Sequence alignment for CL0080

PF00838

TCTP_SCHPO/1-165MLLYKDVISGDELVSDAYDL.KEVDDIVYEADCQMVTVKQ.GGD.VDIGANPSAEDAE....ENAEEGTETVNNLVYSFR
TCTP_CHICK/1-169MIIYRDCISQDEMFSDIYKIREVANGLCLEVEGKMVTRTEGQIDDSLIGGNASAEGPEG...EGTEATVITGVDIVINHH
TCTP_FRAAN/1-167MLVYQDLLSGDELLSDSFPYKEIQNGVLWEVDGKWVVQ...GAVDVDIGANPSAEGADADADEGVDDQTVKVVDIVDTFR
TCTP_LUMRU/1-164MIIFKDVFPGVELFSDSFPV.SLVNETVYKVKGKLRTDTF.AIDDKAIGGNASAEGGE....EGTDAASKQGVDIVMNSR
TCTP_SCHJA/1-166MRVFKDAISGDEMFSDSHSP.QLINDVVYEVDANFITVSN.GLDSKLIAANPSGEEGQ....EEVSDSTERVIDLVHASR
TCTP_YEAST/1-164MIIYKDIFSNDELLSDAYDA.KLVDDVIYEADCAMVNV...GGDNIDIGANPSAEGGD....DDVEEGAEMVNNVVHSFR
TCTP_MEDSA/1-164MLVYQDLLTGDELLSDSYPYKEIENGMLWEVEGKWVTK...GVVEVDIGANASAEGGE...DEGVDDTAVKVVDIVDVFR
TCTP_CAEEL/1-178MLIYKDIFTDDELSSDSFPM.KLVDDLVYEFKGKHVVRK..EGEIVLAGSNPSAEEGAE..DDGSDEHVERGIDIVLNHK
TCTP_BRUMA/1-178MLIFKDAFTDDELASDSFPM.KLVDGLIWEFKGRQVVRR..EGEIQLAGANPSAEGEDG..DEGSEECVERGIDFVLNHR

PF01641

MSRB6_ARATH/28-149NEEWRTVLSPEQF----------------------------KILREKSIEKRGSGEYVKLFEEGIYCCVGCGNPVYK---
MSRB7_ARATH/19-140DEEWRAVLSPEQF----------------------------RVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYK---
MSRB4_ARATH/12-133EEEWRAVLSPEQF----------------------------RILRQKGTETPGTEEYDKFFEEGIFSCIGCKTPLYK---
P72779_SYNY3/55-176DAEWQQQLSPEAY----------------------------KVLRKHGTERAGTSPLDKNYDLGTYECAGCELPLFS---
MSRB_MYCPN/9-132DGELKRTLTKLQY----------------------------DVTQNAHTEPPYTNEYNRHYEKGIYVDITSGEPLFI---
MSRAB_HELPY/206-329DEVLKKKLTKLQY----------------------------EVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFS---
YL56_CAEEL/27-151QTEWKSVLPNEVY----------------------------RVARESGTETPHTGGFNDHFEKGRYVCLCCGSELFN---
MSRB_CLOHI/14-137TEKLKENLTELQY----------------------------NVTQRNATEKPFLNKYDKHFEDGIYVDIVSGEPLFL---
MSRB5_ARATH/12-133EEEWRAVLSPEQF----------------------------RILRQKGTEKPGTGEYDKFFEEGIFDCVGCKTPLYK---
MSAB1_STRR6/172-295QEVLKASLSEESY----------------------------RVTQEAATEAPFTNAYDQTFEEGIYVDITTGEPLFF---
MSRAB_TREPA/1-124MLANLQHLSDIQY----------------------------RVTQQSATETPFKNEFWNSYQPGFYLDVVSGELLFL---
MSRB_BACSU/5-126KEEKIKSLNRMQY----------------------------EVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFT---
MSRAB_HAEIN/213-336DAELKAKLTPLQY----------------------------SVTQNKHTERSFSNEYWDNFQPGIYVDITTGEPVFS---
Q48984_MYCCA/85-208LIRKELSLDELSL----------------------------NVLKYSATEKPHTSEFNDEHRKGIYVEKITGEVLFA---
P71971_MYCTU/10-134DDEWRQKLTPQEF----------------------------HVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFR---
MSRB_METTH/25-147DDEWREILDPEAF----------------------------RVARKAGTEPPFTGKYHDLHDDGIYRCICCGTDLFD---
MXR2_YEAST/40-168DVKWNDALTPLQL----------------------------MVLRDKATERPNTGAYLHTNESGVYHCANCDRPLYS---
MSRB_ECOLI/7-129AEELKKNLSEMQF----------------------------YVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFH---

PF04421

MSS4_HUMAN/17-123-------NRKAVL----------------------------CQRCGSRVLQPGTALFSRRQLFLPSMR...KKPALS---
MSS4_CAEEL/1-86-------MTTEYL----------------------------DEER....DLPLPRQKKGI.................---
DSS4_YEAST/19-131-------NDDNII----------------------------NLPEQVHSEFKLLENRTMR.DATPSESNFLVVPDVW---
MSS4_DROME/32-120-------AQEGTY----------------------------NQEE...VDVPLMTQKQDR......TA.........---
MSS4_SCHPO/11-100-------CPSVVF----------------------------NNKRPDVVKRPTMSAMLHS.................---

PF00838

TCTP_SCHPO/1-165LSPT..SFDKKSYMSYIKGYMKAIKARLQESNPER..VPVFEKNAIGFVKKILAN..FKDYDFYIGESMDP...DAMVVL
TCTP_CHICK/1-169LQET..SFTKESYKKYIKDYMKAIKARLEEHKPER..VKPFMTGAAEQIKHILAN..FKNYQFFVGENMNP...DGMVAL
TCTP_FRAAN/1-167LQEQP.PFDKKQFVTWVKRYIKLLTPKLEGEQQE.....TFKKNIEGATKFLLSK..LSDLQFFVGESMGD...DTSLVF
TCTP_LUMRU/1-164LVEY..ALSKKDYMTHIKSYMKSVKDKLQETKPAD..SELFQKNVQPFIKEVLND..FKEYQLFCGESMGP...EGMLAL
TCTP_SCHJA/1-166LVST..SFDKKSYRAYLKGYLKAIKERLQKENPER..VSIFESRINEYMVNVFKN..FDDYEHYIGESMNP...DGMVAL
TCTP_YEAST/1-164LQQT..AFDKKSFLTYIKGYMKAVKAKLQETNPEE..VPKFEKGAQTYVKKVIGS..FKDWEFFTGESMDP...DAMVVM
TCTP_MEDSA/1-164LQEQP.AFDKKQFLGFVKRYIKLLTPKLDAEKQE.....LFKKHIEGATKYLLCK..LKDLQFFVGESMHD...DGSLVF
TCTP_CAEEL/1-178LVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAI
TCTP_BRUMA/1-178LQEMNCYEDLVTFKSYCKSFMKKVVELMQKNGKSEAEISEFKRKIPAWVVSLLSKDRFKQLQFFIGERMAEGQGEGQVAV

PF01641

MSRB6_ARATH/28-149------STTKFDSGCGWPAFFDAIPG.A.INRTEE--RA..GLRYE-----ITCT----KCDGHLGHVLKN---EGFPT.
MSRB7_ARATH/19-140------STTKFDSGCGWPAFFDAIPG.A.IKQTPE--AG..GRRME-----ITCA----VCDGHLGHVFKG---EGYST.
MSRB4_ARATH/12-133------STTKFDAGCGWPAFFEGLPG.A.INRAPD--PD..GRRTE-----ITCA----VCDGHLGHVHKG---EGYST.
P72779_SYNY3/55-176------SETKFNSGTGWPSFYAPL.ENA.VAYTVD--KSFFMTRTE-----VHCA----RCGGHLGHVFD.---DGPQP.
MSRB_MYCPN/9-132------STDKFKSGCGWPAFTKPISQDL.IANYRD--ESHGMIRTE-----VRAK----NSNSHLGHVFR.---DGPEE.
MSRAB_HELPY/206-329------SADKYDSGCGWPSFSKPINKDV.VKYEDD--ESLNRKRIE-----VLSR----IGKAHLGHVFN.---DGPKE.
YL56_CAEEL/27-151------SDAKFWAGCGWPAFSESVGQDANIVRIVD--RSHGMHRTE-----VRCK----TCDAHLGHVFN.---DGPKE.
MSRB_CLOHI/14-137------SIDKFNSGCGWPAFSKPISRKY.IKERAD--FSHGMSRIE-----VRSK----NADSHLGHVFN.---DGPIE.
MSRB5_ARATH/12-133------STTKFDSGCGWPAFFEGLPG.A.INRTPD--PD..GRRTE-----ITCA----ACDGHLGHVFKG---EGYGN.
MSAB1_STRR6/172-295------AKDKFASGCGWPSFSRPISKEL.IHYYKD--LSHGMERIE-----VRSR----SGSAHLGHVFT.---DGPRE.
MSRAB_TREPA/1-124------SEDKFDSGCGWPSFSAPAYARA.VIEKED--RTHNMLRTE-----VRSR----NANSHLGHVFK.---DGPPE.
MSRB_BACSU/5-126------SKDKFDSQCGWPSFTKPIEEE..VEEKLD--TSHGMIRTE-----VRSR----TADSHLGHVFN.---DGP.G.
MSRAB_HAEIN/213-336------SNDKFESGCGWPSFTKPIIKDV.VHYETD--NSFNMQRTE-----VLSR----AGNAHLGHVFD.---DGPKD.
Q48984_MYCCA/85-208------SNTKFNAGCGWPSFAAPINNKA.VEYKAD--YSHNMHRVE-----VRSK----TGDNHLGHVFN.---DGPKE.
P71971_MYCTU/10-134------STEKFESHCGWPSFFDPKSSDA.VTLRPD--HSLGMTRTE-----VLCA----NCDSHLGHVFAG---EGYPT.
MSRB_METTH/25-147------SETKFDSGTGWPSFYDVVSEHN.IKLRED--RSLGMVRCE-----VLCA----RCDAHLGHVFD.---DGPRP.
MXR2_YEAST/40-168------SKAKFDARCGWPAFYEEVSPGA.ITYHRD--NSLMPARVE-----ICCA----RCGGHLGHVFEG---EGWKQL
MSRB_ECOLI/7-129------SQTKYDSGCGWPSFYEPVSEES.IRYIKD--LSHGMQRIE-----IRCG----NCDAHLGHVFP.---DGPQP.

PF04421

MSS4_HUMAN/17-123------DGSNPDGDLLQEHWLVEDM...-..FIFE--NVGFTKDVG.NIKFLVCA----DCE------------IGPIGW
MSS4_CAEEL/1-86------..DHTQTEPIRGFFGVKDM...-..FAFE--NVGFTRSSE.GKRYLVCG----ECE------------QGPVGF
DSS4_YEAST/19-131------DFDNVGVSREIPSSILGDLSDK-SDFVFE--YGNSSWKIKKCLKYLICA----DCD------------KGPIGI
MSS4_DROME/32-120------..DSLNSEPLKDFWLVKDM...-..MTFE--NIGFSNTVD.GRKFLVCA----DCE------------RGPVGY
MSS4_SCHPO/11-100------..ETQEDLETDDFFLLKDP...-..FAFD--NVSVSKPLANNYKLLACA----DCE------------KGPLGY

PF00838

TCTP_SCHPO/1-165MNYR..EDGITPYMIFFKDGLVS--
TCTP_CHICK/1-169LDFR..EDGVTPYMIFFKDGLEI--
TCTP_FRAAN/1-167ASYK..EGATDPIFIYFAHGLKE--
TCTP_LUMRU/1-164MKW....DGETPYMFFFKHGLDE--
TCTP_SCHJA/1-166MNFR..ENGVTPYFVFLKDGLIE--
TCTP_YEAST/1-164LNYR..EDGTTPFVAIWKHGIVE--
TCTP_MEDSA/1-164AYYK..DGAADPTFLYFAYALKE--
TCTP_CAEEL/1-178IEYRDVDGTEVPTLMLVKEAIIE--
TCTP_BRUMA/1-178VEYRDEEDGEVPYLMLVKEALIE--

PF01641

MSRB6_ARATH/28-149...P----TDERHCVNSVALKFSSA
MSRB7_ARATH/19-140...P----TDQRHCVNSVSLKFSSA
MSRB4_ARATH/12-133...P----TDERLCVNSVSINFNPA
P72779_SYNY3/55-176...T----.GKRYCMNGVSLKFVGA
MSRB_MYCPN/9-132...H----GGLRYCINSAALKFIPF
MSRAB_HELPY/206-329...L----GGLRYCINSAALRFIPL
YL56_CAEEL/27-151...T----TGERYCINSVCMAFEKK
MSRB_CLOHI/14-137...N----GGMRYCINSASLKFIAK
MSRB5_ARATH/12-133...P----TDERHCVNSVSISFNPA
MSAB1_STRR6/172-295...L----GGLRYCINSASLRFVAK
MSRAB_TREPA/1-124...R----GGLRYCINSAALRFVAR
MSRB_BACSU/5-126...P----NGLRYCINSAALRFVPK
MSRAB_HAEIN/213-336...K----GGLRYCINSASIKFIPL
Q48984_MYCCA/85-208...M----GGLRYCINGAAIEFIPY
P71971_MYCTU/10-134...P----TDKRYCINSISLRLVPG
MSRB_METTH/25-147...T----.GKRYCMNSAALKFIPR
MXR2_YEAST/40-168LNLP----KDTRHCVNSASLNLKKD
MSRB_ECOLI/7-129...T----.GERYCVNSASLRFTDG

PF04421

MSS4_HUMAN/17-123HCLD----DKNSFYVALERVSHE--
MSS4_CAEEL/1-86VDPV----TEMNY.VSPERLDVL--
DSS4_YEAST/19-131ICKV----QDQTK..NEERVLHL--
MSS4_DROME/32-120HDLS----TRHCY.LALKRVVHK--
MSS4_SCHPO/11-100YDSK----NNEYL..LLCSLEKN--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window