Sequence alignment for CL0077

PF00941

AOXA_HUMAN/239-419ERMMWFSPVTLKELLEFKF.....-----.KYPQAPVIMGNTSVGPEVKFK------GVFHP---VI.ISP-D--R--IE
Q7RXE4_NEUCR/265-448KRKRWFRPTKLEQLLEIKK.....-----.VYPNAKIIGGSTETQIEIKFK------ALQYP---IS.VFV-G--D--IP
XDH_EMENI/269-448KRKKWYRPVTVQQLLEIKS.....-----.IHPDAKLIGGSTETQIEIKFK------QMRYG---AS.VYL-G--D--LA
Q97W13_SULSO/4-169PKFSYVIPDNVKEALEFLE.....-----.THDDAKPLAGGHSLIPMLKLR------IFRPS---YL.VEI-R--R--LP
Q92V19_RHIME/2-221QPFSYQRADTVETAVAAVA.....-----.GRPAARFIAGGTNLLDLMKLG------IERPE---HL.VDI-G--R--L.
Q92UU0_RHIME/2-217RPFEFQRAASESEAIAAGA.....-----...AGARYLAGGTTLVDLMREE------VETPE---KI.VDI-N--R--L.
Q9I2H2_PSEAE/2-218TPFAYAKPADIEQALGLAG.....-----...PESRYIAGGTNLLDLMKEN------VARPR---RL.IDI-T--G--L.
O17892_CAEEL/259-440HHTKWYQPVSYDDLLSLKR.....-----.ELPHARLISGNSELAIELKFR------FIDLP---AV.INP-R--Q--VK
Q92UJ3_RHIME/205-373GADCLIVPVDAADLAGVLA.....-----.DHPGATIVAGCTDVGLWVTKQ------MRSLN---PV.VFI-N--G--IA
ALDO3_ARATH/222-398LKYRWTTPFSVAELHNIMEA...A-----NSGDSLKLVVGNTGTGYYKDEE------..RFD---RY.IDI-S--N--IP
Q8CJY1_STRCO/19-185QAVTL..PTTLDEAVAALT.....-----.ALPAAVPVAGGTDLMAAVNSG------QLRPA---AL.VGL-G--R--IS
Q9Y9R9_AERPE/4-175ASFEVLIPKSLDEALDMLE.....-----KYGDNAKVLAGGHSLIPMMRLR------LVKPT---YV.IYI-G--R--IP
Q6LQT9_PHOPR/1-157MIEHYLQPESTIQALELMK.....-----QHTGVAAWFAGGTKLNATPTKT------DKTVA---...ISL-D--K--L.
Q6F9M6_ACIAD/202-370QGQQFFAPKTVQEFAALRQ.....-----.QYPQARIVAGSTDVGLWVTKL------GRDLG---DM.LYI-G--Q--VQ
Q92WF7_RHIME/2-220KSFAYARAADLEAAVKLLS.....-----.KTPNAKLLGGGTNLVDLMREN------IEQPD---AL.VDV-T--G--L.
XDH1_ARATH/260-440GGITWYRPVCLQNLLELKA.....-----.NYPDAKLLVGNTEVGIEMRLK------RLQYQ---VL.ISV-A--Q--VP
Q974U9_SULTO/4-169PKFGYVIPDNLNEALEFLE.....-----.EHQDARPLAGGHSLIPMLKLR------LIRPS---YI.VEI-R--R--FS
Q6N0U3_RHOPA/2-168YSTNYHRASSVDEAVALIA.....-----.KGTDAKLLAGGHTLLPVMKQR------LAAPG---DL.VDI-A--K--IP
Q92XI0_RHIME/2-221RAFSYERVSSIGAAARAAA.....-----.ATDGAKFIAGGTNLLDLMKLE------IETPT---HL.VDV-N--G--L.
Q98JI6_RHILO/2-217RDFSYLRASSADAARQAAA.....-----..LPGAMLLAGGTTLIDLAKCG------VAEPD---ML.VDI-T--H--LK
ALDO1_ARATH/249-425RKYRWSSPVSVSELQGLLEV....-----ENGLSVKLVAGNTSTGYYKEEK------ERKYE---RF.IDI-R--K--IP
Q9KBF1_BACHD/778-946FEFEYYKPASIIEATTLFQSL..D-----QAGKDPMYVSGATELITLGRVN------QLKSG---AI.IDL-K--G--IS
XDH_ORYSJ/268-448NGIRWYRPLKLKQVLHLKA.....-----.CYPNAKLIIGNSEVGVETKFK------NAQYK---VL.ISV-T--H--VP
ALDO1_ORYSJ/239-416GDGCWFHPRSIEEFHRLFECN..L-----FDEMSVKIVASNTGSGVYKDQD------L..HD---KY.INI-S--Q--IP
ALDO1_MAIZE/244-417SGDGWYHPKSIEELHRLFDSS..W-----FDDSSVKIVASNTGSGVYKDQD------L..YD---KY.IDI-K--G--IP
Q8ZV34_PYRAE/7-173RHFKYIKANSVEEALQYVE.....-----...EGYRPLAGGQSISTLLKLG------VVAHE---GL.VDI-F--E--LD
XDH_CHICK/258-438ERVMWIQPTTLQELVALKS.....-----.QYPNAKLVVGNTEVGIEMRLK------NMLYP---VI.LAP-A--W--IP
Q9RK26_STRCO/2-220KPFAYVRAGSVEEATEAFA.....-----.AHPGARYLGGGTNLVDLMKLG------VETPA---AL.VDV-T--R--L.
Q9EWZ3_STRCO/2-220REFGYQRADDVSGAVALLA.....-----.ADPDARFLGGGTNLVDLMKTG------VERPA---RL.VDV-R--E--L.
O83120_TREPA/9-178SSVIYYV.KSLGQLCAVLR.....-----.NVAQVQPVGGGTGLVQYQITP------VLTLP---SHLVVL-N--G--VP
Q92X32_RHIME/2-174KPFEYYEPASLAEASDLLR.....-----RLGKDASIIAGGTDLLVEMKEE------LRSVL---HL.VNI-K--K--IP
ALDO4_ARATH/228-407TRYHWSTPGSVAELQEILATTNPG-----KDRGLIKLVVGNTGTGYYKEEK------..QYG---RY.IDI-S--H--IP
Q98D33_RHILO/32-199SVIRYAKPTTVDEALALLG.....-----..EGAWRILAGGTDFYPAQGAK------PFRDN---VL..DI-N--G--LA
DCMM_OLICO/4-175GSFDYHRPKSIADAVALLT.....-----KLGEDARPLAGGHSLIPIMKTR------LATPE---HL.VDL-R--D--IG
Q9VF50_DROME/202-379DGSQWYWPSTLAEIFEALEN...V-----GDSEEFMLVGGNTAHGVYRRSP------..DIK---HF.IDV-N--G--VE
Q88F21_PSEPK/195-363GDKRCLVPLTVADLADLYS.....-----.SHPEARLLAGGTDLALEVTQF------HKTLP---VM.IYV-G--H--VA
XDHC_BACSU/10-174MNIQLWRPAALDEAYSLLE.....-----KLAPDVCAASGSTLLQLQWDKG------TLPKQ---HL.VSL-E--G--ID
Q8P785_XANCP/2-221KAFSYERATSPADAAAKAA.....-----.RQPGAKFIAGGTNLLDLMKLQ------IETPS---HL.IDV-N--G--L.
Q8XZD4_RALSO/2-168YAFEYHKATDAQTAVTALK.....-----.MHPDGKYLGGGQSLLAAMKLR------LAQPA---ML.VDI-T--R--IP
Q89PE8_BRADU/4-175PAFDYLRAESISDVLDGLA.....-----QQGGDARVLAGGQSLMAMLNMR------LAKPK---LL.IDI-M--R--LR
Q6LPZ7_PHOPR/191-359ENLSSFSPTTTDELAELLL.....-----.TYPDARLLAGGTDLALEVTQF------HREIE---QL.ISV-N--L--VA
Q9KEV2_BACHD/4-177MQTVW.KPKDLAEAWELRN.....-----.TVSDSTFVSGATWLRAQWEEN------PVATP---RHIIRL-D--H--IP
Q89PX9_BRADU/4-175APFAYERPRDLNSALSMLA.....-----AAGGSAKIIAGGQSLGPMLNLR------LVQPE---LI.VDI-S--G--LA
Q7TP79_RAT/448-628ERTIWIMPVTLNDLLELKA.....-----.SYPEAPLVMGNTAVGPGMKFN------NEFHP---VF.ISP-L--G--LP
ALDOL_ORYSJ/224-406PREGWYCPKNIKQYYKLVNSG..L-----FSESSVKVVVGNTSTGVYKDQD------L..YD---KY.IDI-A--G--IP
Q8XXL8_RALSO/214-382NAPRFYAPRTVSAFAALKA.....-----.AHPDIRVLAGSTDLGLWVTKQ------LRELG---DL.LYV-G--Q--VA
ALDO2_ARATH/218-402GMYRWCSPASVEELSSLLEACKAN-----SNTVSMKLVAGNTSMGYYKDER------EQNYD---KY.IDI-T--R--IP
Q73PR8_TREDE/6-176KNSIVYRARYMQEMQTILK.....-----.NISNIKPIAGATGFLNHQTDE------MIYLP---EHILDL-N--F--LP
Q9EWG7_STRCO/216-384DDSAFLRRSTLAETLRLLR.....-----.ERPQAVVVAGSTDWGVEVNIR------SRRAD---CV.VAV-D--R--LP
Q97VI7_SULSO/4-174PDFTYVRVSSSEEATKFLE.....-----.SHDDARPLAGGQSLIPMLKLR------VISPN---YI.VDL-N--P--IT
A9CL41_AGRT5/2-219NIFSYHQPSDTASAIALKQ.....-----.AGPTAKYLAGGTNLVDLMRET------VERPE---TL.VDV-T--H--LS
Q8LHR9_ORYSJ/267-447SVSSWYQPKNVEEYYKLIGSLSSS-----SDKSRTKVVVGNTSSGVYRDAE------L..YD---RY.IDL-R--A--IP
Q7VS58_BORPE/4-175AQFEYFRAESMQQALQWLR.....-----QHDGRAKLMAGGQSLGPMLNLR------LARPP---VV.IDI-S--G--VP
Q89GV6_BRADU/4-175RAFSYFRAATIDQALDAHA.....-----RAGDEARFIAGGQSLVPALSLR------LQAPR---LL.IDI-T--H--ID
Q87YY2_PSESM/195-363GEKHCLIPLTVADLADLYQ.....-----.ANPQARLLAGGTDLALEVTQF------HKALP---AM.IYV-G--H--IA
Q6MJY3_BDEBA/203-371GAKKFTAPANFQVATEQKS.....-----.KSPQTRLVAGATDLGVLHNKG------KAFMD---DV.MSL-H--K--IT
A9CI15_AGRT5/197-365GEDRSIIPATLSDLTEIYA.....-----.AEPKATIVAGSTDVGLWVTKQ------MRALN---PV.IFI-N--N--LG
Q89XH7_BRADU/2-168YQTTYHRASSVDEAASLFG.....-----.KSSEAKFLSGGQTLLPVMKQR------LASPS---DV.IDL-G--K--IK
Q976U6_SULTO/9-170KKFKYIKVNSLDEALELLR.....-----...DGSKVLAGGQSLLPLLKLR------ILNVD---TL.IDI-K--N--L.
Q6AIN3_DESPS/3-161KIGNYLCPSSLEDAYQVLQ.....-----..DVPASVVLGGCG...YLRLA------GRRID---TA.IDL-V--K--L.
Q6AK64_DESPS/1-173MVQEYLFPATVSEAVALLA.....-----SKDGKARIIAGGTDLVLDMKDG------KFAAD---VL.LDL-S--N--IG
Q98CI6_RHILO/201-369AKARLIVPANVDDFATVLD.....-----.QEPGATIVAGSTDVGLWVTKH------MRDIS---PA.VFI-G--N--LD
Q9FV24_SOLLC/235-418LRYSWYTPVSIEDLQSLLNSN.VT-----ENGASFKLVVGNTGTGYYKETQ------..RYD---HY.IDL-R--Y--IP
Q92VB8_RHIME/200-368EDERVVLPASLDDFAAVLE.....-----.ANPKATIVAGSTDVGLWVTKF------MRDIA---PV.VHL-S--H--LE
D0IYQ4_COMT2/229-396....FHAPRTLADLAGLCE.....-----.AKPKARIVAGSTDVGLWVNKQ------FRDLG---DM.IYV-G--D--VA
D5API5_RHOCB/182-343......LPETSDALADWYL.....-----.AHPEATLIAGGTDVSLWVTKA------LRDLP---EV.AFL-S--H--CK
AOXC_MOUSE/240-418.RTTWIAPGTLNDLLELKM.....-----.KHPSAPLVIGNTYLGLHMKFT------DVSYP---II.ISP-A--R--IL
G3XCQ8_RHOPA/7-214..LNLLRPGSVDEAIAALL.....-----.AHPGGWLLGGGTDLLVNMRRG------VTQPE---TL.IDT-T--G--IA
H9JLH6_BOMMO/1453-1632.QTTWYRPTNIETVLSLKD.....-----.KFPNAKVVVGNSEVGVEVKFK------RCVYP---II.IMP-N--C--VP
K4DAL9_SOLLC/235-416.KYPWYSPVSIKELWSLLNFN.VT-----VNRGSFKLVVGNTGTGYYKETQ------..RYD---HY.VDL-R--H--IP
M4A7V2_XIPMA/239-417.RMTWVTPTSMEELVQLRA.....-----.KNPKAPLVLGNTNIGPDIKFK------GVLHP---LI.VSP-I--R--VK
XDH_BOVIN/233-411.RVTWIQASTLKELLDLKA.....-----.QHPEAKLVVGNTEIGIEMKFK------NQLFP---MI.ICP-A--W--IP
Q2YPJ7_BRUA2/203-367...RLIVPADLDDFATILA.....-----.AEPKATIVAGSTDVGLWVTKM------MRDIS---PV.VFI-G--H--LE
XDHB_ECOLI/6-173...SYHRAATLADAINLLA.....-----.DNPQAKLLAGGTDVLIQLHHH------NDRYR---HI.VDI-H--N--LA
Q7Q3J8_ANOGA/229-405.RAAWYRPTTLNDLLALKK.....-----.AHPETKIVVGNTEVGVEVKFK------HFEYP---VL.SHP-N--K--G.
Q89IH3_BRADU/3-167.EFKYHRPGTVRQAANLLV.....-----.KNEDAKVIAGGHTLIPVMKQR------LASPP---HL.VDL-S--H--IE

PF01565

Q8EGS3_SHEON/42-180P.EVVVHAETLEQVKLTLTVARKH.....NAP..VTFRAAGTSLS.GQA.I........GEG...IL-LIL.G..HDGFR
GGLO_MOUSE/21-156P.EMYYQPTSVGEVREVLALARQQ.....NKK..VKVVGGGHSPS.DIA.C........TDG...FM-IHM.G..K..MN
YITY_BACSU/45-181I.KQTVKGQEEEMLIDTVKEANRK.....NIK..ISIAGAQHSMG.GHT.Y.......YEDG...IV-LDM.T..G..YN
Q7RV07_NEUCR/47-186P.EAVVRPKDSNDIAEVIKCATQH.....GYK..VQAKSGGHSFG.NYGLGG.....GQDGV...IT-IDL.V..N..FQ
Q9YFD3_AERPE/61-201PRAYVAKPRSRGAVERIVEAAAEA.....GAC..LVPRGGGSNVV.GAS........PPLGC..CLI-LDL....R.MLD
MURB_SYNE7/29-161A.QFYDEPASVEAIATAWQWARLA.....DFP..VTFLGAGSNLLISDR.G........LPG...LV-LNL.R..R..LQ
Q9RTM9_DEIRA/61-199P.LAVVLPESTADVVAAVKAAKAA.....GVP..IVGRGAASGLS.GGV.T......PLQES...LV-ISF.T..R..MT
MURB_STRP1/28-158A.DFLAFPRNHYELSRIVAYANKE.....NMP..WLVLGNASNLIVRDG.G........IRG...FV-IMF....D.KLN
Q72F25_DESVH/44-183P.DMVVLPESVGQIQALMRLATEH.....RFP..VIPRGGGTGLA.GGC.L......ALMGG...VV-LSV.E..R..MN
Q9RJ97_STRCO/99-239P.AAVVLPDGHDEVLAVLAACAEH.....GLA..LVPFGGGTSVV.GGL.AP....GREGAF...VA-LDL.R..R..MN
MURB_PECAS/20-153A.SCIKVADTQDKLIEEWRVASAS.....QEP..VLLLGEGSNVLFLED.F........LGT...IL-LNR.......LK
Q8XND2_CLOPE/36-171P.LGIVFCNNIDDVKNALEWAKEN.....NIP..FRIRVGRHNYE.GYS........IENDI...LV-IDL.S..K..MN
Q8EGB1_SHEON/385-520P.LAIIKCRTRQDVKIVYKTAVDY.....HLA..ISVRSSGHDHE.GESGE........TNS...IV-LDL....E.LMN
Q9HMR2_HALSA/64-202P.VGVVFPTSTDDVAAVVSYCADR.....GIP..VLPRGGGTSLA.GQA.V........NEA...VV-LDF.K..H.AMN
Q98KY4_RHILO/16-149P.....RAIHADAAIALLKSGQAK.....EAS..LLAYGNGRSYG.DSC.Q.......NQAG...AV-VDM.R..T..LN
Q9A8X8_CAUCR/61-191P.AARLAPKDEGELATALKVAQ........AP..IRPVGSGHSFT.ALA.........PTDG...TL-VSL.D..S..MS
O29450_ARCFU/37-175A.TAVVFPENTEQVARIAKLCYEN.....NIK..IYPQGSSTELS.GSS.V.......PEDG...IV-INF.S..K..MN
Q7SHH8_NEUCR/74-210Y.QAAITPTTEADIVSLVKMAKQH.....NIP..FLATGGRHGYGTSLGKC........QEG...LA-IDL....S.HFK
Q82G17_STRAW/96-229P.AAVAYVAHADDLRTTMAYARAH.....GVK..VAIRNGGHSYA.GWS.S.......GNGR...LI-LDV.S..K..LN
Q7N1V5_PHOLL/58-193P.LAVVCVKNTDSIIDIIHYCNIN.....EIP..INIRGVGHSFGTQSL..........SKG...IV-LVV.S.....VE
O33177_MYCTU/35-170P.EVIVQAVSADDIVSAIRYATVN.....GHK..VSVVSGGHSFAASHL.R........DGA...VL-LDV....S.RID
Q974L0_SULTO/23-162P.KIVVYPKNEEEIVKIVNYARET.....RTP..IVTWGAGTSLS.GHL.M.......CDGC...IL-LDM.S..K.YMN
Q6L2S1_PICTO/39-177P.LCVVKITDENIISRVLKIASKY.....HLN..VIARGGGSSPT.GAV.V......PVENT...IV-LDM.R..P..LN
ADAS_DICDI/141-282P.DLIVLPHSHEEVERLVQLAHKY.....NVV..IIPMGGGSNIV.GAI.EPV...SNERFT...VS-IDM.R..R..MN
Q9RVK1_DEIRA/39-176P.DAVLHVQSEQDVVDALRIAGEY.....LFP..IVPFSVGSSLE.GQV.I......PVRGG...LT-LNL.L..G..MN
MURB_HAEDU/19-152A.NQIIEFTTVSQLITEWQKATRA.....DQA..VLILGQGSNVLFLDD..........FNG...VV-LVN....K..LK
Q7S1N4_NEUCR/85-222S.AAYFQPVSAAEVSTALSIITKT.....QCK..FAVRATGHNPNPGFS..S.....TREDG...VI-IDL....Q.LLN
Q9F3A3_STRCO/70-207P.QVVVLPETIEDVAAVLAYARDH.....GRQ..VVFRAAGTSLN.GQA.Q........GED...IL-VDV.R..R.HFT
MURB_SHEON/21-152S...LIEVRSKAELQAICLPLYQS.....KQP..MLVLGGGSNIVFTDD..........FNG...TV-VRV.......LS
Q7V4C5_PROMM/41-176VQAKVVQPASVQQVQELVRQAS.......PAS..LIARGLGRSYG.DAA.Q.......LDGA...SA-VEM.G..A..FD
MURB_NOSS1/59-191A.ELYVAPRNIEALQASLRYAQEH.....NLR..VTTLGAGSNLLVSDR.G........ISG...LV-IAT.RHLR..YT
MURB_BACSU/34-165A.DVLVIPSSVDAVKDIMDVIKKY.....DVK..WTVIGRGSNLLVLDE.G........IRG...VV-IKL.G..A.GLD
Q7NFT8_GLOVI/37-175P.IGVVIPRSQADVVATVQATRAA.....KLP..VLARGGGTSVS.GQA.V........GQA...VV-LDF.S..K.YMH
MURB_ACIAD/22-156A.SHYIKVQSVNELIEALDYAEQQ.....QLN..ALILSGGSNMLLPQS..........LDA...LV-LHI.D.....IQ
Q9KB02_BACHD/48-187P.KAVVFPENTREVASIVRYCHDH.....NLP..FLARGAGTGLS.GGA.I......PINGE...VI-ISL.V..R..MK
MURB_ECOLI/17-150A.QHIVCAEDEQQLLNAWQYATAE.....GQP..VLILGEGSNVLFLED.Y........RGT...VI-INR.......IK
Q7NCA8_GLOVI/44-184PETPVVLPDSPASLAEVMTCAHRE.....RWR..VLPAGRGSKLG.WGA.L......PRAVD...LL-VST.A..R..LN
Q8CJQ0_STRCO/57-195P.LGVVVPRTPEAGVEAVAVAREF.....GAP..VLSRGGGTSLA.GQC.T........NAG...VV-LDW.S..K.YCT
Q726S9_DESVH/41-181P.ALVLRPTETEQLGKLVKLCYEN.....DHP..ITVRGAGTNLS.GGT.IP.....DKREG...IV-ILT....N.SLN
Q98I12_RHILO/59-194PVYGVVEVSEEHHIAKALAFARAN.....GLK..VSLAAIRHSMG.GHA........FDDNA...LV-LDL.K..K..FN
MURB_PSESM/23-157A.RLFAQARNDDEVREALAYSAEH.....DVP..LLVIGGGSNLLLSGD..........VQA...LV-LRMAS..R.GIR
Q8TH91_METAC/83-222P.DYVVRPKSTDEVSRIVRLAYEN.....EIP..LTARGAGTGLA.GGA.V......PVSGG...IV-LDM.S..G..MN
MURB_WOLPM/30-160A.DVLFKPCDIEDLTYLIK...NT.....ELP..VSVIGATSNIIVRDS.G........IRG...IT-VKL.G..K.EFA
O50531_STRCO/29-164P.AREVTPASVDELADAVRRAAED.....GQR..VKAVGTGHSFT.SIA.........ATDG...VL-IRP.Q..L..LT
MURB_AQUAE/21-153V.SFYAEPSDLKEISLCIDFSKSR.....DIP..LFVLGNGSNTIFGDV...........RG...LV-VNL....K.NLK
ALO_SCHPO/28-163S.LGLRCPKTEEQLREILVDANSN.....GKK..IRVVGAGHSPS.DIV.........CTSG...YL-LSL.D..K..MN
ADAS_MOUSE/193-336P.DIVVWPTCHDDVVKIVNLACKY.....NLC..IIPIGGGTSVSYGLM.CP.....ADETR...TI-ISLDT..S.QMN
MURB_CAUCR/32-163A.DVVFLPADEQDLSDFLK.GLDP.....SVP..VMAIGVGSNLLVRDG.G........VDG...VV-IRL.G..K.GFN
MURB_STRCO/53-183A.TRLLTATTDAEVIAAVREADDT.....GTP..LLLIGGGSNLVIGDK.G........FDG...TA-LHI.......AT
Q98KG4_RHILO/152-289P.DGVAFPETTAEVQEIVRACAAH.....RVP..VIAFGVGSSLE.GHT.N......APGGG...IS-VDT.S..R..MN
Q8FNC2_COREF/44-182P.AAVAEPRTVEDIRDAIAVAVAR.....EWP..IVGRGGGSSVA.GNA.I........GEG...LI-IDT.S..R.YFN
Q9KKW5_VIBCH/47-184P.KIVLRLKSLDEVIFAIQSCGQL.....GIH..FTFRAAGTSLS.GQA.V........SDS...VL-ITL.T..D.DWR
Q82SS0_NITEU/46-186P.GAIVYPESVEEVQAIVRLAAKF.....NVP..VWPVSTGKNWGYGEK.TA.....CYPGG...IT-VVL....E.RMN
Q9A317_CAUCR/35-173T.PLLVTPRSTAEVAAVVGICAAE.....GVA..ITPQGGNTGLV.AGQ.I......PR.GE...IL-LST.Q..K..LT
Q7U5R3_SYNPX/72-213A.DLVVRPLTVAGVERLAAACGRH.....GVP..LTLRGSGTGNY.GQS.V......PLEGG...VV-MLS.G..A..LR
MURB1_CORGL/41-172A.AVFAEPSSINEICALLAFMKNR.....PEP..VVVVGGTSNILFDSD.G........FGG...LV-IKL.G.......
Q7N7Z9_PHOLL/19-157I.RAVIRPGTIEEVQEIVRIFNRF.....KTHAGLHAISTGRNWGLGSA.QP.....ATDGV...VT-IDL....Q.RLN
Q7S350_NEUCR/67-202P.SCVFEPGSAEDVSVALRIIGAT.....KTP..FAVQSGGHTSNPGFS.S........TKG...VH-ISL....K.RLN
Q8XW09_RALSO/54-193P.LAVALPDSEAQVVEILRACHRL.....GVP..VVPRGAGTSLS.GGA.M......PTPGG...LV-LSL.A..K..FK
MURB_VIBCH/21-154A.AQLVVAESIDDLKALYCSAEWA.....SLP..KLIIGKGSNMLFTCH..........YTG...MI-VVN....R..LN
ALO_ASHGO/29-168P.RLYFQPRSEDEVVAIVRAAREQ.....GRT..IVTVGSGHSPS.DMC.........ATDD...WM-VNL.D..R..LN
MURB_CLOAB/38-168V.DVLVMPEKYEEINRIIELCEKY.....DVN..YYIIGNGSNLLVRDG.G........LRG...VA-IKL.L..K..LN
Q92RW6_RHIME/20-155S.QYKASPGTEAELAELVAEADKR.....DLG..VRVSGSGHSFT.PVV.........GTSG...LL-LSL.A..D..LR
Q9PBD9_XYLFA/32-171P.LAIALPATVQEVQAIVRWANDA.....HIA..IVPSGGRTGLS.GGA.M......ATNGE...LV-LSL.E..R..MN
P71984_MYCTU/42-177P.ALIATCHDACDVRTVLRRAVDA.....GMV..TAVRGGGHNVA.GTALC........DGG...VV-IDL....S.AMR
Q726N5_DESVH/138-278P.ILVVAPDTAEQVSAIVRLANEM.....KFA..IIPRGGGSGLT.GGA.VP.....ARRRT...VI-MSL.T..R..LT
Q8KEW7_CHLTE/25-165T.PGVFFPETPEEVASLLREACAD.....GRR..YTIAGNGTGTT.GAR.I......PF.GD...YV-IAM.Q..K..LD
Q97U59_SULSO/47-180W.KITAIPQTYAELRDVIKFANEK.....KLS..IYPFSFNMHHI.GPP.V........SID...IG-VKL.S..Q..FN
Q9I3S8_PSEAE/39-178G.SFLVLPESTDQVAAVVRLCRQA.....GRA..LVPQGGLTGLV.GGG.A......AQAGD...VL-LSL.R..R..LN
CKX11_ORYSJ/45-187P.AAVVRPASSDDVASAIRAAART....AHLT..VAARGNGHSVA.GQA.M.......ARGG...LV-LDM.R..A..LP
Q92X65_RHIME/28-163P.SRLDVPEDEETVAALVRAAARQ.....GRS..IRPVGSAHSSS.EIY.........VTDD...IL-VSM.A..G..IC
Q7NZ82_CHRVO/51-186A.QALATPGDEAELARLLREASRS.....GTP..LRCVGAGHSFT.PLV.........PTPG...TI-VSL.D..R..MS
P74033_SYNY3/47-186A.DLVVLARSEPEAIAVIRCCVAN.....QIP..LTVRGAGTGNY.GQC.V......PLEGG...IV-LDL.S..P..MQ
Q9S2F6_STRCO/73-212P.AAVVLPRTVEDVQHVMRTATAL.....RVP..VVPQGARTGLS.GAA.N......ATDGC...VV-LSL.T..K..MD
Q983S0_RHILO/19-151P.RLIASPADAGELGDLVRTAP........GP..VRVVGAGHSFT.PLV.........KSQG...TI-LSL.E..K..LE
MURB_BUCBP/20-153A.KKIIIVKTIKTLIKTWKKCNQE.....NLP..FLLLGKGSNVLFTKN..........YNG...FV-VVN....R..IS
YVDP_BACSU/33-169P.LVFVFAQNSYDVSNAIKWAREN.....KVP..LRVRSGRHALDKNLS........VVSGG...IV-IDV.S..D..MN
O29393_ARCFU/49-187P.DAVVFPKSTEEVSVILKVANTY.....GIP..VYVFGGGSGVI.DAA.T......PYEGG...IA-LST.L..S..LD
Q7URF5_RHOBA/77-214P.LAVVRPRSVADVSATVQYACEN.....DLP..IHPRGSGSGVS.GES.V........GPG...IV-VDM.S..A.HMK
Q6CCU5_YARLI/112-251T.QLVLKPTSAEQVSKILSYCNDK.....KLA..VVPQGGNTGLV.GGS.V......PLYDE...II-LSL.S..N..MN
Q7S0U1_NEUCR/79-214F.QIVIEPGQESDVASIVKYCNEK.....SID..FLAINKGHGYPSSLG.S........FNG...VQ-INL....A.QFR
DIML_CAEEL/59-199PNAHVRKVKHIQEQLKEWNDNGRK.....SKL..VNARPGWLTMSFRFP..L.....YKENA...TK-IAT....D.KLF
Q6NAC4_RHOPA/97-241P.DVVAYPRDEAEIAAVMDWAGGA.....GAA..LTPFGGGSSVC.GGV.ECRVDGNRHKAA...VT-LDL.R..H..LG
Q8F3Y7_LEPIN/117-261V.DGVIYPGKESEISKILEYCSKN.....HIT..IIPYGGGSSVV.GGL.EVIK.AKGQKQV...LS-LDT.T..R..MN
Q9HTK4_PSEAE/8-144P...DAGADHAGALLERVRDALAR.....RAP..LRIVGGDSKAFLGRP..........VAG...EP-LAL....A.EHR
ALO_NEUCR/51-186P.ELYIQPESVSEIQKVVRLARHA.....RRR..VTTTGCGHSPS.DIT.........CTSS...WL-VNL.D..N..FN
Q96YM3_SULTO/46-183P.DYVIYPTSVEDVIDAVKIALKY.....KVP..ITPYGRGTNRY.GNA.L......TTEGG...IL-LDF.S..K..MD
Q9SA87_ARATH/77-216P.ISVVAAATWTHIQAAVGCAREL.....SLQ..VRIRSGGHDFE.GLS.Y........TSTVPFFV-LDM....F.GFK
Q6ALH1_DESPS/43-180P.QVVVRVANEKEMQLCLREASSK.....KLP..VTFKAAGTSLS.GQA.I........SDS...IL-LMA.G.EG..WE
Q8YZY0_NOSS1/35-172T.LGIIRPHNLEELSSALRFAKQQ.....NLR..LKARGKGYTQG.GQS.V.......AQDA...FT-LDL.T..R..LN
Q97Y18_SULSO/44-180P.LLVLSPSTTEEVSNIVKLANKY.....YVC..IVPYGGGSSVV.GGS........YHNNC...VI-LDL.S..K..LN
Q9KB00_BACHD/33-172G.LLEIIPTTERELADVLTLASEE.....EHL..VTVEGAGTKRG.FAG.T......LLETE...WV-VSL.Q..Q..FT
Q97U60_SULSO/35-172P.PVVVLPGSEEEVISLVNFLNEN.....NIK..YIVRGSGTSLS.GAT.T......PTQGE...VV-ISL.T..R..LN
Q96XG8_SULTO/47-186I.LGAVIAEDENDIEYAIKVCSKY.....RIP..LLARGAGTSTI.GQV.L......PIFPS...IV-VDI.Q..K..LN
MURB_YERPE/20-153A.SNVISAGSVETLIAAWHESKAK.....RQP..VLLLGEGSNVLFIKN..........FSG...TV-L.........LN
Q6N8A2_RHOPA/39-178A.AALVRPTSTQQVSEILRWCHAN.....GVH..VVTHGGLTGLV.HGA.D......AEPSE...VI-LSL.E..R..MR
Q9HTM8_PSEAE/30-162P.LAREAPKDLDELVRIIRQASGR..........IRPVGSGHSFS.ALV.........PTDG...TL-LSL.A..Y..FS
Q89HF0_BRADU/40-178P.SGVVVPKTMDEALRALAIARDE.....GRK..VTPRGGGTSQC.GQT.V........NDG...LV-VDL.S..K.HLN
MURB_LEIXX/19-154P.ERLLEPADRDALVATAREVWST.....GDE..WLLLGGGSNTIAADD.G........FEG...TV-LRIVT..R.GVE
Q7YWB6_LEIMA/137-280P.DCILLPNSHKDCVEIMRLAHKH.....NVV..VIPFGGGTNVT.GGV.EADP.FERARMI...IS-VDM.R..R..MN
Q8ERP2_OCEIH/37-174P.DVVCFPTSKEDVQAILEIARNN.....QIP..VTPFGTGSGLE.GSS.I......PVKKG...IS-INF.E..Q..MD
Q9HKQ4_THEAC/37-176P.EAVLLPGSPEDVQRIMKLAYKY.....EVP..VVVRGGGSSLT.GSS.I......LKNEG...IV-ISM.L..R..MN
XYOA_STRCO/17-150A.KELLRPHSLDALRALVADSA.........R..VRVLGSGHSFN.EIA.E......PGDGG...VL-LSL.A..G..LP
Q869M2_DICDI/40-172P.KLIVIVKNENDIINSIKFCKEN.....NIE..IAIKSGGHGFH.SNC...........KG...LL-LDL....N.LLK
Q883D1_PSESM/55-190P.AAIVYPEHVADIRTSALMAAKE.....GVS..FAMRGGGHHIA.GFSTC........DGG...IV-LDF....K.KWK
A4XDV9_NOVAD/50-189P.SAAVAPANMEQIQQALKVFNAY.....KLP..IWTFGNGRNFAYGGP.AP.....RQSGY...VM-FDL.K..R..MN
A4XDW3_NOVAD/40-176P.AGVVLPADEAQLAKVLEAARTS.....GGV..VQTVCNGAYGL.EKA.V.......QDKV...IV-LDL.Q..K..MN
F9UTP6_LACPL/50-187..LAYVEAHTTKDIQGTLKTARKY.....HIA..VIPQDQTTSTVIGAD.G.......LTDS...LI-LST.A..K..MN
G4UXW0_NEUT9/71-205...AVVYPRTTDHVSAIAQICNAR.....NVP..MVPFGAGSSVE.GNF.S......QPYSG...IC-IDF.T..Y..MD
K4D2I8_SOLLC/110-239....FLQPESVEELEGIVKEANVR.....KHK..IRPVGSGLSPN.GIG.L........TRA...GM-VNL.A..L..MD
O07406_MYCTU/37-173..SALVRPGSAEEVAEVLRVCRDA.....GAY..VTVQGGRTSLV.AGT.V......PEHDD...VL-LST.E..R..LC
O25820_HELPY/43-179P.KIVAWVKNEEEVQKLCVLAKKH.....GVS..LTFRAAGSSLS.GQA.I........CDG...VL-VMV.T..H.FFK
O53608_MYCTU/74-210P.AVIVTPTSQLDVQKAMAFAAAN.....NLK..VAPRGGGHSYV.GAS.T.......ANGA...MV-LDL.R..Q..LP
GULDH_MYCTU/16-151P.SAIVRPTSEAELADVIAQAAKR.....GER..VRAVGSGHSFT.DIA.C........TDG...VM-IDM.T..G..LQ
MURB_MYCTU/34-167..RRVITCTSAEQVVAALRHLDSAAKTGADRP...LVFAGGSNLVIAEN.L........TDL...TV-VRL.......AN
Q0SJV5_RHOSR/43-180P.LVVARPRHADEVAAALAVCRRE.....GVP..LTSRGGGTSVA.GNA.V........GTG...LI-LDF.S..R.HMN
Q0WGW9_YERPE/389-525P.AGIVRAATEADVIRTIVFAKER.....GME..VSVRGSGHNYV.GCF.L.......RVDT...LM-LDI.S..G..LK
Q1K764_NEUCR/70-205P.ACFVAPENTLEVAATMKVLASL.....NTQ..FSVKGGGHTAFAGGS.N.......SDGG...VT-VDL.M..Y..LT
MURB_STAA8/38-166..DFYITPTKNEEVQAVVKYAYQN.....EIP..VTYLGNGSNIIIREG.G........IRG...IV-ISL.L..S..LD
Q2USP5_ASPOR/124-262...YAVNVSTPAHVAKTLQFANEH.....NIR..FVIRNTGHDYN.GKS.T.......GAGA...LS-VWT.H..H..LK
MURB_BRUA2/42-173..QVLFQPSDEEDLSAFLKAVP.E.....EIP..LLVVGIGSNLLVRDG.G........VPG...FV-VRL.S.AK.GFG
Q32CF7_SHIDS/51-190P.AAVVKLGSTEQVSRVLNFMNAH.....KIN..GVPRTGASATEGGLE.T......VVENS...VV-LDG.S..A..MN
MURB_NEIG1/23-155..RAFIALKHADELRDIVRLPEFD.....RDT..VLWLGGGSNILLMQD..........YDG...LV-VHM....E..NK
Q5SKY9_THET8/4-133.....LRPESPEEVQEAVRAYP.........R..LRAQGGGTKPALSTP.........KEGE...VL-LDL.S..R..LR
Q81V24_BACAN/20-155P.HYTMYPESIQDVVEVIELARKK.....GKK..IRVVGSGHSFT.PLV.Q........TEE...IL-VSL.D..E..MK
Q8F4R3_LEPIN/53-187....VLFPEKEEDFKNIFSYADQK.....GLK..LTFRGGGCSYG.DAA.T.......NTKG...TV-INI.S..K..YN
Q8PCL6_XANCP/43-182P.GAVALPRDTDDVVAIVQACRAH.....GVP..IVARGAGTGTT.GAA.V......PFSGG...VV-VSM.A..R..MN
MURB_BORPE/34-165..PAFVALTEPSQLPALSALAPRF.....R.Q..LVVLGGGSNVVLPAS..........IDG...LV-AQV....R..LP
V4K8Y9_9ACTO/45-179P.ALIARCTGTPDVVAAVSFSRKS.....GLP..VAVRGGGHSMA.GHS.V.......CDGG...IV-IDL.T..L..MN

PF00941

AOXA_HUMAN/239-419E--LSVVNH----------A..Y....NGLTLGAGLSLAQVKDILADV.VQKLPEEKTQMYH.ALLK--HLGTLAG-SQI
Q7RXE4_NEUCR/265-448E--LRQYFL----------K..E....NHLEVGGNITLTDLENVCQEA.IKHYGEKRGQIFN.AMYK--QLKYFAG-RQI
XDH_EMENI/269-448E--LRQFAF----------H..D....NYLEIGANISLTDLESVCDQA.IERYGSARGQPFA.AIKK--QLRYFAG-RQI
Q97W13_SULSO/4-169E--LKYIKM----------E..G....NVVKIGPIVTHYDIIKA...............NIP.LLSE--TASKIAD-PQV
Q92V19_RHIME/2-221G--LDRIEP----------T.EE....GGLHIGAQVRNSDLAAD..........PIVRSRYP.ALSQ--ALLAGAS-GQI
Q92UU0_RHIME/2-217P--LNYIRA----------T..D....EAIVIGALARMSEVAAN..........QDVRRLQP.LIPE--TLTEGAS-PQL
Q9I2H2_PSEAE/2-218P--LRDIRR----------T.PT....GGLLVGALVSNAELAWN..........PAVEADYP.LLAQ--AILAGAS-PQL
O17892_CAEEL/259-440V--LHEKHL----------E..N....DGVYMGTGMSLTDMDNYSVQL.MKDLPREQTAVLK.HVHE--MLHWFAG-IHV
Q92UJ3_RHIME/205-373E--LQRIES----------S..T....AGLTIGAGVSYTAAH............EALSSAYP.SFGR--LLDRIGG-DQV
ALDO3_ARATH/222-398E--MSMIKK----------D..E....KGIEIGAAVTISNAIDALE......KESKSSYVFK.KMAT--HMEKIGN-RSI
Q8CJY1_STRCO/19-185E--IRGWQY----------Q..D....GHALLGAGLTHARMGR...........PDFAALIP.ALAA--AARAAGP-PQI
Q9Y9R9_AERPE/4-175G--LSYIRE----------E..G....GEIRIGALTTHNEIEES..........SLLKEKNP.LLSE--TASKIGD-LQV
Q6LQT9_PHOPR/1-157A--LDKIEL----------Q..G....EALHIGAMCHIQSLIDN..............ELTPVALKQ--AAAFIYS-RHI
Q6F9M6_ACIAD/202-370E--LKSIDI----------D..Q....NMLHIGANVSLSDAL............SKISDIYP.DFEE--LQRRFAS-MPI
Q92WF7_RHIME/2-220P--LDRIEE----------R.PD....GGLVIGATVRNTAVAGH..........PVVRDRYP.LLAQ--AIVFGAS-GQI
XDH1_ARATH/260-440E--LNALNV----------N..D....NGIEVGSALRLSELLRLFRKI.VKERPAHETSACK.AFIE--QLKWFAG-TQI
Q974U9_SULTO/4-169N--LSYITK----------D..G....NLYKIGALTTHYNISKS...............SIP.LLSE--TASNIGD-PQV
Q6N0U3_RHOPA/2-168A--LIGIEA----------S..G....DTLTIKAATTYYDIMHN..........ADVKRLIP.AIAH--LTSVLGD-PAV
Q92XI0_RHIME/2-221G--LDRIEA----------TRE.....GGLRIGALVRNTDLAAD..........ERVRRDYA.LLSR--ALLTGAS-GQL
Q98JI6_RHILO/2-217G--LDRIDV----------N..E....RGATIGALAKMGHVADH..........ADVKSRFP.AISE--ALWQAAS-AQI
ALDO1_ARATH/249-425E--FTMVRS----------D..E....KGVELGACVTISKAIEVL.......REEKNVSVLA.KIAT--HMEKIAN-RFV
Q9KBF1_BACHD/778-946E--CFELKM----------D..G....TNIILGAAQSLTKIRDA..............GLFP.FLNK--AIVEIAD-HTA
XDH_ORYSJ/268-448E--LHTLKV----------K..E....DGIHIGSSVRLAQLQNFLRKV.ILERDSHEISSCE.AILR--QLKWFAG-TQI
ALDO1_ORYSJ/239-416E--LSAINR----------S..S....NGIEIGAAVSISKAIEILR......SDGGDAVVFR.KIAY--HLGKVAS-PFV
ALDO1_MAIZE/244-417E--LSVINK----------N..D....KAIELGSVVSISKAIEV.........LSDGNLVFR.KIAD--HLNKVAS-PFV
Q8ZV34_PYRAE/7-173E--LRYIRE----------E.......EKLKIGALLTHNDVAMH..........ETVVRWAP.ALSL--AAWHIAD-LQV
XDH_CHICK/258-438E--MNAVQQ----------T..E....TGITFGAACTLSSVEEVLRKA.VAELPSYKTEIFQ.AALE--QLRWFAG-PQI
Q9RK26_STRCO/2-220P--LDTVEE----------L.PD....GSLRAGAMVRNSDLAAH..........PAVRDRYP.ALSQ--ALLAGAS-GQL
Q9EWZ3_STRCO/2-220P--LDAIEE----------T.AD....GGLRIGATVTNSDLAAH..........PEVRRRYP.ALTQ--AVLAGAS-GQL
O83120_TREPA/9-178E--LKDISK----------T..E....HFLEFGGAVSLQAIVRL............GRKNIPVALHE--ALSHAAN-PGI
Q92X32_RHIME/2-174N--LRDFTY----------D..P...AAGLRFGALVTVREIETS..........PHVIGNYP.NLAK--AVSLLGS-VQV
ALDO4_ARATH/228-407E--MSMIKK----------D..D....REIEIGAVVTISKVIDALM......EENTSAYVFK.KIGV--HMEKVAN-HFI
Q98D33_RHILO/32-199A--LRGISE----------T..D....DHFFIGARTTWTDLIRH...........PLPPAFD.ALKQ--AAREVGS-PQI
DCMM_OLICO/4-175D--LVGIRE----------E..G....TDVVIGAMTTQHALIGS..........DFLAAKLP.IIRE--TSLLIAD-PQI
Q9VF50_DROME/202-379D--LHQYSS----------D..K....EKLTLGASLSLTETMEIIQ.....STSKQSGFEYLEVLWH--HIDLVAN-VPV
Q88F21_PSEPK/195-363E--LKRIEK----------T..A....SHLEIGAATPLTDCY............AALNEEYP.DFGA--LLHRFAS-LQI
XDHC_BACSU/10-174E--MRGIST----------S..D....THVSIGGLTSLNECRKN..........PLIKRALS.CFSD--AASAVAA-PGI
Q8P785_XANCP/2-221T--LDTIDA----------T.PE....GGLRIGALVRNTDLAAD..........ARVRRDYA.VLSR--ALLAGAS-GQL
Q8XZD4_RALSO/2-168G--LAGIRS----------Q..P....GVVTVGAATRHADVADS..........EDVRRMLP.ALAE--LAGGIGD-RQV
Q89PE8_BRADU/4-175E--LRQIER----------K..G....DAVVIGAGVRQADLLAW..........PDLAETLP.LVAL--ALPWVGH-MQT
Q6LPZ7_PHOPR/191-359D--MKVLEE----------T..D....SDIIIGANLPISDCYEI............ISKHYP.DFGE--LLHRFAS-LQV
Q9KEV2_BACHD/4-177E--LKGVHL----------I..EEGGGQKLIIGAMTTLSECMGD..........SLLHEWCP.SVVT--SCGQIAA-PSV
Q89PX9_BRADU/4-175E--LKRAEV----------S..G....GELVLGALVTHADIEDG..........RTADVTRG.AMRG--VAANIAY-RAV
Q7TP79_RAT/448-628E--LNLVDT----------A..N....SGVTIGARHSLAQMKDILHSL.TLEQPKEKTKTHQ.ALLK--HLRTLAG-PQI
ALDOL_ORYSJ/224-406E--LSAIVR----------K..D....KGIEIGAATSISRTIEILNQE.SESTSSPNGSVVFRKLAE--HMSKVAS-PFV
Q8XXL8_RALSO/214-382D--LCALDK----------R..D....GWLEIGAAATLEQAYAF............LAEDYP.ELTE--MWRRFGS-LPI
ALDO2_ARATH/218-402H--LKEIRE----------N..Q....NGVEIGSVVTISKVIAALKE...IRVSPGVEKIFG.KLAT--HMEMIAA-RFI
Q73PR8_TREDE/6-176E--LKVISK----------T..E....RYFEFGAAVTLNEILDL............GKKNIPPSLYY--SIEKIAN-NAI
Q9EWG7_STRCO/216-384E--LRDLRV----------E..S....DHVEIGAALTLTEIE............RRLDGSVP.LLAQ--LFPQFAS-RLI
Q97VI7_SULSO/4-174S--LSYVRS----------S..F....NSTKIGALTRYNEILKN..........DLVRVNVP.LLHQ--AVRVVGD-MQV
A9CL41_AGRT5/2-219S--IIERRT----------D.......GSLLVGAGVKNTALAAH..........DAVRAQFP.LLSR--AILAGAS-AQI
Q8LHR9_ORYSJ/267-447E--LNSVSK----------D..V....KGVGIGAAMSISQVIEILRG....EGNSYKDVVFC.KIAD--HMEKVAS-QFV
Q7VS58_BORPE/4-175A--LREVGE----------R..G....GRVRVGAAVTHAEIEDG..........VHAALRGS.ALQQ--VATGIAY-RAI
Q89GV6_BRADU/4-175E--LRGVRR----------E..G....GYLRIGALTRHCEMLSE..........PLIAEFAP.LLAA--AAPFVAH-PAI
Q87YY2_PSESM/195-363E--MKRVER----------F..D....DRLEIGAATPLTDCY............AALKAQYP.DFGE--LLQRFAS-LQI
Q6MJY3_BDEBA/203-371D--TNEIKM----------T..A....DGVWVGARVTLTALENF............LEDKLP.ELSR--LLRIFAS-PQI
A9CI15_AGRT5/197-365D--LQTITV----------G..E....DGITLGAGVTYSQAF............KTIAEHFP.PLAR--LFDRLGG-EQV
Q89XH7_BRADU/2-168D--MIGIEA----------A..G....DTLTIKAATPHYDVATS..........DAAKKAIP.ALAY--LASLIGD-PAV
Q976U6_SULTO/9-170D--LRGVKE----------N..E....KEIEIYSLTTHNEVASKV........K.........LLSK--VAFTIAD-FQV
Q6AIN3_DESPS/3-161G--LDTVVD----------S..D....SSLEIGAMTSLREIETN..........PLILEMCQGLLSR--SVKNIVG-VQL
Q6AK64_DESPS/1-173E--LSDIAE----------A..D....GYIRIGANVTLSQVVNS..........KLVHQHAP.ALVQ--ACRKVGS-LQI
Q98CI6_RHILO/201-369G--LCTVSE----------D..K....GVISIGAGVTYTEAFSM............LAKRIP.ALGP--LFDRIGG-EQV
Q9FV24_SOLLC/235-418E--LSIIKR----------D..Q....AGIDIGSTVTIYKLISFLKEE.SKINFGSYGKLVSDKLAY--HMEKIAS-PFV
Q92VB8_RHIME/200-368E--LRRISI----------A..P....DGITLAAGVSYTEAY............PVIVRNFP.QLRE--LWDRIGG-EQV
D0IYQ4_COMT2/229-396E--MKRIEV----------R..PDAEGGELYIGAGASLESAWSA............LVQRWP.SLTD--VWLRFAS-TPI
D5API5_RHOCB/182-343D--LAQIRE----------T..P....DGYGIGAGVTIAALRAF............AEGPHP.ALAG--LLRRFAS-EQV
AOXC_MOUSE/240-418E--LFVVTN----------T..K....QGLTLGAGLSLTQVKNVLSDV.VSRLPKEKTQIYC.ALLK--QLKTLAG-QQI
G3XCQ8_RHOPA/7-214E--IKQLVA----------D..G....SGLTIGAGVTLASLAAD..........GLVAARYP.ALSE--AARAVAG-PGH
H9JLH6_BOMMO/1453-1632E--LNTITE----------N..E....HGLTVGASVTLNDIEKTFREY.IKKLPPYKTRVLT.AIVE--MLNWFAG-KQI
K4DAL9_SOLLC/235-416E--LSIIKR----------D..Q....TGIEVGATVTISKFISVLKEESHINLGSYGKLVSQ.KLAD--HMEKIAS-PFV
M4A7V2_XIPMA/239-417E--LFEVSE----------A..A....DGVWVGAGSSLSELQSLLEKM.VPQLPEEKTELFR.ALVQ--QLRNLGS-LQI
XDH_BOVIN/233-411E--LNAVEH----------G..P....EGISFGAACALSSVEKTLLEA.VAKLPTQKTEVFR.GVLE--QLRWFAG-KQV
Q2YPJ7_BRUA2/203-367E--LHSIRE----------E..N....GVVTIGAGVTYTQAFGF............LAGRIP.ALGQ--LINRIGG-EQV
XDHB_ECOLI/6-173E--LRGITL----------A.ED....GSLRIGSATTFTQLIED..........PITQRHLP.ALCA--AATSIAG-PQI
Q7Q3J8_ANOGA/229-405.--VDDDRA----------T.......SGLKIGSAVTLMEMEIALRKE.IETGPETETRLYQ.AIVD--MLHWFAG-KQI
Q89IH3_BRADU/3-167G--LNAIEM----------K..G....RSVVIGATAKHAEVATS..........AVVGEAIP.ALAS--LAGGIGD-PAV

PF01565

Q8EGS3_SHEON/42-180K...IEVSS......D...A-------KQITLGAAVIGSDANAV-------------------LAPL..NRKIGPD.PAT
GGLO_MOUSE/21-156R..VLQVDK......E...K-------KQVTVEAGILLTDLHPQ-------------------LDKH..GLALS.N.LGA
YITY_BACSU/45-181K..ILSLDQ......E...K-------KTIRVQSGATWNDIQKY-------------------VNPY..GLAVK.V.MQS
Q7RV07_NEUCR/47-186Q...FSMDN......K...T-------WQATIGAGSHLGDVTDR-------------------LHDA..GGRAMAY..GV
Q9YFD3_AERPE/61-201K..ILWFSG......E...D-------LVVHVEAGAVVSKVEEW-------------------LNRR..GYTLGYH.PQS
MURB_SYNE7/29-161G...ATFDL......A...T-------GCVEVAAGEPIPRLAWA-------------------A.AR..QGWSGLE.WAV
Q9RTM9_DEIRA/61-199G...LHIFP......E...R-------REAVAQPGVVTLKVTEA-------------------AKPH..GLMYPPD.PAS
MURB_STRP1/28-158A...VHLN...........G-------YTLEAEAGANLIETTKI-------------------A.KF..HSLTGFE.FAC
Q72F25_DESVH/44-183R..VRAIDT......R...N-------LVAEVDAGCITQTLRDA-------------------AAAA..NLFYPPD.PAG
Q9RJ97_STRCO/99-239R..LLDLDE......V...S-------RTATLQPGLRAPEAEAL-------------------LAEH..GYTLGHF.PQS
MURB_PECAS/20-153GIDIREESD..........G-------WYLHVGAGENWHQLVEY-------------------T.LK..CGITGLE.NLA
Q8XND2_CLOPE/36-171...NIIIDE......E...N-------MKVTIEGGVKNEEIYEA-------------------L.....GVLGYPF.PGG
Q8EGB1_SHEON/385-520D...IELDP......I...S-------GIVAIEPGCTIGNITSY-------------------LAQK..GLMLPHSTSAS
Q9HMR2_HALSA/64-202G..FVGFDP......E...A-------ETARAQPGITLAALNDE-------------------LAAH..GLKYAPD.PAW
Q98KY4_RHILO/16-149H..IGAFNA......E...T-------GVLEADAGVLLSDIIAH-------------------AAPY..GFFPAVV.PGT
Q9A8X8_CAUCR/61-191G..IVGWE...........G-------DEAIVRAGTRLGALGPL-------------------LAEK..GRALANL.PDI
O29450_ARCFU/37-175K..IEEINV......V...D-------GYAVAQPGVRIAELEER-------------------LNEH..SYTFPVD.PGS
Q7SHH8_NEUCR/74-210D...VKIDK......Q...R-------ETVTIGPGVVFADVFPV-------------------VSDA..GYQVQ...TGT
Q82G17_STRAW/96-229.....KTRA.........SG-------GTAVVGAGSKLIDVYRA-------------------LAAK..GVTIP...AGS
Q7N1V5_PHOLL/58-193NPVFEKID...........E-------YKFKVSAFETWLSVECF-------------------LRKN..GLSFPI..LTR
O33177_MYCTU/35-170H...ASIDA......D...K-------GRAVVGPGKGGSVLMAE-------------------LEAQ..GLFF....PGG
Q974L0_SULTO/23-162K..IIEINE......I...D-------WYAHVQPGVNLEYLNKE-------------------LNKK..GFFFPPD.PAS
Q6L2S1_PICTO/39-177N..IR.VNF......K...D-------GYVEAYAGATLQEVNNE-------------------CMKY..GYFFPPD.PSS
ADAS_DICDI/141-282K..VLWVDR......R...E-------MTACIQVGIMGPELEKQ-------------------LHKQ..GVSLGHD.PDS
Q9RVK1_DEIRA/39-176R..VLAIEP......G...G-------FQATVQPGVTYPELNRQ-------------------ARRH..GLFFPVD.PGA
MURB_HAEDU/19-152GIQHREDHD..........Y-------HYIQAQGGENWHNLVEW-------------------T.LA..KNIAGLE.NLA
Q7S1N4_NEUCR/85-222D...KSFDP......E...T-------GIASVGAGNTWGEVYTW-------------------LEGK..GRSVM...GGR
Q9F3A3_STRCO/70-207G..IEVLDD..........G-------ARARIRPGTTVVRANAT-------------------LARY..GRILGPD.PAS
MURB_SHEON/21-152KGISVTEDV......S...Y-------FYLEIEAGENWHELVEF-------------------T.LN..NHMAGLE.NLA
Q7V4C5_PROMM/41-176Q..I.NLDL......V...K-------GSVTAGAGVSLNQLLRV-------------------IVPA..GFFLPVT.PGT
MURB_NOSS1/59-191H..FDHQTG..........Q-------VTIAAGESIP..SLAWE-------------------I.AK..LGWQGFE.WAV
MURB_BACSU/34-165H...LELE...........G-------EQVTVGGGYSVVRLATS-------------------L.SK..KGLSGLE.FAA
Q7NFT8_GLOVI/37-175R..VIEVNP......E...E-------GTAWVEPGVVQDVFKQH-------------------LRPY..GLQFGPE.TAT
MURB_ACIAD/22-156GLEMIDEDS......E...S-------VKIKVGGGQIWHDFVLM-------------------T.TQ..KGWYGLQ.NLA
Q9KB02_BACHD/48-187R..LLEVDL......K...N-------RRAIVEPGYVNLKLTQS-------------------IEDK..GYYYAPD.PSS
MURB_ECOLI/17-150GIEIHDEPD..........A-------WYLHVGAGENWHRLVKY-------------------T.LQ..EGMPGLE.NLA
Q7NCA8_GLOVI/44-184R..LVEHAA......G...D-------LTVTAEAGIGFAVLQEK-------------------LAKA..NQFLALD.PAY
Q8CJQ0_STRCO/57-195R..VESVDP......G...A-------RTCVVQPGIVLDDLNRQ-------------------LAPH..GLRYGPE.PAT
Q726S9_DESVH/41-181K..IIEINE......Q...D-------LYAVVEPGVVTAKFAAE-------------------VAKR..GLFYPPD.PGS
Q98I12_RHILO/59-194K..V.TVDA......A...A-------KTMTLQPGARWHDIQNL-------------------L.....HPRFAVKAMQS
MURB_PSESM/23-157I..VREDCL..........E-------AIVEAEAGEPWHPFVQS-------------------C.LE..LGLAGLE.NLS
Q8TH91_METAC/83-222R..ILEVDI......D...N-------IQVVVEPGIIQDALNEA-------------------LKPY..GFFFPPN.PGS
MURB_WOLPM/30-160...YIKSKG..........N-------NSIVAGGAVLLSNLAHF-------------------A.GN..QQISGLE.FLV
O50531_STRCO/29-164G..IRSIDR......D...A-------MTVTVEAGTPLKRLNMA-------------------LARE..GLSLT.N.MGD
MURB_AQUAE/21-153GFKVKEIKG..........K-------FFVEAFSGTPLKDLIRF-------------------S.VK..ENVKSFY.KLL
ALO_SCHPO/28-163K..VVSFDP......D...S-------LSITVQAGIRFYQVQEI-------------------LQNL..GYSLP.I.VGS
ADAS_MOUSE/193-336R..ILWVDE......N...N-------LTAHVEAGITGQDLERQ-------------------LKES..GYCTGHE.PDS
MURB_CAUCR/32-163G..VEALG...........D-------NRIKAGSAVPDAILARK-------------------A.AE..AGIAGLE.FYV
MURB_STRCO/53-183R..GFRLD...........G-------TTLELAAGEIWTDAVAR-------------------T.VE..AGLAGVE.CLA
Q98KG4_RHILO/152-289R..ILAVNP......Q...D-------LDCTVEPGVTREDLNRH-------------------LRDT..GLFFPID.PGA
Q8FNC2_COREF/44-182R..ILDIDP......E...N-------RTATIEPGVVCDALRDA-------------------VAPL..GLTYGPD.PST
Q9KKW5_VIBCH/47-184G..HEVQNQ..........G-------LKIRLQPGVIGADANKY-------------------LAPF..QRKIGPD.PAS
Q82SS0_NITEU/46-186R..IHEVDE......A...L-------GYAVIEPGVTYKQLNEF-------------------LKANYPDLWSDSA.GTT
Q9A317_CAUCR/35-173A..IRDVDP......I...D-------DAMVLEAGVTLYEAHQQ-------------------AAKV..GRRFTVG.VAS
Q7U5R3_SYNPX/72-213E..VEHLDP......S...T-------GVVMVQPGCLMRDLDQH-------------------LRAH..GRQLRLL.PST
MURB1_CORGL/41-172ENFSNFIIE..........G-------SRIRAQAGASVPQLVRA-------------------V.AT..EGLEGIV.HAG
Q7N7Z9_PHOLL/19-157V..LREIDC......S...S-------GWAVIESGLTQIELARF-------------------LVGT..DRMLNVT.ASS
Q7S350_NEUCR/67-202Q..VKLSAD..........K-------SVAEIGFGNIWTDVYKA-------------------LDGT..GRNV....VGG
Q8XW09_RALSO/54-193R..ILKLDP......H...T-------RTAAVQPGVRNLAISEA-------------------AAPH..GLYYAPD.PSS
MURB_VIBCH/21-154GIEHQQDDD..........Y-------HRLHVAGGEDWPSLVSW-------------------C.VE..QGIGGLE.NLA
ALO_ASHGO/29-168G..VLELQEDE..QGR...Y-------ADVTVAAGIRVYELHRY-------------------LSAR..GYALQ.N.LGS
MURB_CLOAB/38-168K...LQIG...........N-------NKIIAGCGVPLGYLSRK-------------------A.RD..KSLTGLE.FAC
Q92RW6_RHIME/20-155G..VQKVDK......A...R-------KQITVAGGTRINEVGKT-------------------LKQH..GLSLINQ..GD
Q9PBD9_XYLFA/32-171K..MLRFDP......M...D-------RTMTVQAGMPLEAVQAA-------------------ARQH..GLLYPVD.FAA
P71984_MYCTU/42-177A...VSLDP......A...T-------GRVRVQGGATLADLDHA-------------------TVPF..ARVAP...AGI
Q726N5_DESVH/138-278R..ITSVDT......D...A-------LRLCCEAGVITNDAIRA-------------------ASAK..GLLFTVD.PAS
Q8KEW7_CHLTE/25-165R..IGEVEP......TIDGR-------ALLRVQGGALLQDVQAK-------------------AAAA..GWFYPPD.PTE
Q97U59_SULSO/47-180N..VVEISD......D...D-------LYVTSQVGVRVSDLFEI-------------------IKAK..GLFLPAY....
Q9I3S8_PSEAE/39-178R..IHRLDA......A...S-------QTLDLDAGVTLEQAQAL-------------------AAEA..GLDPGID.LAA
CKX11_ORYSJ/45-187R..RMQLVV......APSGE-------KFADVPGGALWEEVLHW-------------------AVSK..HGLAPAS.WTD
Q92X65_RHIME/28-163G..LREHDA......Q...H-------HRATVGAGSQLTELSKE-------------------LQAA..GMTLS.N.FGD
Q7NZ82_CHRVO/51-186G..LLSYDA......A...A-------GEAILQAGTRIGQLARL-------------------LDAQ..GMALRNQ.PDV
P74033_SYNY3/47-186R..IISLEP...........-------GRAVVEPGVKLGKLEQQ-------------------AKQM..GWELRLL.PST
Q9S2F6_STRCO/73-212R..ILEINP......V...D-------RVAVVEPGVVNATLSRA-------------------VNEH..GLYYPPD.PSS
Q983S0_RHILO/19-151G..LVSHDP......Q...K-------HQARVKAGTRLGPLMHI-------------------LQGI..GQGLP.N.MGD
MURB_BUCBP/20-153GITIHEQKD..........Y-------WLLHVKGGTKWNNLVKY-------------------T.IQ..KKIYGLE.NLA
YVDP_BACSU/33-169K..VFLDEE..........N-------AIATVQTGIPVGPLVKG-------------------LARD..GFMAP...FGD
O29393_ARCFU/49-187Q...IEIDE......E...N-------MVVRAGAGVVGGRLEKI-------------------LNHR..GFTLRHS.PQS
Q7URF5_RHOBA/77-214R..ISPSDD..........G-------MQVTVQSGATLSSVNRF-------------------LKGH..RRWFGPD.PAT
Q6CCU5_YARLI/112-251K..VRSFDN......V...S-------GILVADAGVILEAADMY-------------------LAEQ..GFMFPLD.LGA
Q7S0U1_NEUCR/79-214T...INIQP......N...G-------KSAWFGGGVFDGQANRY-------------------LWDQ..GYVTT...TGS
DIML_CAEEL/59-199D..ILDLDV......E...K-------MTVKAEPGVTMGQLSQY-------------------LISR..GYTLPVL.PEL
Q6NAC4_RHOPA/97-241K..VLEVDA......T...S-------RAALIQGGAYGPALEAQ-------------------LKPH..NVTLRHF.PQS
Q8F3Y7_LEPIN/117-261S..LLSLDL......E...S-------HLATFQTGIYGPPLEIS-------------------LNEK..GFTLGHF.PQS
Q9HTK4_PSEAE/8-144G..IVAYDP......C...E-------LVITARAGTPLDELQAV-------------------LARG..GQMLACEAPGF
ALO_NEUCR/51-186K..VISVDH......L...T-------GLVVVQAGIRLYQLSDE-------------------LDRR..GLALP.S.LGS
Q96YM3_SULTO/46-183K..V.EIDE......S...N-------MVAITEPGATWKLVDLA-------------------AQNK..GLQLRTF.PSS
Q9SA87_ARATH/77-216T...VDVNL......T...E-------RTAWVDSGATLGELYYR-------------------ISEK..SNVLGFP.AGL
Q6ALH1_DESPS/43-180D..YEVLEE..........G-------QKIRLQPGIVGAKVNRI-------------------LAPY..NRKFGPD.PAS
Q8YZY0_NOSS1/35-172H..VSKVDT.........VA-------QAIATEAGATWQDIVTT-------------------TVKY..GMLPCVL.PLN
Q97Y18_SULSO/44-180R..IIEFNE......E...D-------LSVTVEVGIKIKDLEEW-------------------LNKR..GYTLDYH.PQS
Q9KB00_BACHD/33-172G..IVDHSI......G...D-------MTVTVKAGTPLRKLQKE-------------------LAIF..KQALPFD.MPC
Q97U60_SULSO/35-172R..IYSLD...........N-------FEITVGPGLANFLINKT-------------------LGNS..NLFYAPD.PSS
Q96XG8_SULTO/47-186K..VLELDG......D....-------.FLKISPGVKVLQALNY-------------------LRKK..GKELRVY.PSS
MURB_YERPE/20-153R..IMGITSTE..DSA...A-------WYLHVGAGENWHQLVCH-------------------S.LQ..NNMPGLE.NLA
Q6N8A2_RHOPA/39-178T..IEEIDP......K...Q-------RTAVVQAGVPLQALQEE-------------------VDKH..DLAFPLD.LGS
Q9HTM8_PSEAE/30-162G..LLSHDS......V...T-------LQAEFGGGTPMSQMGAP-------------------LKEI..GQALV.N.MAD
Q89HF0_BRADU/40-178R..ILSLDV......A...N-------RTCVVEPGIVLDDLNRQ-------------------LRKH..GLWFPVD.VST
MURB_LEIXX/19-154R..LAAEKG..........R-------IRLRVQAGEPWDALVAL-------------------T.VR..NGWAGIE.ALS
Q7YWB6_LEIMA/137-280R..MISIDR......E...S-------RLATFETGVLGPDLDAQ-------------------LFRH..GFMLGHD.PDS
Q8ERP2_OCEIH/37-174T..VLEFSP......E...N-------MTVTVQPGITRFRLNDY-------------------INSA..GLYFPVD.PGV
Q9HKQ4_THEAC/37-176H..IIDLNL......N...D-------KCVVAEPGVRLDDLERF-------------------LDKY..GHFYPPD.PAS
XYOA_STRCO/17-150S..VVDVDT......A...A-------RTVRVGGGVRYAELARV-------------------VHAR..GLALP.N.MAS
Q869M2_DICDI/40-172G..LKYNDY..........E-------KTVTIESGCRLGEMDKE-------------------NQKH..GYIIP...SGI
Q883D1_PSESM/55-190N...ITLDV......T...T-------GILAVQPGVRLAEIDEF-------------------LVSR..NLVIP...TGT
A4XDV9_NOVAD/50-189R..ILEVNE......K...Y-------GYALVEPGVSYFQLHRH-------------------LRKI..GSKLWVD.PAA
A4XDW3_NOVAD/40-176K..VLEVND......E...L-------ATCLVEPGVTFRQLDAH-------------------IKEK..GIKLWVDFPGN
F9UTP6_LACPL/50-187R..IIEISK......A...D-------SIAVVEPGVVNGDLDKE-------------------ARKQ..GMFYAPD.PGS
G4UXW0_NEUT9/71-205R..VIAFHP......E...D-------MDVVVQPGVNWVDLNNQ-------------------IAHT..GLFVPLD.PSP
K4D2I8_SOLLC/110-239K..VLSVDK......E...N-------KRVTVQAGIRVQQLVDE-------------------IKEF..GITLQ.N.FAS
O07406_MYCTU/37-173V..VSDVDT......V...E-------RRIEIGAGVTLAAVQHA-------------------ASTA..GLVFGVD.LSA
O25820_HELPY/43-179D..AQILD.......N...A-------QSIQLSCGVIGSNANAL-------------------LKPY..HKKIGPD.PST
O53608_MYCTU/74-210G..DINYDA......T...T-------GRVTVTPATGLYAMHQV-------------------LAAA..GRGIP...TGT
GULDH_MYCTU/16-151R..VLDVDQ......P...T-------GLVTVEGGAKLRALGPQ-------------------LAQR..RLGLE.N.QGD
MURB_MYCTU/34-167S..GITID...........G-------NLVRAEAGAVFDDVVVR-------------------A.IE..QGLGGLE.CLS
Q0SJV5_RHOSR/43-180R..VLSIDR......D...A-------QTATVEPGTIQTVLQQA-------------------VAPH..GLRFGPD.PST
Q0WGW9_YERPE/389-525G...LDIDS......R...H-------KRAIVESGVSSGQLCHA-------------------LAAK..GLAFP...TGH
Q1K764_NEUCR/70-205T...LNVSS......D...R-------KTVSIGAGNRWINVSEA-------------------LDTL..GLVVA...GGR
MURB_STAA8/38-166H...IEVS...........D-------DAIIAGSGAAIIDVSRV-------------------A.RD..YALTGLE.FAC
Q2USP5_ASPOR/124-262G...IEFKDWKDEHYT...G-------KAVKLGAGVQGFEAYEA-------------------ANAQ..GLRVV.G.GEC
MURB_BRUA2/42-173E..VEQVC...........D-------TQLRAGAAAPDKRVAAA-------------------A.LE..AGLAGFH.FYH
Q32CF7_SHIDS/51-190Q..IINIDI......E...N-------MQATAQCGVPLEVLENA-------------------LREK..GYTTGHS.PQS
MURB_NEIG1/23-155G..IREIAR......SD.GM-------VLIEAQAGEIWHDFVLH-------------------T.VA..LGLSGLE.NLS
Q5SKY9_THET8/4-133G..LLAYEP......E...E-------FVFTAFAGTPIAEVEEA-------------------LRAH..GQYLPFDPPLA
Q81V24_BACAN/20-155G..IVNIDT......E...K-------MIAEVWAGTKLHELGKL-------------------LEEK..GYAQE.N.LGD
Q8F4R3_LEPIN/53-187R..ILEFDS......K...N-------GIIKAESGVTIKQLWEF-------------------GIEK..GYWPPVV.SGT
Q8PCL6_XANCP/43-182R..ILALRP......A...D-------RCAVVQPGVLNGDLQQA-------------------LQPH..GLFWPPD.PSS
MURB_BORPE/34-165GVRLVGQCA......D...A-------WVVEAAAGENWHGFVTA-------------------C.VD..NGWDGLE.NLA
V4K8Y9_9ACTO/45-179S...IKVSR......R...L-------RRARAQGGCLLGAFDTA-------------------TQAH..MLATP...AGV

PF00941

AOXA_HUMAN/239-419RNMA-SLGGHI.............................................ISRHPDSDLNPILAVGNCTLNLLS
Q7RXE4_NEUCR/265-448RNVG-TPAGNL.............................................VTASPISDLNPVLLAADAVLVAKS
XDH_EMENI/269-448RNVA-SPAGNL.............................................ATASPISDLNPVFVATNTTLVARS
Q97W13_SULSO/4-169RNMG-TIGGSI.............................................SHLDPSADYPAALIAMNAKVRIRS
Q92V19_RHIME/2-221RNKA-STGGNLLQRTRCPYFYNRNMPCNKREP..GAGCAALRGFNRMHAVIGTSQACIAVHPSDMAVAMAVLDANVETVS
Q92UU0_RHIME/2-217RNVA-SIGGNLLQRVRCPYFRMLDAPCNKRVP..GSGCSAIDGLNAGHAILGTSEHCVATHPSDLAVSLVALGAMLSLKG
Q9I2H2_PSEAE/2-218RNMA-STGGNLLQRTRCQYFYDTGTPCNKREP..GSGCPARSGLNRNHAILGASEHCVAVHPSDLCVALAALEAQVLVRG
O17892_CAEEL/259-440RNVA-SVAGNI.............................................ATASPISDLNPIWMASNALVVLDS
Q92UJ3_RHIME/205-373RNMG-TIGGNI.............................................ANGSPIGDSPPPLIVLGATVTLRS
ALDO3_ARATH/222-398RNSG-SIGGNLV..........................................MAQSRKFPSDVTTLLLAVDASVYMLN
Q8CJY1_STRCO/19-185RNAG-TLGGNI.............................................ASAAPTGDALPVLAALEATLIIAG
Q9Y9R9_AERPE/4-175RNMG-TIGGSL.............................................AHADPAADYPAALAALEASVVLRS
Q6LQT9_PHOPR/1-157RNQA-TIGGEI.............................................AAFQSEALLVPSLMALKATVILAN
Q6F9M6_ACIAD/202-370KNAG-TLGGNI.............................................ANGSPIGDSMPALITLDTILRLRS
Q92WF7_RHIME/2-220RNMA-TVAGNLMQRTRCLYFYDHAARCNKRAP..GAGCDAIGGFNRMHAILGASDSCIATHPSDMCVALAALDAKVNVIG
XDH1_ARATH/260-440RNVA-CIGGNI.............................................CTASPISDLNPLWMASRAEFRITN
Q974U9_SULTO/4-169RNMG-TIGGSI.............................................SHLDPSADYPAALIAMDAKVKITS
Q6N0U3_RHOPA/2-168RYRG-TIGGSV.............................................ATNDPAADYPAAILALNATVKTN.
Q92XI0_RHIME/2-221RNRA-TTAGNLLQRTRCPYFYDTNQPCNKRQP..GSGCSALAGFSRQLAVVGVSDACIASHPSDMAVALRALDAVVETVR
Q98JI6_RHILO/2-217RNMA-TIGGNLMQRTRCPYFRDPSNFSACNKRVSGSGCSAIGGVTRGHAVLGTSEACIAMYPGDLATALVAFDATVHLG.
ALDO1_ARATH/249-425RNTG-TIGGNIM..........................................MAQRKQFPSDLATILVAAQATVKIMT
Q9KBF1_BACHD/778-946RNKI-TLGGNL.............................................CANIIYRETALPLLLTNSQVVIAS
XDH_ORYSJ/268-448RNVA-SVGGNI.............................................CTASPISDLNPLWMATGATFEIID
ALDO1_ORYSJ/239-416RNTA-TIGGNII..........................................MAQRMSFPSDIATVLLAAGSTVTIQQ
ALDO1_MAIZE/244-417RNTA-TIGGNIM..........................................MAQRLPFESDVATVLLAAGSTVTVQV
Q8ZV34_PYRAE/7-173RNRG-TIGGSL.............................................AHADPAANYPAVLAALNAEVAVRR
XDH_CHICK/258-438RNVA-ALGGNI.............................................MTASPISDLNPVLMASGSKLTLIS
Q9RK26_STRCO/2-220RNAA-TTGGNLLQRTRCPYFQDVSKPCNKREP..GTGCGALEGVHRDHAVLGHSDQCIATHPSDMAVALAALDARVELHG
Q9EWZ3_STRCO/2-220RNMA-TVGGNLLQRTRCGYFTDLSKPCNKRAP..GSGCSAVTGEHHNHAVLGASDHCVAVHPSDMGVALAAFDAVVGYET
O83120_TREPA/9-178RTLA-TIGGNI.............................................AGTRPHASALAPLIALDAKMEVRT
Q92X32_RHIME/2-174RNRA-TIVGNI.............................................CRASPSADTIPPLIADGASLSVYN
ALDO4_ARATH/228-407RNSG-SIGGNLV..........................................MAQSKSFPSDITTLLLAADASVHMIN
Q98D33_RHILO/32-199QNVA-SVAGNL.............................................CNASPAADGVPGLLVLDAEVELRS
DCMM_OLICO/4-175RYMG-TIGGNA.............................................ANGDPGNDMPALMQCLGAAYELTG
Q9VF50_DROME/202-379RNSG-TLAGNICT.........................................KKEHPEFPSDIFISFEALDVKVVAMK
Q88F21_PSEPK/195-363RNQG-TLGGNI.............................................GNASPIGDSPPLLIALDAQVVLRQ
XDHC_BACSU/10-174RSRA-TIGGNI...............................................ASKIGDFIPLLLVLGAELIVYQ
Q8P785_XANCP/2-221RNRA-TTAGNLLQRTRCPYFYDTNQPCNKRLP..GSGCAAIGGFNRQLAVIGASEDCIATHPSDMAVAMRALDAVVETVR
Q8XZD4_RALSO/2-168RAMG-TLGGSL.............................................ANNDPAACYPAAVLALNATVVTE.
Q89PE8_BRADU/4-175RSRG-TICGSL.............................................AHADPSAEIPLTLVALGGEVFLRN
Q6LPZ7_PHOPR/191-359RNQG-TLGGNI.............................................ANASPIGDAPPLLIALNANITLRR
Q9KEV2_BACHD/4-177RNQG-TIGGNV.............................................MTGT..GDTLPALLTYDAQLCWYQ
Q89PX9_BRADU/4-175RNRG-TIGGSL.............................................SHADPAADWFSALAALGAQVTLRS
Q7TP79_RAT/448-628RNMA-TLGGHV.............................................VSRPDFSDLNPILAAGNATINVIS
ALDOL_ORYSJ/224-406RNTA-SIGGNII..........................................LAHKYPFRSDIATILLGAAATVNLQV
Q8XXL8_RALSO/214-382RNAG-TLGGNI.............................................ANGSPIGDSAPALIALGARVVLQR
ALDO2_ARATH/218-402RNFG-SIGGNLV..........................................MAQRKQFPSDMATILLAAGAFVNIMS
Q73PR8_TREDE/6-176RSLA-TIGGNI.............................................ATANPLSGTFLPMLALDAKLEIRT
Q9EWG7_STRCO/216-384RNGA-TLGGNL.............................................GTGSPIGDSPPVLLALEASLVLAD
Q97VI7_SULSO/4-174RNLG-TIGGSA.............................................ANADPSADIPTVLTALNAEIILSS
A9CL41_AGRT5/2-219RNVA-TVGGNILQRTRCRYFYDNAARCNKRQP..NSGCDALEGFNRYHAILGASESCVATHPSDMCVALVALDASVHLQG
Q8LHR9_ORYSJ/267-447RNMA-SLGGNLI..........................................MAQRDEFASDIATVLLAAGSSLCIQV
Q7VS58_BORPE/4-175RNRG-TIGGSL.............................................AHADPAADWVLTMVALGADIEIAG
Q89GV6_BRADU/4-175RNRG-TFGGSV.............................................ALADPASEFPAMTLALDAEIEVVG
Q87YY2_PSESM/195-363RNQG-TLGGNI.............................................GNASPIGDSPPLLIALGAQIVLRK
Q6MJY3_BDEBA/203-371KNQA-TLVGNV.............................................MNGSPIGDSIPALLALDAEVHLQS
A9CI15_AGRT5/197-365RNMG-TIGGNI.............................................ANGSPIGDTPPALIALGATLTLRS
Q89XH7_BRADU/2-168RYRG-TIGGSL.............................................ANNDPAADYPAATLALGATVKTN.
Q976U6_SULTO/9-170RNKG-TIGGSL.............................................AHADPSSNYYPALLTLDAKVKVKS
Q6AIN3_DESPS/3-161RNCV-TIGGSV.............................................MGRYPFSDPITALVALDAELLFHG
Q6AK64_DESPS/1-173RNVA-TVVGNV.............................................VTANPAADAAVALACLDTSVEVVD
Q98CI6_RHILO/201-369RNMG-TIGGNI.............................................ANGSPIGDTPPPLIALGARLTLRK
Q9FV24_SOLLC/235-418RNSA-SVGGNLV..........................................MAQKNGFPSDIATLFLGLCATVSLMT
Q92VB8_RHIME/200-368RNMG-TVGGNI.............................................ANGSPIGDTPPALIALGASVTLRK
D0IYQ4_COMT2/229-396RHAG-TMGGNV.............................................ANGSPIGDSPPVLMALDAQIELRK
D5API5_RHOCB/182-343RQVA-TIGGNI.............................................ANGSPIGDGPPALIAMGASLTLRR
AOXC_MOUSE/240-418RNVA-SLGGHI.............................................ISRLPTSDLNPILGIGNCILNVAS
G3XCQ8_RHOPA/7-214RKLG-TVGGNLCLDTRCIYYNQSEWWRRAN.......SYCLKNRGEICHVAPKGNRCHAAFSGDLAPALLVLGAEVEIAG
H9JLH6_BOMMO/1453-1632RNVA-AIGGNV.............................................MTGSPISDLNPILMSLKVKLNLLS
K4DAL9_SOLLC/235-416RNSA-SVGGNLV..........................................MAQKNGFPSDIATLLLGLSATVSLMT
M4A7V2_XIPMA/239-417RNVA-SLGGNI.............................................VSAYPNSDLNPVLAAGNCKVKVVS
XDH_BOVIN/233-411KSVA-SLGGNI.............................................ITASPISDLNPVFMASGTKLTIVS
Q2YPJ7_BRUA2/203-367RNMG-TIGGNI.............................................ANGSPIGDTPPPLIALGATLTLRK
XDHB_ECOLI/6-173RNVA-TYGGNI.............................................CNGATSADSATPTLIYDAKLEIHS
Q7Q3J8_ANOGA/229-405RNVA-SVGGNI.............................................MTGSPISDLNPIFTAAAIELEVAS
Q89IH3_BRADU/3-167RHKG-TIGGSL.............................................ANNDPTADYPAAVLALGATIVTN.

PF01565

Q8EGS3_SHEON/42-180IASA.KIGGIV----------------------------------------------------------ANNASGMCCGT
GGLO_MOUSE/21-156VSDV.TVGGVI----------------------------------------------------------GSGTHN.TGIK
YITY_BACSU/45-181QNIF.TIGGSL----------------------------------------------------------SANAHG.RDIR
Q7RV07_NEUCR/47-186CPDV.GIGGHA----------------------------------------------------------TIGGLGPMSRM
Q9YFD3_AERPE/61-201QSLA.TVGGSI----------------------------------------------------------AMLGSGALAPG
MURB_SYNE7/29-161GIPG.TLGGAV----------------------------------------------------------VMNAGAQGGCM
Q9RTM9_DEIRA/61-199FRTS.TIGGNL----------------------------------------------------------GENAGGPMCFK
MURB_STRP1/28-158GIPG.SIGGAV----------------------------------------------------------FMNAGAYGGEI
Q72F25_DESVH/44-183MDRS.TVGGNV----------------------------------------------------------ATNAGGPACVK
Q9RJ97_STRCO/99-239YEWA.TVGGFA----------------------------------------------------------ATRSSGQASAG
MURB_PECAS/20-153LIPG.CVGSAP----------------------------------------------------------IQNIGAYGIEL
Q8XND2_CLOPE/36-171GCPTVGVVGFA----------------------------------------------------------LGGGWGYSSRL
Q8EGB1_SHEON/385-520H....ALAGFI----------------------------------------------------------MGGGWGPWCRK
Q9HMR2_HALSA/64-202GDKS.VLGGAI----------------------------------------------------------GNNSTGAHSLQ
Q98KY4_RHILO/16-149Q.FV.TLGGAI----------------------------------------------------------ANDVHGKNHHR
Q9A8X8_CAUCR/61-191NKQ..SLGGAL----------------------------------------------------------GTATHGTGIKI
O29450_ARCFU/37-175VRSA.TVGGAI----------------------------------------------------------NTGAGGMRGAK
Q7SHH8_NEUCR/74-210CSCV.GMIGAT----------------------------------------------------------IGAGIGRLDGV
Q82G17_STRAW/96-229CPTV.GVSGLT----------------------------------------------------------LGGGHGVVSRA
Q7N1V5_PHOLL/58-193HPDT.TVGGTL----------------------------------------------------------SVGGYGEDSYL
O33177_MYCTU/35-170HCRGVCLGGYL----------------------------------------------------------LQGGYGWNSRI
Q974L0_SULTO/23-162FFLC.TVGGAT----------------------------------------------------------ANSSGGMRGVK
Q6L2S1_PICTO/39-177VSTA.TVGGAV----------------------------------------------------------NENSGGMRCAR
ADAS_DICDI/141-282FEFS.TLGGWL----------------------------------------------------------ATCSSGHQSDK
Q9RVK1_DEIRA/39-176..EA.SLGGMA----------------------------------------------------------STNASGTGAVK
MURB_HAEDU/19-152LIPG.VVGSAP----------------------------------------------------------IQNIGAYGVEF
Q7S1N4_NEUCR/85-222YEEI.GVAGFV----------------------------------------------------------LGGGMPGFVNL
Q9F3A3_STRCO/70-207AIAC.TVGGVV----------------------------------------------------------ANNASGMTAGT
MURB_SHEON/21-152LIPG.TVGAAP----------------------------------------------------------IQNIGAYGVEL
Q7V4C5_PROMM/41-176R.NV.TIGGAI----------------------------------------------------------AADVHGKNHHV
MURB_NOSS1/59-191GIPG.TVGGAV----------------------------------------------------------VMNAGAHNSCI
MURB_BACSU/34-165GIPG.SVGGAV----------------------------------------------------------YMNAGAHGSDM
Q7NFT8_GLOVI/37-175ASRA.TLGGMA----------------------------------------------------------ANNSAGARSIL
MURB_ACIAD/22-156LIPG.LVGASP----------------------------------------------------------VQNIGAYGVEV
Q9KB02_BACHD/48-187QYCC.TIGGNV----------------------------------------------------------AENAGGAHCLK
MURB_ECOLI/17-150LIPG.CVGSSP----------------------------------------------------------IQNIGAYGVEL
Q7NCA8_GLOVI/44-184PEQA.SLGGVL----------------------------------------------------------STADSGPLRHR
Q8CJQ0_STRCO/57-195HPNC.TIGGMI----------------------------------------------------------GNNSCGATAQA
Q726S9_DESVH/41-181QAVS.TLGGNV----------------------------------------------------------AENAGGLRGLK
Q98I12_RHILO/59-194TDIF.SVGGSL----------------------------------------------------------SVNAHG.MDHQ
MURB_PSESM/23-157LIPG.TVGAAP----------------------------------------------------------MQNIGAYGVEI
Q8TH91_METAC/83-222SAMC.TIGGMI----------------------------------------------------------AYNASGMRCVK
MURB_WOLPM/30-160GIPG.TVGGGI----------------------------------------------------------EMNAGAYGSDI
O50531_STRCO/29-164IMEQ.TVSGAT----------------------------------------------------------STGTHGTGRDS
MURB_AQUAE/21-153GFPA.SVGGAV----------------------------------------------------------SMNAGAFGVEI
ALO_SCHPO/28-163ISET.SVSGIM----------------------------------------------------------STCTHGSSLQH
ADAS_MOUSE/193-336LEFS.TVGGWI----------------------------------------------------------STRASGMKKNI
MURB_CAUCR/32-163GVPG.TIGGAV----------------------------------------------------------IMNAGCYGAET
MURB_STRCO/53-183GIPG.SAGATP----------------------------------------------------------IQNVGAYGQEV
Q98KG4_RHILO/152-289..NA.SLGGMA----------------------------------------------------------ATRASGTNAVR
Q8FNC2_COREF/44-182HNRC.TIGGMV----------------------------------------------------------ANNACGSHSVA
Q9KKW5_VIBCH/47-184INTC.KIGGIA----------------------------------------------------------ANNASGMCCGT
Q82SS0_NITEU/46-186QFAS.VLGNAL----------------------------------------------------------DK...GRGLTP
Q9A317_CAUCR/35-173EGSC.TIGGLI----------------------------------------------------------STNAGGTAVLR
Q7U5R3_SYNPX/72-213WRSA.SIGGFL----------------------------------------------------------AGGSGGIGSIR
MURB1_CORGL/41-172GIPG.TVGGLV----------------------------------------------------------VMNGGTQRRGI
Q7N7Z9_PHOLL/19-157GHTS.VVGNAL----------------------------------------------------------DRGV.GLRRQR
Q7S350_NEUCR/67-202RVPGPGVGGLT----------------------------------------------------------LGGGYSWKTNQ
Q8XW09_RALSO/54-193QIAC.TIGGNV----------------------------------------------------------SENSGGVHCLK
MURB_VIBCH/21-154LIPG.CAGSAP----------------------------------------------------------IQNIGAYGVEF
ALO_ASHGO/29-168ISEQ.SVGGII----------------------------------------------------------STGTHG.SSPY
MURB_CLOAB/38-168GIPG.SVGGAV----------------------------------------------------------AMNAGAYNGEI
Q92RW6_RHIME/20-155IDSQ.AVAGAF----------------------------------------------------------TTGTHG.TGIK
Q9PBD9_XYLFA/32-171RGSC.SIGGTI----------------------------------------------------------ATNAGGIRVVR
P71984_MYCTU/42-177VTTT.GVGGLT----------------------------------------------------------LGGGVGWTTRR
Q726N5_DESVH/138-278KTAS.TIGGNI----------------------------------------------------------SENSGGPFAFE
Q8KEW7_CHLTE/25-165KTCF..IGSTI----------------------------------------------------------SNNSTGSRSLK
Q97U59_SULSO/47-180.YDG.SLGGLL----------------------------------------------------------ATNLPTPFSSF
Q9I3S8_PSEAE/39-178RGSA.SVGGLV----------------------------------------------------------ATNAGGIRAFR
CKX11_ORYSJ/45-187YLRL.TVGGTL----------------------------------------------------------SNGGVSGQSFR
Q92X65_RHIME/28-163VATQ.TVGGAI----------------------------------------------------------GTGTHGSGRDF
Q7NZ82_CHRVO/51-186DVQ..SFAGAI----------------------------------------------------------STATHGTGAGL
P74033_SYNY3/47-186YQTA.TVGGFV----------------------------------------------------------SGGSTGMGAVN
Q9S2F6_STRCO/73-212WEMC.TIGGNI----------------------------------------------------------GTASGGLCCVK
Q983S0_RHILO/19-151IDRQ.AIGGAL----------------------------------------------------------GTATHG.SGPT
MURB_BUCBP/20-153LIPG.TVGAAP----------------------------------------------------------IQNIGAYGVEF
YVDP_BACSU/33-169SPTV.GIGGIT----------------------------------------------------------MGGGFGVLSRS
O29393_ARCFU/49-187LYCS.TVGGWV----------------------------------------------------------ATAASGQFSTG
Q7URF5_RHOBA/77-214RSIT.TMGGVI----------------------------------------------------------ATNASGSHYLR
Q6CCU5_YARLI/112-251KGSC.HIGGNV----------------------------------------------------------ATNAGGLRLLR
Q7S0U1_NEUCR/79-214CDCV.GMMGPG----------------------------------------------------------LGGGHGRHEGP
DIML_CAEEL/59-199DDL..TVGGLI----------------------------------------------------------NGCGVESGSFK
Q6NAC4_RHOPA/97-241FEYS.TLGGWI----------------------------------------------------------ATRSGGHYASL
Q8F3Y7_LEPIN/117-261FEYS.TLGGWI----------------------------------------------------------AARSAGQQSNR
Q9HTK4_PSEAE/8-144GGRA.TVGGVL----------------------------------------------------------ASGLSGPRRPW
ALO_NEUCR/51-186INEQ.SIAGAI----------------------------------------------------------STGTHG.SGIK
Q96YM3_SULTO/46-183YD.S.TVGGGI----------------------------------------------------------AGDALGIGSYE
Q9SA87_ARATH/77-216STTL.GVGGHF----------------------------------------------------------SGGGYGNLMRK
Q6ALH1_DESPS/43-180INSA.MVGGII----------------------------------------------------------INNASGMNCGT
Q8YZY0_NOSS1/35-172LEQ..TVGGLL----------------------------------------------------------STGGIGSTSKT
Q97Y18_SULSO/44-180FYLA.TIGGAI----------------------------------------------------------AHKGSGSHSSS
Q9KB00_BACHD/33-172DEAA.TIGGMI----------------------------------------------------------ATNESGPKRLR
Q97U60_SULSO/35-172YVVS.SIGGNI----------------------------------------------------------SHDSGGMHTPK
Q96XG8_SULTO/47-186FYIS.TLGGYI----------------------------------------------------------AGGDVGIGSYQ
MURB_YERPE/20-153LIPG.CVGSAP----------------------------------------------------------IQNIGAYGVEL
Q6N8A2_RHOPA/39-178RGTA.TLGGNA----------------------------------------------------------ATNAGGNRVIR
Q9HTM8_PSEAE/30-162IDYQ.TLAGAI----------------------------------------------------------ATSTHG.TGVG
Q89HF0_BRADU/40-178ASRA.TIGGMA----------------------------------------------------------GNNSCGGRSLR
MURB_LEIXX/19-154GIPG.STGAAP----------------------------------------------------------VQNIGAYGQEI
Q7YWB6_LEIMA/137-280YIYS.TLGGWI----------------------------------------------------------GARGSGAMSNQ
Q8ERP2_OCEIH/37-174..DA.TIGGMV----------------------------------------------------------ATNASGTTAVR
Q9HKQ4_THEAC/37-176SRSA.TVGGSI----------------------------------------------------------STNAGGLRGVA
XYOA_STRCO/17-150LPHI.SVAGSV----------------------------------------------------------ATGTHGSGVGN
Q869M2_DICDI/40-172VSDT.GVFGLT----------------------------------------------------------LGGGIGHLSRS
Q883D1_PSESM/55-190VSDT.GLIGLT----------------------------------------------------------LGGGIGWLVGL
A4XDV9_NOVAD/50-189PGWG.GVMGNA----------------------------------------------------------LE..HGAGYTP
A4XDW3_NOVAD/40-176PDES.VAASFI----------------------------------------------------------NR...RPGYTP
F9UTP6_LACPL/50-187KPIS.GIGGNV----------------------------------------------------------ATNAGGMSTVK
G4UXW0_NEUT9/71-205..TA.TVGGMV----------------------------------------------------------STNCSGTNAMR
K4D2I8_SOLLC/110-239IREQ.QIGGIV----------------------------------------------------------QVGAHGTGARL
O07406_MYCTU/37-173RDTA.TVGGMA----------------------------------------------------------STNAGGLRTVR
O25820_HELPY/43-179INTA.MIGGIV----------------------------------------------------------ANNASGMCCGV
O53608_MYCTU/74-210CPTV.GVAGHA----------------------------------------------------------LGGGLGANSRH
GULDH_MYCTU/16-151VDPQ.SITGAT----------------------------------------------------------ATATHGTGVRF
MURB_MYCTU/34-167GIPG.SAGATP----------------------------------------------------------VQNVGAYGAEV
Q0SJV5_RHOSR/43-180FTRC.TIGGMI----------------------------------------------------------GNNACGSRTLG
Q0WGW9_YERPE/389-525VKEV.GISGFL----------------------------------------------------------LGGGLGINCSQ
Q1K764_NEUCR/70-205VADV.GVSGLI----------------------------------------------------------LGGGISFFSGM
MURB_STAA8/38-166GIPG.SIGGAV----------------------------------------------------------YMNAGAYGGEV
Q2USP5_ASPOR/124-262PSVG.IAGGYS----------------------------------------------------------QGGGHSFLSSM
MURB_BRUA2/42-173GIPG.GIGGAL----------------------------------------------------------RMNAGANGVET
Q32CF7_SHIDS/51-190KPLA.QMGGLV----------------------------------------------------------ATRSIGQFSTL
MURB_NEIG1/23-155LIPG.TVGASP----------------------------------------------------------VQNIGAYGVEA
Q5SKY9_THET8/4-133GKGA.TLGGTV----------------------------------------------------------AAGLSGPLRHR
Q81V24_BACAN/20-155IDSQ.SIAGAI----------------------------------------------------------STGTHG.TGIT
Q8F4R3_LEPIN/53-187MFP..TLGGAL----------------------------------------------------------SMNIHGKNNFA
Q8PCL6_XANCP/43-182AEIC.SVGGNL----------------------------------------------------------STNAGGPRAVK
MURB_BORPE/34-165LIPG.TVGAAP----------------------------------------------------------VQNIGAYGVEL
V4K8Y9_9ACTO/45-179VSHT.GLGGLV----------------------------------------------------------LGGGFGWLSRK

PF00941

AOXA_HUMAN/239-419KEG..KR....QIPLNEQFLS.....KCPNADL.KPQEILVSVNIPYS
Q7RXE4_NEUCR/265-448LGE..NGIVETEIPMSQ.FFT.....GYRRTAL.PQDAILAAIRVPLT
XDH_EMENI/269-448LDK..ET....EIPMTQ.FFR.....GYRSTAL.PPDAIISSLRIPTA
Q97W13_SULSO/4-169TKG..ER....VENFSS.FAK.....DMFTPDL.NPGELVTEIEVPLL
Q92V19_RHIME/2-221PGG.ETR....SIPIGD.LYRLPGTTPHQETVL.AHGEMITGVTLPPP
Q92UU0_RHIME/2-217PRG..ER....TIPVEE.LFRLPESTPHLEHTL.EPGELIVEVHIPNG
Q9I2H2_PSEAE/2-218RAG..ER....RVAFAD.FHRLPADTPERDNCL.AVDELVTAIELPAP
O17892_CAEEL/259-440EAR..GE...KRVHIDEKFFL.....GYRKTVI.QQDEIIKAVIVPLL
Q92UJ3_RHIME/205-373KDG..QR....TLPLED.FFI.....AYGKQDR.RPGEFVESLFVPAL
ALDO3_ARATH/222-398GRK..TE....KVTLQE.FLE.......LSPVL.DSKRVLLKVEIPSW
Q8CJY1_STRCO/19-185PDG.ARR....EMPVSH.LLA.......GMEML.RAGELIGYVRVPLL
Q9Y9R9_AERPE/4-175KAG..ER....VVKLED.FII.....GPYITDL.QPSELLVEVRVPSL
Q6LQT9_PHOPR/1-157AS.........QMDIED.YIN...........S.EQRELIVEVIIPNV
Q6F9M6_ACIAD/202-370GEQ..RR....DIALAD.YYL.....DYQKTAL.QAGEFVEAILIPIH
Q92WF7_RHIME/2-220PSG..AR....TIAFEE.FHRLPEDTPDIETDL.QPGELITGIEIPPL
XDH1_ARATH/260-440CNG..DV...RSIPAKD.FFL.....GYRKVDM.GSNEILLSVFLPWT
Q974U9_SULTO/4-169RKG..DR....VVNFKS.FAK.....DMFTPDL.NPGELVTEIQVPTF
Q6N0U3_RHOPA/2-168.....KR....EIPADQ.FFK.....GLFMTAL.EDNEIITAISFPVP
Q92XI0_RHIME/2-221ADG.TTR....SIPMGD.LHRLPGDTPHIEHVL.ERGELITAVVLPKP
Q98JI6_RHILO/2-217.....ER....KLLVDD.FFLLPGATPDREHAI.EPGEMITAIEIPGS
ALDO1_ARATH/249-425SSS..SQ...EQFTLEE.FLQ........QPPL.DAKSLLLSLEIPSW
Q9KBF1_BACHD/778-946RTG..LK....TQPFIE.MFQ.......GRLTL.EKGEFLVQVIVPQS
XDH_ORYSJ/268-448VNN..NI...RTIPAKD.FFL.....GYRKVDL.KPDEILLSVILPWT
ALDO1_ORYSJ/239-416VAS..KR...MCLTLEE.FLK........QPPC.DSRTLLISISIPDW
ALDO1_MAIZE/244-417ASK..RL....CFTLEE.FLE........QPPC.DSRTLLLSIFIPEW
Q8ZV34_PYRAE/7-173KKG..VY....IYPISQ.FIK.....GPYETEA..EDGLVVEIAVPKW
XDH_CHICK/258-438MEG..KR....TVMMDEKFFT.....GYRKTIV.KPEEVLLSVEIPYS
Q9RK26_STRCO/2-220PEG..TR....SVPAAD.FHRLPGLHPERDTEI.HPGELITGVVLPAG
Q9EWZ3_STRCO/2-220LDG..PG....ELPLAD.FYLPVGDTPHRETAL.PAGALITGVTLPPA
O83120_TREPA/9-178GHE..NF....WISVAH.YAH.....ARSDTLR.HRSHVITRIRLPTD
Q92X32_RHIME/2-174GGT..ER....TILLED.FFT.....GPGRTVL.SPGDIVTGISLPAP
ALDO4_ARATH/228-407AGR..H....EKLRMGE.YLV.......SPPIL.DTKTVLLKVHIPRW
Q98D33_RHILO/32-199AAA..TR....HLPLPD.FIL.....GNRRTAL.RPGEMVTAIRVPKM
DCMM_OLICO/4-175PEG..AR....IVAARD.YYQ.....GAYFTAI.EPGELLTAIRIPVP
Q9VF50_DROME/202-379GIDDEK.....EMTLEE.FL......G....DT.DRKMLLKAFILPRY
Q88F21_PSEPK/195-363GER..QR....VMPLED.YFI.....DYRITAR.QDSEFIEKIIVPRA
XDHC_BACSU/10-174KEL..IR.....LPLGA.WLS........EEDF..RTAIVTRVIIPRA
Q8P785_XANCP/2-221PDG.QTR....AIPIAE.FYRAPGKTPHIETVL.ERGELITAVTLPKP
Q8XZD4_RALSO/2-168.....RR....DIPADD.FFL.....GMYETAL.APDELITEVQFPVP
Q89PE8_BRADU/4-175AKR..RR....RVAAKD.FFS.....GMMLTAR.ADDELIESISLPVI
Q6LPZ7_PHOPR/191-359GKK..SR....TIPIED.YFI.....SYKVTAQ.QPSEFIEKIIIPMP
Q9KEV2_BACHD/4-177RGR..ME....WETLET.WLN.....RCQTTPLTEEQRILVRVGLPLA
Q89PX9_BRADU/4-175LAG..AR....TMAIEA.FVV.....GALESAL.HAGEIVEAIHVPAR
Q7TP79_RAT/448-628KEG..QR....QIPLNGPFLE.....RLPEASL.KPEEVALSVFIPYS
ALDOL_ORYSJ/224-406SSK..TL....HVTLEQ.FLE........QPPL.GHNTLLLSIFIPHW
Q8XXL8_RALSO/214-382GDA..HR....ELPLED.LYL.....AYMKHAM.VPGEFVASLRVPAR
ALDO2_ARATH/218-402SSR..GL...EKLTLEE.FLE........RSPL.EAHDLVLSIEIPFW
Q73PR8_TREDE/6-176AEN..IE....WVPFAK.YID.....KSYAEKR.EEKYIISRIRIPNE
Q9EWG7_STRCO/216-384ADG..ER....EVPLAD.YFT.....GYRQSVR.RPGELIRAVRVPLP
Q97VI7_SULSO/4-174ASG..NR....SVNALD.FFK.....GAFATDL.RKGEIISEIVLPNL
A9CL41_AGRT5/2-219PAG..TR....SLPLRD.LHRLPGHTPEIETEL.DTDDLITAVEIPSL
Q8LHR9_ORYSJ/267-447SSE..RM....NVTLER.FLD........MAPC.DCKTLLLRIYIPHC
Q7VS58_BORPE/4-175VDG..ER....MVPAES.FMQ.....GAYTTVV.GEGELIAAVHVPAM
Q89GV6_BRADU/4-175PSG..AR....RVKADD.FFI.....DLFETTL.QPGELITAVYVPLF
Q87YY2_PSESM/195-363GDT..RR....TLALED.YFI.....DYKVTAR.QPGEFIEKIIVPTA
Q6MJY3_BDEBA/203-371TKG..LR....KVALPK.FYK.....AYKVFDV.TADEIATGILIPVP
A9CI15_AGRT5/197-365SSG..GR....SLPLES.YFI.....DYGKQDR.LSGEFVEKLFIPFQ
Q89XH7_BRADU/2-168.....KR....SISAED.FFK.....GLFTTAL.EDGEIITAVSFPVP
Q976U6_SULTO/9-170KKG..ER....EIKISD.LYL.....SPYTTSM.REDEIITSIIIPKK
Q6AIN3_DESPS/3-161A.........GRVRLTD.YLL.....GKGLRDI......LLKIIIPKG
Q6AK64_DESPS/1-173QKG..LR....VLPLAE.MYA.....GICLSGIDSCNHLVTHLKFPLK
Q98CI6_RHILO/201-369GQK..RR....TIPLEA.FFI.....AYGRQDR.QPGEFVEAVHVPVP
Q9FV24_SOLLC/235-418RHG..LV....KLTWEE.LLL........KPPL.DSRIVLLSVSIPFK
Q92VB8_RHIME/200-368GTS..RR....TLPLEA.FFI.....EYGKQDR.EPGEFVETVRIPFL
D0IYQ4_COMT2/229-396GER..VR....RMPLTD.FYL.....DYMKNQL.EPGEFVQALAVPL.
D5API5_RHOCB/182-343GQE..RR....RMPLED.FFL.....EYRKQDR.RPGEFVESVTLPK.
AOXC_MOUSE/240-418TEG..IQ....QIPLNDHFLA.....GVPDAIL.KPEQVLISVFVPR.
G3XCQ8_RHOPA/7-214PDG..RR....RIPLGELYVE....DGRAHLAL.RPGEVVVTVRLPA.
H9JLH6_BOMMO/1453-1632QEN.GHR....TVLMDETFFT.....GYRKNVV.KSNEILLSIEIPF.
K4DAL9_SOLLC/235-416SHG..PE....NHTWEE.LLS........RPPL.DSKTVLLSVCIPF.
M4A7V2_XIPMA/239-417TGG..KR....EVPLNQDFFV.....GFGKTIL.KPEDVVVSVFIPF.
XDH_BOVIN/233-411RGT..RR....TVPMDHTFFP.....SYRKTLL.GPEEILLSIEIPY.
Q2YPJ7_BRUA2/203-367GAE..RR....TIALED.FFI.....AYGKQDR.GAGEFVEAVHVPL.
XDHB_ECOLI/6-173PRG..VR....FVPING.FHT.....GPGKVSL.EHDEILVAFHFPP.
Q7Q3J8_ANOGA/229-405LDG.GFR....KVRMGDGFFT.....GYRKNVI.QPQEALVSLFIPR.
Q89IH3_BRADU/3-167.....KR....RLKAEE.YFQ.....GLFTTAL.EADEIITKVMFPL.

PF01565

Q8EGS3_SHEON/42-180A.Q--------NSY..Q-TIA-----SAKLLF.-ADGTELDTG-----
GGLO_MOUSE/21-156H.G--------ILA..T-QVV-----ALTLMK.-ADGTVLECS-----
YITY_BACSU/45-181Y.G--------SLI..D-TVK-----SFRLLK.-ADGMIITVT-----
Q7RV07_NEUCR/47-186W.G--------SAL..D-HIV-----EVEVVT.-ADGKIQRAS-----
Q9YFD3_AERPE/61-201L.G--------NIE..D-MVL-----WLETVIP-GLGTV.TLG-----
MURB_SYNE7/29-161A..--------.....D-ILQ-----SVQVIT.-DQGLETWSR-----
Q9RTM9_DEIRA/61-199Y.G--------VTG..D-YVR-----ALEFVD.-VDGDVHRLT-----
MURB_STRP1/28-158S..--------.....H-IFL-----SAKVLT.-PSGEIKTIS-----
Q72F25_DESVH/44-183Y.G--------VTR..D-YVL-----GVEAVL.-PDGELLRAG-----
Q9RJ97_STRCO/99-239Y.G--------RFD..E-MVL-----GLTLAT.-PRGTL.DTG-----
MURB_PECAS/20-153Q..--------.....H-VCD-----YVELLDL-TEGKTIHLT-----
Q8XND2_CLOPE/36-171L.G--------LGC..D-NLL-----EVKFIN.-SKGKIVIAN-----
Q8EGB1_SHEON/385-520Y.G--------MCC..E-GLV-----QAEIVL.-GVGETQVVS-----
Q9HMR2_HALSA/64-202Y.E--------KAD..G-YLE-----SAEVVL.-ADGTVTTLG-----
Q98KY4_RHILO/16-149R.G--------TFG..C-HVE-----SFTLLR.-SDGKTYRCS-----
Q9A8X8_CAUCR/61-191P..--------AMH..G-DVT-----GLRLVT.-PSGKIIDAD-----
O29450_ARCFU/37-175Y.G--------TMV..D-WVL-----GLEVVT.-ADGEVLNIG-----
Q7SHH8_NEUCR/74-210H.G--------LVI..D-ALE-----SVRMIT.-ANGDIVEAS-----
Q82G17_STRAW/96-229Y.G--------LTC..D-SLT-----QATLIT.-ADGKQLVAN-----
Q7N1V5_PHOLL/58-193Y.G--------SQA..S-CIQ-----SYTLIT.-PDGKRHRCS-----
O33177_MYCTU/35-170Y.G--------PAC..E-SVI-----GLDVIT.-ADGAQIHCD-----
Q974L0_SULTO/23-162Y.G--------TFR..D-WVL-----ALKVVL.-PNGKVIKLG-----
Q6L2S1_PICTO/39-177Y.G--------VVK..D-WVL-----KLDCVL.-ANGEETSFG-----
ADAS_DICDI/141-282Y.G--------DIE..D-MAV-----SFRTVT.-PTGTL.ELR-----
Q9RVK1_DEIRA/39-176Y.G--------TTR..D-NVL-----EMRVAL.-PGGRVVRVG-----
MURB_HAEDU/19-152E..--------.....Q-FCD-----FVEVVNL-ANGQIFRLD-----
Q7S1N4_NEUCR/85-222R.G--------MGC..D-QVR-----GFEVVL.-GDGHTVHCS-----
Q9F3A3_STRCO/70-207T.R--------NSY..R-TLA-----SLTFVL.-PGGTVVDTA-----
MURB_SHEON/21-152C..--------.....D-ICH-----WVEYLDL-DSGLLLRLS-----
Q7V4C5_PROMM/41-176D.G--------SFG..N-HLQ-----RLLLVD.-GRGELRELT-----
MURB_NOSS1/59-191A..--------.....D-ILV-----SAQVLS.-PDGTVETLT-----
MURB_BACSU/34-165S..--------.....E-ILV-----KAHILF.-EDGTIEWLT-----
Q7NFT8_GLOVI/37-175Y.G--------KTV..D-HIL-----ECRAVL.-ADGSVCHFG-----
MURB_ACIAD/22-156G..--------.....E-FIE-----LVHVYDR-SEKSVKTIS-----
Q9KB02_BACHD/48-187Y.G--------VTT..N-HIL-----GMEVVL.-PNGDIVEIG-----
MURB_ECOLI/17-150Q..--------.....R-VCA-----YVDSVEL-ATGKQVRLT-----
Q7NCA8_GLOVI/44-184Y.G--------GGR..D-MCL-----GISVVR.-ADGKMVKAG-----
Q8CJQ0_STRCO/57-195H.G--------KVV..D-NIA-----RLEVLL.-YDGTRFWCG-----
Q726S9_DESVH/41-181Y.G--------VTK..D-YVM-----GIEFFD.-VNGGLVKTG-----
Q98I12_RHILO/59-194A.G--------SVA..G-SIR-----SMRVML.-ADGSVTTCS-----
MURB_PSESM/23-157K..--------.....D-VFH-----GLTALDR-ETGELREFA-----
Q8TH91_METAC/83-222Y.G--------TTR..N-YVR-----DLEVVL.-ADGTVIHTG-----
MURB_WOLPM/30-160A..--------.....S-VVQ-----SIKAVNL-EDGNLYEFS-----
O50531_STRCO/29-164A..--------SIA..A-QIR-----GLELVT.-ADGSVLTCS-----
MURB_AQUAE/21-153S..--------.....D-FLK-----EVYFVD.-WEGKLQKAK-----
ALO_SCHPO/28-163Q..--------VLP..H-YIK-----SMRIML.-ADGSIVTCS-----
ADAS_MOUSE/193-336Y.G--------NIE..D-LVV-----HMKMVT.-PRGVIEKSS-----
MURB_CAUCR/32-163V..--------.....N-VVK-----SVRVMN.-RAGVVRELS-----
MURB_STRCO/53-183S..--------.....A-TIT-----EVTAYDR-RSGETVALS-----
Q98KG4_RHILO/152-289Y.G--------TMR..E-NVL-----SLTAVM.-ADGETVTTG-----
Q8FNC2_COREF/44-182Y.G--------TAA..D-NLI-----DVTLML.-ADGREVTVS-----
Q9KKW5_VIBCH/47-184A.Q--------NSY..R-TVD-----GMQIVF.-ADGYVLDTR-----
Q82SS0_NITEU/46-186Y.A--------DHF..G-SLC-----GMDVVL.-PDGRLLETG-----
Q9A317_CAUCR/35-173Y.G--------MMR..E-QVL-----GIEAVL.-PNGEIWNGL-----
Q7U5R3_SYNPX/72-213W.G--------FLRDPG-HLL-----GAELIT.-VEREPRRLQ-----
MURB1_CORGL/41-172G..--------.....E-HVT-----KVLVTD.-AEGSIRELN-----
Q7N7Z9_PHOLL/19-157I..--------.....D-DLA-----GLEVVL.-PDGEVVKVG-----
Q7S350_NEUCR/67-202Y.G--------MTC..D-TVK-----SYELVL.-PNGTITRVS-----
Q8XW09_RALSO/54-193Y.G--------LTV..H-NVL-----RVRAVM.-MDGEVVEFG-----
MURB_VIBCH/21-154K..--------.....D-VCD-----YVEYLCL-ETGTVKRLT-----
ALO_ASHGO/29-168H.G--------LVS..S-QYV-----NLTLVN.-GRGELVFLD-----
MURB_CLOAB/38-168S..--------.....N-VVE-----SVLVID.-NKGKMKRLY-----
Q92RW6_RHIME/20-155L.G--------NMA..S-SIA-----GMRIVK.-ANGEILDID-----
Q9PBD9_XYLFA/32-171Y.G--------NTR..E-WIA-----GLNVVT.-GTGELLTLN-----
P71984_MYCTU/42-177F.G--------LSC..D-NLV-----AVRLVT.-AAGDYLSVD-----
Q726N5_DESVH/138-278Y.G--------TTL..D-NLL-----SWRMVT.-PTGEIIDVE-----
Q8KEW7_CHLTE/25-165Y.G--------PTR..N-HVQ-----ALQIAL.-PQGDLLEIT-----
Q97U59_SULSO/47-180Y.G--------YPK..N-LIL-----MAKVIT.-GDGIIAKGG-----
Q9I3S8_PSEAE/39-178F.G--------TMR..Q-RVL-----GLEAVL.-ADGSVYSDL-----
CKX11_ORYSJ/45-187Y.G--------PQV..S-NVA-----QLEVVT.-GDGECHVCS-----
Q92X65_RHIME/28-163P..--------NLS..M-MLV-----GGRLVT.-AGGEIRTFD-----
Q7NZ82_CHRVO/51-186P..--------ALH..A-DAR-----ALRLLT.-PSGETLDCG-----
P74033_SYNY3/47-186Y.G--------TLFDPG-NVQ-----SLTVLT.-MEAEPQRLI-----
Q9S2F6_STRCO/73-212Y.G--------VTA..E-YVL-----GLDVVL.-ADGRLMSTG-----
Q983S0_RHILO/19-151L.G--------AYH..T-QLE-----TVQIVD.-GLGKVRDFT-----
MURB_BUCBP/20-153K..--------.....D-VCQ-----YVDVLYL-NNSKIVRIN-----
YVDP_BACSU/33-169I.G--------LIS..D-NLL-----ALKTVD.-AKGRIIHAD-----
O29393_ARCFU/49-187Y.G--------NIE..N-LLV-----SLTAVL.-PDGEVVTER-----
Q7URF5_RHOBA/77-214S.G--------SAR..D-TVL-----SLRMIA.-ADGRLVELS-----
Q6CCU5_YARLI/112-251Y.G--------SLH..G-SVL-----GLEVVL.-ANGKVVNML-----
Q7S0U1_NEUCR/79-214H.G--------MIS..D-NIL-----QLNVVL.-ADGTAVRVN-----
DIML_CAEEL/59-199Y.G--------MFQ..H-ICT-----GYEVVM.-SDGELKNVY-----
Q6NAC4_RHOPA/97-241Y.T--------HID..D-FVE-----SVRVVT.-PRG.VLETR-----
Q8F3Y7_LEPIN/117-261Y.G--------KIE..E-ILT-----SLKVVT.-PMGTVETLK-----
Q9HTK4_PSEAE/8-144A.G--------AVR..D-FVL-----GTRLIS.-GLGTHLRFG-----
ALO_NEUCR/51-186H.G--------LVG..E-SIT-----ELKITL.-ANGETLSCS-----
Q96YM3_SULTO/46-183Y.G--------FIS..D-NIS-----FVDMIN.-PKGELIHLE-----
Q9SA87_ARATH/77-216Y.G--------LSV..D-NVF-----GSGIVD.-SNGNIFTDR-----
Q6ALH1_DESPS/43-180H.E--------NAY..K-TIE-----AAKIIF.-ADGTLLDTA-----
Q8YZY0_NOSS1/35-172Y.G--------PVV..A-NVI-----DLHIIT.-GNGEYIQCS-----
Q97Y18_SULSO/44-180N..--------.IE..N-LIL-----WLEVIL.-PNGKAVKVG-----
Q9KB00_BACHD/33-172H.G--------AAR..D-HVI-----GLRVVY.-PDGRIIRTG-----
Q97U60_SULSO/35-172Y.G--------TTF..D-SII-----RLKVLL.-SNGHVEEIG-----
Q96XG8_SULTO/47-186F.G--------YHFHGN-GIR-----RVKIVA.-PNGSQELTG-----
MURB_YERPE/20-153K..--------.....Q-VCE-----YVDLLDM-DKGTIQRIS-----
Q6N8A2_RHOPA/39-178Y.G--------MTR..E-MIL-----GLEVVL.-ADGTVLSSL-----
Q9HTM8_PSEAE/30-162F.G--------SYS..A-QVR-----GLQLVT.-ASGEVLECD-----
Q89HF0_BRADU/40-178Y.G--------TMR..D-NTL-----SMEAAL.-ADGTLSRFG-----
MURB_LEIXX/19-154E..--------.....S-ALI-----GVEFLDY-LTGEVYTLA-----
Q7YWB6_LEIMA/137-280Y.G--------DIE..D-MVV-----AVKVAT.-PTG.IIETP-----
Q8ERP2_OCEIH/37-174Y.G--------AMK..D-QLI-----DLEVVM.-ADGTIIHTA-----
Q9HKQ4_THEAC/37-176Y.G--------VTK..D-WVL-----GLEVVL.-ADGTLVKFG-----
XYOA_STRCO/17-150..G--------SLA..S-VVR-----EVELVT.-ADGSTVVIA-----
Q869M2_DICDI/40-172Y.G--------LTC..D-NLL-----EAKLIT.-CDGEIKIIN-----
Q883D1_PSESM/55-190Y.G--------LTC..D-CLV-----GADVVL.-ADGRLVKAE-----
A4XDV9_NOVAD/50-189Y.G--------DHF..V-MQC-----GMEVVL.-ADGQVVRTG-----
A4XDW3_NOVAD/40-176Y.S--------DHF..L-MQC-----GLEVML.-ADGKMVRTG-----
F9UTP6_LACPL/50-187Y.G--------ATK..D-NVL-----GVKVVL.-ADGREVKL.-----
G4UXW0_NEUT9/71-205Y.G--------TMK..D-WVL-----NLTVIL.-PDGRVIKT.-----
K4D2I8_SOLLC/110-239P..--------PID..E-QVI-----SMKVVTP-AKGTI....-----
O07406_MYCTU/37-173Y.G--------NMG..E-QVV-----GLDVAL.-PDGTVLR..-----
O25820_HELPY/43-179E.Q--------NSY..K-TLK-----SLRVIL.-ADGTLLDT.-----
O53608_MYCTU/74-210A.G--------LLC..D-QLT-----SASVVL.-PSGQAVTAS-----
GULDH_MYCTU/16-151Q..--------NLS..A-RIV-----SLRLVT.-AGGEVLSLS-----
MURB_MYCTU/34-167S..--------.....D-TIT-----RVRLLDR-CTGEVRWVS-----
Q0SJV5_RHOSR/43-180Y.G--------RTS..D-NVK-----GLHVLT.-GTGESLQL.-----
Q0WGW9_YERPE/389-525WGG--------MSV..F-NVQ-----ALDIVT.-ADGHLRHVS-----
Q1K764_NEUCR/70-205Y.G--------WAC..D-NVR-----NYELVL.-ASGLIVNA.-----
MURB_STAA8/38-166K..--------.....D-CID-----YALCVN.-EQGSLIKL.-----
Q2USP5_ASPOR/124-262Y.G--------LGA..D-QVL-----EWEVID.-GTGRLLV..-----
MURB_BRUA2/42-173R..--------.....E-RVV-----EVRALD.-RKGEVHVLS-----
Q32CF7_SHIDS/51-190Y.G--------AIE..D-MVV-----GLEAVL.-ADGTVTRI.-----
MURB_NEIG1/23-155K..--------.....D-VIH-----SVRCFDL-DTETFVTL.-----
Q5SKY9_THET8/4-133Y.G--------GLR..D-FLL-----GVRFVD.-GEGKVVR..-----
Q81V24_BACAN/20-155F.G--------SLS..T-QVI-----EITAVL.-STGETIVCS-----
Q8F4R3_LEPIN/53-187V.G--------PIG..D-HVL-----EFTFMT.-PDGKVHICS-----
Q8PCL6_XANCP/43-182Y.G--------ATR..D-NVL-----GLVAVT.-GTGDVIHCG-----
MURB_BORPE/34-165A..--------.....D-RFH-----SLTAWDV-KGGRWVEM.-----
V4K8Y9_9ACTO/45-179Y.G--------LSI..D-NLT-----SVEIVT.-ADGGVLNA.-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window