Sequence alignment for CL0074

PF02337

M3WSX7_FELCA/8-91EQGY.FVTALQA----------------LMKE----------EGIKVSQSALREFFDI-VHAYCPWFPVGGTADLKDWQR
W5QAV8_SHEEP/6-90NRQM.FIEILLH----------------MLAH----------RGIKVSTGRLSKFLIF-VQEQCPWFPEEGTINLETWTK
W5PKN4_SHEEP/1-83..QL.FIKAISQ----------------LLNK----------RGIKVKKASVQSFFTF-IQEQCPWFPEGGTVNLKTWEK
GAK3_HUMAN/11-92KYAS.YLSFIKI----------------LLKR----------GGVKVSTKNLIKLFQI-IEQFCPWFPEQGTLDLKDWKR
M3Z829_MUSPF/4-86..VV.FMTALQA----------------LMKQ----------KGSKVSKKALQQFFCT-VSELCPWFPKEGTVSLDAWQK
U3KMV8_RABIT/6-86SHEI.FL.ALNA----------------LLRE----------NGLKLKPSTLHRFLRN-CDTIAPWYGVSGSLTIPSWDK
GAG_MMTVC/8-92GQKL.FVSVLQR----------------LLSE----------RGLHVKESSAIEFYQF-LIKVSPWFPEEGGLNLQDWKR
H0W369_CAVPO/6-86SSP..FLKILKH----------------LLSI----------YGISLRSADLDMCIDT-IKEYNPWFPDEGTLDVEVWRK
W5PYM4_SHEEP/6-87TKPHDFSTLLHH----------------LFKV----------QGLSVSRQQIEACLQT-VVECNPWFPDEGSFDLEIWPR
W5PXQ0_SHEEP/6-90SRQL.FVHMLSV----------------MLKH----------RGITVSKPKLINFLSF-IEEVCPWFPREGTVNLETWKK

PF01140

M3X0D2_FELCA/2-130GQTQTT..PLSI----------------MIDHFKDVRGRANNLSVEVRKGRWQVFCSSEWPTFNVRWPPEGTFDLPTIHR
G3GSE2_CRIGR/2-128GQQLTT..PLSL----------------TLGHWQDVLSRARKESVEIRKKKWRTLCFSEWPALNTGWPRDGTFDLTTILQ
M3WYN2_FELCA/2-127GQTQST..PLSL----------------LLANFRDVRARGHNLSVDIRKRKLITYCRSEWPTFGVNWPTEGTFCLPVVLK
M3X6D9_FELCA/2-117GQSQST..PLSL----------------LIANFRDVRTRGQNL....RRGKLITLCCSEWPTFGVGWPTEGTFCLPIIAK
GAG_MLVMS/2-126GQTVTT..PLSL----------------TLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQ
F9W9X7_TRYCI/60-184GQSVST..PLSL----------------TLEHWKEVQVRAHNQSVEVRKGPWQTFCAFEWPTFGVGWPPEGAFDLSLIAA
M3X1Y6_FELCA/2-130GQTLTT..PLSL----------------TLTHFSDVQARARNLSVEVRKGRWRTFCSSEWPTLSVGWPRDGTFDLFVILQ
M3X603_FELCA/2-121GQNQSTPTPLSL----------------ILTHFQDYKRATSVFGLHVKKPVLRILCEVEWTSFQVEWPPQGTFDLTLVYT
GAG_XMRV6/2-124GQTVTT..PLSL----------------TLQHWGDVQRIASNQSVDVKKRRWVTFCSAEWPTFNVGWPQDGTFNLGVISQ
M3XFF7_FELCA/2-127GQTVTT..PLSL----------------TLDHWSEVRARAHNQGVEVRKKKWITLCEAEWVMMNVGWPREGTFTIDNISQ
M3XCF6_FELCA/2-124GQSQST..PLSL----------------LVANLRDVRTRGQNLSLDIWRGKLITLCRSKWPTFGVGWPTEGTFCLPIIAK
M3XCW8_FELCA/2-127GQSQST..PLSL----------------LVANFRDVRTRGQNLSLDIRRGKLITLCRSEWPTFGVGWPTEGTFCLPIIAK

PF02813

GAG_RSVSA/2-87EAVIKVISSACK----------------TYC-----------GKISPSKKEIGAMLSL-LQKEGLLMSPSDLYSPGSWDP

PF00540

GAG_HV1A2/2-134GARASVLSGGELDKWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT
GAG_SIVCZ/2-140GARASVLTGGKLDRWEKVRLRPGGRKRYMMKHLVWASRELERFACDPGLMESKEGCTKLLQQLEPALKTGSEGLRSLFNT
GAG_SIVV1/2-141GAATSALNRRQLDEFEHIRLRPNGKKKYQIKHLIWAGKKMDRFGLHEKLLETEEGCKKIIEVLSPLEPTGSEGMKSLYNL

PF02228

GAG_HTL1C/1-92-MGQIFSRSASP------------------------------IPRPPRGLAAHHWLNF-LQAAYRLEPGPSSYDFHQLKK
GAG_HTL32/1-92-MGKTYSSPINP------------------------------IPKAPKGLAIHHWLNF-LQAAYRLQPGPSEFDFHQLRK

PF02337

M3WSX7_FELCA/8-91VGQELKNQMKIRG.AAVP-GTLW-------STW---------------TCIKEVLD----------------
W5QAV8_SHEEP/6-90VADRLHLFYTLHGPEKVP-VDAF-------ALC---------------SMIRDVLD----------------
W5PKN4_SHEEP/1-83VGKQLKTYYTWHGPKRAP-TDTF-------SLW---------------NMIRDSLD----------------
GAK3_HUMAN/11-92IGKELK.QAGRKG.NIIP-LTVW-------NDW---------------AIIKAAL.----------------
M3Z829_MUSPF/4-86VGQEIKNQIKIHGPTACP-PSTM-------QVW---------------EDIREVLD----------------
U3KMV8_RABIT/6-86LGRDLD.FAFEQG..NLE-GGVR-------PIW---------------KLVRACLE----------------
GAG_MMTVC/8-92VGREMKKYAAEHGTDSIP-KQAY-------PIW---------------LQLREILT----------------
H0W369_CAVPO/6-86ARVSIE.RAMQQE.EKIP-LRFW-------AIW---------------SVVYSLL.----------------
W5PYM4_SHEEP/6-87DKENVE.QATRQG.KNIP-IDFW-------P.W---------------ALIKAVI.----------------
W5PXQ0_SHEEP/6-90VGEQIRTHYTLHGPEKIP-VETL-------SFW---------------TLIRDCLD----------------

PF01140

M3X0D2_FELCA/2-130VRSIISRP.KTGHLDQLPYIITWQDLVEDPPSWLKPFLAPLPLE....PKPILALQGRKKKKSLTQPSAPLY
G3GSE2_CRIGR/2-128VKTRVFQPGPWGYPDQVPYIVTWESLSRDPPPWVRPFLPPRLSGPCPTPLPLPAPLIPTPSA.......PPS
M3WYN2_FELCA/2-127VKSRIFLPGKEGHSDQIPYILVWQDLVENPPPWMASFLTT........GPCKILAAKPTNPPRPPTPNAPPV
M3X6D9_FELCA/2-117VKSKIFLPGCEGHPDQIPYILVWRSLVENPPPSY..............PRERVRSLPCTLHPIIPSPHTPSS
GAG_MLVMS/2-126VKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKPPP....PLP.....PSAPSLPLEPPRSTPP
F9W9X7_TRYCI/60-184VRRIVFQE.EGGHPDQIPYIVTWQNLVQFPPPWVKPWTPN........SSKLTVAVAQSDAAGKSGPSAPPK
M3X1Y6_FELCA/2-130VKTKVMDPGPQGHPDQVAYILTWEDLIRNPPAWVKPFLPSCPT.....SQSTLLPLKTSKNRASTQTPDPPK
M3X603_FELCA/2-121FHDIVFSR....HEDQIPYIGAWRTLIETPPDWLKLLLPLPPCL....PKVQALPLKGSPSGAQ........
GAG_XMRV6/2-124VKSRVFCPGPHGHPDQVPYIVTWEALAYDPPPWVKPFVSPKPP.....PLPTAPVLPPGPSA......QPPS
M3XFF7_FELCA/2-127VEERVF.PGPYGHPDQVPYITTWRSLATDPPPWVRPFLPPPKHPRTDPPAPLPQPLSPQPSA.......PPI
M3XCF6_FELCA/2-124VKSKIFLPGCEGHPDQIPYILVWQHLVENPPPWMAPFLSL........GTCKVLAMRPAGPPKSRTPAA...
M3XCW8_FELCA/2-127VKSKIFLPGREGHPDQIPYILVWRNLVENPPPWLAPFLSS........GTCKVLVMRPADPPKSRTPAAPLY

PF02813

GAG_RSVSA/2-87ITAALSQRAMVLGKSGE--LKTW-------------------------GLVLGALKAAREE-----------

PF00540

GAG_HV1A2/2-134VATLYCVHQRIDVKDTKEALEKIEEEQNKSKKK.........AQQAAAAAGTGNSSQVSQNY----------
GAG_SIVCZ/2-140LAVLWCIHSDITVEDTQKALEQLKRHHGEQQSK..TESNSGSREGGASQG.ASASAGISGNY----------
GAG_SIVV1/2-141VCVLLCVHQEKKVKDTEEALAIVRQCCHLVDK.EKTAVTPPGGQQKNNTGGTATPGG.SQNF----------

PF02228

GAG_HTL1C/1-92FLKIALETPVWICPINYSLLASLLPKGYPGRV----------------NEILHILIQTQA------------
GAG_HTL32/1-92FLKLAIKTPVWLNPINYSVLAGLIPKNYPGRV----------------HEIVAILIQETP------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window