Sequence alignment for CL0084

PF03496

A0FKE4_9GAMM/241-430-----QNQFG------LEAEQYLGEQPHG----------------------------------------------L....
A1KWU2_STAAU/47-247-----ATKWG------NKLIKQAKY....----------------------------------------------.....
A2RG53_STRPG/60-249-----KKRWG------KGLVY........----------------------------------------------.....
A3KYA6_PSEAI/242-430-----VKRFG------ADAEKYLGRQPGG----------------------------------------------I....
A3L121_PSEAI/245-434-----VEHFG------LEAEQYLGEHPDG----------------------------------------------P....
B0YIU7_BACTU/276-462-----AHSWG------MKIYEDWAKNL..----------------------------------------------.....
B1BBR9_CLOBO/55-244-----AKKWG------NAQYKKYGL....----------------------------------------------.....
B1BSY1_CLOPF/261-454-----GDLWG------KENYSDWSNKL..----------------------------------------------.....
B3ZYG6_BACCE/56-253-----AKGWG------EKKYKEWKERL..----------------------------------------------.....
B3ZYJ4_BACCE/45-249-----AEAWG------RERYAGWYNNL..----------------------------------------------.....
B4U1X8_STREM/46-234-----TNRWR------SQTAF........----------------------------------------------.....
C2SU54_BACCE/217-423-----ALQWA------KENLKGYAEKL..----------------------------------------------.....
C2X5A0_BACCE/56-251-----ADAWG------EKFYHQWIPNV..----------------------------------------------.....
C3B4Y1_BACMY/29-179-----AHEWG------SKHFDSWIESL..----------------------------------------------.....
C3B5A2_BACMY/83-262-----AHEWG------SKHFDNWIESL..----------------------------------------------.....
C3DDI1_BACTU/266-451-----GDSWG------KKNYKEWSDSL..----------------------------------------------.....
C3ECU3_BACTU/38-244-----ATAWG------NELFNLWNKLT..----------------------------------------------.....
C3V1Q7_9CAUD/377-628-----KNSWN------AAKTKFLKRMIYS----------------------------------------------FSGIG
C4B698_CLOBO/226-428-----SEAWG------EKNYGDYVSKL..----------------------------------------------.....
D0GI75_9VIRU/1-192-----AKAWG------NAQYKKYGL....----------------------------------------------.....
ALT_BPT4/374-615-----QNSWN------AIKTKIIRRELRG----------------------------------------------YALTA
ARC3_CLOLM/60-249-----ARAWG------DKQFAKYKL....----------------------------------------------.....
CRAX_BACCE/253-470-----AESWG------VQTFKNWKENL..----------------------------------------------.....
Q8GAX6_STAAU/47-247-----ATKWG------NSLIKSAKY....----------------------------------------------.....
Q8VVU2_STAAU/47-247-----ATNWG------NKLIKQANY....----------------------------------------------.....
Q977Y7_CLOAB/207-388-----ANEWG------SQYYDNWLKSL..----------------------------------------------.....

PF01129

NAR5_MOUSE/29-255LSL-VPDTFD------DAYVGCSEEMEEK.AGLLLKEEMARHALLRESWEAAQEAWA..........HR......RHKLT
NAR1_HUMAN/39-274LDM-ALASFD------DQYAGCAAAMTAA.LPDLNHTEFQANQVYADSWTLASSQWQ..........ER......QARWP
NAR1_MOUSE/39-269LDM-APASFD------DQYAGCLADMTAA.LPDLNHSEFQANKVYADGWAQANNQWQ..........ERRAWGSVWGSLP
NRT1_CHICK/37-257MDM-ALNSFD------DQYLLCEDRMRAR.LQMENITEFSTNIAYAVTWRQAAAEWQ..........KR......WGHLA
Q87WF6_PSESM/58-297EQV-LSHTYS------SNIKGKLRTTPPK.GPSPRLSDTPMKQALSSMIVQERKRLKSQPKSLASDIERPDSMIKKALDE
NAR3_HUMAN/29-252LDM-ADNAFD------DEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWA..........AR......KTQIF
NARE_CHICK/37-257MDM-APHSFD------DQYQGCIDLMEAE.LQELNRTEF.ANETFAEGWRSATEEWQ..........RR......WGRVS
NAR2A_MOUSE/27-242LDM-APNAFD------DQYEGCVEDMEKK.APQLLQEDFNMNEELKLEWEKAEIKWK..........EI......KNCMS
NAR2A_RAT/27-239LDT-APNAFD------DQYEGCVNKMEEK.APLLLKEDFNKSEKLKVAWEEAKKRWN..........NI......KPSMS

PF00644

Q7QBC7_ANOGA/780-991LKT.SIEPMA----RDSEEFALLEQYVRNTHAETHRT...YELEVAEIF-------------------------------
PAR12_MOUSE/506-689LGF.KKITLS----SSSEEYQKVWNIFNRTLP.........FYFVQKIE-------------------------------
Q8QGB0_ONCMY/90-274LLM..LVPLT----PGSKEGHDIEKEFRKTLL.........NNTILTIE-------------------------------
PME2_CAEEL/304-528LPC.HLEPV.----..SEEIAGKIGDCLAMRGPTHC....YKLSLIDAF-------------------------------
Q6DDF6_XENLA/117-300LSDKLFTVKS----VPKDKYEEIQALPGSPSHALPT.....PDFLFELE-------------------------------
Q6DFH2_XENLA/340-552LNC.SMQPLD----QTSSTFQLIEGYLQSTHAPTHND...YTMTLLRVF-------------------------------
Q7Z114_DICDI/449-640LNT.HIEHLH----QASAGYQIFIRNFLSNPHHQKAID.NGEIKILNCY-------------------------------
PARP1_CHICK/794-1004LRT.DIKVVD----KDSEEAKIIKQYVKNTHAATHNA...YDLKVVEIF-------------------------------
PARP2_ARATH/421-633LNC.GLTPVG----NDSEEFSMVANYMENTHAKTHSG...YTVEIAQLF-------------------------------
PAR16_MOUSE/90-273LSSKILTIHS----AKKAEFEKIQQLTGAPHTPVPT.....PDFLFEIE-------------------------------
Q6A0B1_MOUSE/386-574LRC.KIEHVD----QNTEEFSRVRKEVLQNNRSEQ......PVDILQIF-------------------------------
PARP2_MAIZE/436-648LHC.DFTPLE----ADSDEYSMIKSYLRNTHGKTHSG...YTVDIVQIF-------------------------------
Q8BSZ1_MOUSE/766-954LG..RLEALE----ENSQEFQDVVRAFYSTLDAVHG.....RIRIVRVE-------------------------------
PARP1_MAIZE/764-976LHC.DITPLA----HDSEDYKLIEQYLLNTHAPTHKD...WSLELEEVF-------------------------------
Q6NX05_DANRE/102-278VKT.......----LQKEEFARLSQLAQREGVSAPA.....PDFLFELQ-------------------------------
PARP2_HUMAN/365-577LHC.ALRPLD----HESYEFKVISQYLQSTHAPTHSD...YTMTLLDLF-------------------------------
Q8X0P2_NEUCS/432-660LKMQEMTPLD----RASTEFAQLADYLVETRGNTHG....LNYQVEEIF-------------------------------
Q8I7C4_DICDI/2328-2536LGA.SLEKLD----ANSPEFGILKKYSENTGC.........TKKIVNIF-------------------------------
Q7ZVB0_DANRE/323-528LKC.SLNLVD----KKSKEYKIIEKYLKATGQ........EGLTLVDVW-------------------------------
Q91YR6_MOUSE/317-528LRC.QLQLLD----SGESEYKAIQTYLKQTGNSYR......CPNLRHVW-------------------------------
PARP_SARPE/782-993LKT.KLEPLD----KNSEEYILLQKYVKNTHAETHKL...YDLEVVDIF-------------------------------
Q6V953_EMEND/449-674LGMQEMTPLD----HASEEFRELEKYLSGTRGSTHG....VKYKVIDIF-------------------------------
PARP3_SOYBN/586-801LGC.SISALD----KSSDDYEMIVKYLEKTYEPVKVGDIEYGVSVENIF-------------------------------
Q8I7C6_DICDI/493-700LKT.DIQPLD----ENSCEYKNILLYVKNTYQGGK......KPTIVNIF-------------------------------
PARP1_ARATH/767-979LHC.DISPLP----HDSEDYRLIEKYLNTTHAPTHTE...WSLELEEVF-------------------------------
Q7Z115_DICDI/725-936LKT.KLTPLD----KDSVVYKTLVDYVANSQDKQFR....TNICVQDIL-------------------------------
PAR11_HUMAN/129-330VPY.QLIPLH----NQTHEYNEVANLFGKTMD.........RNRIKRIQ-------------------------------
Q8I7C5_DICDI/585-801LKA.DIKPLE----RDSFLFRNIEEFALSTVDPSLG....YSIDVLDVF-------------------------------

PF02763

DTXH_CORBE/26-212----GADDVV----DSSKSF--VMENFSSYHGTKPG----YVDSIQKGI-------------------------------
DTX_CORBE/33-219----GADDVV----DSSKSF--VMENFSSYHGTKPG----YVDSIQKGI-------------------------------
DTX_COROM/26-212----GADDVV----DSSKSF--VMENFSSYHGTKPG----YVDSIQKGI-------------------------------

PF01375

E2BA_ECOLX/1-263MAK-VISFFISLFLISFPLYAND..YFRADSRT--------PDEVRRSG-------------------------------
A3H3Z6_VIBCL/2-258VKI-IFVFFI...FLSSFSYANDDKLYRADSRP--------PDEIKQSG-------------------------------
E2AA_ECOLX/2-259IKH-VLLFFV...FISFSVSAND..FFRADSRT--------PDEIRRAG-------------------------------
Q13Q55_BURXL/433-665EDH-PDHPFA...............LFRPSQTS--------PARLKEQQ-------------------------------
A7Y1X7_ECOLX/2-258KNI-TFIFFI...LLASPLYANGDKLYRADSRP--------PDEIKRSG-------------------------------
Q04RV9_LEPBJ/40-285ENQ-IATPPI.............EVFYLVTTLT--------PEQVITSD-------------------------------

PF02917

CARDS_MYCPN/3-234------NPVR--------------FVYRVDLRS--------PEEIFEH--------------------------------
TOX1_BORPE/36-268------DPPA--------------TVYRYDSRP--------PEDVFQN--------------------------------

PF03496

A0FKE4_9GAMM/241-430...............YSDAEVMALGLYTNG------EYQHLN------RSL..RQEK....QLDAGQALIDQ........
A1KWU2_STAAU/47-247................SSDDKIALYEYTK.------DSSKIN------GPL..RLAGGDINKLD..STTQDK........
A2RG53_STRPG/60-249................PRAEQEAMAAYTCQ------QAALIN------TSL..DKTKGELSQLT..PELRDQ........
A3KYA6_PSEAI/242-430...............HSDAEVMALGLYTGI------HYADLN------RAL..RQGQ....ELDAGQKLIDQ........
A3L121_PSEAI/245-434...............YSDAEVMALGLYTNG------EYQHLN------RSL..RQGR....ELDAGQALIDR........
B0YIU7_BACTU/276-462................TASQREALDGYARQ------DYKEIN------NYL..RNQGGSGN.....EKLDAQ........
B1BBR9_CLOBO/55-244................SKPEQEAIKFYTR.------DASKIN------GPL..RANQGNENGLS..SDILQK........
B1BSY1_CLOPF/261-454................TPNELADVNDYMRG------GYTAIN------NYL..ISNGPLNNPN...PELDSK........
B3ZYG6_BACCE/56-253................TSEEKESIEYYTDF------DYLEIN------QYL..REVK....GKLKTSDLNNT........
B3ZYJ4_BACCE/45-249................TIVEQKSLTDYTTE------KGYQIN------KYL..RQNKGNINIPEN.SFLNRN........
B4U1X8_STREM/46-234................TEAEKKMMYQYTHA------SASPIN------LAL..EQVMGDTSQLD..AQLQQS........
C2SU54_BACCE/217-423................NADEKAEIDFYTTS------NYSTIN------SYL..RDSEGSKY.QDK.EGLKKR........
C2X5A0_BACCE/56-251................SSTEIEEFKSYMET------GYHHLN------TYL..LENKGQLTGKD..IKMEQK........
C3B4Y1_BACMY/29-179................TESERSAIRQYTGD------DYRKIN------NYL..RGIA....DSLD.GVESSV........
C3B5A2_BACMY/83-262................TESERSAIRQYTGD------DYRKIN------NYL..RGIA....DSLN.DVESSV........
C3DDI1_BACTU/266-451................TNDQRKDLNDYGAR------GYTEIN------KYL..R.EGGTGN.....TELEEK........
C3ECU3_BACTU/38-244................PQVEKDAIRGYTAT------DYISIN------GYL..RSDYYDVLDQ...AKIEKS........
C3V1Q7_9CAUD/377-628AGPMIDITIARDGSKYTPSQKRGIREYCGS------GYTDIN------NLLLGRYNP.ERYDVMSEKEIESA........
C4B698_CLOBO/226-428................SQEQLGALEGYLHS------DYKAIN------SYL..RNNR.....VPNNDELNKK........
D0GI75_9VIRU/1-192................SKSEKEAIVSYTK.------SASEIN------GKL..RQNKGVINGFP..SNLIKQ........
ALT_BPT4/374-615GWSLHPIVENKDSSKYTPAQKRGIREYVGS------GYVDIN------NALLGLYNPDERTSILTASDIEKA........
ARC3_CLOLM/60-249................SSSEKNALTIYTR.------NAARIN------GPL..RANQGNTNGLP..ADIRKE........
CRAX_BACCE/253-470................TISEKDIITGYTGS------KYDPIN------EYL..RKYDGEIIPNIG.GDLDKKSKKALEKI
Q8GAX6_STAAU/47-247................SSKDKMAIYNYTK.------NSSPIN------TPL..RSANGDVNKLS..ENIQEQ........
Q8VVU2_STAAU/47-247................SSKDKEAIYNYTK.------YSSPIN------TPL..RSSQGDISNFS..ADLQEK........
Q977Y7_CLOAB/207-388................NDSERNAIRQYTGN------DYKKIN------NYL..RGVN....DSLD.GIDPKI........

PF01129

NAR5_MOUSE/29-255...........LPPGFKAQHGVAIMVYTNS...SNTLYWELN------QAV--RTGGGSRELYMRHFPFKAL--------
NAR1_HUMAN/39-274EWSLSPTRPSPPPLGFRDEHGVALLAYTAN....SPLHKEFN------AAV--REAGRSRAHYLHHFSFKTL--------
NAR1_MOUSE/39-269..........PSPPGFRDEHGVALLAYTAN....SPLHKEFN------AAV--REAGRSRAHYLHHFSFKTL--------
NRT1_CHICK/37-257...........RPMQLIREQAIALLAYSAS....SRMCTLFN------EAT--RQGGRSHQDYIHSYHFKTL--------
Q87WF6_PSESM/58-297KD......GHPFGERFSDDEFLAIHLYTSC......LYRPIN------HHL--R........YAPNNDVAPV--------
NAR3_HUMAN/29-252...........LPMNFKDNHGIALMAYISEAQEQTPFYHLFS------EAV--KMAGQSREDYIYGFQFKAF--------
NARE_CHICK/37-257...........SPMVLRQDQAIAVLAYTME....GELYRVFN------NAT--LTAGRSRQHYLSSYPFKTL--------
NAR2A_MOUSE/27-242...........YPAGFHDFHGTALVAYTGN......IHRSLN------EAT--RE....FKINPGNFHYKAF--------
NAR2A_RAT/27-239...........YPKGFNDFHGTALVAYTGS......IGVDFN------RAV--RE....FKENPGQFHYKAF--------

PF00644

Q7QBC7_ANOGA/780-991----------------RIKRKGEDRRYQPFKK.......LHN.........--.....RKLLWHG-SRLTNF--------
PAR12_MOUSE/506-689----------------RIQNMGLWEVYQWQKC.......QMQKQNG.....--GKEVDERQLFHG-TSANFV--------
Q8QGB0_ONCMY/90-274----------------RVQNDSLWKSYQIRKKLLEEKNKHTN.........--....NEKLLFHG-TSSDSI--------
PME2_CAEEL/304-528----------------ELKDPNEIPTEAPVEVQEVPKKRGRKSTKTAAPTV--PPPTTKRLLWHG-TRVTNV--------
Q6DDF6_XENLA/117-300----------------Y..CEKLSAKFQETRG.......DRD.........--.....LIYAFHG-SRLENF--------
Q6DFH2_XENLA/340-552----------------ELQRVGEECNFRED.........LPN.........--.....RMLLWHG-SRLTNW--------
Q7Z114_DICDI/449-640----------------RLDKKLESDNFLD..........VGN.........--.....VQYLYHG-SKPQNL--------
PARP1_CHICK/794-1004----------------RIEREGESQRYKPFKQ.......LHN.........--.....RQLLWHG-SRTTNF--------
PARP2_ARATH/421-633----------------RASRAVEADRFQQFSS.......SKN.........--.....RMLLWHG-SRLTNW--------
PAR16_MOUSE/90-273----------------Y.........FDPANSRFYETKGERD.........--.....LIYAFHG-SRLENF--------
Q6A0B1_MOUSE/386-574----------------RVGRVNEATEFLSK.........LGN.........--.....VRLLFHG-SPVRNI--------
PARP2_MAIZE/436-648----------------KVSRHGETERFQKFAS.......TRN.........--.....RMLLWHG-SRLSNW--------
Q8BSZ1_MOUSE/766-954----------------RVSHPLLQQQYQLHRERLMQSCQQRP.........--....VEQVLYHG-TSESAV--------
PARP1_MAIZE/764-976----------------SLDRDGELNKYSRYKN......NLHN.........--.....KMLLWHG-SRLTNF--------
Q6NX05_DANRE/102-278----------------Y..CDLLNSKFERTRA.......GRD.........--.....LIYAFHG-SRLENF--------
PARP2_HUMAN/365-577----------------EVEKDGEKEAFRED.........LHN.........--.....RMLLWHG-SRMSNW--------
Q8X0P2_NEUCS/432-660----------------RIERQGEFDRFDQSDYADGKMKLKKN.........--.....RKLLWHG-SRSTNF--------
Q8I7C4_DICDI/2328-2536----------------KLQRKGEVERFQAHKN.......LKN.........--.....HFLLWHG-SLTTNY--------
Q7ZVB0_DANRE/323-528----------------EVDRETEAERFRENDA.......LEN.........--.....RKLLWHG-TNVAVV--------
Q91YR6_MOUSE/317-528----------------KVNREGEGDRFQAHSK.......LGN.........--.....RRLLWHG-TNVAVV--------
PARP_SARPE/782-993----------------KVARQGEARRYKPFKK.......LHN.........--.....RRLLWHG-SRLTNF--------
Q6V953_EMEND/449-674----------------RIERQGEHDRFKSSSYAG...LKNSN.........--.....RRLLWHG-SRSTNY--------
PARP3_SOYBN/586-801----------------AVQTGGC.PSYEDIIK.......LPN.........--.....KVLLWCG-SRSSNL--------
Q8I7C6_DICDI/493-700----------------KIDRDGEADRYKTKKH.......LGN.........--.....RKLLWHG-SRLTNY--------
PARP1_ARATH/767-979----------------ALEREGEFDKYAPHRE......KLGN.........--.....KMLLWHG-SRLTNF--------
Q7Z115_DICDI/725-936----------------SLERENESERFTPWAK.......DKN.........--.....RLLLWHG-SRLTNF--------
PAR11_HUMAN/129-330----------------RIQNLDLWEFFCRKKAQLKKKRGVPQI........--....NEQMLFHG-TSSEFV--------
Q8I7C5_DICDI/585-801----------------KVDRIGD.DQFSQWES.......NHN.........--.....RMLLFHG-SRIQSW--------

PF02763

DTXH_CORBE/26-212----------------QKPKSGTQGNYDDD--------------------------------WKGFYSTDNK--------
DTX_CORBE/33-219----------------QKPKSGTQGNYDDD--------------------------------WKGFYSTDNK--------
DTX_COROM/26-212----------------QKPKSGTQGNYDDD--------------------------------WKGFYSTDNK--------

PF01375

E2BA_ECOLX/1-263----------------GLIPRGQDEAYERGTP---ININLYD-------HA--RGTATGNTRYNDGYV-STT--------
A3H3Z6_VIBCL/2-258----------------GLMPRGQSEYFDRGTQ---MNINLYD-------HA--RGTQTGFVRHDDGYV-STS--------
E2AA_ECOLX/2-259----------------GLLPRGQQEAYERGTP---ININLYE-------HA--RGTVTGNTRYNDGYV-STT--------
Q13Q55_BURXL/433-665----------------GF...SVEDTPLRNTS---LD..LHD-------SI--VAGNPAAT.DGGGYV-GTF--------
A7Y1X7_ECOLX/2-258----------------GLMPRGHNEYFDRGTQ---MNINLYD-------HA--RGTQTGFVRYDDGYV-STS--------
Q04RV9_LEPBJ/40-285----------------GFWSAGASSA..DSTN---LDFSLLN-------HV--TPSVNS...ERSGYI-SLF--------

PF02917

CARDS_MYCPN/3-234----------------GFSTLGDVRNFFEHILSTNFGRSYFI-------ST--SETPTAAIRFFGSWLREYV--------
TOX1_BORPE/36-268----------------GFTAWGNNDNVLDHLT....GRSCQV-------GS--SNSAFVSTSSSRRYT.EVY--------

PF03496

A0FKE4_9GAMM/241-430.....GMSAAFEKSTPAEQLVK--------TFRG.................................T-----HGG----
A1KWU2_STAAU/47-247...VRRLDSSISKS.TTPESVY--------VYRLLNLDYLTSIVGFTNEDLYKLQQTNN..GQYD..E-----NLV----
A2RG53_STRPG/60-249...VAQLDAATHRL.VIPWNIV--------VYRYVYETFL.RDIGVSHADLTSYYRN....HQFD..P-----HIL----
A3KYA6_PSEAI/242-430.....GMSAAFEKSGQAEQVVK--------TFRG.................................T-----RGG----
A3L121_PSEAI/245-434.....GMSAAFEKSGPAEQVVK--------TFRG.................................T-----QGR----
B0YIU7_BACTU/276-462...IKNISDALGKK.PIPENIT--------VYRWCGMPEFGYQISDP....................L-----PSL----
B1BBR9_CLOBO/55-244...VKLIDQSFSKM.KIPQNII--------LFRGDDPAYLGPEFQDKILNKD.........GTIN..R-----DVF----
B1BSY1_CLOPF/261-454...VNNIENALKLT.PIPSNLI--------VYRRSGPQEFGLTLTSPEYDFNK..............I-----ENI----
B3ZYG6_BACCE/56-253...IKHIDSALKKG.RISEPIT--------VYRRAKGFSLGINNGLL........VDWKNPNKII..K-----ENI----
B3ZYJ4_BACCE/45-249...IINLDSAIEKA.KMKESIK--------VYRRVGENAFGMEADSLRNK...........NTIN..R-----EKY----
B4U1X8_STREM/46-234...VALLDSATHKL.TIPWNII--------VYRYVYETFL.TELGISEEELARYYHD....KTFD..P-----QIL----
C2SU54_BACCE/217-423...IDLISSGLQKL.SLPTDIV--------VYRRTGTDTFKPDPNNPILKFDFN..........N..P-----KDI----
C2X5A0_BACCE/56-251...IKHLDRAFSSS.SVPDDIV--------VYRRSKESSFGLTEGTLIKD...........NKIN..E-----QEF----
C3B4Y1_BACMY/29-179...IDNIKSGLNKA.SVPYDIQ--------VYRGTDLNSF............................-----...----
C3B5A2_BACMY/83-262...IDNIKSGLNKA.SVPYDIQ--------VYRGTDLKPFKNLYKI.....................D-----DEG----
C3DDI1_BACTU/266-451...IKNISDALEKN.PIPENIT--------VYRYCGMAEFGYPIQPE....................A-----PSV----
C3ECU3_BACTU/38-244...IKQIDRAFSKV.RLHDDII--------VYRRVSEQAFGLPGNSLVNHAEQEENPVNSVSKIN..R-----ENF----
C3V1Q7_9CAUD/377-628...INNLDSAFENGDRIPEGIT--------VYRAQ................................S-----MTA----
C4B698_CLOBO/226-428...IELISSALSVK.PIPETLI--------AYRRVDGIPFDLPSDFS........FDKKENGEIIADK-----QKL----
D0GI75_9VIRU/1-192...VELLDKSFNKM.KTPENIM--------LFRGDDPAYLGTEFQNTLLNSN.........GTIN..K-----TAF----
ALT_BPT4/374-615...IDNLDSAFKNGERLPKGIT--------LYRSQ................................R-----MLP----
ARC3_CLOLM/60-249...VEQIDKSFTKM.QTPENII--------LFRGDDPGYLGPDFENTILNRD.........GTIN..K-----AVF----
CRAX_BACCE/253-470ENQIKNLDAALQKS.KITENLI--------VYRRVSELQFGK.......KYEDYNLRQN..GIIN..E-----EKV----
Q8GAX6_STAAU/47-247...VRQLDSTISKS.VTPDSVY--------VYRLLNLDYLSSITGFTREDLHMLQQTNN..GQYD..E-----ALV----
Q8VVU2_STAAU/47-247...ILRLDRLISKS.STSDSVY--------VYRLLNLDYLSSVKGFSSEDLELLYKTEN..GKYN..E-----ELV----
Q977Y7_CLOAB/207-388...IEDIKSGLKKA.SVPHDMK--------VYRGTDLNPLRNLIDV.....................G-----KDG----

PF01129

NAR5_MOUSE/29-255---HFYLTRALQLLRG...SGGCSRGPGEVVFRGVG..-----------------------------.-----..S----
NAR1_HUMAN/39-274---HFLLTEALQLLGSGQRPPRCHQ.....VFRGVH..-----------------------------.-----..G----
NAR1_MOUSE/39-269---HFLLTEALQLLRS.HRSRGCQQ.....VYRGVH..-----------------------------.-----..G----
NRT1_CHICK/37-257---HFFLTQALFALRA..SQPRCYY.....VYRGVR..-----------------------------.-----..G----
Q87WF6_PSESM/58-297---VEALKSGLAKLAQDPDYQVSSQ.....LHRGIKQK-----------------------------M-----SDG----
NAR3_HUMAN/29-252---HFYLTRALQLLRK.....PCEASSKTVVYRTSQ..-----------------------------.-----..G----
NARE_CHICK/37-257---HFLLSRALHTLQE.SQTQPCHN.....VFRGVR..-----------------------------.-----..G----
NAR2A_MOUSE/27-242---HYYLTRALQLLSD....QGCRS.....VYRGTN..-----------------------------.-----...----
NAR2A_RAT/27-239---HYYLTRALQLLSN....GDCHS.....VYRGTK..-----------------------------.-----...----

PF00644

Q7QBC7_ANOGA/780-991---AGILTNGLKIAPPEAPVTGYM...---..FGKGIYFADMVSKSA..NYCCT..NVA.......DS.....TGL....
PAR12_MOUSE/506-689---DAICQQNF..DWRVCGLHGTS...---..YGKGSYFARDAAYSH..HYSKS....D.......TH.....SHM....
Q8QGB0_ONCMY/90-274---TQINNHGF..NRSYAGTHGAA...---..IGNGSYFAVNSSYSA..RGYSK..ADA.......QG.....NKR....
PME2_CAEEL/304-528---FSILMNGL..QFPVGDRCGLM...---..FGNGVYFANVPTKSA..NYCCP...EA.......SK.....RVF....
Q6DDF6_XENLA/117-300---HSILHNGLHCHLNKTSL.......---..FGEGTYLTSDLGLAL..LYSP.............HG.....QGWTRSM
Q6DFH2_XENLA/340-552---VGILSQGLRVAPPEAPVTGYM...---..FGKGIYFADVSSKSA..NYCFS..SRD.......KN.....VGV....
Q7Z114_DICDI/449-640---VGLLSRGILPPDYVKQIGGKRTDF---GYLGSGIYFSDDV.VSS..TYTSP..IGE.......KG.....SRF....
PARP1_CHICK/794-1004---AGILSQGLRIAPPEAPVTGYM...---..FGKGIYFADMVSKSA..NYCHT..SQA.......DP.....IGL....
PARP2_ARATH/421-633---AGILSQGLRIAPPEAPVTGYM...---..FGKGVYFADMFSKSA..NYCYA..NTG.......AN.....DGV....
PAR16_MOUSE/90-273---HSIIHNGLHCHLNKTSL.......---..FGEGTYLTSDLSLAL..IYSP.............HG.....HGWQHSL
Q6A0B1_MOUSE/386-574---LGILSRGLLLPKVAEDRGVQRTDV---GNLGSGIYFSDSLSTSI..KYAHA..GET.......DG.....SRL....
PARP2_MAIZE/436-648---AGILSQGLRIAPPEAPVTGYM...---..FGKGVYFADMFSKSA..NYCYA..SEA.......CR.....SGV....
Q8BSZ1_MOUSE/766-954---LDICAHGF..NRSFCGRNGTL...---..YGQGVYFAKRASLSVLDRYSPP............NA.....EGYK...
PARP1_MAIZE/764-976---VGILSQGLRIAPPEAPVTGYM...---..FGKGLYFADLVSKSA..QYCYV..DRN.......NP.....VGL....
Q6NX05_DANRE/102-278---HSIIHNGLHCHLNKTSL.......---..FGEGTYLTSDLSMAI..LYSP.............HG.....NGWRESV
PARP2_HUMAN/365-577---VGILSHGLRIAPPEAPITGYM...---..FGKGIYFADMSSKSA..NYCFA..SRL.......KN.....TGL....
Q8X0P2_NEUCS/432-660---GGILSQGLRIAPPEAPVNGYM...---..FGKGVYLADMSSKSA..GYCCA..YMS.......NG.....TAL....
Q8I7C4_DICDI/2328-2536---LSILSQGLKIAPPEAPVTGYM...---..FGKGIYFSDMFRKSI..NYCGS.WDSS.......SA.....NSF....
Q7ZVB0_DANRE/323-528---AAILKSGLRI....MPHSGGR...---..VGRGIYFASENSKSA..GYVRP....S.......NK.....IGI....
Q91YR6_MOUSE/317-528---AAILTSGLRI....MPHSGGR...---..VGKGIYFASENSKSA..GYVTTMHCGG.......HQ.....VGY....
PARP_SARPE/782-993---AGILSHGLKIAPPEAPVTGYM...---..FGKGIYFADMVSKSA..NYCCT..SHH.......NS.....TGL....
Q6V953_EMEND/449-674---GGILSQGLRIAPPEAPVSGYM...---..FGKGVYFADMSSKSA..NYCWS..HNS.......DH.....KAL....
PARP3_SOYBN/586-801---LRHLQKGFLPAICSLPIPGYM...---..FGKAIVCSDAAAEAA..RYGFT..AVD.......RP.....EGF....
Q8I7C6_DICDI/493-700---ASIISQGLRIAPPEAPVSGYR...---..FGKGVYFADCMSLSA..NYCRT...VG.......SN.....DFC....
PARP1_ARATH/767-979---VGILNQGLRIAPPEAPATGYM...---..FGKGIYFADLVSKSA..QYCYT..CKK.......NP.....VGL....
Q7Z115_DICDI/725-936---VSIVSQGLRIAPPSAPKTGYR...---..FGKGIYFADCISKSF..SYCFT..SSD.......CP.....TAL....
PAR11_HUMAN/129-330---EAICIHNF..DWRINGIHGAV...---..FGKGTYFARDAAYSS..RFCKD..DIKHGNTFQIHGVSLQQRHLFRTY
Q8I7C5_DICDI/585-801---CSILPNGLKIASPLSPKSGYR...---..LGKGVYLADCISLSG..LYTGA..TKE.......NP.....TAI....

PF02763

DTXH_CORBE/26-212---YDAAGYSVDNENPLSGKAGDVVKV---TYPGLTKVLALKVDNAE--TIKKE------------LG------------
DTX_CORBE/33-219---YDAAGYSVDNENPLSGKAGGVVKV---TYPGLTKVLALKVDNAE--TIKKE------------LG------------
DTX_COROM/26-212---YDAAGYSVDNENPLSGKAGGVVKV---TYPGLTKVLALKVDNAE--TIKKE------------LG------------

PF01375

E2BA_ECOLX/1-263---TTLRQAHLLGQNMLGGYNEYYIYV---VAAAPNLFDVNGVLGR.YSPYPSENEYAALGGIPLSQI-----IGWYRVS
A3H3Z6_VIBCL/2-258---ISLRSAHLVGQTILSGHSTYYIYV---IATAPNMFNVNDVLGA.YSPHPDEQEVSALGGIPYSQI-----YGWYRVH
E2AA_ECOLX/2-259---VTLRQAHLIGQNILGSYNEYYIYV---VAPAPNLFDVNGVLGR.YSPYPSENEFAALGGIPLSQI-----IGWYRVS
Q13Q55_BURXL/433-665---TGRAEAQARIDATAA..KKGYVYY---VAPSPNMVDVRGSLGSEHARAPRDGEVAAMGHIDYTQV-----RGWQKYE
A7Y1X7_ECOLX/2-258---LSLRSAHLAGQSILSGYSTYYIYV---IATAPNMFNVNDVLGV.YSPHPYEQEVSALGGIPYSQI-----YGWYRVN
Q04RV9_LEPBJ/40-285---RNFIHALICAQSNIS..QDYYIYQ---IAGGFNIVDVQGSLGP.YTPSNSTAEAVALNRIYWNQV-----YGWTRFS

PF02917

CARDS_MYCPN/3-234---PEHPRRAYLYEIRADQ...HFYNA---RATGENLLDLMRQRQV-VFDS-GDREMAQMGIRALRTS-----FAYQREW
TOX1_BORPE/36-268---LEHRMQEAVEAERAGRGTGHFIGY---IYEVRADNNFYGAASS-YFEY-VDTYGDNAGRILAGAL-----ATYQSEY

PF03496

A0FKE4_9GAMM/241-430--DAFSGVTE--GQVGHDTAYFSTSRDPK.......VAT----SFGGS...--------------..GTISTVFGRSGID
A1KWU2_STAAU/47-247--RKLNNVMN--SRIYREDGYSSTQLVSG.........A----AVGGR..P--------------IELRLELPKGTKAAY
A2RG53_STRPG/60-249--CKIK...L--GTRYTKHSFMSTTALKN.........G----AMTHR..P--------------VEVRICVKKGAKAAF
A3KYA6_PSEAI/242-430--DAFNAVEE--GKVGHDDGYLSTSLNPG.......VAR----SF.GQ...--------------..GTISTVFGRSGID
A3L121_PSEAI/245-434--DAFEAVKE--GQVGHDAGYLSTSRDPS.......VAR----SFAGL...--------------..GTITTLFGRSGID
B0YIU7_BACTU/276-462--KDFEEQFL--NTIKEDKGYMSTSLSSE.......RLA----AFGSR..K--------------IILRLQVPKGSTGAY
B1BBR9_CLOBO/55-244--EQVKAKFL--KKDRTEYGYISTSLMS..........A----QFGGR..P--------------IVTKFKVTNGSKGGY
B1BSY1_CLOPF/261-454--DAFKEKWE--GKVITYPNFISTSIGSV.......NMS----AFAKR..K--------------IILRINIPKDSPGAY
B3ZYG6_BACCE/56-253--SKISEMLI--GKTKTEYGYISTSLSQD.......AAS----NFSKL..P--------------ILLKIHLPVGTEAAY
B3ZYJ4_BACCE/45-249--RELAERFM--NKEIKEYGYLSTTLVRGISDEAKIKSP----EIALM..P--------------IILELNIPKGTKAAY
B4U1X8_STREM/46-234--SAIK...P--GARYTKQGFMSTTAIKN.........A----AMPHR..S--------------VELRIRIPQGSQAAF
C2SU54_BACCE/217-423--ESFKKQYE--GSLNEEKAFLSTSLVRDPD.....LYG----SFMQK..R--------------ILMRITLPKGTHAGF
C2X5A0_BACCE/56-251--SEFKNKLL--GKYKTDYTYMSTSILKD.......PSE----SFNGR..P--------------ILIRLTVPKGSHGAY
C3B4Y1_BACMY/29-179--....ENLM--SRFFYFKKKSALILLSL..........----........--------------....LQWTKRFQCCH
C3B5A2_BACMY/83-262--KIVVDSLV--GKTVKDNGFVSTAMVKE.........S----SFDHM..N--------------VSWEINVPKGANAAY
C3DDI1_BACTU/266-451--QDFEEKFL--DKIKEEKGYMSTSLSSD........AT----SFGAR..K--------------IILRLQIPKGSSGAY
C3ECU3_BACTU/38-244--EFFKNRFQ--GKYKKDPAYISTSIVKD.......AAE----GFSGA..P--------------ILMKIHVPKGVPAIY
C3V1Q7_9CAUD/377-628--PIYEALVK--NKVFYFRNFVSTSLTPIIFGRFGITHA----GIGLLEPE--------------ARNELTVDKNEEGIT
C4B698_CLOBO/226-428--NEFIDKWT--GKEIKNLSFSSTSLKST........PL----SFSKS..R--------------FIFRLRLSEGTIGAF
D0GI75_9VIRU/1-192--EKAKAKFL--NKDRLEYGYISTSLMNV.........S----QFAGR..P--------------IITKFKVAKGSKAGY
ALT_BPT4/374-615--SIYEAMVK--NRVFYFRNFVSTSLYPNIFGTWM.TDS----SIGVLPDE--------------KRLSVSIDKTDEGLV
ARC3_CLOLM/60-249--EQVKLRFK--GKDRKEYGYISTSLVNG.........S----AFAGR..P--------------IITKFKVLDGSKAGY
CRAX_BACCE/253-470--MELESNFK--GQTFIQHNYMSTSLVQD.......PHQ----SYSNDRYP--------------ILLEITIPEGVHGAY
Q8GAX6_STAAU/47-247--SKLNNLMN--SRIYRENGYSSTQLVSG.........A----ALAGR..P--------------IELKLELPKGTKAAY
Q8VVU2_STAAU/47-247--KKLNNIMN--SKIYTEYGYSSTQLVKG.........A----ALAGR..P--------------IELKLQLPKGTKAAY
Q977Y7_CLOAB/207-388--SLDFSSLV--GKTFKDDGFMSTALVKE.........S----SFDYM..N--------------VSWEINVPKGTEAAY

PF01129

NAR5_MOUSE/29-255--LHFEPKRL--GDSVRLGQFTSSSVDER-------VAR....RFGNA--------------------TFFNLRTCFGAP
NAR1_HUMAN/39-274--LRFRPAGP--RATVRLGGFASASLKHV-------AAQ....QFGED--------------------TFFGIWTCLGAP
NAR1_MOUSE/39-269--LRFRPAGP--GATVRLGGFASASLKNV-------AAQ....QFGED--------------------TFFGIWTCLGAP
NRT1_CHICK/37-257--IRFM.TQR--GKSVRFGQFTSTSLRKE-------ATV....NFGQD--------------------TLFVVKTCYGVP
Q87WF6_PSESM/58-297--EVMSRFKP--GKTYRDEAFMSTSTHMQ-------VSE....EFTSD--------------------VTLHLRSSSAVN
NAR3_HUMAN/29-252--TSFTFGGL--N.QARFGHFTLAYSAKP-------QAA.....NDQL--------------------TVLSIYTCLGVD
NARE_CHICK/37-257--TRFT.AQQ--GTVVRFGQFTSSSLQKK-------VAE....FFGLD--------------------TFFSVETCYGVP
NAR2A_MOUSE/27-242--VRFRYTGK--G.SVRFGHFASSSLNRS-------VATSSPFFNGQG--------------------TLFIIKTCLGAH
NAR2A_RAT/27-239--TRFHYTGA--G.SVRFGQFTSSSLSKT-------VAQSPEFFSDDG--------------------TLFIIKTCLGVY

PF00644

Q7QBC7_ANOGA/780-991..LLLCEVAL--GD.MQEYTQAHY.V..TKLSTGKHSVK----GIGRTQPD....PTGS.HVRPDGV...EIPMGKG.VS
PAR12_MOUSE/506-689..MFLARVLV--GD......................FVR----GSTSFVR.....................PPAKEGQSN
Q8QGB0_ONCMY/90-274..MYLARVLV--GD...................YTQGQA----GLIVPPA.....................KPSGKD..A
PME2_CAEEL/304-528..MLLCEVET--AN.PLVLYESEIDADEKMEKAKKTSVY----AAGKHTP.......RD.TVEING.....IPAFKSNLE
Q6DDF6_XENLA/117-300LGPVLSCVAM--CE..............MIDHPDVKCQA----KKKDSSE.....................IDRKRA.RA
Q6DFH2_XENLA/340-552..LLLSEVAL--GE.CNELLAADCDA..QKKIKSKHSTK----GLGRSIPD....PKKS..IIHEGA...VVPLGPL.MD
Q7Z114_DICDI/449-640..IIMSSVSL--GK.VKEFSKIQPSL..QCAPSGHHSCK----GLKSTPT.....................NPTD.....
PARP1_CHICK/794-1004..ILLGEVAL--GN.MYELKNASH.I..TKLPKGKHSVK----GLGKTAPD....PTAT..TTLDGV...EVPLGNG.IS
PARP2_ARATH/421-633..LLLCEVAL--GD.MNELLYSDYNA..DNLPPGKLSTK----GVGKTAPN....PSEA.QTLEDGV...VVPLGKP.VE
PAR16_MOUSE/90-273LGPILSCVAV--CE..............VIDHPDVKCQI----KKKDSKE.....................IDRSRA.RI
Q6A0B1_MOUSE/386-574..LVVCDVAL--GK.CVNLFKKDFSL..TEAPPGYDSVH----GVSETTS.....................VPTD.....
PARP2_MAIZE/436-648..LLLCEVAL--GD.MNELLNADYDA..NNLPKGKLRSK----GVGQTAPN....MVES.KVADDGV...VVPLGEP.KQ
Q8BSZ1_MOUSE/766-954.AVFVAQVLT--GD.....................YGQG----SRGLKAP......................PLRVSGQV
PARP1_MAIZE/764-976..MLLSEVAL--GD.MYELKKATS.M..DKPPRGKHSTK----GLGKTVPL....ESEF.VKWRDDV...VVPCGKP.VP
Q6NX05_DANRE/102-278LGPFISCVAL--CE..............IIDHPDVKCQV----KKKDSES.....................IDRQRL.RA
PARP2_HUMAN/365-577..LLLSEVAL--GQ.CNELLEANPKA..EGLLQGKHSTK----GLGKMAPS.....SAH.FVTLNGS...TVPLGPA.SD
Q8X0P2_NEUCS/432-660..LLLCEAEL--GDPIQELTGADYNAGEHAKQKGMLSTW----GKGGTGPLKWKDAGAV.NPALQGV...MMPDTSV..K
Q8I7C4_DICDI/2328-2536..LLLSEVAL--GT.MKEFKSAHY.M..ESPETGTNSTK----GVGKTGPN....FDDS.IILNNGV...AIPLSPP.EQ
Q7ZVB0_DANRE/323-528..MFLNEVAL--GK.EYTITRDDPSL..RKAPAGYDSVI----ARGNQEPD....PSKDVFIELDGKK.VVVPQGKVIKQ
Q91YR6_MOUSE/317-528..MFLGEVAL--GK.EHHITIDDPSL..KSPPPGFDSVI----ARGQTEPD....PAQD.IELELDGQPVVVPQGPPVQC
PARP_SARPE/782-993..MLLSEVAL--GD.MMECTAAKY.V..TKLPNDKHSCF----GRGRTMPN....PSES.IIREDGV...EIPLGKP.IT
Q6V953_EMEND/449-674..LLLGDVEL--GDPIYELYDSDYNAGENAKKEGKIATL----GKGRSIPAGWKDAGCI.HPHLKGI...QVPDADS.GT
PARP3_SOYBN/586-801..LVLAIASL--GNEITELKTPPEDA..SSLEEKKVGVK----GPGKKKTD....ESEH.FVWKDDI...KVPCGKL.VA
Q8I7C6_DICDI/493-700..MLLGDVAL--GK.TADLARDTY.M..EKPQPNSHSTW----ALGTVEPD....PKVF.FQDTEGC...ITPYGQM.IP
PARP1_ARATH/767-979..MLLSEVAL--GE.IHELTKAKY.M..DKPPRGKHSTK----GLGKKVPQ....DSEF.AKWRGDV...TVPCGKP.VS
Q7Z115_DICDI/725-936..MLLCEVSL--GD.MNELKHDTY.M..EEAPHPFHSTK----ALGMAAPHK..DGNHP.LSDSDGL...VVPLGKI.SK
PAR11_HUMAN/129-330KSMFLARVLI--GD......................YIN----GDSKYMR.....................PPSKDGSYV
Q8I7C5_DICDI/585-801..IAICDVAL--GN.SAALYHDTYM...EEPQLGYLSTK----ALGKRQPALYDQLNGC.YQDKDE....FIPSSVLKGP

PF02763

DTXH_CORBE/26-212--LSLTEPLM--EQ---------------VGTEEFIKRF----GDGASRVVL------------------SLPFAEGSSS
DTX_CORBE/33-219--LSLTEPLM--EQ---------------VGTEEFIKRF----GDGASRVVL------------------SLPFAEGSSS
DTX_COROM/26-212--LSLTEPLM--EQ---------------VGTEEFIKRF----GDGASRVVL------------------SLPFAEGSSS

PF01375

E2BA_ECOLX/1-263....FGAIEGG.MHRNRDYRRDLFRGLSAAPNEDGYRIA----GFPDGFPA---------WE-EVPWREF.APNSCLPNN
A3H3Z6_VIBCL/2-258....FGVLDEQ.LHRNRGYRDRYYSNLDIAPAADGYGLA----GFPPEHRA---------WR-EEPWIHH.APPGCGNAP
E2AA_ECOLX/2-259....FGAIEGG.MQRNRDYRGDLFRGLTVAPNEDGYQLA----GFPSNFPA---------WR-EMPWSTF.APEQCVPNN
Q13Q55_BURXL/433-665....NGKLAP..YVANPDYRWDVYDATRTAGAQP..QLA----HFSPDNPA---------WA-DAGHRPFVTPFQQDGKT
A7Y1X7_ECOLX/2-258....FGVIDER.LHRNREYRDRYYRNLNIAPAEDGYRLA----GFPPDHQA---------WR-EEPWIHH.APQGCGNSS
Q04RV9_LEPBJ/40-285SNFIFSLDDPGLLEHNLMFDRETFANATSSPGLP..ELA----GFPQGDPR---------WG-NEFFANV.A..GCEAPL

PF02917

CARDS_MYCPN/3-234--FTDGPIAA--ANVR..SAW-LVDAVPVEPGHAHHPAG----R.VVETTR---------INEPEMHNPHYQELQTQAND
TOX1_BORPE/36-268--LAHRRIPP--ENIRRVTRV-YHNGITGETTTTEYSNA----RYVSQQTR---------AN.PNPYTSRRSVASIVGTL

PF03496

A0FKE4_9GAMM/241-430VSD..I...............................SVE.GDEQEILYNKATDMRVLLSAKDERGVTRRVLEEAKLGEQ
A1KWU2_STAAU/47-247LNSKDL...............................TAY.YGQQEVLLPRGTEYAV..........GSVEL.......S
A2RG53_STRPG/60-249VEP..Y...............................SAV.PSEVELLFPRGCQLEV............VGAYV.....S
A3KYA6_PSEAI/242-430VSG..I...............................SNY.KNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQ
A3L121_PSEAI/245-434VRE..I...............................SIE.GDEQEILYDKGTDMRVLLSAKDGQGVTRRVLEEATLGER
B0YIU7_BACTU/276-462LSA..I...............................GGF.ASEKEILLDKDSKYHI..........DKATEVI.....I
B1BBR9_CLOBO/55-244IDP..I...............................SYF.PGQLEVLLPRNNSYYI..........SDMQI.......S
B1BSY1_CLOPF/261-454LSA..I...............................PGY.AGEYEVLLNHGSKFKI..........NKVDSYK.....D
B3ZYG6_BACCE/56-253LGN..L...............................STN.PGENEVLIGRGFTYQI..........EKASIIE.....L
B3ZYJ4_BACCE/45-249IND..L...............................SDK.PWELELLVGRGSTFKI..........HGMSIIV.....E
B4U1X8_STREM/46-234VQP..Y...............................SFY.PYEMELLFPRQCTLEI............IGANL.....S
C2SU54_BACCE/217-423LPALEL...............................GTY.QGENEMLLDHGYQYKI..........DKIGTVETELSTG
C2X5A0_BACCE/56-251IAP..L...............................SAY.PWEMEMLLPRNTTYKV..........NDISYVK.....N
C3B4Y1_BACMY/29-179IFY..I...............................KSIFSKKVYMLSAQVVKYVL.......................
C3B5A2_BACMY/83-262VGK..I...............................SYI.PTEAELLFNSGQEMVI..........KSANVD......S
C3DDI1_BACTU/266-451VAG..L...............................DGFKPAEKEILIDKGSKYHI..........DKVTEVV.....V
C3ECU3_BACTU/38-244VDP..L...............................SNV.PGEMELLFPRNRSYKI..........TNISPVI.....E
C3V1Q7_9CAUD/377-628INPNEIRAYKENPEYVKVQIGWAIDGAHKVNVVYP.GSLGIATEAEVILPRGLMVKV..........NKITDASNNDGTT
C4B698_CLOBO/226-428IYG..F...............................SGF.QDEQEILLNKNSTFKI..........FRITPITSIINRV
D0GI75_9VIRU/1-192IDP..I...............................SAF.AGQLEMLLPRHSTYHI..........DDMRL.......S
ALT_BPT4/374-615NSSDNL...........VGIGWVITGADKVNVVLPGGSLAPSNEMEVILPRGLMVKV..........NKITDASYNDGTV
ARC3_CLOLM/60-249IEP..I...............................STF.KGQLEVLLPRSSTYTI..........SDMQI.......A
CRAX_BACCE/253-470IAD..M...............................SEY.PGQYEMLINRGYTFKY..........DKFSIVKPTREED
Q8GAX6_STAAU/47-247IDSKEL...............................TAY.PGQQEVLLPRGTEYAV..........GSVKL.......S
Q8VVU2_STAAU/47-247IDSKNL...............................TAY.PGQQEILLPRGTDYTI..........NTVKL.......S
Q977Y7_CLOAB/207-388VSK..I...............................SYF.PDEAELLLNHGQEMII..........KEATVG......S

PF01129

NAR5_MOUSE/29-255IQA--L-------------------------------SVF-PEEREVLIPPHEVFLV----------TGFSQ.------D
NAR1_HUMAN/39-274IKG--Y-------------------------------SFF-PGEEEVLIPPFETFQV----------INASRL------A
NAR1_MOUSE/39-269IRG--Y-------------------------------SFF-PEEEEVLIPPFETFQV----------INTSRP------T
NRT1_CHICK/37-257IKQ--F-------------------------------SFF-PSEDEVLIPPFEVFEV----------INFSN.------D
Q87WF6_PSESM/58-297IGP--F-------------------------------SKN-PYEDEALISPLTPFKV----------TGLRK.------Q
NAR3_HUMAN/29-252IEN--F-------------------------------LDK-ESERITLIPLNEVFQV----------SQ....------E
NARE_CHICK/37-257IKD--L-------------------------------STF-PGEDEVLIPPFEQFRV----------TNSTY.------T
NAR2A_MOUSE/27-242IKH--C-------------------------------SYY-THEEEVLIPGYEVFHK----------VKTQS.------V
NAR2A_RAT/27-239IKE--F-------------------------------SFY-PDQEEVLIPGYEVYQK----------VR....------T

PF00644

Q7QBC7_ANOGA/780-991NEK----------------------------------LKS--S...LLYNEFIVYDV-----------------------
PAR12_MOUSE/506-689AFY----------------------------------DSC--VNSMSDPTIFVVFEK-----------------------
Q8QGB0_ONCMY/90-274DLY----------------------------------DSV--TDNTSNPTMFVIFSD-----------------------
PME2_CAEEL/304-528TIE----------------------------------EET--R...LLYDEYVMFNK-----------------------
Q6DDF6_XENLA/117-300RNS----------------------------------EGG--D...VPQKYFVVTNN-----------------------
Q6DFH2_XENLA/340-552TGL----------------------------------TND--GGYTLNYNEYIVYDP-----------------------
Q7Z114_DICDI/449-640...----------------------------------...--....FKNNEYVVFNP-----------------------
PARP1_CHICK/794-1004TGI----------------------------------NDT--C...LLYNEYIVYDV-----------------------
PARP2_ARATH/421-633RSC----------------------------------SKG--M...LLYNEYIVYNV-----------------------
PAR16_MOUSE/90-273KHS----------------------------------EGG--E...IPPKYFVVTNN-----------------------
Q6A0B1_MOUSE/386-574...----------------------------------...--....FQDDEFVVYKT-----------------------
PARP2_MAIZE/436-648EPS----------------------------------KRG--G...LLYNEYIVYNV-----------------------
Q8BSZ1_MOUSE/766-954LRY----------------------------------DSA--VDCLQQPRIFVIFHD-----------------------
PARP1_MAIZE/764-976SSI----------------------------------RSS--E...LMYNEYIVYNT-----------------------
Q6NX05_DANRE/102-278RNS----------------------------------EGG--E...VPEKYFVVTNN-----------------------
PARP2_HUMAN/365-577TGI----------------------------------LNP--DGYTLNYNEYIVYNP-----------------------
Q8X0P2_NEUCS/432-660PGN----------------------------------TNV--PGCSLLYNEYIAYDV-----------------------
Q8I7C4_DICDI/2328-2536VKG----------------------------------DTS--DY.HLEMNEYIVYDV-----------------------
Q7ZVB0_DANRE/323-528QQY----------------------------------EGS--H...FYNSEYLIYKE-----------------------
Q91YR6_MOUSE/317-528PSF----------------------------------KSS--S...FSQSEYLIYKE-----------------------
PARP_SARPE/782-993NDS----------------------------------LKS--S...LLYNEFIIYDI-----------------------
Q6V953_EMEND/449-674TDH----------------------------------KTD--QG.YLLYNEYIVYDV-----------------------
PARP3_SOYBN/586-801SDH----------------------------------QDS--P...LEYNEYAVYDK-----------------------
Q8I7C6_DICDI/493-700SQH----------------------------------KGV--S...CYEHQYVVYDV-----------------------
PARP1_ARATH/767-979SKV----------------------------------KAS--E...LMYNEYIVYDT-----------------------
Q7Z115_DICDI/725-936TGL----------------------------------STS--....CTHNEFIVYKI-----------------------
PAR11_HUMAN/129-330NLY----------------------------------DSC--VDDTWNPKIFVVFDA-----------------------
Q8I7C5_DICDI/585-801IIE----------------------------------TGS--IVTSFTHNEYVIYNN-----------------------

PF02763

DTXH_CORBE/26-212VEY----------------------------------INNWEQAKALSVKLEINFET---------------------RG
DTX_CORBE/33-219VEY----------------------------------INNWEQAKALSVELEINFET---------------------RG
DTX_COROM/26-212VEY----------------------------------INNWEQAKALSVELEINFET---------------------RG

PF01375

E2BA_ECOLX/1-263KAS----------------------------------SDT--TCASLTNKLSQHDLA---------------------DF
A3H3Z6_VIBCL/2-258RSS----------------------------------MSN--TCDEKTQSLGVKFLD---------------------EY
E2AA_ECOLX/2-259KEF----------------------------------KGG--VCISATNVLSKYDLM---------------------NF
Q13Q55_BURXL/433-665LYR----------------------------------PNE--HPALVQARFYQHANA---------------------DI
A7Y1X7_ECOLX/2-258RTI----------------------------------TGD--TCNEEAQNLSTIYLR---------------------EY
Q04RV9_LEPBJ/40-285RKR----------------------------------SNG--RCYLRQALLDSAQKI---------------------SN

PF02917

CARDS_MYCPN/3-234QPW----------------------------------LPT--PGIATPVHLSIPQAA---------------------SV
TOX1_BORPE/36-268VRM----------------------------------APV--IGACMARQAESSEAM---------------------AA

PF03496

A0FKE4_9GAMM/241-430SGHSKGLLDALDLAR----------------
A1KWU2_STAAU/47-247NDKKKIIITAIVFKK----------------
A2RG53_STRPG/60-249QDQKKLHIEAYFKGS----------------
A3KYA6_PSEAI/242-430SGHSQGLLDALDLAS----------------
A3L121_PSEAI/245-434SGHGEGLLDALDLAT----------------
B0YIU7_BACTU/276-462KGVKRYVVDATLLTN----------------
B1BBR9_CLOBO/55-244RNNRQIMITA.MIFK----------------
B1BSY1_CLOPF/261-454GTVTKLILDAT.LIN----------------
B3ZYG6_BACCE/56-253EGREYLEIEAKGKKD----------------
B3ZYJ4_BACCE/45-249NGRERLKVTADLLKK----------------
B4U1X8_STREM/46-234DDHTRLLIETR.LLP----------------
C2SU54_BACCE/217-423KRRTDVFVEATVLPK----------------
C2X5A0_BACCE/56-251GNSNYVLVDATI.QK----------------
C3B4Y1_BACMY/29-179.AIPHWNHTYSLILL----------------
C3B5A2_BACMY/83-262DGKIHLILD...LIK----------------
C3DDI1_BACTU/266-451KGIRKLVVDATLLLK----------------
C3ECU3_BACTU/38-244KDREYIMMDVEILDI----------------
C3V1Q7_9CAUD/377-628SNNTKLIQAEVMTTE----------------
C4B698_CLOBO/226-428TKMTQVVIDAEVIQN----------------
D0GI75_9VIRU/1-192SDGKQIIITATMMGT----------------
ALT_BPT4/374-615KTNNKLIQAEVMTTE----------------
ARC3_CLOLM/60-249PNNKQIIITA..LLK----------------
CRAX_BACCE/253-470KGKEYLKVNLSIYLG----------------
Q8GAX6_STAAU/47-247DNKRKIIITAVVFKK----------------
Q8VVU2_STAAU/47-247DDHKRILIEGIVFKK----------------
Q977Y7_CLOAB/207-388DGKLNIVLD.LNLKR----------------

PF01129

NAR5_MOUSE/29-255GAQSIVTLWSYDQTCS---------------
NAR1_HUMAN/39-274QGPARIYLRALGKHST---------------
NAR1_MOUSE/39-269QGPARIYLRALGKRST---------------
NRT1_CHICK/37-257RGSVKIQLHSKGKMST---------------
Q87WF6_PSESM/58-297DDKWHVDLNEIADNSD---------------
NAR3_HUMAN/29-252GAGNNLILQSINKTCS---------------
NARE_CHICK/37-257AGRSFIQLRSQGKSST---------------
NAR2A_MOUSE/27-242ERYIQISLDSPKRKKS---------------
NAR2A_RAT/27-239QGYNEIFLDSPKRKKS---------------

PF00644

Q7QBC7_ANOGA/780-991---GQVNCQYLFKMNF---------------
PAR12_MOUSE/506-689---HQVYPEYLIQYST---------------
Q8QGB0_ONCMY/90-274---VQAYPEFLIHSSK---------------
PME2_CAEEL/304-528---EHFKIKYVVEVKV---------------
Q6DDF6_XENLA/117-300---QLLRVKYLMVYSQ---------------
Q6DFH2_XENLA/340-552---HQVRMKYLLQVRF---------------
Q7Z114_DICDI/449-640---NQSKLSFLIEYIE---------------
PARP1_CHICK/794-1004---AQVNLKYLLKLKF---------------
PARP2_ARATH/421-633---EQIKMRYVIQVKF---------------
PAR16_MOUSE/90-273---QLLRVKYLLVYSQ---------------
Q6A0B1_MOUSE/386-574---NQVKMKYIVKFCT---------------
PARP2_MAIZE/436-648---DQIRMRYVLHVNF---------------
Q8BSZ1_MOUSE/766-954---TQALPTHLITCKN---------------
PARP1_MAIZE/764-976---SQVKMQFLLKVRF---------------
Q6NX05_DANRE/102-278---ELLRVKYLLVYSQ---------------
PARP2_HUMAN/365-577---NQVRMRYLLKVQF---------------
Q8X0P2_NEUCS/432-660---AQIRLRYLFRVKI---------------
Q8I7C4_DICDI/2328-2536---SQIRMRYLVEVSN---------------
Q7ZVB0_DANRE/323-528---SQCRIRYLLELKF---------------
Q91YR6_MOUSE/317-528---SQCRLRYLLEIHL---------------
PARP_SARPE/782-993---AQVNIQYMLRMNF---------------
Q6V953_EMEND/449-674---AQIRLRYLFFVDM---------------
PARP3_SOYBN/586-801---KRARISYLVGVKY---------------
Q8I7C6_DICDI/493-700---AQVHLKYLLQLRN---------------
PARP1_ARATH/767-979---AQVKLQFLLKVRF---------------
Q7Z115_DICDI/725-936---EQVRVKYILRVYN---------------
PAR11_HUMAN/129-330---NQIYPEYLIDF..---------------
Q8I7C5_DICDI/585-801---SQCRIKYLLKLRL---------------

PF02763

DTXH_CORBE/26-212KRGQDAMYEYMAQACA---------------
DTX_CORBE/33-219KRGQDAMYEYMAQACA---------------
DTX_COROM/26-212KRGQDAMYEYMAQACA---------------

PF01375

E2BA_ECOLX/1-263KKYIKRKFTLMTLLSINNDGFFSNNGGKDEL
A3H3Z6_VIBCL/2-258QSKVKRQI.....FSGYQSDIDTHNRIKDEL
E2AA_ECOLX/2-259KKLLKRRLALTFFMS..EDDFIGVHGERDEL
Q13Q55_BURXL/433-665QQRVKDQANRL........DYRGPVTIETEW
A7Y1X7_ECOLX/2-258QSKVKRQI.....FSDYQSEVDIYNRIRDEL
Q04RV9_LEPBJ/40-285ASRKRSRLPTLPFFKTPISQAISSKGMFIKL

PF02917

CARDS_MYCPN/3-234ADVSEGTSASLS.FACPDWS-----------
TOX1_BORPE/36-268WSERAGEAMVLVYYESIAYS-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window