Sequence alignment for CL0084

PF03496

A0FKE4_9GAMM/241-430-----QNQFG-------------------L--EAEQYLGEQPHG------------------------------------
A0A021PZP6_STAAU/47-247-----ATKWG-------------------N--KLIKQAKY....------------------------------------
A2RG53_STRPG/60-249-----KKRWG-------------------K--GLVY........------------------------------------
A0A030R3C5_PSEAI/242-430-----VKRFG-------------------A--DAEKYLGRQPGG------------------------------------
A3L121_PSEAI/245-434-----VEHFG-------------------L--EAEQYLGEHPDG------------------------------------
B0YIU7_BACTU/276-462-----AHSWG-------------------M--KIYEDWAKNL..------------------------------------
B1BBR9_CLOBO/55-244-----AKKWG-------------------N--AQYKKYGL....------------------------------------
B1BSY1_CLOPF/261-454-----GDLWG-------------------K--ENYSDWSNKL..------------------------------------
B3ZYG6_BACCE/56-253-----AKGWG-------------------E--KKYKEWKERL..------------------------------------
B3ZYJ4_BACCE/45-249-----AEAWG-------------------R--ERYAGWYNNL..------------------------------------
B4U1X8_STREM/46-234-----TNRWR-------------------S--QTAF........------------------------------------
C2SU54_BACCE/217-423-----ALQWA-------------------K--ENLKGYAEKL..------------------------------------
C2X5A0_BACCE/56-251-----ADAWG-------------------E--KFYHQWIPNV..------------------------------------
C3B4Y1_BACMY/29-179-----AHEWG-------------------S--KHFDSWIESL..------------------------------------
C3B5A2_BACMY/83-262-----AHEWG-------------------S--KHFDNWIESL..------------------------------------
C3DDI1_BACTU/266-451-----GDSWG-------------------K--KNYKEWSDSL..------------------------------------
C3ECU3_BACTU/38-244-----ATAWG-------------------N--ELFNLWNKLT..------------------------------------
C3V1Q7_9CAUD/377-628-----KNSWN-------------------A--AKTKFLKRMIYS------------------------------------
C4B698_CLOBO/226-428-----SEAWG-------------------E--KNYGDYVSKL..------------------------------------
D0GI75_CLOBO/1-192-----AKAWG-------------------N--AQYKKYGL....------------------------------------
D9IEN5_BPT4/374-615-----QNSWN-------------------A--IKTKIIRRELRG------------------------------------
ARC3_CLOLM/60-249-----ARAWG-------------------D--KQFAKYKL....------------------------------------
CRAX_BACCE/253-470-----AESWG-------------------V--QTFKNWKENL..------------------------------------
Q8GAX6_STAAU/47-247-----ATKWG-------------------N--SLIKSAKY....------------------------------------
Q8VVU2_STAAU/47-247-----ATNWG-------------------N--KLIKQANY....------------------------------------
F0K4W7_CLOAE/207-388-----ANEWG-------------------S--QYYDNWLKSL..------------------------------------

PF01129

NAR5_MOUSE/29-255LSL-VPDTFD-------------------D--AYVGCSEEMEEK.AGLLLKEEMARHALLRESWEAAQEAWA........
NAR1_HUMAN/39-274LDM-ALASFD-------------------D--QYAGCAAAMTAA.LPDLNHTEFQANQVYADSWTLASSQWQ........
NRT1_CHICK/37-257MDM-ALNSFD-------------------D--QYLLCEDRMRAR.LQMENITEFSTNIAYAVTWRQAAAEWQ........
Q87WF6_PSESM/58-297EQV-LSHTYS-------------------S--NIKGKLRTTPPK.GPSPRLSDTPMKQALSSMIVQERKRLKSQPKSLAS
NAR3_HUMAN/29-252LDM-ADNAFD-------------------D--EYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWA........
NARE_CHICK/37-257MDM-APHSFD-------------------D--QYQGCIDLMEAE.LQELNRTEF.ANETFAEGWRSATEEWQ........
NAR2A_MOUSE/27-242LDM-APNAFD-------------------D--QYEGCVEDMEKK.APQLLQEDFNMNEELKLEWEKAEIKWK........
NAR2A_RAT/27-239LDT-APNAFD-------------------D--QYEGCVNKMEEK.APLLLKEDFNKSEKLKVAWEEAKKRWN........

PF09156

LEF_BACAN/297-583MLA-RYEKWE-------------------KIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQ

PF01375

Q13Q55_BURXL/433-665EDH-PDHPFA...............LFRPSQTSPARLKEQQGFSV........E--------------------------
M6BJN5_LEPBO/40-285ENQ-IATPPI.............EVFYLVTTLTPEQVITSDGFWSAGASSA..D--------------------------
A0A016X6U0_VIBCL/2-258VKI-IFVFFI...FLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDR--------------------------
A7Y1X7_ECOLX/2-258KNI-TFIFFI...LLASPLYANGDKLYRADSRPPDEIKRSGGLMPRGHNEYFDR--------------------------
E2BA_ECOLX/1-263MAK-VISFFISLFLISFPLYAND..YFRADSRTPDEVRRSGGLIPRGQDEAYER--------------------------
E2AA_ECOLX/2-259IKH-VLLFFV...FISFSVSAND..FFRADSRTPDEIRRAGGLLPRGQQEAYER--------------------------

PF02917

CARDS_MYCPN/3-234------NPVR--------------FVYRVDLRSPEEIFEHGFSTLGDVRNFFEH--------------------------
TOX1_BORPE/36-268------DPPA--------------TVYRYDSRPPEDVFQNGFTAWGNNDNVLDH--------------------------

PF00644

Q7QBC7_ANOGA/780-991LKT.SIEPMA-------------------RDSEEFALLEQYVRNTHAETHRT..--------------------------
PAR12_MOUSE/506-689LGF.KKITLS-------------------SSSEEYQKVWNIFNRTLP.......--------------------------
Q8QGB0_ONCMY/90-274LLM..LVPLT-------------------PGSKEGHDIEKEFRKTLL.......--------------------------
PME2_CAEEL/304-528LPC.HLEPV.-------------------..SEEIAGKIGDCLAMRGPTHC...--------------------------
Q6DDF6_XENLA/117-300LSDKLFTVKS-------------------VPKDKYEEIQALPGSPSHALPT...--------------------------
Q6DFH2_XENLA/340-552LNC.SMQPLD-------------------QTSSTFQLIEGYLQSTHAPTHND..--------------------------
Q7Z114_DICDI/449-640LNT.HIEHLH-------------------QASAGYQIFIRNFLSNPHHQKAID.--------------------------
PARP1_CHICK/794-1004LRT.DIKVVD-------------------KDSEEAKIIKQYVKNTHAATHNA..--------------------------
PARP2_ARATH/421-633LNC.GLTPVG-------------------NDSEEFSMVANYMENTHAKTHSG..--------------------------
PAR16_MOUSE/90-273LSSKILTIHS-------------------AKKAEFEKIQQLTGAPHTPVPT...--------------------------
Q6A0B1_MOUSE/386-574LRC.KIEHVD-------------------QNTEEFSRVRKEVLQNNRSEQ....--------------------------
PARP2_MAIZE/436-648LHC.DFTPLE-------------------ADSDEYSMIKSYLRNTHGKTHSG..--------------------------
Q8BSZ1_MOUSE/766-954LG..RLEALE-------------------ENSQEFQDVVRAFYSTLDAVHG...--------------------------
PARP1_MAIZE/764-976LHC.DITPLA-------------------HDSEDYKLIEQYLLNTHAPTHKD..--------------------------
Q6NX05_DANRE/102-278VKT.......-------------------LQKEEFARLSQLAQREGVSAPA...--------------------------
H2Q7V9_PANTR/365-577LHC.ALRPLD-------------------HESYEFKVISQYLQSTHAPTHSD..--------------------------
Q8X0P2_NEUCS/432-660LKMQEMTPLD-------------------RASTEFAQLADYLVETRGNTHG...--------------------------
Q8I7C4_DICDI/2328-2536LGA.SLEKLD-------------------ANSPEFGILKKYSENTGC.......--------------------------
Q7ZVB0_DANRE/323-528LKC.SLNLVD-------------------KKSKEYKIIEKYLKATGQ.......--------------------------
Q91YR6_MOUSE/317-528LRC.QLQLLD-------------------SGESEYKAIQTYLKQTGNSYR....--------------------------
PARP_SARPE/782-993LKT.KLEPLD-------------------KNSEEYILLQKYVKNTHAETHKL..--------------------------
G5EB68_EMENI/449-674LGMQEMTPLD-------------------HASEEFRELEKYLSGTRGSTHG...--------------------------
PARP3_SOYBN/586-801LGC.SISALD-------------------KSSDDYEMIVKYLEKTYEPVKVGDI--------------------------
Q8I7C6_DICDI/493-700LKT.DIQPLD-------------------ENSCEYKNILLYVKNTYQGGK....--------------------------
PARP1_ARATH/767-979LHC.DISPLP-------------------HDSEDYRLIEKYLNTTHAPTHTE..--------------------------
Q7Z115_DICDI/725-936LKT.KLTPLD-------------------KDSVVYKTLVDYVANSQDKQFR...--------------------------
PAR11_HUMAN/129-330VPY.QLIPLH-------------------NQTHEYNEVANLFGKTMD.......--------------------------
Q8I7C5_DICDI/585-801LKA.DIKPLE-------------------RDSFLFRNIEEFALSTVDPSLG...--------------------------

PF02763

Q6NK15_CORDI/26-212----GADDVV-------------------DSSKSF--VMENFSSYHGTKPG-----------------------------

PF03496

A0FKE4_9GAMM/241-430----------L...................YSDAEVMAL---------------GLYTNG------EYQHLNRSL..RQE
A0A021PZP6_STAAU/47-247----------.....................SSDDKIAL---------------YEYTK.------DSSKINGPL..RLA
A2RG53_STRPG/60-249----------.....................PRAEQEAM---------------AAYTCQ------QAALINTSL..DKT
A0A030R3C5_PSEAI/242-430----------I...................HSDAEVMAL---------------GLYTGI------HYADLNRAL..RQG
A3L121_PSEAI/245-434----------P...................YSDAEVMAL---------------GLYTNG------EYQHLNRSL..RQG
B0YIU7_BACTU/276-462----------.....................TASQREAL---------------DGYARQ------DYKEINNYL..RNQ
B1BBR9_CLOBO/55-244----------.....................SKPEQEAI---------------KFYTR.------DASKINGPL..RAN
B1BSY1_CLOPF/261-454----------.....................TPNELADV---------------NDYMRG------GYTAINNYL..ISN
B3ZYG6_BACCE/56-253----------.....................TSEEKESI---------------EYYTDF------DYLEINQYL..REV
B3ZYJ4_BACCE/45-249----------.....................TIVEQKSL---------------TDYTTE------KGYQINKYL..RQN
B4U1X8_STREM/46-234----------.....................TEAEKKMM---------------YQYTHA------SASPINLAL..EQV
C2SU54_BACCE/217-423----------.....................NADEKAEI---------------DFYTTS------NYSTINSYL..RDS
C2X5A0_BACCE/56-251----------.....................SSTEIEEF---------------KSYMET------GYHHLNTYL..LEN
C3B4Y1_BACMY/29-179----------.....................TESERSAI---------------RQYTGD------DYRKINNYL..RGI
C3B5A2_BACMY/83-262----------.....................TESERSAI---------------RQYTGD------DYRKINNYL..RGI
C3DDI1_BACTU/266-451----------.....................TNDQRKDL---------------NDYGAR------GYTEINKYL..R.E
C3ECU3_BACTU/38-244----------.....................PQVEKDAI---------------RGYTAT------DYISINGYL..RSD
C3V1Q7_9CAUD/377-628----------FSGIGAGPMIDITIARDGSKYTPSQKRGI---------------REYCGS------GYTDINNLLLGRYN
C4B698_CLOBO/226-428----------.....................SQEQLGAL---------------EGYLHS------DYKAINSYL..RNN
D0GI75_CLOBO/1-192----------.....................SKSEKEAI---------------VSYTK.------SASEINGKL..RQN
D9IEN5_BPT4/374-615----------YALTAGWSLHPIVENKDSSKYTPAQKRGI---------------REYVGS------GYVDINNALLGLYN
ARC3_CLOLM/60-249----------.....................SSSEKNAL---------------TIYTR.------NAARINGPL..RAN
CRAX_BACCE/253-470----------.....................TISEKDII---------------TGYTGS------KYDPINEYL..RKY
Q8GAX6_STAAU/47-247----------.....................SSKDKMAI---------------YNYTK.------NSSPINTPL..RSA
Q8VVU2_STAAU/47-247----------.....................SSKDKEAI---------------YNYTK.------YSSPINTPL..RSS
F0K4W7_CLOAE/207-388----------.....................NDSERNAI---------------RQYTGN------DYKKINNYL..RGV

PF01129

NAR5_MOUSE/29-255..HR......RHKLT...........LPPGFKAQHGVAI---------------MVYTNS...SNTLYWELNQAV--RTG
NAR1_HUMAN/39-274..ER......QARWPEWSLSPTRPSPPPLGFRDEHGVAL---------------LAYTAN....SPLHKEFNAAV--REA
NRT1_CHICK/37-257..KR......WGHLA...........RPMQLIREQAIAL---------------LAYSAS....SRMCTLFNEAT--RQG
Q87WF6_PSESM/58-297DIERPDSMIKKALDEKD......GHPFGERFSDDEFLAI---------------HLYTSC......LYRPINHHL--R..
NAR3_HUMAN/29-252..AR......KTQIF...........LPMNFKDNHGIAL---------------MAYISEAQEQTPFYHLFSEAV--KMA
NARE_CHICK/37-257..RR......WGRVS...........SPMVLRQDQAIAV---------------LAYTME....GELYRVFNNAT--LTA
NAR2A_MOUSE/27-242..EI......KNCMS...........YPAGFHDFHGTAL---------------VAYTGN......IHRSLNEAT--RE.
NAR2A_RAT/27-239..NI......KPSMS...........YPKGFNDFHGTAL---------------VAYTGS......IGVDFNRAV--RE.

PF09156

LEF_BACAN/297-583IDSSD-----FLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPY-DINQRL--QDT

PF01375

Q13Q55_BURXL/433-665-------------------------------DTPLRNTS---------------LDLHDSIVAGNPAATDGGGYV-GTFT
M6BJN5_LEPBO/40-285-------------------------------STNLDFSL---------------LNHVTPSVNSE...RSG..YI-SLFR
A0A016X6U0_VIBCL/2-258-------------------------------GTQMNINL---------------YDHARGTQTGFVRHDDG..YV-STSI
A7Y1X7_ECOLX/2-258-------------------------------GTQMNINL---------------YDHARGTQTGFVRYDDG..YV-STSL
E2BA_ECOLX/1-263-------------------------------GTPININL---------------YDHARGTATGNTRYNDG..YV-STTT
E2AA_ECOLX/2-259-------------------------------GTPININL---------------YEHARGTVTGNTRYNDG..YV-STTV

PF02917

CARDS_MYCPN/3-234-------------------------------ILSTNFGR---------------SYFISTSETPTAAIRFFGSWLREYVP
TOX1_BORPE/36-268-------------------------------LT....GR---------------SCQVGSSNSAFVSTSSSRRYT.EVYL

PF00644

Q7QBC7_ANOGA/780-991-------------------------------.YELEVAE---------------IFRIKRKGEDRRYQPFKK.......L
PAR12_MOUSE/506-689-------------------------------..FYFVQK---------------IERIQNMGLWEVYQWQKC.......Q
Q8QGB0_ONCMY/90-274-------------------------------..NNTILT---------------IERVQNDSLWKSYQIRKKLLEEKNKH
PME2_CAEEL/304-528-------------------------------.YKLSLID---------------AFELKDPNEIPTEAPVEVQEVPKKRG
Q6DDF6_XENLA/117-300-------------------------------..PDFLFE---------------LEY..CEKLSAKFQETRG.......D
Q6DFH2_XENLA/340-552-------------------------------.YTMTLLR---------------VFELQRVGEECNFRED.........L
Q7Z114_DICDI/449-640-------------------------------NGEIKILN---------------CYRLDKKLESDNFLD..........V
PARP1_CHICK/794-1004-------------------------------.YDLKVVE---------------IFRIEREGESQRYKPFKQ.......L
PARP2_ARATH/421-633-------------------------------.YTVEIAQ---------------LFRASRAVEADRFQQFSS.......S
PAR16_MOUSE/90-273-------------------------------..PDFLFE---------------IEY.........FDPANSRFYETKGE
Q6A0B1_MOUSE/386-574-------------------------------..PVDILQ---------------IFRVGRVNEATEFLSK.........L
PARP2_MAIZE/436-648-------------------------------.YTVDIVQ---------------IFKVSRHGETERFQKFAS.......T
Q8BSZ1_MOUSE/766-954-------------------------------..RIRIVR---------------VERVSHPLLQQQYQLHRERLMQSCQQ
PARP1_MAIZE/764-976-------------------------------.WSLELEE---------------VFSLDRDGELNKYSRYKN......NL
Q6NX05_DANRE/102-278-------------------------------..PDFLFE---------------LQY..CDLLNSKFERTRA.......G
H2Q7V9_PANTR/365-577-------------------------------.YTMTLLD---------------LFEVEKDGEKEAFRED.........L
Q8X0P2_NEUCS/432-660-------------------------------.LNYQVEE---------------IFRIERQGEFDRFDQSDYADGKMKLK
Q8I7C4_DICDI/2328-2536-------------------------------..TKKIVN---------------IFKLQRKGEVERFQAHKN.......L
Q7ZVB0_DANRE/323-528-------------------------------.EGLTLVD---------------VWEVDRETEAERFRENDA.......L
Q91YR6_MOUSE/317-528-------------------------------..CPNLRH---------------VWKVNREGEGDRFQAHSK.......L
PARP_SARPE/782-993-------------------------------.YDLEVVD---------------IFKVARQGEARRYKPFKK.......L
G5EB68_EMENI/449-674-------------------------------.VKYKVID---------------IFRIERQGEHDRFKSSSYAG...LKN
PARP3_SOYBN/586-801-------------------------------EYGVSVEN---------------IFAVQTGGC.PSYEDIIK.......L
Q8I7C6_DICDI/493-700-------------------------------..KPTIVN---------------IFKIDRDGEADRYKTKKH.......L
PARP1_ARATH/767-979-------------------------------.WSLELEE---------------VFALEREGEFDKYAPHRE......KL
Q7Z115_DICDI/725-936-------------------------------.TNICVQD---------------ILSLERENESERFTPWAK.......D
PAR11_HUMAN/129-330-------------------------------..RNRIKR---------------IQRIQNLDLWEFFCRKKAQLKKKRGV
Q8I7C5_DICDI/585-801-------------------------------.YSIDVLD---------------VFKVDRIGD.DQFSQWES.......N

PF02763

Q6NK15_CORDI/26-212--------------------------------YVDSIQK---------------GIQKPKSGTQGNYDDD----------

PF03496

A0FKE4_9GAMM/241-430K.--------------...QLDAGQALIDQ.............GMSAAFEK--STPAEQLVK--------TFRG......
A0A021PZP6_STAAU/47-247GG--------------DINKLD..STTQDK...........VRRLDSSISK--S.TTPESVY--------VYRLLNLDYL
A2RG53_STRPG/60-249KG--------------ELSQLT..PELRDQ...........VAQLDAATHR--L.VIPWNIV--------VYRYVYETFL
A0A030R3C5_PSEAI/242-430Q.--------------...ELDAGQKLIDQ.............GMSAAFEK--SGQAEQVVK--------TFRG......
A3L121_PSEAI/245-434R.--------------...ELDAGQALIDR.............GMSAAFEK--SGPAEQVVK--------TFRG......
B0YIU7_BACTU/276-462GG--------------SGN.....EKLDAQ...........IKNISDALGK--K.PIPENIT--------VYRWCGMPEF
B1BBR9_CLOBO/55-244QG--------------NENGLS..SDILQK...........VKLIDQSFSK--M.KIPQNII--------LFRGDDPAYL
B1BSY1_CLOPF/261-454GP--------------LNNPN...PELDSK...........VNNIENALKL--T.PIPSNLI--------VYRRSGPQEF
B3ZYG6_BACCE/56-253K.--------------...GKLKTSDLNNT...........IKHIDSALKK--G.RISEPIT--------VYRRAKGFSL
B3ZYJ4_BACCE/45-249KG--------------NINIPEN.SFLNRN...........IINLDSAIEK--A.KMKESIK--------VYRRVGENAF
B4U1X8_STREM/46-234MG--------------DTSQLD..AQLQQS...........VALLDSATHK--L.TIPWNII--------VYRYVYETFL
C2SU54_BACCE/217-423EG--------------SKY.QDK.EGLKKR...........IDLISSGLQK--L.SLPTDIV--------VYRRTGTDTF
C2X5A0_BACCE/56-251KG--------------QLTGKD..IKMEQK...........IKHLDRAFSS--S.SVPDDIV--------VYRRSKESSF
C3B4Y1_BACMY/29-179A.--------------...DSLD.GVESSV...........IDNIKSGLNK--A.SVPYDIQ--------VYRGTDLNSF
C3B5A2_BACMY/83-262A.--------------...DSLN.DVESSV...........IDNIKSGLNK--A.SVPYDIQ--------VYRGTDLKPF
C3DDI1_BACTU/266-451GG--------------TGN.....TELEEK...........IKNISDALEK--N.PIPENIT--------VYRYCGMAEF
C3ECU3_BACTU/38-244YY--------------DVLDQ...AKIEKS...........IKQIDRAFSK--V.RLHDDII--------VYRRVSEQAF
C3V1Q7_9CAUD/377-628P.--------------ERYDVMSEKEIESA...........INNLDSAFEN--GDRIPEGIT--------VYRAQ.....
C4B698_CLOBO/226-428R.--------------....VPNNDELNKK...........IELISSALSV--K.PIPETLI--------AYRRVDGIPF
D0GI75_CLOBO/1-192KG--------------VINGFP..SNLIKQ...........VELLDKSFNK--M.KTPENIM--------LFRGDDPAYL
D9IEN5_BPT4/374-615PD--------------ERTSILTASDIEKA...........IDNLDSAFKN--GERLPKGIT--------LYRSQ.....
ARC3_CLOLM/60-249QG--------------NTNGLP..ADIRKE...........VEQIDKSFTK--M.QTPENII--------LFRGDDPGYL
CRAX_BACCE/253-470DG--------------EIIPNIG.GDLDKKSKKALEKIENQIKNLDAALQK--S.KITENLI--------VYRRVSELQF
Q8GAX6_STAAU/47-247NG--------------DVNKLS..ENIQEQ...........VRQLDSTISK--S.VTPDSVY--------VYRLLNLDYL
Q8VVU2_STAAU/47-247QG--------------DISNFS..ADLQEK...........ILRLDRLISK--S.STSDSVY--------VYRLLNLDYL
F0K4W7_CLOAE/207-388N.--------------...DSLD.GIDPKI...........IEDIKSGLKK--A.SVPHDMK--------VYRGTDLNPL

PF01129

NAR5_MOUSE/29-255GG--------------SRELYMRHFPFKAL-----------HFYLTRALQL--LRG...SGGCSRGPGEVVFRGVG..--
NAR1_HUMAN/39-274GR--------------SRAHYLHHFSFKTL-----------HFLLTEALQL--LGSGQRPPRCHQ.....VFRGVH..--
NRT1_CHICK/37-257GR--------------SHQDYIHSYHFKTL-----------HFFLTQALFA--LRA..SQPRCYY.....VYRGVR..--
Q87WF6_PSESM/58-297..--------------....YAPNNDVAPV-----------VEALKSGLAK--LAQDPDYQVSSQ.....LHRGIKQK--
NAR3_HUMAN/29-252GQ--------------SREDYIYGFQFKAF-----------HFYLTRALQL--LRK.....PCEASSKTVVYRTSQ..--
NARE_CHICK/37-257GR--------------SRQHYLSSYPFKTL-----------HFLLSRALHT--LQE.SQTQPCHN.....VFRGVR..--
NAR2A_MOUSE/27-242..--------------.FKINPGNFHYKAF-----------HYYLTRALQL--LSD....QGCRS.....VYRGTN..--
NAR2A_RAT/27-239..--------------.FKENPGQFHYKAF-----------HYYLTRALQL--LSN....GDCHS.....VYRGTK..--

PF09156

LEF_BACAN/297-583GG--------------LIDSPSINLDVRKQ-------YKRDIQNIDALLHQSIGSTLYNKIY--------LYENMNINNL

PF01375

Q13Q55_BURXL/433-665GR--------------AEAQARIDATAA..-----------KKGYVYYVAP--SPNMVDVRGSLGSEHARAPRDGEVAAM
M6BJN5_LEPBO/40-285NF--------------IHALICAQSNIS..-----------QDYYIYQIAG--GFNIVDVQGSLGP.YTPSNSTAEAVAL
A0A016X6U0_VIBCL/2-258SL--------------RSAHLVGQTILSGH-----------STYYIYVIAT--APNMFNVNDVLGA.YSPHPDEQEVSAL
A7Y1X7_ECOLX/2-258SL--------------RSAHLAGQSILSGY-----------STYYIYVIAT--APNMFNVNDVLGV.YSPHPYEQEVSAL
E2BA_ECOLX/1-263TL--------------RQAHFLGQNMLGGY-----------NEYYIYVVAA--APNLFDVNGVLGR.YSPYPSENEYAAL
E2AA_ECOLX/2-259TL--------------RQAHLIGQNILGSY-----------NEYYIYVVAP--APNLFDVNGVLGR.YSPYPSENEFAAL

PF02917

CARDS_MYCPN/3-234EH--------------PRRAYLYEIRADQ.-----------..HFYNARAT--GENLLDLMRQRQV-VFDS-GDREMAQM
TOX1_BORPE/36-268EH--------------RMQEAVEAERAGRG-----------TGHFIGYIYE--VRADNNFYGAASS-YFEY-VDTYGDNA

PF00644

Q7QBC7_ANOGA/780-991HN..............RKLLWHG-SRLTNF-----------AGILTNGLKI--APPEAPVTGYM..-...FGKGIYFADM
PAR12_MOUSE/506-689MQKQNG.....GKEVDERQLFHG-TSANFV-----------DAICQQNF..--DWRVCGLHGTS..-...YGKGSYFARD
Q8QGB0_ONCMY/90-274TN.............NEKLLFHG-TSSDSI-----------TQINNHGF..--NRSYAGTHGAA..-...IGNGSYFAVN
PME2_CAEEL/304-528RKSTKTAAPTVPPPTTKRLLWHG-TRVTNV-----------FSILMNGL..--QFPVGDRCGLM..-...FGNGVYFANV
Q6DDF6_XENLA/117-300RD..............LIYAFHG-SRLENF-----------HSILHNGLHC--HLNKTSL......-...FGEGTYLTSD
Q6DFH2_XENLA/340-552PN..............RMLLWHG-SRLTNW-----------VGILSQGLRV--APPEAPVTGYM..-...FGKGIYFADV
Q7Z114_DICDI/449-640GN..............VQYLYHG-SKPQNL-----------VGLLSRGILP--PDYVKQIGGKRTD-FGYLGSGIYFSDD
PARP1_CHICK/794-1004HN..............RQLLWHG-SRTTNF-----------AGILSQGLRI--APPEAPVTGYM..-...FGKGIYFADM
PARP2_ARATH/421-633KN..............RMLLWHG-SRLTNW-----------AGILSQGLRI--APPEAPVTGYM..-...FGKGVYFADM
PAR16_MOUSE/90-273RD..............LIYAFHG-SRLENF-----------HSIIHNGLHC--HLNKTSL......-...FGEGTYLTSD
Q6A0B1_MOUSE/386-574GN..............VRLLFHG-SPVRNI-----------LGILSRGLLL--PKVAEDRGVQRTD-VGNLGSGIYFSDS
PARP2_MAIZE/436-648RN..............RMLLWHG-SRLSNW-----------AGILSQGLRI--APPEAPVTGYM..-...FGKGVYFADM
Q8BSZ1_MOUSE/766-954RP.............VEQVLYHG-TSESAV-----------LDICAHGF..--NRSFCGRNGTL..-...YGQGVYFAKR
PARP1_MAIZE/764-976HN..............KMLLWHG-SRLTNF-----------VGILSQGLRI--APPEAPVTGYM..-...FGKGLYFADL
Q6NX05_DANRE/102-278RD..............LIYAFHG-SRLENF-----------HSIIHNGLHC--HLNKTSL......-...FGEGTYLTSD
H2Q7V9_PANTR/365-577HN..............RMLLWHG-SRMSNW-----------VGILSHGLRI--APPEAPITGYM..-...FGKGIYFADM
Q8X0P2_NEUCS/432-660KN..............RKLLWHG-SRSTNF-----------GGILSQGLRI--APPEAPVNGYM..-...FGKGVYLADM
Q8I7C4_DICDI/2328-2536KN..............HFLLWHG-SLTTNY-----------LSILSQGLKI--APPEAPVTGYM..-...FGKGIYFSDM
Q7ZVB0_DANRE/323-528EN..............RKLLWHG-TNVAVV-----------AAILKSGLRI--....MPHSGGR..-...VGRGIYFASE
Q91YR6_MOUSE/317-528GN..............RRLLWHG-TNVAVV-----------AAILTSGLRI--....MPHSGGR..-...VGKGIYFASE
PARP_SARPE/782-993HN..............RRLLWHG-SRLTNF-----------AGILSHGLKI--APPEAPVTGYM..-...FGKGIYFADM
G5EB68_EMENI/449-674SN..............RRLLWHG-SRSTNY-----------GGILSQGLRI--APPEAPVSGYM..-...FGKGVYFADM
PARP3_SOYBN/586-801PN..............KVLLWCG-SRSSNL-----------LRHLQKGFLP--AICSLPIPGYM..-...FGKAIVCSDA
Q8I7C6_DICDI/493-700GN..............RKLLWHG-SRLTNY-----------ASIISQGLRI--APPEAPVSGYR..-...FGKGVYFADC
PARP1_ARATH/767-979GN..............KMLLWHG-SRLTNF-----------VGILNQGLRI--APPEAPATGYM..-...FGKGIYFADL
Q7Z115_DICDI/725-936KN..............RLLLWHG-SRLTNF-----------VSIVSQGLRI--APPSAPKTGYR..-...FGKGIYFADC
PAR11_HUMAN/129-330PQI............NEQMLFHG-TSSEFV-----------EAICIHNF..--DWRINGIHGAV..-...FGKGTYFARD
Q8I7C5_DICDI/585-801HN..............RMLLFHG-SRIQSW-----------CSILPNGLKI--ASPLSPKSGYR..-...LGKGVYLADC

PF02763

Q6NK15_CORDI/26-212--------------------WKGFYSTDNK-----------YDAAGYSVDN--ENPLSGKAGGVVK-VTYPGLTKVLALK

PF03496

A0FKE4_9GAMM/241-430...........................THGGDAFSGVTEGQVGHDTAYFSTSRDPK.......VAT----SFGGS.....
A0A021PZP6_STAAU/47-247TSIVGFTNEDLYKLQQTNN..GQYD..ENLVRKLNNVMNSRIYREDGYSSTQLVSG.........A----AVGGR..PIE
A2RG53_STRPG/60-249.RDIGVSHADLTSYYRN....HQFD..PHILCKIK...LGTRYTKHSFMSTTALKN.........G----AMTHR..PVE
A0A030R3C5_PSEAI/242-430...........................TRGGDAFNAVEEGKVGHDDGYLSTSLNPG.......VAR----SF.GQ.....
A3L121_PSEAI/245-434...........................TQGRDAFEAVKEGQVGHDAGYLSTSRDPS.......VAR----SFAGL.....
B0YIU7_BACTU/276-462GYQISDP....................LPSLKDFEEQFLNTIKEDKGYMSTSLSSE.......RLA----AFGSR..KII
B1BBR9_CLOBO/55-244GPEFQDKILNKD.........GTIN..RDVFEQVKAKFLKKDRTEYGYISTSLMS..........A----QFGGR..PIV
B1BSY1_CLOPF/261-454GLTLTSPEYDFNK..............IENIDAFKEKWEGKVITYPNFISTSIGSV.......NMS----AFAKR..KII
B3ZYG6_BACCE/56-253GINNGLL........VDWKNPNKII..KENISKISEMLIGKTKTEYGYISTSLSQD.......AAS----NFSKL..PIL
B3ZYJ4_BACCE/45-249GMEADSLRNK...........NTIN..REKYRELAERFMNKEIKEYGYLSTTLVRGISDEAKIKSP----EIALM..PII
B4U1X8_STREM/46-234.TELGISEEELARYYHD....KTFD..PQILSAIK...PGARYTKQGFMSTTAIKN.........A----AMPHR..SVE
C2SU54_BACCE/217-423KPDPNNPILKFDFN..........N..PKDIESFKKQYEGSLNEEKAFLSTSLVRDPD.....LYG----SFMQK..RIL
C2X5A0_BACCE/56-251GLTEGTLIKD...........NKIN..EQEFSEFKNKLLGKYKTDYTYMSTSILKD.......PSE----SFNGR..PIL
C3B4Y1_BACMY/29-179...................................ENLMSRFFYFKKKSALILLSL..........----..........
C3B5A2_BACMY/83-262KNLYKI.....................DDEGKIVVDSLVGKTVKDNGFVSTAMVKE.........S----SFDHM..NVS
C3DDI1_BACTU/266-451GYPIQPE....................APSVQDFEEKFLDKIKEEKGYMSTSLSSD........AT----SFGAR..KII
C3ECU3_BACTU/38-244GLPGNSLVNHAEQEENPVNSVSKIN..RENFEFFKNRFQGKYKKDPAYISTSIVKD.......AAE----GFSGA..PIL
C3V1Q7_9CAUD/377-628...........................SMTAPIYEALVKNKVFYFRNFVSTSLTPIIFGRFGITHA----GIGLLEPEAR
C4B698_CLOBO/226-428DLPSDFS........FDKKENGEIIADKQKLNEFIDKWTGKEIKNLSFSSTSLKST........PL----SFSKS..RFI
D0GI75_CLOBO/1-192GTEFQNTLLNSN.........GTIN..KTAFEKAKAKFLNKDRLEYGYISTSLMNV.........S----QFAGR..PII
D9IEN5_BPT4/374-615...........................RMLPSIYEAMVKNRVFYFRNFVSTSLYPNIFGTWM.TDS----SIGVLPDEKR
ARC3_CLOLM/60-249GPDFENTILNRD.........GTIN..KAVFEQVKLRFKGKDRKEYGYISTSLVNG.........S----AFAGR..PII
CRAX_BACCE/253-470GK.......KYEDYNLRQN..GIIN..EEKVMELESNFKGQTFIQHNYMSTSLVQD.......PHQ----SYSNDRYPIL
Q8GAX6_STAAU/47-247SSITGFTREDLHMLQQTNN..GQYD..EALVSKLNNLMNSRIYRENGYSSTQLVSG.........A----ALAGR..PIE
Q8VVU2_STAAU/47-247SSVKGFSSEDLELLYKTEN..GKYN..EELVKKLNNIMNSKIYTEYGYSSTQLVKG.........A----ALAGR..PIE
F0K4W7_CLOAE/207-388RNLIDV.....................GKDGSLDFSSLVGKTFKDDGFMSTALVKE.........S----SFDYM..NVS

PF01129

NAR5_MOUSE/29-255---------------------------...SLHFEPKRLGDSVRLGQFTSSSVDER-------VAR....RFGNA-----
NAR1_HUMAN/39-274---------------------------...GLRFRPAGPRATVRLGGFASASLKHV-------AAQ....QFGED-----
NRT1_CHICK/37-257---------------------------...GIRFM.TQRGKSVRFGQFTSTSLRKE-------ATV....NFGQD-----
Q87WF6_PSESM/58-297---------------------------MSDGEVMSRFKPGKTYRDEAFMSTSTHMQ-------VSE....EFTSD-----
NAR3_HUMAN/29-252---------------------------...GTSFTFGGLN.QARFGHFTLAYSAKP-------QAA.....NDQL-----
NARE_CHICK/37-257---------------------------...GTRFT.AQQGTVVRFGQFTSSSLQKK-------VAE....FFGLD-----
NAR2A_MOUSE/27-242---------------------------....VRFRYTGKG.SVRFGHFASSSLNRS-------VATSSPFFNGQG-----
NAR2A_RAT/27-239---------------------------....TRFHYTGAG.SVRFGQFTSSSLSKT-------VAQSPEFFSDDG-----

PF09156

LEF_BACAN/297-583TATLGADLVD-----------------STDNTKINRGIFNEFKKNFKYSISSNYMI-------VDINERPALDNE--RLK

PF01375

Q13Q55_BURXL/433-665GHIDYTQVRGWQK--YE-------NGKL......APYVANPDYRWDVYDATRTAGAQP..QL--AHFSPDNPAWA-DAGH
M6BJN5_LEPBO/40-285NRIYWNQVYGWTR--FS-------SNFIFSLDDPGLLEHNLMFDRETFANATSSPGLP..EL--AGFPQGDPRWG-NEFF
A0A016X6U0_VIBCL/2-258GGIPYSQIYGWYR--VH-------FGVL.....DEQLHRNRGYRDRYYSNLDIAPAADGYGL--AGFPPEHRAWR-EEPW
A7Y1X7_ECOLX/2-258GGIPYSQIYGWYR--VN-------FGVI.....DERLHRNREYRDRYYRNLNIAPAEDGYRL--AGFPPDHQAWR-EEPW
E2BA_ECOLX/1-263GGIPLSQIIGWYR--VS-------FGAI.....EGGMHRNRDYRRDLFRGLSAAPNEDGYRI--AGFPDGFPAWE-EVPW
E2AA_ECOLX/2-259GGIPLSQIIGWYR--VS-------FGAI.....EGGMQRNRDYRGDLFRGLTVAPNEDGYQL--AGFPSNFPAWR-EMPW

PF02917

CARDS_MYCPN/3-234GIRALRTSFAYQREWFT-------DGPI-------AAANVR..SAWLVDAVPVEPGHAHHPA--GR.VVETTRINEPEMH
TOX1_BORPE/36-268GRILAGALATYQSEYLA-------HRRI-------PPENIRRVTRVYHNGITGETTTTEYSN--ARYVSQQTRAN.PNPY

PF00644

Q7QBC7_ANOGA/780-991VSKSA..NYCCT..NVA.......DS.....TGL......LLLCEVALGD.MQEYTQAHY.V..TKLSTGKHSVKGIGRT
PAR12_MOUSE/506-689AAYSH..HYSKS....D.......TH.....SHM......MFLARVLVGD......................FVRGSTSF
Q8QGB0_ONCMY/90-274SSYSA..RGYSK..ADA.......QG.....NKR......MYLARVLVGD...................YTQGQAGLIVP
PME2_CAEEL/304-528PTKSA..NYCCP...EA.......SK.....RVF......MLLCEVETAN.PLVLYESEIDADEKMEKAKKTSVYAAGKH
Q6DDF6_XENLA/117-300LGLAL..LYSP.............HG.....QGWTRSMLGPVLSCVAMCE..............MIDHPDVKCQAKKKDS
Q6DFH2_XENLA/340-552SSKSA..NYCFS..SRD.......KN.....VGV......LLLSEVALGE.CNELLAADCDA..QKKIKSKHSTKGLGRS
Q7Z114_DICDI/449-640V.VSS..TYTSP..IGE.......KG.....SRF......IIMSSVSLGK.VKEFSKIQPSL..QCAPSGHHSCKGLKST
PARP1_CHICK/794-1004VSKSA..NYCHT..SQA.......DP.....IGL......ILLGEVALGN.MYELKNASH.I..TKLPKGKHSVKGLGKT
PARP2_ARATH/421-633FSKSA..NYCYA..NTG.......AN.....DGV......LLLCEVALGD.MNELLYSDYNA..DNLPPGKLSTKGVGKT
PAR16_MOUSE/90-273LSLAL..IYSP.............HG.....HGWQHSLLGPILSCVAVCE..............VIDHPDVKCQIKKKDS
Q6A0B1_MOUSE/386-574LSTSI..KYAHA..GET.......DG.....SRL......LVVCDVALGK.CVNLFKKDFSL..TEAPPGYDSVHGVSET
PARP2_MAIZE/436-648FSKSA..NYCYA..SEA.......CR.....SGV......LLLCEVALGD.MNELLNADYDA..NNLPKGKLRSKGVGQT
Q8BSZ1_MOUSE/766-954ASLSVLDRYSPP............NA.....EGYK....AVFVAQVLTGD.....................YGQGSRGLK
PARP1_MAIZE/764-976VSKSA..QYCYV..DRN.......NP.....VGL......MLLSEVALGD.MYELKKATS.M..DKPPRGKHSTKGLGKT
Q6NX05_DANRE/102-278LSMAI..LYSP.............HG.....NGWRESVLGPFISCVALCE..............IIDHPDVKCQVKKKDS
H2Q7V9_PANTR/365-577SSKSA..NYCFA..SRL.......KN.....TGL......LLLSEVALGQ.CNELLEANPKA..EGLLQGKHSTKGLGKM
Q8X0P2_NEUCS/432-660SSKSA..GYCCA..YMS.......NG.....TAL......LLLCEAELGDPIQELTGADYNAGEHAKQKGMLSTWGKGGT
Q8I7C4_DICDI/2328-2536FRKSI..NYCGS.WDSS.......SA.....NSF......LLLSEVALGT.MKEFKSAHY.M..ESPETGTNSTKGVGKT
Q7ZVB0_DANRE/323-528NSKSA..GYVRP....S.......NK.....IGI......MFLNEVALGK.EYTITRDDPSL..RKAPAGYDSVIARGNQ
Q91YR6_MOUSE/317-528NSKSA..GYVTTMHCGG.......HQ.....VGY......MFLGEVALGK.EHHITIDDPSL..KSPPPGFDSVIARGQT
PARP_SARPE/782-993VSKSA..NYCCT..SHH.......NS.....TGL......MLLSEVALGD.MMECTAAKY.V..TKLPNDKHSCFGRGRT
G5EB68_EMENI/449-674SSKSA..NYCWS..HNS.......DH.....KAL......LLLGDVELGDPIYELYDSDYNAGENAKKEGKIATLGKGRS
PARP3_SOYBN/586-801AAEAA..RYGFT..AVD.......RP.....EGF......LVLAIASLGNEITELKTPPEDA..SSLEEKKVGVKGPGKK
Q8I7C6_DICDI/493-700MSLSA..NYCRT...VG.......SN.....DFC......MLLGDVALGK.TADLARDTY.M..EKPQPNSHSTWALGTV
PARP1_ARATH/767-979VSKSA..QYCYT..CKK.......NP.....VGL......MLLSEVALGE.IHELTKAKY.M..DKPPRGKHSTKGLGKK
Q7Z115_DICDI/725-936ISKSF..SYCFT..SSD.......CP.....TAL......MLLCEVSLGD.MNELKHDTY.M..EEAPHPFHSTKALGMA
PAR11_HUMAN/129-330AAYSS..RFCKD..DIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGD......................YINGDSKY
Q8I7C5_DICDI/585-801ISLSG..LYTGA..TKE.......NP.....TAI......IAICDVALGN.SAALYHDTYM...EEPQLGYLSTKALGKR

PF02763

Q6NK15_CORDI/26-212VDNAE--TIKKE------------LG--------------LSLTEPLMEQ---------------VGTEEFIKRFGDGAS

PF03496

A0FKE4_9GAMM/241-430GTISTVFGRSGIDVSD..I...............................SVE.GDEQEILYNKATDMRVLLSAKDERGV
A0A021PZP6_STAAU/47-247LRLELPKGTKAAYLNSKDL...............................TAY.YGQQEVLLPRGTEYAV..........
A2RG53_STRPG/60-249VRICVKKGAKAAFVEP..Y...............................SAV.PSEVELLFPRGCQLEV..........
A0A030R3C5_PSEAI/242-430GTISTVFGRSGIDVSG..I...............................SNY.KNEKEILYNKETDMRVLLSASDEQGV
A3L121_PSEAI/245-434GTITTLFGRSGIDVRE..I...............................SIE.GDEQEILYDKGTDMRVLLSAKDGQGV
B0YIU7_BACTU/276-462LRLQVPKGSTGAYLSA..I...............................GGF.ASEKEILLDKDSKYHI..........
B1BBR9_CLOBO/55-244TKFKVTNGSKGGYIDP..I...............................SYF.PGQLEVLLPRNNSYYI..........
B1BSY1_CLOPF/261-454LRINIPKDSPGAYLSA..I...............................PGY.AGEYEVLLNHGSKFKI..........
B3ZYG6_BACCE/56-253LKIHLPVGTEAAYLGN..L...............................STN.PGENEVLIGRGFTYQI..........
B3ZYJ4_BACCE/45-249LELNIPKGTKAAYIND..L...............................SDK.PWELELLVGRGSTFKI..........
B4U1X8_STREM/46-234LRIRIPQGSQAAFVQP..Y...............................SFY.PYEMELLFPRQCTLEI..........
C2SU54_BACCE/217-423MRITLPKGTHAGFLPALEL...............................GTY.QGENEMLLDHGYQYKI..........
C2X5A0_BACCE/56-251IRLTVPKGSHGAYIAP..L...............................SAY.PWEMEMLLPRNTTYKV..........
C3B4Y1_BACMY/29-179..LQWTKRFQCCHIFY..I...............................KSIFSKKVYMLSAQVVKYVL..........
C3B5A2_BACMY/83-262WEINVPKGANAAYVGK..I...............................SYI.PTEAELLFNSGQEMVI..........
C3DDI1_BACTU/266-451LRLQIPKGSSGAYVAG..L...............................DGFKPAEKEILIDKGSKYHI..........
C3ECU3_BACTU/38-244MKIHVPKGVPAIYVDP..L...............................SNV.PGEMELLFPRNRSYKI..........
C3V1Q7_9CAUD/377-628NELTVDKNEEGITINPNEIRAYKENPEYVKVQIGWAIDGAHKVNVVYP.GSLGIATEAEVILPRGLMVKV..........
C4B698_CLOBO/226-428FRLRLSEGTIGAFIYG..F...............................SGF.QDEQEILLNKNSTFKI..........
D0GI75_CLOBO/1-192TKFKVAKGSKAGYIDP..I...............................SAF.AGQLEMLLPRHSTYHI..........
D9IEN5_BPT4/374-615LSVSIDKTDEGLVNSSDNL...........VGIGWVITGADKVNVVLPGGSLAPSNEMEVILPRGLMVKV..........
ARC3_CLOLM/60-249TKFKVLDGSKAGYIEP..I...............................STF.KGQLEVLLPRSSTYTI..........
CRAX_BACCE/253-470LEITIPEGVHGAYIAD..M...............................SEY.PGQYEMLINRGYTFKY..........
Q8GAX6_STAAU/47-247LKLELPKGTKAAYIDSKEL...............................TAY.PGQQEVLLPRGTEYAV..........
Q8VVU2_STAAU/47-247LKLQLPKGTKAAYIDSKNL...............................TAY.PGQQEILLPRGTDYTI..........
F0K4W7_CLOAE/207-388WEINVPKGTEAAYVSK..I...............................SYF.PDEAELLLNHGQEMII..........

PF01129

NAR5_MOUSE/29-255-TFFNLRTCFGAPIQA--L-------------------------------SVF-PEEREVLIPPHEVFLV----------
NAR1_HUMAN/39-274-TFFGIWTCLGAPIKG--Y-------------------------------SFF-PGEEEVLIPPFETFQV----------
NRT1_CHICK/37-257-TLFVVKTCYGVPIKQ--F-------------------------------SFF-PSEDEVLIPPFEVFEV----------
Q87WF6_PSESM/58-297-VTLHLRSSSAVNIGP--F-------------------------------SKN-PYEDEALISPLTPFKV----------
NAR3_HUMAN/29-252-TVLSIYTCLGVDIEN--F-------------------------------LDK-ESERITLIPLNEVFQV----------
NARE_CHICK/37-257-TFFSVETCYGVPIKD--L-------------------------------STF-PGEDEVLIPPFEQFRV----------
NAR2A_MOUSE/27-242-TLFIIKTCLGAHIKH--C-------------------------------SYY-THEEEVLIPGYEVFHK----------
NAR2A_RAT/27-239-TLFIIKTCLGVYIKE--F-------------------------------SFY-PDQEEVLIPGYEVYQK----------

PF09156

LEF_BACAN/297-583WRIQLSPDTRAGYLEN-----------------------------------------GKLILQRNIGLEI----------

PF01375

Q13Q55_BURXL/433-665RPFVTPFQQDGKTLYRPNE-------------------------------HPALVQARFYQHANADIQQR----------
M6BJN5_LEPBO/40-285ANV.A..GCEAPLRKRSNG-------------------------------RCYLRQALLDSAQKISNASR----------
A0A016X6U0_VIBCL/2-258IHH.APPGCGNAPRSSMSN-------------------------------TCDEKTQSLGVKFLDEYQSK----------
A7Y1X7_ECOLX/2-258IHH.APQGCGNSSRTITGD-------------------------------TCNEEAQNLSTIYLREYQSK----------
E2BA_ECOLX/1-263REF.APNSCLPNNKASSDT-------------------------------TCASLTNKLSQHDLADFKKY----------
E2AA_ECOLX/2-259STF.APEQCVPNNKEFKGG-------------------------------VCISATNVLSKYDLMNFKKL----------

PF02917

CARDS_MYCPN/3-234NPHYQELQTQANDQPWLPT-------------------------------PGIATPVHLSIPQAASVADV----------
TOX1_BORPE/36-268TSRRSVASIVGTLVRMAPV-------------------------------IGACMARQAESSEAMAAWSE----------

PF00644

Q7QBC7_ANOGA/780-991QPD....PTGS.HVRPDGV-------------------------------...EIPMGKG.VSNEKLKS-----------
PAR12_MOUSE/506-689VR.................-------------------------------....PPAKEGQSNAFYDSC-----------
Q8QGB0_ONCMY/90-274PA.................-------------------------------....KPSGKD..ADLYDSV-----------
PME2_CAEEL/304-528TP.......RD.TVEING.-------------------------------....IPAFKSNLETIEEET-----------
Q6DDF6_XENLA/117-300SE.................-------------------------------....IDRKRA.RARNSEGG-----------
Q6DFH2_XENLA/340-552IPD....PKKS..IIHEGA-------------------------------...VVPLGPL.MDTGLTND-----------
Q7Z114_DICDI/449-640PT.................-------------------------------....NPTD...........-----------
PARP1_CHICK/794-1004APD....PTAT..TTLDGV-------------------------------...EVPLGNG.ISTGINDT-----------
PARP2_ARATH/421-633APN....PSEA.QTLEDGV-------------------------------...VVPLGKP.VERSCSKG-----------
PAR16_MOUSE/90-273KE.................-------------------------------....IDRSRA.RIKHSEGG-----------
Q6A0B1_MOUSE/386-574TS.................-------------------------------....VPTD...........-----------
PARP2_MAIZE/436-648APN....MVES.KVADDGV-------------------------------...VVPLGEP.KQEPSKRG-----------
Q8BSZ1_MOUSE/766-954AP.................-------------------------------.....PLRVSGQVLRYDSA-----------
PARP1_MAIZE/764-976VPL....ESEF.VKWRDDV-------------------------------...VVPCGKP.VPSSIRSS-----------
Q6NX05_DANRE/102-278ES.................-------------------------------....IDRQRL.RARNSEGG-----------
H2Q7V9_PANTR/365-577APS.....SAH.FVTLNGS-------------------------------...TVPLGPA.SDTGILNP-----------
Q8X0P2_NEUCS/432-660GPLKWKDAGAV.NPALQGV-------------------------------...MMPDTSV..KPGNTNV-----------
Q8I7C4_DICDI/2328-2536GPN....FDDS.IILNNGV-------------------------------...AIPLSPP.EQVKGDTS-----------
Q7ZVB0_DANRE/323-528EPD....PSKDVFIELDGK-------------------------------K.VVVPQGKVIKQQQYEGS-----------
Q91YR6_MOUSE/317-528EPD....PAQD.IELELDG-------------------------------QPVVVPQGPPVQCPSFKSS-----------
PARP_SARPE/782-993MPN....PSES.IIREDGV-------------------------------...EIPLGKP.ITNDSLKS-----------
G5EB68_EMENI/449-674IPAGWKDAGCI.HPHLKGI-------------------------------...QVPDADS.GTTDHKTD-----------
PARP3_SOYBN/586-801KTD....ESEH.FVWKDDI-------------------------------...KVPCGKL.VASDHQDS-----------
Q8I7C6_DICDI/493-700EPD....PKVF.FQDTEGC-------------------------------...ITPYGQM.IPSQHKGV-----------
PARP1_ARATH/767-979VPQ....DSEF.AKWRGDV-------------------------------...TVPCGKP.VSSKVKAS-----------
Q7Z115_DICDI/725-936APHK..DGNHP.LSDSDGL-------------------------------...VVPLGKI.SKTGLSTS-----------
PAR11_HUMAN/129-330MR.................-------------------------------....PPSKDGSYVNLYDSC-----------
Q8I7C5_DICDI/585-801QPALYDQLNGC.YQDKDE.-------------------------------...FIPSSVLKGPIIETGS-----------

PF02763

Q6NK15_CORDI/26-212RVVL-------------------------------------------------SLPFAEGSSSVEYINNW----------

PF03496

A0FKE4_9GAMM/241-430TRRVLEEAKLGEQSGH-----SKGLLDALDLAR-
A0A021PZP6_STAAU/47-247GSVEL.......SNDK-----KKIIITAIVFKK-
A2RG53_STRPG/60-249..VGAYV.....SQDQ-----KKLHIEAYFKGS-
A0A030R3C5_PSEAI/242-430TRRVLEEAALGEQSGH-----SQGLLDALDLAS-
A3L121_PSEAI/245-434TRRVLEEATLGERSGH-----GEGLLDALDLAT-
B0YIU7_BACTU/276-462DKATEVI.....IKGV-----KRYVVDATLLTN-
B1BBR9_CLOBO/55-244SDMQI.......SRNN-----RQIMITA.MIFK-
B1BSY1_CLOPF/261-454NKVDSYK.....DGTV-----TKLILDAT.LIN-
B3ZYG6_BACCE/56-253EKASIIE.....LEGR-----EYLEIEAKGKKD-
B3ZYJ4_BACCE/45-249HGMSIIV.....ENGR-----ERLKVTADLLKK-
B4U1X8_STREM/46-234..IGANL.....SDDH-----TRLLIETR.LLP-
C2SU54_BACCE/217-423DKIGTVETELSTGKRR-----TDVFVEATVLPK-
C2X5A0_BACCE/56-251NDISYVK.....NGNS-----NYVLVDATI.QK-
C3B4Y1_BACMY/29-179..............AI-----PHWNHTYSLILL-
C3B5A2_BACMY/83-262KSANVD......SDGK-----IHLILD...LIK-
C3DDI1_BACTU/266-451DKVTEVV.....VKGI-----RKLVVDATLLLK-
C3ECU3_BACTU/38-244TNISPVI.....EKDR-----EYIMMDVEILDI-
C3V1Q7_9CAUD/377-628NKITDASNNDGTTSNN-----TKLIQAEVMTTE-
C4B698_CLOBO/226-428FRITPITSIINRVTKM-----TQVVIDAEVIQN-
D0GI75_CLOBO/1-192DDMRL.......SSDG-----KQIIITATMMGT-
D9IEN5_BPT4/374-615NKITDASYNDGTVKTN-----NKLIQAEVMTTE-
ARC3_CLOLM/60-249SDMQI.......APNN-----KQIIITA..LLK-
CRAX_BACCE/253-470DKFSIVKPTREEDKGK-----EYLKVNLSIYLG-
Q8GAX6_STAAU/47-247GSVKL.......SDNK-----RKIIITAVVFKK-
Q8VVU2_STAAU/47-247NTVKL.......SDDH-----KRILIEGIVFKK-
F0K4W7_CLOAE/207-388KEATVG......SDGK-----LNIVLD.LNLKR-

PF01129

NAR5_MOUSE/29-255TGFSQ.------DGAQ-----SIVTLWSYDQTCS
NAR1_HUMAN/39-274INASRL------AQGP-----ARIYLRALGKHST
NRT1_CHICK/37-257INFSN.------DRGS-----VKIQLHSKGKMST
Q87WF6_PSESM/58-297TGLRK.------QDDK-----WHVDLNEIADNSD
NAR3_HUMAN/29-252SQ....------EGAG-----NNLILQSINKTCS
NARE_CHICK/37-257TNSTY.------TAGR-----SFIQLRSQGKSST
NAR2A_MOUSE/27-242VKTQS.------VERY-----IQISLDSPKRKKS
NAR2A_RAT/27-239VR....------TQGY-----NEIFLDSPKRKKS

PF09156

LEF_BACAN/297-583KDVQIIK-----QSEK-----EYIRIDAKVV---

PF01375

Q13Q55_BURXL/433-665VKDQ........ANR------LDYRGPVTIETEW
M6BJN5_LEPBO/40-285KRSRLPTLPFFKTPI------SQAISSKGMFIKL
A0A016X6U0_VIBCL/2-258VKRQ.....IFSGYQ------SDIDTHNRIKDEL
A7Y1X7_ECOLX/2-258VKRQ.....IFSDYQ------SEVDIYNRIRDEL
E2BA_ECOLX/1-263IKRKFTLMTLLSINN------DGFFSNNGGKDEL
E2AA_ECOLX/2-259LKRRLAL..TFFMSE------DDFIGVHGERDEL

PF02917

CARDS_MYCPN/3-234SEGTSASLS.FACPD------WS-----------
TOX1_BORPE/36-268RAGEAMVLVYYESIA------YS-----------

PF00644

Q7QBC7_ANOGA/780-991-S...LLYNEFIVYDV-----GQVNCQYLFKMNF
PAR12_MOUSE/506-689-VNSMSDPTIFVVFEK-----HQVYPEYLIQYST
Q8QGB0_ONCMY/90-274-TDNTSNPTMFVIFSD-----VQAYPEFLIHSSK
PME2_CAEEL/304-528-R...LLYDEYVMFNK-----EHFKIKYVVEVKV
Q6DDF6_XENLA/117-300-D...VPQKYFVVTNN-----QLLRVKYLMVYSQ
Q6DFH2_XENLA/340-552-GGYTLNYNEYIVYDP-----HQVRMKYLLQVRF
Q7Z114_DICDI/449-640-....FKNNEYVVFNP-----NQSKLSFLIEYIE
PARP1_CHICK/794-1004-C...LLYNEYIVYDV-----AQVNLKYLLKLKF
PARP2_ARATH/421-633-M...LLYNEYIVYNV-----EQIKMRYVIQVKF
PAR16_MOUSE/90-273-E...IPPKYFVVTNN-----QLLRVKYLLVYSQ
Q6A0B1_MOUSE/386-574-....FQDDEFVVYKT-----NQVKMKYIVKFCT
PARP2_MAIZE/436-648-G...LLYNEYIVYNV-----DQIRMRYVLHVNF
Q8BSZ1_MOUSE/766-954-VDCLQQPRIFVIFHD-----TQALPTHLITCKN
PARP1_MAIZE/764-976-E...LMYNEYIVYNT-----SQVKMQFLLKVRF
Q6NX05_DANRE/102-278-E...VPEKYFVVTNN-----ELLRVKYLLVYSQ
H2Q7V9_PANTR/365-577-DGYTLNYNEYIVYNP-----NQVRMRYLLKVQF
Q8X0P2_NEUCS/432-660-PGCSLLYNEYIAYDV-----AQIRLRYLFRVKI
Q8I7C4_DICDI/2328-2536-DY.HLEMNEYIVYDV-----SQIRMRYLVEVSN
Q7ZVB0_DANRE/323-528-H...FYNSEYLIYKE-----SQCRIRYLLELKF
Q91YR6_MOUSE/317-528-S...FSQSEYLIYKE-----SQCRLRYLLEIHL
PARP_SARPE/782-993-S...LLYNEFIIYDI-----AQVNIQYMLRMNF
G5EB68_EMENI/449-674-QG.YLLYNEYIVYDV-----AQIRLRYLFFVDM
PARP3_SOYBN/586-801-P...LEYNEYAVYDK-----KRARISYLVGVKY
Q8I7C6_DICDI/493-700-S...CYEHQYVVYDV-----AQVHLKYLLQLRN
PARP1_ARATH/767-979-E...LMYNEYIVYDT-----AQVKLQFLLKVRF
Q7Z115_DICDI/725-936-....CTHNEFIVYKI-----EQVRVKYILRVYN
PAR11_HUMAN/129-330-VDDTWNPKIFVVFDA-----NQIYPEYLIDF..
Q8I7C5_DICDI/585-801-IVTSFTHNEYVIYNN-----SQCRIKYLLKLRL

PF02763

Q6NK15_CORDI/26-212EQAKALSVELEINFETRGKRGQDAMYEYMAQACA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window