Sequence alignment for CL0083

PF11703

G7YD78_CLOSI/34-91CATPDEEC..GTF.KPCCGRHLICKRLGSAE-------------GQCV..RCSR--------------------------
G7Y4U0_CLOSI/24-81CMEEGMKCSKTLK.THCCG.ELICHLTSAFT-------------GTCK..RCLP--------------------------
G4VLW5_SCHMA/26-84CRTVGQECSKTVF.SPCCE.NFYCGLNTLFS-------------GQCQ..PCLA--------------------------
G4M208_SCHMA/29-87CKQKGESCAKTIF.DRCCG.ELVCELDAPFS-------------GKCV..ECLS--------------------------
H2KPG9_CLOSI/24-82CKGLGEWCDGTVF.NRCCG.DLRCQLSGFGQ-------------GICK..TCIE--------------------------
G7YUW6_CLOSI/40-99CKNLGDFCRKLPFGQRCCG.DTVCDLYAPFK-------------GKCV..RCLP--------------------------
A0A068Y8W4_ECHMU/21-80CRKMGEPCSRTVF.SRCCE.GLYCVLKGFAD-------------GTCE..KCLP--------------------------
G4VLW4_SCHMA/162-220CRALGEKCSKTVF.DRCCG.DTVCHLSSPFH-------------GKCV..KCLK--------------------------
G7YI46_CLOSI/30-88CSELGEECNKTLF.KRCCR.NYVCDLVSPFR-------------GTCI..DCYP--------------------------
G4VLW4_SCHMA/104-161CKEYGESCMKTVF.NKCCG.SNVCQLIGPFN-------------GKCV..RCIQ--------------------------
A0A068XBH6_HYMMI/23-82CKRLGEQCDRTVF.NRCCK.DLYCVLAGPGD-------------GTCQ..PCLP--------------------------
G7Y700_CLOSI/24-82CKQLGEWCDGTIF.NSCCG.DLKCQLSNFAV-------------GTCK..KCIE--------------------------
G4VD24_SCHMA/21-78CSEPETVC..TVF.RPCCGRDWVCNRKSSAT-------------GKCV..QCAH--------------------------
G4VMF1_SCHMA/36-92CSNLNESCSRILF.RRCCD.KLVCQ..GFFT-------------GTCV..ECLG--------------------------
G7YI45_CLOSI/25-83CVPLGGNCTKTVF.SRCCG.DAVCDLRGPFN-------------GICV..ACYE--------------------------
G4VBF7_SCHMA/36-95CKNLGTFCRKLPFSQRCCD.TTVCDLKAPFS-------------GTCV..RCLD--------------------------
G4VME9_SCHMA/59-115CANLTQRCEPTY...PCCS.PNLCQVISSEI-------------GTCV..ECFQ--------------------------
G4LWF3_SCHMA/2-62CFGVGKYCDGAGH.RKCCP.PHSCKLINPRE-------------GVCVRGQCLQ--------------------------

PF08087

Q80LL0_NPVAH/21-51S-------------------------------------------------ACTE--------------------------
Q9YMR0_NPVLD/20-52L-------------------------------------------------ACTD--------------------------
Q8JM47_9ABAC/20-50L-------------------------------------------------ACTE--------------------------
CXOL2_NPVOP/22-52L-------------------------------------------------ACTE--------------------------
CXOL1_NPVOP/23-53A-------------------------------------------------ACAE--------------------------
H6UPN5_9ABAC/23-53A-------------------------------------------------ACAE--------------------------
Q9YMH9_NPVLD/23-53A-------------------------------------------------ACAD--------------------------

PF08027

K7M0N2_SOYBN/29-63C---NGACSPFEM-PPCRSRDCRCVPIGLVA-------------GFCI----HP--------------------------
K7M0N1_SOYBN/11-45C---NGACSPFEM-PPCRSSDCRCVPIALFV-------------GFCI----HP--------------------------

PF16720

I1KW03_SOYBN/76-123---------------------EHPKLCQSHDECMKKG-------------------------------------------
K7M0N1_SOYBN/55-102---------------------EHPNLCQSDDECMKKG-------------------------------------------

PF07473

CP91_CONGL/61-88---------------------SCNNSCQSHSDCASH--------------------------------------------
CP91_CONRE/57-83---------------------FCGQACSS.VKCPKK--------------------------------------------

PF08099

SCXC_SCOMA/1-33--GDCLP-------------------------------------------------------------------------
IPTXA_PANIM/1-33--GDCLP-------------------------------------------------------------------------

PF07740

WGRTX_GRARO/50-81---DCVR-------------------------------------------------------------------------
H3A12_HAPHA/49-79---GCKG-------------------------------------------------------------------------
H1A03_HAPHA/49-79---ECKG-------------------------------------------------------------------------
TX27_PHONI/2-36---ACAP-------------------------------------------------------------------------
TX5B_HETVE/2-34---DCGW-------------------------------------------------------------------------
H8A01_HAPHA/53-81---DCAG-------------------------------------------------------------------------
TX5A_HETVE/3-35---DCGW-------------------------------------------------------------------------
TXHN1_GRARO/1-30---ECRY-------------------------------------------------------------------------
TXPR1_THRPR/1-30---ECRY-------------------------------------------------------------------------
TXHP1_HETVE/1-29---DCGT-------------------------------------------------------------------------
TXHA5_HAPHA/1-33---ECLG-------------------------------------------------------------------------
TXMG8_MACGS/46-76---DCKG-------------------------------------------------------------------------
TX2_THEBL/2-32---DCLG-------------------------------------------------------------------------
TXP5_BRASM/1-30---SCVD-------------------------------------------------------------------------
TX1_THEBL/2-32---ACLG-------------------------------------------------------------------------
TX32_PHOKE/2-36---ACAP-------------------------------------------------------------------------
TXH4_HAPSC/53-85---ECLE-------------------------------------------------------------------------
TX2_HETMC/1-34---ECRY-------------------------------------------------------------------------
M5AY85_GRARO/47-78---GCLE-------------------------------------------------------------------------
JZT1B_CHIGU/30-60---ACGQ-------------------------------------------------------------------------
TX1_HETMC/1-30---ECRY-------------------------------------------------------------------------
TX1_STRGF/1-30---TCRY-------------------------------------------------------------------------
TXH1_HAPSC/49-79---ACKG-------------------------------------------------------------------------
TXU2_HETVE/2-28---DCGG-------------------------------------------------------------------------
B3FIU4_HAPSC/51-80---ECRW-------------------------------------------------------------------------
TX482_HYSGI/6-35---GCRY-------------------------------------------------------------------------
VSTX1_GRARO/1-30---ECGK-------------------------------------------------------------------------
TX1_STRCF/1-30---DCTR-------------------------------------------------------------------------
TX27_PHORI/2-36---ACAP-------------------------------------------------------------------------
TXHP3_HETVE/1-27---ECGT-------------------------------------------------------------------------
TXL1_HAPSC/50-77---GCLG-------------------------------------------------------------------------

PF08093

TXM11_MACGS/51-78---SCKL-------------------------------------------------------------------------
TOT2A_HADIN/60-89---DCVV-------------------------------------------------------------------------
TOT2B_ATRIL/59-87---DCVL-------------------------------------------------------------------------
TXR3_MACRV/1-29---GCKL-------------------------------------------------------------------------
TOT2A_HADVE/3-32---ACLF-------------------------------------------------------------------------

PF08117

IOB1_ISYOB/2-36ADEDCLP-------------------------------------------------------------------------
PTU1_PEITU/1-34AEKDCIA-------------------------------------------------------------------------

PF08092

TXPT6_MACGS/61-98----CMG-------------------------------------------------------------------------
TXLT4_LASSB/58-97----CGG-------------------------------------------------------------------------
TXMG2_MACGS/81-120----CMG-------------------------------------------------------------------------

PF08008

Q77ZH3_CSIVT/110-192PEPSCID-------------------------------------------------------------------------
Q98825_CSIVT/36-118CEPGCIG-------------------------------------------------------------------------
Q98825_CSIVT/169-250PDTDSPI-------------------------------------------------------------------------

PF07945

TK1C_HADVE/1-35--AICTG-------------------------------------------------------------------------
TK1B_HADVE/1-36--TICTG-------------------------------------------------------------------------

PF05374

CM3A_CONGE/51-72--RDCCT-------------------------------------------------------------------------
CM3A_CONPU/51-72--RLCCG-------------------------------------------------------------------------
CM3B_CONGE/1-22--RDCCT-------------------------------------------------------------------------
CM3C_CONGE/1-22--RDCCT-------------------------------------------------------------------------

PF02950

CO27A_CONTE/2-73EKLTILLLVAAVLMS.....TQAMF.QGDGE--KSRK.......AEINFSETRK--LAR..NKQ-K...R....C.....
CO7_CONTE/1-76MKLTCMMIVAVLFLTA...WTFATA.DDSGN--GLEN.......LFPKAHHEMK--NPE..ASK-L...NKR..C.....
CM31_CONTE/2-70LKMGVVLFIFLVLFP......LATL.QLDAD--QPVE.......RYAENKQLLN--PDE..RRE-I...LLP........
CM237_CONTS/3-67SKLGVLLTICLLLFP......LTAV.PLDGD--QHAD.......RPADRMQDIS--SEQ..HPL-F...D..........
O2651_CONLT/2-74EKLTILLLVAAVLMS.....TQALV.ERAGE--NRSK.......ENIKFLLKRK--RAA..DRG-M...WGK..C.....
O367_CONTS/2-78SGLGIMVLTLLLLVF....MATSHQ.DAGEK--QATQ.......RDAVNVRRRR--SIA..GRT-T...TEE..C.....
CT52_CONAE/2-65LCLP.VFIILLLLAS.....PAASN.PLEKR--IQSD.......LIRAALEDAD--TKN..DPR-L...L..........
CT54_CONTS/2-72LCLP.VFIILLLLAS.....PAAPN.PLETR--IQRD.......LIRAALEDAD--MKT..NER-F...LEG..V.....
CM132_CONPE/2-70LKMGVLLFTFLVLFP......LATL.QLDAD--QPVE.......QYAGNKQDLN--PDE..KRE-M...ILP........
CM3_CONTE/2-68SKLGALLIICLLLFP......LTAV.PMDGD--QPAD.......RPAERMQDDI--SFE..QHP-M...F..........
O1613_CONPE/1-76MKLTCMMIVAVLFLTA...WTFATA.DDPRN--RLEN.......FFSKTQHEMK--NPE..ASK-L...NKR..C.....
O1617_CONAE/1-68MKLTCVLIIAVLFLT.....A.....CQLTT--GEQK.......DHAQ....RS--ADR..NSK-L...TRQ..C.....
CO14_CONTE/1-81MKLTCVVIVAVLFLTAWTFVTAVPH.SSNAL--ENLY.......LKARHEMENP--EAS..KLN-T...RYD..C.....
CM233_CONVE/3-66SKLGVVLTICLLPFP......LTAL.PMDGD--QPAD.......LPALRTQDFE--PER..SPW-F...D..........
O3620_CONVE/2-78SGLGIMVLALLLLVF....MATSHQ.DGGGK--QATQ.......RDAINVRRRR--SIT..RRV-V...TET..C.....
CT52_CONGL/2-60RCLP.VFVILLLLIA........SA.PSVDA--QPKT.......KDDVPLAPLH--DNI..RST-L...Q..........
CO1X1_CONTE/1-76MKLTCVVIVAVLFLTV...WTFATA.DDSGN--GLEK.......LFSNAHHEMK--NPE..ASK-L...NER..C.....
CM231_CONAE/3-68SKLGVLLTICMLLFP......LTAL.PLDGD--QPAD.......RPAERMQDDF--ISE..QHP-L...F..........
O3621_CONVE/2-74SGLEIMVLTLLLLVS....MATSHQ.DGGEK--QATQ.......RDAINVRRRS--..I..TR.-....TEA..C.....
O1614_CONPE/1-83MNLTCMMIVAVLFLTA...WTFVMA.DDSNN--GLAN.......LFSKSRYEME--DPEPSKLE-K...RKT..C.....
O1610_CONVE/1-77MKLTCMMIVAVLFLTA...WTFVTA.DDSRN--GLDY.......LFPKARHEMN--PKA..SRD-I...K.R..C.....
CM02_CONTS/2-70LKMGVVLFTFLVLFP......LATL.QLDAD--QPVE.......RYAENKQGLN--PDE..SRE-I...ILS........
CT122_CONPE/2-61RCLP.VFVILLLLIA.......SAP.SVDAR--PKTK.......DDIPLVSFQD--NAK..RAL-Q...ILS........
CT56_CONVE/2-71LCLP.VFIILLLLAS.....PAAPN.PLEKR--IQSD.......LIRAALEDAD--MKT..GER-E...ILN..I.....
O1618_CONAE/1-74MKLTCVLIIAVLFLT.......ACQ.LTTGE--TYSR.......GEQKDHALRS--TDK..NSK-L...TRQ..C.....
O1613_CONTE/1-78MKLTCMMIVAVLFLTA...WTFATA.DDSGN--GLEN.......LFSNAHHQMK--NPE..ASK-L...NKR.WC.....
CM131_CONAE/2-67LKMEVVLFTFLVLFP......LSTL.QLETD--QPVE.......RYVENKQDLN--PDE..SRN-F...MLP........
O264_CONVE/2-74QKLTILLLVAAVLMS.....TQALI.KGGGE--KRPK.......EKIKFLSKRR--TNA..ERW-W...EGD..C.....
O1618_CONVE/2-73MKLTCVLIIAVLFLT.....A.....CQLTT--AETR.......DEYRAVRSSD--EVQ..NSR-S...TDD..C.....
O1611_CONVE/1-79MKLTCMMIVAVLFLTA...WTFVTA.DDSRN--GLEY.......LFPKAHYEMN--PEA..SKL-N..KKED..C.....
O1619_CONAE/1-75MKLTCVIIVVALFLT......ACHA.KDKQE--HPAV.......RGSD...DMQ--DSE..DLK-L...AKK..C.....
H2BKF9_CONCE/3-69SKLGALLTICLLLFS......LTAV.PLDGD--QHAD.......QPAQRLQDRI--PTE..DHP-L...F..........
O168_CONAE/1-74MKLTCVLIVAVLFLT.....ACQLI.AADDS--RDLK.......RFSRRNMRDG--MLN..TKN-T...KRQ..C.....
O261_CONTE/2-73EKLTILLLVAAVLLS........IQ.ALNQE--KHQR.......AKINLLSKRK--PPA..ERW-W..RWGG..C.....
O265_CONVE/2-77QKLTILLLVAAVLMS.....TQALI.RGGVE--KRQE.......AKRNFFSKRK--TTA..ESW-W...EGE..C.....
CO16B_CONST/1-72MKLTCVVIVAVLLLT.....A.....CQLIT--ADDS.......RGTQKHRALR--SDT..KLP-M...STR..C.....
O163_CONAE/1-80MKVTCMMIVAVLFLTA...WTFVTA.DDSIS--ALED.......LFAKAHDKME--NSE..ASP-L..NERD..C.....
O1612_CONVE/1-87MKLTCVMIVAVLFLTA...WTFVTA.DDPRD--GPDTAVGWRKLFSEARDEMKN--REA..SKL-N...ERG..C.....
CO16E_CONST/1-78MKLTCVMIVAVLFLTT...WTFVTA.DDSRY--GLKN.......LFPKARHEMK--NPE..ASK-L...NKRDGC.....
H2BKT2_CONVT/3-72SKLGVLLTICLLLFP......LTAV.PLDGD--QPAD.......RPAERMQDGI--SSE..HHP-F...FDS........
O162_CONAE/1-78MKLTCMMIVAVLFLTA...WTSVTA.VNTRG--ELEN.......LFLRASHEMN--SEA..SKL-D...KKV..C.....
CO16B_CONMR/1-82MKLTCMMIVAVLFLTA..WTLVMAD.DSNNG--LANH.......FLKSRDEMED--PEA..SKL-E...KRA..C.....
CO16A_CONST/1-72MKLTCVMIVAVLLLT......ACQL.ITAED--SRGT.......QKHRTLRSTA--RRS..KSE-S...TTR..C.....
CO12A_CONPL/1-74MKLTCVVIVAVLFLT.......ACQ.LITAE--TYSR.......GEQKHRALSS--TDK..NSK-L...TRT..C.....
O1613_CONVE/1-83MKLMCMMIVAVLFLTA...WTFVTA.DDSIN--GPENRRIWEKLLSKTRDEMKN--PEA..SKL-N...KKE..C.....
CO1K1_CONTE/1-77MKLTCMMIVAVLFLTA...WTFATA.DDSSN--GLEN.......LFSKAHHEMK--NPE..ASK-L...NKR..C.....
CM23B_CONTS/3-66SKLGVLLTICLLLFP......LTAV.QLDGD--QPAD.......LPALRTQDIA--TDH..SPW-F...D..........
CO15_CONST/1-72MKLTCVMIVAVLLLT.....A.....CQLIT--ADDS.......RGTQKHRSLR--STT..KVS-K...STS..C.....
O236D_CONTE/2-72QKLIILLLVAAVLMS........TQ.AVLQE--KRPK.......EKIKFLSKRK--TDA..EKQ-Q...KRL..C.....
O1610_CONAE/1-76MKLTCVLIIAVLCLT......VCQL.ITADY--LRDK.......QKYRSVRLRD--GML..NFK-G...SRQ..C.....
COW1_CONTE/2-63GKLTILVLVAVALLS.....TQVMV.QGDGD--QPAD.......RDAV.PRDDN--PGG..MSE-K...FLN........
CT5A_CONTE/2-60RCFP.VFIILLLLIA.......SAP.CFDAR--TKTD.......DDVP.LSSLR--DNL..KRT-I...RTR........
CO26_CONTE/2-70EKLTILLLVAAVLTS.....TQALI.QGGGD--ERQK.......AKINFLSRSD--........-.....RD..C.....
O3626_CONAE/2-76SGLGIMLLTLLLLVF....METSHQ.DAGEK--QATQ.......RDAINVRRRR--SLT..RR.-V...TEE..C.....
CM11_CONTS/2-70LKMGVVLFVFLVLFP......LATL.QLDAD--QPVE.......RYAENKQLVS--PYE..RRQ-I...ILH..A.....
CO16A_CONPL/1-79MKLTCVMIVAVLFLTA...WTFVTA.DSIRA--LEDL.......FAKAPDEMEN--SGA..SPL-N...ERD..C.....
H2BK07_CONMI/2-70LKMGVVLFIFLVLFP......LATL.QLDAD--QPVE.......RYAENKQLLS--PDE..RRE-I...ILH........
C0261_CONTE/2-76EKLTILLLVAVVLMS.....TQALP.QGGGE--KRPR.......ENIRFLSKRK--SNA..ERW-R...EGS..C.....
CM236_CONTE/3-90SKLGVLLTICLLLFP.....H.TAV.PLDGD--QHAD.......QPAERLQDDI--SSE..HHP-M...LNS..IRRREQ
CO14_CONST/1-73MKLTCMVIVAVLLLT.....A.....CQLIT--ADDS.......RGTQKHRSLR--STT..KVS-K...ATD..C.....
O226A_CONTE/2-71QKLIILLLVAAVLMS........TQ.ALFQE--KRPM.......KKIDFLSKGK--TDA..EKQ-Q...KRS..C.....
O1611_CONAE/1-78MKLTCVLIIAMLFLI.....VCQLN.TADDS--TDKQ.......EYRAVKLRDA--MRN..FKG-S...KRN..C.....
COW3_CONTE/2-63GKLTILVLVAAVLLS.....AQVMV.QGDGD--QPAD.......RKAVPREDNP--GGA..SGK-L...M..........
O1615_CONVE/1-72MKLTCVLIVAVLFLT.......ACQ.LTTAA--SYAR.......SERQHPDLGS--SDQ..NSK-L...TKR..C.....
O266_CONVE/2-76EKLTILLLVAAVLMS.....TQALI.QHDGE--KSQK.......AKMKFLTART--LSA..KTR-G...V.D..C.....
H2BKV0_CONTE/3-71SKLGALLIICLLLFP......LTAV.PLDGD--QHAD.......RPAERLQDDI--SSK..HHP-M...F..........
CT51_CONTS/2-60RCLP.VFIILLLLIP........SA.ASAAQ--PETK.......DDAA.LASFY--DNA..KRT-L...QRH........
CO27A_CONPE/2-71EKLTILLLVAAVLMS........TQ.AQNQE--QRQQ.......AKINFLSKRK--PSA..ERW-R....RD..C.....
O3610_CONPE/2-77SGLGIMVLTLLLLVF....METSHQ.DAGEK--QAMQ.......RDAINVRRRR--SIT..RR.-V...SEA..C.....
H2BJZ4_CONVA/2-70LKMGVVLFIFLVLFP......LATL.QLDAD--QPVE.......RYAENKQLLN--TDE..RRE-I...ILS........
O263_CONTS/2-72EKLTILLLVAAVLMS.......TQA.LIQRG--GAKR.......RKVNFFSIRE--PGA..EDW-R...EGN..C.....
CM235_CONVE/2-69LKMGVVLFIFLVLFT......LATL.QLDAD--QPVE.......RYAENKRLMS--PYK..RRA-I...LHA........
CO13_CONST/1-71MKLTCMVIVAVLLLT.....A.....CQLIT--ADDS.......RGTQKHRTLR--SKT..KLS-M...STR..C.....
CM231_CONVE/3-67SKLGALLTICLLLFP......LTAL.PLDGD--QPAD.......RPAERMQDDI--SSE..QHP-L...F..........
O1612_CONAE/1-75MKLTCVLIIAVLFLI......VCQL.NTADD--SRDK.......QEYRAVRLRD--AIR..NSR-G...SRS..C.....
COW2_CONTE/2-63GKLTILVLVAAVLLS.....TQAMA.QGDGD--QPAA.......RNAVPRDDNP--DGP..SAK-F...M..........
O1612_CONPE/1-76MKLTCMMIVAVLFLTA..WTVVTAV.PHSNK--RLAN.......LYLKARHEMK--NPE..ASN-V...DKR..C.....
O262_CONTS/2-76EKLTILLLLAAVLVL.....AQALIKKGGGE--KRQK.......EKINFLSKRK--TTA..ESW-W...EGE..C.....
CO16_CONTE/1-82MKLTCVVIVAVLFLTA...WTLVMA.DDSNN--GLAN......LFSKSRDEMED--PEA..AKL-E...KNY..C.....
O268_CONPE/2-71QKLIILLLVAAVLMS........TQ.ALFQE--KRLK.......EKINFLSKEK--ADA..EKQ-Q...KRY..C.....
O3611_CONPE/2-78SRLGIMVLTLLLLVF....IVTSHQ.DAGEK--QATQ.......RDAINFRWRR--SLI..RRT-A...TEE..C.....
CT53_CONTS/2-74LCLP.VFIILLLLAS.....PAAPN.PLERR--IQSD.......LIRTALEDAD--MKT..PKG-V...LSG..I.....
O366_CONTS/2-77SGLGIMVLTLLLFMF....MATSHQ.DAGEK--QATQ.......RDAINVRRRR--SIT..RRG-....DEE..C.....
O262_CONVE/2-72EKLTILLLVAAVLMS........TQ.ALIQE--KRPK.......EKIKFLSKRK--SIP..ESW-W...EGE..C.....
CO1K2_CONTE/1-77MKLTCMMIVAVLFLTA...WTFVTA.DDSGN--GLEN.......LFSKAHHEMK--NPE..ASN-L...NKR..C.....
O168_CONVE/1-78MKLTCMMIVAVLFLTA...WTFVTA.DSRNG--LEYL.......FPKAHYEMNP--EAS..KLN-K...KRD..C.....
CM4B_CONPE/3-69SKLGVLLIICLLLCP......LTAV.PQDGD--QPAD.......QPAERMQDDI--SSE..HHP-F...F..........
CT53_CONAE/2-66LCLP.VFIILLLLAS.....PAASN.PLEKR--IQND.......LIRAALEDAD--MEN..DPR-S...IID........
CO142_CONTE/1-75MKLTCMMIVAVLFLTA...WTFATA.DDSSN--GLEN.......LFLKAHHEMN--PEA..SKL-N...E.R..C.....
CM01_CONTE/3-67SKLGVLLITCLLLFP......LTAV.PLDGD--QPAD.......QPAERLQDDI--SSE..NHP-F...F..........
CO15_CONTE/1-76MKLTCMVIVAVLFLTA...WTFVTA.ITSNG--LENL.......FPNAHHEMKN--PEA..SKL-N...K.R..C.....
CT51B_CONAE/2-74LCLP.VFIILLLLAS.....PAASN.PLKTR--IQSD.......LIRAALEDAD--MKN..EKN-I...LSS..I.....
O1613_CONAE/1-81MKLTCVLIVALLFLTA...CQLTTA.DDSRD--KQED.......PLVRSHRKMQ--KSE..DPK-M...AER..C.....
CO16A_CONGE/1-72MKLTCVVIVAVLLLT.....A.....CQLIT--ADDS.......RGTQKHRALG--STT..ELS-L...STR..C.....
CO6B_CONPE/1-82MKLTCMMIVAVLFLTA..WTVVTAE.PHSSN--VLEN.......LYLKAHHEME--NPE..ASK-LNTRDDD..C.....
O269_CONPE/2-74EKLTILLLVAAVLMS.....TQALP.QGGGE--NRLK.......ENIKFLLKRK--TAA..DRG-M...WGD..C.....
CO12_CONTE/1-76MKLTCVVIVAVLFLTA..WTFVTAA.PHSSN--ALEN.......LYLKAHHEMN--NPE..DSE-L...NKR..C.....
CO6A_CONPE/1-74MKLTCMMIIAVLFLTA...WTFVMA.DDPRD--EPEA.......RDEM.....N--PAA..SKL-N...ERG..C.....

PF16981

CT1A_CONMR/1-58MRCLPVLIILLLLTA-------SAP-GVVVL..PKT.-------EDDVPMSSVY..GNG--KSI.L---RGI--------
CT51_CONIM/1-58MYCLPVFIILLLLIS-------SAP-STPPQ..PRN.-------KDRVHLISLL..DNH--KQI.L---QRD--------
H8Y818_CONIM/1-59MYCLPVFIILLLLIP-------SAP-SVDVQ..PIT.-------KNDVILDSLR..NVA--TKP.L---QRL--------
CT55_CONPL/1-59MRCVPVFIILLVLIA-------SAP-SVDAR..PQT.-------KDD.ALASFR..DSI--KRH.L---QTL--------
CTX1_CONPE/1-61MRCLPVFVILLLLTA-------SGP-SVDAKVHLKT.-------KGDGPLSSFR..DNA--KST.L---QRL--------
CT5_CONPE/1-60MHCLSVFVILLLLTA-------SAP-SVDAQ..PKT.-------EDDVPLSSFH..DDL--QRT.V---RTL--------
CT411_CONPE/1-60MRCFPVFIILLLLMA-------SAP-SFDAR..PKT.-------EDDVPLSSFR..DNL--KRT.L---RTL--------
CT02_CONPE/1-59MRCLPVFIILLLLIA-------SAP-SFDAL..PKT.-------EDNVPLSSFH..DNL--KRT.R---RIH--------
CT5AB_CONTE/1-59MRCFPVFIILLLLIA-------SAP-CFDAR..TKT.-------DDDVPLSPLR..DNL--KRT.I---RTR--------
CT154_CONTE/1-60MHCLPVFVILLLLTA-------SGL-SVDAR..PKT.-------EDDVPLSSFR..DNT--KST.L---QRL--------
Q9BH99_CONPE/1-57MHCLSVFVILLLLTA-------SAP-SVDAQ..PKT.-------EDGVLLSSFR..DNA--ERT.L---QKL--------
CT51_CONGL/1-60MRYLPVFVILLLLIA-------SIP-SDTVQ..LKT.-------KDDMPLASFH..GNG--RRI.L---RML--------
CT13_CONTE/1-60MRCLPVFVILLLLIA-------SVP-SDAVQ..LKT.-------KDDMPLPSFN..GNA--RRT.P---RML--------
CT111_CONTE/1-60MRCLPVFVILLLLIA-------STP-SDTVP..LKT.-------KDDMPQASFH..GNA--RRT.L---QML--------
H8Y819_CONIM/1-60MCCIPVFIILLLLIP-------SAP-SILGQ..PTT.-------KGDVALASSY..DDA--KRI.L---QRY--------
H8Y1U1_CONIM/1-60MCCIPVFFILLLLIP-------SAP-SILAQ..PTT.-------KGDVALASSY..DDA--KRT.L---QRL--------
CT5M_CONVE/1-60MHCLPVFVILLLLIA-------SAP-GVDVQ..PKT.-------KNFMTRASLR..DFA--KKT.P---KRL--------
CT52_CONVE/1-60MRCLPVFVILLLLIA-------SAP-GVDAQ..PKT.-------KYDVPLASRH..DFA--KKT.P---KRL--------
CT51_CONPL/1-61MRCVPVFVILLLLIA-------STP-SVDAR..PNP.-------KDDVPLASFH..EDA--NGI.L---QML--------
CT51B_CONVR/1-60MLCVPVFIILFIIIP-------FAP-TSESQ..PKT.-------KEEVAKASVH..DNA--ERT.L---QRL--------
CTMI_CONMI/1-60MRCVPVFIILLLLIP-------SAS-SVDVQ..PLT.-------RDDVPLASFL..DDA--RRT.L---RSP--------
CT05_CONVE/1-60MRCLPVFIILLVLSA-------SAP-SVDAR..PKN.-------EDDVSLASFH..DNA--QRT.L---QRL--------
CXT52_CONQU/1-59MRCVPVFIILLLLSP-------SAP-SVDAH..PMT.-------KDDVPQASLH..DDA--KRT.L---QVP--------
CT121_CONLI/1-60MRCVPVFIILLLLSP-------SAP-SVDAH..PKT.-------KDDVPLASFH..DDA--KRT.L---QRL--------
CT03_CONTS/1-59MRCLPVFIILLLLIP-------SAA-SV.AQ..PKT.-------KDDVALASFY..DNA--KRT.L---QRH--------
CT5A_CONPU/1-60MRCLPVFVILLLLIP-------SAP-CVDAH..PKT.-------KDDMPLASFH..DNA--KGT.L---QRF--------
CT5B_CONVR/1-56MRCVPVFIILLLLIP-------SAP-SAAVQ..PKTE-------KDDVPLASFH..DSA--MRI.L---S..--------
CT51A_CONVR/1-60MRCVPVFIILLLLIP-------SAP-SADAQ..PKT.-------KDDVPLASYH..DNA--ERT.L---QRL--------
CT53_CONLT/1-60MRFLPVFIILLLLIP-------SAP-SVDAQ..PMT.-------KDDVPLSSLH..DNA--KRA.L---QMF--------
CT55_CONLT/1-60MRCLQVFIIFLLLIP-------SPP-SVDAQ..RKT.-------KDDVPLASFH..DNA--KRT.L---KRL--------
CT11_CONLE/1-59MRCLPVFIILLLLIP-------SAP-SVDAQ..PKT.-------EDDVPLASLH..DNA--KLT.L---QGL--------
CTDA_CONTE/1-58MRCLPVFVILLLLIA-------SVP-SVDAE..LKA.-------KDDMPQASFH..DNA--ERD.Q---QKK--------
CT54_CONVE/1-61MRCLPVFVILLLLIA-------SAP-SVDAR..PKT.-------KDDVPLASFH..GNA--ERTLL---NIL--------
CT5A_CONSP/1-59MRCLPVFVILLLLIA-------SAP-SVDAQ..LKT.-------KDDVPLASFH..DNA--KGT..---QHK--------
CT53_CONCB/1-59MRCVPVFIILLLLIA-------SAP-GVDAQ..PKT.-------KYNAPLTSLH..DNA--KGI.L---QEH--------
CT56_CONPL/1-56MRCVPVFVILLLLIA-------SAA-SIDAQ..QKT.-------KDDAPLTSLN..DNA--....L---QQH--------
CT593_CONTE/1-59MRCLPVFVILLLLIA-------SAP-SVDAQ..PKT.-------KDDIPQASFL..DNA--KRY.L---QVL--------
CT14_CONPE/1-59MRCLPVFVILLLLIA-------SAP-SVDAR..PKT.-------KDDIPLVSFQ..DHA--KRI.L---QTF--------
CT151_CONTE/1-59MRCLPVFVVLLLLIA-------SAP-SVDAQ..PKT.-------KDDVPLAPLH..DNI--QNT.L---QTL--------
CT011_CONTS/1-61MHCLPVLVILLLLIA-------STP-SVDAR..PKT.-------KDDVPLASFHGADNA--NRI.L---RTL--------
H8Y821_CONMR/1-58MRCLPVFVILLLLIA-------SAP-SVDAR..LKT.-------K.DMPLPSSH..ANI--KRT.L---QIH--------
CT52_CONMR/1-60MRCVPVFVILLLLIA-------SAP-TVDAQ..LKT.-------KDDMPLASFH..ANV--KRT.L---QIL--------
CT21_CONTE/1-60MRCLPVFVILLLLIA-------STP-SVDAR..AKT.-------RDDMSLASFH..DDA--KRI.L---QIL--------
CT34_CONBE/1-60MRGLPVFVILLLLIA-------SEP-SVDAR..PKT.-------KADVPLTSLN..DNA--KRT.L---QIL--------
CT5M_CONPE/1-57MRCLPVFVILLLLIA-------STP-SVNAR..PKT.-------KD...LASFH..DNA--KRT.Q---HIF--------
CT51_CONTE/1-58MCCLPVFVILLLLIA-------SAP-SVDAQ..PKT.-------KDDVPLAPLH..DNA--KSA.L---QHL--------
CT243_CONLT/1-60MRCLPVFVILLLLIA-------STP-SIDAR..PKT.-------KDDMPLASFN..DNA--KRI.L---QIL--------
CT54_CONTE/1-59MRCLPVFVILLLLIA-------STP-SVDAQ..LKT.-------KDDMSLASFH..DNV--KRI.L---QIR--------
CT151_CONPE/1-60MRCLPVFVILLLLIA-------STP-SVDAL..QKT.-------KDDMPLASFH..DNV--KRI.L---QTL--------
CT121_CONPE/1-60MCCLPVFVILLLLIA-------SAP-SVDAL..PKT.-------KDDMSLASFH..DNA--KRT.L---QIL--------

PF11478

TACB2_TACTR/1-42-------------------------------------------------------------------------------Y
TACB1_TACTR/1-42-------------------------------------------------------------------------------Y

PF11406

TACA2_TACTR/24-67-------------------------------------------------------------------------------Y
TACA1_TACTR/1-44-------------------------------------------------------------------------------Y

PF05980

TAG2F_AGEOR/36-69--------------------------------------------------------------------------------
TAG2R_AGEOR/36-69--------------------------------------------------------------------------------
TAG2J_AGEOR/36-69--------------------------------------------------------------------------------
TAG2K_AGEOR/35-68--------------------------------------------------------------------------------
TAG2O_AGEOR/35-68--------------------------------------------------------------------------------
Q5Y4X8_AGEOR/35-68--------------------------------------------------------------------------------
TAG2L_AGEOR/36-69--------------------------------------------------------------------------------
TAG2Q_AGEOR/36-69--------------------------------------------------------------------------------
TAG2N_AGEOR/36-69--------------------------------------------------------------------------------
TAG2D_AGEOR/36-69--------------------------------------------------------------------------------
TAG2U_AGEOR/35-68--------------------------------------------------------------------------------
TXMG4_AGEAP/1-34--------------------------------------------------------------------------------
TAG3K_AGEOR/35-68--------------------------------------------------------------------------------
TAG3J_AGEOR/35-68--------------------------------------------------------------------------------
TXMG6_AGEAP/1-34--------------------------------------------------------------------------------
TAG3F_AGEOR/36-69--------------------------------------------------------------------------------
TAG3I_AGEOR/35-68--------------------------------------------------------------------------------
TAG3E_AGEOR/35-68--------------------------------------------------------------------------------
TAG3A_AGEOR/34-67--------------------------------------------------------------------------------
TXMG2_AGEAP/1-34--------------------------------------------------------------------------------
TXDP4_PIRLC/1-34--------------------------------------------------------------------------------
TXDP1_PIRLC/1-34--------------------------------------------------------------------------------
TXAG5_AGEOR/35-68--------------------------------------------------------------------------------
TX10A_HAPSC/41-72--------------------------------------------------------------------------------
C7TRQ6_SCHJA/23-56--------------------------------------------------------------------------------
TAG2W_AGEOR/36-69--------------------------------------------------------------------------------
TAG2Y_AGEOR/35-68--------------------------------------------------------------------------------
TA2GE_AGEOR/36-69--------------------------------------------------------------------------------
TAG2T_AGEOR/36-69--------------------------------------------------------------------------------
TAG2P_AGEOR/36-69--------------------------------------------------------------------------------

PF08094

C7A_CONTU/1-30--------------------------------------------------------------------------------
CGS_CONGE/1-33--------------------------------------------------------------------------------

PF08089

TXL1_LASSB/51-99-------------------------------------------------------------------------------F
TXP1_BRASM/1-39-------------------------------------------------------------------------------I
B3FIU5_HAPSC/49-85-------------------------------------------------------------------------------L

PF06357

TO1F_HADVE/1-37-------------------------------------------------------------------------------S
TO1A_HADVE/1-37-------------------------------------------------------------------------------S

PF08091

TXP3_APOSC/1-37--------------------------------------------------------------------------------
CALC_CALS5/1-39--------------------------------------------------------------------------------

PF05353

TXMG4_MACGS/63-105--------------------------------------------------------------------------------
TXM14_MACGS/27-68--------------------------------------------------------------------------------
TDT1B_HADVE/1-42--------------------------------------------------------------------------------
TXDT1_HADSP/1-42--------------------------------------------------------------------------------
TDM1A_MISBR/1-42--------------------------------------------------------------------------------

PF02819

TX32_PHONI/39-81--------------------------------------------------------------------------------
TOG4A_AGEAP/4-48--------------------------------------------------------------------------------
TX31_PHONI/40-82--------------------------------------------------------------------------------
TXP8_PLETR/17-61--------------------------------------------------------------------------------
TOG4B_AGEAP/39-83--------------------------------------------------------------------------------
TX3A_PHONI/39-80--------------------------------------------------------------------------------

PF05039

G3SVT4_LOXAF/43-129.KLLDFPSV...........SVVALNKKSKRILSRKE..AEMMKGPSK...KKA--SVK--.........KAARPRPPPP
G7PGK3_MACFA/42-125VNLLDFPSV...........SIVALNKNSKQI.SRKE..AEKK.RSSK...VRA--GKP--.........PSLRPAWPPA
ASIP_HUMAN/42-127VNLLDVPSV...........SIVALNKKSKQI.GRKA..AEKK.RSSK...KEA--SMK--.........KVVRPRTPLS
F6XD58_MONDO/39-130.SQALYPGLLHS........AGPGIQPELEQM.ASEL..AGESFMQ.....DTE--ALA--...PGMLDLQDREER.SP.
H0VZP4_CAVPO/41-127KNFVDFPSV...........SIVGSTEQEIQN.SKKE..AEKRKRSSK...KKA--SMK--.........EVKPPRPPPP
U3K7P9_FICAL/53-134....DLPPI...........SIVDLTRKSQKV.SRKE..AENK.KSSK...KNA--KRK--.........ISPKPRPPPA
G3TG92_LOXAF/34-123SDHALFPAF...........PGLGLRPALKRT.VEGQ..AEEALLQ.....EAE--ALA--EVTAQALD...REPR.SA.
F7H591_MACMU/34-122PDQALFPEL...........PGLGLRAPLKKT.TAEL..AEEDLLQ.....EAQ--ALA--....EVLDSQDREPR.SS.
G1T0P8_RABIT/41-127TNLLEFSSV...........SIVALNKKSKDI.SIKE..AEKKKRSSK...KKA--SKK--.........KVARPRPLLP
W5KRC1_ASTMX/43-124QNHTSSPSI...........LIVELSNSSKKS.KTSE..KKQKKMQMK...LNG--QVK--..............RPLPP
F7DQS7_ORNAN/43-129ASM.................PDAALRPEMERM.AAELAKVEDIIAQGR...VSR--ALR--....QVPDLQGREER.SP.
AGRP_PIG/34-124LDQALFPEL...........QDLGLQPPLKRT.TAER..AEEALLQQA...EAK--ALA--....EVLDPEGRKAR.SP.
I3M2D9_SPETR/42-128MKVLDIPSV...........SIVALNKKSQKI.SRTE..AEKRTRSSK...KKA--PMK--.........KVARPRPPPP
C0A1C9_CHICK/49-156ADRARYPSLLHKAKEASVELAGALPRPDLDQM.ALEVQEGDGNLLQKSSVLEPQ--ALS--....TALQAAGREERSSP.
B4YAJ9_SHEEP/42-128MNLLDFPSV...........SIVALNKKSKKI.SRNE..AEKKKRASK...RKA--PMK--.........NVARTRPPPP
H0VHZ8_CAVPO/34-122PDQVLFPDF...........PGLGQHVPLKRT.TAEQ..AEEALLQ.....KAE--ALA--....EVLDPQNREPR.TP.
L5LI85_MYODS/44-132PDEALFSEL...........SDLGLRRELKRT.AVEQ..AEEALLQ.....EAK--DLA--....EALDPEEREPR.SQ.
E2RJQ9_CANFA/34-122PDQALFPEL...........PGLGLQSSLKRA.TAEQ..SEEALLQ.....EAE--ALA--....EVLDPEGREPR.SP.

PF11703

G7YD78_CLOSI/34-91------DHEHCN--------RSSECC---------------L--G-------------VC--MNHT.--------CR---
G7Y4U0_CLOSI/24-81------VGAFCL--------NSSECC---------------S--R-------------KC--.ILK.--------CK---
G4VLW5_SCHMA/26-84------GGYFCW--------TDKECC---------------S--G-------------KC--SWLK.--------CT---
G4M208_SCHMA/29-87------FKSFCM--------SNKECC---------------S--K-------------KC--HLST.--------CK---
H2KPG9_CLOSI/24-82------DGHACA--------HDSHCC---------------S--G-------------NC--RWLR.--------CR---
G7YUW6_CLOSI/40-99------PGKFCL--------RTKDCC---------------Q--G-------------KC--LFFF.--------CR---
A0A068Y8W4_ECHMU/21-80------QGHFCF--------SDGECC---------------S--N-------------DC--AWYRF--------CR---
G4VLW4_SCHMA/162-220------EGTLCV--------SDKNCC---------------S--H-------------KC--NIGK.--------CT---
G7YI46_CLOSI/30-88------VNHTCV--------KDSECC---------------S--S-------------YC--HLLR.--------CG---
G4VLW4_SCHMA/104-161------TGYSCL--------HNGECC---------------S--R-------------NC--WLFR.--------C.---
A0A068XBH6_HYMMI/23-82------SSHFCF--------RDSECC---------------S--R-------------NC--AWYFF--------CK---
G7Y700_CLOSI/24-82------VSYPCA--------RNAHCC---------------S--G-------------KC--EWFQ.--------CQ---
G4VD24_SCHMA/21-78------ANSPCI--------HANDCC---------------R--G-------------AC--IKGS.--------CK---
G4VMF1_SCHMA/36-92------INKLCF--------RSSDCC---------------S--G-------------RC--WFFH.--------CK---
G7YI45_CLOSI/25-83------LEHGCL--------SDDECC---------------S--K-------------RC--HWFQ.--------CK---
G4VBF7_SCHMA/36-95------KGRFCL--------RSRECC---------------D--K-------------YC--FFFK.--------CR---
G4VME9_SCHMA/59-115------LEVDCQ--------YNQQCC---------------S--G-------------LC--FKNV.--------CT---
G4LWF3_SCHMA/2-62------SKEQCV--------DNVDCC---------------S--G-------------HC--LNGH.--------CR---

PF08087

Q80LL0_NPVAH/21-51------TGRNCQ--------TNAECC---------------S..G-------------ACSAAFGF---------CLHR-
Q9YMR0_NPVLD/20-52------TGRNCK--------YSYTRC---------------SGGG-------------ARSAAFGL---------CLPR-
Q8JM47_9ABAC/20-50------TGRNCK--------YSYECC---------------S..G-------------ACSAAFGF---------CLHR-
CXOL2_NPVOP/22-52------TGRNCQ--------YSYECC---------------S..G-------------ACSAAFGF---------CLHR-
CXOL1_NPVOP/23-53------TGAVCV--------HSDECC---------------S..G-------------ACSPVFNY---------CLPQ-
H6UPN5_9ABAC/23-53------TGAVCV--------HNDECC---------------S..G-------------ACSPIFNY---------CLPQ-
Q9YMH9_NPVLD/23-53------TGAVCV--------HSDECC---------------S..G-------------ACSPVFNY---------CLPQ-

PF08027

K7M0N2_SOYBN/29-63------TG------------------------------------------------------------------------
K7M0N1_SOYBN/11-45------TG------------------------------------------------------------------------

PF16720

I1KW03_SOYBN/76-123------SGKFCARYPNPES-EYGWCI---------------D--S-------------DSEALKGFLKM-----------
K7M0N1_SOYBN/55-102------SGNFCARYPNNYI-DYGWCF---------------D--S-------------DSEALKGFLAM-----------

PF07473

CP91_CONGL/61-88----------C------------ICT---------------F--R-------------GCGAVNG---------------
CP91_CONRE/57-83----------C------------FCH---------------P--E-------------EKVCYRE---------------

PF08099

SCXC_SCOMA/1-33------HLKLCKE-------NKD-CC------------------S-------------KKCKRRGTNIE--KR--CR---
IPTXA_PANIM/1-33------HLKRCKA-------DND-CC------------------G-------------KKCKRRGTNAE--KR--CR---

PF07740

WGRTX_GRARO/50-81------FWGKCSQ-------TSD.CC-------------..P--H-------------LACKSK....WPRNI..CVW--
H3A12_HAPHA/49-79------FGDSCTP-------GKNECC-------------..P--N-------------YACSSK....H..KW..CKV--
H1A03_HAPHA/49-79------FGKSCVP-------GKNECC-------------..S--G-------------YACNSR....D..KW..CKV--
TX27_PHONI/2-36------RFSLCNS-------DKE.CC-------------..K--G-------------LRCQSRIANMW.PTF..CSQ--
TX5B_HETVE/2-34------LFHSCES-------NAD.CC-------------..E--N-------------WACATTG.RFR..YL..CKY--
H8A01_HAPHA/53-81------YMRECK.-------EKL.CC-------------..S--G-------------YVCSSR....W..KW..CVL--
TX5A_HETVE/3-35------IMDDCTS-------DSD.CC-------------..P--N-------------WVCSKTG.FVK..NI..CKY--
TXHN1_GRARO/1-30------LFGGCKT-------TSD.CC-------------..K--H-------------LGCKFR....D..KY..CAW--
TXPR1_THRPR/1-30------WLGGCSA-------GQT.CC-------------..K--H-------------LVCSRR....H..GW..CVW--
TXHP1_HETVE/1-29------IWHYCGT-------DQSECC-------------..E--G-------------WKCS......R..QL..CKY--
TXHA5_HAPHA/1-33------FGKGCNP-------SNDQCC-------------KSA--N-------------LVCSRK....H..RW..CKY--
TXMG8_MACGS/46-76------LFRQCKK-------SSE.CC-------------..K--G-------------SSCESDL.TGL......CIF--
TX2_THEBL/2-32------MFSSCDP-------KNDKCC-------------..P--N-------------RVCRSR....D..QW..CKY--
TXP5_BRASM/1-30------FQTKCKK-------DSD.CC-------------..G--K-------------LECSSR....W..KW..CVY--
TX1_THEBL/2-32------MFESCDP-------NNDKCC-------------..P--N-------------RECNRK....H..KW..CKY--
TX32_PHOKE/2-36------RGQLCFS-------DKL.CC-------------..I--G-------------LRCKSRV.ANMWPTF..CLV--
TXH4_HAPSC/53-85------IFKACNP-------SNDQCC-------------KSS--K-------------LVCSRK....T..RW..CKY--
TX2_HETMC/1-34------FWGECND-------EMV.CC-------------..E--H-------------LVCKEK....WPITYKICVW--
M5AY85_GRARO/47-78------FWWKCNP-------NDDKCC-------------.RP--K-------------LKCSKL....F..KL..CNF--
JZT1B_CHIGU/30-60------FWWKCGE-------GKPPCC-------------..A--N-------------FACKIG....L..YL..CIW--
TX1_HETMC/1-30------LFGGCSS-------TSD.CC-------------..K--H-------------LSCRSD....W..KY..CAW--
TX1_STRGF/1-30------LFGGCKT-------TAD.CC-------------..K--H-------------LACRSD....G..KY..CAW--
TXH1_HAPSC/49-79------VFDACTP-------GKNECC-------------..P--N-------------RVCSDK....H..KW..CKW--
TXU2_HETVE/2-28------LFSGCDS-------NAD.CC-------------..E--G-------------YVCR.........LW..CKY--
B3FIU4_HAPSC/51-80------YLGGCSQ-------DGD.CC-------------..K--H-------------LQCHSN....Y..EW..CVW--
TX482_HYSGI/6-35------MFGGCSV-------NDD.CC-------------..P--R-------------LGCHSL....F..SY..CAW--
VSTX1_GRARO/1-30------FMWKCKN-------SND.CC-------------..K--D-------------LVCSSR....W..KW..CVL--
TX1_STRCF/1-30------MFGACRR-------DSD.CC-------------..P--H-------------LGCKPT....S..KY..CAW--
TX27_PHORI/2-36------RGLLCFR-------DKE.CC-------------..K--G-------------LTCKGRF.VNTWPTF..CLV--
TXHP3_HETVE/1-27------LFSGCST-------HAD.CC-------------..E--G-------------FICK.........LW..CRY--
TXL1_HAPSC/50-77------..DKCDY-------NNG.CC-------------..S--G-------------YVCSRT....W..KW..CVL--

PF08093

TXM11_MACGS/51-78------TFWRCKK-------DKE-CC--------------GW--N-------------.ICT.G----L------CIPP-
TOT2A_HADIN/60-89------NTLGCSS-------DKD-CC--------------GM--T-------------PSCTLG----I------CAPS-
TOT2B_ATRIL/59-87------SRV.CSS-------DAN-CC--------------GL--T-------------PTCKMG----L------CVPK-
TXR3_MACRV/1-29------TFWKCKN-------KKE-CC--------------GW--N-------------.ACALG----I------CMPR-
TOT2A_HADVE/3-32------GNGRCSS-------NRD-CC--------------EL--T-------------PVCKRG----S------CVSS-

PF08117

IOB1_ISYOB/2-36------RGSKCLG-------ENKQCC-------------E.K--T-------------TCMFYA-------NR--CVGI-
PTU1_PEITU/1-34------PGAPCFG-------TDKPCC-------------NPR--A-------------WCSSYA-------NK--C..L-

PF08092

TXPT6_MACGS/61-98------YDIECNE-------RLH.CC-------------AD.--.-------------LECVKTSGR.WWYKKTYCRRKS
TXLT4_LASSB/58-97------VDAPCDK-------DRPDCC-------------SY.--.-------------AECLRPSGYGWWHGTYYCYRKR
TXMG2_MACGS/81-120------YDIECNE-------NLP.CC-------------KHR--K-------------LECVETSGY.WWYKRKYCRPIK

PF08008

Q77ZH3_CSIVT/110-192------NWKYCRG-------INKPCCGQQLMEDGTL...GPK--H-------------FVCFE-----LGQGI--CTPLS
Q98825_CSIVT/36-118------NYQPCIE-------STKPCC...RLEDRTSVQFGRK--E-------------YICDR-----FFGGL--CAPLD
Q98825_CSIVT/169-250------NNKPCIE-------STESRC...RLENRTLVQFGRE--E-------------DIYGR-----FLGGI--YAPLI

PF07945

TK1C_HADVE/1-35------ADRPCAA-------CCP-CC---------------P--G-------------TSCKA.----ESNGVSYCRKD-
TK1B_HADVE/1-36------ADRPCAA-------CCP-CC---------------P--G-------------TSCQGP----EPNGVSYCRND-

PF05374

CM3A_CONGE/51-72------PPKKCKD-------RQ--CK---------------P--Q-------------RCCA------------------
CM3A_CONPU/51-72------FPKSCRS-------RQ--CK---------------P--H-------------RCCG------------------
CM3B_CONGE/1-22------PPRKCKD-------RR--CK---------------P--M-------------KCCA------------------
CM3C_CONGE/1-22------PPKKCKD-------RR--CK---------------P--L-------------KCCA------------------

PF02950

CO27A_CONTE/2-73...GG-YSTYC.....EVD-SE--CC---------------S--D.....--------NCV.....RSY------CT---
CO7_CONTE/1-76...KQ-ADEPC....DVFS-LD--CC---------------T--G.....--------ICL......GV------CM---
CM31_CONTE/2-70.....-..........ALR-KF--CC---------------D--S....N--------WCHI..SDCEC------CY---
CM237_CONTS/3-67.....-...........PV-KR--CC---------------D--W.....--------PCTI..GCVPC------CL---
O2651_CONLT/2-74...KD-GLTTC.....LAP-SE--CC---------------S--G.....--------NCEQ...N...------CK---
O367_CONTS/2-78...DE-...YC....EDLN-KN--CC---------------G--LSNGEP--------VCA......TA------CL---
CT52_CONAE/2-65.....-........GL.VT-GA--CC---------------A--VL...K--------F.......SFC------CG---
CT54_CONTS/2-72...IS-TIK......DFAG-KV--CC---------------S--VS...V--------N........FC------CP---
CM132_CONPE/2-70.....-.........ALRQ-WQ--CC---------------T--M....A--------WCDS...GCLC------CE---
CM3_CONTE/2-68.....-..........DAT-RR--CC---------------N--A....G--------FCRF..GCTPC------CY---
O1613_CONPE/1-76...IA-ESEPC....NIIT-QN--CC---------------D--G.....--------KCL......FF------CI---
O1617_CONAE/1-68...TP-VGGSC.....SRH-YH--CC---------------S--L.....--------YCNK...NIGQ------CL---
CO14_CONTE/1-81...EP-PGNFCG..MIKIG-PP--CC---------------S--G.....--------WCF......FA------CA---
CM233_CONVE/3-66.....-...........PV-KR--CC---------------S--Q.....--------DCRV...CIPC------CP---
O3620_CONVE/2-78...KE-...YC....EDRD-KT--CC---------------G--LENGQP--------DCA......NL------CL---
CT52_CONGL/2-60.....-.........TLRK-KV--CC---------------R--P.....--------V.......QDC------CS---
CO1X1_CONTE/1-76...LD-AGEVC....DIFF-PT--CC---------------G--......--------YCI.....LLF------CA---
CM231_CONAE/3-68.....-..........NPI-KR--CC---------------D--W.....--------PCTI..GCVPC------CK---
O3621_CONVE/2-74...YE-...YC....KEQN-KT--CC---------------G--ISNGRP--------ICVG...G...------CI---
O1614_CONPE/1-83...QR-RWDFCP.GALVGV-IT--CC---------------G--G....L--------ICL.....GVM------CI---
O1610_CONVE/1-77...RP-GGMICG..FPKPG-PY--CC---------------S--G.....--------WCF......VV------CL---
CM02_CONTS/2-70.....-.........ALRQ-RD--CC---------------E--Q....G--------WCDG...GCDC------CQ---
CT122_CONPE/2-61.....-...........NK-RY--CC---------------Y--......--------F.D....Y.SC------CL---
CT56_CONVE/2-71...ID-SIS......DVAK-QI--CC---------------Q--IT...V--------DC.........------CV---
O1618_CONAE/1-74...SP-NGGSC.....SRH-YH--CC---------------S--L.....--------WCNK...DSGV------CV---
O1613_CONTE/1-78...KQ-SGEMC....NLLD-QN--CC---------------D--G.....--------YCI.....VFV------CT---
CM131_CONAE/2-67.....-...........IV-KK--CC---------------T--......--------ACRM..PPCKC------CA---
O264_CONVE/2-74...TG-WLDGC.....TSP-AE--CC---------------T--A.....--------VCDA...T...------CK---
O1618_CONVE/2-73...ST-A..GC......KN-VP--CC---------------E--G....L--------VCTGP.SQGPV------CQ---
O1611_CONVE/1-79...EA-GGRFCG..FPKIG-EP--CC---------------S--G.....--------WCF......FV------CA---
O1619_CONAE/1-75...TV-DSDFC....DPDN-HD--CC---------------S--G.....--------RCIDE.GGSGV------CA---
H2BKF9_CONCE/3-69.....-..........DPN-KR--CC---------------D--D....S--------ECSY..SCWPC------CY---
O168_CONAE/1-74...LP-PLSLC....NMAD-DD--CC---------------N--......--------DCV.....LFL------CS---
O261_CONTE/2-73...MA-WFGLC.....SKD-SE--CC---------------S--N.....--------SCD.....VTR------CE---
O265_CONVE/2-77...RT-WYAPC.....NFP-SQ--CC---------------S--E.....--------VCSS...KTGR------CL---
CO16B_CONST/1-72...KL-KGQSC....RKTS-YD--CC---------------S--G.....--------SCGR...S.GK------CG---
O163_CONAE/1-80...RA-LGEYCG.LPYVHN-SR--CC---------------S--Q.....--------LC......GFI------CV---
O1612_CONVE/1-87...IE-DKKYCGILPFANS-GV--CC---------------S--Y.....--------LC......IFV------CV---
CO16E_CONST/1-78...SS-GGTFC...GI.HP-GL--CC---------------S--E.....--------FCF......LW------CI---
H2BKT2_CONVT/3-72.....-.........VKKK-QQ--CC---------------P--P....V--------ACNM..GCEPC------CG---
O162_CONAE/1-78...VD-GGTFCG..FPKIG-GP--CC---------------S--G.....--------WC......IFV------CL---
CO16B_CONMR/1-82...SK-KWEYCI.VPILGF-VY--CC---------------P--G....L--------ICG....P.FV------CV---
CO16A_CONST/1-72...RS-SGSPC....G.VT-SI--CC---------------G--......--------RCY.....RGK------CT---
CO12A_CONPL/1-74...NT-PTQYC.....TLH-RH--CC---------------S--L.....--------YCHK...TIHA------CA---
O1613_CONVE/1-83...RQ-PGEFC....FPVV-AK--CC---------------G--G.....--------TCL......VI------CI---
CO1K1_CONTE/1-77...IE-QFDPC....EMIR-HT--CC---------------V--G.....--------VCF.....LMA------CI---
CM23B_CONTS/3-66.....-...........PV-KR--CC---------------S--R.....--------YCYI...CIPC------CP---
CO15_CONST/1-72...ME-AGSYC....GSTT-RI--CC---------------G--......--------YCAY...FGKK------CI---
O236D_CONTE/2-72...PD-YTDPC.....SHA-HE--CC---------------S--W.....--------NCYN..GH...------CT---
O1610_CONAE/1-76...AD-LGEEC......YT-RF--CC---------------P--G....L--------RCKD..LQVPT------CL---
COW1_CONTE/2-63.....-..........ALQ-RR--GC---------------P--W....Q--------.........PY------CG---
CT5A_CONTE/2-60.....-..........LNI-RE--CC---------------E--D....G--------WC.........------CT---
CO26_CONTE/2-70...RG-YDAPC.....SSG-AP--CC---------------D--W....W--------TCSA...RTNR------CF---
O3626_CONAE/2-76...EE-...NC....EEEE-KH--CC---------------N--TNN.GP--------SCA......PQ------CF---
CM11_CONTS/2-70...LG-Q............-RQ--CC---------------D--W....Q--------WCDG...ACDC------CA---
CO16A_CONPL/1-79...RP-VGQYCG.IPYEHN-WR--CC---------------S--Q.....--------LCA......II------CV---
H2BK07_CONMI/2-70.....-..........ALG-TR--CC---------------S--W....D--------VCDH..PSCTC------CG---
C0261_CONTE/2-76...TS-WLATC.....TDA-SQ--CC---------------T--G.....--------VCYK...R.AY------CA---
CM236_CONTE/3-90NQFMS-FTSV.K.LRDSRG-ER--CC---------------G--P....T--------ACMA..GCRPC------CG---
CO14_CONST/1-73...IE-AGNYC...GPTVM-KI--CC---------------G--......--------FCSP...YSKI------CM---
O226A_CONTE/2-71...SD-DWQYC.....ESP-TD--CC---------------S--W.....--------DCD......VV------CS---
O1611_CONAE/1-78...GE-QGEGC......AT-RP--CC---------------A--G....L--------SCVGS.RPGGL------CQ---
COW3_CONTE/2-63.....-.........DVLR-PK--KC---------------V--LY...P--------W..........------CG---
O1615_CONVE/1-72...LG-SGETC.....WLD-SS--CC---------------S--F.....--------SCT....N.NV------CF---
O266_CONVE/2-76...VG-LSSYC...GPWNN-PP--CC---------------S--W....Y--------TCD......YY------CK---
H2BKV0_CONTE/3-71.....-..........DAV-RG--CC---------------H--P....S--------TCHMRKGCSRC------CS---
CT51_CONTS/2-60.....-..........WAK-SL--CC---------------P--ED...A--------WC.........------CS---
CO27A_CONPE/2-71...TS-WFGRC.....TVN-SE--CC---------------S--N.....--------SCD....Q.TY------CE---
O3610_CONPE/2-77...EE-...SC....EDEE-KH--CC---------------H--ENNGVY--------TCL......RY------CW---
H2BJZ4_CONVA/2-70.....-.........ALRT-RV--CC---------------P--F....G--------GCHE...LCQC------CE---
O263_CONTS/2-72...TP-WLGGC.....TSP-EE--CC---------------P--G.....--------NCE......TY------CR---
CM235_CONVE/2-69.....-..........PRE-QE--CC---------------E--P....Q--------WCDG...GCDA------CC---
CO13_CONST/1-71...KA-AGKPC....SRIA-YN--CC---------------T--G.....--------SCR.....SGK------CG---
CM231_CONVE/3-67.....-..........DKE-RQ--CC---------------T--G.....--------SCLN...CWPC------CG---
O1612_CONAE/1-75...GN-LGESC......SA-HR--CC---------------P--G....L--------MCMG...EASI------CI---
COW2_CONTE/2-63.....-.........NVQR-RS--GC---------------P--WE...P--------W..........------CG---
O1612_CONPE/1-76...FE-SWVAC.....ESP-KR--CC---------------S--H.....--------VCL......FV------CA---
O262_CONTS/2-76...SG-WSVYC.....TSD-PE--CC---------------S--G.....--------ECS.....SYY------CE---
CO16_CONTE/1-82...QE-KWDYCP.VPFLGS-RY--CC---------------D--G....L--------FCT.....LFF------CA---
O268_CONPE/2-71...SD-QWKSC.....SYP-HE--CC---------------R--W.....--------SCN......RY------CA---
O3611_CONPE/2-78...EE-...YC....EDEE-KT--CC---------------G--LEDGEP--------VCA......TT------CL---
CT53_CONTS/2-74...MS-NLGTV...GNMVG-GF--CC---------------T--V.....--------Y.......SGC------CS---
O366_CONTS/2-77...NE-...YC....DDRN-KE--CC---------------G--RTNGHP--------RCA......NV------CF---
O262_CONVE/2-72...SG-WSVHC.....TQH-SD--CC---------------S--G.....--------ECT.....GSY------CE---
CO1K2_CONTE/1-77...AP-FLHPC....TFFF-PN--CC---------------N--S.....--------YCV....Q.FI------CL---
O168_CONVE/1-78...VA-GGHFCG..FPKIG-GP--CC---------------S--G.....--------WCF......FV------CA---
CM4B_CONPE/3-69.....-..........DPV-KR--CC---------------K--YG...W--------TCWL...GCSP------CG---
CT53_CONAE/2-66.....-..........SVK-TF--CC---------------S--TF...N--------L.......GIC------CS---
CO142_CONTE/1-75...LD-AGEIC....DFFF-PT--CC---------------G--......--------YCI.....LLF------CA---
CM01_CONTE/3-67.....-..........DPV-KR--CC---------------R--L.....--------LCLS..CN.PC------CG---
CO15_CONTE/1-76...VP-YEGPC....NWLT-QN--CC---------------D--A.....--------TCV.....VFW------CL---
CT51B_CONAE/2-74...MG-SLGTI...GNVVG-NV--CC---------------S--IT...K--------SC.........------CA---
O1613_CONAE/1-81...SN-FGSDC....IPAT-HD--CC---------------S--G.....--------ECFGF.EDMGL------CT---
CO16A_CONGE/1-72...KS-PGSSC....SPTS-YN--CC---------------R--......--------SCNP...YTKR------CY---
CO6B_CONPE/1-82...EP-PGNFCG..MIKIG-PP--CC---------------S--G.....--------WCF......FA------CA---
O269_CONPE/2-74...DD-WLAAC.....TTP-SQ--CC---------------T--E.....--------VCD......GF------CR---
CO12_CONTE/1-76...YD-SGTSC.....NTG-NQ--CC---------------S--G.....--------WC......IFV------CL---
CO6A_CONPE/1-74...LE-VDYFCG.IPFANN-GL--CC---------------S--G.....--------NCV......FV------CT---

PF16981

CT1A_CONMR/1-58----------------LRN.GV..CC---------------G--Y---------------------KL.------.C---
CT51_CONIM/1-58----------------WNS.....CC---------------G--K---------------------NPG------CC---
H8Y818_CONIM/1-59----------------LNT.R...CC---------------I--K---------------------FHP------CC---
CT55_CONPL/1-59----------------LDA.RE..CC---------------P--Q---------------------SPP------CC---
CTX1_CONPE/1-61----------------QDK.ST..CC---------------.--G---------------------YRM------CV---
CT5_CONPE/1-60----------------LDI.RM..CC---------------L--G---------------------TSG------CC---
CT411_CONPE/1-60----------------LDP.RR..CC---------------Y--E---------------------TPG------CC---
CT02_CONPE/1-59----------------LNI.RE..CC---------------.--S---------------------DGW------CC---
CT5AB_CONTE/1-59----------------LNI.RE..CC---------------.--E---------------------DGW------CC---
CT154_CONTE/1-60----------------LKR.VN..CC---------------P--I---------------------DES------CC---
Q9BH99_CONPE/1-57----------------WNH.ARDWCD---------------P--.---------------------...------.C---
CT51_CONGL/1-60----------------SNK.RL..CC---------------V--T---------------------EDW------CC---
CT13_CONTE/1-60----------------SNK.RI..CC---------------Y--P---------------------NVW------CC---
CT111_CONTE/1-60----------------SKK.QC..CW---------------Y--F---------------------DIS------CC---
H8Y819_CONIM/1-60----------------LDH.PW..CC---------------A--V---------------------KYS------CC---
H8Y1U1_CONIM/1-60----------------SIE.YS..CC---------------P--G---------------------IVS------CC---
CT5M_CONVE/1-60----------------SKL.RG..CC---------------P--R---------------------SFL------CC---
CT52_CONVE/1-60----------------SKP.RD..CC---------------L--R---------------------HFL------CC---
CT51_CONPL/1-61----------------WKKGRS..CC---------------P--S---------------------PTS------CC---
CT51B_CONVR/1-60----------------WNQ.SH..CC---------------P--I---------------------DLQ------CC---
CTMI_CONMI/1-60----------------WMT.RR..CC---------------P--G---------------------NFA------CC---
CT05_CONVE/1-60----------------LNK.RS..CC---------------P--N---------------------NPA------CC---
CXT52_CONQU/1-59----------------WMK.RG..CC---------------.--A---------------------MLT------CC---
CT121_CONLI/1-60----------------WIK.AL..CC---------------Y--G---------------------YRF------CC---
CT03_CONTS/1-59----------------WAK.SL..CC---------------P--E---------------------DAW------CC---
CT5A_CONPU/1-60----------------WKK.RG..CC---------------P--K---------------------QMR------CC---
CT5B_CONVR/1-56----------------....RQ..CC---------------P--T---------------------IPE------CC---
CT51A_CONVR/1-60----------------WNQ.RH..CC---------------P--I---------------------DLP------CC---
CT53_CONLT/1-60----------------WNK.RD..CC---------------P--A---------------------KMF------CC---
CT55_CONLT/1-60----------------WNK.RS..CC---------------P--R---------------------EFL------CC---
CT11_CONLE/1-59----------------WDK.R...CC---------------P--N---------------------LFY------CC---
CTDA_CONTE/1-58----------------TSD.....CC---------------F--Y---------------------HNC------CC---
CT54_CONVE/1-61----------------RDG.DN..CC---------------I--D---------------------KQG------CC---
CT5A_CONSP/1-59----------------RII.NW..CC---------------L--I---------------------FYQ------CC---
CT53_CONCB/1-59----------------WNK.R...CC---------------P--R---------------------RLA------CC---
CT56_CONPL/1-56----------------WNK.R...CC---------------P--R---------------------KIW------CC---
CT593_CONTE/1-59----------------ESK.RN..CC---------------.--R---------------------RQI------CC---
CT14_CONPE/1-59----------------ESR.YD..CC---------------.--K---------------------TFE------CC---
CT151_CONTE/1-59----------------RKK.V...CC---------------R--P---------------------MQD------CC---
CT011_CONTS/1-61----------------WNL.RG..CC---------------.--E---------------------DKT------CC---
H8Y821_CONMR/1-58----------------RNK.R...CC---------------P--G---------------------WEL------CC---
CT52_CONMR/1-60----------------RDK.RF..CC---------------R--T---------------------QEV------CC---
CT21_CONTE/1-60----------------QDR.SG..CC---------------V--I---------------------DSN------CC---
CT34_CONBE/1-60----------------RNK.RA..CC---------------P--Y---------------------EPS------CC---
CT5M_CONPE/1-57----------------WSK.RN..CC---------------I--Y---------------------ENW------CC---
CT51_CONTE/1-58----------------NQR.....CC---------------Q--T---------------------FYW------CC---
CT243_CONLT/1-60----------------SRK.PC..CS---------------I--H---------------------DNS------CC---
CT54_CONTE/1-59----------------TTE.E...CC---------------P--F---------------------IVG------CC---
CT151_CONPE/1-60----------------SNK.RS..CC---------------P--T---------------------ILS------CC---
CT121_CONPE/1-60----------------SNK.RY..CC---------------V--Y---------------------DYS------CC---

PF11478

TACB2_TACTR/1-42ITCLF-RGARCRVYS-----GRSCCF---------------G--YYC-----------R-RDFPGSIFG------TCSRR
TACB1_TACTR/1-42VSCLF-RGARCRVYS-----GRSCCF---------------G--YYC-----------R-RDFPGSIFG------TCSRR

PF11406

TACA2_TACTR/24-67SRCQL-QGFNCVVRSYGLP-TIPCCR---------------G--LTC-----------R-SYFPGSTYG------RCQR-
TACA1_TACTR/1-44SRCQL-QGFNCVVRSYGLP-TIPCCR---------------G--LTC-----------R-SYFPGSTYG------RCQR-

PF05980

TAG2F_AGEOR/36-69-GCLP-HNRFCNALS-----GPRCCS---------------R--LKC-----------KELSIWDS---------RCL--
TAG2R_AGEOR/36-69-GCLP-HNRFCNALT-----GPRCCS---------------R--LRC-----------KELSIWDS---------ICL--
TAG2J_AGEOR/36-69-GCLP-HNRFCNALS-----GPRCCS---------------G--LRC-----------KELSIWDS---------TCL--
TAG2K_AGEOR/35-68-GCLP-HNRFCNALS-----GPRCCS---------------G--LKS-----------KELSIWDS---------RCL--
TAG2O_AGEOR/35-68-GCLP-HNRFCNALS-----GPRCCT---------------G--LKC-----------KELSIWDS---------RCL--
Q5Y4X8_AGEOR/35-68-GCLP-HNTFCNALS-----GPRCCS---------------G--LKC-----------KELSIWDS---------RCL--
TAG2L_AGEOR/36-69-GCLP-HNRFCNALS-----DPRCCS---------------G--LRC-----------KELSIWDS---------RCL--
TAG2Q_AGEOR/36-69-GCLP-HNRFCNALS-----GPRCFS---------------G--LRC-----------KELSIWDS---------RCL--
TAG2N_AGEOR/36-69-GCLP-HNRFCNALS-----GPRCCS---------------G--LRC-----------KELSIRDS---------RCL--
TAG2D_AGEOR/36-69-GCLP-HNRFCNALS-----GPRCCS---------------G--LKC-----------KELSIYDS---------RCL--
TAG2U_AGEOR/35-68-GCLP-HNRFCNALS-----GPRCCS---------------G--LTC-----------KELNIWAS---------KCL--
TXMG4_AGEAP/1-34-ACVG-ENQQCADWA-----GPHCCD---------------G--YYC-----------TCRYFPKC---------ICR--
TAG3K_AGEOR/35-68-GCVG-ENQQCADWA-----GLHCCS---------------G--YYC-----------TCRYFPKC---------ICR--
TAG3J_AGEOR/35-68-GCVG-ENQQCADWA-----RPHCCS---------------G--YYC-----------TCRYFPKC---------ICR--
TXMG6_AGEAP/1-34-DCVG-ESQQCADWA-----GPHCCD---------------G--YYC-----------TCRYFPKC---------ICV--
TAG3F_AGEOR/36-69-DCVG-ESQQCADWS-----GPYCCK---------------G--YYC-----------TCRYFPKC---------ICV--
TAG3I_AGEOR/35-68-GCVG-ENQQCANWA-----GPHCCS---------------G--YYC-----------TCRYFPKC---------ICR--
TAG3E_AGEOR/35-68-GCVG-ENQQCADWA-----GPHCCS---------------G--YYC-----------TCRYFPKC---------ICV--
TAG3A_AGEOR/34-67-ECAA-KNKRCADWA-----GPWCCE---------------G--LYC-----------SCRSYPGC---------MCR--
TXMG2_AGEAP/1-34-ECAT-KNKRCADWA-----GPWCCD---------------G--LYC-----------SCRSYPGC---------MCR--
TXDP4_PIRLC/1-34-ACAT-KNQRCASWA-----GPYCCD---------------G--FYC-----------SCRSYPGC---------MCR--
TXDP1_PIRLC/1-34-GCLG-EGEKCADWS-----GPSCCD---------------G--FYC-----------SCRSMPYC---------RCR--
TXAG5_AGEOR/35-68-GCVG-ENQQCADWA-----GPHCCS---------------G--LRC-----------KELSIWDS---------RCL--
TX10A_HAPSC/41-72-GCFK-EGKWCPKSA-----.P.CCA---------------P--LKC-----------KGPSIKQQ---------KCV--
C7TRQ6_SCHJA/23-56-SCLY-LGQHCNALA-----TKKCCP---------------P--FTC-----------KFVNQRES---------ICV--
TAG2W_AGEOR/36-69-GCLP-RNKFCNPSS-----GPRCCS---------------G--LTC-----------KELNIWAS---------KCL--
TAG2Y_AGEOR/35-68-GCLP-RNKFCNPSS-----GPRCCS---------------G--LTC-----------KELNIWDS---------RCL--
TA2GE_AGEOR/36-69-GCLP-RNRFCNALS-----GPRCCS---------------G--LRC-----------KELSIWAS---------KCL--
TAG2T_AGEOR/36-69-GCLP-HNKFCNALS-----GPRCCS---------------G--LKC-----------KELTIWNT---------KCL--
TAG2P_AGEOR/36-69-GCLP-HNRFCNALS-----GPRCCS---------------G--LKC-----------KELSIWDS---------ICL--

PF08094

C7A_CONTU/1-30-SCSG-RDSRC---------PPVCCM---------------G--LMCSRG.-----..KCVSIYGE--------------
CGS_CONGE/1-33-ACSG-RGSRC---------PPQCCM---------------G--LRCGRGN-----PQKCIGAHED--------------

PF08089

TXL1_LASSB/51-99FECTF-E---CDIKKE----G.KPCK---------------P--KGCKCKDKDNKDHKKCSGGWRCKLK------LCLKF
TXP1_BRASM/1-39FECVF-S---CDIEKE----G.KPCK---------------P--KG..........EKKCSGGWKCKIK------LCLKI
B3FIU5_HAPSC/49-85FECSF-S---CEIEKE----GDKPCK---------------.--............KKKCKGGWKCKFN------MCVKV

PF06357

TO1F_HADVE/1-37AVCIP-SGQPCPY-------SKYCCS---------------G---SCTYK--------TNE----NGNS------VQ---
TO1A_HADVE/1-37PTCIP-SGQPCPY-------NENCCS---------------Q---SCTFK--------ENE----NGNT------VK---

PF08091

TXP3_APOSC/1-37--CNS-KGTPCTN-------ADECCG---------------G---KCAYN--------VWNCI..GGGC------SK---
CALC_CALS5/1-39--CIS-ARYPCSN-------SKDCCS---------------G---SCGI.--------FWTCYLRKDPC------SK---

PF05353

TXMG4_MACGS/63-105--CGS-KRAWCKE-------KKDCCC---------------G--YNCVYA--------WYNQ---QSSC------ERKWK
TXM14_MACGS/27-68--CAR-KRAWCEK-------TENCCC---------------P--MKCIYA--------WYNG---QSSC------DHTIS
TDT1B_HADVE/1-42--CSR-SDGWCGK-------TEDCCC---------------P--MKCIKA--------WYKQ---NGNC------QNTIS
TXDT1_HADSP/1-42--CAK-KRNWCGK-------NEDCCC---------------P--MKCIYA--------WYNQ---QGSC------QSTIT
TDM1A_MISBR/1-42--CAK-KREWCAK-------TEDCCC---------------P--MKCIYA--------WYNE---QSSC------QTTFS

PF02819

TX32_PHONI/39-81--CAG.LYKKCGK-------GASPCC---------------E---DR.PC--------KCDLA--MGNC------ICK..
TOG4A_AGEAP/4-48--CIAKDYGRCKW-------GGTPCC---------------R---GR.GC--------ICSIM--GTNC------ECK.P
TX31_PHONI/40-82--CAA.VYERCGK-------GYKRCC---------------E---ER.PC--------KCNIV--MDNC------TCK..
TXP8_PLETR/17-61--CIG.WQETCN.-------GQLPCC---------------D---GCVMC--------ECNIM--GQNC------RCNHP
TOG4B_AGEAP/39-83--CIAEDYGKCTW-------GGTKCC---------------R---GR.PC--------RCSMI--GTNC------ECT.P
TX3A_PHONI/39-80--CAD.VYKECWY-------PEKPCC---------------K---DR.AC--------QCTLG--MT.C------KCK..

PF05039

G3SVT4_LOXAF/43-129AGCVA-TRDSCKP-------PAPACC---------------D---PCASC--------QCRFF--RSAC------SCR--
G7PGK3_MACFA/42-125T..AA-XXXXXXP-------PAPACC---------------D---PCASC--------QCRFF--RSAC------SCR--
ASIP_HUMAN/42-127APCVA-TRNSCKP-------PAPACC---------------D---PCASC--------QCRFF--RSAC------SCR--
F6XD58_MONDO/39-130RRCVR-LLESCLG-------HQVPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
H0VZP4_CAVPO/41-127APCVA-TRDSCKP-------PAPACC---------------N---PCASC--------QCRFF--GSVC------SCR--
U3K7P9_FICAL/53-134ANCVP-TFKTCKP-------HLNSCC---------------H---YCALC--------KCRIF--QTIC------QCL--
G3TG92_LOXAF/34-123RRCVR-LHESCLG-------HQVPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
F7H591_MACMU/34-122RRCVR-LHESCLG-------QQVPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
G1T0P8_RABIT/41-127APCVA-TRDSCKP-------PAPVCC---------------D---PCASC--------QCRFF--RSVC------TCR--
W5KRC1_ASTMX/43-124PNCTP-LWGSCKD-------PNSVCC---------------E---PCAFC--------SCRLL--RTIC------YCR--
F7DQS7_ORNAN/43-129RRCVR-LLESCLG-------HQLPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
AGRP_PIG/34-124RRCVR-LHESCLG-------HQVPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
I3M2D9_SPETR/42-128TPCVA-TRDSCKS-------PSPPCC---------------D---PCASC--------VCRFF--GSVC------SCR--
C0A1C9_CHICK/49-156RRCVR-LLESCLG-------HQIPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
B4YAJ9_SHEEP/42-128TPCVA-TRDSCKP-------PAPACC---------------D---PCAFC--------QCRFF--RSAC------SCR--
H0VHZ8_CAVPO/34-122RRCVR-LQESCLG-------QQVPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
L5LI85_MYODS/44-132RRCVR-LHESCLG-------HQVPCC---------------D---PCATC--------YCRFF--NAFC------YCR--
E2RJQ9_CANFA/34-122RRCVR-LHESCLG-------HQVPCC---------------D---PCATC--------YCRFF--NAFC------YCR--

PF11703

G7YD78_CLOSI/34-91----------------------------------
G7Y4U0_CLOSI/24-81----------------------------------
G4VLW5_SCHMA/26-84----------------------------------
G4M208_SCHMA/29-87----------------------------------
H2KPG9_CLOSI/24-82----------------------------------
G7YUW6_CLOSI/40-99----------------------------------
A0A068Y8W4_ECHMU/21-80----------------------------------
G4VLW4_SCHMA/162-220----------------------------------
G7YI46_CLOSI/30-88----------------------------------
G4VLW4_SCHMA/104-161----------------------------------
A0A068XBH6_HYMMI/23-82----------------------------------
G7Y700_CLOSI/24-82----------------------------------
G4VD24_SCHMA/21-78----------------------------------
G4VMF1_SCHMA/36-92----------------------------------
G7YI45_CLOSI/25-83----------------------------------
G4VBF7_SCHMA/36-95----------------------------------
G4VME9_SCHMA/59-115----------------------------------
G4LWF3_SCHMA/2-62----------------------------------

PF08087

Q80LL0_NPVAH/21-51----------------------------------
Q9YMR0_NPVLD/20-52----------------------------------
Q8JM47_9ABAC/20-50----------------------------------
CXOL2_NPVOP/22-52----------------------------------
CXOL1_NPVOP/23-53----------------------------------
H6UPN5_9ABAC/23-53----------------------------------
Q9YMH9_NPVLD/23-53----------------------------------

PF08027

K7M0N2_SOYBN/29-63----------------------------------
K7M0N1_SOYBN/11-45----------------------------------

PF16720

I1KW03_SOYBN/76-123----------------------------------
K7M0N1_SOYBN/55-102----------------------------------

PF07473

CP91_CONGL/61-88----------------------------------
CP91_CONRE/57-83----------------------------------

PF08099

SCXC_SCOMA/1-33----------------------------------
IPTXA_PANIM/1-33----------------------------------

PF07740

WGRTX_GRARO/50-81----------------------------------
H3A12_HAPHA/49-79----------------------------------
H1A03_HAPHA/49-79----------------------------------
TX27_PHONI/2-36----------------------------------
TX5B_HETVE/2-34----------------------------------
H8A01_HAPHA/53-81----------------------------------
TX5A_HETVE/3-35----------------------------------
TXHN1_GRARO/1-30----------------------------------
TXPR1_THRPR/1-30----------------------------------
TXHP1_HETVE/1-29----------------------------------
TXHA5_HAPHA/1-33----------------------------------
TXMG8_MACGS/46-76----------------------------------
TX2_THEBL/2-32----------------------------------
TXP5_BRASM/1-30----------------------------------
TX1_THEBL/2-32----------------------------------
TX32_PHOKE/2-36----------------------------------
TXH4_HAPSC/53-85----------------------------------
TX2_HETMC/1-34----------------------------------
M5AY85_GRARO/47-78----------------------------------
JZT1B_CHIGU/30-60----------------------------------
TX1_HETMC/1-30----------------------------------
TX1_STRGF/1-30----------------------------------
TXH1_HAPSC/49-79----------------------------------
TXU2_HETVE/2-28----------------------------------
B3FIU4_HAPSC/51-80----------------------------------
TX482_HYSGI/6-35----------------------------------
VSTX1_GRARO/1-30----------------------------------
TX1_STRCF/1-30----------------------------------
TX27_PHORI/2-36----------------------------------
TXHP3_HETVE/1-27----------------------------------
TXL1_HAPSC/50-77----------------------------------

PF08093

TXM11_MACGS/51-78----------------------------------
TOT2A_HADIN/60-89----------------------------------
TOT2B_ATRIL/59-87----------------------------------
TXR3_MACRV/1-29----------------------------------
TOT2A_HADVE/3-32----------------------------------

PF08117

IOB1_ISYOB/2-36----------------------------------
PTU1_PEITU/1-34----------------------------------

PF08092

TXPT6_MACGS/61-98----------------------------------
TXLT4_LASSB/58-97----------------------------------
TXMG2_MACGS/81-120----------------------------------

PF08008

Q77ZH3_CSIVT/110-192QIKNADLFAKLADQLNDTNYAELESQYWKSVSSP
Q98825_CSIVT/36-118VINNLTLYKELSAQLNETNLAELSNLYFQGIKHT
Q98825_CSIVT/169-250VVNNSTLYLELSKGMNETKLSNLSDWYIAA.AVI

PF07945

TK1C_HADVE/1-35----------------------------------
TK1B_HADVE/1-36----------------------------------

PF05374

CM3A_CONGE/51-72----------------------------------
CM3A_CONPU/51-72----------------------------------
CM3B_CONGE/1-22----------------------------------
CM3C_CONGE/1-22----------------------------------

PF02950

CO27A_CONTE/2-73----------------------------------
CO7_CONTE/1-76----------------------------------
CM31_CONTE/2-70----------------------------------
CM237_CONTS/3-67----------------------------------
O2651_CONLT/2-74----------------------------------
O367_CONTS/2-78----------------------------------
CT52_CONAE/2-65----------------------------------
CT54_CONTS/2-72----------------------------------
CM132_CONPE/2-70----------------------------------
CM3_CONTE/2-68----------------------------------
O1613_CONPE/1-76----------------------------------
O1617_CONAE/1-68----------------------------------
CO14_CONTE/1-81----------------------------------
CM233_CONVE/3-66----------------------------------
O3620_CONVE/2-78----------------------------------
CT52_CONGL/2-60----------------------------------
CO1X1_CONTE/1-76----------------------------------
CM231_CONAE/3-68----------------------------------
O3621_CONVE/2-74----------------------------------
O1614_CONPE/1-83----------------------------------
O1610_CONVE/1-77----------------------------------
CM02_CONTS/2-70----------------------------------
CT122_CONPE/2-61----------------------------------
CT56_CONVE/2-71----------------------------------
O1618_CONAE/1-74----------------------------------
O1613_CONTE/1-78----------------------------------
CM131_CONAE/2-67----------------------------------
O264_CONVE/2-74----------------------------------
O1618_CONVE/2-73----------------------------------
O1611_CONVE/1-79----------------------------------
O1619_CONAE/1-75----------------------------------
H2BKF9_CONCE/3-69----------------------------------
O168_CONAE/1-74----------------------------------
O261_CONTE/2-73----------------------------------
O265_CONVE/2-77----------------------------------
CO16B_CONST/1-72----------------------------------
O163_CONAE/1-80----------------------------------
O1612_CONVE/1-87----------------------------------
CO16E_CONST/1-78----------------------------------
H2BKT2_CONVT/3-72----------------------------------
O162_CONAE/1-78----------------------------------
CO16B_CONMR/1-82----------------------------------
CO16A_CONST/1-72----------------------------------
CO12A_CONPL/1-74----------------------------------
O1613_CONVE/1-83----------------------------------
CO1K1_CONTE/1-77----------------------------------
CM23B_CONTS/3-66----------------------------------
CO15_CONST/1-72----------------------------------
O236D_CONTE/2-72----------------------------------
O1610_CONAE/1-76----------------------------------
COW1_CONTE/2-63----------------------------------
CT5A_CONTE/2-60----------------------------------
CO26_CONTE/2-70----------------------------------
O3626_CONAE/2-76----------------------------------
CM11_CONTS/2-70----------------------------------
CO16A_CONPL/1-79----------------------------------
H2BK07_CONMI/2-70----------------------------------
C0261_CONTE/2-76----------------------------------
CM236_CONTE/3-90----------------------------------
CO14_CONST/1-73----------------------------------
O226A_CONTE/2-71----------------------------------
O1611_CONAE/1-78----------------------------------
COW3_CONTE/2-63----------------------------------
O1615_CONVE/1-72----------------------------------
O266_CONVE/2-76----------------------------------
H2BKV0_CONTE/3-71----------------------------------
CT51_CONTS/2-60----------------------------------
CO27A_CONPE/2-71----------------------------------
O3610_CONPE/2-77----------------------------------
H2BJZ4_CONVA/2-70----------------------------------
O263_CONTS/2-72----------------------------------
CM235_CONVE/2-69----------------------------------
CO13_CONST/1-71----------------------------------
CM231_CONVE/3-67----------------------------------
O1612_CONAE/1-75----------------------------------
COW2_CONTE/2-63----------------------------------
O1612_CONPE/1-76----------------------------------
O262_CONTS/2-76----------------------------------
CO16_CONTE/1-82----------------------------------
O268_CONPE/2-71----------------------------------
O3611_CONPE/2-78----------------------------------
CT53_CONTS/2-74----------------------------------
O366_CONTS/2-77----------------------------------
O262_CONVE/2-72----------------------------------
CO1K2_CONTE/1-77----------------------------------
O168_CONVE/1-78----------------------------------
CM4B_CONPE/3-69----------------------------------
CT53_CONAE/2-66----------------------------------
CO142_CONTE/1-75----------------------------------
CM01_CONTE/3-67----------------------------------
CO15_CONTE/1-76----------------------------------
CT51B_CONAE/2-74----------------------------------
O1613_CONAE/1-81----------------------------------
CO16A_CONGE/1-72----------------------------------
CO6B_CONPE/1-82----------------------------------
O269_CONPE/2-74----------------------------------
CO12_CONTE/1-76----------------------------------
CO6A_CONPE/1-74----------------------------------

PF16981

CT1A_CONMR/1-58----------------------------------
CT51_CONIM/1-58----------------------------------
H8Y818_CONIM/1-59----------------------------------
CT55_CONPL/1-59----------------------------------
CTX1_CONPE/1-61----------------------------------
CT5_CONPE/1-60----------------------------------
CT411_CONPE/1-60----------------------------------
CT02_CONPE/1-59----------------------------------
CT5AB_CONTE/1-59----------------------------------
CT154_CONTE/1-60----------------------------------
Q9BH99_CONPE/1-57----------------------------------
CT51_CONGL/1-60----------------------------------
CT13_CONTE/1-60----------------------------------
CT111_CONTE/1-60----------------------------------
H8Y819_CONIM/1-60----------------------------------
H8Y1U1_CONIM/1-60----------------------------------
CT5M_CONVE/1-60----------------------------------
CT52_CONVE/1-60----------------------------------
CT51_CONPL/1-61----------------------------------
CT51B_CONVR/1-60----------------------------------
CTMI_CONMI/1-60----------------------------------
CT05_CONVE/1-60----------------------------------
CXT52_CONQU/1-59----------------------------------
CT121_CONLI/1-60----------------------------------
CT03_CONTS/1-59----------------------------------
CT5A_CONPU/1-60----------------------------------
CT5B_CONVR/1-56----------------------------------
CT51A_CONVR/1-60----------------------------------
CT53_CONLT/1-60----------------------------------
CT55_CONLT/1-60----------------------------------
CT11_CONLE/1-59----------------------------------
CTDA_CONTE/1-58----------------------------------
CT54_CONVE/1-61----------------------------------
CT5A_CONSP/1-59----------------------------------
CT53_CONCB/1-59----------------------------------
CT56_CONPL/1-56----------------------------------
CT593_CONTE/1-59----------------------------------
CT14_CONPE/1-59----------------------------------
CT151_CONTE/1-59----------------------------------
CT011_CONTS/1-61----------------------------------
H8Y821_CONMR/1-58----------------------------------
CT52_CONMR/1-60----------------------------------
CT21_CONTE/1-60----------------------------------
CT34_CONBE/1-60----------------------------------
CT5M_CONPE/1-57----------------------------------
CT51_CONTE/1-58----------------------------------
CT243_CONLT/1-60----------------------------------
CT54_CONTE/1-59----------------------------------
CT151_CONPE/1-60----------------------------------
CT121_CONPE/1-60----------------------------------

PF11478

TACB2_TACTR/1-42NF--------------------------------
TACB1_TACTR/1-42NF--------------------------------

PF11406

TACA2_TACTR/24-67-Y--------------------------------
TACA1_TACTR/1-44-F--------------------------------

PF05980

TAG2F_AGEOR/36-69----------------------------------
TAG2R_AGEOR/36-69----------------------------------
TAG2J_AGEOR/36-69----------------------------------
TAG2K_AGEOR/35-68----------------------------------
TAG2O_AGEOR/35-68----------------------------------
Q5Y4X8_AGEOR/35-68----------------------------------
TAG2L_AGEOR/36-69----------------------------------
TAG2Q_AGEOR/36-69----------------------------------
TAG2N_AGEOR/36-69----------------------------------
TAG2D_AGEOR/36-69----------------------------------
TAG2U_AGEOR/35-68----------------------------------
TXMG4_AGEAP/1-34----------------------------------
TAG3K_AGEOR/35-68----------------------------------
TAG3J_AGEOR/35-68----------------------------------
TXMG6_AGEAP/1-34----------------------------------
TAG3F_AGEOR/36-69----------------------------------
TAG3I_AGEOR/35-68----------------------------------
TAG3E_AGEOR/35-68----------------------------------
TAG3A_AGEOR/34-67----------------------------------
TXMG2_AGEAP/1-34----------------------------------
TXDP4_PIRLC/1-34----------------------------------
TXDP1_PIRLC/1-34----------------------------------
TXAG5_AGEOR/35-68----------------------------------
TX10A_HAPSC/41-72----------------------------------
C7TRQ6_SCHJA/23-56----------------------------------
TAG2W_AGEOR/36-69----------------------------------
TAG2Y_AGEOR/35-68----------------------------------
TA2GE_AGEOR/36-69----------------------------------
TAG2T_AGEOR/36-69----------------------------------
TAG2P_AGEOR/36-69----------------------------------

PF08094

C7A_CONTU/1-30----------------------------------
CGS_CONGE/1-33----------------------------------

PF08089

TXL1_LASSB/51-99----------------------------------
TXP1_BRASM/1-39----------------------------------
B3FIU5_HAPSC/49-85----------------------------------

PF06357

TO1F_HADVE/1-37-----RCD--------------------------
TO1A_HADVE/1-37-----RCD--------------------------

PF08091

TXP3_APOSC/1-37-----TC.GY------------------------
CALC_CALS5/1-39-----ECLAP------------------------

PF05353

TXMG4_MACGS/63-105YLFTGEC---------------------------
TXM14_MACGS/27-68TIWT.SC---------------------------
TDT1B_HADVE/1-42AIWK.NC---------------------------
TXDT1_HADSP/1-42GLFK.KC---------------------------
TDM1A_MISBR/1-42GMFK.KC---------------------------

PF02819

TX32_PHONI/39-81KKFIEFFGGG------------------------
TOG4A_AGEAP/4-48RLIMEGLGLA------------------------
TX31_PHONI/40-82KFISELFGFG------------------------
TXP8_PLETR/17-61KMTSECGSRR------------------------
TOG4B_AGEAP/39-83RLIMEGLSFA------------------------
TX3A_PHONI/39-80ATLGDLFGRR------------------------

PF05039

G3SVT4_LOXAF/43-129.V--------------------------------
G7PGK3_MACFA/42-125.V--------------------------------
ASIP_HUMAN/42-127.V--------------------------------
F6XD58_MONDO/39-130KI--------------------------------
H0VZP4_CAVPO/41-127.V--------------------------------
U3K7P9_FICAL/53-134.M--------------------------------
G3TG92_LOXAF/34-123KL--------------------------------
F7H591_MACMU/34-122KL--------------------------------
G1T0P8_RABIT/41-127.V--------------------------------
W5KRC1_ASTMX/43-124.M--------------------------------
F7DQS7_ORNAN/43-129KI--------------------------------
AGRP_PIG/34-124KL--------------------------------
I3M2D9_SPETR/42-128.V--------------------------------
C0A1C9_CHICK/49-156KI--------------------------------
B4YAJ9_SHEEP/42-128.V--------------------------------
H0VHZ8_CAVPO/34-122KL--------------------------------
L5LI85_MYODS/44-132KL--------------------------------
E2RJQ9_CANFA/34-122KL--------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window