------------------------------LITFF-TA-------
L0EJH8_THECK/282-365-----------------------------------------------------------------LQTYF-TA-------
W5V146_9MOLU/283-366-----------------------------------------------------------------LGTFF-TA-------
G8B8Y4_CANPC/306-389-----------------------------------------------------------------LISFY-TC-------
K3WZY0_PYTUL/274-356-----------------------------------------------------------------LQTYY-TV-------
A3M0J8_PICST/310-394-----------------------------------------------------------------LISFY-TC-------
C7RHW3_ANAPD/281-364-----------------------------------------------------------------LMSFL-TT-------
V6F6N6_9PROT/283-366-----------------------------------------------------------------LITFF-TV-------
G0NDJ2_CAEBE/301-384-----------------------------------------------------------------LEYFF-TA-------
F9ZMP0_ACICS/279-362-----------------------------------------------------------------LETYF-TA-------
B8C5C0_THAPS/279-362-----------------------------------------------------------------LQTYF-TS-------
R7DN82_9FIRM/284-367-----------------------------------------------------------------LSTFF-TV-------
D8LSE9_ECTSI/307-390-----------------------------------------------------------------LIHYF-TS-------
B0S0L2_FINM2/281-364-----------------------------------------------------------------LMSFL-TT-------
R7F2W9_9BACI/282-365-----------------------------------------------------------------LATYF-TV-------
Q54CY8_DICDI/325-409-----------------------------------------------------------------LQSYY-TA-------
K7SB96_GLUOY/280-363-----------------------------------------------------------------LRTYF-TV-------
D6GR42_FILAD/280-364-----------------------------------------------------------------LISFL-TA-------
Q7AQ18_MYCLE/273-354-----------------------------------------------------------------LQTFL-TV-------
E1QKV3_DESB2/256-338-----------------------------------------------------------------LISFF-TV-------
C1F914_ACIC5/281-364-----------------------------------------------------------------LITYF-TA-------
A5EX41_DICNV/279-362-----------------------------------------------------------------LGTYF-TA-------
A0RQ41_CAMFF/283-366-----------------------------------------------------------------LISYF-TA-------
R5ZA97_9FIRM/283-366-----------------------------------------------------------------LQTFL-TA-------
G0W5Y9_NAUDC/321-406-----------------------------------------------------------------LISFF-TC-------
C6X7S9_METGS/277-360-----------------------------------------------------------------LQTYF-TA-------
Q6F0F7_MESFL/280-363-----------------------------------------------------------------LETYF-TA-------
G7LZR1_9CLOT/281-364-----------------------------------------------------------------LMSFL-TA-------
S9XHW5_SCHCR/326-408-----------------------------------------------------------------LMHYF-TA-------
E6SJG6_THEM7/272-355-----------------------------------------------------------------LISFF-TA-------
F0RSY8_SPHGB/285-367-----------------------------------------------------------------.RTYF-TA-------
R5T189_9CLOT/282-365-----------------------------------------------------------------LATFL-TA-------
I3VVL8_THESW/279-362-----------------------------------------------------------------LITFF-TA-------
R7FLB9_9CLOT/283-366-----------------------------------------------------------------LKTFF-TV-------
D8M6E3_BLAHO/213-294-----------------------------------------------------------------LCTFY-TV-------
Q6AQ62_DESPS/281-364-----------------------------------------------------------------LQTYF-TV-------
K3W730_PYTUL/305-388-----------------------------------------------------------------LIHFF-TC-------
M4ZTG7_9FLAO/256-338-----------------------------------------------------------------LQSFF-TI-------
D0MK23_RHOM4/282-365-----------------------------------------------------------------LITFF-TV-------
F8KXZ5_PARAV/281-364-----------------------------------------------------------------LITFL-TT-------
Q1QXD4_CHRSD/279-362-----------------------------------------------------------------LQTYF-TA-------
B2A457_NATTJ/284-367-----------------------------------------------------------------LITFF-TA-------
G8YL69_PICSO/324-409-----------------------------------------------------------------LISFY-TC-------
D2VQZ2_NAEGR/269-352-----------------------------------------------------------------LITYY-TV-------
E1F5U1_GIAIA/316-399-----------------------------------------------------------------LCHFF-TC-------
Q8RDX8_FUSNN/280-363-----------------------------------------------------------------LQTYF-TA-------
Q0AXS2_SYNWW/270-353-----------------------------------------------------------------LISFF-TV-------
L0KEJ1_HALHC/281-364-----------------------------------------------------------------LITFF-TA-------
A9V629_MONBE/305-388-----------------------------------------------------------------LCYFF-TA-------
R7EYQ8_9BACT/45-128-----------------------------------------------------------------LRTYF-TA-------
E9CH21_CAPO3/369-450-----------------------------------------------------------------LQSFY-TA-------
F6CLX4_DESK7/279-362-----------------------------------------------------------------LISFF-TV-------
A0DV36_PARTE/299-382-----------------------------------------------------------------LIYFF-TA-------
C5K9C2_PERM5/306-389-----------------------------------------------------------------LIHFF-TC-------
W0RI91_9BACT/282-365-----------------------------------------------------------------LQTYF-TA-------
I0IBH8_PHYMF/287-368-----------------------------------------------------------------LSSYF-TA-------
K7RVB6_PROA4/273-355-----------------------------------------------------------------LQTFL-TA-------
R6FY26_9FIRM/281-364-----------------------------------------------------------------LISYL-TS-------
U3U9L5_9BACT/279-361-----------------------------------------------------------------LQTYF-TV-------
G8BQR8_TETPH/329-415-----------------------------------------------------------------LISYY-TC-------
I4C2Y3_DESTA/274-356-----------------------------------------------------------------.IVFF-TA-------
J3TGB2_9ENTR/278-361-----------------------------------------------------------------LQTYF-TA-------
A5CF36_ORITB/282-365-----------------------------------------------------------------LNSYF-TV-------
F4Q953_DICFS/302-377-----------------------------------------------------------------LCHFF-TC-------
A8I882_CHLRE/310-396-----------------------------------------------------------------LIYFF-TA-------
O83161_TREPA/284-367-----------------------------------------------------------------LRTFF-TA-------
L0DL94_SINAD/257-337-----------------------------------------------------------------.ITFF-TA-------
G8ZQ73_TORDC/314-399-----------------------------------------------------------------LISFY-TC-------
D2RNC2_ACIFV/285-368-----------------------------------------------------------------LQTFL-TA-------
U5H5A4_USTV1/312-395-----------------------------------------------------------------LIRYF-TC-------
E1ZJW4_CHLVA/286-368-----------------------------------------------------------------LLTYF-TT-------
E4XHS9_OIKDI/309-392-----------------------------------------------------------------LEYFF-TA-------
R5MDR3_9FIRM/280-363-----------------------------------------------------------------LISYL-TA-------
M9W913_9MOLU/280-363-----------------------------------------------------------------LQTFF-TA-------
YCHF_BUCAI/278-361-----------------------------------------------------------------LITFF-TV-------
K4L8N3_9FIRM/282-365-----------------------------------------------------------------LITFF-TA-------
R5EKF0_9CLOT/280-363-----------------------------------------------------------------LISYL-TS-------
G2LG11_CHLTF/268-351-----------------------------------------------------------------LISFL-TA-------
F7XXR9_MOREP/279-362-----------------------------------------------------------------LQTYF-TV-------
H0UXC5_CAVPO/11-94-----------------------------------------------------------------LEYFF-TA-------
O25293_HELPY/282-365-----------------------------------------------------------------LINYF-TA-------
I1CE69_RHIO9/280-363-----------------------------------------------------------------LIHYF-TC-------
W8T635_EUBAC/280-363-----------------------------------------------------------------LISFL-TA-------
R5AJL3_9BACT/283-366-----------------------------------------------------------------LQTFF-TA-------
R4XCI1_TAPDE/310-392-----------------------------------------------------------------LIYYF-TA-------
D1CD91_THET1/266-349-----------------------------------------------------------------LISFF-TV-------
B5HXP7_9ACTO/278-361-----------------------------------------------------------------LQTYL-TA-------
B1I6T3_DESAP/239-322-----------------------------------------------------------------LVTFF-TT-------
G0GFI9_SPITZ/285-368-----------------------------------------------------------------LRTFF-TA-------
F0JHI3_DESDE/253-336-----------------------------------------------------------------LISFL-TA-------
O51251_BORBU/284-367-----------------------------------------------------------------LRTYF-TA-------
D0LU81_HALO1/264-347-----------------------------------------------------------------LVSML-TA-------
W0GNM5_9MOLU/282-365-----------------------------------------------------------------LQTFF-TA-------
F6B731_DESCC/282-365-----------------------------------------------------------------LISFL-TA-------
Q6FN34_CANGA/336-421-----------------------------------------------------------------LISFY-TC-------
I0I5D3_CALAS/282-365-----------------------------------------------------------------LISFF-TA-------
Q3ZAE8_DEHM1/283-366-----------------------------------------------------------------LISFF-TV-------
U5Q2B8_9BACT/283-366-----------------------------------------------------------------LETYF-TA-------
B0TA60_HELMI/282-365-----------------------------------------------------------------LITYF-TA-------
F7YWD8_9THEM/277-359-----------------------------------------------------------------LICFL-TA-------
Q1MS23_LAWIP/282-365-----------------------------------------------------------------LISYF-TA-------
K7X980_MYCHR/283-365-----------------------------------------------------------------LANYF-TA-------
A8ESS4_ARCB4/283-366-----------------------------------------------------------------LMSYF-TA-------
Q83AN9_COXBU/283-365-----------------------------------------------------------------LITFF-TA-------
R6R1F6_9FIRM/283-366-----------------------------------------------------------------LATFF-TV-------
D4H1D1_DENA2/280-363-----------------------------------------------------------------LITFF-TA-------
A5DLV3_PICGU/110-192-----------------------------------------------------------------LISFF-TC-------
D9S1Y0_THEOJ/280-363-----------------------------------------------------------------LITFF-TA-------
D7CTW4_TRURR/277-360-----------------------------------------------------------------LLTFL-TA-------
G3AWM5_CANTC/311-398-----------------------------------------------------------------LISYF-TC-------
R5WIC9_9DELT/279-362-----------------------------------------------------------------LVSYL-TA-------
R6UK31_9CLOT/280-363-----------------------------------------------------------------LISFL-TC-------
R6P360_9FIRM/280-363-----------------------------------------------------------------LISYL-TA-------
K8EW69_CARML/282-365-----------------------------------------------------------------LATYF-TA-------
Q02B74_SOLUE/274-355-----------------------------------------------------------------LMSFL-TA-------
Q83MS1_TROWT/260-342-----------------------------------------------------------------LQTFF-TA-------
Q2LYC3_SYNAS/268-351-----------------------------------------------------------------.ISYF-TV-------
F0ZZE8_DICPU/305-387-----------------------------------------------------------------LYHFF-TC-------
K1WK47_MARBU/310-392-----------------------------------------------------------------LGSFF-TT-------
R6XEA3_9FIRM/281-364-----------------------------------------------------------------LCTFF-TA-------
B3QZQ1_PHYMT/281-364-----------------------------------------------------------------LKTYL-TA-------
C5E4G3_ZYGRC/313-398-----------------------------------------------------------------LISFF-TC-------
G0QUP8_ICHMG/271-352-----------------------------------------------------------------.HHFY-TV-------
Q2NAN6_ERYLH/282-365-----------------------------------------------------------------LQTFF-TA-------
T1JKL5_STRMM/43-119-----------------------------------------------------------------.....-.C-------
A9WPD9_RENSM/341-424-----------------------------------------------------------------LQTYL-TA-------
F2NI66_DESAR/279-361-----------------------------------------------------------------LITFY-TI-------
Q057U9_BUCCC/263-346-----------------------------------------------------------------LCTFF-TA-------
R6H5S9_9ACTN/270-353-----------------------------------------------------------------LQSYF-TS-------
I6Z8V7_MELRP/276-359-----------------------------------------------------------------LQSFF-TV-------
B0VG33_CLOAI/275-357-----------------------------------------------------------------.ISFF-TV-------
F4PFB4_BATDJ/317-399-----------------------------------------------------------------LVYFF-TG-------
R7NEX9_9MOLU/282-365-----------------------------------------------------------------LETFF-TA-------
Q01ER9_OSTTA/336-419-----------------------------------------------------------------LLTYF-TT-------
X5DSP8_9CORY/277-360-----------------------------------------------------------------LQTYL-TA-------
A1WVQ0_HALHL/279-362-----------------------------------------------------------------LQTFF-TA-------
H9UG17_SPIAZ/285-368-----------------------------------------------------------------LHTYF-TA-------
F8I0K9_WEIKK/282-365-----------------------------------------------------------------LRTFF-TA-------
L8FWM9_PSED2/310-397-----------------------------------------------------------------LQYYF-TA-------
F0Y4G9_AURAN/312-399-----------------------------------------------------------------LIYFF-TA-------
B8D1D0_HALOH/280-363-----------------------------------------------------------------LITFF-TA-------
YEAD_SCHPO/323-405-----------------------------------------------------------------LIHYF-TA-------
A5V637_SPHWW/282-365-----------------------------------------------------------------LITFF-TV-------
Q59RJ0_CANAL/313-396-----------------------------------------------------------------LISFF-TC-------
F8AD90_THEID/260-342-----------------------------------------------------------------LICFF-TG-------
Q0BPN6_GRABC/280-363-----------------------------------------------------------------LLTYF-TC-------
YCHF_BUCBP/279-361-----------------------------------------------------------------LITFF-TA-------
L0A0C6_DEIPD/281-364-----------------------------------------------------------------LITFI-TS-------
M1E5Z2_9FIRM/264-346-----------------------------------------------------------------.MTFF-TV-------
D2QKU9_SPILD/282-363-----------------------------------------------------------------LITYF-TA-------
Q73HU8_WOLPM/281-363-----------------------------------------------------------------.ITFF-TV-------
Q4DNY5_TRYCC/284-362-----------------------------------------------------------------LQSFF-TV-------
R6DY10_9FIRM/241-325-----------------------------------------------------------------LISFL-TA-------
U4L290_PYROM/309-395-----------------------------------------------------------------LIYYF-TA-------
A8F5U9_THELT/277-359-----------------------------------------------------------------LICFL-TA-------
R6P3U8_9CLOT/281-363-----------------------------------------------------------------LRTYI-TA-------
D2UZT5_NAEGR/294-377-----------------------------------------------------------------LIYYF-TA-------
B6H8T7_PENCW/307-389-----------------------------------------------------------------LGSFF-TT-------
A9CTA6_ENTBH/281-364-----------------------------------------------------------------LINYF-TV-------
Q2RFN0_MOOTA/273-356-----------------------------------------------------------------LISFL-TA-------
S5MKM8_9MOLU/281-364-----------------------------------------------------------------LKTYF-TC-------
B9L188_THERP/283-366-----------------------------------------------------------------LISFF-TV-------
Q92N65_RHIME/283-366-----------------------------------------------------------------LITYF-TV-------
R5JM46_9FIRM/281-364-----------------------------------------------------------------LISFL-TA-------
R6XQ89_9BACT/283-366-----------------------------------------------------------------LQTFF-TA-------
I7LUN5_TETTS/312-393-----------------------------------------------------------------.CHFF-TV-------
A7TEI5_VANPO/306-388-----------------------------------------------------------------LISFF-TC-------
K0AYF5_CLOA9/279-362-----------------------------------------------------------------LMSYL-TA-------
W5X0E3_BDEBC/282-365-----------------------------------------------------------------LQTYF-TA-------
I4BY84_ANAMD/281-365-----------------------------------------------------------------LITFF-TV-------
Q2S6K6_SALRD/316-399-----------------------------------------------------------------LITFF-TA-------
F4GKC3_SPICD/280-363-----------------------------------------------------------------LRTFF-TA-------
R5JB25_9FIRM/281-364-----------------------------------------------------------------LSTYL-TA-------
W1QJ12_OGAPD/294-376-----------------------------------------------------------------LISFY-TC-------
C4LSZ7_ENTHI/305-388-----------------------------------------------------------------LIHFF-TA-------
R7P7S5_9CLOT/282-365-----------------------------------------------------------------LATFF-TA-------
D1AX95_STRM9/282-365-----------------------------------------------------------------LISYF-TA-------
Q5NGZ7_FRATT/279-362-----------------------------------------------------------------LHTYL-TA-------
M4BZR8_HYAAE/232-314-----------------------------------------------------------------LQTYY-TV-------
Q099K6_STIAD/285-368-----------------------------------------------------------------LQTYF-TV-------
R7JUV4_9FIRM/281-364-----------------------------------------------------------------LMSFL-TA-------
Q8SRN9_ENCCU/277-360-----------------------------------------------------------------LINFF-TV-------
Q1ILQ1_KORVE/277-357-----------------------------------------------------------------.MSFF-TV-------
F8WJY6_MYCGA/283-366-----------------------------------------------------------------LCTFF-TC-------
E6TZX7_BACCJ/282-365-----------------------------------------------------------------LETYF-TA-------
F8E3U9_FLESM/279-362-----------------------------------------------------------------LITFF-TA-------
R7CL44_9FIRM/284-367-----------------------------------------------------------------LINFF-TV-------
V4J9W5_9DELT/60-141-----------------------------------------------------------------.ISFF-TV-------
R7GJ72_9CLOT/283-365-----------------------------------------------------------------.ATYF-TA-------
D3PR84_MEIRD/288-371-----------------------------------------------------------------LQTFF-TA-------
F0STA0_PLABD/280-362-----------------------------------------------------------------.QSYF-TA-------
V5WKG7_9SPIO/285-368-----------------------------------------------------------------LRTFF-TA-------
Q8EKV3_OCEIH/282-365-----------------------------------------------------------------LATYF-TA-------
Q4FPG8_PELUB/273-356-----------------------------------------------------------------LDTYF-TS-------
U6ILW8_HYMMI/303-386-----------------------------------------------------------------LIYFF-TA-------
R7D511_9ACTN/274-357-----------------------------------------------------------------LQSFF-TA-------
Q47Y86_COLP3/279-362-----------------------------------------------------------------LQTYF-TA-------
D1C700_SPHTD/284-367-----------------------------------------------------------------LISFF-TV-------
R7JPR2_9BACT/282-365-----------------------------------------------------------------LQTFF-TT-------
R5I0D4_9BACT/282-365-----------------------------------------------------------------LRTYF-TA-------
M5A5E8_9ACTN/278-361-----------------------------------------------------------------LRTYM-TT-------
K4IMK0_PSYTT/281-363-----------------------------------------------------------------.QTYF-TV-------
E9ADG1_LEIMA/286-363-----------------------------------------------------------------LQSFF-TV-------
E8RJ73_DESPD/281-364-----------------------------------------------------------------LITFF-TV-------
Q8IBM9_PLAF7/303-386-----------------------------------------------------------------LIHFF-TC-------
M1NEP0_DESSD/281-364-----------------------------------------------------------------LITYF-TV-------
M5EC44_MALS4/312-394-----------------------------------------------------------------LIRYF-TA-------
I4AQ11_FLELS/281-364-----------------------------------------------------------------LITYF-TA-------
H0UMJ2_9BACT/278-361-----------------------------------------------------------------LMSFL-TA-------
Q6CBV0_YARLI/356-439-----------------------------------------------------------------LISFF-TG-------
E0UT48_SULAO/282-365-----------------------------------------------------------------LMSYF-TA-------
Q75DI5_ASHGO/322-407-----------------------------------------------------------------LISFY-TC-------
G4T5T2_PIRID/309-391-----------------------------------------------------------------LIRYF-TC-------
C0Q8X2_DESAH/285-368-----------------------------------------------------------------LMTYF-TA-------
D5EJM3_CORAD/283-366-----------------------------------------------------------------LASYF-TA-------
G8PB02_PEDCP/284-367-----------------------------------------------------------------LQTFF-TA-------
F2LU33_HIPMA/279-362-----------------------------------------------------------------LITFF-TA-------
A6TS78_ALKMQ/280-363-----------------------------------------------------------------LISYL-TA-------
W0F649_9SPHI/281-364-----------------------------------------------------------------LNTYF-TA-------
R7ITH9_9CLOT/279-362-----------------------------------------------------------------LMSFL-TA-------
Q4AA46_MYCHJ/283-365-----------------------------------------------------------------LATFF-TV-------
Q7VB66_PROMA/279-362-----------------------------------------------------------------LRTYF-TT-------
A6LLV7_THEM4/271-354-----------------------------------------------------------------LISFF-TV-------
F1TJU6_COREQ/275-358-----------------------------------------------------------------LQTYL-TA-------
L7K0I6_TRAHO/268-351-----------------------------------------------------------------LINFF-TV-------
F8I4L3_SULAT/294-376-----------------------------------------------------------------.ISFL-TA-------
I1C290_RHIO9/307-390-----------------------------------------------------------------LIYFF-TG-------
E8RMK2_ASTEC/286-369-----------------------------------------------------------------LQSYF-TV-------
S0EV28_CHTCT/279-362-----------------------------------------------------------------LISFF-TV-------
G2TIG7_BACCO/282-365-----------------------------------------------------------------LATYF-TA-------
G0VR22_MEGEL/284-367-----------------------------------------------------------------LINFF-TA-------
R5Q1I6_9PROT/283-366-----------------------------------------------------------------LMTFF-TV-------
C4L007_EXISA/282-365-----------------------------------------------------------------LATYF-TA-------
C5CIW5_KOSOT/275-358-----------------------------------------------------------------LMSFL-TV-------
Q8R9F4_THETN/279-362-----------------------------------------------------------------LITFF-TA-------
C0ZA48_BREBN/282-365-----------------------------------------------------------------LVTYF-TA-------
Q24MB6_DESHY/282-365-----------------------------------------------------------------LMTYF-TA-------
W5X647_9BACT/268-349-----------------------------------------------------------------LITFF-TA-------
C5YIF5_SORBI/15-98-----------------------------------------------------------------LIYFF-TA-------
B9GJZ9_POPTR/344-427-----------------------------------------------------------------LRTYF-TS-------
A5USV6_ROSS1/276-359-----------------------------------------------------------------LISFL-TA-------
C4XI32_DESMR/285-368-----------------------------------------------------------------LLSFF-TA-------
Q9ZCV5_RICPR/281-364-----------------------------------------------------------------LKSFF-TI-------
R6G0M1_9FIRM/281-364-----------------------------------------------------------------LISYL-TA-------
F6IPG0_9SPHN/282-365-----------------------------------------------------------------LLTFF-TV-------
B1WC04_RAT/449-526-----------------------------------------------------------------.....-.N-------
Q98R45_MYCPU/285-367-----------------------------------------------------------------LETFF-TV-------
B4U7U1_HYDS0/284-367-----------------------------------------------------------------LITFF-TA-------
Q6CIM0_KLULA/319-404-----------------------------------------------------------------LISFY-TC-------
C4QXB1_PICPG/305-390-----------------------------------------------------------------LISFY-TC-------
X5H510_9RICK/246-327-----------------------------------------------------------------LIVFF-TA-------
Q8EU98_MYCPE/281-364-----------------------------------------------------------------LMTYF-TY-------
F0Y8J3_AURAN/372-454-----------------------------------------------------------------LILLF-TC-------
I2EVP1_EMTOG/283-366-----------------------------------------------------------------LRTYF-TA-------
D5MEU1_9BACT/276-358-----------------------------------------------------------------.MTFF-TV-------
K0K9D8_WICCF/316-401-----------------------------------------------------------------LISFY-TV-------
G0V8L9_NAUCC/321-406-----------------------------------------------------------------LISFF-TC-------
H6LAU8_SAPGL/283-366-----------------------------------------------------------------LITYF-TA-------
W6AB65_9MOLU/281-364-----------------------------------------------------------------LQTFF-TV-------
D5GNQ9_TUBMM/307-389-----------------------------------------------------------------LISFF-TT-------
Q12R18_SHEDO/279-362-----------------------------------------------------------------LQTYF-TA-------
E9C9A1_CAPO3/302-385-----------------------------------------------------------------LEYFF-TA-------
G7V7D7_THELD/279-363-----------------------------------------------------------------LISFF-TV-------
I7MIE8_TETTS/291-374-----------------------------------------------------------------LIYFF-TA-------
A9KM89_CLOPH/281-364-----------------------------------------------------------------LISYL-TA-------
Q1ATZ1_RUBXD/285-368-----------------------------------------------------------------LITFF-TF-------
E6W1V2_DESIS/283-366-----------------------------------------------------------------LITYF-TA-------
Q7VR78_BLOFL/264-346-----------------------------------------------------------------LNTFF-TT-------
K2SLS5_MACPH/307-388-----------------------------------------------------------------LASFF-TT-------
K1R8Y1_CRAGI/317-400-----------------------------------------------------------------LQYFF-TS-------
G7US16_PSEUP/279-362-----------------------------------------------------------------LQTYF-TA-------
A1AXW6_RUTMC/279-361-----------------------------------------------------------------LQTYF-TA-------
F8C387_THEGP/284-367-----------------------------------------------------------------LITFF-TT-------
R7IIC0_9BURK/280-363-----------------------------------------------------------------LQTFF-TS-------
Q6YR35_ONYPE/279-362-----------------------------------------------------------------LQTYF-TA-------
D9R4H6_CLOSW/281-364-----------------------------------------------------------------LISYL-TA-------
B2IY39_NOSP7/279-362-----------------------------------------------------------------LRTYF-TC-------
R7JA46_9PORP/283-366-----------------------------------------------------------------LQTFL-TA-------
A5E7H7_LODEL/320-403-----------------------------------------------------------------LISFY-TC-------
F0YE04_AURAN/314-397-----------------------------------------------------------------LITYY-TS-------
D8K232_DEHLB/277-360-----------------------------------------------------------------LISFF-TV-------
D3SNA0_THEAH/284-367-----------------------------------------------------------------LITFF-TA-------
B1GZF3_UNCTG/279-362-----------------------------------------------------------------LATFL-TA-------
K0TBD2_THAOC/427-514-----------------------------------------------------------------LQSFY-TA-------
R5FVU8_9FIRM/281-364-----------------------------------------------------------------LATFF-TA-------
A8L199_FRASN/274-357-----------------------------------------------------------------LQTYL-TA-------
H1XTJ5_9BACT/275-358-----------------------------------------------------------------LISFF-TV-------
D5C3Z3_NITHN/278-361-----------------------------------------------------------------LQTFF-TA-------
B5Y9Z6_COPPD/260-342-----------------------------------------------------------------LQSFL-TA-------
D1J7J3_MYCHP/285-365-----------------------------------------------------------------..TYF-TA-------
R5ZSG0_9CLOT/285-367-----------------------------------------------------------------LRTFF-TG-------
I0GU95_SELRL/284-367-----------------------------------------------------------------LQTFL-TA-------
K0P6D0_9BACT/281-364-----------------------------------------------------------------LITYF-TV-------
D8TM54_VOLCA/282-365-----------------------------------------------------------------LQTYF-TT-------
Q586V0_TRYB2/283-360-----------------------------------------------------------------LQSFF-TI-------
G3USV4_MELGA/294-380-----------------------------------------------------------------LEYFF-TA-------
G2ISN5_9SPHN/282-363-----------------------------------------------------------------LITFF-TV-------
D5BP00_PUNMI/282-365-----------------------------------------------------------------LLTFF-TV-------
Q9PPP4_UREPA/282-365-----------------------------------------------------------------LKTYF-TY-------
I3EES6_NEMP3/291-373-----------------------------------------------------------------LITFF-TC-------
I0GIA8_CALEA/261-345-----------------------------------------------------------------LDVFY-TV-------
T0TPT9_9STRE/294-377-----------------------------------------------------------------LGTYF-TA-------
Q6MD73_PARUW/282-363-----------------------------------------------------------------LLTYL-TT-------
C5J6P9_MYCCR/300-382-----------------------------------------------------------------LSTFF-TA-------
C9RBT8_AMMDK/275-357-----------------------------------------------------------------LISFF-TV-------
Q1LTH0_BAUCH/272-355-----------------------------------------------------------------LQTYF-TA-------
F9VKM6_ARTSS/280-363-----------------------------------------------------------------LISYL-TA-------
D6Z0J3_DESAT/280-363-----------------------------------------------------------------LITYF-TV-------
K9YDF5_HALP7/279-362-----------------------------------------------------------------LRTYL-TT-------
A8ZSN9_DESOH/253-336-----------------------------------------------------------------LISFF-TV-------
Q6KH43_MYCMO/282-364-----------------------------------------------------------------LRTYF-TA-------
S5R8D6_9PROT/279-362-----------------------------------------------------------------LRTYF-TV-------
R6IVH6_9PROT/286-369-----------------------------------------------------------------LQTYF-TC-------
R5VWF7_9FIRM/283-366-----------------------------------------------------------------LETFY-TS-------
Q7V0W4_PROMP/279-362-----------------------------------------------------------------LKTYF-TT-------
Q0C0W8_HYPNA/281-364-----------------------------------------------------------------LQTYF-TA-------
F4BRI6_CARS1/282-365-----------------------------------------------------------------LGTYF-TA-------
B6YQR1_AZOPC/283-365-----------------------------------------------------------------LETFL-TV-------
B7J503_ACIF2/279-362-----------------------------------------------------------------LQTYF-TA-------
Q7NGD8_GLOVI/280-363-----------------------------------------------------------------LQTFF-TA-------
M7X6R9_RHOT1/406-488-----------------------------------------------------------------LIHYF-TC-------
Q5LV85_RUEPO/281-364-----------------------------------------------------------------LETYF-TV-------
B2KB10_ELUMP/272-356-----------------------------------------------------------------LCTYF-TA-------
E7LV53_YEASV/148-233-----------------------------------------------------------------LISFF-TC-------
Q8F3S1_LEPIN/281-364-----------------------------------------------------------------LITFF-TA-------
I3THA7_TISMK/282-365-----------------------------------------------------------------LLTFF-TV-------
E6K1G8_PARDN/277-360-----------------------------------------------------------------LQTFL-TA-------
B8DPA4_DESVM/282-365-----------------------------------------------------------------LASYF-TV-------
B2GF26_LACF3/281-364-----------------------------------------------------------------LETFF-TA-------
Q2GHV2_EHRCR/279-361-----------------------------------------------------------------.ITFF-TL-------
J3VS97_9ENTR/279-362-----------------------------------------------------------------LQTFF-TA-------
A5I1T1_CLOBH/281-364-----------------------------------------------------------------LISFL-TA-------
F7WZ63_9ENTR/278-362-----------------------------------------------------------------LITFF-TA-------
B6AI40_CRYMR/306-389-----------------------------------------------------------------LLHYF-TA-------
B3DWJ0_METI4/284-367-----------------------------------------------------------------LRSFF-TT-------
L0RUS0_MYCC1/282-364-----------------------------------------------------------------LETYF-TA-------
M7NKX8_PNEMU/820-902-----------------------------------------------------------------LMHYF-TC-------
E0TD90_PARBH/281-363-----------------------------------------------------------------LQTYF-TA-------
F4PR24_DICFS/337-421-----------------------------------------------------------------LQSYY-TA-------
C9RM43_FIBSS/281-364-----------------------------------------------------------------LRTFF-TA-------
D2R7G2_PIRSD/279-362-----------------------------------------------------------------LQSYF-TA-------
E8R3Q6_ISOPI/259-341-----------------------------------------------------------------.ISFF-TA-------
H6LK20_ACEWD/281-364-----------------------------------------------------------------LITFL-TA-------
R6TJH4_9FIRM/285-368-----------------------------------------------------------------LISFL-TY-------
R7G3P5_9PROT/281-364-----------------------------------------------------------------LISFL-TS-------
B2UNH1_AKKM8/289-372-----------------------------------------------------------------LRTYL-TT-------
A9EY40_SORC5/279-362-----------------------------------------------------------------LQSYY-TA-------
R5LDY5_9SPIR/282-365-----------------------------------------------------------------LITFL-TS-------
Q8D2K3_WIGBR/273-356-----------------------------------------------------------------LKTFF-SV-------
C6XPG7_HIRBI/283-366-----------------------------------------------------------------LQTYF-TC-------
F8L9T8_SIMNZ/282-363-----------------------------------------------------------------LITFL-TT-------
R5YFW0_9MOLU/281-364-----------------------------------------------------------------LKTYF-TC-------
D1B915_THEAS/278-362-----------------------------------------------------------------LISFF-TC-------
I4YEH6_WALSC/321-404-----------------------------------------------------------------LIRYF-TC-------
E8MZE8_ANATU/272-355-----------------------------------------------------------------LQSFF-TV-------
Q03ZA0_LEUMM/282-365-----------------------------------------------------------------LRTFF-TA-------
Q9X0W7_THEMA/273-355-----------------------------------------------------------------LIRFL-TA-------

PF02824

DRG1_ARATH/290-366-----------------------------------------------------------------VRVYSKPQ-------
SYT2_BACSU/5-64-----------------------------------------------------------------VHIQL.PD-------
RELA_BACSU/394-453-----------------------------------------------------------------VYVFT.PK-------
Q9YA87_AERPE/316-388-----------------------------------------------------------------VRVYTKQP-------
RELA_CORGL/420-479-----------------------------------------------------------------IFVFT.PK-------
SYTC_SCHPO/49-109-----------------------------------------------------------------IDITL.PD-------
SYTC_HUMAN/83-143-----------------------------------------------------------------IKVTL.PD-------
SYT_DEIRA/1-60-----------------------------------------------------------------MHVTL.PD-------
Q9WZI8_THEMA/437-496-----------------------------------------------------------------VFVFT.PK-------
SYT1_BACSU/5-64-----------------------------------------------------------------VKITF.PD-------
RELA_STRCO/505-564-----------------------------------------------------------------VFVFT.PK-------
128UP_DROME/292-366-----------------------------------------------------------------QRIYTKPK-------
DRG1_HUMAN/292-366-----------------------------------------------------------------VRIYTKPK-------
SYTC_YEAST/75-135-----------------------------------------------------------------LKIVL.KD-------
Y1332_METJA/331-390-----------------------------------------------------------------QGNVL.PD-------
O27559_METTH/338-397-----------------------------------------------------------------KGNVL.PD-------
Y1111_HALSA/295-368-----------------------------------------------------------------IRIYMDKP-------
RBG2_YEAST/294-367-----------------------------------------------------------------SRVYTKKR-------
YFY7_SCHPO/291-365-----------------------------------------------------------------VRVYTRPR-------
SYT_THEMA/3-59-----------------------------------------------------------------IKVKL.PD-------
DRG2_MOUSE/290-363-----------------------------------------------------------------TCIYTKKR-------
SYT_RICPR/2-61-----------------------------------------------------------------INISF.PD-------
Q9RTC7_DEIRA/456-515-----------------------------------------------------------------VWVFT.PK-------
SYTM_ARATH/75-135-----------------------------------------------------------------IKVTL.PD-------
Q9VDV2_DROME/289-362-----------------------------------------------------------------IRVYTKKP-------
Y1326_METJA/316-389-----------------------------------------------------------------IKIYLKPQ-------
SPOT_SYNY3/423-482-----------------------------------------------------------------VYVFT.PK-------
RBG1_YEAST/294-368-----------------------------------------------------------------VRIYTKPK-------
O27658_METTH/305-378-----------------------------------------------------------------IRIYLKPQ-------
SYTC_CAEEL/82-142-----------------------------------------------------------------IQITL.PD-------
Q9YCU8_AERPE/346-405-----------------------------------------------------------------EGRIL.PD-------
SYT_THET8/1-60-----------------------------------------------------------------MTVYL.PD-------
SYT_CHLTR/1-58-----------------------------------------------------------------MIHVT.CN-------
O28136_ARCFU/282-355-----------------------------------------------------------------IRVYLKPP-------
GTP1_SCHPO/289-363-----------------------------------------------------------------YRIYTKRK-------
YKK3_CAEEL/290-365-----------------------------------------------------------------VRVYTKKP-------
SPOT_AQUAE/387-446-----------------------------------------------------------------VFVFT.PK-------
SPOT_HAEIN/362-421-----------------------------------------------------------------IYVFT.PK-------
SPOT_BORBU/403-462-----------------------------------------------------------------IYVYT.PE-------
SYT_HAEIN/2-61-----------------------------------------------------------------PIITL.PD-------
DRG3_ARATH/293-367-----------------------------------------------------------------TRIYTKPK-------
O69970_STRCO/446-505-----------------------------------------------------------------ITVFR.PD-------
O28907_ARCFU/326-385-----------------------------------------------------------------KGNVL.PD-------
D5C946_ENTCC/405-464-----------------------------------------------------------------VYVFT.PK-------
F4JHA4_ARATH/566-625-----------------------------------------------------------------VFVFT.PK-------
H2IYA3_RAHAC/388-447-----------------------------------------------------------------IYVFT.PE-------
H3ZMI2_THELN/314-385-----------------------------------------------------------------IRVFTKSP-------
I1MJZ5_SOYBN/290-366-----------------------------------------------------------------VRVYTKPQ-------
O25466_HELPY/418-477-----------------------------------------------------------------IVVFS.PH-------
SYT_ECOLI/4-61-----------------------------------------------------------------..ITL.PD-------
Q1D7G8_MYXXD/404-463-----------------------------------------------------------------VFVFT.PK-------
Q2FXU1_STAA8/395-454-----------------------------------------------------------------VYAFT.PA-------
Q741P2_MYCPA/450-509-----------------------------------------------------------------IFVFT.PK-------
Q7LXL0_SULSO/345-401-----------------------------------------------------------------..NVL.PD-------
Q9HI56_THEAC/285-357-----------------------------------------------------------------IRIYLRNK-------
R4UJ80_9MOLU/409-468-----------------------------------------------------------------VYVLT.PN-------
T0TBD7_9STRE/395-454-----------------------------------------------------------------IYVFT.PT-------

PF03658

E5AR18_BURRH/17-99-----------------------------------------------------------------IEVQV-CY-------
M5DTB5_9GAMM/5-89-----------------------------------------------------------------IQVEV-AY-------
L0E0Q0_THIND/13-95-----------------------------------------------------------------ISVEV-AY-------
U5T367_9GAMM/13-95-----------------------------------------------------------------MNVEV-VY-------
Q2Y9R7_NITMU/8-90-----------------------------------------------------------------IDIEV-VY-------
Y850_VIBCH/6-88-----------------------------------------------------------------IHVEV-VY-------
Q5NFP6_FRATT/1-83-----------------------------------------------------------------MKIEV-IY-------
RNFH_BURXL/6-87-----------------------------------------------------------------.SIEV-CY-------
C7RLY3_ACCPU/5-87-----------------------------------------------------------------ITVEV-VY-------
K4KND4_SIMAS/7-96-----------------------------------------------------------------IRVEV-AY-------
RNFH_PSEHT/2-84-----------------------------------------------------------------IDVEV-VF-------
L0GTI6_9GAMM/1-80-----------------------------------------------------------------MHIGV-AY-------
Q0A7D6_ALKEH/6-89-----------------------------------------------------------------MTVEV-AY-------
A3QCE2_SHELP/8-89-----------------------------------------------------------------.AVEV-IY-------
D3RPX7_ALLVD/1-83-----------------------------------------------------------------MLVGV-AY-------
F6AE55_PSEF1/6-90-----------------------------------------------------------------LSVEV-VF-------
I3YE52_THIV6/1-83-----------------------------------------------------------------MHIGV-AY-------
Q5NLH8_ZYMMO/1-83-----------------------------------------------------------------MKISV-AY-------
C6WVC1_METML/7-89-----------------------------------------------------------------ITVEV-AY-------
F9ZZ10_METMM/1-83-----------------------------------------------------------------MNVGV-CY-------
B8GNW4_THISH/12-94-----------------------------------------------------------------MTVEV-AY-------
I3UC04_ADVKW/6-89-----------------------------------------------------------------MTITI-CY-------
X4YVS6_9BORD/5-87-----------------------------------------------------------------LRVTV-CH-------
M1S836_MORMO/4-86-----------------------------------------------------------------ISVEV-CY-------
RNFH_PROMH/4-86-----------------------------------------------------------------IWVEV-AY-------
I0HTV1_RUBGI/1-83-----------------------------------------------------------------MRVEL-VY-------
G0A3A9_METMM/6-88-----------------------------------------------------------------IAVEV-AY-------
L0GZM4_9GAMM/6-88-----------------------------------------------------------------IKVEV-AY-------
Q21W45_ALBFT/7-90-----------------------------------------------------------------LQITV-VY-------
RNFH_PSEMY/6-90-----------------------------------------------------------------IAIEV-VY-------
H8L5G4_FRAAD/6-88-----------------------------------------------------------------LRIEV-AY-------
H0PTJ3_9RHOO/7-90-----------------------------------------------------------------INVEV-VY-------
S5R8P5_9PROT/5-84-----------------------------------------------------------------IYVQI-CY-------
A1VNT4_POLNA/13-96-----------------------------------------------------------------LKITL-VY-------
C4KA01_THASP/5-88-----------------------------------------------------------------INVEV-VY-------
RATB_ECOLI/5-87-----------------------------------------------------------------IAVEV-AY-------
Q1H276_METFK/6-87-----------------------------------------------------------------.SIEV-AY-------
B2UBC6_RALPJ/10-91-----------------------------------------------------------------IDVMV-CL-------
Q3SI26_THIDA/3-85-----------------------------------------------------------------LNVEV-VY-------
I1YEL1_METFJ/9-91-----------------------------------------------------------------MTVEV-AY-------
D3HPP7_LEGLN/2-83-----------------------------------------------------------------IKVEV-VY-------
Q085W6_SHEFN/9-90-----------------------------------------------------------------.SVDV-IY-------
Q5E3A1_VIBF1/8-90-----------------------------------------------------------------IHVEV-VY-------
RNFH_AZOVD/1-83-----------------------------------------------------------------MRVSV-VY-------
RNFH_TOLAT/5-87-----------------------------------------------------------------IQIEV-VY-------
A0KI82_AERHH/5-87-----------------------------------------------------------------LNIEV-VY-------
F2K845_PSEBN/2-86-----------------------------------------------------------------IEIEV-VY-------
D5CPG1_SIDLE/1-82-----------------------------------------------------------------MQIGV-AY-------
Q7VYA6_BORPE/2-81-----------------------------------------------------------------...TV-CH-------
Y234_BUCBP/2-78-----------------------------------------------------------------ITITI-VY-------
E3HTN3_ACHXA/10-92-----------------------------------------------------------------IGVSV-CY-------
RNFH_ERWT9/4-86-----------------------------------------------------------------IAIEV-VY-------
D7DHI7_METV0/6-88-----------------------------------------------------------------MIVEV-AY-------
C5BQH3_TERTT/7-96-----------------------------------------------------------------ISVEV-AY-------
Q47XI0_COLP3/21-102-----------------------------------------------------------------.TIEV-VY-------
W0DUM3_9GAMM/11-91-----------------------------------------------------------------MLVEV-AY-------
W8KKU5_HALHR/1-83-----------------------------------------------------------------MRVGV-AY-------
RNFH_PSYIN/5-87-----------------------------------------------------------------IEIEV-VY-------
G0AB63_COLFT/18-100-----------------------------------------------------------------IQIQV-CY-------
B8F4V6_HAEPS/8-90-----------------------------------------------------------------IVVEV-IY-------
Q6FDQ4_ACIAD/6-85-----------------------------------------------------------------.NVWV-AY-------
Q12AT5_POLSJ/1-84-----------------------------------------------------------------MKIWL-VY-------
Q2L133_BORA1/5-87-----------------------------------------------------------------LRVTV-CF-------
D5ARZ5_RHOCB/1-83-----------------------------------------------------------------MIVGV-AY-------
A5WGN6_PSYWF/19-107-----------------------------------------------------------------A....-..-------
RNFH_PSEF5/6-90-----------------------------------------------------------------ISIEV-AY-------
Q1LND5_RALME/15-96-----------------------------------------------------------------.RLSV-CY-------
W0E312_MARPU/1-83-----------------------------------------------------------------MRIGV-AY-------
C5BAL1_EDWI9/1-83-----------------------------------------------------------------MSIEV-VY-------
A1TSJ2_ACIAC/16-92-----------------------------------------------------------------.AVTV-AW-------
G9AMP8_PANAN/4-86-----------------------------------------------------------------ISVEV-VY-------
B8CKP1_SHEPW/9-90-----------------------------------------------------------------.TVEI-IY-------
V5ULJ6_9BURK/6-87-----------------------------------------------------------------.HVEV-CY-------
K0I5X7_9BURK/13-90-----------------------------------------------------------------.AITV-VA-------
C6XD50_METGS/7-89-----------------------------------------------------------------ILVEV-AY-------
RNFH_METCA/1-83-----------------------------------------------------------------MNVGV-CY-------
RNFH_HAHCH/6-89-----------------------------------------------------------------IQVEV-AY-------
B2FMX7_STRMK/2-79-----------------------------------------------------------------IEVEV-VL-------
Q6LUB2_PHOPR/8-90-----------------------------------------------------------------IHVEV-VY-------
B3PF46_CELJU/7-96-----------------------------------------------------------------ITVEV-AY-------
B1Y227_LEPCP/11-95-----------------------------------------------------------------...TV-VA-------
G8M860_9BURK/2-85-----------------------------------------------------------------MQIDV-CY-------
Q5QW49_IDILO/10-91-----------------------------------------------------------------.TIEV-AY-------
Y4512_PSESM/6-90-----------------------------------------------------------------IQIEV-VY-------
W0E0J7_MARPU/5-87-----------------------------------------------------------------LQVSV-AY-------
E6WTK4_PSEUU/1-78-----------------------------------------------------------------MRVEV-VI-------
E1SSV5_FERBD/5-87-----------------------------------------------------------------MQVEV-VY-------
M1FM03_9ALTE/3-86-----------------------------------------------------------------IRIEV-AY-------
V4J5I6_9GAMM/1-83-----------------------------------------------------------------MHIGV-AY-------
F8GED8_NITSI/6-87-----------------------------------------------------------------.QVEI-VY-------
RNFH_PSEA6/6-88-----------------------------------------------------------------INLEV-AY-------
L0B5B2_9PROT/10-92-----------------------------------------------------------------INITI-VY-------
I1XKS4_METNJ/9-91-----------------------------------------------------------------ITVEV-AY-------
G4QHA1_GLANF/5-87-----------------------------------------------------------------INIEV-VY-------
F4HCN9_GALAU/4-86-----------------------------------------------------------------ISVEI-AY-------
RNFH_ALCBS/6-90-----------------------------------------------------------------IHVEV-VY-------
Q21H31_SACD2/7-96-----------------------------------------------------------------ISVEV-AY-------
Y166_PASMU/4-86-----------------------------------------------------------------IKIEI-AY-------
I3Y7K1_THIV6/6-88-----------------------------------------------------------------LHVSV-AY-------
Q5P533_AROAE/3-85-----------------------------------------------------------------MKIGV-AY-------
A2SG91_METPP/10-92-----------------------------------------------------------------.RVEV-AY-------
W8WY01_CASDE/1-83-----------------------------------------------------------------MRVHI-AF-------
E0SB11_DICD3/4-86-----------------------------------------------------------------IRVEV-VY-------
W0LA05_SERFO/4-86-----------------------------------------------------------------IQVEV-VY-------
H5WIL6_9BURK/8-91-----------------------------------------------------------------IRVEV-VF-------
F4GS42_PUSST/5-87-----------------------------------------------------------------ISIEV-VY-------
X2H0C2_9GAMM/4-83-----------------------------------------------------------------..IQI-VY-------
RNFH_ACTSZ/4-86-----------------------------------------------------------------INIEI-AY-------
A5EXZ3_DICNV/4-86-----------------------------------------------------------------INVEI-VY-------
W8U6C4_YEREN/4-86-----------------------------------------------------------------IRVEV-VY-------
H2J085_RAHAC/4-86-----------------------------------------------------------------IRVEV-VY-------
S6AAF8_9PROT/1-83-----------------------------------------------------------------MKISV-AY-------
D9SGG9_GALCS/5-87-----------------------------------------------------------------INIEI-VY-------
Q47DK5_DECAR/5-87-----------------------------------------------------------------LNIEV-CY-------
F5XXS5_RAMTT/9-91-----------------------------------------------------------------.TVTV-AY-------
D0L0Y6_HALNC/11-93-----------------------------------------------------------------IEVEV-AY-------
Q4FV25_PSYA2/33-129-----------------------------------------------------------------ITVYL-AY-------
E4PPI0_MARAH/2-85-----------------------------------------------------------------MQVEV-AY-------
Q5ZYK1_LEGPH/2-83-----------------------------------------------------------------VKVEL-VY-------
K0C2E1_CYCSP/3-84-----------------------------------------------------------------.NVEV-AY-------
Y796_NEIMB/2-84-----------------------------------------------------------------LEIEI-VY-------
Q8PAL5_XANCP/1-78-----------------------------------------------------------------MRVEV-IV-------
Q5NYE2_AROAE/5-88-----------------------------------------------------------------INVEV-TY-------
Y1828_HAEDU/8-90-----------------------------------------------------------------IVVEI-IY-------
A4G4U3_HERAR/12-94-----------------------------------------------------------------IHIQI-CY-------
G2IZ07_PSEUL/5-87-----------------------------------------------------------------IQIEV-TY-------
X2H4Y7_9NEIS/4-86-----------------------------------------------------------------IIVEA-VY-------
H0PV88_9RHOO/1-83-----------------------------------------------------------------MKIGI-AY-------
D5WYV7_THIK1/3-85-----------------------------------------------------------------.NIAV-FY-------
C7R6J7_KANKD/7-89-----------------------------------------------------------------ITVEV-CY-------
M4U771_9GAMM/5-87-----------------------------------------------------------------IDIEV-VY-------
D5BY77_NITHN/2-84-----------------------------------------------------------------ITVEV-AY-------
Q63T36_BURPS/3-84-----------------------------------------------------------------.KVQV-CY-------
B4EC76_BURCJ/3-84-----------------------------------------------------------------.SIEV-CY-------
A1WPQ1_VEREI/18-107-----------------------------------------------------------------.QVTV-VL-------
Y3462_CHRVO/5-87-----------------------------------------------------------------LSVEV-AY-------
D8IU41_HERSS/7-89-----------------------------------------------------------------LQVQL-CY-------
C7RRB2_ACCPU/1-83-----------------------------------------------------------------MQVGV-AY-------
F5Z797_ALTSS/6-88-----------------------------------------------------------------MHIEV-AY-------
Q82X67_NITEU/10-92-----------------------------------------------------------------ITIEV-AF-------
Q6D8Y3_PECAS/1-83-----------------------------------------------------------------MQVDV-VY-------
D5CSC8_SIDLE/6-88-----------------------------------------------------------------IDVEL-VY-------
S6BII7_9GAMM/6-88-----------------------------------------------------------------IAVEV-AY-------
E1VM45_9GAMM/1-85-----------------------------------------------------------------MDIEV-AY-------
K0CKL9_ALCDB/5-89-----------------------------------------------------------------IRVEV-VY-------
A9INN7_BORPD/9-90-----------------------------------------------------------------..VCV-CH-------
Y1475_SHEON/10-90-----------------------------------------------------------------..VDV-IY-------
Q0KA38_CUPNH/12-93-----------------------------------------------------------------.HIAV-CY-------
E6WFL4_PANSA/4-86-----------------------------------------------------------------MTVEV-VY-------
RNFH_MAGSA/1-83-----------------------------------------------------------------MKIGV-VY-------
C4L9I0_TOLAT/1-83-----------------------------------------------------------------MKISV-AH-------
Y253_BUCAI/4-86-----------------------------------------------------------------IKVTV-VY-------
H8GJC1_METAL/13-93-----------------------------------------------------------------..VDV-AY-------
A6W2D7_MARMS/1-85-----------------------------------------------------------------MRVEV-AY-------
S6BNN8_PSERE/6-90-----------------------------------------------------------------IAVEV-VY-------
M4NH40_9GAMM/6-88-----------------------------------------------------------------IRVEV-VY-------
U3U649_9BACT/4-86-----------------------------------------------------------------ITVEV-IY-------
H2FST8_OCESG/4-86-----------------------------------------------------------------IQVEV-VY-------
D3RMP7_ALLVD/5-87-----------------------------------------------------------------LQISV-AY-------
Q1QSW5_CHRSD/6-92-----------------------------------------------------------------IEVEV-AY-------
C4KB18_THASP/1-82-----------------------------------------------------------------MKISV-SY-------
A0L9F7_MAGSM/1-83-----------------------------------------------------------------MRVAV-TY-------
D2UAW5_XANAP/1-78-----------------------------------------------------------------MQIEV-VL-------
A1AXM6_RUTMC/1-83-----------------------------------------------------------------MQIEV-AY-------
D3SC43_THISK/17-99-----------------------------------------------------------------IRIEV-AY-------
I2B6A6_SHIBC/2-79-----------------------------------------------------------------I....-.Y-------
W0B658_9GAMM/2-83-----------------------------------------------------------------VKVEI-VY-------
Y395_HAEIN/4-86-----------------------------------------------------------------INIEI-AY-------
Q47FY6_DECAR/1-83-----------------------------------------------------------------MQIGV-AY-------
Q1LSR8_BAUCH/22-102-----------------------------------------------------------------IIVKV-VY-------
A1K5U0_AZOSB/7-90-----------------------------------------------------------------IHVEV-VY-------
I3Y587_THIV6/1-81-----------------------------------------------------------------MKVSI-VY-------
G8QPC2_AZOSU/5-87-----------------------------------------------------------------INVEV-VY-------
E1VAU9_HALED/2-88-----------------------------------------------------------------VHVEV-AF-------
G4T3F4_META2/6-88-----------------------------------------------------------------IRVEV-AY-------
Y1303_COXBU/2-83-----------------------------------------------------------------ISIII-AY-------
C5AEX8_BURGB/3-84-----------------------------------------------------------------.AVQV-CY-------
RNFH_HALHL/8-89-----------------------------------------------------------------.GIEV-VY-------
D3VLH2_XENNA/4-86-----------------------------------------------------------------INIEV-VY-------
Q12PU9_SHEDO/9-90-----------------------------------------------------------------.EVDV-VY-------
F2GB67_ALTMD/6-88-----------------------------------------------------------------INIEV-AY-------
M9X4G7_PASHA/29-111-----------------------------------------------------------------INVEV-LY-------
A1S884_SHEAM/10-90-----------------------------------------------------------------..VDV-VY-------
D8MVV3_ERWBE/4-86-----------------------------------------------------------------IAVEV-VY-------
G7UVA3_PSEUP/1-78-----------------------------------------------------------------MKIEV-VL-------
S6AGG4_9PROT/2-81-----------------------------------------------------------------...EV-AY-------
K6ZX54_9ALTE/6-88-----------------------------------------------------------------ISLEV-VY-------
Q31FS1_THICR/1-81-----------------------------------------------------------------MKIEV-AY-------
RNFH_BURP8/6-87-----------------------------------------------------------------.TVQV-CY-------
M4X3E7_PSEDE/7-91-----------------------------------------------------------------IAIEV-VY-------
A3MYY0_ACTP2/7-89-----------------------------------------------------------------IEVEV-LF-------
V4IZ77_9GAMM/6-88-----------------------------------------------------------------IHVEV-AY-------
F2K0E2_MARM1/4-88-----------------------------------------------------------------MHVEV-AY-------
RNFH_LARHH/7-89-----------------------------------------------------------------ISVEV-AY-------

PF07715

Q8E8C4_SHEON/58-157-----------------------------------------------------------------DLMDT-PQ-------
Q8E8X7_SHEON/49-160-----------------------------------------------------------------QVRDA-PA-------
Q8ECU0_SHEON/79-182-----------------------------------------------------------------SYLET-PQ-------
FCT_DICD3/78-182-----------------------------------------------------------------PLIKT-PQ-------
Q8EXD4_LEPIN/153-260-----------------------------------------------------------------EKEKQ-LM-------
Q8F194_LEPIN/126-228-----------------------------------------------------------------LQRKS-GV-------
Q8F6F1_LEPIN/52-159-----------------------------------------------------------------NFRSN-PS-------
Q8F8I4_LEPIN/202-315-----------------------------------------------------------------TNLNS-A.-------
Q7CTM1_AGRT5/59-169-----------------------------------------------------------------NVKDA-PA-------
Q7CT31_AGRT5/152-260-----------------------------------------------------------------TLAST-SS-------
O25395_HELPY/45-160-----------------------------------------------------------------EVRNY-MG-------
O25487_HELPY/58-173-----------------------------------------------------------------EMRNS-TS-------
O25543_HELPY/31-142-----------------------------------------------------------------KVTTQ-AK-------
O25574_HELPY/57-162-----------------------------------------------------------------AKIFN-YN-------
O25950_HELPY/64-179-----------------------------------------------------------------EVKKY-TG-------
O26042_HELPY/37-141-----------------------------------------------------------------RTFEY-NN-------
O66812_AQUAE/22-129-----------------------------------------------------------------EEIQV-IG-------
TDHA_HAEDU/39-144-----------------------------------------------------------------HHERQ-P.-------
FEPA_ECOLI/43-163-----------------------------------------------------------------QNLQA-P.-------
FECA_ECOLI/129-244-----------------------------------------------------------------DVFEH-AG-------
FHUE_ECOLI/74-177-----------------------------------------------------------------TQRDI-PQ-------
CIRA_ECOLI/43-152-----------------------------------------------------------------NLKDA-PA-------
FPTA_PSEAE/75-175-----------------------------------------------------------------KPREL-PQ-------
TDHA_HAEIN/46-151-----------------------------------------------------------------DSNKL-P.-------
HXUC1_HAEIN/37-141-----------------------------------------------------------------PSRFA-YT-------
HGP1_HAEIN/75-194-----------------------------------------------------------------NVKEK-KV-------
TBPA_HAEIN/64-182-----------------------------------------------------------------DNEVT-GL-------
Y1217_HAEIN/46-159-----------------------------------------------------------------KPFTE-AK-------
Y1369_HAEIN/80-211-----------------------------------------------------------------DNNKS-LS-------
Y1466_HAEIN/62-161-----------------------------------------------------------------PVFDT-PN-------
FYUA_YERPE/43-149-----------------------------------------------------------------SASAN-NV-------
FPVA_PSEAE/161-265-----------------------------------------------------------------TPRET-PQ-------
P72594_SYNY3/185-289-----------------------------------------------------------------EIANI-PR-------
P72599_SYNY3/217-321-----------------------------------------------------------------PIMDT-PF-------
P72602_SYNY3/190-290-----------------------------------------------------------------PLLDI-PQ-------
P72609_SYNY3/218-317-----------------------------------------------------------------PLRDI-PQ-------
FIU_ECOLI/67-169-----------------------------------------------------------------PVADT-TR-------
YNCD_ECOLI/39-151-----------------------------------------------------------------SELDT-PA-------
BFRD_BORPE/62-162-----------------------------------------------------------------PLADT-PR-------
VIUA_VIBCH/62-178-----------------------------------------------------------------SIYET-SA-------
HGBA_HAEDU/38-161-----------------------------------------------------------------SEDDS-VH-------
FOXA_SALTY/55-162-----------------------------------------------------------------PDIET-PQ-------
HGP4_HAEIN/70-189-----------------------------------------------------------------DNTPP-KI-------
Q7M8J9_WOLSU/43-150-----------------------------------------------------------------NLQEV-PL-------
Q7M8T8_WOLSU/144-247-----------------------------------------------------------------SARDT-PQ-------
Q7M930_WOLSU/57-169-----------------------------------------------------------------ELGEG-EE-------
Q7M977_WOLSU/36-141-----------------------------------------------------------------DISKN-P.-------
Q7M9D6_WOLSU/46-150-----------------------------------------------------------------TVYTG-S.-------
Q7M9H6_WOLSU/36-147-----------------------------------------------------------------RVDGV-AA-------
Q7M9Y3_WOLSU/138-238-----------------------------------------------------------------SIRET-PQ-------
Q7MAF6_WOLSU/73-171-----------------------------------------------------------------KPDES-AK-------
Q7MB83_PHOLL/151-259-----------------------------------------------------------------EPLRF-GS-------
Q7MC79_VIBVY/47-151-----------------------------------------------------------------AISDI-PG-------
Q7MFF8_VIBVY/41-151-----------------------------------------------------------------PLSEV-AG-------
Q7MFP2_VIBVY/51-161-----------------------------------------------------------------SLADT-PA-------
Q7MPW2_VIBVY/48-167-----------------------------------------------------------------TEMEG-PS-------
BTUB_VIBVY/41-148-----------------------------------------------------------------VESSV-LA-------
Q7MQW5_WOLSU/41-147-----------------------------------------------------------------EMWGT-AI-------
Q7MRE4_WOLSU/43-145-----------------------------------------------------------------EERGS-P.-------
Q7MTP7_PORGI/90-201-----------------------------------------------------------------ATAKT-PV-------
Q7MUS3_PORGI/125-235-----------------------------------------------------------------KDRMT-PV-------
Q7MVP2_PORGI/189-288-----------------------------------------------------------------PLVKM-EI-------
Q7MXJ7_PORGI/114-223-----------------------------------------------------------------KLSTV-SG-------
BTUB_PHOLL/43-151-----------------------------------------------------------------PISSI-LA-------
Q7MYQ3_PHOLL/88-191-----------------------------------------------------------------SARET-PQ-------
Q7N0P3_PHOLL/52-162-----------------------------------------------------------------DTLVV-IA-------
Q7N1F7_PHOLL/33-146-----------------------------------------------------------------DVITV-TA-------
Q7N1G3_PHOLL/80-191-----------------------------------------------------------------AVYDK-DI-------
Q7N369_PHOLL/43-154-----------------------------------------------------------------KIEDA-PA-------
Q7N3K1_PHOLL/52-162-----------------------------------------------------------------RAMER-PG-------
Q7N3T1_PHOLL/54-159-----------------------------------------------------------------DSFEA-PM-------
Q7N4L5_PHOLL/42-147-----------------------------------------------------------------ALNKV-DG-------
Q7N7B7_PHOLL/75-179-----------------------------------------------------------------NSVSA-GS-------
Q7NDD9_GLOVI/129-238-----------------------------------------------------------------RARDS-TQ-------
Q7NEA4_GLOVI/107-208-----------------------------------------------------------------AILDV-PQ-------
Q7NEA6_GLOVI/95-195-----------------------------------------------------------------PIRDI-PA-------
Q7NF46_GLOVI/89-197-----------------------------------------------------------------RQSET-TT-------
Q7NFC5_GLOVI/90-203-----------------------------------------------------------------SDLST-PL-------
Q7NG22_GLOVI/140-248-----------------------------------------------------------------RARDT-TA-------
Q7NGR5_GLOVI/172-282-----------------------------------------------------------------PRRST-PV-------
Q7NIR6_GLOVI/75-186-----------------------------------------------------------------QPLPP-VA-------
Q7NIY1_GLOVI/55-161-----------------------------------------------------------------PRSKT-PA-------
Q7NJ54_GLOVI/81-181-----------------------------------------------------------------PLRDI-PQ-------
Q7NJ59_GLOVI/134-244-----------------------------------------------------------------TLKEA-SR-------
Q7NJ70_GLOVI/124-232-----------------------------------------------------------------RERDT-TA-------
Q7NJC3_GLOVI/97-200-----------------------------------------------------------------AIRDI-PA-------
Q7NK68_GLOVI/88-195-----------------------------------------------------------------PILDV-PT-------
Q7NKI9_GLOVI/78-186-----------------------------------------------------------------RERDT-TA-------
Q7NKM5_GLOVI/105-213-----------------------------------------------------------------RVRDI-PG-------
Q7NKU0_GLOVI/141-249-----------------------------------------------------------------RARDT-PS-------
Q7NKU6_GLOVI/116-224-----------------------------------------------------------------RQRDI-TA-------
Q7NL22_GLOVI/133-241-----------------------------------------------------------------RQRDT-TA-------
Q7NL50_GLOVI/131-239-----------------------------------------------------------------RQRDV-TA-------
Q7NM72_GLOVI/83-193-----------------------------------------------------------------PARTN-ET-------
Q7NNP9_GLOVI/89-187-----------------------------------------------------------------ALRDT-PA-------
Q7NNR1_GLOVI/144-243-----------------------------------------------------------------DVMDV-PQ-------
Q7NNR7_GLOVI/107-209-----------------------------------------------------------------RLSDV-AR-------
Q7NNT3_GLOVI/186-294-----------------------------------------------------------------KPQDV-PI-------
Q7NNU0_GLOVI/140-239-----------------------------------------------------------------PILDT-PQ-------
Q7NNU6_GLOVI/111-210-----------------------------------------------------------------PLIDI-PQ-------
Q7NNU8_GLOVI/124-223-----------------------------------------------------------------PILDT-PQ-------
Q7NNV6_GLOVI/112-214-----------------------------------------------------------------RVQDV-PR-------
Q7NNX8_GLOVI/67-175-----------------------------------------------------------------QVYKV-PL-------
Q7NR88_CHRVO/41-155-----------------------------------------------------------------PLAET-AP-------
Q7NT73_CHRVO/48-158-----------------------------------------------------------------QQQEG-AR-------
Q7NVU1_CHRVO/84-183-----------------------------------------------------------------DVIDI-PQ-------
Q7NWK4_CHRVO/48-162-----------------------------------------------------------------KQEKA-L.-------
Q7NWL3_CHRVO/55-169-----------------------------------------------------------------SKETA-V.-------
Q7NXC8_CHRVO/28-147-----------------------------------------------------------------SAKAK-TN-------
Q7NXY5_CHRVO/51-162-----------------------------------------------------------------KIKEA-PA-------
Q7NZA3_CHRVO/47-166-----------------------------------------------------------------SAKEG-PT-------
Q7NZM7_CHRVO/36-143-----------------------------------------------------------------TRLDQ-PL-------
Q7P0S2_CHRVO/42-149-----------------------------------------------------------------PLSKT-LA-------
Q7P1Y5_CHRVO/44-158-----------------------------------------------------------------KQEKA-L.-------
Q7VF32_HELHP/43-147-----------------------------------------------------------------HPISN-A.-------
Q7VFY4_HELHP/46-150-----------------------------------------------------------------DLQST-TN-------
Q7VI87_HELHP/66-181-----------------------------------------------------------------NVIDA-PA-------
Q7VJ32_HELHP/37-143-----------------------------------------------------------------DVEKI-PG-------
Q7VNB0_HAEDU/33-172-----------------------------------------------------------------NVNST-SS-------
Q7VR34_BLOFL/76-178-----------------------------------------------------------------SLVST-ST-------
Q7VSG8_BORPE/46-152-----------------------------------------------------------------IGDSV-AA-------
Q7VSQ4_BORPE/124-230-----------------------------------------------------------------VRADP-AW-------
Q7VTE7_BORPE/49-156-----------------------------------------------------------------LLKNV-LA-------
Q7VUK9_BORPE/69-175-----------------------------------------------------------------DLDSM-TA-------
Q7VUZ3_BORPE/63-165-----------------------------------------------------------------TLRET-PA-------
Q7VX53_BORPE/74-174-----------------------------------------------------------------PLSET-PQ-------
Q7VXJ8_BORPE/120-247-----------------------------------------------------------------RVYGD-AT-------
Q7VZ08_BORPE/157-259-----------------------------------------------------------------PLIET-PQ-------
Q7VZP0_BORPE/67-167-----------------------------------------------------------------PLLDT-PR-------
Q7VZY3_BORPE/161-265-----------------------------------------------------------------PLIEI-PQ-------
Q7WXJ8_CUPNH/70-167-----------------------------------------------------------------PLRDV-PQ-------
Q7WXT8_CUPNH/85-201-----------------------------------------------------------------EADAT-GE-------
Q82SB3_NITEU/179-279-----------------------------------------------------------------AVMDT-PF-------
Q82SY1_NITEU/175-276-----------------------------------------------------------------PIMET-PM-------
Q82T03_NITEU/135-245-----------------------------------------------------------------NIQYT-PG-------
Q82TZ3_NITEU/58-164-----------------------------------------------------------------DQADI-AQ-------
Q82UF0_NITEU/63-168-----------------------------------------------------------------KVSEI-PE-------
Q82UF4_NITEU/110-222-----------------------------------------------------------------SHFTS-PS-------
Q82UF7_NITEU/77-188-----------------------------------------------------------------EMRKI-PG-------
Q82V93_NITEU/69-181-----------------------------------------------------------------KLESL-PG-------
Q82VI7_NITEU/165-266-----------------------------------------------------------------PLIEV-PQ-------
Q82VJ4_NITEU/168-275-----------------------------------------------------------------PLIEV-PQ-------
Q82VJ5_NITEU/173-278-----------------------------------------------------------------TLRET-PQ-------
Q82VK9_NITEU/147-247-----------------------------------------------------------------SLRDT-PY-------
Q82WD2_NITEU/53-167-----------------------------------------------------------------SIEEI-PG-------
Q82WF0_NITEU/69-169-----------------------------------------------------------------PLIDT-PK-------
Q82WN2_NITEU/44-151-----------------------------------------------------------------AAEDT-LA-------
Q82WN8_NITEU/69-180-----------------------------------------------------------------TTKEV-PQ-------
Q82WP7_NITEU/39-147-----------------------------------------------------------------KIRDA-VT-------
Q82WU8_NITEU/145-245-----------------------------------------------------------------PIMET-PM-------
Q82WV1_NITEU/138-236-----------------------------------------------------------------PIMKT-PM-------
Q82WV8_NITEU/139-239-----------------------------------------------------------------PIMET-PM-------
Q82WX2_NITEU/175-272-----------------------------------------------------------------SIMET-PF-------
Q82XF3_NITEU/71-173-----------------------------------------------------------------TPRET-PA-------
Q87FM2_VIBPA/63-162-----------------------------------------------------------------EWLDV-PQ-------
Q87FM3_VIBPA/65-177-----------------------------------------------------------------DVKEY-PG-------
Q87G51_VIBPA/41-151-----------------------------------------------------------------PVSEV-AG-------
Q87G82_VIBPA/54-155-----------------------------------------------------------------PAAET-PR-------
Q87HI4_VIBPA/52-156-----------------------------------------------------------------SISDI-PG-------
Q87HS4_VIBPA/40-151-----------------------------------------------------------------QIEDT-AA-------
Q87IE2_VIBPA/44-144-----------------------------------------------------------------KVSSN-TE-------
BTUB_VIBPA/42-148-----------------------------------------------------------------DGAVL-AQ-------
Q87LK9_VIBPA/45-156-----------------------------------------------------------------SQADA-PA-------
Q87TA2_VIBPA/50-165-----------------------------------------------------------------ASMEG-ST-------
Q87TW0_PSESM/88-193-----------------------------------------------------------------TALQT-PA-------
Q87XP8_PSESM/153-256-----------------------------------------------------------------KLQDA-PY-------
Q87YV0_PSESM/81-183-----------------------------------------------------------------TMRET-PQ-------
Q87Z57_PSESM/67-166-----------------------------------------------------------------PIKEE-AQ-------
Q87ZG7_PSESM/76-176-----------------------------------------------------------------DIMDV-PF-------
Q87ZX8_PSESM/70-170-----------------------------------------------------------------SLHET-PQ-------
Q880C9_PSESM/53-159-----------------------------------------------------------------EQRSA-DS-------
Q880Y5_PSESM/67-188-----------------------------------------------------------------TVTSS-PV-------
Q881N5_PSESM/124-225-----------------------------------------------------------------SAREN-PA-------
Q881P1_PSESM/85-186-----------------------------------------------------------------PLIEV-PQ-------
Q882L9_PSESM/60-181-----------------------------------------------------------------TVTDS-PA-------
Q882M1_PSESM/57-162-----------------------------------------------------------------SQDQT-DL-------
Q882Y8_PSESM/59-181-----------------------------------------------------------------TASAS-LS-------
Q883A9_PSESM/67-167-----------------------------------------------------------------AIRDI-PQ-------
Q884E1_PSESM/91-194-----------------------------------------------------------------SLRET-PQ-------
Q884E2_PSESM/175-278-----------------------------------------------------------------SLRDT-PQ-------
Q885H8_PSESM/64-175-----------------------------------------------------------------STSSV-LS-------
Q886G9_PSESM/65-165-----------------------------------------------------------------LLLDT-PA-------
Q887T0_PSESM/158-260-----------------------------------------------------------------ALIET-PQ-------
Q888K4_PSESM/46-154-----------------------------------------------------------------VQEES-IK-------
Q889G6_PSESM/54-164-----------------------------------------------------------------NLEDA-PA-------
Q889S8_PSESM/60-178-----------------------------------------------------------------SVIGQ-GE-------
Q88AW5_PSESM/47-168-----------------------------------------------------------------VDAET-AV-------
Q88DI7_PSEPK/51-160-----------------------------------------------------------------TAVAP-SS-------
Q88DR8_PSEPK/170-269-----------------------------------------------------------------SILNT-PA-------
Q88E62_PSEPK/143-242-----------------------------------------------------------------PNQDI-PQ-------
Q88F81_PSEPK/155-255-----------------------------------------------------------------TLRET-PQ-------
Q88FC7_PSEPK/46-156-----------------------------------------------------------------SPAAV-PG-------
Q88FF9_PSEPK/50-161-----------------------------------------------------------------RLREI-PG-------
Q88GV5_PSEPK/124-221-----------------------------------------------------------------PLRDI-PQ-------
Q88GZ0_PSEPK/156-256-----------------------------------------------------------------DFMET-PF-------
Q88HM8_PSEPK/63-163-----------------------------------------------------------------DIRDT-PQ-------
Q88IB5_PSEPK/165-265-----------------------------------------------------------------AISDV-PF-------
Q88JQ9_PSEPK/127-228-----------------------------------------------------------------DFMET-PF-------
Q88K71_PSEPK/81-186-----------------------------------------------------------------SALET-PA-------
Q88KU6_PSEPK/152-256-----------------------------------------------------------------AISEI-PG-------
Q88MX2_PSEPK/38-144-----------------------------------------------------------------GNRQL-AA-------
Q88PI3_PSEPK/137-252-----------------------------------------------------------------VVQNH-PG-------
Q88PI9_PSEPK/87-187-----------------------------------------------------------------PLVDT-PR-------
Q88Q29_PSEPK/156-260-----------------------------------------------------------------SLRET-PQ-------
Q88QF9_PSEPK/83-183-----------------------------------------------------------------ALKDI-PQ-------
Q88QG8_PSEPK/68-175-----------------------------------------------------------------SRTAT-SA-------
Q88QY4_PSEPK/153-254-----------------------------------------------------------------ALVEV-PR-------
Q88R62_PSEPK/80-184-----------------------------------------------------------------TPRQT-PQ-------
Q88RH0_PSEPK/172-279-----------------------------------------------------------------PLVET-SQ-------
Q89C30_BRADU/122-221-----------------------------------------------------------------SPLDT-SQ-------
Q89EK1_BRADU/100-209-----------------------------------------------------------------RAIDA-LA-------
Q89EX1_BRADU/91-207-----------------------------------------------------------------GPEGP-PG-------
Q89H12_BRADU/102-215-----------------------------------------------------------------DVDKV-PS-------
Q89KM4_BRADU/121-237-----------------------------------------------------------------ARYQL-PQ-------
Q89KY2_BRADU/91-205-----------------------------------------------------------------NGGIV-GA-------
Q89LN9_BRADU/126-232-----------------------------------------------------------------PLIET-PQ-------
Q89ND8_BRADU/131-231-----------------------------------------------------------------KLVDT-PK-------
Q89PC7_BRADU/142-245-----------------------------------------------------------------GTMKS-PF-------
Q89Q52_BRADU/116-218-----------------------------------------------------------------TVRET-PA-------
Q89SE0_BRADU/105-212-----------------------------------------------------------------IVTNQ-FA-------
Q89YK7_BACTN/215-322-----------------------------------------------------------------SQKLV-TT-------
Q89YM4_BACTN/201-329-----------------------------------------------------------------EAKS