Sequence alignment for CL0078

PF01331

Q9S9L3_ARATH/297-492---------------------------------------------------------------------HPLSLGR.E--
MCE_PBCV1/60-236---------------------------------------------------------------------NPVSIER.K--
MCE1_YEAST/47-249---------------------------------------------------------------------QPVSFQHSD--
Q9VY44_DROME/307-497---------------------------------------------------------------------QPVSMDR.E--
MCE1_CAEEL/289-479---------------------------------------------------------------------QPVSLSR.G--
MCE1_HUMAN/272-460---------------------------------------------------------------------QPVSMDK.Q--
MCE1_SCHPO/45-242---------------------------------------------------------------------QPVSFSK.K--
F4IYM6_ARATH/357-547---------------------------------------------------------------------...SLNR.E--

PF01068

DNLI4_SCHPO/254-462----------------------------------------------------------------------PQLANFKK.K
DNLI3_HUMAN/483-677----------------------------------------------------------------------PMLAEACK..
DNLI4_CANAL/259-494----------------------------------------------------------------------PQLSERLT.T
Q9VG84_DROME/257-451----------------------------------------------------------------------PMLASPCK..
DNLI4_HUMAN/248-451----------------------------------------------------------------------PMLAAIADIE
DNLI1_CAEEL/263-465----------------------------------------------------------------------PMLAHPTK..
Q9XAM3_STRCO/11-197----------------------------------------------------------------------PMLAKSVA..
DNLI_METJA/226-440----------------------------------------------------------------------PMLAQLTP..
DNLI_ARCFU/225-419----------------------------------------------------------------------MMLAQVAE..
DNLI_PYRFU/224-422----------------------------------------------------------------------PMLAQQAA..
DNLI_AQUAE/225-424----------------------------------------------------------------------PMLAERMS..
DNLI_PYRAE/226-424----------------------------------------------------------------------PMLAQRLS..
DNLI_AERPE/239-439----------------------------------------------------------------------PMLAERGR..
DNLI1_YEAST/393-598----------------------------------------------------------------------PMLAKPTK..
DNLI1_SCHPO/390-595----------------------------------------------------------------------PMLAKPTK..
DNLI1_HUMAN/542-746----------------------------------------------------------------------PMLAHPTR..
DNLI1_DROME/369-573----------------------------------------------------------------------PMLAQPTK..
DNLI1_ARATH/418-622----------------------------------------------------------------------PMLAKPTK..
DNLI_FOWPN/211-405----------------------------------------------------------------------PMLASACK..
DNLI_BPT7/8-240----------------------------------------------------------------------PFKAVSFVES
DNLI_ASFB7/126-318----------------------------------------------------------------------PMLVKYFN..
DNLI_BPT4/135-367----------------------------------------------------------------------QMLASSYD..
DNLI4_YEAST/256-466----------------------------------------------------------------------PQLAKKVN.L
Q9VYA5_DROME/258-461----------------------------------------------------------------------PMLCERFP.G
LIGD_BACSU/13-208----------------------------------------------------------------------PPI.......
O28549_ARCFU/10-196----------------------------------------------------------------------PMLAVRSK..
F4B718_ACIHW/236-436----------------------------------------------------------------------PMLAERLS..
LIGC_MYCTU/11-201----------------------------------------------------------------------PMLAKSVT..
DNLI_VACCW/206-399----------------------------------------------------------------------PMLAESCD..
DNLI_MYCTU/186-380----------------------------------------------------------------------PMLAQTAT..
DNLI_METTH/227-425----------------------------------------------------------------------PMLAQLAS..
Q9Q8U5_RFVKA/212-406----------------------------------------------------------------------PMLADICR..

PF09414

Q6T434_TRYCR/74-303--------------------------------------------------------------------------------
Q86QW3_LEITA/98-325--------------------------------------------------------------------------------
Q4DAH8_TRYCC/50-271--------------------------------------------------------------------------------
Q86QW4_LEITA/51-272--------------------------------------------------------------------------------
A6GCV5_9DELT/26-233--------------------------------------------------------------------------------
A1ZC58_9BACT/31-233--------------------------------------------------------------------------------
Q06EF1_BPR32/28-227--------------------------------------------------------------------------------
Q7Y4V8_BPR69/28-225--------------------------------------------------------------------------------
Q5QBW9_9CAUD/28-227--------------------------------------------------------------------------------
Q56BF0_9CAUD/28-233--------------------------------------------------------------------------------
Q6WI19_BPKVM/27-222--------------------------------------------------------------------------------
C3IWF6_BACTU/25-179--------------------------------------------------------------------------------
A3IEU7_9BACI/35-189--------------------------------------------------------------------------------
Q857R9_9CAUD/188-418--------------------------------------------------------------------------------
Q854A4_BPMOM/187-423--------------------------------------------------------------------------------
Q5YSN8_NOCFA/190-399--------------------------------------------------------------------------------
Q6MVA4_NEUCS/200-398--------------------------------------------------------------------------------
Q54EG7_DICDI/247-425--------------------------------------------------------------------------------
Q56EF5_9CAUD/169-356--------------------------------------------------------------------------------
Q9RZM9_DEIRA/158-328--------------------------------------------------------------------------------
Q2S6U3_HAHCH/186-380--------------------------------------------------------------------------------
Q828Q7_STRAW/158-341--------------------------------------------------------------------------------

PF01653

DNLJ_HAEIN/2-319TNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVG.AKPLSGFSQIRHEIPML
DNLJ_MYCPN/1-307MAKVAQIRAIVEQLKRYDYHYYVLDDPLVSDFEYDQLYKQLQALEQAHPELIQPDSPTQRVGGIVVEA.FNKFPHQNPML
DNLJ_ECOLI/2-318ESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVG.AAPLAAFSQIRHEVPML
DNLJ_MYCLE/11-328PEVLQQWRKLTEEVREHQFRYYVRDAPIISDAEFDALLDRLTVLEEQHPELCTPDSPTQLVGGAGFMTDFVATEHLERMF
DNLJ_AQUAE/30-348EEAKKLAEDLREVIRYHDYKYYVEANPVIPDYDYDRLFRALKEIEKKYPELITPDSPTQRV.ASEISGEFPTVKHYTPML
DNLJ_HELPY/2-310IKSQKEYLERIAYLNTLSHHYYNLDEPIVSDAIYDELYQELKAYEEKNPNGIQANSPTQKVG.ATTTNSFNKNPHLMRMW
DNLJ_BORBU/3-309SKVQQEIADLKKLIRKWDKEYYVDSLPSVEDFVYDKHILRLQELESKYPEYKTLDSPTLKFG.SDLLNDFKEVEHSAPIL
DNLJ_BACSU/4-314ETAKQRAEELRRTINKYSYEYYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVGGAVLEA.FQKVTHGTPML
DNLJ_SYNY3/1-317MTTPDRLLQLRQQLQKASYAYYVLDAPVMEDSVYDQLYRELQRLEAENPELITPDSPTQRV.GEQPASQFRSVAHNIPLY
DNLJ_ZYMMO/29-346EQAVIELERLAKLISHYDHLYHDKDNPAVPDSEYDALVLRNRRIEQFFPDLIRPDSPSKKVG.SRPNSRLPKIAHRAAML
D0MI04_RHOM4/37-360.EAEALAARLREVLNQHAYRYYVLDNPLIPDADYDLLMQALRKLEARFPELVTPDSPTQRVG.GPPLGRFEKVRHPEPLL
DNLJ_THET8/5-322.EARKRVNELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPELKSPDSPTLQVGARPLEATFRPVRHPTRMY

PF01331

Q9S9L3_ARATH/297-492ALQLLRQRY--------------------------YYATWKADGTRYMMLLT--RD.......GCYLVNREYRFRRV---
MCE_PBCV1/60-236DFEKLKQNK--------------------------YVVSEKTDGIRFMMFFT--RVFG...FKVCTIIDRAMTVYLL---
MCE1_YEAST/47-249VEEKLLAHD--------------------------YYVCEKTDGLRVLMFIV--INPVT.GEQGCFMIDRENNYYLV---
Q9VY44_DROME/307-497NIKRLSEIP--------------------------YRVSWKADGTRYMMLID--GRD.....E.VYFFDRNHSCFQV---
MCE1_CAEEL/289-479NINLLEQES--------------------------YMVSWKADGMRYIIYIN--DG.......DVYAFDRDNEVFEI---
MCE1_HUMAN/272-460NIKLLDLKP--------------------------YKVSWKADGTRYMMLID--GTN.....E.VFMIDRDNSVFHV---
MCE1_SCHPO/45-242HLQALKEKN--------------------------YFVCEKSDGIRCLLYMT--EHPRYENRPSVYLFDRKMNFYHV---
F4IYM6_ARATH/357-547NLQLLRQRY--------------------------YYATWKADGTRYMMLLT--TD.......GCYIVDRSFRFRRV---

PF01068

DNLI4_SCHPO/254-462DLHQTLEAM........----..........GNKPFWIEEKLDGER..IQLH..M.SS----GKFQFYSRNARSYTYAYG
DNLI3_HUMAN/483-677SVEYAMKKC........----..........PNGMF.SEIKYDGER..VQVH..K.NG----DHFSYFSRSLKPVLP...
DNLI4_CANAL/259-494SYKTLVKKLQRKHEMDP----PYEKKFQELGLENKFYIEEKMDGDR..MLLH..K.DG----DSFKFFSRRLKDYSYLYG
Q9VG84_DROME/257-451SVEDAFKKS........----...........PTGLYSEIKYDGER..VQIH..K.QG----NDFKFFSRNLKPVVD...
DNLI4_HUMAN/248-451HIEKDMKH.........----............QSFYIETKLDGER..MQMH..K.DG----DVYKYFSRNGYNYTDQFG
DNLI1_CAEEL/263-465GIDEIMRRF........----..........RNQTMTCEWKYDGER..GQIH..KRED----GQIFIYSRNQENNTT...
Q9XAM3_STRCO/11-197KI...............----...........PPGMHYEAKWDGFR..AIVY..R.DG----DEVELGSRTGKPLTR...
DNLI_METJA/226-440SIEEALLEM........----...........GRAQ.FETKYDGAR..VQIH..K.DG----NKVKIYSRRLEDVTN...
DNLI_ARCFU/225-419SLESAVREM........----...........RTAA.VEWKFDGSR..VQVH..W.DG----SRVTIYSRRLENVTN...
DNLI_PYRFU/224-422SIRDALLEM........----..........GGEAE.FEIKYDGAR..VQVH..K.DG----SKIIVYSRRLENVTR...
DNLI_AQUAE/225-424SPILILRKL........----..........GGKCG.AEYKYDGER..IQAH..R.KG----DEFYLFSRRLENITH...
DNLI_PYRAE/226-424SASEILAKL........----..........GGSAI.CEYKYDGER..AQIH..L.TP----GGVKIFSRRLEDITH...
DNLI_AERPE/239-439DPAEILRKV........----..........GGRAV.VEYKYDGER..AQIH..K.KD----GEVYIYSRRLENITR...
DNLI1_YEAST/393-598AINEVLDRF........----..........QGETFTSEYKYDGER..AQVH..LLND----GTMRIYSRNGENMTE...
DNLI1_SCHPO/390-595QISEVLNTF........----..........DQAAFTCEYKYDGER..AQVH..FTED----GKFYVFSRNSENMSV...
DNLI1_HUMAN/542-746GISEVLKRF........----..........EEAAFTCEYKYDGQR..AQIH..ALEG----GEVKIFSRNQEDNTG...
DNLI1_DROME/369-573GVHEVFERF........----..........GGMQITCEWKYDGER..AQIH..RNEK----GEISIFSRNSENNTA...
DNLI1_ARATH/418-622GVAEILNKF........----..........QDIVFTCEYKYDGER..AQIH..FMED----GTFEIYSRNAERNTG...
DNLI_FOWPN/211-405TFSEAVKKC........----..........PNGII.VEFKYDGER..IQIH..K.HD----KNFKYFSRSLKPITP...
DNLI_BPT7/8-240AIKKALDN.........----...........AGYLIAEIKYDGVRGNICVD....NT----ANSYWLSRVSKTIPALEH
DNLI_ASFB7/126-318IIPKTFFEE........----...........ETDPIVQRKRNGVRAVACQQ....GD----GCILLYSRTEKEFLG...
DNLI_BPT4/135-367..EKGINKN........----..........IKFPAFAQLKADGARCFAEVR..GDEL----DDVRLLSRAGNEYLGL..
DNLI4_YEAST/256-466SYEKICRTL........----..........H.DDFLVEEKMDGER..IQVHYMN.YG----ESIKFFSRRGIDYTYLYG
Q9VYA5_DROME/258-461DIQEL...M........----..........QSDVLYLETKMDGER..FQLH..I.DR----GRFMYISRNGVDYTRNFG
LIGD_BACSU/13-208.................----...........GAEWRYEVKYDGYRCILRIH.....S----SGVTLTSRNGVELSS...
O28549_ARCFU/10-196P.......F........----..........SSDDHIYEVKWDGTRCLAFVD..V.EG----KRVRLQNRRLLDITY...
F4B718_ACIHW/236-436DPAEMLSKV........----...........GNLALVDYKYDGER..GQIH..K.AG----DKIFIFSRRLENITN...
LIGC_MYCTU/11-201AI...............----...........PPDASYEPKWDGFR..SICF..R.DG----DQVELGSRNERPMTR...
DNLI_VACCW/206-399SVNKAFKKF........----...........PSGMFAEVKYDGER..VQVH..K.NN----NEFAFFSRNMKPVLS...
DNLI_MYCTU/186-380SVHDALERH........----...........GGTTIFEAKLDGAR..VQIH..R.AN----DQVRIYTRSLDDVTA...
DNLI_METTH/227-425SIESAITEL........----...........GRAF.CETKYDGIR..VQIH..R.CG----DEISIFTRRLENITA...
Q9Q8U5_RFVKA/212-406SVSTIVNKY........----...........KRGIYAEIKYDGER..VQIH..K.YD----DVYEFYSRNLRPVTP...

PF09414

Q6T434_TRYCR/74-303---------------------------------QDWVACEKVHGTNFSIYLINLGD......KEVVRFAKRSGIM....D
Q86QW3_LEITA/98-325---------------------------------QEWVACEKVHGTNFAIYLINENE.........VRFAKRSGIM....D
Q4DAH8_TRYCC/50-271---------------------------------DEWIATEKVHGANFGIYSIEGEK........TIRYAKRSGIM....H
Q86QW4_LEITA/51-272---------------------------------DEWIATEKVHGANFGIYSTEHGK........IIQYAKRSGIM....P
A6GCV5_9DELT/26-233---------------------------------SDWVATEKIHGAQLVLGCDGRS..........VEVGKRKAWL....A
A1ZC58_9BACT/31-233---------------------------------TDWVVTEKIHGANFCVLSNGEE..........TQFAKRKAVL....D
Q06EF1_BPR32/28-227---------------------------------GEWVAREKIHGTNFSLII.ERDK.........ATCAKRTGPI....L
Q7Y4V8_BPR69/28-225---------------------------------GVWVAREKIHGTNFSLII.ERDN.........VTCAKRTGPI....L
Q5QBW9_9CAUD/28-227---------------------------------GEWVAREKIHGTNFSLII.ERDA.........VTCAKRTGPI....L
Q56BF0_9CAUD/28-233---------------------------------GVWVAREKIHGANFSLITSDGER.........VIPAKRSGEI....L
Q6WI19_BPKVM/27-222---------------------------------REWVALEKIHGANFSFIVEFKPNEAQDGAEFTVTPAKRTSTIGANVM
C3IWF6_BACTU/25-179---------------------------------QEVIVLEKLDGENTSLY..............................
A3IEU7_9BACI/35-189---------------------------------KEVVVTEKLDGEGTTLY..............................
Q857R9_9CAUD/188-418---------------------------------REVIVTQKLHGTSIRVGNVPVLRQKKWLERLVNRWVKTPD.......
Q854A4_BPMOM/187-423---------------------------------REIVITQKLHGTSIRVGRVPCLRQKGRLERFLNRWLPTPD.......
Q5YSN8_NOCFA/190-399---------------------------------ARVVITQKLHGTSIRIGNTIARRQPTWRDKLAARLLRVPV.......
Q6MVA4_NEUCS/200-398---------------------------------RIYQVTEKLDGVTMHVYKVSNQSPDLLAYFPALKPTAGSIPI....P
Q54EG7_DICDI/247-425---------------------------------LLWEVTEKLEGSSITVF..............................
Q56EF5_9CAUD/169-356---------------------------------VKFAKSLKLDGSSITMAWVTD.........PELFLDLGTEEEPYAHD
Q9RZM9_DEIRA/158-328---------------------------------EEVMVTEKLHGT.QGVYFRTAEG..........RWLVTSK.......
Q2S6U3_HAHCH/186-380---------------------------------EEVVFTEKLHGTFTGVAILPEKDAHQEAFGVKRNVLIFSK.......
Q828Q7_STRAW/158-341---------------------------------EPVVLTEKLHGTACLVTYLADED..........RVHVSSK.......

PF01653

DNLJ_HAEIN/2-319SLDNAFSDAEFNAFVKR....IEDRLILLPKP.LTFCCEPKLDGLAVSILYV---------NGELTQAATRGDGTTGEDI
DNLJ_MYCPN/1-307SLDNAFDTATIASFIAN....INNLTGVQNR....FVVEPKIDGVSISLTYE---------NGLLTRALTRGDGLVGEDV
DNLJ_ECOLI/2-318SLDNVFDEESFLAFNKR....VQDRLKNNEK..VTWCCELKLDGLAVSILYE---------NGVLVSAATRGDGTTGEDI
DNLJ_MYCLE/11-328SLDNAFSGDELNAWVTR....IRAEIGNDAH....YLCELKIDGVALSLVYR---------DGRLTRATTRGDGRTGEDV
DNLJ_AQUAE/30-348SLDNAYSEDELREFDRR....VRQITGLEV...VEYAVEPKLDGAGIALVYE---------NDLFVRGATRGDGEYGEDI
DNLJ_HELPY/2-310SLDDVFNQSELQAWLQR....ILKAYPSAS.....FVCSPKLDGVSLNLLYQ---------HGKLVKATTRGNGLEGELV
DNLJ_BORBU/3-309SLDKVYDLDLLKSWIDK.....ID.FNNSFN....ISVEPKIDGCSIVLYYK---------DGVLEKALTRGNGKFGNDV
DNLJ_BACSU/4-314SLGNAFNADDLRDFDRR....VRQSVGDDV....AYNVELKIDGLAVSLRYE---------DGYFVRGATRGDGTTGEDI
DNLJ_SYNY3/1-317SLENAFNVQELQQWQER....WQRIAPTIEK..AEYVCELKIDGSAIALTYE---------NGLLVRGVTRGDGTTGEEI
DNLJ_ZYMMO/29-346SLDNGFLDQDVEDFLGR....VRRFFNLKENQAVICTVEPKIDGLSCSLRYE---------KGILTQAVTRGDGVIGEDV
D0MI04_RHOM4/37-360SLNNAFGEEDVRVWYERCCRMLAERLGQPVQ..PAVTAELKIDGLAMALTYE---------NGVLTVGATRGDGIEGENV
DNLJ_THET8/5-322SLDNAFNLDELKAFEER....IERALGRKGP..FAYTVEHKVDGLSVNLYYE---------EGVLVYGATRGDGEVGEEV

PF01331

Q9S9L3_ARATH/297-492--Q.MRFPCE-----------------Y..EPS..DYKVHHY-TLLDGEMVV-------------DTIK-----------
MCE_PBCV1/60-236--PFKNIPRV-----------------L...........FQG-SIFDGELCV-------------DIVE-----------
MCE1_YEAST/47-249--NGFRFPRL-----------------PQKKKEELLETLQDG-TLLDGELVI-------------QTNP-----------
Q9VY44_DROME/307-497--ENVTFVES-----------------RN......LNEHLDG-TLVDGEMVL-------------DKIG-----------
MCE1_CAEEL/289-479--ENLDFVTK-----------------N.GAP.......LME-TLVDTEVII-------------DKVE-----------
MCE1_HUMAN/272-460--SNLEFPFR-----------------KD......LRMHLSN-TLLDGEMII-------------DRVN-----------
MCE1_SCHPO/45-242--EKIFYPVE-----------------NDKSG....KKYHVD-TLLDGELVL-------------DIYP-----------
F4IYM6_ARATH/357-547--Q.MRFPFR-----------------HPTEGI..SDKVHHF-TLLDGEMII-------------DTLP-----------

PF01068

DNLI4_SCHPO/254-462SSYFDEQSRL-----------------TQYIIGAFDKRISQ..IILDGEMVT..WDPVLETVIPYGSLR-----------
DNLI3_HUMAN/483-677.....HKVAH-----------------FKDYIPQAFPGGHS..MILDSEVLL..IDNKTGKPLPFGTLG-----------
DNLI4_CANAL/259-494..ESFQFGAL-----------------TKFLAHAFAGNIQS..VILDGEMVA..YDYERNVILPFGTLK-----------
Q9VG84_DROME/257-451.....HKIRA-----------------LKKYIPQAFPGGGE..MILDSEIIL..VDTDTGALLPFGSLG-----------
DNLI4_HUMAN/248-451..ASPTEGSL-----------------TPFIHNAFKADIQI..CILDGEMMA..YNPNTQTFMQKGTKF-----------
DNLI1_CAEEL/263-465.....KYPDI-----------------IEKISSCIGDGVTS..FIVDAEVVA..IDEA.GLILPFQVLS-----------
Q9XAM3_STRCO/11-197.....YFPEL-----------------VVAVRERLPER.....CVVDGEIVI.....ARDGHLDFDALT-----------
DNLI_METJA/226-440.....ALPEI-----------------VEAVKNINVD...K..LIVEGECVA..IDKQTGKPRPFQDIL-----------
DNLI_ARCFU/225-419.....ALPDI-----------------VEEIKKSVKP...G..VILDGEVIA..V.KE.GKPMPFQHVL-----------
DNLI_PYRFU/224-422.....AIPEI-----------------VEALKEAIIPE..K..AIVEGELVA..I.GENGRPLPFQYVL-----------
DNLI_AQUAE/225-424.....QYPDL-----------------IEFLKEAI.PH..D..FIVELEAVV..IDPASGEIRPFQELM-----------
DNLI_PYRAE/226-424.....AYPDV-----------------VKAVKEAVSAK..E..AILEGEIVA..VDPDTGDMLPFQELM-----------
DNLI_AERPE/239-439.....MFPDV-----------------VEMARKGLKAG..E..AIVEGEIVA..VDPDNYEIQPFQVLM-----------
DNLI1_YEAST/393-598.....RYPEI-----------------NITDFIQDLDTTKN..LILDCEAVA..WDKDQGKILPFQVLS-----------
DNLI1_SCHPO/390-595.....RYPDI-----------------SVSVSKWKKPDARS..FILDCEAVG..WDRDENKILPFQKLA-----------
DNLI1_HUMAN/542-746.....KYPDI-----------------ISRIPKIKLPSVTS..FILDTEAVA..WDREKKQIQPFQVLT-----------
DNLI1_DROME/369-573.....KYPDL-----------------IARSTALLKGDVKS..YIIDSEIVA..WDVERKQILPFQVLS-----------
DNLI1_ARATH/418-622.....KYPDV-----------------ALALSRLKKPSVKS..FILDCEVVA..FDREKKKILPFQILS-----------
DNLI_FOWPN/211-405.....HKVTD-----------------FEELLDRAFPSAKN..MILDGEIIL..IDTETNQPLPFGTLG-----------
DNLI_BPT7/8-240LNGFDVRWKR-----------------LLNDDRCFYKDG....FMLDGELMVKGVDFNTGSGLLRTKWT-----------
DNLI_ASFB7/126-318......LDNI-----------------KKELKQLYLFIDVR..VYLDGELYL........HRKPLQWIA-----------
DNLI_BPT4/135-367...DLLKEEL-----------------IKMTAEARQIHPEG..VLIDGELVYHEQVKKEPEGLDFLFDA-----------
DNLI4_YEAST/256-466..ASLSSGTI-----------------SQHL..RFTDSVKE..CVLDGEMVT..FDAKRRVILPFGL..-----------
Q9VYA5_DROME/258-461..HSYDHGTL-----------------TPKLRGLLPLGLES..IILDGEMMV..WDTNKLRFREKGENT-----------
LIGD_BACSU/13-208.....TFPEI-----------------TQFAKTAFQHLEKELPLTLDGEIVC..LVNPCRADFEHLQVR-----------
O28549_ARCFU/10-196.....RYPEI-----------------.....KLLDAVERN..AILDGEVVV..I.KDGKPSFPLLQKR-----------
F4B718_ACIHW/236-436.....QYPDV-----------------AEYISKYVKGN..E..FIVEGEIIP..VDPETGEMRPFQELM-----------
LIGC_MYCTU/11-201.....YFPEL-----------------VAAIRAELPHR.....CVIDGEIII.....ATDHGLDFEALQ-----------
DNLI_VACCW/206-399.....HKVDY-----------------LKEYIPKAFKKATS..IVLDSEIVL..VDEH.NVPLPFGSLG-----------
DNLI_MYCTU/186-380.....RLPEV-----------------VEATLALPV...RD..LVADGEAIA..LCPD.NRPQRFQVTA-----------
DNLI_METTH/227-425.....AVPEI-----------------LEGVEEALPAD..D..YIVEGEIIV....TMDGRPASFQYIL-----------
Q9Q8U5_RFVKA/212-406.....HKVQG-----------------LDEALSIAFPSANN..FILDAELVL..VDEHTGECLPFGSLG-----------

PF09414

Q6T434_TRYCR/74-303PNENFFGYHI.................LIDEFTAQIRILSDLLK..QKYGL.....GRIGRVVLNGELFGAKYKH.....
Q86QW3_LEITA/98-325PNEHFFGYHL.................LIDDFTAQVRALCALLK..RKYGVT....GRMGRVVLHGELFGAKYKH.....
Q4DAH8_TRYCC/50-271PTEHFFGYHM.................LVPQLQQYITVTREMLC..DKLQK......KLHTVLINGELFGGKYDH.....
Q86QW4_LEITA/51-272PHEHFFGYHV.................LIPDLARYIKQGRELLT..EQLGV......SPTTVIMNGELFGGKYDH.....
A6GCV5_9DELT/26-233DDEPFFGWQL.................LRGALERAALDAFAFLR......ASAVTDYAPATVYVYGELFGGAYPH.....
A1ZC58_9BACT/31-233EEENFFGYHS.................LRNHLTAQVAQVFAELKRQHADTVA.........VAVYGELFGGAYPH.....
Q06EF1_BPR32/28-227PAEDFFGYEI.................ILKNYKDSIKAVQDIME..TSAVVS.........YQVFGEFAG..........
Q7Y4V8_BPR69/28-225PAEDFYGYEI.................VLKKYDKAIKTVQKFMY..TARAVS.........YQVFGEFAG..........
Q5QBW9_9CAUD/28-227PAEDFYGYEI.................VLKNYADSIKSVQHLIE..SINYQS.........YQIYGELAG..........
Q56BF0_9CAUD/28-233PTEQFYGCEP.................VVARYAPAIRKLWDVIN..TAQQVSGIYV.DSLVIQVYGEFAG..........
Q6WI19_BPKVM/27-222GDYDFYGCTS.................VVEAHTAKMEAISNWLW..ARGIIN.....VGETIIVYGELAG..........
C3IWF6_BACTU/25-179...........................KDAIHARSLSSGHHPSRTWVKTLQGSMGYRIPEGWRICGENVYAC........
A3IEU7_9BACI/35-189...........................KDYMHARSIHSANHPSRHWVKTFHASFSYQIPDSWRLCGENMYAK........
Q857R9_9CAUD/188-418.......YEFDVVYGSRKVIKDVNNP.NQNHYYQSDIWTEYGKK..IA.......ALIPEGFIVYGELIGWTP..DG...
Q854A4_BPMOM/187-423.......YTYDAVFGSRKVIKDVNNP.NQNHYYQSDIWTDYGKK..IA.......DLIPEGYIVYGELIGWTPVKDGMQF
Q5YSN8_NOCFA/190-399.....SQYDYDTVYGSRKVIKD.PKV.QQNHFYGTDVWTYYGQR..LD.......GLIPQGFVVYGELIGWTP..DG...
Q6MVA4_NEUCS/200-398PTMQTPRGRVGVCNRKHEFFDD.....GKNIYWETAKTSGILDK..IH.......KIPYRNIAIQGELVG..........
Q54EG7_DICDI/247-425K....KGKESGVCSRNF.LIE...DFQGSDIHQAVIEDLDLLNR..LS.......T.IDLNIALQGEILG..........
Q56EF5_9CAUD/169-356Y....DDAQFIVASRNQVLRY...N..ADSKWWKGVENYQIVDR..LK.......E.LGMSVAIQGELMG..........
Q9RZM9_DEIRA/158-328..........GLSRGGLTLRE...A..ASNVYWQA......ARN..SNLFAEADAAFSGGEVQIFGEVV...........
Q2S6U3_HAHCH/186-380..........GLGAKGLVLANTDGN..SANVYVRATTGM.VAVI..DALLASGELRVEDEPLFILGETFG..........
Q828Q7_STRAW/158-341..........GFGAKSLALKE...D..PRNLYWRAVHGHGVAQA..AARLAE...RLGARRVGIFGEVYG..........

PF01653

DNLJ_HAEIN/2-319TANIRTIRNV-----------------PLQLLTDN....PPARLEVRGEVFMPHAGFERLNKYALEHNE-----------
DNLJ_MYCPN/1-307LSNVKTIKSI-----------------PLTIPFH.......KQVEIRGEIFVDKKTFAQIN....ENLA-----------
DNLJ_ECOLI/2-318TSNVRTIRAI-----------------PLKLHGEN....IPARLEVRGEVFLPQAGFEKINEDARRTGG-----------
DNLJ_MYCLE/11-328TLNARTIEDV-----------------PERLTVSDI.YPLPEVLEVRGEVFFRVVDFQALNTSLVEEGK-----------
DNLJ_AQUAE/30-348TNNLKTIKTI-----------------PLKAEFSR...FGIKLAEIRGEVVIRKDEFQKLNKERMEEGL-----------
DNLJ_HELPY/2-310SANAKHIANI-----------------PHAIAYN.......GEIEIRGEVIISKKDFDALNQERLNANE-----------
DNLJ_BORBU/3-309TINVRTIRYI-----------------PLFLDEK.......VDLVLRGEVYITKENFLKIN....KFLE-----------
DNLJ_BACSU/4-314TENLKTIRNI-----------------PLKMNR.......ELSIEVRGEAYMPKRSFEALNEERIKNEE-----------
DNLJ_SYNY3/1-317SQNIKTIRSI-----------------PVKLNLDN....PPPTVEVRGEAFLPLEEFNRINHEREAQGE-----------
DNLJ_ZYMMO/29-346TPNVRVIDDI-----------------PKTLKGDN....WPEIIEIRGEVYMAKSDFAALNARQTEENK-----------
D0MI04_RHOM4/37-360TQNVRTIPAI-----------------PLRIPVDPAVGPPPTRLEVRGEVYMRKRDFERLNEQLQARGE-----------
DNLJ_THET8/5-322TQNLLTIPTI-----------------PRRLKGV......PERLEVRGEVYMPIEAFLRLNEELEERGE-----------

PF01331

Q9S9L3_ARATH/297-492---EGETQRHV----------------------------RRYLVYDLVAI---------NGQF-V-------AERPFS.E
MCE_PBCV1/60-236---K......K----------------------------FAFVLFDAVVV---------SGVT-V-------SQMDLA.S
MCE1_YEAST/47-249---MT..KLQE----------------------------LRYLMFDCLAI---------NGRC-L-------TQSPTS.S
Q9VY44_DROME/307-497---E...T.VT----------------------------PRYLIYDIVRL---------SNRD-V-------RDEPFYPN
MCE1_CAEEL/289-479---INGAMCDQ----------------------------PRMLIYDIMRF---------NSVN-V-------MKEPFY.K
MCE1_HUMAN/272-460---G...Q.AV----------------------------PRYLIYDIIKF---------NSQP-V-------GDCDFN.V
MCE1_SCHPO/45-242---G...GKKQ----------------------------LRYLVFDCLAC---------DGIV-Y-------MSRLLD.K
F4IYM6_ARATH/357-547---DK..QKQE----------------------------RRYLIYDMVAI---------NGQS-V-------VERPFY.E

PF01068

DNLI4_SCHPO/254-462---SIFEDSSS......................H.SSYSPYYVVFDILYL.........NGKS.L.......VKYSLE-S
DNLI3_HUMAN/483-677---VHK.KAAF..........Q..............DANVCLFVFDCIYF.........NDVS.L.......MDRPLC-E
DNLI4_CANAL/259-494---SSAIQESVRQF...TTIDQ........YEQQ..TAYPFFLVFDILFL.........NGKD.L.......TNYPLF-F
Q9VG84_DROME/257-451---AHK.KQTF..........A..............NAAVCLFVFDCILY.........DGED.L.......TQLPFR-K
DNLI4_HUMAN/248-451---DI..KRMV..........E........DSDL....QTCYCVFDVLMV.........NNKK.L.......GHETLR-K
DNLI1_CAEEL/263-465---TRK.RKNA.........TD........DNGV....KVVVFLFDLLYF.........NGEP.L.......VRKPLR-K
Q9XAM3_STRCO/11-197---ERIHPADS..........R........VRTLAERTPASLVAFDLLAL.........DDAS.L.......LDVGLA-D
DNLI_METJA/226-440---RRF.RRKY..........D........IGKMMKEINLRVYLFDILYK.........DGVS.F.......IDEEFE-K
DNLI_ARCFU/225-419---RRF.RRKH..........D........VAKMVEKIPLEAHFFDILYH.........DGEC.........IDLPLR-E
DNLI_PYRFU/224-422---RRF.RRKH..........N........IEEMMEKIPLELNLFDVLYV.........DGQS.L.......IDTKFI-D
DNLI_AQUAE/225-424---HR..KVKY..........V........TKYHITKYPVAGFLFDIIYL.........DGED.L.......TLKPYP-E
DNLI_PYRAE/226-424---HR..KRKH..........D........VATAVELYPTVLYLFDVLYV.........DGED.L.......TEEPLI-Y
DNLI_AERPE/239-439---QR..KRKH..........D........IHRVMREVPVAVFLFDALYV.........DGED.L.......TSKPLP-E
DNLI1_YEAST/393-598---TRK.RKDV..........E........LNDV..KVKVCLFAFDILCY.........NDER.L.......INKSLK-E
DNLI1_SCHPO/390-595---TRK.RKDV..........K........IGDI..KVRACLFAFDILYL.........NGQP.L.......LETPLN-E
DNLI1_HUMAN/542-746---TRK.RKEV..........D........ASEI..QVQVCLYAFDLIYL.........NGES.L.......VREPLS-R
DNLI1_DROME/369-573---TRK.RKNV..........D........IEEI..KVQVCVYIFDLLYI.........NGTA.L.......VTKNLS-E
DNLI1_ARATH/418-622---TRA.RKNV..........N........VNDI..KVGVCIFAFDMLYL.........NGQQ.L.......IQENLK-I
DNLI_FOWPN/211-405---INK.KSMY..........H..............NACVCIFIFDCLYF.........NDTV.L.......IDKPLI-E
DNLI_BPT7/8-240---DTKNQEFHEELFVEPIRKKD......KVPFKLHTGHLHIKLYAILPLHIVESGEDCDVMTLL.......MQEHVK-N
DNLI_ASFB7/126-318---GQANAKTD.........................SSELHFYVFDCFWS.........DQ...........LQMPSN-K
DNLI_BPT4/135-367---YPENSKAKEFAEVAESRTASNGIANKSLKGTISEKEAQCMKFQVW...........DYVPLVEIYSLPAFRLKYD-V
DNLI4_YEAST/256-466---.V..KGSAKEAL..SFNSI........NNVD...FHPLYMVFDLLYL.........NGTS.L.......TPLPLH-Q
Q9VYA5_DROME/258-461---DV..KSLK..........P........EGSWQPC....FVVYDLLYF.........NGQS.L.......LDHTYI-Q
LIGD_BACSU/13-208---GRLKRPDK...................IQESANARPCCFLAFDLLER.........SGED.V.......TLLSYL-D
O28549_ARCFU/10-196---EHV.DSRF..........K........IEILSKTIPAVYIVFDVLYC.........DG.W.V.......VDLELM-E
F4B718_ACIHW/236-436---HRK..RKS..........D........IHEAIKEYPVNVFLFDLMYY.........EGED.Y.......TVKPLS-E
LIGC_MYCTU/11-201---QRIHPAES..........R........VRMLADRTPASFIAFDLLAL.........GDDD.Y.......TGRPFS-E
DNLI_VACCW/206-399---IHK.KKEY......................K..NSNMCLFVFDCLYF.........DGFD.M.......TDIPLY-E
DNLI_MYCTU/186-380---SRF.GRSV..........D........VAAARATQPLSVFFFDILHR.........DGTD.L.......LEAPTT-E
DNLI_METTH/227-425---QRV.RRKY..........D........VERLTREVPLSLFLFDVLYH.........RE.P.L.......IDEPLR-H
Q9Q8U5_RFVKA/212-406---VHK.KASF......................K..SSTPCLFVFDCLFY.........NDKS.L.......LRVPFV-Q

PF09414

Q6T434_TRYCR/74-303...PLVPPSEKWCTMPNGKRFPIAGVQIQREAFPQYSPELHFFAFDIKYS---------VSGA-EEDFV....LLGYD-E
Q86QW3_LEITA/98-325...PLVPTSKKWCTLPNKKRIPISGVEIQSEPFPQYSPELHFFAFDVKYS---------VSGA-EEDVV....LLPFD-D
Q4DAH8_TRYCC/50-271...PSLQKTRKTVMVAGKPRTISA...VQTDSFPQYSPDLHFYAFDIKYK---------ET.N-EAEYV....TLTFD-D
Q86QW4_LEITA/51-272...PSVSKRRQSVMVAGKSRTITA...VQNNAFPQYSPDLHFYAFDIKYR---------MT.E-EEEYR....TMTYD-Q
A6GCV5_9DELT/26-233...PETEALPG...............LSPVQTGIWYAPGLAFAAFDVLVC---------RGAE-PEHSDPPEPEFLSR-T
A1ZC58_9BACT/31-233...PDVTAVTG...............VQAIQTGIYYCPEVRFWVFDLVR.---------...I-TDTSS....YFVDF-D
Q06EF1_BPR32/28-227...PGIQKNVD.........................YGDKDFYVFDIIVT---------...T-ESGDV....TYVDD-Y
Q7Y4V8_BPR69/28-225...GGIQKGVD.........................YGEKDFYVFDILIN---------...T-ESGDN....TYLTD-Y
Q5QBW9_9CAUD/28-227...PGIQKNVD.........................YGDKDFYVFDIRVT---------...K-EDGTE....SVLTD-T
Q56BF0_9CAUD/28-233...RGVQKDVD.........................YGEKDFYVFDIRVN---------...G-K.........FLHD-N
Q6WI19_BPKVM/27-222...KGVQKEVN.........................YGDKDFWAYDILLP---------....-..ETG....KFLDW-D
C3IWF6_BACTU/25-179...HSIHYTAL...........................TSYFYVFSIWN.---------....-..EKN....ECLSW-D
A3IEU7_9BACI/35-189...HTIYYQAL...........................TSYFYLFSIWN.---------....-..EDN....ICLSW-D
Q857R9_9CAUD/188-418..QPIQKGYTY................DVPRG......EAHLYVYRVAHI---------..NN-QGHL.....SDLSW-N
Q854A4_BPMOM/187-423DTSPIQKNYTY................NLPEG......QAELYVYRVATI---------..NT-QGTL.....ADLPW-D
Q5YSN8_NOCFA/190-399..RPIQPGYTY................NVPEG......DAHLYVYRVAHV---------..NP-QGVI.....TDLAW-G
Q6MVA4_NEUCS/200-398...SHIQGNTM................QYPEG......KHEFVVFGIWDM---------..DA-R........DYLAT-K
Q54EG7_DICDI/247-425...PKIQGNIY................QL..R......KNYFKIFDIFLI---------..DS-Q........RYATH-D
Q56EF5_9CAUD/169-356...PGIQKNRE................NF..D......KYRIFAFRAWFI---------..DE-Q........RFATD-E
Q9RZM9_DEIRA/158-328...PVQKGFSY................GQ..H......KPTVFVFKVVYD---------..G.-L........RLPRR-D
Q2S6U3_HAHCH/186-380...PGVQDLAY................GK..D.....LGFRLFALASGYR---------..GA-Q........RYHDF-D
Q828Q7_STRAW/158-341...AGVQDLTY................GA..DGRRDTLGYAVFDVSADID---------..GE-V........RW..L-D

PF01653

DNLJ_HAEIN/2-319---KTFANPRN----------AAAGSLRQLDPNITSKRPLVLNAYGIGI.---------.AEG---------VDLP.T-T
DNLJ_MYCPN/1-307---KPFANARN----------LAAGTLRNLNSEVSAKRKLKAFFYFVP..---------..NA---------LTLGCR-S
DNLJ_ECOLI/2-318---KVFANPRN----------AAAGSLRQLDPRITAKRPLTFFCYGVGV.---------.LEG---------GELP.D-T
DNLJ_MYCLE/11-328---NPFANPRN----------SAAGSLRQKDPAVTAHRKLRMICHGLGH.---------.IEG---------FRPA..-T
DNLJ_AQUAE/30-348---PPFANPRN----------AAAGSIRQKDPKEVAKRNLEAIVYHLSY.---------.VEP---------PETEPP-T
DNLJ_HELPY/2-310---PLFANPRN----------AASGSLRQLDSEITKKRKLQFIPWGVG..---------...K---------HSLNFL-S
DNLJ_BORBU/3-309---KPYTNSRN----------LASGILRRVDSREVANFPLNIFIYDFLN.---------..AG---------..LEFK-T
DNLJ_BACSU/4-314---EPFANPRN----------AAAGSLRQLDPKIAAKRNLDIFVYSIAE.---------.LDE---------..MGVE-T
DNLJ_SYNY3/1-317---SLFANPRN----------AAAGTLRQLDPKIVHQRRLQFFAYTLHL.---------.PGQ---------.EDKIQ-S
DNLJ_ZYMMO/29-346---KLFANPRN----------AAAGSLRQLDPNITARRSLRFLAHGWG..---------..EA---------TSLPAD-T
D0MI04_RHOM4/37-360---RPFANPRN----------AAAGSVRQLNPQVTALRPLSFFAYGIGP.---------.VEG---------.AEVPD-S
DNLJ_THET8/5-322---RIFKNPRN----------AAAGSLRQKDPRITAKRGLRATFYALGLG---------LEEV---------EREGVA-T

PF01331

Q9S9L3_ARATH/297-492RWNILERELIKPRNDEKKVRDHWYRYDKEPF-GVRIKAFCLLSAVEKKVFNELIPLLS----------------------
MCE_PBCV1/60-236RFFAMKRSLKEFKNVPE.........D..PA-ILRYKEWIPLEHPTIIKDHLKKANAI----------------------
MCE1_YEAST/47-249RLAHLGKEFFKPYFDLRAAYPNRCTT..FPF-KISMKHMDFSYQLVK..VAKSLDKLP----------------------
Q9VY44_DROME/307-497RLDYIKTEVIGPRILGM..KHGIINQRLQAF-SVRGKDFWDIWMSARLLGEKFSRTLA----------------------
MCE1_CAEEL/289-479RFEIIKTEIIDMRTAA..FKTGRLKHENQIM-SVRRKDFYDLEATAKLFGPKFVQHVG----------------------
MCE1_HUMAN/272-460RLQCIEREIISPRHEKM..KTGLIDKTQEPF-SVRNKPFFDICTSRKLLEGNFAKEVS----------------------
MCE1_SCHPO/45-242RLGIFAKSIQKPLDEYT..KTHMRETAIFPF-LTSLKKMELGHGILK.LFNEVIPRLR----------------------
F4IYM6_ARATH/357-547RWKMLEKEVIDPRNHEK.ARSHIYRYDLEPF-RVRRKDFWLLSAVEK.VLKGFIPSLS----------------------

PF01068

DNLI4_SCHPO/254-462RRRILEKVI................VRESHR-MSILPYKVG..STIEDIEAELRNVIQ----------------------
DNLI3_HUMAN/483-677RRKFLHDNM................VEIPNR-IMFSEMKRV..TKALDLADMITRVIQ----------------------
DNLI4_CANAL/259-494RKNILNRIL................RPIPNR-FEVLDTRLG..SSSEDIERAIREVVS----------------------
Q9VG84_DROME/257-451RREILEQNI................QPIKSH-VQLSESEFL..KTTRELAAMTARVLH----------------------
DNLI4_HUMAN/248-451RYEILSSIF................TPIPGR-IEIVQKTQA..HTKNEVIDALNEAID----------------------
DNLI1_CAEEL/263-465RRELLRTNF................KKIDGS-FYFATSVDT..NDTDEINSFFDEAVQ----------------------
Q9XAM3_STRCO/11-197RRALLVRAL..................SGVT-PPVHVAPAT..DDIEVARRWFEQYEG----------------------
DNLI_METJA/226-440RRKVLEEIVGYENDWRTERKRIEKELKSDKI-IDISYKLVT..NDAKEAREFYNWSLS----------------------
DNLI_ARCFU/225-419RRKLLESAV.................NESEK-IKLAKQIVT..DSVDEVRKMYDEAIS----------------------
DNLI_PYRFU/224-422RRRTLEEII.................KQNEK-IKVAENLIT..KKVEEAEAFYKRALE----------------------
DNLI_AQUAE/225-424RREILEKVV.................KRTDR-IGLVPRKIV..DNVEDLENFFYQAIE----------------------
DNLI_PYRAE/226-424RRVRLSEIV.................CETDK-VSIAKWRIF..DNAEAVDVFFHESVS----------------------
DNLI_AERPE/239-439RRRRLKEIV.................VETPL-WRLAESIET..SDPEELWTFFLKAIE----------------------
DNLI1_YEAST/393-598RREYLTKVT................KVVPGE-FQYATQITT..NNLDELQKFLDESVN----------------------
DNLI1_SCHPO/390-595RRKLLYSMF................QPSTGD-FTFAKHSDQ..KSIESIEEFLEESVK----------------------
DNLI1_HUMAN/542-746RRQLLRENF................VETEGE-FVFATSLDT..KDIEQIAEFLEQSVK----------------------
DNLI1_DROME/369-573RRKLLLEHF................QEVEGE-WKFATALDT..NDIDEVQQFLEESIK----------------------
DNLI1_ARATH/418-622RREKLYESF................EEDPGY-FQFATAVTS..NDIDEIQKFLDASVD----------------------
DNLI_FOWPN/211-405RRNIIHANI................KEIPNR-ILLSEVKNI..STDEELSKLLHIVLS----------------------
DNLI_BPT7/8-240MLPLLQEYF..................PEIE-WQAAESYEV..YDMVELQQLYEQKRA----------------------
DNLI_ASFB7/126-318RQQLLTNIFK..............QKEDLTF-IHQVENFSV..KNVDEALRLKAQFIK----------------------
DNLI_BPT4/135-367RFSKLEQMT.................SGYDK-VILIENQVV..NNLDEAKVIYKKYID----------------------
DNLI4_YEAST/256-466RKQYLNSIL................SPLKNI-VEIVRSSRC..YGVESIKKSLEVAIS----------------------
Q9VYA5_DROME/258-461RAYKLQKLI................VEQSGV-LQLMRARKI..GSVQEFNELFQQALD----------------------
LIGD_BACSU/13-208RKKSLRELISA...........AKLPASPDP-YAKETIQSI..PCYDHFDQLWEMVIK----------------------
O28549_ARCFU/10-196RKKILSEVL.................QSRGR-VVVEEWIEG..KG....EEFYRKAVE----------------------
F4B718_ACIHW/236-436RRKKLESIV.................EDNDY-VHIATHIIT..DNVEKLKEFFYQAIS----------------------
LIGC_MYCTU/11-201RRAALVDAVT..............GSGADAD-LSIHVTPAT..TDMATAQRWFSEFEG----------------------
DNLI_VACCW/206-399RRSFLKDVM................VEIPNR-IVFSELTNI..SNESQLTDVLDDALT----------------------
DNLI_MYCTU/186-380RLAALDALV.................PARHR-V...DRLIT..SDPTDAANFLDATLA----------------------
DNLI_METTH/227-425RREVLESIL................SEIPGR-VEASRMVDVGPDNLNDALWLFEESIR----------------------
Q9Q8U5_RFVKA/212-406RRAFVETTI................KEIKHK-IVLSDIRTI..RSESDITEALNESVE----------------------

PF09414

Q6T434_TRYCR/74-303FVEFCSKIP-----------------NLL..-..YSKALVR--GTLDACLAFDVENFH......................
Q86QW3_LEITA/98-325FTEVCAQVP-----------------NLL..-..YARSLVR--GTLDECLAFDVENFV......................
Q4DAH8_TRYCC/50-271ATELFKRVP-----------------GLL..-..YARAIIR--GPMSKVAAFDVEHFV......................
Q86QW4_LEITA/51-272ALAIFEKIP-----------------GLL..-..YARAIIR--GPLSKVVAFDVENFA......................
A6GCV5_9DELT/26-233ELEAVAEHA-----------------GLR..-..TVPVLGR--GTRRQLEALPVRYPT......................
A1ZC58_9BACT/31-233NMRETCDTV-----------------GLP..-..YVPALLV--GTFSEVQNYAIEFES......................
Q06EF1_BPR32/28-227MMESFCNTF-----------------KFK..-..MAPLLGR--GKFEELIKLPND.........................
Q7Y4V8_BPR69/28-225EMQDFCNEF-----------------GFK..-..MAPMLGR--GTFDSLIMIPND.........................
Q5QBW9_9CAUD/28-227LMEAFCIIH-----------------KFK..-..VAPCLAT--GSFEDLIKLPND.........................
Q56BF0_9CAUD/28-233IVAVYAKTV-----------------GLK..-..MAPLLAY--GTFDEIRALPIT.........................
Q6WI19_BPKVM/27-222VVLEACEFA-----------------KVK..-..TTHEIAR--GTLDELLRIDPLFRS......................
C3IWF6_BACTU/25-179ATVAWCKKL-----------------GLA..-..HVPVLYR--GPYNEKVIRSCYNGT......................
A3IEU7_9BACI/35-189ETVAFAEKL-----------------GVE..-..TVPVLYR--GIFDERKIKRMFTGK......................
Q857R9_9CAUD/188-418GVKQFCQVR-----------------GLK..-..WTPEMDR--VSFGGADPEYPSIEELTQYITQAMDMRYADHYDKTVA
Q854A4_BPMOM/187-423AVKEFCLAR-----------------GLK..-..WTPEMGR--VSFGPQTLWSAEDIE..QYVNELMDMRYADYYDEVVA
Q5YSN8_NOCFA/190-399QVVEWCAQL-----------------GLK..-..TVPVLTE--MQHRAFDP............VDWLDRRY...YDEGYG
Q6MVA4_NEUCS/200-398SVELLCKTL-----------------DIA..-..HVPVLGY--GPVT..KYGKSVEEI.....LAYADK...........
Q54EG7_DICDI/247-425ERIEILNSL-----------------KLTPS-DHMAPVISN--SFSLKGKTLSDILDM.....ANGFSI...........
Q56EF5_9CAUD/169-356EFQDLCRTL-----------------GME..-..ICPQLGY--SYPF..QEFTNVKDM.....LAAADI...........
Q9RZM9_DEIRA/158-328WPQWVLDHA-----------------.....-...VPVLYE--GPFD....EATVRKL.....RGGLET...........
Q2S6U3_HAHCH/186-380ALQAMAEQL-----------------GVQ..-..TVPILYR--GPFS....QEVMREH.....TDGATK...........
Q828Q7_STRAW/158-341AADRLDGEL-----------------PL...-...VPRLYE--GPYD....IERVLET.....ASGRET...........

PF01653

DNLJ_HAEIN/2-319HYARLQWLK-----------------SIGIP.VNPEIRLCN...GADEVLGFYRDIQN----------------------
DNLJ_MYCPN/1-307QSAVLAQLK-----------------QWNFP.VSKAVASFD...RPEALIEYLEQFDQ----------------------
DNLJ_ECOLI/2-318HLGRLLQFK-----------------KWGLP.VSDRVTLCE...SAEEVLAFYHKVEE----------------------
DNLJ_MYCLE/11-328QHQAYLALR-----------------DWGLP.VSEHTTLVN...DIAGVQGCIAYWAE----------------------
DNLJ_AQUAE/30-348HYESLKMLH-----------------TLGFKTLFKDTKVCK...GIDEVIEYCKEWEK----------------------
DNLJ_HELPY/2-310FKECLDFIV-----------------SLGFS.AIQYLSLNK...NHQEIEDNYHTLIR----------------------
DNLJ_BORBU/3-309NDLATARLK-----------------KLGFK.VNPLIRFFDLKNSIGEVLNYIADITK----------------------
DNLJ_BACSU/4-314QSQGLDFLD-----------------ELGFK.TNQERKKCG...SIEEVITLIDELQA----------------------
DNLJ_SYNY3/1-317QWQALEYLK-----------------KAGFM.VNPHCQLCK...GLDEVVAYFEDWEG----------------------
DNLJ_ZYMMO/29-346QYGMMKVIE-----------------SYGLS.VSNLLARAD...DIGQMLDFYQKIEA----------------------
D0MI04_RHOM4/37-360QYEVLQWLG-----------------RLGFP.VNEHARRFE...HLDDVLEYCRYWTE----------------------
DNLJ_THET8/5-322QFALLHWLK-----------------EKGFP.VEHGYARAV...GAEGVEAVYQDWLK----------------------

PF01331

Q9S9L3_ARATH/297-492----------------------------------------------------HESDGLIFQG---WDNPYVFG--.P-NK
MCE_PBCV1/60-236----------------------------------------------------YHTDGLIIMS---VDEPVIYG--.R-NF
MCE1_YEAST/47-249----------------------------------------------------HLSDGLIFTP---VKAPYTAG--GK-DS
Q9VY44_DROME/307-497----------------------------------------------------HEPDGLIFQP---SKQPYTAG--.T-CS
MCE1_CAEEL/289-479----------------------------------------------------HEIDGLIFQP---KKTKYETG--.R-CD
MCE1_HUMAN/272-460----------------------------------------------------HEMDGLIFQP---TG.KYKPG--.R-CD
MCE1_SCHPO/45-242----------------------------------------------------HGNDGLIFTC---TETPYVSG--.T-DQ
F4IYM6_ARATH/357-547----------------------------------------------------HEADGLIFQG---WDDPYVPR--.T-HE

PF01068

DNLI4_SCHPO/254-462----------------------------------------------------EGSEGLVIKK...PSGSYHLG..ER.MD
DNLI3_HUMAN/483-677----------------------------------------------------EGLEGLVLKD...VKGTYEPG..KR...
DNLI4_CANAL/259-494----------------------------------------------------SRCEGLVLKN...VQSKYEID.GFR.NP
Q9VG84_DROME/257-451----------------------------------------------------ANLEGVVLKS...PTSTYQPG..KR...
DNLI4_HUMAN/248-451----------------------------------------------------KREEGIMVKQ...PLSIYKPD..KR.GE
DNLI1_CAEEL/263-465----------------------------------------------------NKCEGLMIKTL.DTEATYEIS..RR.SH
Q9XAM3_STRCO/11-197----------------------------------------------------AGLDGVVAKP...LDLRYRQD..ER...
DNLI_METJA/226-440----------------------------------------------------IGHEGVMIKN...LKAPYTPG..SR.VR
DNLI_ARCFU/225-419----------------------------------------------------AGHEGVMIKL...PSSPYIPG..KR.GK
DNLI_PYRFU/224-422----------------------------------------------------MGHEGLMAKR...LDAVYEPG..NR.GK
DNLI_AQUAE/225-424----------------------------------------------------EGCEGLVCKSL.APNSIYQAG..KR.GF
DNLI_PYRAE/226-424----------------------------------------------------MGTEGLICKS...PSSIYEMG..AR.GW
DNLI_AERPE/239-439----------------------------------------------------EGAEGVMVKAV.HRDSVYTAG..VR.GW
DNLI1_YEAST/393-598----------------------------------------------------HSCEGLMVKMLEGPESHYEPS..KR.SR
DNLI1_SCHPO/390-595----------------------------------------------------DSCEGLMVKMLEGPDSHYEPS..KR.SR
DNLI1_HUMAN/542-746----------------------------------------------------DSCEGLMVKTL.DVDATYEIA..KR.SH
DNLI1_DROME/369-573----------------------------------------------------GNCEGLMVKTL.DEEATYEIA..KR.SR
DNLI1_ARATH/418-622----------------------------------------------------VGCEGLIIKTL.DSDATYEPA..KR.SN
DNLI_FOWPN/211-405----------------------------------------------------KNIEGFVLKD...AKGVYEPG..MR...
DNLI_BPT7/8-240----------------------------------------------------EGHEGLIVKD...PMCIYKRG..KK..S
DNLI_ASFB7/126-318----------------------------------------------------EGYEGAIVRN...ANGPYEPGYNNYHSA
DNLI_BPT4/135-367----------------------------------------------------QGLEGIILKN...IDGLWENA..RS..K
DNLI4_YEAST/256-466----------------------------------------------------LGSEGVVLKY...YNSSYNVA..S.RNN
Q9VYA5_DROME/258-461----------------------------------------------------SHAEGIVLKK...QGSRYQPG..VRLGG
LIGD_BACSU/13-208----------------------------------------------------YDGEGIVAKK...TNSKWLEK..KR.SS
O28549_ARCFU/10-196----------------------------------------------------MGLEGIVAKK...KDGRYLIG..KR.SR
F4B718_ACIHW/236-436----------------------------------------------------EGAEGVMVKSL.APDAIYQAG..SR.GW
LIGC_MYCTU/11-201----------------------------------------------------AGLDGVIAKP...PHITYQPD..KR...
DNLI_VACCW/206-399----------------------------------------------------RKLEGLVLKD...INGVYEPG..KR...
DNLI_MYCTU/186-380----------------------------------------------------AGHEGVMAKA...PAARYLAG..RR.GA
DNLI_METTH/227-425----------------------------------------------------EGHEGIMIKD...TEAPYIPG..IR.GK
Q9Q8U5_RFVKA/212-406----------------------------------------------------KGLEGLMLKG...GDDVYKPG..LR...

PF09414

Q6T434_TRYCR/74-303........TPLPALL...........................GLGNYPLEG.NLAEGVVIRHVHRGDPATEK...HN-VA
Q86QW3_LEITA/98-325........TPLPALL...........................GLGNYPLEG.NLAEGVVIRHVRRGDPAVES...SG-VS
Q4DAH8_TRYCC/50-271........TTIPPLV...........................GMGNYPLKG.NWAEGLVVKHAKRGTPGFDP...KG-L.
Q86QW4_LEITA/51-272........TTIPSLV...........................GMGDYPLKG.NWAEGLVVKHCRRGESGFDA...KG-V.
A6GCV5_9DELT/26-233......................................TVPERLGLPALPD.NVAEGFVLVPDRRLP........AK-AR
A1ZC58_9BACT/31-233......................................TIAGLLGLPALPTPNLAEGVVIKPATSLLMDTAK...GW-VR
Q06EF1_BPR32/28-227..........LDSVVQDYNFTVDHAGLVDANKCV........WNAKAKGEV.FTAEGYVLKPC...YPSWMP...NG-NR
Q7Y4V8_BPR69/28-225..........LDSVLAAYN.ATASEDLVEANNCV........FDANVIGD..NTAEGYVLKPC...FPKWLP...NG-TR
Q5QBW9_9CAUD/28-227..........FDSVIPDYNFAVDNAGLTIANSTD........FIPKVEGKV.FTAEGFVLKPD...IPTWLP...NG-NR
Q56BF0_9CAUD/28-233..........FDSVV.....NLANSGAIPAHNGVEPEFKNFMTLKDGEGE..NIAEGFVMKPV...HPAFMP...NG-ER
Q6WI19_BPKVM/27-222.......F..................................HTPADVDGD.NVAEGFVVKQLR..NEKRLH...NG-SR
C3IWF6_BACTU/25-179...............................................SLFG.GIQEGYVLRLTDAFHYN......DF-SK
A3IEU7_9BACI/35-189...............................................SMFD.GEQEGYVIRNAASFHYD......DF-QY
Q857R9_9CAUD/188-418.GTAVAALIDRPISL................................SDKK.SVDEGVCLRQD............GL-VP
Q854A4_BPMOM/187-423KDEELAAIFERPIPL................................SDKK.TVDEGVVLRQE............GI-VP
Q5YSN8_NOCFA/190-399..........QAVPL...............................SGSKK.LVDEGVCIRAVD...........TL-FP
Q6MVA4_NEUCS/200-398............................................LGPGEYG.GVKEGLIFRAN............DD-WK
Q54EG7_DICDI/247-425............................................LKESKPK.ILREGLVFKSTSTIG.....SV.NQ-SV
Q56EF5_9CAUD/169-356..............................................PSIEH.KIAEGVVYKSVEL........V.DG-RM
Q9RZM9_DEIRA/158-328............................................V.SGKGL.HIREGVVVAPKVPRF.....AA.DG-SD
Q2S6U3_HAHCH/186-380............................................L.DAD...HIREGIVITPTKERR.....DP.EL-GR
Q828Q7_STRAW/158-341............................................V.SGHGL.HLREGVVIRSATERR.....SPVTG-GR

PF01653

DNLJ_HAEIN/2-319----------------------------------------------KRSSLGYDIDGTVLKIND-IALQNELGFISK-AP
DNLJ_MYCPN/1-307----------------------------------------------TRDQLNFQVDGLVVKLDN-FHFYDQLGFTSK-FP
DNLJ_ECOLI/2-318----------------------------------------------DRPTLGFDIDGVVIKVNS-LAQQEQLGFVAR-AP
DNLJ_MYCLE/11-328----------------------------------------------HRHEVDHEIDGIVVKIDE-VTLQRRLGSTSR-AP
DNLJ_AQUAE/30-348----------------------------------------------KRDSYPYEIDGMVVKVND-RRLWKVLGYTSH-HP
DNLJ_HELPY/2-310----------------------------------------------EREGFFALLDGMVIVVNE-LNIQKELGYTQK-SP
DNLJ_BORBU/3-309----------------------------------------------KRDSFEYEIDGVVLKVSD-FALRERLGYTAH-HP
DNLJ_BACSU/4-314----------------------------------------------KRADLPYEIDGIVIKVDS-LDQQEELGFTAK-SP
DNLJ_SYNY3/1-317----------------------------------------------ARQRLPYMTDGVVVKINQ-YPLQRELGFTQK-FP
DNLJ_ZYMMO/29-346----------------------------------------------ERADLDFDIDGVVYKLDQ-LDWQQRFGFSAR-AP
D0MI04_RHOM4/37-360----------------------------------------------HRDELDYEIDGVVLKIDH-RPWQALLGAISN-AP
DNLJ_THET8/5-322----------------------------------------------KRRALPFEADGVVVKLDE-LALWRELGYTAR-AP

PF01331

Q9S9L3_ARATH/297-492DL-----LKWK
MCE_PBCV1/60-236NL-----FKLK
MCE1_YEAST/47-249LL-----LKWK
Q9VY44_DROME/307-497DV-----FKWK
MCE1_CAEEL/289-479KV-----LKWK
MCE1_HUMAN/272-460DI-----LKWK
MCE1_SCHPO/45-242SL-----LKWK
F4IYM6_ARATH/357-547GL-----LKWK

PF01068

DNLI4_SCHPO/254-462DW-----IKVK
DNLI3_HUMAN/483-677HW-----LKVK
DNLI4_CANAL/259-494DW-----IKVK
Q9VG84_DROME/257-451NW-----LKVK
DNLI4_HUMAN/248-451GW-----LKIK
DNLI1_CAEEL/263-465SW-----LKMK
Q9XAM3_STRCO/11-197AM-----YKIK
DNLI_METJA/226-440TM-----YKFK
DNLI_ARCFU/225-419NW-----LKVK
DNLI_PYRFU/224-422KW-----LKIK
DNLI_AQUAE/225-424LW-----IKYK
DNLI_PYRAE/226-424NW-----IKYK
DNLI_AERPE/239-439LW-----VKLK
DNLI1_YEAST/393-598NW-----LKLK
DNLI1_SCHPO/390-595HW-----LKVK
DNLI1_HUMAN/542-746NW-----LKLK
DNLI1_DROME/369-573NW-----LKLK
DNLI1_ARATH/418-622NW-----LKLK
DNLI_FOWPN/211-405RW-----LKIK
DNLI_BPT7/8-240GW-----WKMK
DNLI_ASFB7/126-318HL-----AKLK
DNLI_BPT4/135-367NL-----YKFK
DNLI4_YEAST/256-466NW-----IKVK
Q9VYA5_DROME/258-461GW-----YKDK
LIGD_BACSU/13-208DW-----LKYK
O28549_ARCFU/10-196LW-----KKIK
F4B718_ACIHW/236-436LW-----IKFK
LIGC_MYCTU/11-201VM-----FKIK
DNLI_VACCW/206-399RW-----LKIK
DNLI_MYCTU/186-380GW-----LKVK
DNLI_METTH/227-425KM-----LKFK
Q9Q8U5_RFVKA/212-406GW-----LKIK

PF09414

Q6T434_TRYCR/74-303TI-----LKLR
Q86QW3_LEITA/98-325TI-----IKLR
Q4DAH8_TRYCC/50-271TI-----LKFK
Q86QW4_LEITA/51-272TI-----MKFK
A6GCV5_9DELT/26-233PV-----VKHK
A1ZC58_9BACT/31-233PV-----IKKK
Q06EF1_BPR32/28-227VA-----IKCK
Q7Y4V8_BPR69/28-225VA-----IKCK
Q5QBW9_9CAUD/28-227VA-----IKCK
Q56BF0_9CAUD/28-233VA-----IKCK
Q6WI19_BPKVM/27-222AI-----LKVK
C3IWF6_BACTU/25-179SV-----GKFV
A3IEU7_9BACI/35-189NL-----GKFV
Q857R9_9CAUD/188-418TI-----LKAK
Q854A4_BPMOM/187-423VL-----LKAK
Q5YSN8_NOCFA/190-399TV-----LKAK
Q6MVA4_NEUCS/200-398KG-----FKVI
Q54EG7_DICDI/247-425VS-----FKAI
Q56EF5_9CAUD/169-356VH-----FKAI
Q9RZM9_DEIRA/158-328LS-----VKLI
Q2S6U3_HAHCH/186-380VC-----LKSV
Q828Q7_STRAW/158-341AI-----AKAV

PF01653

DNLJ_HAEIN/2-319RWAIAYKFPAQ
DNLJ_MYCPN/1-307RWALAYKFKPK
DNLJ_ECOLI/2-318RWAVAFKFPAQ
DNLJ_MYCLE/11-328RWAIAYKYLPE
DNLJ_AQUAE/30-348RWAIAYKFKPR
DNLJ_HELPY/2-310KFACAYKFPAL
DNLJ_BORBU/3-309KWAMAYKFEAL
DNLJ_BACSU/4-314RWAIAYKFPAE
DNLJ_SYNY3/1-317RWAIALKYPAE
DNLJ_ZYMMO/29-346RFALAHKFPAE
D0MI04_RHOM4/37-360RWAVAYKFPAR
DNLJ_THET8/5-322RFAIAYKFPAE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window