Sequence alignment for CL0077

PF00941

ADO_HUMAN/239-419ERMMWFSPVTLKELLEFKF......K---YPQ--APVIMGNTSVGPEVKFK------GVFHP---VI.ISP----DRI.E
Q7RXE4_NEUCR/265-448KRKRWFRPTKLEQLLEIKK......V---YPN--AKIIGGSTETQIEIKFK------ALQYP---IS.VFV----GDI.P
XDH_EMENI/269-448KRKKWYRPVTVQQLLEIKS......I---HPD--AKLIGGSTETQIEIKFK------QMRYG---AS.VYL----GDL.A
Q97W13_SULSO/4-169PKFSYVIPDNVKEALEFLE......T---HDD--AKPLAGGHSLIPMLKLR------IFRPS---YL.VEI----RRL.P
Q92V19_RHIME/2-221QPFSYQRADTVETAVAAVA......G---RPA--ARFIAGGTNLLDLMKLG------IERPE---HL.VDI----GRL..
Q92UU0_RHIME/2-217RPFEFQRAASESEAIAAGA.......---.AG--ARYLAGGTTLVDLMREE------VETPE---KI.VDI----NRL..
Q9I2H2_PSEAE/2-218TPFAYAKPADIEQALGLAG.......---.PE--SRYIAGGTNLLDLMKEN------VARPR---RL.IDI----TGL..
O17892_CAEEL/259-440HHTKWYQPVSYDDLLSLKR......E---LPH--ARLISGNSELAIELKFR------FIDLP---AV.INP----RQV.K
Q6SF51_9BACT/2-165YDFELLTATSLQEAVTALQ.......---DEE--TQALAGGQTLIPTMKQR------LASPE---RL.VSL----TKI.K
ADO_BOVIN/239-419DRMTWISPVTLKELLEAKV......K---YPQ--APVVMGNTSVGPDMKFK------GIFHP---VI.ISP----DRI.E
O87681_ARTNI/4-175PSFDYVVADSVEHALRLLA.....DG---GDD--AKIIAGGQSLVPLLNFR------MSRPS---LL.VDI----NRV.P
Q92UJ3_RHIME/205-373GADCLIVPVDAADLAGVLA......D---HPG--ATIVAGCTDVGLWVTKQ------MRSLN---PV.VFI----NGI.A
ALDO3_ARATH/222-398LKYRWTTPFSVAELHNIMEA...ANS---GDS--LKLVVGNTGTGYYKDEE------..RFD---RY.IDI----SNI.P
Q8CJY1_STRCO/19-185QAVTL..PTTLDEAVAALT......A---LPA--AVPVAGGTDLMAAVNSG------QLRPA---AL.VGL----GRI.S
ADO_MOUSE/238-418ERVTWISPVTLKELVEAKF......K---YPQ--APIVMGYTSVGPEVKFK------GVFHP---II.ISP----DRI.E
P72222_PSEPU/4-174PAFSYRAPASLQEVIQVLA......D---DPD--ARIIAGGQSLLPLLAFR------LVYPS---CL.VDL----RNV.S
Q9Y9R9_AERPE/4-175ASFEVLIPKSLDEALDMLE.....KY---GDN--AKVLAGGHSLIPMMRLR------LVKPT---YV.IYI----GRI.P
Q6LQT9_PHOPR/1-157MIEHYLQPESTIQALELMK.....QH---TGV--AAWFAGGTKLNATPTKT------DKTVA---...ISL----DKL..
Q6F9M6_ACIAD/202-370QGQQFFAPKTVQEFAALRQ......Q---YPQ--ARIVAGSTDVGLWVTKL------GRDLG---DM.LYI----GQV.Q
Q92WF7_RHIME/2-220KSFAYARAADLEAAVKLLS......K---TPN--AKLLGGGTNLVDLMREN------IEQPD---AL.VDV----TGL..
XDH1_ARATH/260-440GGITWYRPVCLQNLLELKA......N---YPD--AKLLVGNTEVGIEMRLK------RLQYQ---VL.ISV----AQV.P
YAGS_ECO57/2-221KAFTYERVNTPAEAALSAQ......R---VPG--AKFIAGGTNLLDLMKLE------IETPT---HL.IDV----NGL..
Q974U9_SULTO/4-169PKFGYVIPDNLNEALEFLE......E---HQD--ARPLAGGHSLIPMLKLR------LIRPS---YI.VEI----RRF.S
Q6N0U3_RHOPA/2-168YSTNYHRASSVDEAVALIA......K---GTD--AKLLAGGHTLLPVMKQR------LAAPG---DL.VDI----AKI.P
Q92XI0_RHIME/2-221RAFSYERVSSIGAAARAAA......A---TDG--AKFIAGGTNLLDLMKLE------IETPT---HL.VDV----NGL..
Q98JI6_RHILO/2-217RDFSYLRASSADAARQAAA.......---LPG--AMLLAGGTTLIDLAKCG------VAEPD---ML.VDI----THL.K
ALDO1_ARATH/249-425RKYRWSSPVSVSELQGLLEV....EN---GLS--VKLVAGNTSTGYYKEEK------ERKYE---RF.IDI----RKI.P
Q8G2H3_BRUSU/200-368GKDRLIVPADLDDFAPILA......A---EPK--ATIVAGSTDVGLWVTKM------MRDIS---PV.VFI----GHL.E
Q9KBF1_BACHD/778-946FEFEYYKPASIIEATTLFQSL..DQA---GKD--PMYVSGATELITLGRVN------QLKSG---AI.IDL----KGI.S
XDH_ORYSJ/268-448NGIRWYRPLKLKQVLHLKA......C---YPN--AKLIIGNSEVGVETKFK------NAQYK---VL.ISV----THV.P
O17505_BOMMO/28-208ENVIWLRPRNLKELVLVKS......R---IPD--SKVVVGNTEIGVEMKFK------KKFYP---VL.ISP----TII.G
O52838_BRAJP/2-168YEFKYHRPGTVRQAANLLV......K---NED--AKVIAGGHTLIPVMKQR------LASPP---HL.VDL----SHI.E
ALDO1_ORYSJ/239-416GDGCWFHPRSIEEFHRLFECN..LFD---EMS--VKIVASNTGSGVYKDQD------L..HD---KY.INI----SQI.P
O17506_BOMMO/254-435KQTTWYRPTNIETVLSLKD......K---FPN--AKVVVGNSEVGVEVKFK------RCVYP---II.IMP----NCV.P
O23887_MAIZE/244-417SGDGWYHPKSIEELHRLFDSS..WFD---DSS--VKIVASNTGSGVYKDQD------L..YD---KY.IDI----KGI.P
Q8ZV34_PYRAE/7-173RHFKYIKANSVEEALQYVE.......---.EG--YRPLAGGQSISTLLKLG------VVAHE---GL.VDI----FEL.D
Q9BIF9_CERCA/242-426PRSTWYRPVELSDLLKLKS......E---NPH--GKIIVGNTEVGVEMKFK------QFLYT---VH.INP----IKV.P
XDH_CHICK/258-438ERVMWIQPTTLQELVALKS......Q---YPN--AKLVVGNTEVGIEMRLK------NMLYP---VI.LAP----AWI.P
Q9RK26_STRCO/2-220KPFAYVRAGSVEEATEAFA......A---HPG--ARYLGGGTNLVDLMKLG------VETPA---AL.VDV----TRL..
Q9EWZ3_STRCO/2-220REFGYQRADDVSGAVALLA......A---DPD--ARFLGGGTNLVDLMKTG------VERPA---RL.VDV----REL..
Q8I9N3_ANOGA/220-400SRTAWYRPTTLNDLLALKK......A---HPE--TKIVVGNTEVGVEVKFK------HFEYP---SSPIHP----NK...
O83120_TREPA/9-178SSVIYYV.KSLGQLCAVLR......N---VAQ--VQPVGGGTGLVQYQITP------VLTLP---SHLVVL----NGV.P
Q92X32_RHIME/2-174KPFEYYEPASLAEASDLLR.....RL---GKD--ASIIAGGTDLLVEMKEE------LRSVL---HL.VNI----KKI.P
Q84IX9_9PROT/2-222NPFHWKVAQSASEAAALKQ.......---QSG--SQILAGGTTQLDLMKCG------VFNPP---QL.IGI----NGL.S
ALDO4_ARATH/228-407TRYHWSTPGSVAELQEILATTNPGKD---RGL--IKLVVGNTGTGYYKEEK------..QYG---RY.IDI----SHI.P
Q98D33_RHILO/32-199SVIRYAKPTTVDEALALLG.......---EGA--WRILAGGTDFYPAQGAK------PFRDN---VL..DI----NGL.A
O97896_SYNCA/228-408ERVTWIQASTLKELLDLKA......Q---HPE--AKLVVGNTEIGIEMKFK------NQLFP---MI.ICP----AWI.P
DCMM_OLICO/4-175GSFDYHRPKSIADAVALLT.....KL---GED--ARPLAGGHSLIPIMKTR------LATPE---HL.VDL----RDI.G
Q9VF50_DROME/202-379DGSQWYWPSTLAEIFEALEN...VGD---SEE--FMLVGGNTAHGVYRRSP------..DIK---HF.IDV----NGV.E
P95637_RHOPL/5-215NALNLLRPGSVDEAIAALL......A---HPG--GWLLGGGTDLLVNMRRG------VTQPE---TL.IDT----TGI.A
Q88F21_PSEPK/195-363GDKRCLVPLTVADLADLYS......S---HPE--ARLLAGGTDLALEVTQF------HKTLP---VM.IYV----GHV.A
XDHC_BACSU/10-174MNIQLWRPAALDEAYSLLE.....KL---APD--VCAASGSTLLQLQWDKG------TLPKQ---HL.VSL----EGI.D
Q8P785_XANCP/2-221KAFSYERATSPADAAAKAA......R---QPG--AKFIAGGTNLLDLMKLQ------IETPS---HL.IDV----NGL..
O54050_RHOCA/176-344QTAPAFLPETSDALADWYL......A---HPE--ATLIAGGTDVSLWVTKA------LRDLP---EV.AFL----SHC.K
Q6GMC5_XENLA/148-328ERIKWITPHSLEELLALKV......Q---YPD--APLLVGNTSIGLQMKME------GIIYP---VI.LSV----SRI.E
Q8XZD4_RALSO/2-168YAFEYHKATDAQTAVTALK......M---HPD--GKYLGGGQSLLAAMKLR------LAQPA---ML.VDI----TRI.P
Q59127_ARTNI/4-174PAIRYASPASIEDACDLLS......T---DED--SKIIAGGQSLLPVMAMR------LAQPS---VV.IDL----GNV.P
Q89PE8_BRAJA/4-175PAFDYLRAESISDVLDGLA.....QQ---GGD--ARVLAGGQSLMAMLNMR------LAKPK---LL.IDI----MRL.R
DCMM_HYDPS/4-175PRFEYHAPKSVGEAVALLG.....QL---GSD--AKLLAGGHSLLPMMKLR------FAQPE---HL.IDI----NRI.P
Q9ES55_MOUSE/240-421KRTTWIIPVTLNDLLELKA......S---YPE--APLVMGNTTVGPGIKFN------DEFYP---VF.ISP----LGV.P
Q52588_9PSED/4-175PAFAYHAPRTLPDAIRLLS.....EL---GDD--AKLLAGGHSLLPMMKLR------SPALP---RS.STS----TAS.R
Q6LPZ7_PHOPR/191-359ENLSSFSPTTTDELAELLL......T---YPD--ARLLAGGTDLALEVTQF------HREIE---QL.ISV----NLV.A
Q9KEV2_BACHD/4-177MQTVW.KPKDLAEAWELRN......T---VSD--STFVSGATWLRAQWEEN------PVATP---RHIIRL----DHI.P
Q89PX9_BRAJA/4-175APFAYERPRDLNSALSMLA.....AA---GGS--AKIIAGGQSLGPMLNLR------LVQPE---LI.VDI----SGL.A
Q7DM89_SOLLC/83-266SKYPWYSPVSIKELWSLLNFN.ATVN---RGS--FKLVVGNTGTGYYKETQ------..RYD---HY.VDL----RHI.P
Q7TP79_RAT/448-628ERTIWIMPVTLNDLLELKA......S---YPE--APLVMGNTAVGPGMKFN------NEFHP---VF.ISP----LGL.P
ALDOL_ORYSJ/224-406PREGWYCPKNIKQYYKLVNSG..LFS---ESS--VKVVVGNTSTGVYKDQD------L..YD---KY.IDI----AGI.P
Q6V956_MOUSE/239-419ERTTWIAPGTLNDLLELKM......K---HPS--APLVIGNTYLGLHMKFT------DVSYP---II.ISP----ARI.L
Q8FE94_ECOL6/3-174DFASYHRATTLADAITLLA......D---NPQ--AKLLAGGTDVLIQLHHH------NDRYR---HI.VDI----HNL.A
Q86NS1_DROME/200-377DGVQWHWPKSLSELFDALDK...VKD---SEE--FMLVAGNTAHGVYRRST------..DIK---HF.IDV----QGV.E
Q8XXL8_RALSO/214-382NAPRFYAPRTVSAFAALKA......A---HPD--IRVLAGSTDLGLWVTKQ------LRELG---DL.LYV----GQV.A
ALDO2_ARATH/218-402GMYRWCSPASVEELSSLLEACKANSN---TVS--MKLVAGNTSMGYYKDER------EQNYD---KY.IDI----TRI.P
Q73PR8_TREDE/6-176KNSIVYRARYMQEMQTILK......N---ISN--IKPIAGATGFLNHQTDE------MIYLP---EHILDL----NFL.P
Q9NCL9_CULQU/211-388NQREWHKVYNVQDVFAILEK....VG---SRP--YMLVAGNTAHGVYRRSD------..SLE---VF.IDI----SSI.E
Q7D9X3_MYCTU/5-181GPFEYERATSVDHAIGLLD.....RL---GEG--ARVVAGGHSLLPMMKLR------IANPE---YL.VDI----NDLAP
Q9EWG7_STRCO/216-384DDSAFLRRSTLAETLRLLR......E---RPQ--AVVVAGSTDWGVEVNIR------SRRAD---CV.VAV----DRL.P
Q97VI7_SULSO/4-174PDFTYVRVSSSEEATKFLE......S---HDD--ARPLAGGQSLIPMLKLR------VISPN---YI.VDL----NPI.T
A9CL41_AGRT5/2-219NIFSYHQPSDTASAIALKQ......A---GPT--AKYLAGGTNLVDLMRET------VERPE---TL.VDV----THL.S
Q8LHR9_ORYSJ/267-447SVSSWYQPKNVEEYYKLIGSLSSSSD---KSR--TKVVVGNTSSGVYRDAE------L..YD---RY.IDL----RAI.P
Q7VS58_BORPE/4-175AQFEYFRAESMQQALQWLR.....QH---DGR--AKLMAGGQSLGPMLNLR------LARPP---VV.IDI----SGV.P
Q89GV6_BRAJA/4-175RAFSYFRAATIDQALDAHA.....RA---GDE--ARFIAGGQSLVPALSLR------LQAPR---LL.IDI----THI.D
Q87YY2_PSESM/195-363GEKHCLIPLTVADLADLYQ......A---NPQ--ARLLAGGTDLALEVTQF------HKALP---AM.IYV----GHI.A
XDH_CALVI/248-432ERATWYRPGNLEDLLKIKA......Q---FPE--AKLVVGNTEIGVEVKFK------HFLYP---VL.VNP----TKV.K
Q8RLC1_DELAC/227-399RTDFFHAPRTLADLASLCE......A---KPK--ARIVAGSTDVGLWVNKQ------FRDLG---DM.IYV----GDV.A
Q6MJY3_BDEBA/203-371GAKKFTAPANFQVATEQKS......K---SPQ--TRLVAGATDLGVLHNKG------KAFMD---DV.MSL----HKI.T
A9CI15_AGRT5/197-365GEDRSIIPATLSDLTEIYA......A---EPK--ATIVAGSTDVGLWVTKQ------MRALN---PV.IFI----NNL.G
Q89XH7_BRAJA/2-168YQTTYHRASSVDEAASLFG......K---SSE--AKFLSGGQTLLPVMKQR------LASPS---DV.IDL----GKI.K
Q976U6_SULTO/9-170KKFKYIKVNSLDEALELLR.......---.DG--SKVLAGGQSLLPLLKLR------ILNVD---TL.IDI----KNL..
Q6AIN3_DESPS/3-161KIGNYLCPSSLEDAYQVLQ.......---DVP--ASVVLGGCG...YLRLA------GRRID---TA.IDL----VKL..
Q6AK64_DESPS/1-173MVQEYLFPATVSEAVALLA.....SK---DGK--ARIIAGGTDLVLDMKDG------KFAAD---VL.LDL----SNI.G
Q98CI6_RHILO/201-369AKARLIVPANVDDFATVLD......Q---EPG--ATIVAGSTDVGLWVTKH------MRDIS---PA.VFI----GNL.D
Q9FV24_SOLLC/235-418LRYSWYTPVSIEDLQSLLNSN.VTEN---GAS--FKLVVGNTGTGYYKETQ------..RYD---HY.IDL----RYI.P
Q90W93_POERE/237-417ERMIWMSPTSLEELVQLRA......K---NPK--APLVIGNTNIGPDIKFK------GILHP---LI.ISP----MRV.K
Q92VB8_RHIME/200-368EDERVVLPASLDDFAAVLE......A---NPK--ATIVAGSTDVGLWVTKF------MRDIA---PV.VHL----SHL.E

PF01565

GGLO_MOUSE/21-156P.EMYYQPTSVGEVREVLALAR..QQ...NKK..VKVVGGGHSPS.DIA.C........TDG...FM-IHM.G..K.M-N
Q9FE45_9ASPA/67-206P.SAVFLPSSPSDIATLLRLSHFSPH...SFT..VSARGLGHSTR.GQA.Q.......AFGG...IV-INM.P..S.L-D
YITY_BACSU/45-181I.KQTVKGQEEEMLIDTVKEAN..RK...NIK..ISIAGAQHSMG.GHT.Y.......YEDG...IV-LDM.T..G.Y-N
Q7S1P7_NEUCR/64-202P.VAIAVPTTIEHIQGAVSCAT..KL...GIK..VTPKSGGHSYA.SFG.LG.....GENGH...LV-VEL.D..R.M-S
Q7RV07_NEUCR/47-186P.EAVVRPKDSNDIAEVIKCAT..QH...GYK..VQAKSGGHSFG.NYGLGG.....GQDGV...IT-IDL.V..N.F-Q
Q9YFD3_AERPE/61-201PRAYVAKPRSRGAVERIVEAAA..EA...GAC..LVPRGGGSNVV.GAS........PPLGC..CLI-LDL....RML-D
MURB_SYNE7/29-161A.QFYDEPASVEAIATAWQWAR..LA...DFP..VTFLGAGSNLLISDR.G........LPG...LV-LNL.R..R.L-Q
MURB_LEPIC/43-173P..VIVEPEISSQVSEILHIFS..KF...DIP..WKILGGGSNLLISDH.........PDNF...VT-LRL.S..GKF-K
Q9RTM9_DEIRA/61-199P.LAVVLPESTADVVAAVKAAK..AA...GVP..IVGRGAASGLS.GGV.T......PLQES...LV-ISF.T..R.M-T
MURB_STRP1/28-158A.DFLAFPRNHYELSRIVAYAN..KE...NMP..WLVLGNASNLIVRDG.G........IRG...FV-IMF....DKL-N
Q72F25_DESVH/44-183P.DMVVLPESVGQIQALMRLAT..EH...RFP..VIPRGGGTGLA.GGC.L......ALMGG...VV-LSV.E..R.M-N
Q8KSY2_9ACTO/34-166P.RAIAYCTSPDDVLACVRHAR..EA...GIP..AHVRGAGHSFN.GWS.T........GTG...LV-IDL....SRM-N
Q9RJ97_STRCO/99-239P.AAVVLPDGHDEVLAVLAACA..EH...GLA..LVPFGGGTSVV.GGL.AP....GREGAF...VA-LDL.R..R.M-N
MURB_ERWCT/20-153A.SCIKVADTQDKLIEEWRVAS..AS...QEP..VLLLGEGSNVLFLED.F........LGT...IL-LNR......L-K
Q69BI6_9NOCA/43-181P.LVVARPRHADEVAAALAVCR..RE...GVP..LTSRGGGTSVA.GNA.V........GTG...LI-LDF.S..RRM-N
Q8XND2_CLOPE/36-171P.LGIVFCNNIDDVKNALEWAK..EN...NIP..FRIRVGRHNYE.GYS........IENDI...LV-IDL.S..K.M-N
Q9EYH6_YERPS/48-184P.AGIVRAATEADVIRTIVFAK..ER...GME..VSVRGSGHNYV.GCFLR........VDT...LM-LDI....SGL-K
O86000_SPHAR/54-193P.SAAVAPANMEQIQQALKVFN..AY...KLP..IWTFGNGRNFAYGGP.AP.....RQSGY...VM-FDL.K..R.M-N
Q8EGB1_SHEON/385-520P.LAIIKCRTRQDVKIVYKTAV..DY...HLA..ISVRSSGHDHE.GESGE........TNS...IV-LDL....ELM-N
Q9HMR2_HALSA/64-202P.VGVVFPTSTDDVAAVVSYCA..DR...GIP..VLPRGGGTSLA.GQA.V........NEA...VV-LDF.K..HAM-N
MURB_STAAU/37-167A.DFYITPTKNEEVQAVVKYAY..QN...EIP..VTYLGNGSNIIIREG.G........IRG...IV-ISL.L..S.L-D
Q98KY4_RHILO/16-149P.....RAIHADAAIALLKSGQ..AK...EAS..LLAYGNGRSYG.DSC.Q.......NQAG...AV-VDM.R..T.L-N
Q9RDU1_PSESP/57-197P.AGALTPSSVEQVQKVMGICN..KY...KIP..VWPISTGRNWGYGSA.SP.....ATPGQ...MI-LDL....RKM-N
Q7P685_FUSNV/21-150A.KKLIILETKEEIVDVYNDKE.......NTN..IFILGNGTNVLFTDE.Y........MDR...TF-VCT....KKL-N
Q9A8X8_CAUCR/61-191P.AARLAPKDEGELATALKVAQ........AP..IRPVGSGHSFT.ALA.........PTDG...TL-VSL.D..S.M-S
Q9ZK04_HELPJ/41-178P.KIVAWVKNEEEVQKLCALAK..KH...GVT..LTFRAAGSSLS.GQA.S........CDG...VL-VVV.A..HFF-K
O29450_ARCFU/37-175A.TAVVFPENTEQVARIAKLCY..EN...NIK..IYPQGSSTELS.GSS.V.......PEDG...IV-INF.S..K.M-N
MURB_NEIMA/22-156A.RAFIALEHADGLRDIVRLPE..FN...RDT..VLWLGGGSNILLMED..........YAG...LV-VHMEN..KGI-R
Q7SHH8_NEUCR/74-210Y.QAAITPTTEADIVSLVKMAK..QH...NIP..FLATGGRHGYGTSLGKC........QEG...LA-IDL....SHF-K
Q82G17_STRAW/96-229P.AAVAYVAHADDLRTTMAYAR..AH...GVK..VAIRNGGHSYA.GWS.S.......GNGR...LI-LDV.S..K.L-N
Q7N1V5_PHOLL/58-193P.LAVVCVKNTDSIIDIIHYCN..IN...EIP..INIRGVGHSFGTQSL..........SKG...IV-LVV.S....V-E
O33177_MYCTU/35-170P.EVIVQAVSADDIVSAIRYAT..VN...GHK..VSVVSGGHSFAASHL.R........DGA...VL-LDV....SRI-D
Q974L0_SULTO/23-162P.KIVVYPKNEEEIVKIVNYAR..ET...RTP..IVTWGAGTSLS.GHL.M.......CDGC...IL-LDM.S..KYM-N
Q6L2S1_PICTO/39-177P.LCVVKITDENIISRVLKIAS..KY...HLN..VIARGGGSSPT.GAV.V......PVENT...IV-LDM.R..P.L-N
ADAS_DICDI/141-282P.DLIVLPHSHEEVERLVQLAH..KY...NVV..IIPMGGGSNIV.GAI.EPV...SNERFT...VS-IDM.R..R.M-N
Q9X5T1_STRLA/54-186P.ALVVVATGAADVIAAVRFAR..AR...GLG..IAVQATGHGKSSAAT.D..............VL-IST....RRM-T
Q9RVK1_DEIRA/39-176P.DAVLHVQSEQDVVDALRIAG..EY...LFP..IVPFSVGSSLE.GQV.I......PVRGG...LT-LNL.L..G.M-N
MURB_HAEDU/19-152A.NQIIEFTTVSQLITEWQKAT..RA...DQA..VLILGQGSNVLFLDD..........FNG...VV-LVN....K.L-K
Q7S4K5_NEUCR/69-206A.VAVVYPRTTDHVSAIAQICN..AR...NLP..MVPFGAGSSVE.GNF.S......QPYSG...IC-IDF.T..Y.M-D
Q7S1N4_NEUCR/85-222S.AAYFQPVSAAEVSTALSIIT..KT...QCK..FAVRATGHNPNPGFS..S.....TREDG...VI-IDL....QLL-N
Q9F3A3_STRCO/70-207P.QVVVLPETIEDVAAVLAYAR..DH...GRQ..VVFRAAGTSLN.GQA.Q........GED...IL-VDV.R..RHF-T
MURB_SHEON/21-152S...LIEVRSKAELQAICLPLY..QS...KQP..MLVLGGGSNIVFTDD..........FNG...TV-VRV......L-S
Q7V4C5_PROMM/41-176VQAKVVQPASVQQVQELVRQAS.......PAS..LIARGLGRSYG.DAA.Q.......LDGA...SA-VEM.G..A.F-D
MURB_NOSS1/59-191A.ELYVAPRNIEALQASLRYAQ..EH...NLR..VTTLGAGSNLLVSDR.G........ISG...LV-IAT.RHLR.Y-T
Q8LP11_SOLLC/107-242T.RAFLQPESVEELEGIVKEAN..VR...KHK..IRPVGSGLSPN.GIG.........LTRA...GM-VNL.A..L.M-D
MURB_BACSU/34-165A.DVLVIPSSVDAVKDIMDVIK..KY...DVK..WTVIGRGSNLLVLDE.G........IRG...VV-IKL.G..AGL-D
Q72R23_LEPIC/52-187P...VLFPEKEEDFKNIFSYAD..QK...GLK..LTFRGGGCSYG.DAA.T.......NTKG...TV-IDI.S..K.Y-N
Q7NFT8_GLOVI/37-175P.IGVVIPRSQADVVATVQATR..AA...KLP..VLARGGGTSVS.GQA.V........GQA...VV-LDF.S..KYM-H
MURB_ACIAD/22-156A.SHYIKVQSVNELIEALDYAE..QQ...QLN..ALILSGGSNMLLPQS..........LDA...LV-LHI.D....I-Q
Q9KB02_BACHD/48-187P.KAVVFPENTREVASIVRYCH..DH...NLP..FLARGAGTGLS.GGA.I......PINGE...VI-ISL.V..R.M-K
MURB_ECOLI/17-150A.QHIVCAEDEQQLLNAWQYAT..AE...GQP..VLILGEGSNVLFLED.Y........RGT...VI-INR......I-K
Q7NCA8_GLOVI/44-184PETPVVLPDSPASLAEVMTCAH..RE...RWR..VLPAGRGSKLG.WGA.L......PRAVD...LL-VST.A..R.L-N
Q8CJQ0_STRCO/57-195P.LGVVVPRTPEAGVEAVAVAR..EF...GAP..VLSRGGGTSLA.GQC.T........NAG...VV-LDW.S..KYC-T
Q726S9_DESVH/41-181P.ALVLRPTETEQLGKLVKLCY..EN...DHP..ITVRGAGTNLS.GGT.IP.....DKREG...IV-ILT....NSL-N
Q98I12_RHILO/59-194PVYGVVEVSEEHHIAKALAFAR..AN...GLK..VSLAAIRHSMG.GHA........FDDNA...LV-LDL.K..K.F-N
MURB_PSESM/23-157A.RLFAQARNDDEVREALAYSA..EH...DVP..LLVIGGGSNLLLSGD..........VQA...LV-LRMAS..RGI-R
Q8TH91_METAC/83-222P.DYVVRPKSTDEVSRIVRLAY..EN...EIP..LTARGAGTGLA.GGA.V......PVSGG...IV-LDM.S..G.M-N
MURB_WOLPM/30-160A.DVLFKPCDIEDLTYLIK.....NT...ELP..VSVIGATSNIIVRDS.G........IRG...IT-VKL.G..KEF-A
O50531_STRCO/29-164P.AREVTPASVDELADAVRRAA..ED...GQR..VKAVGTGHSFT.SIA.........ATDG...VL-IRP.Q..L.L-T
Q8RPG8_DESHA/35-170P.AAVVCPGNTAEVAGIVKLAN..SH...NIK..I....SAAGQV.ADT.K......ALDGG...IA-LIM.N..R.M-N
Q8EGS3_SHEON/22-160P.EVVVHAETLEQVKLTLTVAR..KH...NAP..VTFRAAGTSLS.GQA.I........GEG...IL-LIL.GHDG.F-R
MURB_AQUAE/21-153V.SFYAEPSDLKEISLCIDFSK..SR...DIP..LFVLGNGSNTIFGDV...........RG...LV-VNL....KNL-K
ALO_SCHPO/28-163S.LGLRCPKTEEQLREILVDAN..SN...GKK..IRVVGAGHSPS.DIV.........CTSG...YL-LSL.D..K.M-N
ADAS_MOUSE/193-336P.DIVVWPTCHDDVVKIVNLAC..KY...NLC..IIPIGGGTSVSYGLM.CP.....ADETR...TI-ISLDT..SQM-N
Q7U2X9_MYCBO/74-210P.AVIVTPTSQLDVQKAMAFAA..AN...NLK..VAPRGGGHSYV.GAS.T.......ANGA...MV-LDL.R..Q.L-P
MURB_CAUCR/32-163A.DVVFLPADEQDLSDFLK.GL..DP...SVP..VMAIGVGSNLLVRDG.G........VDG...VV-IRL.G..KGF-N
MURB_STRCO/53-183A.TRLLTATTDAEVIAAVREAD..DT...GTP..LLLIGGGSNLVIGDK.G........FDG...TA-LHI......A-T
Q98KG4_RHILO/152-289P.DGVAFPETTAEVQEIVRACA..AH...RVP..VIAFGVGSSLE.GHT.N......APGGG...IS-VDT.S..R.M-N
Q8FNC2_COREF/44-182P.AAVAEPRTVEDIRDAIAVAV..AR...EWP..IVGRGGGSSVA.GNA.I........GEG...LI-IDT.S..RYF-N
Q7U2P7_MYCBO/36-175A.SALVRPGSAEEVAEVLRVCR..DA...GAY..VTVQGGRTSLV.AGT.V......PEHDD...VL-LST.E..R.L-C
Q9KKW5_VIBCH/47-184P.KIVLRLKSLDEVIFAIQSCG..QL...GIH..FTFRAAGTSLS.GQA.V........SDS...VL-ITL.T..DDW-R
Q82SS0_NITEU/46-186P.GAIVYPESVEEVQAIVRLAA..KF...NVP..VWPVSTGKNWGYGEK.TA.....CYPGG...IT-VVL....ERM-N
Q9A317_CAUCR/35-173T.PLLVTPRSTAEVAAVVGICA..AE...GVA..ITPQGGNTGLV.AGQ.I......PR.GE...IL-LST.Q..K.L-T
Q7U5R3_SYNPX/72-213A.DLVVRPLTVAGVERLAAACG..RH...GVP..LTLRGSGTGNY.GQS.V......PLEGG...VV-MLS.G..A.L-R
O06804_MYCTU/16-151P.SAIVRPTSEAELADVIAQAA..KR...GER..VRAVGSGHSFT.DIA.........CTDG...VM-IDM.T..G.L-Q
MURB1_CORGL/41-172A.AVFAEPSSINEICALLAFMK..NR...PEP..VVVVGGTSNILFDSD.G........FGG...LV-IKL.G.....-.
Q7N7Z9_PHOLL/19-157I.RAVIRPGTIEEVQEIVRIFN..RF...KTHAGLHAISTGRNWGLGSA.QP.....ATDGV...VT-IDL....QRL-N
Q7S350_NEUCR/67-202P.SCVFEPGSAEDVSVALRIIG..AT...KTP..FAVQSGGHTSNPGFS.S........TKG...VH-ISL....KRL-N
Q8XW09_RALSO/54-193P.LAVALPDSEAQVVEILRACH..RL...GVP..VVPRGAGTSLS.GGA.M......PTPGG...LV-LSL.A..K.F-K
Q6HND5_BACHK/20-155P.HYTMYPESIQDVVEVIELAR..KK...GKK..IRVVGSGHSFT.PLV.........QTEE...IL-VSL.D..E.M-K
MURB_VIBCH/21-154A.AQLVVAESIDDLKALYCSAE..WA...SLP..KLIIGKGSNMLFTCH..........YTG...MI-VVN....R.L-N
ALO_ASHGO/29-168P.RLYFQPRSEDEVVAIVRAAR..EQ...GRT..IVTVGSGHSPS.DMC.........ATDD...WM-VNL.D..R.L-N
MURB_MYCTU/33-167A.RRVITCTSAEQVVAALRHLDSAAKTGADRP...LVFAGGSNLVIAEN.L........TDL...TV-VRL......A-N
MURB_CLOAB/38-168V.DVLVMPEKYEEINRIIELCE..KY...DVN..YYIIGNGSNLLVRDG.G........LRG...VA-IKL.L..K.L-N
Q92RW6_RHIME/20-155S.QYKASPGTEAELAELVAEAD..KR...DLG..VRVSGSGHSFT.PVV.........GTSG...LL-LSL.A..D.L-R
Q72LD1_THET2/2-135P...TLRPESPEEVQEAVRAYP..R.........LRAQGGGTKPALSTP.K........EGE...VL-LDL.S..R.L-R
Q9PBD9_XYLFA/32-171P.LAIALPATVQEVQAIVRWAN..DA...HIA..IVPSGGRTGLS.GGA.M......ATNGE...LV-LSL.E..R.M-N
P71984_MYCTU/42-177P.ALIATCHDACDVRTVLRRAV..DA...GMV..TAVRGGGHNVA.GTALC........DGG...VV-IDL....SAM-R
Q726N5_DESVH/138-278P.ILVVAPDTAEQVSAIVRLAN..EM...KFA..IIPRGGGSGLT.GGA.VP.....ARRRT...VI-MSL.T..R.L-T
Q8KEW7_CHLTE/25-165T.PGVFFPETPEEVASLLREAC..AD...GRR..YTIAGNGTGTT.GAR.I......PF.GD...YV-IAM.Q..K.L-D
Q97U59_SULSO/47-180W.KITAIPQTYAELRDVIKFAN..EK...KLS..IYPFSFNMHHI.GPP.V........SID...IG-VKL.S..Q.F-N
Q9I3S8_PSEAE/39-178G.SFLVLPESTDQVAAVVRLCR..QA...GRA..LVPQGGLTGLV.GGG.A......AQAGD...VL-LSL.R..R.L-N
CKX11_ORYSJ/45-187P.AAVVRPASSDDVASAIRAAA..RT..AHLT..VAARGNGHSVA.GQA.M.......ARGG...LV-LDM.R..A.L-P
Q92X65_RHIME/28-163P.SRLDVPEDEETVAALVRAAA..RQ...GRS..IRPVGSAHSSS.EIY.........VTDD...IL-VSM.A..G.I-C
Q7NZ82_CHRVO/51-186A.QALATPGDEAELARLLREAS..RS...GTP..LRCVGAGHSFT.PLV.........PTPG...TI-VSL.D..R.M-S
P74033_SYNY3/47-186A.DLVVLARSEPEAIAVIRCCV..AN...QIP..LTVRGAGTGNY.GQC.V......PLEGG...IV-LDL.S..P.M-Q
Q9S2F6_STRCO/73-212P.AAVVLPRTVEDVQHVMRTAT..AL...RVP..VVPQGARTGLS.GAA.N......ATDGC...VV-LSL.T..K.M-D
Q983S0_RHILO/19-151P.RLIASPADAGELGDLVRTAP........GP..VRVVGAGHSFT.PLV.........KSQG...TI-LSL.E..K.L-E
Q9P6Z1_NEUCS/70-206P.ACFVAPENTLEVAATMKVLA..SL...NTQ..FSVKGGGHTAFAGGSNS........DGG...VT-VDL.M....Y-L
MURB_BUCBP/20-153A.KKIIIVKTIKTLIKTWKKCN..QE...NLP..FLLLGKGSNVLFTKN..........YNG...FV-VVN....R.I-S
YVDP_BACSU/33-169P.LVFVFAQNSYDVSNAIKWAR..EN...KVP..LRVRSGRHALDKNLS........VVSGG...IV-IDV.S..D.M-N
MURB_BRUME/41-173A.QVLFQPSDEEDLSAFLKAVP..EE....IP..LLVVGIGSNLLVRDG.G........VPG...FV-VRLSA..KGF-G
O29393_ARCFU/49-187P.DAVVFPKSTEEVSVILKVAN..TY...GIP..VYVFGGGSGVI.DAA.T......PYEGG...IA-LST.L..S.L-D
Q7URF5_RHOBA/77-214P.LAVVRPRSVADVSATVQYAC..EN...DLP..IHPRGSGSGVS.GES.V........GPG...IV-VDM.S..AHM-K
Q8PPC4_XANAC/43-182P.AAVALPRDTDEVVAIVQACR..AH...GVP..IVARGAGTGTT.GAA.V......PFSGG...VV-VSM.A..R.M-N
Q6CCU5_YARLI/112-251T.QLVLKPTSAEQVSKILSYCN..DK...KLA..VVPQGGNTGLV.GGS.V......PLYDE...II-LSL.S..N.M-N
Q7S0U1_NEUCR/79-214F.QIVIEPGQESDVASIVKYCN..EK...SID..FLAINKGHGYPSSLG.S........FNG...VQ-INL....AQF-R
Q8RPG7_DESHA/41-180P.LGVVSPQTTEQVVELVKYLN..EH...NIK..VIPRGAGTNVI.GGT.I......PAEES...VV-ISF.T..R.M-N
DIML_CAEEL/59-199PNAHVRKVKHIQEQLKEWNDNG..RK...SKL..VNARPGWLTMSFRFP..L.....YKENA...TK-IAT....DKL-F
Q6NAC4_RHOPA/97-241P.DVVAYPRDEAEIAAVMDWAG..GA...GAA..LTPFGGGSSVC.GGV.ECRVDGNRHKAA...VT-LDL.R..H.L-G
Q8F3Y7_LEPIN/117-261V.DGVIYPGKESEISKILEYCS..KN...HIT..IIPYGGGSSVV.GGL.EVIK.AKGQKQV...LS-LDT.T..R.M-N
Q84HB2_STRCZ/65-200P.VAVLHPADAEDVATIVRFGR..EN...GFA..VVPRGAACSVD.GQA.Q.......TSDG...IV-VDL.S..S.L-S
Q9HTK4_PSEAE/8-144P...DAGADHAGALLERVRDAL..AR...RAP..LRIVGGDSKAFLGRP..........VAG...EP-LAL....AEH-R
ALO_NEUCR/51-186P.ELYIQPESVSEIQKVVRLAR..HA...RRR..VTTTGCGHSPS.DIT.........CTSS...WL-VNL.D..N.F-N
Q96YM3_SULTO/46-183P.DYVIYPTSVEDVIDAVKIAL..KY...KVP..ITPYGRGTNRY.GNA.L......TTEGG...IL-LDF.S..K.M-D
Q9SA87_ARATH/77-216P.ISVVAAATWTHIQAAVGCAR..EL...SLQ..VRIRSGGHDFE.GLS.Y........TSTVPFFV-LDM....FGF-K
Q6ALH1_DESPS/43-180P.QVVVRVANEKEMQLCLREAS..SK...KLP..VTFKAAGTSLS.GQA.I........SDS...IL-LMA.G.EG.W-E
Q8YZY0_NOSS1/35-172T.LGIIRPHNLEELSSALRFAK..QQ...NLR..LKARGKGYTQG.GQS.V.......AQDA...FT-LDL.T..R.L-N
FAS5_RHOFA/27-162P.PVVVVPRTVADVQEALRYTA..AR...NLS..LAVRGSGHSTY.GQC.Q.......ADGG...VV-LDM.K..R.F-N
Q97Y18_SULSO/44-180P.LLVLSPSTTEEVSNIVKLAN..KY...YVC..IVPYGGGSSVV.GGS........YHNNC...VI-LDL.S..K.L-N
Q9KB00_BACHD/33-172G.LLEIIPTTERELADVLTLAS..EE...EHL..VTVEGAGTKRG.FAG.T......LLETE...WV-VSL.Q..Q.F-T
MURB_BORPA/35-168A.PAFVALTEPSQLPALSALAP..RF...R.Q..LVVLGGGSNVVLPAS..........IDG...LV-AQV....R.L-P
Q8GQQ2_LACPN/49-188A.LAYVEAHTTKDIQGTLKTAR..KY...HIA..VIPQDQTTSTV.IGA.D......GLTDS...LI-LST.A..K.M-N
Q8FEI0_ECOL6/51-191P.AAVVKLGSTEQVSRVLNFMN..AHKINGVP..RTGASATEGGL.ETV.V........ENS...VV-LDG.S..A.M-N
Q97U60_SULSO/35-172P.PVVVLPGSEEEVISLVNFLN..EN...NIK..YIVRGSGTSLS.GAT.T......PTQGE...VV-ISL.T..R.L-N
Q96XG8_SULTO/47-186I.LGAVIAEDENDIEYAIKVCS..KY...RIP..LLARGAGTSTI.GQV.L......PIFPS...IV-VDI.Q..K.L-N
MURB_YERPE/20-153A.SNVISAGSVETLIAAWHESK..AK...RQP..VLLLGEGSNVLFIKN..........FSG...TV-L........L-N
Q6N8A2_RHOPA/39-178A.AALVRPTSTQQVSEILRWCH..AN...GVH..VVTHGGLTGLV.HGA.D......AEPSE...VI-LSL.E..R.M-R
Q9HTM8_PSEAE/30-162P.LAREAPKDLDELVRIIRQAS..GR........IRPVGSGHSFS.ALV.........PTDG...TL-LSL.A..Y.F-S
Q9HGH9_ASPOZ/122-264V.RYAVNVSTPAHVAKTLQFAN..EH...NIR..FVIRNTGHDYN.GKS..........TGA...GA-LSVWT..HHL-K
Q89HF0_BRAJA/40-178P.SGVVVPKTMDEALRALAIAR..DE...GRK..VTPRGGGTSQC.GQT.V........NDG...LV-VDL.S..KHL-N
Q9KHK2_9ACTO/45-180P.ALIARCTSTPDVVAAVSFAR..KS...GLL..VAVRGGGHSMA.GHSVC........DGG...IV-IDL....SLM-N
MURB_LEIXX/19-154P.ERLLEPADRDALVATAREVW..ST...GDE..WLLLGGGSNTIAADD.G........FEG...TV-LRIVT..RGV-E
MURB_CHLCV/31-161A.NYFKEVHSTSEAQRVIQFLY..SH...NYP..FIIVGKGSNCLFDDQ.G........FDG...FV-LYN.S....I-Q
Q7YWB6_LEIMA/137-280P.DCILLPNSHKDCVEIMRLAH..KH...NVV..VIPFGGGTNVT.GGV.EADP.FERARMI...IS-VDM.R..R.M-N
O86004_SPHAR/40-176P.AGVVLPADEAQLAKVLEAAR..TS...GGV..VQTVCNGAYGLEKAV.Q........DKV...IV-LDL....QKM-N
Q8ERP2_OCEIH/37-174P.DVVCFPTSKEDVQAILEIAR..NN...QIP..VTPFGTGSGLE.GSS.I......PVKKG...IS-INF.E..Q.M-D
Q9HKQ4_THEAC/37-176P.EAVLLPGSPEDVQRIMKLAY..KY...EVP..VVVRGGGSSLT.GSS.I......LKNEG...IV-ISM.L..R.M-N
XYOA_STRCO/17-150A.KELLRPHSLDALRALVADSA.........R..VRVLGSGHSFN.EIA.E......PGDGG...VL-LSL.A..G.L-P
Q869M2_DICDI/40-172P.KLIVIVKNENDIINSIKFCK..EN...NIE..IAIKSGGHGFH.SNC...........KG...LL-LDL....NLL-K
RETO_PAPSO/75-214P.SFIVMPGSKEELSSTVHCCT..RE...SWT..IRLRSGGHSYE.GLS.Y........TADTPFVI-VDM.M..N.L-N
Q883D1_PSESM/55-190P.AAIVYPEHVADIRTSALMAA..KE...GVS..FAMRGGGHHIA.GFSTC........DGG...IV-LDF....KKW-K

PF00941

ADO_HUMAN/239-419E--LSVVNH--------A..Y....NGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYH.ALLK--HLGTLAG-SQIRNM
Q7RXE4_NEUCR/265-448E--LRQYFL--------K..E....NHLEVGGNITLTDLENVCQEAIKHYGEKRGQIFN.AMYK--QLKYFAG-RQIRNV
XDH_EMENI/269-448E--LRQFAF--------H..D....NYLEIGANISLTDLESVCDQAIERYGSARGQPFA.AIKK--QLRYFAG-RQIRNV
Q97W13_SULSO/4-169E--LKYIKM--------E..G....NVVKIGPIVTHYDIIKA..............NIP.LLSE--TASKIAD-PQVRNM
Q92V19_RHIME/2-221G--LDRIEP--------T.EE....GGLHIGAQVRNSDLAAD.........PIVRSRYP.ALSQ--ALLAGAS-GQIRNK
Q92UU0_RHIME/2-217P--LNYIRA--------T..D....EAIVIGALARMSEVAAN.........QDVRRLQP.LIPE--TLTEGAS-PQLRNV
Q9I2H2_PSEAE/2-218P--LRDIRR--------T.PT....GGLLVGALVSNAELAWN.........PAVEADYP.LLAQ--AILAGAS-PQLRNM
O17892_CAEEL/259-440V--LHEKHL--------E..N....DGVYMGTGMSLTDMDNYSVQLMKDLPREQTAVLK.HVHE--MLHWFAG-IHVRNV
Q6SF51_9BACT/2-165A--LQGVTA--------T..A....QEVVIGAAARHADVA...........VEAAAFFP.ALAD--LAGHIGD-PAVRNR
ADO_BOVIN/239-419E--LSVVNY--------T..D....NGLTLGAAVSLAEVKDILANVTRKLPEEKTQMYH.ALLK--HLETLAG-PQIRNM
O87681_ARTNI/4-175G--LANIRK--------S..D....QTIAIGALTRHAKLTTS.........KTISQNLP.ILSE--AAAWIAH-PQIRNR
Q92UJ3_RHIME/205-373E--LQRIES--------S..T....AGLTIGAGVSYTAAH...........EALSSAYP.SFGR--LLDRIGG-DQVRNM
ALDO3_ARATH/222-398E--MSMIKK--------D..E....KGIEIGAAVTISNAIDALE.....KESKSSYVFK.KMAT--HMEKIGN-RSIRNS
Q8CJY1_STRCO/19-185E--IRGWQY--------Q..D....GHALLGAGLTHARMGR..........PDFAALIP.ALAA--AARAAGP-PQIRNA
ADO_MOUSE/238-418E--LGVISQ--------A..R....DGLTLGAGLSLDQVKDILADIVQKLPEEKTQTYR.ALLK--HLRTLAG-SQIRNM
P72222_PSEPU/4-174E--LFEISQ--------S..A....GILSVGAMVTHFRNKTD.........PTVAKCVP.ILPK--VLAHVAH-QAVRNR
Q9Y9R9_AERPE/4-175G--LSYIRE--------E..G....GEIRIGALTTHNEIEES.........SLLKEKNP.LLSE--TASKIGD-LQVRNM
Q6LQT9_PHOPR/1-157A--LDKIEL--------Q..G....EALHIGAMCHIQSLIDN.............ELTPVALKQ--AAAFIYS-RHIRNQ
Q6F9M6_ACIAD/202-370E--LKSIDI--------D..Q....NMLHIGANVSLSDAL...........SKISDIYP.DFEE--LQRRFAS-MPIKNA
Q92WF7_RHIME/2-220P--LDRIEE--------R.PD....GGLVIGATVRNTAVAGH.........PVVRDRYP.LLAQ--AIVFGAS-GQIRNM
XDH1_ARATH/260-440E--LNALNV--------N..D....NGIEVGSALRLSELLRLFRKIVKERPAHETSACK.AFIE--QLKWFAG-TQIRNV
YAGS_ECO57/2-221G--LDKIEV--------T..D...AGGLRIGALVRNTDLVAH.........ERVRRDYA.VLSR--ALLAGAS-GQLRNQ
Q974U9_SULTO/4-169N--LSYITK--------D..G....NLYKIGALTTHYNISKS..............SIP.LLSE--TASNIGD-PQVRNM
Q6N0U3_RHOPA/2-168A--LIGIEA--------S..G....DTLTIKAATTYYDIMHN.........ADVKRLIP.AIAH--LTSVLGD-PAVRYR
Q92XI0_RHIME/2-221G--LDRIEA--------TRE.....GGLRIGALVRNTDLAAD.........ERVRRDYA.LLSR--ALLTGAS-GQLRNR
Q98JI6_RHILO/2-217G--LDRIDV--------N..E....RGATIGALAKMGHVADH.........ADVKSRFP.AISE--ALWQAAS-AQIRNM
ALDO1_ARATH/249-425E--FTMVRS--------D..E....KGVELGACVTISKAIEVL......REEKNVSVLA.KIAT--HMEKIAN-RFVRNT
Q8G2H3_BRUSU/200-368E--LHSIRE--------E..N....GVVTIGAGVTYTQAFGF...........LAGRIP.ALGQ--LINRIGG-EQVRNM
Q9KBF1_BACHD/778-946E--CFELKM--------D..G....TNIILGAAQSLTKIRDA.............GLFP.FLNK--AIVEIAD-HTARNK
XDH_ORYSJ/268-448E--LHTLKV--------K..E....DGIHIGSSVRLAQLQNFLRKVILERDSHEISSCE.AILR--QLKWFAG-TQIRNV
O17505_BOMMO/28-208E--VNYCSI--------E..N....DGILVGAAVTLTELQIFLKSF.IVEHPSKSKIFK.AVNA--MLHWFAG-SQVRNV
O52838_BRAJP/2-168G--LNAIEM--------K..G....RSVVIGATAKHAEVATS.........AVVGEAIP.ALAS--LAGGIGD-PAVRHK
ALDO1_ORYSJ/239-416E--LSAINR--------S..S....NGIEIGAAVSISKAIEILR.....SDGGDAVVFR.KIAY--HLGKVAS-PFVRNT
O17506_BOMMO/254-435E--LNTITE--------N..E....HGLTVGASVTLNDIEKTFREYIKKLPPYKTRVLT.TIVE--MLNWFAG-KQIRNV
O23887_MAIZE/244-417E--LSVINK--------N..D....KAIELGSVVSISKAIEV........LSDGNLVFR.KIAD--HLNKVAS-PFVRNT
Q8ZV34_PYRAE/7-173E--LRYIRE--------E.......EKLKIGALLTHNDVAMH.........ETVVRWAP.ALSL--AAWHIAD-LQVRNR
Q9BIF9_CERCA/242-426E--LNEMQE--------L..E....DSILFGSAVTLMDIEEYLRERIAKLPEHETRFFR.CAVK--MLHYFAG-KQIRNV
XDH_CHICK/258-438E--MNAVQQ--------T..E....TGITFGAACTLSSVEEVLRKAVAELPSYKTEIFQ.AALE--QLRWFAG-PQIRNV
Q9RK26_STRCO/2-220P--LDTVEE--------L.PD....GSLRAGAMVRNSDLAAH.........PAVRDRYP.ALSQ--ALLAGAS-GQLRNA
Q9EWZ3_STRCO/2-220P--LDAIEE--------T.AD....GGLRIGATVTNSDLAAH.........PEVRRRYP.ALTQ--AVLAGAS-GQLRNM
Q8I9N3_ANOGA/220-400G--VDDDRA--------T..S....SGLKIGSAVTLMEMEIALAKKSKPVLETETRLYQ.AIVD--MLHWFAG-KQIRNV
O83120_TREPA/9-178E--LKDISK--------T..E....HFLEFGGAVSLQAIVRL...........GRKNIPVALHE--ALSHAAN-PGIRTL
Q92X32_RHIME/2-174N--LRDFTY--------D..P...AAGLRFGALVTVREIETS.........PHVIGNYP.NLAK--AVSLLGS-VQVRNR
Q84IX9_9PROT/2-222E--LRSLSF--------D..N....DKISAGALITMSQLADH.........PDCQQHAP.AIYG--SLWQAAS-PQIRNM
ALDO4_ARATH/228-407E--MSMIKK--------D..D....REIEIGAVVTISKVIDALM.....EENTSAYVFK.KIGV--HMEKVAN-HFIRNS
Q98D33_RHILO/32-199A--LRGISE--------T..D....DHFFIGARTTWTDLIRH..........PLPPAFD.ALKQ--AAREVGS-PQIQNV
O97896_SYNCA/228-408E--LNAVEH--------G..P....EGIPFGAACTLSSVEKTLLEAVAKLPTQKTEVFR.GVLE--QLRWFAG-KQVKSV
DCMM_OLICO/4-175D--LVGIRE--------E..G....TDVVIGAMTTQHALIGS.........DFLAAKLP.IIRE--TSLLIAD-PQIRYM
Q9VF50_DROME/202-379D--LHQYSS--------D..K....EKLTLGASLSLTETMEIIQ....STSKQSGFEYLEVLWH--HIDLVAN-VPVRNS
P95637_RHOPL/5-215E--IKQLVA--------D..G....SGLTIGAGVTLASLAAD.........GLVAARYP.ALSE--AARAVAG-PGHRKL
Q88F21_PSEPK/195-363E--LKRIEK--------T..A....SHLEIGAATPLTDCY...........AALNEEYP.DFGA--LLHRFAS-LQIRNQ
XDHC_BACSU/10-174E--MRGIST--------S..D....THVSIGGLTSLNECRKN.........PLIKRALS.CFSD--AASAVAA-PGIRSR
Q8P785_XANCP/2-221T--LDTIDA--------T.PE....GGLRIGALVRNTDLAAD.........ARVRRDYA.VLSR--ALLAGAS-GQLRNR
O54050_RHOCA/176-344D--LAQIRE--------T..P....DGYGIGAGVTIAALRAF...........AEGPHP.ALAG--LLRRFAS-EQVRQV
Q6GMC5_XENLA/148-328D--LNVVKY--------T..N....DGISVGAACSLSVLRDTLNKAVLEHPEEKTKTFC.ALLQ--QLKTLAG-RQIKNM
Q8XZD4_RALSO/2-168G--LAGIRS--------Q..P....GVVTVGAATRHADVADS.........EDVRRMLP.ALAE--LAGGIGD-RQVRAM
Q59127_ARTNI/4-174G--LTRLEE--------V..G....DYVRFGPMVTHATIVNS.........PAVAKHLP.MMAA--AGRHIAH-PQIRNR
Q89PE8_BRAJA/4-175E--LRQIER--------K..G....DAVVIGAGVRQADLLAW.........PDLAETLP.LVAL--ALPWVGH-MQTRSR
DCMM_HYDPS/4-175E--LRGIRE--------E..G....STVVIGAMTVENDLISS.........PIVQARLP.LLAE--AAKLIAD-PQVRNR
Q9ES55_MOUSE/240-421E--LNLMDT--------T..N....NGVTIGAGYSLAQLKDTLDFLVSGQPKEKTKTFR.ALQK--HLRTLAG-SQIRNM
Q52588_9PSED/4-175N--FAGYGK--------K..P....ALSALGAMTTENELIAS.........ELLKEKVP.LLPE--AAQLIAD-PQVRNR
Q6LPZ7_PHOPR/191-359D--MKVLEE--------T..D....SDIIIGANLPISDCYEI...........ISKHYP.DFGE--LLHRFAS-LQVRNQ
Q9KEV2_BACHD/4-177E--LKGVHL--------I..EEGGGQKLIIGAMTTLSECMGD.........SLLHEWCP.SVVT--SCGQIAA-PSVRNQ
Q89PX9_BRAJA/4-175E--LKRAEV--------S..G....GELVLGALVTHADIEDG.........RTADVTRG.AMRG--VAANIAY-RAVRNR
Q7DM89_SOLLC/83-266E--LSIIKR--------D..Q....TGIEIGATVTISKFISVLKEESHINLGSYGKLVSQKLAD--HMEKIAS-PFVRNS
Q7TP79_RAT/448-628E--LNLVDT--------A..N....SGVTIGARHSLAQMKDILHSLTLEQPKEKTKTHQ.ALLK--HLRTLAG-PQIRNM
ALDOL_ORYSJ/224-406E--LSAIVR--------K..D....KGIEIGAATSISRTIEILNQESESTSSPNGSVVFRKLAE--HMSKVAS-PFVRNT
Q6V956_MOUSE/239-419E--LFVVTN--------T..K....QGLTLGAGLSLTQVKNVLSDVVSRLPKEKTQIYC.ALLK--QLKTLAG-QQIRNV
Q8FE94_ECOL6/3-174E--LQGITQ--------A.ED....GALRIGSATTFTQLIED.........PVIQRNLP.ALCA--AAASIAG-PQIRNV
Q86NS1_DROME/200-377E--LHQHSS--------E..G....QQLKLGANLSLTQTMEIIR....TTSKQPGFEYLDVLWN--HIDLIAN-VPVRNS
Q8XXL8_RALSO/214-382D--LCALDK--------R..D....GWLEIGAAATLEQAYAF...........LAEDYP.ELTE--MWRRFGS-LPIRNA
ALDO2_ARATH/218-402H--LKEIRE--------N..Q....NGVEIGSVVTISKVIAALKE..IRVSPGVEKIFG.KLAT--HMEMIAA-RFIRNF
Q73PR8_TREDE/6-176E--LKVISK--------T..E....RYFEFGAAVTLNEILDL...........GKKNIPPSLYY--SIEKIAN-NAIRSL
Q9NCL9_CULQU/211-388E--LKYHSL--------G..C....SSLTVGANTTLTQLLQILTE...AAVKSTDFRYCTELAK--HVDLIAN-VPVRNA
Q7D9X3_MYCTU/5-181E--LGYVVV--------G..GINNPNLVRLGAMTRHREILDS.........DALAAVCP.IFRD--AERVIAD-PVVRNR
Q9EWG7_STRCO/216-384E--LRDLRV--------E..S....DHVEIGAALTLTEIE...........RRLDGSVP.LLAQ--LFPQFAS-RLIRNG
Q97VI7_SULSO/4-174S--LSYVRS--------S..F....NSTKIGALTRYNEILKN.........DLVRVNVP.LLHQ--AVRVVGD-MQVRNL
A9CL41_AGRT5/2-219S--IIERRT--------D.......GSLLVGAGVKNTALAAH.........DAVRAQFP.LLSR--AILAGAS-AQIRNV
Q8LHR9_ORYSJ/267-447E--LNSVSK--------D..V....KGVGIGAAMSISQVIEILRG...EGNSYKDVVFC.KIAD--HMEKVAS-QFVRNM
Q7VS58_BORPE/4-175A--LREVGE--------R..G....GRVRVGAAVTHAEIEDG.........VHAALRGS.ALQQ--VATGIAY-RAIRNR
Q89GV6_BRAJA/4-175E--LRGVRR--------E..G....GYLRIGALTRHCEMLSE.........PLIAEFAP.LLAA--AAPFVAH-PAIRNR
Q87YY2_PSESM/195-363E--MKRVER--------F..D....DRLEIGAATPLTDCY...........AALKAQYP.DFGE--LLQRFAS-LQIRNQ
XDH_CALVI/248-432E--MIDVQE--------L..E....DSIYFGASVSLMDIDRILRSSIEKLPEHQTRFFQ.CAVN--MLHYFAG-KQIRNV
Q8RLC1_DELAC/227-399E--MKRIEV--------R..PDAEGGELYIGAGASLESAW...........SALVQRWP.SLTD--VWLRFAS-TPIRHA
Q6MJY3_BDEBA/203-371D--TNEIKM--------T..A....DGVWVGARVTLTALENF...........LEDKLP.ELSR--LLRIFAS-PQIKNQ
A9CI15_AGRT5/197-365D--LQTITV--------G..E....DGITLGAGVTYSQAF...........KTIAEHFP.PLAR--LFDRLGG-EQVRNM
Q89XH7_BRAJA/2-168D--MIGIEA--------A..G....DTLTIKAATPHYDVATS.........DAAKKAIP.ALAY--LASLIGD-PAVRYR
Q976U6_SULTO/9-170D--LRGVKE--------N..E....KEIEIYSLTTHNEVASKV.......K.........LLSK--VAFTIAD-FQVRNK
Q6AIN3_DESPS/3-161G--LDTVVD--------S..D....SSLEIGAMTSLREIETN.........PLILEMCQGLLSR--SVKNIVG-VQLRNC
Q6AK64_DESPS/1-173E--LSDIAE--------A..D....GYIRIGANVTLSQVVNS.........KLVHQHAP.ALVQ--ACRKVGS-LQIRNV
Q98CI6_RHILO/201-369G--LCTVSE--------D..K....GVISIGAGVTYTEAFSM...........LAKRIP.ALGP--LFDRIGG-EQVRNM
Q9FV24_SOLLC/235-418E--LSIIKR--------D..Q....AGIDIGSTVTIYKLISFLKEESKINFGSYGKLVSDKLAY--HMEKIAS-PFVRNS
Q90W93_POERE/237-417E--LFEVSE--------G..A....DGVWVGAGSSLSELQSLLEKMVPQNPEEKTELFR.ALIQ--QLRNLGS-LQIRNV
Q92VB8_RHIME/200-368E--LRRISI--------A..P....DGITLAAGVSYTEAY...........PVIVRNFP.QLRE--LWDRIGG-EQVRNM

PF01565

GGLO_MOUSE/21-156R..VLQVDK....E...K-------KQVTVEAGILLTDLHPQ------------------LDKH..GLALS.N.LGAVSD
Q9FE45_9ASPA/67-206G..GITVSI....D...G-------MFVDAGAEQMWIDVLRE------------------T.LR..HGLTPKS.WTDYLY
YITY_BACSU/45-181K..ILSLDQ....E...K-------KTIRVQSGATWNDIQKY------------------VNPY..GLAVK.V.MQSQNI
Q7S1P7_NEUCR/64-202K...VTLDK....T...T-------NIADVQSGARLGHVATE------------------L.PY..FLAWPGL.TKEGNR
Q7RV07_NEUCR/47-186Q...FSMDN....K...T-------WQATIGAGSHLGDVTDR------------------LHDA..GGRAMAY..GVCPD
Q9YFD3_AERPE/61-201K..ILWFSG....E...D-------LVVHVEAGAVVSKVEEW------------------LNRR..GYTLGYH.PQSQSL
MURB_SYNE7/29-161G...ATFDL....A...T-------GCVEVAAGEPIPRLAWA------------------A.AR..QGWSGLE.WAVGIP
MURB_LEPIC/43-173E..FVSLG.........D-------GKFKIGAATNTTPTFRQ------------------I.SQ..LGYTGAE.FLSTIP
Q9RTM9_DEIRA/61-199G...LHIFP....E...R-------REAVAQPGVVTLKVTEA------------------AKPH..GLMYPPD.PASFRT
MURB_STRP1/28-158A...VHLN.........G-------YTLEAEAGANLIETTKI------------------A.KF..HSLTGFE.FACGIP
Q72F25_DESVH/44-183R..VRAIDT....R...N-------LVAEVDAGCITQTLRDA------------------AAAA..NLFYPPD.PAGMDR
Q8KSY2_9ACTO/34-166H....AAAD........G-------PTVSIGAGIQSLDALDA------------------LKRH..DRQII...TGTFPT
Q9RJ97_STRCO/99-239R..LLDLDE....V...S-------RTATLQPGLRAPEAEAL------------------LAEH..GYTLGHF.PQSYEW
MURB_ERWCT/20-153GIDIREESD........G-------WYLHVGAGENWHQLVEY------------------T.LK..CGITGLE.NLALIP
Q69BI6_9NOCA/43-181R..VLSIDR....D...A-------QTATVEPGTIQTVLQQA------------------VAPQ..GLRFGPD.PSTFTR
Q8XND2_CLOPE/36-171...NIIIDE....E...N-------MKVTIEGGVKNEEIYEA------------------L.....GVLGYPF.PGGGCP
Q9EYH6_YERPS/48-184G...LDIDS....R...H-------KRAIVESGVSSGQLCHA------------------LAAK..GLAFP...TGHVKE
O86000_SPHAR/54-193R..ILEVNE....K...Y-------GYALVEPGVSYFQLHRH------------------LRKI..GSKLWVD.PAAPGW
Q8EGB1_SHEON/385-520D...IELDP....I...S-------GIVAIEPGCTIGNITSY------------------LAQK..GLMLPHSTSASH..
Q9HMR2_HALSA/64-202G..FVGFDP....E...A-------ETARAQPGITLAALNDE------------------LAAH..GLKYAPD.PAWGDK
MURB_STAAU/37-167H..IEVSDD.........-------.AIIAGSGAAIIDVSRV------------------ARDY...ALTGLE.FACGIP
Q98KY4_RHILO/16-149H..IGAFNA....E...T-------GVLEADAGVLLSDIIAH------------------AAPY..GFFPAVV.PGTQ.F
Q9RDU1_PSESP/57-197K..IIEIDV....E...G-------CTALLEPGVTYQQLHDY------------------IKEH..NLPLMLD.VPTIGP
Q7P685_FUSNV/21-150K..IEDLG.........N-------NLVKVETGANLKDLTDF------------------M.RN..KNYTGIE.SLFGIP
Q9A8X8_CAUCR/61-191G..IVGWE.........G-------DEAIVRAGTRLGALGPL------------------LAEK..GRALANL.PDINKQ
Q9ZK04_HELPJ/41-178D..AHILDN........A-------QSIQLSCGVIGSHANDL------------------LKPY..HKKIGPD.PATINT
O29450_ARCFU/37-175K..IEEINV....V...D-------GYAVAQPGVRIAELEER------------------LNEH..SYTFPVD.PGSVRS
MURB_NEIMA/22-156E..IARSDG........M-------VLIEAQAGEIWHDFVLH------------------A.VA..LGLNGLE.NLSLIP
Q7SHH8_NEUCR/74-210D...VKIDK....Q...R-------ETVTIGPGVVFADVFPV------------------VSDA..GYQVQ...TGTCSC
Q82G17_STRAW/96-229.....KTRA.......SG-------GTAVVGAGSKLIDVYRA------------------LAAK..GVTIP...AGSCPT
Q7N1V5_PHOLL/58-193NPVFEKID.........E-------YKFKVSAFETWLSVECF------------------LRKN..GLSFPI..LTRHPD
O33177_MYCTU/35-170H...ASIDA....D...K-------GRAVVGPGKGGSVLMAE------------------LEAQ..GLFF....PGGHCR
Q974L0_SULTO/23-162K..IIEINE....I...D-------WYAHVQPGVNLEYLNKE------------------LNKK..GFFFPPD.PASFFL
Q6L2S1_PICTO/39-177N..IR.VNF....K...D-------GYVEAYAGATLQEVNNE------------------CMKY..GYFFPPD.PSSVST
ADAS_DICDI/141-282K..VLWVDR....R...E-------MTACIQVGIMGPELEKQ------------------LHKQ..GVSLGHD.PDSFEF
Q9X5T1_STRLA/54-186G...VRVDP....R...A-------RTARIEAGVRWEQVIHE------------------A.AA..HGLAPLS.GSAPFV
Q9RVK1_DEIRA/39-176R..VLAIEP....G...G-------FQATVQPGVTYPELNRQ------------------ARRH..GLFFPVD.PGA..E
MURB_HAEDU/19-152GIQHREDHD........Y-------HYIQAQGGENWHNLVEW------------------T.LA..KNIAGLE.NLALIP
Q7S4K5_NEUCR/69-206R..VIAFHP....E...D-------MDVVVQPGVNWVDLNNQ------------------IAHT..GLFVPLD.PSP..T
Q7S1N4_NEUCR/85-222D...KSFDP....E...T-------GIASVGAGNTWGEVYTW------------------LEGK..GRSVM...GGRYEE
Q9F3A3_STRCO/70-207G..IEVLDD........G-------ARARIRPGTTVVRANAT------------------LARY..GRILGPD.PASAIA
MURB_SHEON/21-152KGISVTEDV....S...Y-------FYLEIEAGENWHELVEF------------------T.LN..NHMAGLE.NLALIP
Q7V4C5_PROMM/41-176Q..I.NLDL....V...K-------GSVTAGAGVSLNQLLRV------------------IVPA..GFFLPVT.PGTR.N
MURB_NOSS1/59-191H..FDHQTG........Q-------VTIAAGESIP..SLAWE------------------I.AK..LGWQGFE.WAVGIP
Q8LP11_SOLLC/107-242K..VLSVDK....E...N-------KRVTVQAGIRVQQLVDE------------------IKEF..GITLQ.N.FASIRE
MURB_BACSU/34-165H...LELE.........G-------EQVTVGGGYSVVRLATS------------------L.SK..KGLSGLE.FAAGIP
Q72R23_LEPIC/52-187R..ILEFDS....K...N-------GIIKAESGVTIKQLWEF------------------GIEK..GYWPPVV.SGTMFP
Q7NFT8_GLOVI/37-175R..VIEVNP....E...E-------GTAWVEPGVVQDVFKQH------------------LRPY..GLQFGPE.TATASR
MURB_ACIAD/22-156GLEMIDEDS....E...S-------VKIKVGGGQIWHDFVLM------------------T.TQ..KGWYGLQ.NLALIP
Q9KB02_BACHD/48-187R..LLEVDL....K...N-------RRAIVEPGYVNLKLTQS------------------IEDK..GYYYAPD.PSSQYC
MURB_ECOLI/17-150GIEIHDEPD........A-------WYLHVGAGENWHRLVKY------------------T.LQ..EGMPGLE.NLALIP
Q7NCA8_GLOVI/44-184R..LVEHAA....G...D-------LTVTAEAGIGFAVLQEK------------------LAKA..NQFLALD.PAYPEQ
Q8CJQ0_STRCO/57-195R..VESVDP....G...A-------RTCVVQPGIVLDDLNRQ------------------LAPH..GLRYGPE.PATHPN
Q726S9_DESVH/41-181K..IIEINE....Q...D-------LYAVVEPGVVTAKFAAE------------------VAKR..GLFYPPD.PGSQAV
Q98I12_RHILO/59-194K..V.TVDA....A...A-------KTMTLQPGARWHDIQNL------------------L.....HPRFAVKAMQSTDI
MURB_PSESM/23-157I..VREDCL........E-------AIVEAEAGEPWHPFVQS------------------C.LE..LGLAGLE.NLSLIP
Q8TH91_METAC/83-222R..ILEVDI....D...N-------IQVVVEPGIIQDALNEA------------------LKPY..GFFFPPN.PGSSAM
MURB_WOLPM/30-160...YIKSKG........N-------NSIVAGGAVLLSNLAHF------------------A.GN..QQISGLE.FLVGIP
O50531_STRCO/29-164G..IRSIDR....D...A-------MTVTVEAGTPLKRLNMA------------------LARE..GLSLT.N.MGDIME
Q8RPG8_DESHA/35-170R..ILEIDH....E...N-------MVAVVEPGMSHQEFLKH------------------IGEA..GFNFPPE.PCAVDT
Q8EGS3_SHEON/22-160K..IEVSSD........A-------KQITLGAAVIGSDANAV------------------LAPL..NRKIGPD.PATIAS
MURB_AQUAE/21-153GFKVKEIKG........K-------FFVEAFSGTPLKDLIRF------------------S.VK..ENVKSFY.KLLGFP
ALO_SCHPO/28-163K..VVSFDP....D...S-------LSITVQAGIRFYQVQEI------------------LQNL..GYSLP.I.VGSISE
ADAS_MOUSE/193-336R..ILWVDE....N...N-------LTAHVEAGITGQDLERQ------------------LKES..GYCTGHE.PDSLEF
Q7U2X9_MYCBO/74-210G..DINYDA.......TT-------GRVTVTPATGLYAMHQV------------------LAAA..GRGIP...TGTCPT
MURB_CAUCR/32-163G..VEALG.........D-------NRIKAGSAVPDAILARK------------------A.AE..AGIAGLE.FYVGVP
MURB_STRCO/53-183R..GFRLD.........G-------TTLELAAGEIWTDAVAR------------------T.VE..AGLAGVE.CLAGIP
Q98KG4_RHILO/152-289R..ILAVNP....Q...D-------LDCTVEPGVTREDLNRH------------------LRDT..GLFFPID.PGA..N
Q8FNC2_COREF/44-182R..ILDIDP....E...N-------RTATIEPGVVCDALRDA------------------VAPL..GLTYGPD.PSTHNR
Q7U2P7_MYCBO/36-175V..VSDVDT....V...E-------RRIEIGAGVTLAAVQHA------------------ASTA..GLVFGVD.LSARDT
Q9KKW5_VIBCH/47-184G..HEVQNQ........G-------LKIRLQPGVIGADANKY------------------LAPF..QRKIGPD.PASINT
Q82SS0_NITEU/46-186R..IHEVDE....A...L-------GYAVIEPGVTYKQLNEF------------------LKANYPDLWSDSA.GTTQFA
Q9A317_CAUCR/35-173A..IRDVDP....I...D-------DAMVLEAGVTLYEAHQQ------------------AAKV..GRRFTVG.VASEGS
Q7U5R3_SYNPX/72-213E..VEHLDP....S...T-------GVVMVQPGCLMRDLDQH------------------LRAH..GRQLRLL.PSTWRS
O06804_MYCTU/16-151R..VLDVDQ....P...T-------GLVTVEGGAKLRALGPQ------------------LAQR....RLGLENQGDVDP
MURB1_CORGL/41-172ENFSNFIIE........G-------SRIRAQAGASVPQLVRA------------------V.AT..EGLEGIV.HAGGIP
Q7N7Z9_PHOLL/19-157V..LREIDC....S...S-------GWAVIESGLTQIELARF------------------LVGT..DRMLNVT.ASSGHT
Q7S350_NEUCR/67-202Q..VKLSAD........K-------SVAEIGFGNIWTDVYKA------------------LDGT..GRNV....VGGRVP
Q8XW09_RALSO/54-193R..ILKLDP....H...T-------RTAAVQPGVRNLAISEA------------------AAPH..GLYYAPD.PSSQIA
Q6HND5_BACHK/20-155G..IVNIDT....E...K-------MIAEVWAGTKLHELGKL------------------L.EE..KGYAQEN.LGDIDS
MURB_VIBCH/21-154GIEHQQDDD........Y-------HRLHVAGGEDWPSLVSW------------------C.VE..QGIGGLE.NLALIP
ALO_ASHGO/29-168G..VLELQEDEQGR...Y-------ADVTVAAGIRVYELHRY------------------LSAR..GYALQ.N.LGSISE
MURB_MYCTU/33-167S..GITID.........G-------NLVRAEAGAVFDDVVVR------------------A.IE..QGLGGLE.CLSGIP
MURB_CLOAB/38-168K...LQIG.........N-------NKIIAGCGVPLGYLSRK------------------A.RD..KSLTGLE.FACGIP
Q92RW6_RHIME/20-155G..VQKVDK....A...R-------KQITVAGGTRINEVGKT------------------LKQH..GLSLINQ..GDIDS
Q72LD1_THET2/2-135G..LLAYEP....E...E-------FVFTAFAGTPIAEVEEA------------------LRAH..GQYLPFD.PPLAGK
Q9PBD9_XYLFA/32-171K..MLRFDP....M...D-------RTMTVQAGMPLEAVQAA------------------ARQH..GLLYPVD.FAARGS
P71984_MYCTU/42-177A...VSLDP....A...T-------GRVRVQGGATLADLDHA------------------TVPF..ARVAP...AGIVTT
Q726N5_DESVH/138-278R..ITSVDT....D...A-------LRLCCEAGVITNDAIRA------------------ASAK..GLLFTVD.PASKTA
Q8KEW7_CHLTE/25-165R..IGEVEP....TIDGR-------ALLRVQGGALLQDVQAK------------------AAAA..GWFYPPD.PTEKTC
Q97U59_SULSO/47-180N..VVEISD....D...D-------LYVTSQVGVRVSDLFEI------------------IKAK..GLFLPAY.....YD
Q9I3S8_PSEAE/39-178R..IHRLDA....A...S-------QTLDLDAGVTLEQAQAL------------------AAEA..GLDPGID.LAARGS
CKX11_ORYSJ/45-187R..RMQLVV....APSGE-------KFADVPGGALWEEVLHW------------------AVSK..HGLAPAS.WTDYLR
Q92X65_RHIME/28-163G..LREHDA....Q...H-------HRATVGAGSQLTELSKE------------------LQAA..GMTLS.N.FGDVAT
Q7NZ82_CHRVO/51-186G..LLSYDA....A...A-------GEAILQAGTRIGQLARL------------------LDAQ..GMALRNQ.PDVDVQ
P74033_SYNY3/47-186R..IISLEP.........-------GRAVVEPGVKLGKLEQQ------------------AKQM..GWELRLL.PSTYQT
Q9S2F6_STRCO/73-212R..ILEINP....V...D-------RVAVVEPGVVNATLSRA------------------VNEH..GLYYPPD.PSSWEM
Q983S0_RHILO/19-151G..LVSHDP....Q...K-------HQARVKAGTRLGPLMHI------------------LQGI..GQGLP.N.MGDIDR
Q9P6Z1_NEUCS/70-206T..TLNVSS....D...R-------KTVSIGAGNRWINVSEA------------------LDTL..GLVVA...GGRVAD
MURB_BUCBP/20-153GITIHEQKD........Y-------WLLHVKGGTKWNNLVKY------------------T.IQ..KKIYGLE.NLALIP
YVDP_BACSU/33-169K..VFLDEE........N-------AIATVQTGIPVGPLVKG------------------LARD..GFMAP...FGDSPT
MURB_BRUME/41-173E..VEQVC.........D-------TQLRAGAAAPDKRVAAA------------------A.LE..AGLAGFH.FYHGIP
O29393_ARCFU/49-187Q...IEIDE....E...N-------MVVRAGAGVVGGRLEKI------------------LNHR..GFTLRHS.PQSLYC
Q7URF5_RHOBA/77-214R..ISPSDD........G-------MQVTVQSGATLSSVNRF------------------LKGH..RRWFGPD.PATRSI
Q8PPC4_XANAC/43-182Q..ILALRP....Q...D-------RCAVVQPGLLNGDLQQA------------------LQPH..GLFWPPD.PSSADI
Q6CCU5_YARLI/112-251K..VRSFDN....V...S-------GILVADAGVILEAADMY------------------LAEQ..GFMFPLD.LGAKGS
Q7S0U1_NEUCR/79-214T...INIQP....N...G-------KSAWFGGGVFDGQANRY------------------LWDQ..GYVTT...TGSCDC
Q8RPG7_DESHA/41-180K..ILEIDT....E...N-------FVTVVQPGVVNFDLQLE------------------LEKR..GFYYPPD.PSSAKV
DIML_CAEEL/59-199D..ILDLDV....E...K-------MTVKAEPGVTMGQLSQY------------------LISR..GYTLPVL.PELDDL
Q6NAC4_RHOPA/97-241K..VLEVDA....T...S-------RAALIQGGAYGPALEAQ------------------LKPH..NVTLRHF.PQSFEY
Q8F3Y7_LEPIN/117-261S..LLSLDL....E...S-------HLATFQTGIYGPPLEIS------------------LNEK..GFTLGHF.PQSFEY
Q84HB2_STRCZ/65-200A..VGEPAP.......SL-------VRVDGGAR..WRAVLEA------------------TLPC..GRVPLVV.PDHLGL
Q9HTK4_PSEAE/8-144G..IVAYDP....C...E-------LVITARAGTPLDELQAV------------------LARG..GQMLACEAPGFGGR
ALO_NEUCR/51-186K..VISVDH....L...T-------GLVVVQAGIRLYQLSDE------------------LDRR..GLALP.S.LGSINE
Q96YM3_SULTO/46-183K..V.EIDE....S...N-------MVAITEPGATWKLVDLA------------------AQNK..GLQLRTF.PSSYD.
Q9SA87_ARATH/77-216T...VDVNL....T...E-------RTAWVDSGATLGELYYR------------------ISEK..SNVLGFP.AGLSTT
Q6ALH1_DESPS/43-180D..YEVLEE........G-------QKIRLQPGIVGAKVNRI------------------LAPY..NRKFGPD.PASINS
Q8YZY0_NOSS1/35-172H..VSKVDT.......VA-------QAIATEAGATWQDIVTT------------------TVKY..GMLPCVL.PLNLEQ
FAS5_RHOFA/27-162T..VHDVRS.......GQ-------ATIDAGVR..WSDVVAA------------------T.LS..RQQTPPV.LTDYLG
Q97Y18_SULSO/44-180R..IIEFNE....E...D-------LSVTVEVGIKIKDLEEW------------------LNKR..GYTLDYH.PQSFYL
Q9KB00_BACHD/33-172G..IVDHSI....G...D-------MTVTVKAGTPLRKLQKE------------------LAIF..KQALPFD.MPCDEA
MURB_BORPA/35-168GVRLVGQCA....D...A-------WVVEAAAGENWHGFVTA------------------C.VD..NGWDGLE.NLALIP
Q8GQQ2_LACPN/49-188R..IIEISK....A...D-------SIAVVEPGVVNGDLDKE------------------ARKQ..GMFYAPD.PGSKPI
Q8FEI0_ECOL6/51-191Q..IINIDI....E...N-------MQATAQCGVPLEVLENA------------------LREK..GYTTGHS.PQSKPL
Q97U60_SULSO/35-172R..IYSLD.........N-------FEITVGPGLANFLINKT------------------LGNS..NLFYAPD.PSSYVV
Q96XG8_SULTO/47-186K..VLELDG....D....-------.FLKISPGVKVLQALNY------------------LRKK..GKELRVY.PSSFYI
MURB_YERPE/20-153R..IMGITSTEDSA...A-------WYLHVGAGENWHQLVCH------------------S.LQ..NNMPGLE.NLALIP
Q6N8A2_RHOPA/39-178T..IEEIDP....K...Q-------RTAVVQAGVPLQALQEE------------------VDKH..DLAFPLD.LGSRGT
Q9HTM8_PSEAE/30-162G..LLSHDS....V...T-------LQAEFGGGTPMSQMGAP------------------LKEI..GQALV.N.MADIDY
Q9HGH9_ASPOZ/122-264GIEFKDWKD....EHYTG-------KAVKLGAGVQGFEAYEA------------------ANAQ..GLRVVG..GECPSV
Q89HF0_BRAJA/40-178R..ILSLDV....A...N-------RTCVVEPGIVLDDLNRQ------------------LRKH..GLWFPVD.VSTASR
Q9KHK2_9ACTO/45-180S...IKVSR....R...L-------RRARAQGGCLLGAFDTA------------------TQAH..MLATP...AGVVSH
MURB_LEIXX/19-154R..LAAEKG........R-------IRLRVQAGEPWDALVAL------------------T.VR..NGWAGIE.ALSGIP
MURB_CHLCV/31-161GKEFLS...........D-------TTIKAYSGMSFSFLGKT------------------L.AS..SGYSGLE.FAVGIP
Q7YWB6_LEIMA/137-280R..MISIDR....E...S-------RLATFETGVLGPDLDAQ------------------LFRH..GFMLGHD.PDSYIY
O86004_SPHAR/40-176K..VLEVND....E...L-------ATCLVEPGVTFRQLDAH------------------IKEK..GIKLWVDFPGNPDE
Q8ERP2_OCEIH/37-174T..VLEFSP....E...N-------MTVTVQPGITRFRLNDY------------------INSA..GLYFPVD.PGV..D
Q9HKQ4_THEAC/37-176H..IIDLNL....N...D-------KCVVAEPGVRLDDLERF------------------LDKY..GHFYPPD.PASSRS
XYOA_STRCO/17-150S..VVDVDT....A...A-------RTVRVGGGVRYAELARV------------------VHAR..GLALP.N.MASLPH
Q869M2_DICDI/40-172G..LKYNDY........E-------KTVTIESGCRLGEMDKE------------------NQKH..GYIIP...SGIVSD
RETO_PAPSO/75-214R...ISIDV....L...S-------ETAWVESGATLGELYYA------------------IAQS..TDTLGFT.AGWCPT
Q883D1_PSESM/55-190N...ITLDV....T...T-------GILAVQPGVRLAEIDEF------------------LVSR..NLVIP...TGTVSD

PF00941

ADO_HUMAN/239-419A--SLGGHI.............................................ISRHPDSDLNPILAVGNCTLNLLSKE
Q7RXE4_NEUCR/265-448G--TPAGNL.............................................VTASPISDLNPVLLAADAVLVAKSLG
XDH_EMENI/269-448A--SPAGNL.............................................ATASPISDLNPVFVATNTTLVARSLD
Q97W13_SULSO/4-169G--TIGGSI.............................................SHLDPSADYPAALIAMNAKVRIRSTK
Q92V19_RHIME/2-221A--STGGNLLQRTRCPYFYNRNMPCNKREP..GAGCAALRGFNRMHAVIGTSQACIAVHPSDMAVAMAVLDANVETVSPG
Q92UU0_RHIME/2-217A--SIGGNLLQRVRCPYFRMLDAPCNKRVP..GSGCSAIDGLNAGHAILGTSEHCVATHPSDLAVSLVALGAMLSLKGPR
Q9I2H2_PSEAE/2-218A--STGGNLLQRTRCQYFYDTGTPCNKREP..GSGCPARSGLNRNHAILGASEHCVAVHPSDLCVALAALEAQVLVRGRA
O17892_CAEEL/259-440A--SVAGNI.............................................ATASPISDLNPIWMASNALVVLDSEA
Q6SF51_9BACT/2-165G--TIGGSL.............................................ANNDPAACYPAAVLACGAVIETN...
ADO_BOVIN/239-419A--SLGGHI.............................................VSRHPDSDLNPLLAVGNCTLNLLSKE
O87681_ARTNI/4-175G--TIGGSL.............................................AHADAAAELPVVLLALDAYVTAQSLQ
Q92UJ3_RHIME/205-373G--TIGGNI.............................................ANGSPIGDSPPPLIVLGATVTLRSKD
ALDO3_ARATH/222-398G--SIGGNLV..........................................MAQSRKFPSDVTTLLLAVDASVYMLNGR
Q8CJY1_STRCO/19-185G--TLGGNI.............................................ASAAPTGDALPVLAALEATLIIAGPD
ADO_MOUSE/238-418A--SLGGHI.............................................VSRHLDSDLNPLLAVGNCTLNLLSKD
P72222_PSEPU/4-174G--TLGGSL.............................................AHADAGAEMPFLMATLGATMYIASSA
Q9Y9R9_AERPE/4-175G--TIGGSL.............................................AHADPAADYPAALAALEASVVLRSKA
Q6LQT9_PHOPR/1-157A--TIGGEI.............................................AAFQSEALLVPSLMALKATVILANAS
Q6F9M6_ACIAD/202-370G--TLGGNI.............................................ANGSPIGDSMPALITLDTILRLRSGE
Q92WF7_RHIME/2-220A--TVAGNLMQRTRCLYFYDHAARCNKRAP..GAGCDAIGGFNRMHAILGASDSCIATHPSDMCVALAALDAKVNVIGPS
XDH1_ARATH/260-440A--CIGGNI.............................................CTASPISDLNPLWMASRAEFRITNCN
YAGS_ECO57/2-221A--TTAGNLLQRTRCPYFYDTNQPCNKRLP..GSGCAALEGFSRQHAVVGVSEACIATHPSDMAVAMRLLDAVVETITPE
Q974U9_SULTO/4-169G--TIGGSI.............................................SHLDPSADYPAALIAMDAKVKITSRK
Q6N0U3_RHOPA/2-168G--TIGGSV.............................................ATNDPAADYPAAILALNATVKTN...
Q92XI0_RHIME/2-221A--TTAGNLLQRTRCPYFYDTNQPCNKRQP..GSGCSALAGFSRQLAVVGVSDACIASHPSDMAVALRALDAVVETVRAD
Q98JI6_RHILO/2-217A--TIGGNLMQRTRCPYFRDPSNFSACNKRVSGSGCSAIGGVTRGHAVLGTSEACIAMYPGDLATALVAFDATVHLG...
ALDO1_ARATH/249-425G--TIGGNIM..........................................MAQRKQFPSDLATILVAAQATVKIMTSS
Q8G2H3_BRUSU/200-368G--TIGGNI.............................................ANGSPIGDTPPPLIALGATLTLRKGA
Q9KBF1_BACHD/778-946I--TLGGNL.............................................CANIIYRETALPLLLTNSQVVIASRT
XDH_ORYSJ/268-448A--SVGGNI.............................................CTASPISDLNPLWMATGATFEIIDVN
O17505_BOMMO/28-208A--SLTGNI.............................................VTASPISDLNPILMACSAVLNVYSTT
O52838_BRAJP/2-168G--TIGGSL.............................................ANNDPTADYPAAVLALGATIVTN...
ALDO1_ORYSJ/239-416A--TIGGNII..........................................MAQRMSFPSDIATVLLAAGSTVTIQQVA
O17506_BOMMO/254-435A--AIGGNV.............................................MTGSPISDLNPILMSLKVKLNLLSQE
O23887_MAIZE/244-417A--TIGGNIM..........................................MAQRLPFESDVATVLLAAGSTVTVQVAS
Q8ZV34_PYRAE/7-173G--TIGGSL.............................................AHADPAANYPAVLAALNAEVAVRRKK
Q9BIF9_CERCA/242-426A--SLGGNI.............................................MTGSPISDMNPILTAACAKLKVCSLV
XDH_CHICK/258-438A--ALGGNI.............................................MTASPISDLNPVLMASGSKLTLISME
Q9RK26_STRCO/2-220A--TTGGNLLQRTRCPYFQDVSKPCNKREP..GTGCGALEGVHRDHAVLGHSDQCIATHPSDMAVALAALDARVELHGPE
Q9EWZ3_STRCO/2-220A--TVGGNLLQRTRCGYFTDLSKPCNKRAP..GSGCSAVTGEHHNHAVLGASDHCVAVHPSDMGVALAAFDAVVGYETLD
Q8I9N3_ANOGA/220-400A--SVGGNI.............................................MTGSPISDLNPIFTAAAIELEVASLD
O83120_TREPA/9-178A--TIGGNI.............................................AGTRPHASALAPLIALDAKMEVRTGH
Q92X32_RHIME/2-174A--TIVGNI.............................................CRASPSADTIPPLIADGASLSVYNGG
Q84IX9_9PROT/2-222A--TLGGNLRQRTRCAYYRDPATFSACNKRNPGSGCAARQGVNSNHAILGASDSCIAVYPGDLAVALVAFDAVVIVQNPQ
ALDO4_ARATH/228-407G--SIGGNLV..........................................MAQSKSFPSDITTLLLAADASVHMINAG
Q98D33_RHILO/32-199A--SVAGNL.............................................CNASPAADGVPGLLVLDAEVELRSAA
O97896_SYNCA/228-408A--SIGGNI.............................................ITASPISDLNPVFMASGTKLTIVSRG
DCMM_OLICO/4-175G--TIGGNA.............................................ANGDPGNDMPALMQCLGAAYELTGPE
Q9VF50_DROME/202-379G--TLAGNICT.........................................KKEHPEFPSDIFISFEALDVKVVAMKGI
P95637_RHOPL/5-215G--TVGGNLCLDTRCIYYNQSEWWRRAN.......SYCLKNRGEICHVAPKGNRCHAAFSGDLAPALLVLGAEVEIAGPD
Q88F21_PSEPK/195-363G--TLGGNI.............................................GNASPIGDSPPLLIALDAQVVLRQGE
XDHC_BACSU/10-174A--TIGGNI...............................................ASKIGDFIPLLLVLGAELIVYQKE
Q8P785_XANCP/2-221A--TTAGNLLQRTRCPYFYDTNQPCNKRLP..GSGCAAIGGFNRQLAVIGASEDCIATHPSDMAVAMRALDAVVETVRPD
O54050_RHOCA/176-344A--TIGGNI.............................................ANGSPIGDGPPALIAMGASLTLRRGQ
Q6GMC5_XENLA/148-328A--SLGGHV.............................................IIKDSLSDLNPVLAAANSSLHVLSKA
Q8XZD4_RALSO/2-168G--TLGGSL.............................................ANNDPAACYPAAVLALNATVVTE...
Q59127_ARTNI/4-174G--TLGGSL.............................................AHGDAAGEWPLVLLALNGMVEVQSVR
Q89PE8_BRAJA/4-175G--TICGSL.............................................AHADPSAEIPLTLVALGGEVFLRNAK
DCMM_HYDPS/4-175G--TIGGDI.............................................AHGHPGNDHPALSIAVEAHFVLEGPN
Q9ES55_MOUSE/240-421A--TLGGHT.............................................ASRPNFSDLNPILAAGNATINVVSRE
Q52588_9PSED/4-175G--TIGGDI.............................................AHGDPGNDHPAISMALEAVFVLQGPQ
Q6LPZ7_PHOPR/191-359G--TLGGNI.............................................ANASPIGDAPPLLIALNANITLRRGK
Q9KEV2_BACHD/4-177G--TIGGNV.............................................MTGT..GDTLPALLTYDAQLCWYQRG
Q89PX9_BRAJA/4-175G--TIGGSL.............................................SHADPAADWFSALAALGAQVTLRSLA
Q7DM89_SOLLC/83-266A--SVGGNLV..........................................MVQKNGFPSDIATLLLGLSATVSLMTSH
Q7TP79_RAT/448-628A--TLGGHV.............................................VSRPDFSDLNPILAAGNATINVISKE
ALDOL_ORYSJ/224-406A--SIGGNII..........................................LAHKYPFRSDIATILLGAAATVNLQVSS
Q6V956_MOUSE/239-419A--SLGGHI.............................................ISRLPTSDLNPILGIGNCILNVASTE
Q8FE94_ECOL6/3-174A--TYGGNI.............................................CNGATSADSATPTLIYDAKLELHSPR
Q86NS1_DROME/200-377G--TLAGNISI.........................................KKQNPEFPSDIFISFEALNVKVVALKNA
Q8XXL8_RALSO/214-382G--TLGGNI.............................................ANGSPIGDSAPALIALGARVVLQRGD
ALDO2_ARATH/218-402G--SIGGNLV..........................................MAQRKQFPSDMATILLAAGAFVNIMSSS
Q73PR8_TREDE/6-176A--TIGGNI.............................................ATANPLSGTFLPMLALDAKLEIRTAE
Q9NCL9_CULQU/211-388G--TIAGNLWM.........................................KNRYNGFPSDLFLILAAVRAKLTIAEAG
Q7D9X3_MYCTU/5-181G--TLGGSL.............................................CQADPAEDLSTVCTVLDAVCLAKGPS
Q9EWG7_STRCO/216-384A--TLGGNL.............................................GTGSPIGDSPPVLLALEASLVLADAD
Q97VI7_SULSO/4-174G--TIGGSA.............................................ANADPSADIPTVLTALNAEIILSSAS
A9CL41_AGRT5/2-219A--TVGGNILQRTRCRYFYDNAARCNKRQP..NSGCDALEGFNRYHAILGASESCVATHPSDMCVALVALDASVHLQGPA
Q8LHR9_ORYSJ/267-447A--SLGGNLI..........................................MAQRDEFASDIATVLLAAGSSLCIQVSS
Q7VS58_BORPE/4-175G--TIGGSL.............................................AHADPAADWVLTMVALGADIEIAGVD
Q89GV6_BRAJA/4-175G--TFGGSV.............................................ALADPASEFPAMTLALDAEIEVVGPS
Q87YY2_PSESM/195-363G--TLGGNI.............................................GNASPIGDSPPLLIALGAQIVLRKGD
XDH_CALVI/248-432A--SLGGNI.............................................MTGSPISDMNPVLMAGAVKFKVAKYV
Q8RLC1_DELAC/227-399G--TMGGNV.............................................ANGSPIGDSPPVLMALDAQIELRKGE
Q6MJY3_BDEBA/203-371A--TLVGNV.............................................MNGSPIGDSIPALLALDAEVHLQSTK
A9CI15_AGRT5/197-365G--TIGGNI.............................................ANGSPIGDTPPALIALGATLTLRSSS
Q89XH7_BRAJA/2-168G--TIGGSL.............................................ANNDPAADYPAATLALGATVKTN...
Q976U6_SULTO/9-170G--TIGGSL.............................................AHADPSSNYYPALLTLDAKVKVKSKK
Q6AIN3_DESPS/3-161V--TIGGSV.............................................MGRYPFSDPITALVALDAELLFHGA.
Q6AK64_DESPS/1-173A--TVVGNV.............................................VTANPAADAAVALACLDTSVEVVDQK
Q98CI6_RHILO/201-369G--TIGGNI.............................................ANGSPIGDTPPPLIALGARLTLRKGQ
Q9FV24_SOLLC/235-418A--SVGGNLV..........................................MAQKNGFPSDIATLFLGLCATVSLMTRH
Q90W93_POERE/237-417A--SLGGNI.............................................VSAYPNSDLNPVLAAGNCKVKVISPG
Q92VB8_RHIME/200-368G--TVGGNI.............................................ANGSPIGDTPPALIALGASVTLRKGT

PF01565

GGLO_MOUSE/21-156V..TVGGVI---------------------------------------------GSGTHN.TGIKH.GILA..TQVVALT
Q9FE45_9ASPA/67-206L..TLGGTL---------------------------------------------SNGGISGQAFLH.GPQI..SNVHELD
YITY_BACSU/45-181F..TIGGSL---------------------------------------------SANAHG.RDIRY.GSLI..DTVKSFR
Q7S1P7_NEUCR/64-202V..GVGGHS---------------------------------------------LHGGFGFSSHTY.GLAV..DWIAAAT
Q7RV07_NEUCR/47-186V..GIGGHA---------------------------------------------TIGGLGPMSRMW.GSAL..DHIVEVE
Q9YFD3_AERPE/61-201A..TVGGSI---------------------------------------------AMLGSGALAPGL.GNIE..DMVLWLE
MURB_SYNE7/29-161G..TLGGAV---------------------------------------------VMNAGAQGGCMA.......DILQSVQ
MURB_LEPIC/43-173G..WTGGAV---------------------------------------------IQNAGCYGGELF.......DLIESVE
Q9RTM9_DEIRA/61-199S..TIGGNL---------------------------------------------GENAGGPMCFKY.GVTG..DYVRALE
MURB_STRP1/28-158G..SIGGAV---------------------------------------------FMNAGAYGGEIS.......HIFLSAK
Q72F25_DESVH/44-183S..TVGGNV---------------------------------------------ATNAGGPACVKY.GVTR..DYVLGVE
Q8KSY2_9ACTO/34-166V..GQGGFL---------------------------------------------SGGGLGWQTRKF.GVAS..DRIVSAR
Q9RJ97_STRCO/99-239A..TVGGFA---------------------------------------------ATRSSGQASAGY.GRFD..EMVLGLT
MURB_ERWCT/20-153G..CVGSAP---------------------------------------------IQNIGAYGIELQ.......HVCDYVE
Q69BI6_9NOCA/43-181C..TIGGMI---------------------------------------------GNNACGSRTLGY.GRTS..DNVKGLH
Q8XND2_CLOPE/36-171T.VGVVGFA---------------------------------------------LGGGWGYSSRLL.GLGC..DNLLEVK
Q9EYH6_YERPS/48-184V..GISGFL---------------------------------------------LGGGLGINCSQWGGMSV..FNVQALD
O86000_SPHAR/54-193G.GVMGNAL---------------------------------------------E...HGAGYTPY.GDHF..VMQCGME
Q8EGB1_SHEON/385-520...ALAGFI---------------------------------------------MGGGWGPWCRKY.GMCC..EGLVQAE
Q9HMR2_HALSA/64-202S..VLGGAI---------------------------------------------GNNSTGAHSLQY.EKAD..GYLESAE
MURB_STAAU/37-167G..SIGGAV---------------------------------------------YMNAGAYGGEVK.......DCIDYAL
Q98KY4_RHILO/16-149V..TLGGAI---------------------------------------------ANDVHGKNHHRR.GTFG..CHVESFT
Q9RDU1_PSESP/57-197MVGPVGNTL---------------------------------------------DR...GVGYTPY.GEHF..MMQCGME
Q7P685_FUSNV/21-150G..SIGGLV---------------------------------------------YMNGGAFGTEIF.......DKIVSVE
Q9A8X8_CAUCR/61-191...SLGGAL---------------------------------------------GTATHGTGIKIP..AMH..GDVTGLR
Q9ZK04_HELPJ/41-178A..MIGGIV---------------------------------------------ANNASGMCCGVE.QNSY..KTLKSLR
O29450_ARCFU/37-175A..TVGGAI---------------------------------------------NTGAGGMRGAKY.GTMV..DWVLGLE
MURB_NEIMA/22-156G..TVGASP---------------------------------------------VQNIGAYGVEAK.......DVIHSVR
Q7SHH8_NEUCR/74-210V..GMIGAT---------------------------------------------IGAGIGRLDGVH.GLVI..DALESVR
Q82G17_STRAW/96-229V..GVSGLT---------------------------------------------LGGGHGVVSRAY.GLTC..DSLTQAT
Q7N1V5_PHOLL/58-193T..TVGGTL---------------------------------------------SVGGYGEDSYLY.GSQA..SCIQSYT
O33177_MYCTU/35-170G.VCLGGYL---------------------------------------------LQGGYGWNSRIY.GPAC..ESVIGLD
Q974L0_SULTO/23-162C..TVGGAT---------------------------------------------ANSSGGMRGVKY.GTFR..DWVLALK
Q6L2S1_PICTO/39-177A..TVGGAV---------------------------------------------NENSGGMRCARY.GVVK..DWVLKLD
ADAS_DICDI/141-282S..TLGGWL---------------------------------------------ATCSSGHQSDKY.GDIE..DMAVSFR
Q9X5T1_STRLA/54-186G...AVSYL---------------------------------------------LGGGLGLLSRKY.GFAG..DHVVSLD
Q9RVK1_DEIRA/39-176A..SLGGMA---------------------------------------------STNASGTGAVKY.GTTR..DNVLEMR
MURB_HAEDU/19-152G..VVGSAP---------------------------------------------IQNIGAYGVEFE.......QFCDFVE
Q7S4K5_NEUCR/69-206A..TVGGMV---------------------------------------------STNCSGTNAMRY.GTMK..DWVLNLT
Q7S1N4_NEUCR/85-222I..GVAGFV---------------------------------------------LGGGMPGFVNLR.GMGC..DQVRGFE
Q9F3A3_STRCO/70-207C..TVGGVV---------------------------------------------ANNASGMTAGTT.RNSY..RTLASLT
MURB_SHEON/21-152G..TVGAAP---------------------------------------------IQNIGAYGVELC.......DICHWVE
Q7V4C5_PROMM/41-176V..TIGGAI---------------------------------------------AADVHGKNHHVD.GSFG..NHLQRLL
MURB_NOSS1/59-191G..TVGGAV---------------------------------------------VMNAGAHNSCIA.......DILVSAQ
Q8LP11_SOLLC/107-242Q..QIGGIV---------------------------------------------QVGAHGTGARLP..PID..EQVISMK
MURB_BACSU/34-165G..SVGGAV---------------------------------------------YMNAGAHGSDMS.......EILVKAH
Q72R23_LEPIC/52-187...TLGGAL---------------------------------------------SMNIHGKNNFAV.GPIG..DHVLEFT
Q7NFT8_GLOVI/37-175A..TLGGMA---------------------------------------------ANNSAGARSILY.GKTV..DHILECR
MURB_ACIAD/22-156G..LVGASP---------------------------------------------VQNIGAYGVEVG.......EFIELVH
Q9KB02_BACHD/48-187C..TIGGNV---------------------------------------------AENAGGAHCLKY.GVTT..NHILGME
MURB_ECOLI/17-150G..CVGSSP---------------------------------------------IQNIGAYGVELQ.......RVCAYVD
Q7NCA8_GLOVI/44-184A..SLGGVL---------------------------------------------STADSGPLRHRY.GGGR..DMCLGIS
Q8CJQ0_STRCO/57-195C..TIGGMI---------------------------------------------GNNSCGATAQAH.GKVV..DNIARLE
Q726S9_DESVH/41-181S..TLGGNV---------------------------------------------AENAGGLRGLKY.GVTK..DYVMGIE
Q98I12_RHILO/59-194F..SVGGSL---------------------------------------------SVNAHG.MDHQA.GSVA..GSIRSMR
MURB_PSESM/23-157G..TVGAAP---------------------------------------------MQNIGAYGVEIK.......DVFHGLT
Q8TH91_METAC/83-222C..TIGGMI---------------------------------------------AYNASGMRCVKY.GTTR..NYVRDLE
MURB_WOLPM/30-160G..TVGGGI---------------------------------------------EMNAGAYGSDIA.......SVVQSIK
O50531_STRCO/29-164Q..TVSGAT---------------------------------------------STGTHGTGRDSA..SIA..AQIRGLE
Q8RPG8_DESHA/35-170S..SLGGCF---------------------------------------------AIGDSDSKSFNY.GPTR..TYLLGFE
Q8EGS3_SHEON/22-160A..KIGGIV---------------------------------------------ANNASGMCCGTA.QNSY..QTIASAK
MURB_AQUAE/21-153A..SVGGAV---------------------------------------------SMNAGAFGVEIS.......DFLKEVY
ALO_SCHPO/28-163T..SVSGIM---------------------------------------------STCTHGSSLQHQ..VLP..HYIKSMR
ADAS_MOUSE/193-336S..TVGGWI---------------------------------------------STRASGMKKNIY.GNIE..DLVVHMK
Q7U2X9_MYCBO/74-210V..GVAGHA---------------------------------------------LGGGLGANSRHA.GLLC..DQLTSAS
MURB_CAUCR/32-163G..TIGGAV---------------------------------------------IMNAGCYGAETV.......NVVKSVR
MURB_STRCO/53-183G..SAGATP---------------------------------------------IQNVGAYGQEVS.......ATITEVT
Q98KG4_RHILO/152-289A..SLGGMA---------------------------------------------ATRASGTNAVRY.GTMR..ENVLSLT
Q8FNC2_COREF/44-182C..TIGGMV---------------------------------------------ANNACGSHSVAY.GTAA..DNLIDVT
Q7U2P7_MYCBO/36-175A..TVGGMA---------------------------------------------STNAGGLRTVRY.GNMG..EQVVGLD
Q9KKW5_VIBCH/47-184C..KIGGIA---------------------------------------------ANNASGMCCGTA.QNSY..RTVDGMQ
Q82SS0_NITEU/46-186S..VLGNAL---------------------------------------------DK...GRGLTPY.ADHF..GSLCGMD
Q9A317_CAUCR/35-173C..TIGGLI---------------------------------------------STNAGGTAVLRY.GMMR..EQVLGIE
Q7U5R3_SYNPX/72-213A..SIGGFL---------------------------------------------AGGSGGIGSIRW.GFLRDPGHLLGAE
O06804_MYCTU/16-151Q..SITGAT---------------------------------------------ATATHGTGVRFQ..NLS..ARIVSLR
MURB1_CORGL/41-172G..TVGGLV---------------------------------------------VMNGGTQRRGIG.......EHVTKVL
Q7N7Z9_PHOLL/19-157S..VVGNAL---------------------------------------------DRGV.GLRRQRI.......DDLAGLE
Q7S350_NEUCR/67-202G.PGVGGLT---------------------------------------------LGGGYSWKTNQY.GMTC..DTVKSYE
Q8XW09_RALSO/54-193C..TIGGNV---------------------------------------------SENSGGVHCLKY.GLTV..HNVLRVR
Q6HND5_BACHK/20-155Q..SIAGAI---------------------------------------------STGTHG.TGITF.GSLS..TQVIEIT
MURB_VIBCH/21-154G..CAGSAP---------------------------------------------IQNIGAYGVEFK.......DVCDYVE
ALO_ASHGO/29-168Q..SVGGII---------------------------------------------STGTHG.SSPYH.GLVS..SQYVNLT
MURB_MYCTU/33-167G..SAGATP---------------------------------------------VQNVGAYGAEVS.......DTITRVR
MURB_CLOAB/38-168G..SVGGAV---------------------------------------------AMNAGAYNGEIS.......NVVESVL
Q92RW6_RHIME/20-155Q..AVAGAF---------------------------------------------TTGTHG.TGIKL.GNMA..SSIAGMR
Q72LD1_THET2/2-135G.ATLGGTV---------------------------------------------AAGLSGPSRHRY.GGLR..DFLLGVR
Q9PBD9_XYLFA/32-171C..SIGGTI---------------------------------------------ATNAGGIRVVRY.GNTR..EWIAGLN
P71984_MYCTU/42-177T..GVGGLT---------------------------------------------LGGGVGWTTRRF.GLSC..DNLVAVR
Q726N5_DESVH/138-278S..TIGGNI---------------------------------------------SENSGGPFAFEY.GTTL..DNLLSWR
Q8KEW7_CHLTE/25-165F...IGSTI---------------------------------------------SNNSTGSRSLKY.GPTR..NHVQALQ
Q97U59_SULSO/47-180G..SLGGLL---------------------------------------------ATNLPTPFSSFY.GYPK..NLILMAK
Q9I3S8_PSEAE/39-178A..SVGGLV---------------------------------------------ATNAGGIRAFRF.GTMR..QRVLGLE
CKX11_ORYSJ/45-187L..TVGGTL---------------------------------------------SNGGVSGQSFRY.GPQV..SNVAQLE
Q92X65_RHIME/28-163Q..TVGGAI---------------------------------------------GTGTHGSGRDFP..NLS..MMLVGGR
Q7NZ82_CHRVO/51-186...SFAGAI---------------------------------------------STATHGTGAGLP..ALH..ADARALR
P74033_SYNY3/47-186A..TVGGFV---------------------------------------------SGGSTGMGAVNY.GTLFDPGNVQSLT
Q9S2F6_STRCO/73-212C..TIGGNI---------------------------------------------GTASGGLCCVKY.GVTA..EYVLGLD
Q983S0_RHILO/19-151Q..AIGGAL---------------------------------------------GTATHG.SGPTL.GAYH..TQLETVQ
Q9P6Z1_NEUCS/70-206V..GVSGLI---------------------------------------------LGGGISFFSGMY.GWAC..DNVRNYE
MURB_BUCBP/20-153G..TVGAAP---------------------------------------------IQNIGAYGVEFK.......DVCQYVD
YVDP_BACSU/33-169V..GIGGIT---------------------------------------------MGGGFGVLSRSI.GLIS..DNLLALK
MURB_BRUME/41-173G..GIGGAL---------------------------------------------RMNAGANGVETR.......ERVVEVR
O29393_ARCFU/49-187S..TVGGWV---------------------------------------------ATAASGQFSTGY.GNIE..NLLVSLT
Q7URF5_RHOBA/77-214T..TMGGVI---------------------------------------------ATNASGSHYLRS.GSAR..DTVLSLR
Q8PPC4_XANAC/43-182C..SVGGNL---------------------------------------------STNAGGPRAVKY.GATR..DNVLGLV
Q6CCU5_YARLI/112-251C..HIGGNV---------------------------------------------ATNAGGLRLLRY.GSLH..GSVLGLE
Q7S0U1_NEUCR/79-214V..GMMGPG---------------------------------------------LGGGHGRHEGPH.GMIS..DNILQLN
Q8RPG7_DESHA/41-180A..TLGGNL---------------------------------------------AESSGGARCFKY.GVTR..DYILGVE
DIML_CAEEL/59-199...TVGGLI---------------------------------------------NGCGVESGSFKY.GMFQ..HICTGYE
Q6NAC4_RHOPA/97-241S..TLGGWI---------------------------------------------ATRSGGHYASLY.THID..DFVESVR
Q8F3Y7_LEPIN/117-261S..TLGGWI---------------------------------------------AARSAGQQSNRY.GKIE..EILTSLK
Q84HB2_STRCZ/65-200S...VGGTL---------------------------------------------SVGGIGGTSHRY.GSVA..DNVLELE
Q9HTK4_PSEAE/8-144A..TVGGVL---------------------------------------------ASGLSGPRRPWA.GAVR..DFVLGTR
ALO_NEUCR/51-186Q..SIAGAI---------------------------------------------STGTHG.SGIKH.GLVG..ESITELK
Q96YM3_SULTO/46-183S..TVGGGI---------------------------------------------AGDALGIGSYEY.GFIS..DNISFVD
Q9SA87_ARATH/77-216L..GVGGHF---------------------------------------------SGGGYGNLMRKY.GLSV..DNVFGSG
Q6ALH1_DESPS/43-180A..MVGGII---------------------------------------------INNASGMNCGTH.ENAY..KTIEAAK
Q8YZY0_NOSS1/35-172...TVGGLL---------------------------------------------STGGIGSTSKTY.GPVV..ANVIDLH
FAS5_RHOFA/27-162T..TVGGTL---------------------------------------------SVGGFGGSSHGF.GLQT..DNVDSLA
Q97Y18_SULSO/44-180A..TIGGAI---------------------------------------------AHKGSGSHSSSN...IE..NLILWLE
Q9KB00_BACHD/33-172A..TIGGMI---------------------------------------------ATNESGPKRLRH.GAAR..DHVIGLR
MURB_BORPA/35-168G..TVGAAP---------------------------------------------VQNIGAYGVELA.......DRFHSLT
Q8GQQ2_LACPN/49-188S..GIGGNV---------------------------------------------ATNAGGMSTVKY.GATK..DNVLGVK
Q8FEI0_ECOL6/51-191A..QMGGLV---------------------------------------------ATRSIGQFSTLY.GAIE..DMVVGLE
Q97U60_SULSO/35-172S..SIGGNI---------------------------------------------SHDSGGMHTPKY.GTTF..DSIIRLK
Q96XG8_SULTO/47-186S..TLGGYI---------------------------------------------AGGDVGIGSYQF.GYHFHGNGIRRVK
MURB_YERPE/20-153G..CVGSAP---------------------------------------------IQNIGAYGVELK.......QVCEYVD
Q6N8A2_RHOPA/39-178A..TLGGNA---------------------------------------------ATNAGGNRVIRY.GMTR..EMILGLE
Q9HTM8_PSEAE/30-162Q..TLAGAI---------------------------------------------ATSTHG.TGVGF.GSYS..AQVRGLQ
Q9HGH9_ASPOZ/122-264G..IAGGYS---------------------------------------------QGGGHSFLSSMY.GLGA..DQVLEWE
Q89HF0_BRAJA/40-178A..TIGGMA---------------------------------------------GNNSCGGRSLRY.GTMR..DNTLSME
Q9KHK2_9ACTO/45-180T..GLGGLV---------------------------------------------LGGGFGWLSRKY.GLSI..DNLTSVE
MURB_LEIXX/19-154G..STGAAP---------------------------------------------VQNIGAYGQEIE.......SALIGVE
MURB_CHLCV/31-161G..SVGGAI---------------------------------------------FMNAGTGKQDTA.......SVVESVE
Q7YWB6_LEIMA/137-280S..TLGGWI---------------------------------------------GARGSGAMSNQY.GDIE..DMVVAVK
O86004_SPHAR/40-176S..VAASFI---------------------------------------------NR...RPGYTPY.SDHF..LMQCGLE
Q8ERP2_OCEIH/37-174A..TIGGMV---------------------------------------------ATNASGTTAVRY.GAMK..DQLIDLE
Q9HKQ4_THEAC/37-176A..TVGGSI---------------------------------------------STNAGGLRGVAY.GVTK..DWVLGLE
XYOA_STRCO/17-150I..SVAGSV---------------------------------------------ATGTHGSGVGN..GSLA..SVVREVE
Q869M2_DICDI/40-172T..GVFGLT---------------------------------------------LGGGIGHLSRSY.GLTC..DNLLEAK
RETO_PAPSO/75-214V..GSGGHI---------------------------------------------SGGGFGMMSRKY.GLAA..DNVVDAI
Q883D1_PSESM/55-190T..GLIGLT---------------------------------------------LGGGIGWLVGLY.GLTC..DCLVGAD

PF00941

ADO_HUMAN/239-419G..KR....QIPLNEQFLS.....KCPNADL.KPQEILVSVNIPYS
Q7RXE4_NEUCR/265-448E..NGIVETEIPMSQ.FFT.....GYRRTAL.PQDAILAAIRVPLT
XDH_EMENI/269-448K..ET....EIPMTQ.FFR.....GYRSTAL.PPDAIISSLRIPTA
Q97W13_SULSO/4-169G..ER....VENFSS.FAK.....DMFTPDL.NPGELVTEIEVPLL
Q92V19_RHIME/2-221G.ETR....SIPIGD.LYRLPGTTPHQETVL.AHGEMITGVTLPPP
Q92UU0_RHIME/2-217G..ER....TIPVEE.LFRLPESTPHLEHTL.EPGELIVEVHIPNG
Q9I2H2_PSEAE/2-218G..ER....RVAFAD.FHRLPADTPERDNCL.AVDELVTAIELPAP
O17892_CAEEL/259-440R..GE...KRVHIDEKFFL.....GYRKTVI.QQDEIIKAVIVPLL
Q6SF51_9BACT/2-165...LR....QIAAKD.YFD.....GMFGTAL.DDGELITAVRFPIP
ADO_BOVIN/239-419G..RR....QIPLNEQFLR.....KCPSADL.KPEEILISVNIPYS
O87681_ARTNI/4-175G..ER....KIPLKE.LLV.....SHFVSSI.LPGELIVEVNVPQL
Q92UJ3_RHIME/205-373G..QR....TLPLED.FFI.....AYGKQDR.RPGEFVESLFVPAL
ALDO3_ARATH/222-398K..TE....KVTLQE.FLE.......LSPVL.DSKRVLLKVEIPSW
Q8CJY1_STRCO/19-185G.ARR....EMPVSH.LLA.......GMEML.RAGELIGYVRVPLL
ADO_MOUSE/238-418G..ER....RIPLSEEFLR.....KCPEADL.KPQEVLVSVNIPWS
P72222_PSEPU/4-174G..VR....SVSATD.FMK.....GHYFTDL.EAGEVLVRVEIPIP
Q9Y9R9_AERPE/4-175G..ER....VVKLED.FII.....GPYITDL.QPSELLVEVRVPSL
Q6LQT9_PHOPR/1-157.........QMDIED.YIN...........S.EQRELIVEVIIPNV
Q6F9M6_ACIAD/202-370Q..RR....DIALAD.YYL.....DYQKTAL.QAGEFVEAILIPIH
Q92WF7_RHIME/2-220G..AR....TIAFEE.FHRLPEDTPDIETDL.QPGELITGIEIPPL
XDH1_ARATH/260-440G..DV...RSIPAKD.FFL.....GYRKVDM.GSNEILLSVFLPWT
YAGS_ECO57/2-221G.KTR....SITLAD.FYHPPGKTPHIETAL.LPGELIVAVTLPPP
Q974U9_SULTO/4-169G..DR....VVNFKS.FAK.....DMFTPDL.NPGELVTEIQVPTF
Q6N0U3_RHOPA/2-168...KR....EIPADQ.FFK.....GLFMTAL.EDNEIITAISFPVP
Q92XI0_RHIME/2-221G.TTR....SIPMGD.LHRLPGDTPHIEHVL.ERGELITAVVLPKP
Q98JI6_RHILO/2-217...ER....KLLVDD.FFLLPGATPDREHAI.EPGEMITAIEIPGS
ALDO1_ARATH/249-425S..SQ...EQFTLEE.FLQ........QPPL.DAKSLLLSLEIPSW
Q8G2H3_BRUSU/200-368E..RR....TIALED.FFI.....AYGKQDR.GAGEFVEAVHVPLP
Q9KBF1_BACHD/778-946G..LK....TQPFIE.MFQ.......GRLTL.EKGEFLVQVIVPQS
XDH_ORYSJ/268-448N..NI...RTIPAKD.FFL.....GYRKVDL.KPDEILLSVILPWT
O17505_BOMMO/28-208N..GS...RQITIDENFFK.....GYRKTIL.EDDEVVISIKLPFS
O52838_BRAJP/2-168...KR....RLKAEE.YLQ.....GLFRTAL.EADEIITKVMFPLP
ALDO1_ORYSJ/239-416S..KR...MCLTLEE.FLK........QPPC.DSRTLLISISIPDW
O17506_BOMMO/254-435N..GH...RTVLMDETFFT.....GYRKNVV.KSNEILLSIEIPFS
O23887_MAIZE/244-417K..RL....CFTLEE.FLE........QPPC.DSRTLLLSIFIPEW
Q8ZV34_PYRAE/7-173G..VY....IYPISQ.FIK.....GPYETEA..EDGLVVEIAVPKW
Q9BIF9_CERCA/242-426E..GRIETREVCMGPGFFT.....GYRKNTI.QPHEVLVAIHFPKS
XDH_CHICK/258-438G..KR....TVMMDEKFFT.....GYRKTIV.KPEEVLLSVEIPYS
Q9RK26_STRCO/2-220G..TR....SVPAAD.FHRLPGLHPERDTEI.HPGELITGVVLPAG
Q9EWZ3_STRCO/2-220G..PG....ELPLAD.FYLPVGDTPHRETAL.PAGALITGVTLPPA
Q8I9N3_ANOGA/220-400G..GF...RKVRMGDGFFT.....GYRKNVI.QPHEALVSLFIPRT
O83120_TREPA/9-178E..NF....WISVAH.YAH.....ARSDTLR.HRSHVITRIRLPTD
Q92X32_RHIME/2-174T..ER....TILLED.FFT.....GPGRTVL.SPGDIVTGISLPAP
Q84IX9_9PROT/2-222G.ETR....RIAIDD.FSLLPGETPDQEHDL.RDDEIIVAIEVPQT
ALDO4_ARATH/228-407R..H....EKLRMGE.YLV.......SPPIL.DTKTVLLKVHIPRW
Q98D33_RHILO/32-199A..TR....HLPLPD.FIL.....GNRRTAL.RPGEMVTAIRVPKM
O97896_SYNCA/228-408T..RR....TVPMDHTFFP.....SYRKTLL.GPEEILLSLEIPYS
DCMM_OLICO/4-175G..AR....IVAARD.YYQ.....GAYFTAI.EPGELLTAIRIPVP
Q9VF50_DROME/202-379DDEK.....EMTLEE.FL......G....DT.DRKMLLKAFILPRY
P95637_RHOPL/5-215G..RR....RIPLGELYVE....DGRAHLAL.RPGEVVVTVRLPAD
Q88F21_PSEPK/195-363R..QR....VMPLED.YFI.....DYRITAR.QDSEFIEKIIVPRA
XDHC_BACSU/10-174L..IR.....LPLGA.WLS........EEDF..RTAIVTRVIIPRA
Q8P785_XANCP/2-221G.QTR....AIPIAE.FYRAPGKTPHIETVL.ERGELITAVTLPKP
O54050_RHOCA/176-344E..RR....RMPLED.FFL.....EYRKQDR.RPGEFVESVTLPKS
Q6GMC5_XENLA/148-328G..AR....EIHCNEAYFE.....SIEHASL.LPEEVLISVLIPFS
Q8XZD4_RALSO/2-168...RR....DIPADD.FFL.....GMYETAL.APDELITEVQFPVP
Q59127_ARTNI/4-174G..RR....TIEADD.LFV.....GPYMTSL.AADEIITDVWIPSR
Q89PE8_BRAJA/4-175R..RR....RVAAKD.FFS.....GMMLTAR.ADDELIESISLPVI
DCMM_HYDPS/4-175G..RR....TVPADG.FFL.....GTYMTLL.EENEVMVEIRVPAF
Q9ES55_MOUSE/240-421G.KDR....QLPLNGPFLE.....KLPEADL.KPEEVILSISIPYT
Q52588_9PSED/4-175G..ER....KVKATE.FFQ.....DTYMTAL.AENEILTAILVPPM
Q6LPZ7_PHOPR/191-359K..SR....TIPIED.YFI.....SYKVTAQ.QPSEFIEKIIIPMP
Q9KEV2_BACHD/4-177R..ME....WETLET.WLN.....RCQTTPLTEEQRILVRVGLPLA
Q89PX9_BRAJA/4-175G..AR....TMAIEA.FVV.....GALESAL.HAGEIVEAIHVPAR
Q7DM89_SOLLC/83-266G..PE....NHTWEE.LLS........RPPL.DSKTVLLCVCIPFK
Q7TP79_RAT/448-628G..QR....QIPLNGPFLE.....RLPEASL.KPEEVALSVFIPYS
ALDOL_ORYSJ/224-406K..TL....HVTLEQ.FLE........QPPL.GHNTLLLSIFIPHW
Q6V956_MOUSE/239-419G..IQ....QIPLNDHFLA.....GVPDAIL.KPEQVLISVFVPRS
Q8FE94_ECOL6/3-174G..VR....FVPING.FHT.....GPGKVSL.EHDEILVAFHFPPQ
Q86NS1_DROME/200-377A.DEK....EMSLAE.YL......GTNDKKL.....VLKTFVLPAY
Q8XXL8_RALSO/214-382A..HR....ELPLED.LYL.....AYMKHAM.VPGEFVASLRVPAR
ALDO2_ARATH/218-402R..GL...EKLTLEE.FLE........RSPL.EAHDLVLSIEIPFW
Q73PR8_TREDE/6-176N..IE....WVPFAK.YID.....KSYAEKR.EEKYIISRIRIPNE
Q9NCL9_CULQU/211-388G..KL...NTVLVED.FPN...........LDLNKKVILNVVFPPL
Q7D9X3_MYCTU/5-181G..ER....EIAIDD.FLV.....GPYETAL.AHNEVLIEVRIPLR
Q9EWG7_STRCO/216-384G..ER....EVPLAD.YFT.....GYRQSVR.RPGELIRAVRVPLP
Q97VI7_SULSO/4-174G..NR....SVNALD.FFK.....GAFATDL.RKGEIISEIVLPNL
A9CL41_AGRT5/2-219G..TR....SLPLRD.LHRLPGHTPEIETEL.DTDDLITAVEIPSL
Q8LHR9_ORYSJ/267-447E..RM....NVTLER.FLD........MAPC.DCKTLLLRIYIPHC
Q7VS58_BORPE/4-175G..ER....MVPAES.FMQ.....GAYTTVV.GEGELIAAVHVPAM
Q89GV6_BRAJA/4-175G..AR....RVKADD.FFI.....DLFETTL.QPGELITAVYVPLF
Q87YY2_PSESM/195-363T..RR....TLALED.YFI.....DYKVTAR.QPGEFIEKIIVPTA
XDH_CALVI/248-432E..GQIKYREVCMASGFFT.....GYRKNVI.EPTEILVGLYFPKT
Q8RLC1_DELAC/227-399R..VR....RMPLTD.FYL.....DYMKNQL.EAGEFVQALAVPLA
Q6MJY3_BDEBA/203-371G..LR....KVALPK.FYK.....AYKVFDV.TADEIATGILIPVP
A9CI15_AGRT5/197-365G..GR....SLPLES.YFI.....DYGKQDR.LSGEFVEKLFIPFQ
Q89XH7_BRAJA/2-168...KR....SISAED.FFK.....GLFTTAL.EDGEIITAVSFPVP
Q976U6_SULTO/9-170G..ER....EIKISD.LYL.....SPYTTSM.REDEIITSIIIPKK
Q6AIN3_DESPS/3-161........GRVRLTD.YLL.....GKGLRDI......LLKIIIPKG
Q6AK64_DESPS/1-173G..LR....VLPLAE.MYA.....GICLSGIDSCNHLVTHLKFPLK
Q98CI6_RHILO/201-369K..RR....TIPLEA.FFI.....AYGRQDR.QPGEFVEAVHVPVP
Q9FV24_SOLLC/235-418G..LV....KLTWEE.LLL........KPPL.DSRIVLLSVSIPFK
Q90W93_POERE/237-417G..SR....EVPLNQDFFI.....GFGKTIL.KPEDVVVSVFIPFT
Q92VB8_RHIME/200-368S..RR....TLPLEA.FFI.....EYGKQDR.EPGEFVETVRIPFL

PF01565

GGLO_MOUSE/21-156L---------------MK.-------------ADGTVLECS-----
Q9FE45_9ASPA/67-206I---------------VT.-------------GKGEMVTCS-----
YITY_BACSU/45-181L---------------LK.-------------ADGMIITVT-----
Q7S1P7_NEUCR/64-202V---------------VL.-------------ANSTVVTAS-----
Q7RV07_NEUCR/47-186V---------------VT.-------------ADGKIQRAS-----
Q9YFD3_AERPE/61-201T---------------VIP-------------GLGTV.TLG-----
MURB_SYNE7/29-161V---------------IT.-------------DQGLETWSR-----
MURB_LEPIC/43-173F---------------.L.-------------RNGEVFVRK-----
Q9RTM9_DEIRA/61-199F---------------VD.-------------VDGDVHRLT-----
MURB_STRP1/28-158V---------------LT.-------------PSGEIKTIS-----
Q72F25_DESVH/44-183A---------------VL.-------------PDGELLRAG-----
Q8KSY2_9ACTO/34-166V---------------VL.-------------ADGRAVVAS-----
Q9RJ97_STRCO/99-239L---------------AT.-------------PRGTL.DTG-----
MURB_ERWCT/20-153L---------------LDL-------------TEGKTIHLT-----
Q69BI6_9NOCA/43-181V---------------LT.-------------GTGESLXLG-----
Q8XND2_CLOPE/36-171F---------------IN.-------------SKGKIVIAN-----
Q9EYH6_YERPS/48-184I---------------VT.-------------ADGRLRHVS-----
O86000_SPHAR/54-193V---------------VL.-------------ADGQVVRTG-----
Q8EGB1_SHEON/385-520I---------------VL.-------------GVGETQVVS-----
Q9HMR2_HALSA/64-202V---------------VL.-------------ADGTVTTLG-----
MURB_STAAU/37-167C---------------VN.-------------EQGSLIKLT-----
Q98KY4_RHILO/16-149L---------------LR.-------------SDGKTYRCS-----
Q9RDU1_PSESP/57-197V---------------VM.-------------ADGEILRTG-----
Q7P685_FUSNV/21-150V---------------FD.-------------ENHQIREIK-----
Q9A8X8_CAUCR/61-191L---------------VT.-------------PSGKIIDAD-----
Q9ZK04_HELPJ/41-178V---------------IL.-------------ADGTLLDTA-----
O29450_ARCFU/37-175V---------------VT.-------------ADGEVLNIG-----
MURB_NEIMA/22-156C---------------FDL-------------DTETFVTLS-----
Q7SHH8_NEUCR/74-210M---------------IT.-------------ANGDIVEAS-----
Q82G17_STRAW/96-229L---------------IT.-------------ADGKQLVAN-----
Q7N1V5_PHOLL/58-193L---------------IT.-------------PDGKRHRCS-----
O33177_MYCTU/35-170V---------------IT.-------------ADGAQIHCD-----
Q974L0_SULTO/23-162V---------------VL.-------------PNGKVIKLG-----
Q6L2S1_PICTO/39-177C---------------VL.-------------ANGEETSFG-----
ADAS_DICDI/141-282T---------------VT.-------------PTGTL.ELR-----
Q9X5T1_STRLA/54-186L---------------VT.-------------ADGRFLQVS-----
Q9RVK1_DEIRA/39-176V---------------AL.-------------PGGRVVRVG-----
MURB_HAEDU/19-152V---------------VNL-------------ANGQIFRLD-----
Q7S4K5_NEUCR/69-206V---------------VL.-------------PDGRVIKTR-----
Q7S1N4_NEUCR/85-222V---------------VL.-------------GDGHTVHCS-----
Q9F3A3_STRCO/70-207F---------------VL.-------------PGGTVVDTA-----
MURB_SHEON/21-152Y---------------LDL-------------DSGLLLRLS-----
Q7V4C5_PROMM/41-176L---------------VD.-------------GRGELRELT-----
MURB_NOSS1/59-191V---------------LS.-------------PDGTVETLT-----
Q8LP11_SOLLC/107-242V---------------VT.-------------PAKGTIEIS-----
MURB_BACSU/34-165I---------------LF.-------------EDGTIEWLT-----
Q72R23_LEPIC/52-187F---------------MT.-------------PDGKVHICS-----
Q7NFT8_GLOVI/37-175A---------------VL.-------------ADGSVCHFG-----
MURB_ACIAD/22-156V---------------YDR-------------SEKSVKTIS-----
Q9KB02_BACHD/48-187V---------------VL.-------------PNGDIVEIG-----
MURB_ECOLI/17-150S---------------VEL-------------ATGKQVRLT-----
Q7NCA8_GLOVI/44-184V---------------VR.-------------ADGKMVKAG-----
Q8CJQ0_STRCO/57-195V---------------LL.-------------YDGTRFWCG-----
Q726S9_DESVH/41-181F---------------FD.-------------VNGGLVKTG-----
Q98I12_RHILO/59-194V---------------ML.-------------ADGSVTTCS-----
MURB_PSESM/23-157A---------------LDR-------------ETGELREFA-----
Q8TH91_METAC/83-222V---------------VL.-------------ADGTVIHTG-----
MURB_WOLPM/30-160A---------------VNL-------------EDGNLYEFS-----
O50531_STRCO/29-164L---------------VT.-------------ADGSVLTCS-----
Q8RPG8_DESHA/35-170M---------------VL.-------------PTGEVLNIG-----
Q8EGS3_SHEON/22-160L---------------LF.-------------ADGTELDTG-----
MURB_AQUAE/21-153F---------------VD.-------------WEGKLQKAK-----
ALO_SCHPO/28-163I---------------ML.-------------ADGSIVTCS-----
ADAS_MOUSE/193-336M---------------VT.-------------PRGVIEKSS-----
Q7U2X9_MYCBO/74-210V---------------VL.-------------PSGQAVTAS-----
MURB_CAUCR/32-163V---------------MN.-------------RAGVVRELS-----
MURB_STRCO/53-183A---------------YDR-------------RSGETVALS-----
Q98KG4_RHILO/152-289A---------------VM.-------------ADGETVTTG-----
Q8FNC2_COREF/44-182L---------------ML.-------------ADGREVTVS-----
Q7U2P7_MYCBO/36-175V---------------AL.-------------PDGTVLRRH-----
Q9KKW5_VIBCH/47-184I---------------VF.-------------ADGYVLDTR-----
Q82SS0_NITEU/46-186V---------------VL.-------------PDGRLLETG-----
Q9A317_CAUCR/35-173A---------------VL.-------------PNGEIWNGL-----
Q7U5R3_SYNPX/72-213L---------------IT.-------------VEREPRRLQ-----
O06804_MYCTU/16-151L---------------VT.-------------AGGEVLSLS-----
MURB1_CORGL/41-172V---------------TD.-------------AEGSIRELN-----
Q7N7Z9_PHOLL/19-157V---------------VL.-------------PDGEVVKVG-----
Q7S350_NEUCR/67-202L---------------VL.-------------PNGTITRVS-----
Q8XW09_RALSO/54-193A---------------VM.-------------MDGEVVEFG-----
Q6HND5_BACHK/20-155A---------------VL.-------------STGETIVCS-----
MURB_VIBCH/21-154Y---------------LCL-------------ETGTVKRLT-----
ALO_ASHGO/29-168L---------------VN.-------------GRGELVFLD-----
MURB_MYCTU/33-167L---------------LDR-------------CTGEVRWVS-----
MURB_CLOAB/38-168V---------------ID.-------------NKGKMKRLY-----
Q92RW6_RHIME/20-155I---------------VK.-------------ANGEILDID-----
Q72LD1_THET2/2-135F---------------VD.-------------GEGRAVRGG-----
Q9PBD9_XYLFA/32-171V---------------VT.-------------GTGELLTLN-----
P71984_MYCTU/42-177L---------------VT.-------------AAGDYLSVD-----
Q726N5_DESVH/138-278M---------------VT.-------------PTGEIIDVE-----
Q8KEW7_CHLTE/25-165I---------------AL.-------------PQGDLLEIT-----
Q97U59_SULSO/47-180V---------------IT.-------------GDGIIAKGG-----
Q9I3S8_PSEAE/39-178A---------------VL.-------------ADGSVYSDL-----
CKX11_ORYSJ/45-187V---------------VT.-------------GDGECHVCS-----
Q92X65_RHIME/28-163L---------------VT.-------------AGGEIRTFD-----
Q7NZ82_CHRVO/51-186L---------------LT.-------------PSGETLDCG-----
P74033_SYNY3/47-186V---------------LT.-------------MEAEPQRLI-----
Q9S2F6_STRCO/73-212V---------------VL.-------------ADGRLMSTG-----
Q983S0_RHILO/19-151I---------------VD.-------------GLGKVRDFT-----
Q9P6Z1_NEUCS/70-206L---------------VL.-------------ASGLIVNAS-----
MURB_BUCBP/20-153V---------------LYL-------------NNSKIVRIN-----
YVDP_BACSU/33-169T---------------VD.-------------AKGRIIHAD-----
MURB_BRUME/41-173A---------------LD.-------------RKGEVHVLS-----
O29393_ARCFU/49-187A---------------VL.-------------PDGEVVTER-----
Q7URF5_RHOBA/77-214M---------------IA.-------------ADGRLVELS-----
Q8PPC4_XANAC/43-182A---------------VT.-------------GTGEVIRCG-----
Q6CCU5_YARLI/112-251V---------------VL.-------------ANGKVVNML-----
Q7S0U1_NEUCR/79-214V---------------VL.-------------ADGTAVRVN-----
Q8RPG7_DESHA/41-180V---------------VL.-------------PNGKVINTG-----
DIML_CAEEL/59-199V---------------VM.-------------SDGELKNVY-----
Q6NAC4_RHOPA/97-241V---------------VT.-------------PRG.VLETR-----
Q8F3Y7_LEPIN/117-261V---------------VT.-------------PMGTVETLK-----
Q84HB2_STRCZ/65-200V---------------VT.-------------ASGDLLTCS-----
Q9HTK4_PSEAE/8-144L---------------IS.-------------GLGTHLRFG-----
ALO_NEUCR/51-186I---------------TL.-------------ANGETLSCS-----
Q96YM3_SULTO/46-183M---------------IN.-------------PKGELIHLE-----
Q9SA87_ARATH/77-216I---------------VD.-------------SNGNIFTDR-----
Q6ALH1_DESPS/43-180I---------------IF.-------------ADGTLLDTA-----
Q8YZY0_NOSS1/35-172I---------------IT.-------------GNGEYIQCS-----
FAS5_RHOFA/27-162V---------------VT.-------------GSGDFRECS-----
Q97Y18_SULSO/44-180V---------------IL.-------------PNGKAVKVG-----
Q9KB00_BACHD/33-172V---------------VY.-------------PDGRIIRTG-----
MURB_BORPA/35-168A---------------WDV-------------KGGRWVEMG-----
Q8GQQ2_LACPN/49-188V---------------VL.-------------ADGREVKLG-----
Q8FEI0_ECOL6/51-191A---------------VL.-------------ADGTVTRIK-----
Q97U60_SULSO/35-172V---------------LL.-------------SNGHVEEIG-----
Q96XG8_SULTO/47-186I---------------VA.-------------PNGSQELTG-----
MURB_YERPE/20-153L---------------LDM-------------DKGTIQRIS-----
Q6N8A2_RHOPA/39-178V---------------VL.-------------ADGTVLSSL-----
Q9HTM8_PSEAE/30-162L---------------VT.-------------ASGEVLECD-----
Q9HGH9_ASPOZ/122-264V---------------ID.-------------GTGRLLVAN-----
Q89HF0_BRAJA/40-178A---------------AL.-------------ADGTLSRFG-----
Q9KHK2_9ACTO/45-180I---------------VT.-------------ADGGVLTAS-----
MURB_LEIXX/19-154F---------------LDY-------------LTGEVYTLA-----
MURB_CHLCV/31-161V---------------IN.-------------SKGEILSYR-----
Q7YWB6_LEIMA/137-280V---------------AT.-------------PTG.IIETP-----
O86004_SPHAR/40-176V---------------ML.-------------ADGKMVRTG-----
Q8ERP2_OCEIH/37-174V---------------VM.-------------ADGTIIHTA-----
Q9HKQ4_THEAC/37-176V---------------VL.-------------ADGTLVKFG-----
XYOA_STRCO/17-150L---------------VT.-------------ADGSTVVIA-----
Q869M2_DICDI/40-172L---------------IT.-------------CDGEIKIIN-----
RETO_PAPSO/75-214L---------------ID.-------------SNGAILDRE-----
Q883D1_PSESM/55-190V---------------VL.-------------ADGRLVKAE-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window