Sequence alignment for CL0078

PF01068

DNLI3_HUMAN/483-677----------------------------------------------------------------------PMLAEACK..
DNLI4_CANAL/259-494----------------------------------------------------------------------PQLSERLT.T
Q9VG84_DROME/257-451----------------------------------------------------------------------PMLASPCK..
DNLI4_HUMAN/248-451----------------------------------------------------------------------PMLAAIADIE
DNLI1_CAEEL/263-465----------------------------------------------------------------------PMLAHPTK..
O69698_MYCTU/11-201----------------------------------------------------------------------PMLAKSVT..
Q9XAM3_STRCO/11-197----------------------------------------------------------------------PMLAKSVA..
Y938_MYCTU/460-637----------------------------------------------------------------------PMLATHGTVA
DNLI_METJA/226-440----------------------------------------------------------------------PMLAQLTP..
DNLI_ARCFU/225-419----------------------------------------------------------------------MMLAQVAE..
DNLI_PYRFU/224-422----------------------------------------------------------------------PMLAQQAA..
DNLI_METTF/227-425----------------------------------------------------------------------PMLAQLAS..
DNLI_MYCTU/186-380----------------------------------------------------------------------PMLAQTAT..
DNLI_AQUAE/225-424----------------------------------------------------------------------PMLAERMS..
DNLI_PYRAE/226-424----------------------------------------------------------------------PMLAQRLS..
DNLI_AERPE/239-439----------------------------------------------------------------------PMLAERGR..
DNLI_ACIAM/236-436----------------------------------------------------------------------PMLAERLS..
DNLI1_YEAST/393-598----------------------------------------------------------------------PMLAKPTK..
DNLI1_SCHPO/390-595----------------------------------------------------------------------PMLAKPTK..
DNLI1_HUMAN/542-746----------------------------------------------------------------------PMLAHPTR..
DNLI1_XENLA/695-899----------------------------------------------------------------------PMLAHPTK..
DNLI1_DROME/369-573----------------------------------------------------------------------PMLAQPTK..
DNLI1_ARATH/418-622----------------------------------------------------------------------PMLAKPTK..
DNLI_NPVLD/173-367----------------------------------------------------------------------PALAQPCR..
DNLI_FOWPN/211-405----------------------------------------------------------------------PMLASACK..
DNLI_VACCC/206-399----------------------------------------------------------------------PMLAESCD..
Q90026_9POXV/212-406----------------------------------------------------------------------PMLADICR..
O58234_PYRHO/76-247----------------------------------------------------------------------NGIKRTFK..
O67191_AQUAE/62-235----------------------------------------------------------------------TGLREQFE..
O27289_METTH/82-255----------------------------------------------------------------------PTIQEHFR..
Y414_METJA/85-260----------------------------------------------------------------------PTIKKHFI..
O29409_ARCFU/80-251----------------------------------------------------------------------PTIKKHFG..
DNLI_BPT7/8-240----------------------------------------------------------------------PFKAVSFVES
DNLI_BPT3/8-246----------------------------------------------------------------------PFKAVSFVES
O41026_PBCV1/6-186----------------------------------------------------------------------PLLAATLE..
O68776_YERPE/73-267----------------------------------------------------------------------PFKPNPKA..
DNLI_ASFB7/126-318----------------------------------------------------------------------PMLVKYFN..
DNLI_HAEIN/35-189----------------------------------------------------------------------GWV.......
DNLI_BPT4/135-367----------------------------------------------------------------------QMLASSYD..
DNLI4_YEAST/256-466----------------------------------------------------------------------PQLAKKVN.L
DNLI4_SCHPO/268-476----------------------------------------------------------------------PQLANFKK.K
Q9VYA5_DROME/258-461----------------------------------------------------------------------PMLCERFP.G
YKOU_BACSU/13-208----------------------------------------------------------------------PPI.......
LIGB_BACSU/5-183----------------------------------------------------------------------PMLLHSIK..
Q9PYQ5_GVXN/195-361----------------------------------------------------------------------AMLALPCK..
O28549_ARCFU/10-196----------------------------------------------------------------------PMLAVRSK..

PF01331

Q9S9L3_ARATH/297-492----------------------------------------------------------------------HPLSLGR.--
MCE_PBCV1/60-236----------------------------------------------------------------------NPVSIER.--
MCE1_YEAST/47-249----------------------------------------------------------------------QPVSFQHS--
Q9VY44_DROME/307-497----------------------------------------------------------------------QPVSMDR.--
MCE1_CAEEL/289-479----------------------------------------------------------------------QPVSLSR.--
Q9AVW1_GUITH/39-226----------------------------------------------------------------------MPINISR.--
MCE1_HUMAN/272-460----------------------------------------------------------------------QPVSMDK.--
MCE1_CANAX/44-243----------------------------------------------------------------------QPVSFERR--
MCE1_SCHPO/45-242----------------------------------------------------------------------QPVSFSK.--
MCE_ASFB7/259-424----------------------------------------------------------------------QVKSMTKA--
Q9LFA7_ARATH/294-481----------------------------------------------------------------------..DTLGD.--
Q9SS77_ARATH/343-536----------------------------------------------------------------------GVGNFKS.--

PF01653

DNLJ_HAEIN/2-319TNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG.AKPLSGFSQIRHEIPML
DNLJ_MYCPN/1-307MAKVAQIRAIVEQLKRYDYHYYVLDDPLVSDFEYDQLYKQLQALEQAHPELIQPDSPTQRVGGIVVEA.FNKFPHQNPML
DNLJ_ECOLI/2-318ESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG.AAPLAAFSQIRHEVPML
DNLJ_MYCLE/11-328PEVLQQWRKLTEEVREHQFRYYVRDAPIISDAEFDALLDRLTVLEEQHPELCTPDSPTQLVGGAGFMTDFVATEHLERMF
DNLJ_AQUAE/30-348EEAKKLAEDLREVIRYHDYKYYVEANPVIPDYDYDRLFRALKEIEKKYPELITPDSPTQRV.ASEISGEFPTVKHYTPML
DNLJ_HELPY/2-310IKSQKEYLERIAYLNTLSHHYYNLDEPIVSDAIYDELYQELKAYEEKNPNGIQANSPTQKVG.ATTTNSFNKNPHLMRMW
DNLJ_BORBU/3-309SKVQQEIADLKKLIRKWDKEYYVDSLPSVEDFVYDKHILRLQELESKYPEYKTLDSPTLKFG.SDLLNDFKEVEHSAPIL
DNLJ_MYCGE/2-308MDVKLKIQQLVNLIKNYDYHYYVLSEPLIDDFEYDMLYKSLQQLEKDHPDLIQIDSPTQRVGGEAVKG.FKKLNHNSPML
LIGB_ECOLI/28-308ARAQEEISRLQQQIKQWDDDYWKEGKSEVEDGVYDQLSARLTQWQRCFG......SEPRDVMMPPLNG...AVMHPVAHT
DNLJ_BACSU/4-314ETAKQRAEELRRTINKYSYEYYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVGGAVLEA.FQKVTHGTPML
DNLJ_SYNY3/1-317MTTPDRLLQLRQQLQKASYAYYVLDAPVMEDSVYDQLYRELQRLEAENPELITPDSPTQRV.GEQPASQFRSVAHNIPLY
DNLJ_THESC/4-319EEARKRVNELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPELKSPDSPTEQVGAKPLEATFRPIRHPTRMY
DNLJ_ZYMMO/29-346EQAVIELERLAKLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIRPDSPSKKVG.SRPNSRLPKIAHRAAML
Q99540_HUMAN/14-325SAAQQEVAQLQADLTEYGVAYYEQDAPLVEDHVYDALYARLVALESAFPQFVTQDSPTQNVGGALTKSGLAKVEHPAPML
DNLJ_RHOMR/36-360KEAEALAARLREVLNQHAYRYYVLDNPLIPDADYDLLMQALRKLEARFPELVTPDSPTQRV.GGPPLGRFEKVRHPEPLL

PF09414

Q6T434_TRYCR/74-303----------------------------------------------------------------------QDWVACEKVH
Q86QW3_LEITA/98-325----------------------------------------------------------------------QEWVACEKVH
Q4DAH8_TRYCC/50-271----------------------------------------------------------------------DEWIATEKVH
Q86QW4_LEITA/51-272----------------------------------------------------------------------DEWIATEKVH
A6GCV5_9DELT/26-233----------------------------------------------------------------------SDWVATEKIH
A1ZC58_9BACT/31-233----------------------------------------------------------------------TDWVVTEKIH
Q06EF1_BPR32/28-227----------------------------------------------------------------------GEWVAREKIH
Q7Y4V8_BPR69/28-225----------------------------------------------------------------------GVWVAREKIH
Q5QBW9_9CAUD/28-227----------------------------------------------------------------------GEWVAREKIH
Q56BF0_9CAUD/28-233----------------------------------------------------------------------GVWVAREKIH
Q6WI19_BPKV4/27-222----------------------------------------------------------------------REWVALEKIH
Q3EP73_BACTI/25-179----------------------------------------------------------------------QEVIVLEKLD
A3IEU7_9BACI/35-189----------------------------------------------------------------------KEVVVTEKLD
Q857R9_9CAUD/188-418----------------------------------------------------------------------REVIVTQKLH
Q854A4_9CAUD/187-423----------------------------------------------------------------------REIVITQKLH
Q5YSN8_NOCFA/190-399----------------------------------------------------------------------ARVVITQKLH
Q6MVA4_NEUCS/200-398----------------------------------------------------------------------RIYQVTEKLD
Q54EG7_DICDI/247-425----------------------------------------------------------------------LLWEVTEKLE
Q56EF5_9CAUD/169-356----------------------------------------------------------------------VKFAKSLKLD
Q9RZM9_DEIRA/158-328----------------------------------------------------------------------EEVMVTEKLH
Q2S6U3_HAHCH/186-380----------------------------------------------------------------------EEVVFTEKLH
Q828Q7_STRAW/158-341----------------------------------------------------------------------EPVVLTEKLH

PF01068

DNLI3_HUMAN/483-677SVEYAMKKCP..................NGM----F.SEIKYDGER..VQVH..K.NGDH------FSYFSRSLKPVLP.
DNLI4_CANAL/259-494SYKTLVKKLQRKHEMDPPYEKKFQELGLENK----FYIEEKMDGDR..MLLH..K.DGDS------FKFFSRRLKDYSYL
Q9VG84_DROME/257-451SVEDAFKKS...................PTG----LYSEIKYDGER..VQIH..K.QGND------FKFFSRNLKPVVD.
DNLI4_HUMAN/248-451HIEKDMKH.....................QS----FYIETKLDGER..MQMH..K.DGDV------YKYFSRNGYNYTDQ
DNLI1_CAEEL/263-465GIDEIMRRFR..................NQT----MTCEWKYDGER..GQIH..KREDGQ------IFIYSRNQENNTT.
O69698_MYCTU/11-201AI..........................PPD----ASYEPKWDGFR..SICF..R.DGDQ------VELGSRNERPMTR.
Q9XAM3_STRCO/11-197KI..........................PPG----MHYEAKWDGFR..AIVY..R.DGDE------VELGSRTGKPLTR.
Y938_MYCTU/460-637GLK.........................ASQ----WAFEGKWDGYR..LLVE..A.DHGA------VRLRSRSGRDVTA.
DNLI_METJA/226-440SIEEALLEM...................GRA----Q.FETKYDGAR..VQIH..K.DGNK------VKIYSRRLEDVTN.
DNLI_ARCFU/225-419SLESAVREM...................RTA----A.VEWKFDGSR..VQVH..W.DGSR------VTIYSRRLENVTN.
DNLI_PYRFU/224-422SIRDALLEMG..................GEA----E.FEIKYDGAR..VQVH..K.DGSK------IIVYSRRLENVTR.
DNLI_METTF/227-425SIESAITEL...................GRA----F.CETKYDGIR..VQIH..R.CGDE------VSIFTRRLENITA.
DNLI_MYCTU/186-380SVHDALERHG..................GTT----I.FEAKLDGAR..VQIH..R.ANDQ------VRIYTRSLDDVTA.
DNLI_AQUAE/225-424SPILILRKLG..................GKC----G.AEYKYDGER..IQAH..R.KGDE------FYLFSRRLENITH.
DNLI_PYRAE/226-424SASEILAKLG..................GSA----I.CEYKYDGER..AQIH..L.TPGG------VKIFSRRLEDITH.
DNLI_AERPE/239-439DPAEILRKVG..................GRA----V.VEYKYDGER..AQIH..K.KDGE------VYIYSRRLENITR.
DNLI_ACIAM/236-436DPAEMLSKVG..................NIA----L.VDYKYDGER..GQIH..K.AGDK------IFIFSRRLENITN.
DNLI1_YEAST/393-598AINEVLDRFQ..................GET----FTSEYKYDGER..AQVH..LLNDGT------MRIYSRNGENMTE.
DNLI1_SCHPO/390-595QISEVLNTFD..................QAA----FTCEYKYDGER..AQVH..FTEDGK------FYVFSRNSENMSV.
DNLI1_HUMAN/542-746GISEVLKRFE..................EAA----FTCEYKYDGQR..AQIH..ALEGGE------VKIFSRNQEDNTG.
DNLI1_XENLA/695-899GIGEVLKRFD..................EAA----FTCEYKYDGER..AQIH..ILENGE------VHVYSRNQENNTT.
DNLI1_DROME/369-573GVHEVFERFG..................GMQ----ITCEWKYDGER..AQIH..RNEKGE------ISIFSRNSENNTA.
DNLI1_ARATH/418-622GVAEILNKFQ..................DIV----FTCEYKYDGER..AQIH..FMEDGT------FEIYSRNAERNTG.
DNLI_NPVLD/173-367RLASVLVKHP..................EGA----L.AEVKYDGER..VQVH..K.AGSR------FKFFSRTLKPVPE.
DNLI_FOWPN/211-405TFSEAVKKCP..................NGI----I.VEFKYDGER..IQIH..K.HDKN------FKYFSRSLKPITP.
DNLI_VACCC/206-399SVNKAFKKFP..................SGM----F.AEVKYDGER..VQVH..K.NNNE------FAFFSRNMKPVLS.
Q90026_9POXV/212-406SVSTIVNKYK..................RGI----Y.AEIKYDGER..VQIH..K.YDDV------YEFYSRNLRPVTP.
O58234_PYRHO/76-247............................RGE----FYVEEKVDGYN..VRVV..K.FRGK------ILGITRGGFICPF.
O67191_AQUAE/62-235.............................AP----FWVEEKVDGYN..TRIF..K.YGDN------YYALSRGGFICPF.
O27289_METTH/82-255.............................DR----VAVEEKMNGYN..VRIA..CLSSGE------TVALTRGGHVCPF.
Y414_METJA/85-260.............................DK----VVIEEKLNGYN..IRIV..K.IDGE------VYALTRSGYICPF.
O29409_ARCFU/80-251............................DRE----VVLEEKMNGYN..VRIV..K.VGDN------LYAITRRGLICPY.
DNLI_BPT7/8-240AIKKALDN....................AGY----LIAEIKYDGVRGNICVD....NTAN------SYWLSRVSKTIPAL
DNLI_BPT3/8-246AVKKALET....................SGY----LIADCKYDGVRGNIVVD....NVAE------AAWLSRVSKFIPAL
O41026_PBCV1/6-186NIEDV.......................QFP----CLATPKIDGIR..........SVKQ------TQMLSRTFKPIRN.
O68776_YERPE/73-267............................KWP----MIGSLKLDGLR..VICEVIV.DEEE------VNFLTRTGNPITS.
DNLI_ASFB7/126-318IIPKTFFEE...................ETD----PIVQRKRNGVRAVACQQ....GDGC------ILLYSRTEKEFLG.
DNLI_HAEIN/35-189...............................----..MSEKLDGVR.........GYWNG------KQLLTRQGQRLSP.
DNLI_BPT4/135-367..EKGINKNI..................KFP----AFAQLKADGARCFAEVR..GDELDD------VRLLSRAGNEYLGL
DNLI4_YEAST/256-466SYEKICRTLH...................DD----FLVEEKMDGER..IQVHYMN.YGES------IKFFSRRGIDYTYL
DNLI4_SCHPO/268-476DLHQTLEAMG..................NKP----FWIEEKLDGER..IQLH..M.SSGK------FQFYSRNARSYTYA
Q9VYA5_DROME/258-461DIQEL...MQ..................SDV----LYLETKMDGER..FQLH..I.DRGR------FMYISRNGVDYTRN
YKOU_BACSU/13-208............................GAE----WRYEVKYDGYRCILRIH.....SSG------VTLTSRNGVELSS.
LIGB_BACSU/5-183......EPFN..................DEN----YITELKFDGIR..LILS..K.FDNQ------IKLYTRHNNEVTS.
Q9PYQ5_GVXN/195-361....DFNQLN..................YQN----YCVEIKYDGER..LQVH..KMNDGT------IVCYKRNMNAHTK.
O28549_ARCFU/10-196P.......FS..................SDD----HIYEVKWDGTRCLAFVD..V.EGKR------VRLQNRRLLDITY.

PF01331

Q9S9L3_ARATH/297-492---EALQLLR------------------QRY----YYATWKADGTRYMMLLT----RD.......GCYLVNREYRFRRV-
MCE_PBCV1/60-236---KDFEKLK------------------QNK----YVVSEKTDGIRFMMFFT----RVFG...FKVCTIIDRAMTVYLL-
MCE1_YEAST/47-249---DVEEKLL------------------AHD----YYVCEKTDGLRVLMFIV----INPVTGEQ.GCFMIDRENNYYLV-
Q9VY44_DROME/307-497---ENIKRLS------------------EIP----YRVSWKADGTRYMMLID----GRDE......VYFFDRNHSCFQV-
MCE1_CAEEL/289-479---GNINLLE------------------QES----YMVSWKADGMRYIIYIN----DG.......DVYAFDRDNEVFEI-
Q9AVW1_GUITH/39-226---NQLKFFF------------------KND----YGFFEKTDGFRFILLIS----KK........FYLIDRKNKIFVL-
MCE1_HUMAN/272-460---QNIKLLD------------------LKP----YKVSWKADGTRYMMLID----GTNE......VFMIDRDNSVFHV-
MCE1_CANAX/44-243---HLEETLM------------------QKD----YFVCEKTDGLRCLLFLI----NDPDKGE..GVFLVTRENDYYFI-
MCE1_SCHPO/45-242---KHLQALK------------------EKN----YFVCEKSDGIRCLLYMT----EHPRYENRPSVYLFDRKMNFYHV-
MCE_ASFB7/259-424---DYMKFYP------------------PVG----YYVTDKADGIRGIAVIQ----DT........QIYVVADQLYSLG-
Q9LFA7_ARATH/294-481---EIPHYQE------------------EAY----RQFCYKMLMMNVGGEFA----TF.......EAAILLCDMEGRWN-
Q9SS77_ARATH/343-536---ENLQLLR------------------QRY----YYATWKADGTRYMMLLT----TD.......GCYIVDRSFRFRRV-

PF01653

DNLJ_HAEIN/2-319SLDNAFSDAEFNAFVKR....IEDRLILLPKP.LTFCCEPKLDGLAVSILYVNGELTQAA------TRGDGTTGEDITA-
DNLJ_MYCPN/1-307SLDNAFDTATIASFIAN....INNLTGVQNR....FVVEPKIDGVSISLTYENGLLTRAL------TRGDGLVGEDVLS-
DNLJ_ECOLI/2-318SLDNVFDEESFLAFNKR....VQDRLKNNEK..VTWCCELKLDGLAVSILYENGVLVSAA------TRGDGTTGEDITS-
DNLJ_MYCLE/11-328SLDNAFSGDELNAWVTR....IRAEIGNDAH....YLCELKIDGVALSLVYRDGRLTRAT------TRGDGRTGEDVTL-
DNLJ_AQUAE/30-348SLDNAYSEDELREFDRR....VRQITGLEV...VEYAVEPKLDGAGIALVYENDLFVRGA------TRGDGEYGEDITN-
DNLJ_HELPY/2-310SLDDVFNQSELQAWLQR....ILKAYPSAS.....FVCSPKLDGVSLNLLYQHGKLVKAT------TRGNGLEGELVSA-
DNLJ_BORBU/3-309SLDKVYDLDLLKSWIDK.....ID.FNNSFN....ISVEPKIDGCSIVLYYKDGVLEKAL------TRGNGKFGNDVTI-
DNLJ_MYCGE/2-308SLENAFSTKEIANFIDN....INFQTNSKNE....FVVEPKIDGVSISLTYKNGVLVHAL------TRGDGSVGEDVLN-
LIGB_ECOLI/28-308GVRKMVDKNALSLWMRE..........RSD.....LWVQPKVDGVAVTLVYRDGKLNKAI------SRGNGLKGEDWTQ-
DNLJ_BACSU/4-314SLGNAFNADDLRDFDRR....VRQSVGDDV....AYNVELKIDGLAVSLRYEDGYFVRGA------TRGDGTTGEDITE-
DNLJ_SYNY3/1-317SLENAFNVQELQQWQER....WQRIAPTIEK..AEYVCELKIDGSAIALTYENGLLVRGV------TRGDGTTGEEISQ-
DNLJ_THESC/4-319SLDNAFNFDELKAFEER....IGRALGREGP..FAYTVEHKVDGLSVNLYYEDGVLVWGA------TRGDGEVGEEVTQ-
DNLJ_ZYMMO/29-346SLDNGFLDQDVEDFLGR....VRRFFNLKENQAVICTVEPKIDGLSCSLRYEKGILTQAV------TRGDGVIGEDVTP-
Q99540_HUMAN/14-325SLGDVFSLEELAAWDER....TTKSLGFQS....PYNLELKIDGLAVALTYVDGRLVQAS------TRGNGTIGEDVTR-
DNLJ_RHOMR/36-360SLNNAFGEEDVRVWYERCCRMLAERLGQPVQ..PAVTAELKIDGLAMALTYENGVLSVGA------TRGDGIEGENVTQ-

PF09414

Q6T434_TRYCR/74-303GTNFSIYLINLGD......KEVVRFAKRSGIM....DPNENFFGYHI.............------....LIDEFTAQI-
Q86QW3_LEITA/98-325GTNFAIYLINENE.........VRFAKRSGIM....DPNEHFFGYHL.............------....LIDDFTAQV-
Q4DAH8_TRYCC/50-271GANFGIYSIEGEK........TIRYAKRSGIM....HPTEHFFGYHM.............------....LVPQLQQYI-
Q86QW4_LEITA/51-272GANFGIYSTEHGK........IIQYAKRSGIM....PPHEHFFGYHV.............------....LIPDLARYI-
A6GCV5_9DELT/26-233GAQLVLGCDGRS..........VEVGKRKAWL....ADDEPFFGWQL.............------....LRGALERAA-
A1ZC58_9BACT/31-233GANFCVLSNGEE..........TQFAKRKAVL....DEEENFFGYHS.............------....LRNHLTAQV-
Q06EF1_BPR32/28-227GTNFSLII.ERDK.........ATCAKRTGPI....LPAEDFFGYEI.............------....ILKNYKDSI-
Q7Y4V8_BPR69/28-225GTNFSLII.ERDN.........VTCAKRTGPI....LPAEDFYGYEI.............------....VLKKYDKAI-
Q5QBW9_9CAUD/28-227GTNFSLII.ERDA.........VTCAKRTGPI....LPAEDFYGYEI.............------....VLKNYADSI-
Q56BF0_9CAUD/28-233GANFSLITSDGER.........VIPAKRSGEI....LPTEQFYGCEP.............------....VVARYAPAI-
Q6WI19_BPKV4/27-222GANFSFIVEFKPNEAQDGAEFTVTPAKRTSTIGANVMGDYDFYGCTS.............------....VVEAHTAKM-
Q3EP73_BACTI/25-179GENTSLY.....................................................------....KDAIHARSL-
A3IEU7_9BACI/35-189GEGTTLY.....................................................------....KDYMHARSI-
Q857R9_9CAUD/188-418GTSIRVGNVPVLRQKKWLERLVNRWVKTPD..............YEFDVVYGSRKVIKDV------NNP.NQNHYYQSD-
Q854A4_9CAUD/187-423GTSIRVGRVPCLRQKGRLERFLNRWLPTPD..............YTYDAVFGSRKVIKDV------NNP.NQNHYYQSD-
Q5YSN8_NOCFA/190-399GTSIRIGNTIARRQPTWRDKLAARLLRVPV............SQYDYDTVYGSRKVIKD.------PKV.QQNHFYGTD-
Q6MVA4_NEUCS/200-398GVTMHVYKVSNQSPDLLAYFPALKPTAGSIPI....PPTMQTPRGRVGVCNRKHEFFDD.------....GKNIYWETA-
Q54EG7_DICDI/247-425GSSITVF..............................K....KGKESGVCSRNF.LIE..------.DFQGSDIHQAVI-
Q56EF5_9CAUD/169-356GSSITMAWVTD.........PELFLDLGTEEEPYAHDY....DDAQFIVASRNQVLRY..------.N..ADSKWWKGV-
Q9RZM9_DEIRA/158-328GT.QGVYFRTAEG..........RWLVTSK.................GLSRGGLTLRE..------.A..ASNVYWQA.-
Q2S6U3_HAHCH/186-380GTFTGVAILPEKDAHQEAFGVKRNVLIFSK.................GLGAKGLVLANTD------GN..SANVYVRAT-
Q828Q7_STRAW/158-341GTACLVTYLADED..........RVHVSSK.................GFGAKSLALKE..------.D..PRNLYWRAV-

PF01068

DNLI3_HUMAN/483-677.......HKVAHFKDYI.PQAFPGGHS..MILDSEVLL..IDNKTGKPLPFGTLGVHK.KAAF..........Q......
DNLI4_CANAL/259-494YG..ESFQFGALTKFLA.HAFAGNIQS..VILDGEMVA..YDYERNVILPFGTLKSSAIQESVRQF...TTIDQ......
Q9VG84_DROME/257-451.......HKIRALKKYI.PQAFPGGGE..MILDSEIIL..VDTDTGALLPFGSLGAHK.KQTF..........A......
DNLI4_HUMAN/248-451FG..ASPTEGSLTPFIH.NAFKADIQI..CILDGEMMA..YNPNTQTFMQKGTKFDI..KRMV..........E......
DNLI1_CAEEL/263-465.......KYPDIIEKIS.SCIGDGVTS..FIVDAEVVA..IDEA.GLILPFQVLSTRK.RKNA.........TD......
O69698_MYCTU/11-201.......YFPELVAAIR.AELPHR.....CVIDGEIII.....ATDHGLDFEALQQRIHPAES..........R......
Q9XAM3_STRCO/11-197.......YFPELVVAVR.ERLPER.....CVVDGEIVI.....ARDGHLDFDALTERIHPADS..........R......
Y938_MYCTU/460-637.......EYPQL......RALAEDLADHHVVLDGEAVV....LDSSGVPSFSQMQNRG......................
DNLI_METJA/226-440.......ALPEIVEAVK.NINVD...K..LIVEGECVA..IDKQTGKPRPFQDILRRF.RRKY..........D......
DNLI_ARCFU/225-419.......ALPDIVEEIK.KSVKP...G..VILDGEVIA..V.KE.GKPMPFQHVLRRF.RRKH..........D......
DNLI_PYRFU/224-422.......AIPEIVEALK.EAIIPE..K..AIVEGELVA..I.GENGRPLPFQYVLRRF.RRKH..........N......
DNLI_METTF/227-425.......AVPEILEGVE.EALPAD..D..YIVEGEIIV..T..MDGRPASFQYILQRV.RRKY..........D......
DNLI_MYCTU/186-380.......RLPEVVEATL.AL...PVRD..LVADGEAIA..LCPDN.RPQRFQVTASRF.GRSV..........D......
DNLI_AQUAE/225-424.......QYPDLIEFLK.EAI.PH..D..FIVELEAVV..IDPASGEIRPFQELMHR..KVKY..........V......
DNLI_PYRAE/226-424.......AYPDVVKAVK.EAVSAK..E..AILEGEIVA..VDPDTGDMLPFQELMHR..KRKH..........D......
DNLI_AERPE/239-439.......MFPDVVEMAR.KGLKAG..E..AIVEGEIVA..VDPDNYEIQPFQVLMQR..KRKH..........D......
DNLI_ACIAM/236-436.......QYPDVAEYIS.KYVKGN..E..FIVEGEIIP..VDPETGEMRPFQELMHR..KRKS..........D......
DNLI1_YEAST/393-598.......RYPEINITDF.IQDLDTTKN..LILDCEAVA..WDKDQGKILPFQVLSTRK.RKDV..........E......
DNLI1_SCHPO/390-595.......RYPDISVSVS.KWKKPDARS..FILDCEAVG..WDRDENKILPFQKLATRK.RKDV..........K......
DNLI1_HUMAN/542-746.......KYPDIISRIP.KIKLPSVTS..FILDTEAVA..WDREKKQIQPFQVLTTRK.RKEV..........D......
DNLI1_XENLA/695-899.......KYPDIISRIP.KIKKESVKS..CILDTEAVA..GDAEKKQIQPFQVLTTRK.RKDV..........D......
DNLI1_DROME/369-573.......KYPDLIARST.ALLKGDVKS..YIIDSEIVA..WDVERKQILPFQVLSTRK.RKNV..........D......
DNLI1_ARATH/418-622.......KYPDVALALS.RLKKPSVKS..FILDCEVVA..FDREKKKILPFQILSTRA.RKNV..........N......
DNLI_NPVLD/173-367.......HKVAGCREHL.TRAFPRARN..FILDAEIVM..VD.GSGEALPFGTLGRLKQMEHA.................
DNLI_FOWPN/211-405.......HKVTDFEELL.DRAFPSAKN..MILDGEIIL..IDTETNQPLPFGTLGINK.KSMY..........H......
DNLI_VACCC/206-399.......HKVDYLKEYI.PKAFKKATS..IVLDSEIVL..VDEHN.VPLPFGSLGIHK.KKEY..........K......
Q90026_9POXV/212-406.......HKVQGLDEAL.SIAFPSANN..FILDAELVL..VDEHTGECLPFGSLGVHK.KASF..........K......
O58234_PYRHO/76-247.......TTERISDFIP.EEFFKDHPN..LILVGEMAG........PESPYLVEGPPYVK....................
O67191_AQUAE/62-235.......TTDRLPDLID.LRILDENPD..LVICAEVAG........PENPYIEESPPYVK....................
O27289_METTH/82-255.......TTRKAQELLDLSEFFREHPD..LVICGEMIG........RDNPYVSQDYPEVG....................
Y414_METJA/85-260.......TTKKVKKFLN.LEILDDYSE..YMLCGEMIG........INNPYTPYYYKEVDRGF.................
O29409_ARCFU/80-251.......TTEKARTLID.DEFFRDYPD..YMLCCEAVG........RASPYVPTDVYGI.....................
DNLI_BPT7/8-240EHLNGFDVRWKRLLNDD.RCFYKDG....FMLDGELMVKGVDFNTGSGLLRTKWTDTKNQEFHEELFVEPIRKKD.....
DNLI_BPT3/8-246EHLNGFDKRWQQLLNDD.RCIFPDG....FMLDGELMVKGVDFNTGSGLLRTKWVKRDNMGFHLTNVPTKLTPKGREVID
O41026_PBCV1/6-186..........SVMNRLL.TELLPEGS......DGEISI......EGATFQDTTSAVMTGHKMY.................
O68776_YERPE/73-267.......LDHLKPAMLE.RGRLSGFKH..IFFDGE..........GTAGTFNQSVSALRKKNV.................
DNLI_ASFB7/126-318........LDNIKKELK.QLYLFIDVR..VYLDGELYL........HRKPLQWIAGQANAKTD.................
DNLI_HAEIN/35-189.......P..........AYFIKDFPP..FAIDGELF.....SERNHFEEISTITKSF.KGDG.................
DNLI_BPT4/135-367.....DLLKEELIKMTA.EARQIHPEG..VLIDGELVYHEQVKKEPEGLDFLFDAYPENSKAKEFAEVAESRTASNGIAN
DNLI4_YEAST/256-466YG..ASLSSGTISQHL...RFTDSVKE..CVLDGEMVT..FDAKRRVILPFGL...V..KGSAKEAL..SFNSI......
DNLI4_SCHPO/268-476YGSSYFDEQSRLTQYII.GAFDKRISQ..IILDGEMVT..WDPVLETVIPYGS...L..RSIF..........E......
Q9VYA5_DROME/258-461FG..HSYDHGTLTPKLR.GLLPLGLES..IILDGEMMV..WDTNKLRFREKGENTDV..KSLK..........P......
YKOU_BACSU/13-208.......TFPEITQFAK.TAFQHLEKELPLTLDGEIVC..LVNPCRADFEHLQVRGRLKRPDK.................
LIGB_BACSU/5-183.......KFPELMDLDIPDG.........TVLDGEVIV....AASGGAPDFEAVMERFMSKKS.................
Q9PYQ5_GVXN/195-361.......CLVELLPFLE.DAL.RDVKD..VIIDGELM...........................................
O28549_ARCFU/10-196.......RYPEI......KLLDAVERN..AILDGEVVV..I.KDGKPSFPLLQKREHV.DSRF..........K......

PF01331

Q9S9L3_ARATH/297-492----Q.MRFPCEY..EPSD..YKVHHY--TLLDGEMVV-----------DTIKEGETQ----------------------
MCE_PBCV1/60-236----PFKNIPRVL...........FQG--SIFDGELCV-----------DIVEK....----------------------
MCE1_YEAST/47-249----NGFRFPRLPQKKKEELLETLQDG--TLLDGELVI-----------QTNPM..TK----------------------
Q9VY44_DROME/307-497----ENVTFVESRN......LNEHLDG--TLVDGEMVL-----------DKIGET...----------------------
MCE1_CAEEL/289-479----ENLDFVTKN.GAP.......LME--TLVDTEVII-----------DKVEINGAM----------------------
Q9AVW1_GUITH/39-226----KNFKNPNYLEG...........Y--YCFDGELCF-----------DFIS.....----------------------
MCE1_HUMAN/272-460----SNLEFPFRKD......LRMHLSN--TLLDGEMII-----------DRVNGQ...----------------------
MCE1_CANAX/44-243----PNIHFPLSVNETREK..PTYHHG--TLLDGELVL-----------E.NRN..VS----------------------
MCE1_SCHPO/45-242----EKIFYPVENDKSG....KKYHVD--TLLDGELVL-----------DIYPGG...----------------------
MCE_ASFB7/259-424----TTGIEPLKP..............--TILDGEFMP-----------E........----------------------
Q9LFA7_ARATH/294-481----T.LYDALNYR.WGIS..DKVHHY--TLLDGEMVI-----------DTPTG.EQG----------------------
Q9SS77_ARATH/343-536----Q.MRFPFRHPTEGIS..DKVHHF--TLLDGEMII-----------DTLPD..KQ----------------------

PF01653

DNLJ_HAEIN/2-319----NIRTIRNVPLQLL-TDN....PPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRN----------AAAGSLR
DNLJ_MYCPN/1-307----NVKTIKSIPLTIP-FH.......KQVEIRGEIFVDKKTFAQIN....ENLAKPFANARN----------LAAGTLR
DNLJ_ECOLI/2-318----NVRTIRAIPLKLH-GEN....IPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPRN----------AAAGSLR
DNLJ_MYCLE/11-328----NARTIEDVPERLT-VSDI.YPLPEVLEVRGEVFFRVVDFQALNTSLVEEGKNPFANPRN----------SAAGSLR
DNLJ_AQUAE/30-348----NLKTIKTIPLKAE-FSR...FGIKLAEIRGEVVIRKDEFQKLNKERMEEGLPPFANPRN----------AAAGSIR
DNLJ_HELPY/2-310----NAKHIANIPHAIA-YN.......GEIEIRGEVIISKKDFDALNQERLNANEPLFANPRN----------AASGSLR
DNLJ_BORBU/3-309----NVRTIRYIPLFLD-EK.......VDLVLRGEVYITKENFLKIN....KFLEKPYTNSRN----------LASGILR
DNLJ_MYCGE/2-308----NVKTIKSIPLTIP-FT.......KTIEIRGEIFVDKKTFLAIN....NQLEKPFANARN----------LAAGTIR
LIGB_ECOLI/28-308----KVSLISAVPQTVS-GP......LANSTLQGEIFLQREGHIQQQ........MGGINARA----------KVAGLMM
DNLJ_BACSU/4-314----NLKTIRNIPLKMN-R.......ELSIEVRGEAYMPKRSFEALNEERIKNEEEPFANPRN----------AAAGSLR
DNLJ_SYNY3/1-317----NIKTIRSIPVKLN-LDN....PPPTVEVRGEAFLPLEEFNRINHEREAQGESLFANPRN----------AAAGTLR
DNLJ_THESC/4-319----NLLTIPTIPRRVK-G......VPERLEVRGEVYMPIEAFLRLNEELEEKGEKIFKNPRN----------AAAGSLR
DNLJ_ZYMMO/29-346----NVRVIDDIPKTLK-GDN....WPEIIEIRGEVYMAKSDFAALNARQTEENKKLFANPRN----------AAAGSLR
Q99540_HUMAN/14-325----NVKTIKAIPQQLT-E.......PLTIEVRGEIYMPKKSFAALNVQREADGLEPFANPRN----------AAAGSLR
DNLJ_RHOMR/36-360----NVRTIPAIPLRIP-VDPAVGPPPTRLEVRGEVYMRKRDFERLNEQLQARGERPFANPRN----------AAAGSVR

PF09414

Q6T434_TRYCR/74-303----RILSDLLK..QKYGL.....GRIGRVVLNGELFG----AKYKH........PLVPPSEKWCTMPNGKRFPIAGVQI
Q86QW3_LEITA/98-325----RALCALLK..RKYGVT....GRMGRVVLHGELFG----AKYKH........PLVPTSKKWCTLPNKKRIPISGVEI
Q4DAH8_TRYCC/50-271----TVTREMLC..DKLQK......KLHTVLINGELFG----GKYDH........PSLQKTRKTVMVAGKPRTISA...V
Q86QW4_LEITA/51-272----KQGRELLT..EQLGV......SPTTVIMNGELFG----GKYDH........PSVSKRRQSVMVAGKSRTITA...V
A6GCV5_9DELT/26-233----LDAFAFLR......ASAVTDYAPATVYVYGELFG----GAYPH........PETEALPG...............LS
A1ZC58_9BACT/31-233----AQVFAELKRQHADTVA.........VAVYGELFG----GAYPH........PDVTAVTG...............VQ
Q06EF1_BPR32/28-227----KAVQDIME..TSAVVS.........YQVFGEFAG----.............PGIQKNVD.................
Q7Y4V8_BPR69/28-225----KTVQKFMY..TARAVS.........YQVFGEFAG----.............GGIQKGVD.................
Q5QBW9_9CAUD/28-227----KSVQHLIE..SINYQS.........YQIYGELAG----.............PGIQKNVD.................
Q56BF0_9CAUD/28-233----RKLWDVIN..TAQQVSGIYV.DSLVIQVYGEFAG----.............RGVQKDVD.................
Q6WI19_BPKV4/27-222----EAISNWLW..ARGIIN.....VGETIIVYGELAG----.............KGVQKEVN.................
Q3EP73_BACTI/25-179----SSGHHPSRTWVKTLQGSMGYRIPEGWRICGENVY----AC...........HSIHYTAL.................
A3IEU7_9BACI/35-189----HSANHPSRHWVKTFHASFSYQIPDSWRLCGENMY----AK...........HTIYYQAL.................
Q857R9_9CAUD/188-418----IWTEYGKK..IA.......ALIPEGFIVYGELIG----WTP..DG.....QPIQKGYTY................D
Q854A4_9CAUD/187-423----IWTDYGKK..IA.......DLIPEGYIVYGELIG----WTPVKDGMQFDTSPIQKNYTY................N
Q5YSN8_NOCFA/190-399----VWTYYGQR..LD.......GLIPQGFVVYGELIG----WTP..DG.....RPIQPGYTY................N
Q6MVA4_NEUCS/200-398----KTSGILDK..IH.......KIPYRNIAIQGELVG----.............SHIQGNTM................Q
Q54EG7_DICDI/247-425----EDLDLLNR..LS.......T.IDLNIALQGEILG----.............PKIQGNIY................Q
Q56EF5_9CAUD/169-356----ENYQIVDR..LK.......E.LGMSVAIQGELMG----.............PGIQKNRE................N
Q9RZM9_DEIRA/158-328----.....ARN..SNLFAEADAAFSGGEVQIFGEVV.----.............PVQKGFSY................G
Q2S6U3_HAHCH/186-380----TGM.VAVI..DALLASGELRVEDEPLFILGETFG----.............PGVQDLAY................G
Q828Q7_STRAW/158-341----HGHGVAQA..AARLAE...RLGARRVGIFGEVYG----.............AGVQDLTY................G

PF01068

DNLI3_HUMAN/483-677........DANVCLFVFDCIYF.........NDVS.L.......MDRPLC--ERRKFLHDNM................VE
DNLI4_CANAL/259-494..YEQQ..TAYPFFLVFDILFL.........NGKD.L.......TNYPLF--FRKNILNRIL................RP
Q9VG84_DROME/257-451........NAAVCLFVFDCILY.........DGED.L.......TQLPFR--KRREILEQNI................QP
DNLI4_HUMAN/248-451..DSDL....QTCYCVFDVLMV.........NNKK.L.......GHETLR--KRYEILSSIF................TP
DNLI1_CAEEL/263-465..DNGV....KVVVFLFDLLYF.........NGEP.L.......VRKPLR--KRRELLRTNF................KK
O69698_MYCTU/11-201..VRMLADRTPASFIAFDLLAL.........GDDD.Y.......TGRPFS--ERRAALVDAVT..............GSG
Q9XAM3_STRCO/11-197..VRTLAERTPASLVAFDLLAL.........DDAS.L.......LDVGLA--DRRALLVRAL..................
Y938_MYCTU/460-637.......RDTRVEFWAFDLLYL.........DGRA.L.......LGTRYQ--DRRKLLETLA..................
DNLI_METJA/226-440..IGKMMKEINLRVYLFDILYK.........DGVS.F.......IDEEFE--KRRKVLEEIVGYENDWRTERKRIEKELK
DNLI_ARCFU/225-419..VAKMVEKIPLEAHFFDILYH.........DGEC.........IDLPLR--ERRKLLESAV.................N
DNLI_PYRFU/224-422..IEEMMEKIPLELNLFDVLYV.........DGQS.L.......IDTKFI--DRRRTLEEII.................K
DNLI_METTF/227-425..VDRLTREVPLSLFLFDVLYH.........RG.P.L.......IDEPLW--HRREVLESILSEI..........PGRVE
DNLI_MYCTU/186-380..VAAARATQPLSVFFFDILHR.........DGTD.L.......LEAPTT--ERLAALDALV..................
DNLI_AQUAE/225-424..TKYHITKYPVAGFLFDIIYL.........DGED.L.......TLKPYP--ERREILEKVV.................K
DNLI_PYRAE/226-424..VATAVELYPTVLYLFDVLYV.........DGED.L.......TEEPLI--YRRVRLSEIV.................C
DNLI_AERPE/239-439..IHRVMREVPVAVFLFDALYV.........DGED.L.......TSKPLP--ERRRRLKEIV.................V
DNLI_ACIAM/236-436..IHEAIKEYPVNVFLFDLMYY.........EGED.Y.......TVKPLS--ERRKKLESIV.................E
DNLI1_YEAST/393-598..LNDV..KVKVCLFAFDILCY.........NDER.L.......INKSLK--ERREYLTKVT................KV
DNLI1_SCHPO/390-595..IGDI..KVRACLFAFDILYL.........NGQP.L.......LETPLN--ERRKLLYSMF................QP
DNLI1_HUMAN/542-746..ASEI..QVQVCLYAFDLIYL.........NGES.L.......VREPLS--RRRQLLRENF................VE
DNLI1_XENLA/695-899..ASEI..KVQVCVYAFDMLYL.........NGES.L.......VKEPFA--KRRQLLRDSF................LE
DNLI1_DROME/369-573..IEEI..KVQVCVYIFDLLYI.........NGTA.L.......VTKNLS--ERRKLLLEHF................QE
DNLI1_ARATH/418-622..VNDI..KVGVCIFAFDMLYL.........NGQQ.L.......IQENLK--IRREKLYESF................EE
DNLI_NPVLD/173-367........DGHVCMYIFDCLRY.........NGVSYL.......NATPLD--FRRRVLQDEI................VP
DNLI_FOWPN/211-405........NACVCIFIFDCLYF.........NDTV.L.......IDKPLI--ERRNIIHANI................KE
DNLI_VACCC/206-399........NSNMCLFVFDCLYF.........DGFD.M.......TDIPLY--ERRSFLKDVM................VE
Q90026_9POXV/212-406........SSTPCLFVFDCLFY.........NDKS.L.......LRVPFV--QRRAFVETTI................KE
O58234_PYRHO/76-247.........EDIQFFLFDIQEL.........GTGRSL..........PVE--ERLKIAEEYG.................I
O67191_AQUAE/62-235.........EDVQLFVFDFMKK.........NEQGFL..........SQE--EKMELIEKYN.................L
O27289_METTH/82-255..........PLGFRVFDLREK.........NTNRPL..........PVE--ERRALLDSYG.................L
Y414_METJA/85-260.........ENLGFYIFDIKER.........ETNKSL..........PIK--ERINLCEKYN.................L
O29409_ARCFU/80-251.........ETLEFFLFDVREG.........KTNQPV..........TID--EKKEIAEKYG..................
DNLI_BPT7/8-240.KVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLL.......MQEHVK--NMLPLLQEYF..................
DNLI_BPT3/8-246GKFEFHLDPKRLSVRLYAVMPIHIAESGEDYDVQNLL.......MPYHVE--AMRSLLVEYF..................
O41026_PBCV1/6-186........NAKFSYYWFDYV...........TDDP.L.........KKYI--DRVEDMKNYITVH.........PHILEH
O68776_YERPE/73-267.......KAIGAVYHIFDFFLP.........EWRAQAKSKEYLKTGMKLK--ERLAMLVSLFRN...........TCGED
DNLI_ASFB7/126-318........SSELHFYVFDCFWS.........DQ...........LQMPSN--KRQQLLTNIFK..............QKE
DNLI_HAEIN/35-189........WEKLKLYVFDVPDA.........EGN..L.......FERLAK--LKAHLLEHPT..................
DNLI_BPT4/135-367KSLKGTISEKEAQCMKFQVW...........DYVPLVEIYSLPAFRLKYD--VRFSKLEQMT.................S
DNLI4_YEAST/256-466..NNVD...FHPLYMVFDLLYL.........NGTS.L.......TPLPLH--QRKQYLNSIL................SP
DNLI4_SCHPO/268-476..DSSSHSSYSPYYVVFDILYL.........NGKS.L.......VKYSLE--SRRRILEKVI................VR
Q9VYA5_DROME/258-461..EGSWQPC....FVVYDLLYF.........NGQS.L.......LDHTYI--QRAYKLQKLI................VE
YKOU_BACSU/13-208..IQESANARPCCFLAFDLLER.........SGED.V.......TLLSYL--DRKKSLRELISA...........AKLPA
LIGB_BACSU/5-183........AHNIVYCVFDVIYK.........DGQS.I.......AAKPLT--ERKTVLNSLE.................L
Q9PYQ5_GVXN/195-361........DGNAGFIAFDVLIH.........NGRN.M.......MNADLK--TRKLLLSTCV.................K
O28549_ARCFU/10-196..IEILSKTIPAVYIVFDVLYC.........DG.W.V.......VDLELM--ERKKILSEVL.................Q

PF01331

Q9S9L3_ARATH/297-492--------RHVRRYLVYDLVAI---------NGQF.V-------AERPFS..ERWNILERELIKPRNDEKKVRDHWYRYD
MCE_PBCV1/60-236--------..KFAFVLFDAVVV---------SGVT.V-------SQMDLA..SRFFAMKRSLKEFKNVPE.........D
MCE1_YEAST/47-249--------LQELRYLMFDCLAI---------NGRC.L-------TQSPTS..SRLAHLGKEFFKPYFDLRAAYPNRCTT.
Q9VY44_DROME/307-497--------.VTPRYLIYDIVRL---------SNRD.V-------RDEPFYP.NRLDYIKTEVIGPRILGM..KHGIINQR
MCE1_CAEEL/289-479--------CDQPRMLIYDIMRF---------NSVN.V-------MKEPFY..KRFEIIKTEIIDMRTAA..FKTGRLKHE
Q9AVW1_GUITH/39-226--------.QSYIYLIYDFLVF---------KNDWRI-------STWDLSSRMHFSTYFVKILNLNLKNIFFFNVKSIMK
MCE1_HUMAN/272-460--------.AVPRYLIYDIIKF---------NSQP.V-------GDCDFN..VRLQCIEREIISPRHEKM..KTGLIDKT
MCE1_CANAX/44-243--------EPVLRYVIFDALAI---------HGKC.I-------IDRPLP..KRLGYITENVMKPFDNFKKHNPDIVNSP
MCE1_SCHPO/45-242--------KKQLRYLVFDCLAC---------DGIV.Y-------MSRLLD..KRLGIFAKSIQKPLDEYT..KTHMRETA
MCE_ASFB7/259-424--------..KKEFYGFDVIMY---------EGNL.L-------TQQGFE..TRIESLSKGIKVLQAFN.......IKAE
Q9LFA7_ARATH/294-481--------EARRRYLVYDMVAI---------NGES.V-------VERTFC..ERWNMFVREVIGPRAAEK.LRSHCYRYD
Q9SS77_ARATH/343-536--------KQERRYLIYDMVAI---------NGQS.V-------VERPFY..ERWKMLEKEVIDPRNHEK.ARSHIYRYD

PF01653

DNLJ_HAEIN/2-319QLDPNITSKRPLVLNAYGIGIA---------EGVD-L-------P.TTHY--ARLQWLKSIG----------------IP
DNLJ_MYCPN/1-307NLNSEVSAKRKLKAFFYFVP..---------NALT-L-------GCRSQS--AVLAQLKQWN----------------FP
DNLJ_ECOLI/2-318QLDPRITAKRPLTFFCYGVGVL---------EGGE-L-------P.DTHL--GRLLQFKKWG----------------LP
DNLJ_MYCLE/11-328QKDPAVTAHRKLRMICHGLGHI---------EGFR-P-------A..TQH--QAYLALRDWG----------------LP
DNLJ_AQUAE/30-348QKDPKEVAKRNLEAIVYHLSYV---------EPPE-T-------EPPTHY--ESLKMLHTLG----------------FK
DNLJ_HELPY/2-310QLDSEITKKRKLQFIPWGVG..---------.KHS-L-------NFLSFK--ECLDFIVSLG----------------FS
DNLJ_BORBU/3-309RVDSREVANFPLNIFIYDFLN.---------AG..-L-------EFKTND--LATARLKKLG----------------FK
DNLJ_MYCGE/2-308NLNSEITAQRKLRALFYYIP..---------NGLE-E-------SITTQT--MVLEQLKQWK----------------FP
LIGB_ECOLI/28-308RQDDSDTLN.SLGVFVWAWP..---------....-D-------GPQLMS--DRLKELATAG----------------FT
DNLJ_BACSU/4-314QLDPKIAAKRNLDIFVYSIAEL---------DE..-M-------GVETQS--QGLDFLDELG----------------FK
DNLJ_SYNY3/1-317QLDPKIVHQRRLQFFAYTLHLP---------GQ.E-D-------KIQSQW--QALEYLKKAG----------------FM
DNLJ_THESC/4-319QKDPRITARRGLRATFYALGLG---------LE.E-S-------GLKTQL--DLLHWLREKG----------------FP
DNLJ_ZYMMO/29-346QLDPNITARRSLRFLAHGWG..---------EATS-L-------PADTQY--GMMKVIESYG----------------LS
Q99540_HUMAN/14-325QLDAQVTKQRELSAFVYYTAEP---------EV..-L-------GVTTQS--GALARFAELG----------------LP
DNLJ_RHOMR/36-360QLNPQVTALRPLSFFAYGIGPV---------EG.A-E-------VPDSQY--EVLQWLGRLG----------------FP

PF09414

Q6T434_TRYCR/74-303QREAFPQYSPELHFFAFDIKYS---------VSGAEEDFV....LLGYDE--FVEFCSKIPNLL....------------
Q86QW3_LEITA/98-325QSEPFPQYSPELHFFAFDVKYS---------VSGAEEDVV....LLPFDD--FTEVCAQVPNLL....------------
Q4DAH8_TRYCC/50-271QTDSFPQYSPDLHFYAFDIKYK---------ET.NEAEYV....TLTFDD--ATELFKRVPGLL....------------
Q86QW4_LEITA/51-272QNNAFPQYSPDLHFYAFDIKYR---------MT.EEEEYR....TMTYDQ--ALAIFEKIPGLL....------------
A6GCV5_9DELT/26-233PVQTGIWYAPGLAFAAFDVLVC---------RGAEPEHSDPPEPEFLSRT--ELEAVAEHAGLR....------------
A1ZC58_9BACT/31-233AIQTGIYYCPEVRFWVFDLVR.---------...ITDTSS....YFVDFD--NMRETCDTVGLP....------------
Q06EF1_BPR32/28-227........YGDKDFYVFDIIVT---------...TESGDV....TYVDDY--MMESFCNTFKFK....------------
Q7Y4V8_BPR69/28-225........YGEKDFYVFDILIN---------...TESGDN....TYLTDY--EMQDFCNEFGFK....------------
Q5QBW9_9CAUD/28-227........YGDKDFYVFDIRVT---------...KEDGTE....SVLTDT--LMEAFCIIHKFK....------------
Q56BF0_9CAUD/28-233........YGEKDFYVFDIRVN---------...GK.........FLHDN--IVAVYAKTVGLK....------------
Q6WI19_BPKV4/27-222........YGDKDFWAYDILLP---------......ETG....KFLDWD--VVLEACEFAKVK....------------
Q3EP73_BACTI/25-179..........TSYFYVFSIWN.---------......EKN....ECLSWD--ATVAWCKKLGLA....------------
A3IEU7_9BACI/35-189..........TSYFYLFSIWN.---------......EDN....ICLSWD--ETVAFAEKLGVE....------------
Q857R9_9CAUD/188-418VPRG......EAHLYVYRVAHI---------..NNQGHL.....SDLSWN--GVKQFCQVRGLK....------------
Q854A4_9CAUD/187-423LPEG......QAELYVYRVATI---------..NTQGTL.....ADLPWD--AVKEFCLARGLK....------------
Q5YSN8_NOCFA/190-399VPEG......DAHLYVYRVAHV---------..NPQGVI.....TDLAWG--QVVEWCAQLGLK....------------
Q6MVA4_NEUCS/200-398YPEG......KHEFVVFGIWDM---------..DAR........DYLATK--SVELLCKTLDIA....------------
Q54EG7_DICDI/247-425L..R......KNYFKIFDIFLI---------..DSQ........RYATHD--ERIEILNSLKLTPSDH------------
Q56EF5_9CAUD/169-356F..D......KYRIFAFRAWFI---------..DEQ........RFATDE--EFQDLCRTLGME....------------
Q9RZM9_DEIRA/158-328Q..H......KPTVFVFKVVYD---------..G.L........RLPRRD--WPQWVLDHA.......------------
Q2S6U3_HAHCH/186-380K..D.....LGFRLFALASGYR---------..GAQ........RYHDFD--ALQAMAEQLGVQ....------------
Q828Q7_STRAW/158-341A..DGRRDTLGYAVFDVSADID---------..GEV........RW..LD--AADRLDGELPL.....------------

PF01068

DNLI3_HUMAN/483-677-IPNRIMFSEMKRVTKALDL------------------------------------------------------------
DNLI4_CANAL/259-494-IPNRFEVLDTRLGSSSEDI------------------------------------------------------------
Q9VG84_DROME/257-451-IKSHVQLSESEFLKTTREL------------------------------------------------------------
DNLI4_HUMAN/248-451-IPGRIEIVQKTQAHTKNEV------------------------------------------------------------
DNLI1_CAEEL/263-465-IDGSFYFATSVDTNDTDEI------------------------------------------------------------
O69698_MYCTU/11-201-ADADLSIHVTPATTDMATA------------------------------------------------------------
Q9XAM3_STRCO/11-197-SGVTPPVHVAPATDDIEVA------------------------------------------------------------
Y938_MYCTU/460-637-NATSLTVPELLPGDG....------------------------------------------------------------
DNLI_METJA/226-440-SDKIIDISYKLVTNDAKEA------------------------------------------------------------
DNLI_ARCFU/225-419-ESEKIKLAKQIVTDSVDEV------------------------------------------------------------
DNLI_PYRFU/224-422-QNEKIKVAENLITKKVEEA------------------------------------------------------------
DNLI_METTF/227-425-ASRMVDVG....PDNLDDA------------------------------------------------------------
DNLI_MYCTU/186-380-..PARHRVDRLITSDPTDA------------------------------------------------------------
DNLI_AQUAE/225-424-RTDRIGLVPRKIVDNVEDL------------------------------------------------------------
DNLI_PYRAE/226-424-ETDKVSIAKWRIFDNAEAV------------------------------------------------------------
DNLI_AERPE/239-439-ETPLWRLAESIETSDPEEL------------------------------------------------------------
DNLI_ACIAM/236-436-DNDYVHIATHIITDNVEKL------------------------------------------------------------
DNLI1_YEAST/393-598-VPGEFQYATQITTNNLDEL------------------------------------------------------------
DNLI1_SCHPO/390-595-STGDFTFAKHSDQKSIESI------------------------------------------------------------
DNLI1_HUMAN/542-746-TEGEFVFATSLDTKDIEQI------------------------------------------------------------
DNLI1_XENLA/695-899-TEGQFMFATYMDKSNTDEI------------------------------------------------------------
DNLI1_DROME/369-573-VEGEWKFATALDTNDIDEV------------------------------------------------------------
DNLI1_ARATH/418-622-DPGYFQFATAVTSNDIDEI------------------------------------------------------------
DNLI_NPVLD/173-367-IEGRVVLSAMERTNTLSEL------------------------------------------------------------
DNLI_FOWPN/211-405-IPNRILLSEVKNISTDEEL------------------------------------------------------------
DNLI_VACCC/206-399-IPNRIVFSELTNISNESQL------------------------------------------------------------
Q90026_9POXV/212-406-IKHKIVLSDIRTIRSESDI------------------------------------------------------------
O58234_PYRHO/76-247-SHVEVFGKFTYKD..LEEI------------------------------------------------------------
O67191_AQUAE/62-235-PHVEILGRFTASEEGIKKI------------------------------------------------------------
O27289_METTH/82-255-PNVRLFGVYP.IEEAASEV------------------------------------------------------------
Y414_METJA/85-260-PYVKPLAVVD.KDEAHIHV------------------------------------------------------------
O29409_ARCFU/80-251-.FRLAEILETVSSDDVARI------------------------------------------------------------
DNLI_BPT7/8-240-PEIEWQAAESYEVYDMVEL------------------------------------------------------------
DNLI_BPT3/8-246-PEIEWLIAETYEVYDMDSL------------------------------------------------------------
O41026_PBCV1/6-186-AQVKIIPLIPVEINNITEL------------------------------------------------------------
O68776_YERPE/73-267-YAQDIHLHPFYIIHSHEDF------------------------------------------------------------
DNLI_ASFB7/126-318-DLTFIHQVENFSVKNVDEA------------------------------------------------------------
DNLI_HAEIN/35-189-..TYIEIIEQIPVKDKTHL------------------------------------------------------------
DNLI_BPT4/135-367-GYDKVILIENQVVNNLDEA------------------------------------------------------------
DNLI4_YEAST/256-466-LKNIVEIVRSSRCYGVESI------------------------------------------------------------
DNLI4_SCHPO/268-476-ESHRMSILPYKVGSTIEDI------------------------------------------------------------
Q9VYA5_DROME/258-461-QSGVLQLMRARKIGSVQEF------------------------------------------------------------
YKOU_BACSU/13-208-SPDPYAKETIQSIPCYDHF------------------------------------------------------------
LIGB_BACSU/5-183-DHPNVFVIEGTQGNGL...------------------------------------------------------------
Q9PYQ5_GVXN/195-361-ANERVVVIEYHESNDRNLV------------------------------------------------------------
O28549_ARCFU/10-196-SRGRVVVEEWIEGKG....------------------------------------------------------------

PF01331

Q9S9L3_ARATH/297-492-KEPFGVRIKAFCLLSAVEKKV.---------------------------------------------------------
MCE_PBCV1/60-236-..PAILRYKEWIPLEHPTIIK.---------------------------------------------------------
MCE1_YEAST/47-249-.FPFKISMKHMDFSYQLVK...---------------------------------------------------------
Q9VY44_DROME/307-497-LQAFSVRGKDFWDIWMSARLL.---------------------------------------------------------
MCE1_CAEEL/289-479-NQIMSVRRKDFYDLEATAKLF.---------------------------------------------------------
Q9AVW1_GUITH/39-226-LFQLEIFFESLIENLYSSEKVY---------------------------------------------------------
MCE1_HUMAN/272-460-QEPFSVRNKPFFDICTSRKLL.---------------------------------------------------------
MCE1_CANAX/44-243-EFPFKVGFKTMLTSYHADD...---------------------------------------------------------
MCE1_SCHPO/45-242-IFPFLTSLKKMELGHGILK.L.---------------------------------------------------------
MCE_ASFB7/259-424-MKPFIS.LTSADPNVLLKNFE.---------------------------------------------------------
Q9LFA7_ARATH/294-481-LEPFAG....FWLLSTVEK.L.---------------------------------------------------------
Q9SS77_ARATH/343-536-LEPFRVRRKDFWLLSAVEK.V.---------------------------------------------------------

PF01653

DNLJ_HAEIN/2-319.VNPEIRLCN...GADEVLGFYR---------------------------------------------------------
DNLJ_MYCPN/1-307.VSKAVASFD...RPEALIEYLE---------------------------------------------------------
DNLJ_ECOLI/2-318.VSDRVTLCE...SAEEVLAFYH---------------------------------------------------------
DNLJ_MYCLE/11-328.VSEHTTLVN...DIAGVQGCIA---------------------------------------------------------
DNLJ_AQUAE/30-348TLFKDTKVCK...GIDEVIEYCK---------------------------------------------------------
DNLJ_HELPY/2-310.AIQYLSLNK...NHQEIEDNYH---------------------------------------------------------
DNLJ_BORBU/3-309.VNPLIRFFDLKNSIGEVLNYIA---------------------------------------------------------
DNLJ_MYCGE/2-308.VSDTIRVFQ...NKFQLINYLE---------------------------------------------------------
LIGB_ECOLI/28-308LTQTYTRAVK...NADEVARVRN---------------------------------------------------------
DNLJ_BACSU/4-314.TNQERKKCG...SIEEVITLID---------------------------------------------------------
DNLJ_SYNY3/1-317.VNPHCQLCK...GLDEVVAYFE---------------------------------------------------------
DNLJ_THESC/4-319.VEHGFARAE...GAEGVERIYQ---------------------------------------------------------
DNLJ_ZYMMO/29-346.VSNLLARAD...DIGQMLDFYQ---------------------------------------------------------
Q99540_HUMAN/14-325.TDTHNQVIE...KMADIADFIA---------------------------------------------------------
DNLJ_RHOMR/36-360.VNEHARRFE...HLDDVLEYCR---------------------------------------------------------

PF09414

Q6T434_TRYCR/74-303-YSKALVRGTLDACLAFDVENFH..............................TPLPALL....................
Q86QW3_LEITA/98-325-YARSLVRGTLDECLAFDVENFV..............................TPLPALL....................
Q4DAH8_TRYCC/50-271-YARAIIRGPMSKVAAFDVEHFV..............................TTIPPLV....................
Q86QW4_LEITA/51-272-YARAIIRGPLSKVVAFDVENFA..............................TTIPSLV....................
A6GCV5_9DELT/26-233-TVPVLGRGTRRQLEALPVRYPT.........................................................
A1ZC58_9BACT/31-233-YVPALLVGTFSEVQNYAIEFES.........................................................
Q06EF1_BPR32/28-227-MAPLLGRGKFEELIKLPND...................................LDSVVQDYNFTVDHAGLVDANKCV.
Q7Y4V8_BPR69/28-225-MAPMLGRGTFDSLIMIPND...................................LDSVLAAYN.ATASEDLVEANNCV.
Q5QBW9_9CAUD/28-227-VAPCLATGSFEDLIKLPND...................................FDSVIPDYNFAVDNAGLTIANSTD.
Q56BF0_9CAUD/28-233-MAPLLAYGTFDEIRALPIT...................................FDSVV.....NLANSGAIPAHNGVE
Q6WI19_BPKV4/27-222-TTHEIARGTLDELLRIDPLFRS.............................F...........................
Q3EP73_BACTI/25-179-HVPVLYRGPYNEKVIRSCYNGT.........................................................
A3IEU7_9BACI/35-189-TVPVLYRGIFDERKIKRMFTGK.........................................................
Q857R9_9CAUD/188-418-WTPEMDRVSFGGADPEYPSIEELTQYITQAMDMRYADHYDKTVA.GTAVAALIDRPISL....................
Q854A4_9CAUD/187-423-WTPEMGRVSFGPQTLWSAEDIE..QYVNELMDMRYADYYDEVVAKDEELAAIFERPIPL....................
Q5YSN8_NOCFA/190-399-TVPVLTEMQHRAFDP............VDWLDRRY...YDEGYG..........QAVPL....................
Q6MVA4_NEUCS/200-398-HVPVLGYGPVT..KYGKSVEEI.....LAYADK..............................................
Q54EG7_DICDI/247-425-MAPVISNSFSLKGKTLSDILDM.....ANGFSI..............................................
Q56EF5_9CAUD/169-356-ICPQLGYSYPF..QEFTNVKDM.....LAAADI..............................................
Q9RZM9_DEIRA/158-328-.VPVLYEGPFD....EATVRKL.....RGGLET..............................................
Q2S6U3_HAHCH/186-380-TVPILYRGPFS....QEVMREH.....TDGATK..............................................
Q828Q7_STRAW/158-341-.VPRLYEGPYD....IERVLET.....ASGRET..............................................

PF01068

DNLI3_HUMAN/483-677--------ADMITRVIQEGLEGLVLKD...VKGTYEP--G..KR...HWLKVK----
DNLI4_CANAL/259-494--------ERAIREVVSSRCEGLVLKN...VQSKYEI--D.GFR.NPDWIKVK----
Q9VG84_DROME/257-451--------AAMTARVLHANLEGVVLKS...PTSTYQP--G..KR...NWLKVK----
DNLI4_HUMAN/248-451--------IDALNEAIDKREEGIMVKQ...PLSIYKP--D..KR.GEGWLKIK----
DNLI1_CAEEL/263-465--------NSFFDEAVQNKCEGLMIKTL.DTEATYEI--S..RR.SHSWLKMK----
O69698_MYCTU/11-201--------QRWFSEFEGAGLDGVIAKP...PHITYQP--D..KR...VMFKIK----
Q9XAM3_STRCO/11-197--------RRWFEQYEGAGLDGVVAKP...LDLRYRQ--D..ER...AMYKIK----
Y938_MYCTU/460-637--------AQAFACSRKHGWEGVIAKR...RDSRYQP--G..RR.CASWVKDK----
DNLI_METJA/226-440--------REFYNWSLSIGHEGVMIKN...LKAPYTP--G..SR.VRTMYKFK----
DNLI_ARCFU/225-419--------RKMYDEAISAGHEGVMIKL...PSSPYIP--G..KR.GKNWLKVK----
DNLI_PYRFU/224-422--------EAFYKRALEMGHEGLMAKR...LDAVYEP--G..NR.GKKWLKIK----
DNLI_METTF/227-425--------LWLFKESIREGHEGIMIKD...TEAPYIP--G..IR.GKKMLKFK----
DNLI_MYCTU/186-380--------ANFLDATLAAGHEGVMAKA...PAARYLA--G..RR.GAGWLKVK----
DNLI_AQUAE/225-424--------ENFFYQAIEEGCEGLVCKSL.APNSIYQA--G..KR.GFLWIKYK----
DNLI_PYRAE/226-424--------DVFFHESVSMGTEGLICKS...PSSIYEM--G..AR.GWNWIKYK----
DNLI_AERPE/239-439--------WTFFLKAIEEGAEGVMVKAV.HRDSVYTA--G..VR.GWLWVKLK----
DNLI_ACIAM/236-436--------KEFFYQAISEGAEGVMVKSL.APDAIYQA--G..SR.GWLWIKFK----
DNLI1_YEAST/393-598--------QKFLDESVNHSCEGLMVKMLEGPESHYEP--S..KR.SRNWLKLK----
DNLI1_SCHPO/390-595--------EEFLEESVKDSCEGLMVKMLEGPDSHYEP--S..KR.SRHWLKVK----
DNLI1_HUMAN/542-746--------AEFLEQSVKDSCEGLMVKTL.DVDATYEI--A..KR.SHNWLKLK----
DNLI1_XENLA/695-899--------SEFLDQSIKDSCEGLMVKTL.EQDATYEI--A..KR.SHNWLKLK----
DNLI1_DROME/369-573--------QQFLEESIKGNCEGLMVKTL.DEEATYEI--A..KR.SRNWLKLK----
DNLI1_ARATH/418-622--------QKFLDASVDVGCEGLIIKTL.DSDATYEP--A..KR.SNNWLKLK----
DNLI_NPVLD/173-367--------RRFVHRTLATGAEGVVLKG...RLSSYAP--N..KR...DWFKMK----
DNLI_FOWPN/211-405--------SKLLHIVLSKNIEGFVLKD...AKGVYEP--G..MR...RWLKIK----
DNLI_VACCC/206-399--------TDVLDDALTRKLEGLVLKD...INGVYEP--G..KR...RWLKIK----
Q90026_9POXV/212-406--------TEALNESVEKGLEGLMLKG...GDDVYKP--G..LR...GWLKIK----
O58234_PYRHO/76-247--------YEIVERLSREGREGIVMKS...PDMR.KM--V..KY.VTPYANIN----
O67191_AQUAE/62-235--------KEILKRFNEEGREGVVFKE...DSERNKR--A..KY.ITSYANLM----
O27289_METTH/82-255--------ADIIRALGMAGREGVVMKD...PSMEVPP--L..KY.TSSQAHAR----
Y414_METJA/85-260--------REIIEKLNKEGREGVVLKD...PDMAVSP--I..KY.TTHYTQCE----
O29409_ARCFU/80-251--------KEVVEKLNKNRREGVVFKD...REMVLNP--L..KY.TTSYANQS----
DNLI_BPT7/8-240--------QQLYEQKRAEGHEGLIVKD...PMCIYKR--G..KK..SGWWKMK----
DNLI_BPT3/8-246--------TELYEEKRAEGHEGLIVKD...PQGIYKR--G..KK..SGWWKLK----
O41026_PBCV1/6-186--------LQYERDVLSKGFEGVMIRK...PDGKYKF--G..RSTLKEGILLK----
O68776_YERPE/73-267--------IERFMKRLDENEEGEMGKD...PDSVYEF--...KR.TRSWWKLK----
DNLI_ASFB7/126-318--------LRLKAQFIKEGYEGAIVRN...ANGPYEP--GYNNYHSAHLAKLK----
DNLI_HAEIN/35-189--------YQFLAQVENLQGEGVVVRN...PNAPYE.--R..KR.SSQILKLK----
DNLI_BPT4/135-367--------KVIYKKYIDQGLEGIILKN...IDGLWEN--A..RS..KNLYKFK----
DNLI4_YEAST/256-466--------KKSLEVAISLGSEGVVLKY...YNSSYNV--A..S.RNNNWIKVK----
DNLI4_SCHPO/268-476--------EAELRNVIQEGSEGLVIKK...PSGSYHL--G..ER.MDDWIKVK----
Q9VYA5_DROME/258-461--------NELFQQALDSHAEGIVLKK...QGSRYQP--G..VRLGGGWYKDK----
YKOU_BACSU/13-208--------DQLWEMVIKYDGEGIVAKK...TNSKWLE--K..KR.SSDWLKYK----
LIGB_BACSU/5-183--------.AYFNLAKEKNLEGIVIKK...ANSPYEI--N..KR.SHNWLKVI----
Q9PYQ5_GVXN/195-361--------VDLIKRYLKEDVEGVVVKD...LTAPYEC--K..KK...KWLKIK----
O28549_ARCFU/10-196--------EEFYRKAVEMGLEGIVAKK...KDGRYLI--G..KR.SRLWKKIK----

PF01331

Q9S9L3_ARATH/297-492-------.FNELIPLLSHESDGLIFQG---WDNPYVF--G--.P-NKDLLKWK----
MCE_PBCV1/60-236-------.DHLKKANAIYHTDGLIIMS---VDEPVIY--G--.R-NFNLFKLK----
MCE1_YEAST/47-249-------.VAKSLDKLPHLSDGLIFTP---VKAPYTA--G--GK-DSLLLKWK----
Q9VY44_DROME/307-497-------.GEKFSRTLAHEPDGLIFQP---SKQPYTA--G--.T-CSDVFKWK----
MCE1_CAEEL/289-479-------.GPKFVQHVGHEIDGLIFQP---KKTKYET--G--.R-CDKVLKWK----
Q9AVW1_GUITH/39-226-------YSYLIFKIYCTKIDGVVFSS---NNISYST--N--.R-PLNNFKWK----
MCE1_HUMAN/272-460-------.EGNFAKEVSHEMDGLIFQP---TG.KYKP--G--.R-CDDILKWK----
MCE1_CANAX/44-243-------.VLSKMDKLFHASDGLIYTC---AETPYVF--G--.T-DQTLLKWK----
MCE1_SCHPO/45-242-------.FNEVIPRLRHGNDGLIFTC---TETPYVS--G--.T-DQSLLKWK----
MCE_ASFB7/259-424-------.SIFKKKTRPYSIDGIILVE---PGNSYLN--T--..-..NTFKWK----
Q9LFA7_ARATH/294-481-------.LKNTIPSLSHEADGLIFQG---WDDPYVP--R--.T-HKGLLKWK----
Q9SS77_ARATH/343-536-------.LKGFIPSLSHEADGLIFQG---WDDPYVP--R--.T-HEGLLKWK----

PF01653

DNLJ_HAEIN/2-319-------DIQNKRSSLGYDIDGTVLKI---NDIALQNELGFISKAPRWAIAYKFPAQ
DNLJ_MYCPN/1-307-------QFDQTRDQLNFQVDGLVVKL---DNFHFYDQLGFTSKFPRWALAYKFKPK
DNLJ_ECOLI/2-318-------KVEEDRPTLGFDIDGVVIKV---NSLAQQEQLGFVARAPRWAVAFKFPAQ
DNLJ_MYCLE/11-328-------YWAEHRHEVDHEIDGIVVKI---DEVTLQRRLGSTSRAPRWAIAYKYLPE
DNLJ_AQUAE/30-348-------EWEKKRDSYPYEIDGMVVKV---NDRRLWKVLGYTSHHPRWAIAYKFKPR
DNLJ_HELPY/2-310-------TLIREREGFFALLDGMVIVV---NELNIQKELGYTQKSPKFACAYKFPAL
DNLJ_BORBU/3-309-------DITKKRDSFEYEIDGVVLKV---SDFALRERLGYTAHHPKWAMAYKFEAL
DNLJ_MYCGE/2-308-------AFDKKREQLTFNLDGLVIKL---NSLLFYQQLGATSKSPRWAIAFKFSPK
LIGB_ECOLI/28-308-------EWWK..AELPFVTDGVVVRA---AKEPESR..HWLPGQAEWLVAWKYQPV
DNLJ_BACSU/4-314-------ELQAKRADLPYEIDGIVIKV---DSLDQQEELGFTAKSPRWAIAYKFPAE
DNLJ_SYNY3/1-317-------DWEGARQRLPYMTDGVVVKI---NQYPLQRELGFTQKFPRWAIALKYPAE
DNLJ_THESC/4-319-------GWLKERRSLPFEADGVVVKL---DELSLWRELGYTARAPRFAIAYKFPAE
DNLJ_ZYMMO/29-346-------KIEAERADLDFDIDGVVYKL---DQLDWQQRFGFSARAPRFALAHKFPAE
Q99540_HUMAN/14-325-------TYTAKRDTLAYGIDGVVVKV---NALDNQVELGNTVKIPRWAIAYKFPPE
DNLJ_RHOMR/36-360-------YWTEHRDELDYEIDGVVLKI---DHRPWQALLGAISNAPRWAVAYKFPAR

PF09414

Q6T434_TRYCR/74-303.......GLGNYPLEG.NLAEGVVIRH---VHRGDPATEK...HNVATILKLR----
Q86QW3_LEITA/98-325.......GLGNYPLEG.NLAEGVVIRH---VRRGDPAVES...SGVSTIIKLR----
Q4DAH8_TRYCC/50-271.......GMGNYPLKG.NWAEGLVVKH---AKRGTPGFDP...KGL.TILKFK----
Q86QW4_LEITA/51-272.......GMGDYPLKG.NWAEGLVVKH---CRRGESGFDA...KGV.TIMKFK----
A6GCV5_9DELT/26-233...TVPERLGLPALPD.NVAEGFVLVP---DRRLP........AKARPVVKHK----
A1ZC58_9BACT/31-233...TIAGLLGLPALPTPNLAEGVVIKP---ATSLLMDTAK...GWVRPVIKKK----
Q06EF1_BPR32/28-227.......WNAKAKGEV.FTAEGYVLKP---C...YPSWMP...NGNRVAIKCK----
Q7Y4V8_BPR69/28-225.......FDANVIGD..NTAEGYVLKP---C...FPKWLP...NGTRVAIKCK----
Q5QBW9_9CAUD/28-227.......FIPKVEGKV.FTAEGFVLKP---D...IPTWLP...NGNRVAIKCK----
Q56BF0_9CAUD/28-233PEFKNFMTLKDGEGE..NIAEGFVMKP---V...HPAFMP...NGERVAIKCK----
Q6WI19_BPKV4/27-222.......HTPADVDGD.NVAEGFVVKQ---LR..NEKRLH...NGSRAILKVK----
Q3EP73_BACTI/25-179............SLFG.GIQEGYVLRL---TDAFHYN......DFSKSVGKFV----
A3IEU7_9BACI/35-189............SMFD.GEQEGYVIRN---AASFHYD......DFQYNLGKFV----
Q857R9_9CAUD/188-418............SDKK.SVDEGVCLRQ---D............GLVPTILKAK----
Q854A4_9CAUD/187-423............SDKK.TVDEGVVLRQ---E............GIVPVLLKAK----
Q5YSN8_NOCFA/190-399...........SGSKK.LVDEGVCIRA---VD...........TLFPTVLKAK----
Q6MVA4_NEUCS/200-398.........LGPGEYG.GVKEGLIFRA---N............DDWKKGFKVI----
Q54EG7_DICDI/247-425.........LKESKPK.ILREGLVFKS---TSTIG.....SV.NQSVVSFKAI----
Q56EF5_9CAUD/169-356...........PSIEH.KIAEGVVYKS---VEL........V.DGRMVHFKAI----
Q9RZM9_DEIRA/158-328.........V.SGKGL.HIREGVVVAP---KVPRF.....AA.DGSDLSVKLI----
Q2S6U3_HAHCH/186-380.........L.DAD...HIREGIVITP---TKERR.....DP.ELGRVCLKSV----
Q828Q7_STRAW/158-341.........V.SGHGL.HLREGVVIRS---ATERR.....SPVTGGRAIAKAV----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window