Sequence alignment for CL0085

PF02552

ACDE2_ARCFU/2-172AKALEQP..-----------------------------------------------------------------------
ACDE_METTH/4-171LNDRIIP..-----------------------------------------------------------------------
ACDE_METJA/4-144RFIAYIP..-----------------------------------------------------------------------
O67557_AQUAE/619-788EDMSRLPIV-----------------------------------------------------------------------
ACDE1_ARCFU/7-181AKEEKFPTA-----------------------------------------------------------------------
O67252_AQUAE/19-183GVLTPPP..-----------------------------------------------------------------------

PF00205

PDC2_SCHPO/205-338--------------------------------------------------------------------------------
Q4KDI6_PSEF5/219-353--------------------------------------------------------------------------------
Q4WM01_ASPFU/222-353--------------------------------------------------------------------------------
Q4WC96_ASPFU/248-378--------------------------------------------------------------------------------
Q4WW88_ASPFU/200-331--------------------------------------------------------------------------------
HACL_ARATH/206-334--------------------------------------------------------------------------------
ILVB_SPIPL/206-344--------------------------------------------------------------------------------
IOLD_BACSU/220-354--------------------------------------------------------------------------------
ILVX_BACSU/200-335--------------------------------------------------------------------------------
ILVBL_BOVIN/273-405--------------------------------------------------------------------------------
IOLD_LISMF/221-354--------------------------------------------------------------------------------
Q86ZI4_NEUCS/227-359--------------------------------------------------------------------------------
O07043_AZOBR/192-324--------------------------------------------------------------------------------
O22578_VOLCA/289-422--------------------------------------------------------------------------------
O26576_METTH/240-367--------------------------------------------------------------------------------
O28180_ARCFU/201-335--------------------------------------------------------------------------------
O28554_ARCFU/190-325--------------------------------------------------------------------------------
ILVBL_CAEEL/277-409--------------------------------------------------------------------------------
O66759_AQUAE/198-333--------------------------------------------------------------------------------
O68497_CLOAT/208-342--------------------------------------------------------------------------------
O87839_STRCO/200-327--------------------------------------------------------------------------------
PDC_ZYMMO/199-331--------------------------------------------------------------------------------
MDLC_PSEPU/190-325--------------------------------------------------------------------------------
DCIP_ENTCL/199-331--------------------------------------------------------------------------------
ILVB_KLEPN/197-331--------------------------------------------------------------------------------
PDC1_MAIZE/246-379--------------------------------------------------------------------------------
PDC_NEUCR/205-336--------------------------------------------------------------------------------
ILVB_SCHPO/285-430--------------------------------------------------------------------------------
POXB_LACPL/202-333--------------------------------------------------------------------------------
YEC0_YEAST/195-327--------------------------------------------------------------------------------
OXC_OXAFO/203-333--------------------------------------------------------------------------------
ILVB_CORGL/216-351--------------------------------------------------------------------------------
ILVI_HAEIN/196-331--------------------------------------------------------------------------------
BZNB_PSEFL/194-329--------------------------------------------------------------------------------
ILVB_PORPU/206-341--------------------------------------------------------------------------------
P94896_OENOE/194-330--------------------------------------------------------------------------------
YDAP_BACSU/193-321--------------------------------------------------------------------------------
P97113_LEUMC/201-336--------------------------------------------------------------------------------
ILVB_LACLA/200-335--------------------------------------------------------------------------------
ARO10_YEAST/244-383--------------------------------------------------------------------------------
THI3_YEAST/212-344--------------------------------------------------------------------------------
PDC1_KLULA/201-333--------------------------------------------------------------------------------
Q17474_CAEEL/261-391--------------------------------------------------------------------------------
Q1LF51_RALME/275-402--------------------------------------------------------------------------------
Q1LM48_RALME/189-317--------------------------------------------------------------------------------
Q1M4I8_RHIL3/188-321--------------------------------------------------------------------------------
Q1M4Y3_RHIL3/204-337--------------------------------------------------------------------------------
Q1MJ71_RHIL3/230-364--------------------------------------------------------------------------------
Q1N3D1_9GAMM/189-317--------------------------------------------------------------------------------
Q1NYW7_9FLAO/195-332--------------------------------------------------------------------------------
Q1QAH7_PSYCK/229-362--------------------------------------------------------------------------------
Q1R058_CHRSD/190-323--------------------------------------------------------------------------------
Q1R095_CHRSD/207-342--------------------------------------------------------------------------------
B3XNI8_LACRE/195-331--------------------------------------------------------------------------------
B3XR89_LACRE/202-331--------------------------------------------------------------------------------
A5WFU4_PSYWF/155-291--------------------------------------------------------------------------------
A5WFU5_PSYWF/195-322--------------------------------------------------------------------------------
A5WDF4_PSYWF/210-343--------------------------------------------------------------------------------
Q1V0A8_PELUQ/195-332--------------------------------------------------------------------------------
Q1VVK9_9FLAO/210-345--------------------------------------------------------------------------------
Q1WVB6_LACS1/198-333--------------------------------------------------------------------------------
Q1WVR0_LACS1/195-324--------------------------------------------------------------------------------
A5D4V9_PELTS/192-327--------------------------------------------------------------------------------
Q1YIT6_MOBAS/207-341--------------------------------------------------------------------------------
Q1YIU4_MOBAS/196-334--------------------------------------------------------------------------------
Q1YKX8_MOBAS/228-407--------------------------------------------------------------------------------
Q1YX19_PHOPR/200-338--------------------------------------------------------------------------------
Q1ZKY9_PHOAS/187-322--------------------------------------------------------------------------------
Q1ZSM4_PHOAS/192-327--------------------------------------------------------------------------------
Q21SN9_RHOFD/191-324--------------------------------------------------------------------------------
Q21T72_RHOFD/229-365--------------------------------------------------------------------------------
Q21VK8_RHOFD/229-357--------------------------------------------------------------------------------
Q220C3_RHOFD/190-328--------------------------------------------------------------------------------
Q24UP5_DESHY/194-329--------------------------------------------------------------------------------
Q24XT7_DESHY/200-336--------------------------------------------------------------------------------
Q251L0_DESHY/193-331--------------------------------------------------------------------------------
Q252I7_DESHY/193-328--------------------------------------------------------------------------------
Q28KM5_JANSC/191-323--------------------------------------------------------------------------------
Q28SI9_JANSC/198-334--------------------------------------------------------------------------------
Q28W58_JANSC/189-326--------------------------------------------------------------------------------
B8CX18_HALOH/193-328--------------------------------------------------------------------------------
B8CWB0_HALOH/189-317--------------------------------------------------------------------------------
Q2CC29_9RHOB/189-327--------------------------------------------------------------------------------
A5G0X6_ACICJ/217-351--------------------------------------------------------------------------------
A5FTR0_ACICJ/189-317--------------------------------------------------------------------------------
A5G2E1_ACICJ/199-336--------------------------------------------------------------------------------
A5GC69_GEOUR/192-327--------------------------------------------------------------------------------
A5FR34_DEHSB/193-328--------------------------------------------------------------------------------
Q2F5Z5_BOMMO/217-346--------------------------------------------------------------------------------
Q2FM35_METHJ/193-328--------------------------------------------------------------------------------
Q2G625_NOVAD/195-332--------------------------------------------------------------------------------
Q2GMZ7_CHAGB/217-331--------------------------------------------------------------------------------
Q2IJB5_ANADE/195-330--------------------------------------------------------------------------------
Q2IPR2_ANADE/234-362--------------------------------------------------------------------------------
Q2J1F2_RHOP2/193-331--------------------------------------------------------------------------------
Q2J6V0_FRASC/199-334--------------------------------------------------------------------------------
Q2JZ22_RHIEC/196-321--------------------------------------------------------------------------------
Q2KTL4_BORA1/228-365--------------------------------------------------------------------------------
Q2LXN9_SYNAS/193-328--------------------------------------------------------------------------------
Q2LXP1_SYNAS/192-327--------------------------------------------------------------------------------
Q2NBF4_ERYLH/186-319--------------------------------------------------------------------------------
Q2NI91_METST/191-326--------------------------------------------------------------------------------
Q2P758_XANOM/197-332--------------------------------------------------------------------------------
Q2RG94_MOOTA/203-338--------------------------------------------------------------------------------
Q2RG96_MOOTA/197-332--------------------------------------------------------------------------------
Q2RXQ6_RHORT/213-351--------------------------------------------------------------------------------
Q2S0N1_SALRD/216-351--------------------------------------------------------------------------------
Q2S798_HAHCH/191-326--------------------------------------------------------------------------------
Q2SJ09_HAHCH/200-336--------------------------------------------------------------------------------
Q2SM62_HAHCH/214-350--------------------------------------------------------------------------------
Q2SMT8_HAHCH/219-352--------------------------------------------------------------------------------
Q2U768_ASPOR/207-343--------------------------------------------------------------------------------
Q2UC40_ASPOR/202-333--------------------------------------------------------------------------------
Q2W471_MAGSA/196-334--------------------------------------------------------------------------------
Q2WFA8_MONVA/223-356--------------------------------------------------------------------------------
A6LXD5_CLOB8/198-332--------------------------------------------------------------------------------
A6LPX7_CLOB8/192-326--------------------------------------------------------------------------------
A6LWS0_CLOB8/194-329--------------------------------------------------------------------------------
A6M227_CLOB8/219-353--------------------------------------------------------------------------------
A6LX01_CLOB8/191-328--------------------------------------------------------------------------------
A5W954_PSEP1/196-331--------------------------------------------------------------------------------
A5W0I1_PSEP1/200-336--------------------------------------------------------------------------------
A5W364_PSEP1/198-328--------------------------------------------------------------------------------
Q877U6_PSEPK/187-320--------------------------------------------------------------------------------
A5W220_PSEP1/196-326--------------------------------------------------------------------------------
Q2YKW9_BRUA2/216-350--------------------------------------------------------------------------------
A4XIL5_CALS8/194-328--------------------------------------------------------------------------------
A4XHS0_CALS8/191-326--------------------------------------------------------------------------------
Q30RG2_SULDN/193-328--------------------------------------------------------------------------------
Q30YW8_DESDG/192-323--------------------------------------------------------------------------------
Q31JM5_THICR/186-321--------------------------------------------------------------------------------
A5EDH4_BRASB/198-324--------------------------------------------------------------------------------
A5ECG1_BRASB/192-328--------------------------------------------------------------------------------
Q38UJ8_LACSS/196-325--------------------------------------------------------------------------------
Q39P46_BURS3/215-348--------------------------------------------------------------------------------
Q39W78_GEOMG/193-328--------------------------------------------------------------------------------
Q3AEQ6_CARHZ/192-327--------------------------------------------------------------------------------
Q3AEQ9_CARHZ/192-327--------------------------------------------------------------------------------
Q3ALE4_SYNSC/204-340--------------------------------------------------------------------------------
Q3ALP1_SYNSC/196-331--------------------------------------------------------------------------------
Q3AM88_SYNSC/188-321--------------------------------------------------------------------------------
A6TTL0_ALKMQ/192-327--------------------------------------------------------------------------------
A6TTM8_ALKMQ/204-339--------------------------------------------------------------------------------
B9LGM6_CHLSY/196-331--------------------------------------------------------------------------------
B9LHS5_CHLSY/482-610--------------------------------------------------------------------------------
A6VLE4_ACTSZ/188-323--------------------------------------------------------------------------------
Q3ICC9_PSEHT/198-333--------------------------------------------------------------------------------
Q3IS45_NATPD/201-338--------------------------------------------------------------------------------
Q3JBM9_NITOC/217-353--------------------------------------------------------------------------------
Q3K7P6_PSEPF/191-324--------------------------------------------------------------------------------
A3D4X6_SHEB5/190-319--------------------------------------------------------------------------------
Q3SL06_THIDA/197-334--------------------------------------------------------------------------------
Q3V892_DESVH/193-328--------------------------------------------------------------------------------
Q3V893_DESVH/192-327--------------------------------------------------------------------------------
A8L943_FRASN/191-326--------------------------------------------------------------------------------
A8L1M3_FRASN/194-330--------------------------------------------------------------------------------
Q3XZD0_ENTFC/193-322--------------------------------------------------------------------------------
Q3Y3Q3_ENTFC/220-354--------------------------------------------------------------------------------
Q3YZF7_SHISS/201-329--------------------------------------------------------------------------------
Q3Z3R2_SHISS/191-319--------------------------------------------------------------------------------
A6WFD0_KINRD/239-373--------------------------------------------------------------------------------
B1YKG0_EXIS2/201-337--------------------------------------------------------------------------------
Q46SP4_CUPPJ/228-365--------------------------------------------------------------------------------
Q46VA1_CUPPJ/202-331--------------------------------------------------------------------------------
Q471R9_CUPPJ/220-358--------------------------------------------------------------------------------
Q47FL3_DECAR/193-328--------------------------------------------------------------------------------
Q47SH6_THEFY/199-330--------------------------------------------------------------------------------
Q47UP0_COLP3/160-295--------------------------------------------------------------------------------
Q47YT4_COLP3/192-325--------------------------------------------------------------------------------
Q48634_9LACT/192-327--------------------------------------------------------------------------------
Q4A101_STAS1/192-327--------------------------------------------------------------------------------
Q4BWI9_CROWT/189-323--------------------------------------------------------------------------------
A3DIY4_CLOTH/192-327--------------------------------------------------------------------------------
A3DID9_CLOTH/192-327--------------------------------------------------------------------------------
Q4FTE7_PSYA2/199-331--------------------------------------------------------------------------------
B9KGF5_CAMLR/194-329--------------------------------------------------------------------------------
Q4J6N9_SULAC/197-320--------------------------------------------------------------------------------
Q4J7J3_SULAC/185-313--------------------------------------------------------------------------------
Q4J9P1_SULAC/191-326--------------------------------------------------------------------------------
Q4JAP2_SULAC/203-338--------------------------------------------------------------------------------
Q4JWD0_CORJK/191-318--------------------------------------------------------------------------------
Q4L7T7_STAHJ/225-360--------------------------------------------------------------------------------
Q4V070_XANC8/193-321--------------------------------------------------------------------------------
Q4Y789_PLACH/107-235--------------------------------------------------------------------------------
POXB_STRPN/196-327--------------------------------------------------------------------------------
Q5AMN8_CANAL/91-249--------------------------------------------------------------------------------
Q5AZE4_EMENI/765-897--------------------------------------------------------------------------------
Q5B535_EMENI/204-350--------------------------------------------------------------------------------
Q5FHQ7_LACAC/194-323--------------------------------------------------------------------------------
Q5FLY7_LACAC/198-327--------------------------------------------------------------------------------
Q5FRZ0_GLUOX/205-342--------------------------------------------------------------------------------
Q5L322_GEOKA/194-329--------------------------------------------------------------------------------
Q5LKS2_SILPO/192-328--------------------------------------------------------------------------------
Q5LLG2_SILPO/190-321--------------------------------------------------------------------------------
Q5LQV0_SILPO/199-335--------------------------------------------------------------------------------
Q5NEA3_FRATT/213-346--------------------------------------------------------------------------------
Q5NPP9_ZYMMO/193-327--------------------------------------------------------------------------------
Q5QZF0_IDILO/186-322--------------------------------------------------------------------------------
Q5R276_DROSE/193-322--------------------------------------------------------------------------------
Q5UWG1_HALMA/202-340--------------------------------------------------------------------------------
Q5V522_HALMA/213-348--------------------------------------------------------------------------------
Q5V5J6_HALMA/187-321--------------------------------------------------------------------------------
Q5WGG1_BACSK/191-329--------------------------------------------------------------------------------
Q5WW44_LEGPL/218-352--------------------------------------------------------------------------------
Q5YN72_NOCFA/213-347--------------------------------------------------------------------------------
Q60021_THEAQ/190-323--------------------------------------------------------------------------------
Q601Q2_MYCH2/220-353--------------------------------------------------------------------------------
Q62KX9_BURMA/246-379--------------------------------------------------------------------------------
IOLD1_BACCZ/219-353--------------------------------------------------------------------------------
Q64BR9_9ARCH/196-332--------------------------------------------------------------------------------
Q64PS7_BACFR/197-332--------------------------------------------------------------------------------
Q67KX7_SYMTH/192-328--------------------------------------------------------------------------------
Q6AAK5_PROAC/228-362--------------------------------------------------------------------------------
Q6AEP0_LEIXX/219-354--------------------------------------------------------------------------------
Q6AJI2_DESPS/239-374--------------------------------------------------------------------------------
Q6APX2_DESPS/190-328--------------------------------------------------------------------------------
Q6C6Q2_YARLI/193-323--------------------------------------------------------------------------------
Q6CDI5_YARLI/273-418--------------------------------------------------------------------------------
Q6DDN7_XENLA/202-331--------------------------------------------------------------------------------
Q6FDG8_ACIAD/195-324--------------------------------------------------------------------------------
Q6FJV6_CANGA/193-324--------------------------------------------------------------------------------
Q6FYB3_CANGA/251-392--------------------------------------------------------------------------------
Q6G6D5_STAAS/193-322--------------------------------------------------------------------------------
Q6HKA3_BACHK/204-339--------------------------------------------------------------------------------
Q6HLF6_BACHK/202-337--------------------------------------------------------------------------------
Q6L042_PICTO/193-329--------------------------------------------------------------------------------
Q6LK31_PHOPR/222-355--------------------------------------------------------------------------------
Q6LK45_PHOPR/220-354--------------------------------------------------------------------------------
Q6LZH8_METMP/193-328--------------------------------------------------------------------------------
Q6N2J6_RHOPA/202-339--------------------------------------------------------------------------------
Q6N2Y1_RHOPA/196-336--------------------------------------------------------------------------------
Q6N3D1_RHOPA/193-319--------------------------------------------------------------------------------
Q6N658_RHOPA/218-353--------------------------------------------------------------------------------
Q6NDJ7_RHOPA/202-334--------------------------------------------------------------------------------
Q6SGJ7_9BACT/200-328--------------------------------------------------------------------------------
Q6W1J3_RHISN/220-353--------------------------------------------------------------------------------
Q6ZUX2_HUMAN/198-327--------------------------------------------------------------------------------
Q70I04_9ACTO/185-318--------------------------------------------------------------------------------
Q72SH3_LEPIC/221-355--------------------------------------------------------------------------------
Q737X8_BACC1/202-334--------------------------------------------------------------------------------
Q738G9_BACC1/193-321--------------------------------------------------------------------------------
Q73CV8_BACC1/203-338--------------------------------------------------------------------------------
Q73TP3_MYCPA/147-281--------------------------------------------------------------------------------
Q73U45_MYCPA/225-354--------------------------------------------------------------------------------
Q74H96_LACJO/195-324--------------------------------------------------------------------------------
Q757R7_ASHGO/187-316--------------------------------------------------------------------------------
Q75PZ0_9BIFI/209-338--------------------------------------------------------------------------------
Q7CL03_YERPE/186-321--------------------------------------------------------------------------------
A2VGF0_MYCTU/208-339--------------------------------------------------------------------------------
Q7MAQ0_WOLSU/193-328--------------------------------------------------------------------------------
Q7N5X4_PHOLL/224-358--------------------------------------------------------------------------------
Q7NR95_CHRVO/168-305--------------------------------------------------------------------------------
Q7UHW9_RHOBA/234-369--------------------------------------------------------------------------------
Q7VXC3_BORPE/196-334--------------------------------------------------------------------------------
Q7VY25_BORPE/197-335--------------------------------------------------------------------------------
Q7WBZ5_BORPA/205-338--------------------------------------------------------------------------------
Q7WCV8_BORBR/218-357--------------------------------------------------------------------------------
Q7WHS2_BORBR/197-328--------------------------------------------------------------------------------
Q7WPE1_BORBR/198-327--------------------------------------------------------------------------------
Q7WQI4_BORBR/197-333--------------------------------------------------------------------------------
Q7WQJ5_BORBR/206-345--------------------------------------------------------------------------------
Q82CK4_STRAW/220-354--------------------------------------------------------------------------------
Q82CQ7_STRAW/217-348--------------------------------------------------------------------------------
Q82PG6_STRAW/190-319--------------------------------------------------------------------------------
Q83HI7_TROW8/197-332--------------------------------------------------------------------------------
Q845Z6_SELRU/190-325--------------------------------------------------------------------------------
ILVI_BUCBP/196-331--------------------------------------------------------------------------------
Q89E01_BRAJA/194-322--------------------------------------------------------------------------------
Q89QL7_BRAJA/184-317--------------------------------------------------------------------------------
Q8A6Q6_BACTN/191-319--------------------------------------------------------------------------------
Q8DR05_STRR6/200-335--------------------------------------------------------------------------------
Q8EL23_OCEIH/193-321--------------------------------------------------------------------------------
Q8ELJ0_OCEIH/199-338--------------------------------------------------------------------------------
Q8EN64_OCEIH/207-342--------------------------------------------------------------------------------
Q8FQJ5_COREF/209-339--------------------------------------------------------------------------------
Q8G7H0_BIFLO/221-356--------------------------------------------------------------------------------
Q8PUJ4_METMA/186-320--------------------------------------------------------------------------------
Q8RDJ8_THETN/191-326--------------------------------------------------------------------------------
Q8TT45_METAC/203-335--------------------------------------------------------------------------------
Q8U2A4_PYRFU/195-330--------------------------------------------------------------------------------
Q92DT2_LISIN/193-321--------------------------------------------------------------------------------
Q92NJ5_RHIME/187-325--------------------------------------------------------------------------------
Q92X67_RHIME/197-327--------------------------------------------------------------------------------
Q92XQ1_RHIME/191-335--------------------------------------------------------------------------------
Q92ZG6_RHIME/197-336--------------------------------------------------------------------------------
XSC_DESTI/194-332--------------------------------------------------------------------------------
Q971A7_SULTO/197-333--------------------------------------------------------------------------------
Q97EE4_CLOAB/189-324--------------------------------------------------------------------------------
Q97TS2_CLOAB/199-331--------------------------------------------------------------------------------
Q97UP3_SULSO/187-315--------------------------------------------------------------------------------
Q97XR3_SULSO/187-318--------------------------------------------------------------------------------
Q988P8_RHILO/199-338--------------------------------------------------------------------------------
Q98CV8_RHILO/243-377--------------------------------------------------------------------------------
Q9A8Q4_CAUCR/219-353--------------------------------------------------------------------------------
Q9CE06_LACLA/194-323--------------------------------------------------------------------------------
Q9F7L7_PRB01/188-323--------------------------------------------------------------------------------
Q9HJZ5_THEAC/187-315--------------------------------------------------------------------------------
Q9HK28_THEAC/167-303--------------------------------------------------------------------------------
Q9HKB0_THEAC/203-342--------------------------------------------------------------------------------
Q9HTQ7_PSEAE/190-318--------------------------------------------------------------------------------
Q9I207_PSEAE/198-328--------------------------------------------------------------------------------
Q9K659_BACHD/188-324--------------------------------------------------------------------------------
IOLD_BACHD/219-353--------------------------------------------------------------------------------
Q9L123_STRCO/189-324--------------------------------------------------------------------------------
PDC3_SCHPO/210-342--------------------------------------------------------------------------------
Q9WZ18_THEMA/197-332--------------------------------------------------------------------------------
YGK4_SCHPO/192-322--------------------------------------------------------------------------------
Q9ZBT3_STRCO/192-320--------------------------------------------------------------------------------
Q9ZIA9_LEULA/196-332--------------------------------------------------------------------------------

PF02233

NNTM_BOVIN/618-1080NIEQIMYLG...SGLCCVGALAGLSTQGTARLGNALGMIGVAGGLAATLGGLKPCPELLA..................QM
PNTB_HAEIN/4-474GLVQAAYIL...AALLFIMSLAGLSKHETAKAGCWFGIVGMTIALIATI..FGPHSEGTF..................WI
PNTB_SHIFL/4-462GLVTAAYIV...AAILFIFSLAGLSKHETSRQGNNFGIAGMAIALIATI..FGPDTGNVG..................WI
Q18031_CAEEL/573-1036LIHSYAYLG...SSLCCVGALAGLSSQSTARVGNALGIIGVTGG.IGAT..LGLLQPDFNT...............LCQM
Q24813_ENTHI/17-526IINNFVSVGNIIISLCFILALRGLSTQISAKMGNIYGIIGMTVAFIAAV..VDKIGDYFDPEVYGEETGKTSIIYLLIGY
P73500_SYNY3/4-464SLQTVAYVA...ASILFIFSLGGLANQETARRGNVYGIAGMAIAFLATA..LGGDFTGYT..................TL
Q9ZE72_RICPR/4-462QIIQLLYLL...AAVCFILSLKFLSSQKQARLGSIIGILGMTIAVGITF..CLPDFTHKL..................QI
PNTB_RHORU/4-463SLTMAAYIV...AGVLFILALRGLSNPESARNGNRMGMVGMAIAILTTL..LSPSVQAYA..................WI
P96834_MYCTU/5-472YLVEILYII...SFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIAVAATL..VMIRHTSQW.................PLI
Q07600_EIMTE/3-459SLLGAVYLF...SAICFILCLRGLSTPQTAKRGNILGLVGMVAA...VV..VTFTEAGFGQH..............YLLF

PF02146

SIR2_TRYB2/37-220--------------------------------------------------------------------------------
SIR2_LEIMA/39-223--------------------------------------------------------------------------------
SIR2_DROME/229-434--------------------------------------------------------------------------------
SIR2_CANAL/246-437--------------------------------------------------------------------------------
NPD_PYRHO/20-197--------------------------------------------------------------------------------
NPD_BACSU/19-198--------------------------------------------------------------------------------
NPD_STAA8/23-198--------------------------------------------------------------------------------
SIR2_CAEEL/153-334--------------------------------------------------------------------------------
NPD2_ARCFU/23-198--------------------------------------------------------------------------------
SIR42_CAEEL/35-243--------------------------------------------------------------------------------
SIR2_KLULA/318-534--------------------------------------------------------------------------------
NPD_MYCTU/8-184--------------------------------------------------------------------------------
SIR2_YEAST/262-478--------------------------------------------------------------------------------
E9YAJ6_ECOLX/48-221--------------------------------------------------------------------------------
SIR2_SCHPO/164-380--------------------------------------------------------------------------------
O94066_CANAX/26-208--------------------------------------------------------------------------------
NPD1_ARCFU/20-192--------------------------------------------------------------------------------
NPD_AQUAE/11-183--------------------------------------------------------------------------------
NPD_AGGAC/10-177--------------------------------------------------------------------------------
SIR41_CAEEL/35-243--------------------------------------------------------------------------------

PF13289

C3WEJ8_FUSMR/103-239--------------------------------------------------------------------------------
E0WKU6_LISGR/186-358--------------------------------------------------------------------------------
B8FFN4_DESAA/108-257--------------------------------------------------------------------------------
C2VLS5_BACCE/130-263--------------------------------------------------------------------------------
C7RFY6_ANAPD/212-382--------------------------------------------------------------------------------
C7RVA1_ACCPU/142-298--------------------------------------------------------------------------------
A1TX65_MARAV/101-247--------------------------------------------------------------------------------
C6JRB3_FUSVA/103-240--------------------------------------------------------------------------------
A6DRE2_9BACT/143-270--------------------------------------------------------------------------------
C6I4U2_9BACE/102-244--------------------------------------------------------------------------------
D1AZA4_SULD5/145-284--------------------------------------------------------------------------------
C3JCK6_9PORP/114-255--------------------------------------------------------------------------------
B8EJ27_METSB/100-273--------------------------------------------------------------------------------
B0NWG4_9CLOT/150-288--------------------------------------------------------------------------------
Q1BDR9_MYCSS/245-384--------------------------------------------------------------------------------
A9KVJ0_SHEB9/173-321--------------------------------------------------------------------------------
B7J5Y3_ACIF2/103-252--------------------------------------------------------------------------------
D2R627_PIRSD/146-286--------------------------------------------------------------------------------
Q6ALX8_DESPS/166-342--------------------------------------------------------------------------------
A6G3D2_9DELT/43-176--------------------------------------------------------------------------------
C6B833_RHILS/108-250--------------------------------------------------------------------------------
A0QRW8_MYCS2/295-432--------------------------------------------------------------------------------
C3WNE7_9FUSO/40-180--------------------------------------------------------------------------------
Q0YTA6_9CHLB/271-402--------------------------------------------------------------------------------
D4G637_BACNA/107-249--------------------------------------------------------------------------------
B3PHQ7_CELJU/121-268--------------------------------------------------------------------------------
B1IFA3_CLOBK/211-355--------------------------------------------------------------------------------
B2RK70_PORG3/130-279--------------------------------------------------------------------------------
E6TR41_BACCJ/246-381--------------------------------------------------------------------------------
A3IA13_9BACI/104-251--------------------------------------------------------------------------------
C7HAZ7_9FIRM/289-441--------------------------------------------------------------------------------
C4ZMZ3_THASP/323-497--------------------------------------------------------------------------------
B1GAX3_9BURK/115-258--------------------------------------------------------------------------------
Q1D4W8_MYXXD/1238-1377--------------------------------------------------------------------------------
B8I4A6_CLOCE/97-241--------------------------------------------------------------------------------
A0LH81_SYNFM/83-241--------------------------------------------------------------------------------
B0UD07_METS4/36-185--------------------------------------------------------------------------------
B3JQ32_9BACE/138-309--------------------------------------------------------------------------------
D2B798_STRRD/104-265--------------------------------------------------------------------------------
A7GBJ3_CLOBL/118-257--------------------------------------------------------------------------------
A9FD38_SORC5/122-271--------------------------------------------------------------------------------
C3HSI6_BACTU/106-242--------------------------------------------------------------------------------
C3J834_9PORP/142-278--------------------------------------------------------------------------------
D0LP08_HALO1/119-264--------------------------------------------------------------------------------
C2NSI3_BACCE/166-312--------------------------------------------------------------------------------
B5UXF8_BACCE/31-164--------------------------------------------------------------------------------
C1M7E6_9ENTR/499-661--------------------------------------------------------------------------------
Q21D17_RHOPB/114-255--------------------------------------------------------------------------------
A8SDW3_9FIRM/117-269--------------------------------------------------------------------------------
Q6DF29_XENTR/142-286--------------------------------------------------------------------------------
Q4QK39_HAEI8/178-326--------------------------------------------------------------------------------
A7K172_VIBSE/104-251--------------------------------------------------------------------------------
Q223H0_RHOFD/193-348--------------------------------------------------------------------------------
C8NLF5_COREF/112-260--------------------------------------------------------------------------------
A4N3X2_HAEIF/175-323--------------------------------------------------------------------------------
A6G812_9DELT/112-246--------------------------------------------------------------------------------
A4X0P5_RHOS5/105-260--------------------------------------------------------------------------------
A1SJK6_NOCSJ/125-273--------------------------------------------------------------------------------
A6STW5_JANMA/147-314--------------------------------------------------------------------------------
Q48B89_PSE14/9-154--------------------------------------------------------------------------------
Q2RM32_MOOTA/133-297--------------------------------------------------------------------------------
Q0W7V8_UNCMA/109-246--------------------------------------------------------------------------------
C6I9L2_9BACE/137-277--------------------------------------------------------------------------------
Q54CK8_DICDI/935-1078--------------------------------------------------------------------------------
B1MA98_METRJ/103-241--------------------------------------------------------------------------------
Q5V033_HALMA/150-286--------------------------------------------------------------------------------
B9Y0H1_HELPX/107-243--------------------------------------------------------------------------------
A5L0C3_9GAMM/214-366--------------------------------------------------------------------------------
C1ERC3_BACC3/124-262--------------------------------------------------------------------------------
C8X684_NAKMY/91-246--------------------------------------------------------------------------------
B2IE38_BEII9/105-265--------------------------------------------------------------------------------
A3YXQ6_9SYNE/63-205--------------------------------------------------------------------------------
F0QDG8_ACIAP/134-282--------------------------------------------------------------------------------
C1DSG4_AZOVD/112-256--------------------------------------------------------------------------------
C2LUJ2_STRSL/225-405--------------------------------------------------------------------------------
Q6MH60_BDEBA/224-370--------------------------------------------------------------------------------
A6G9A9_9DELT/1210-1344--------------------------------------------------------------------------------
D4KUN5_9FIRM/115-253--------------------------------------------------------------------------------
A7BSX6_9GAMM/390-563--------------------------------------------------------------------------------
A7ABF7_9PORP/141-280--------------------------------------------------------------------------------
A5MFE1_STRPN/104-240--------------------------------------------------------------------------------
A9GWR7_SORC5/128-261--------------------------------------------------------------------------------
C4L4F1_EXISA/106-243--------------------------------------------------------------------------------
C7X7Y0_9PORP/105-251--------------------------------------------------------------------------------
A8IIJ2_AZOC5/116-266--------------------------------------------------------------------------------
B7ITB3_BACC2/116-253--------------------------------------------------------------------------------
D1A4U2_THECD/106-274--------------------------------------------------------------------------------
A9G7D0_SORC5/160-352--------------------------------------------------------------------------------
D3F474_CONWI/122-259--------------------------------------------------------------------------------
E3IX96_FRASU/105-267--------------------------------------------------------------------------------
B0RMG9_XANCB/115-257--------------------------------------------------------------------------------
Q38324_9CAUD/146-291--------------------------------------------------------------------------------
B8K7Z1_VIBPA/98-239--------------------------------------------------------------------------------
A9G5J6_SORC5/116-251--------------------------------------------------------------------------------
B0VP62_ACIBS/101-247--------------------------------------------------------------------------------
C2T6L1_BACCE/106-260--------------------------------------------------------------------------------
A3NCJ6_BURP6/175-318--------------------------------------------------------------------------------
C5BPH6_TERTT/174-345--------------------------------------------------------------------------------
Q468D1_METBF/112-267--------------------------------------------------------------------------------
A9GGY2_SORC5/142-276--------------------------------------------------------------------------------
C7RS50_ACCPU/115-274--------------------------------------------------------------------------------
Q74DF6_GEOSL/136-280--------------------------------------------------------------------------------
D5SSN9_PLAL2/125-270--------------------------------------------------------------------------------
C2W2L4_BACCE/159-308--------------------------------------------------------------------------------
A9E6S3_9FLAO/103-241--------------------------------------------------------------------------------
C9XIG8_CLODC/103-255--------------------------------------------------------------------------------
A3ZR10_9PLAN/69-211--------------------------------------------------------------------------------
C5P7U6_COCP7/141-273--------------------------------------------------------------------------------
A9NH35_ACHLI/152-331--------------------------------------------------------------------------------
D2SD45_GEOOG/295-434--------------------------------------------------------------------------------
B6W7K6_9FIRM/106-236--------------------------------------------------------------------------------
Q5Y0K2_9ARCH/104-253--------------------------------------------------------------------------------
C4X9G7_KLEPN/110-254--------------------------------------------------------------------------------
D2SAI3_GEOOG/505-643--------------------------------------------------------------------------------
D3PB24_DEFDS/122-262--------------------------------------------------------------------------------
A8V433_9AQUI/117-295--------------------------------------------------------------------------------
B1IFA2_CLOBK/117-257--------------------------------------------------------------------------------
A4INT2_GEOTN/98-236--------------------------------------------------------------------------------
A6UN29_SINMW/117-268--------------------------------------------------------------------------------
Q7BQV0_9ENTR/132-298--------------------------------------------------------------------------------
A9KLI0_CLOPH/125-265--------------------------------------------------------------------------------
B4BSV3_9BACI/147-291--------------------------------------------------------------------------------
C1FU09_CLOBJ/116-249--------------------------------------------------------------------------------
A9G4K5_SORC5/114-247--------------------------------------------------------------------------------
A9GB97_SORC5/76-223--------------------------------------------------------------------------------
A6WPG0_SHEB8/65-208--------------------------------------------------------------------------------
Q3BK53_9PROT/118-263--------------------------------------------------------------------------------
Q2YAQ1_NITMU/270-428--------------------------------------------------------------------------------
A1BG00_CHLPD/160-328--------------------------------------------------------------------------------
D2KYA1_CORGT/132-278--------------------------------------------------------------------------------
D1PKF2_9FIRM/165-305--------------------------------------------------------------------------------
C4UA68_YERAL/102-244--------------------------------------------------------------------------------
D0GZ99_VIBMI/58-197--------------------------------------------------------------------------------
A4YZ71_BRASO/96-242--------------------------------------------------------------------------------
B1Q6E3_CLOBO/113-269--------------------------------------------------------------------------------
C0ZNB5_RHOE4/283-422--------------------------------------------------------------------------------
A6DXW7_9RHOB/85-232--------------------------------------------------------------------------------
C7VB26_ENTFL/149-285--------------------------------------------------------------------------------
C4UXP5_YERRO/145-292--------------------------------------------------------------------------------
A6GR96_9BURK/96-234--------------------------------------------------------------------------------
D0LGB9_HALO1/120-267--------------------------------------------------------------------------------
B5UXD5_BACCE/105-241--------------------------------------------------------------------------------
A6SWS4_JANMA/63-201--------------------------------------------------------------------------------
Q6NBK9_RHOPA/152-303--------------------------------------------------------------------------------
C6J830_9FIRM/113-258--------------------------------------------------------------------------------
D9SP56_CLOC7/120-256--------------------------------------------------------------------------------
D1RZ28_SEROD/104-261--------------------------------------------------------------------------------
Q12QQ9_SHEDO/90-229--------------------------------------------------------------------------------
E0TDM6_PARBH/151-296--------------------------------------------------------------------------------
Q1Q2W8_9BACT/165-308--------------------------------------------------------------------------------
D4B7J4_9ENTR/118-255--------------------------------------------------------------------------------
D2SB42_GEOOG/148-291--------------------------------------------------------------------------------
B7L3H7_METC4/126-276--------------------------------------------------------------------------------
B9JR52_AGRVS/164-337--------------------------------------------------------------------------------
A7VYZ2_9CLOT/121-240--------------------------------------------------------------------------------
C2ZYS5_BACCE/126-295--------------------------------------------------------------------------------
C0ZFK0_BREBN/117-254--------------------------------------------------------------------------------
C8PPW3_9SPIO/130-269--------------------------------------------------------------------------------
A1A364_BIFAA/140-287--------------------------------------------------------------------------------
A4CA56_9GAMM/100-236--------------------------------------------------------------------------------
D4J271_BUTFI/140-278--------------------------------------------------------------------------------
A1F0G4_VIBCL/160-327--------------------------------------------------------------------------------
B5WD67_9BURK/102-236--------------------------------------------------------------------------------
Q08QJ5_STIAD/174-316--------------------------------------------------------------------------------

PF00766

ETFA_THETC/205-290--------------------------------------------------------------------------------
Q7CSV6_AGRT5/187-273--------------------------------------------------------------------------------
FIXB_AZOC5/234-319--------------------------------------------------------------------------------
Q7RVY2_NEUCR/223-309--------------------------------------------------------------------------------
Q6AIQ0_DESPS/306-391--------------------------------------------------------------------------------
Q978W1_THEVO/215-300--------------------------------------------------------------------------------
FIXB_CLOSA/206-291--------------------------------------------------------------------------------
ETFA_CLOAB/210-295--------------------------------------------------------------------------------
Q83RF6_SHIFL/188-274--------------------------------------------------------------------------------
Q8NKM5_9CREN/280-377--------------------------------------------------------------------------------
Q83QD8_SHIFL/174-256--------------------------------------------------------------------------------
Q8KZQ0_BUTFI/219-304--------------------------------------------------------------------------------
Q7NG11_GLOVI/221-307--------------------------------------------------------------------------------
FIXB_RHISN/234-319--------------------------------------------------------------------------------
Q9Y966_AERPE/222-307--------------------------------------------------------------------------------
Q8RMW1_AZOBR/227-312--------------------------------------------------------------------------------
ETFA_YEAST/218-304--------------------------------------------------------------------------------
FIXB_SHIFL/189-275--------------------------------------------------------------------------------
Q9HL11_THEAC/441-526--------------------------------------------------------------------------------
FIXB_AZOVI/228-313--------------------------------------------------------------------------------
ETFA_ORYSJ/233-318--------------------------------------------------------------------------------
Q7MVI3_PORGI/207-292--------------------------------------------------------------------------------
Q9FA09_GLUDI/231-317--------------------------------------------------------------------------------
Q8FQ06_COREF/191-277--------------------------------------------------------------------------------
Q8XNM1_CLOPE/270-355--------------------------------------------------------------------------------
Q8ZYL5_PYRAE/218-303--------------------------------------------------------------------------------
ETFA_SCHPO/219-305--------------------------------------------------------------------------------
Q750K5_ASHGO/222-308--------------------------------------------------------------------------------
Q97G29_CLOAB/269-354--------------------------------------------------------------------------------
Q749E7_GEOSL/207-292--------------------------------------------------------------------------------
Q6US86_RHORU/233-318--------------------------------------------------------------------------------
ETFA_HUMAN/209-294--------------------------------------------------------------------------------
ETFA_MEGEL/208-295--------------------------------------------------------------------------------
Q9X1L7_THEMA/206-291--------------------------------------------------------------------------------
Q892L4_CLOTE/208-293--------------------------------------------------------------------------------
Q8D6Q4_VIBVU/200-285--------------------------------------------------------------------------------
Q896M7_CLOTE/271-356--------------------------------------------------------------------------------
Q897M1_CLOTE/208-293--------------------------------------------------------------------------------
Q8XI26_CLOPE/207-292--------------------------------------------------------------------------------

PF01916

DHYS_HUMAN/42-356--------------------------------------------------------------------------------
DHYS_YEAST/45-377--------------------------------------------------------------------------------
DHYS_METJA/25-330--------------------------------------------------------------------------------
DHYS_PYRHO/31-334--------------------------------------------------------------------------------
DHYS_NEUCR/43-348--------------------------------------------------------------------------------
DHYS1_ARCFU/14-296--------------------------------------------------------------------------------
DHYS_METTH/17-305--------------------------------------------------------------------------------

PF02552

ACDE2_ARCFU/2-172--------------------------------------------------------------------------------
ACDE_METTH/4-171--------------------------------------------------------------------------------
ACDE_METJA/4-144--------------------------------------------------------------------------------
O67557_AQUAE/619-788--------------------------------------------------------------------------------
ACDE1_ARCFU/7-181--------------------------------------------------------------------------------
O67252_AQUAE/19-183--------------------------------------------------------------------------------

PF00205

PDC2_SCHPO/205-338--------------------------------------------------------------------------------
Q4KDI6_PSEF5/219-353--------------------------------------------------------------------------------
Q4WM01_ASPFU/222-353--------------------------------------------------------------------------------
Q4WC96_ASPFU/248-378--------------------------------------------------------------------------------
Q4WW88_ASPFU/200-331--------------------------------------------------------------------------------
HACL_ARATH/206-334--------------------------------------------------------------------------------
ILVB_SPIPL/206-344--------------------------------------------------------------------------------
IOLD_BACSU/220-354--------------------------------------------------------------------------------
ILVX_BACSU/200-335--------------------------------------------------------------------------------
ILVBL_BOVIN/273-405--------------------------------------------------------------------------------
IOLD_LISMF/221-354--------------------------------------------------------------------------------
Q86ZI4_NEUCS/227-359--------------------------------------------------------------------------------
O07043_AZOBR/192-324--------------------------------------------------------------------------------
O22578_VOLCA/289-422--------------------------------------------------------------------------------
O26576_METTH/240-367--------------------------------------------------------------------------------
O28180_ARCFU/201-335--------------------------------------------------------------------------------
O28554_ARCFU/190-325--------------------------------------------------------------------------------
ILVBL_CAEEL/277-409--------------------------------------------------------------------------------
O66759_AQUAE/198-333--------------------------------------------------------------------------------
O68497_CLOAT/208-342--------------------------------------------------------------------------------
O87839_STRCO/200-327--------------------------------------------------------------------------------
PDC_ZYMMO/199-331--------------------------------------------------------------------------------
MDLC_PSEPU/190-325--------------------------------------------------------------------------------
DCIP_ENTCL/199-331--------------------------------------------------------------------------------
ILVB_KLEPN/197-331--------------------------------------------------------------------------------
PDC1_MAIZE/246-379--------------------------------------------------------------------------------
PDC_NEUCR/205-336--------------------------------------------------------------------------------
ILVB_SCHPO/285-430--------------------------------------------------------------------------------
POXB_LACPL/202-333--------------------------------------------------------------------------------
YEC0_YEAST/195-327--------------------------------------------------------------------------------
OXC_OXAFO/203-333--------------------------------------------------------------------------------
ILVB_CORGL/216-351--------------------------------------------------------------------------------
ILVI_HAEIN/196-331--------------------------------------------------------------------------------
BZNB_PSEFL/194-329--------------------------------------------------------------------------------
ILVB_PORPU/206-341--------------------------------------------------------------------------------
P94896_OENOE/194-330--------------------------------------------------------------------------------
YDAP_BACSU/193-321--------------------------------------------------------------------------------
P97113_LEUMC/201-336--------------------------------------------------------------------------------
ILVB_LACLA/200-335--------------------------------------------------------------------------------
ARO10_YEAST/244-383--------------------------------------------------------------------------------
THI3_YEAST/212-344--------------------------------------------------------------------------------
PDC1_KLULA/201-333--------------------------------------------------------------------------------
Q17474_CAEEL/261-391--------------------------------------------------------------------------------
Q1LF51_RALME/275-402--------------------------------------------------------------------------------
Q1LM48_RALME/189-317--------------------------------------------------------------------------------
Q1M4I8_RHIL3/188-321--------------------------------------------------------------------------------
Q1M4Y3_RHIL3/204-337--------------------------------------------------------------------------------
Q1MJ71_RHIL3/230-364--------------------------------------------------------------------------------
Q1N3D1_9GAMM/189-317--------------------------------------------------------------------------------
Q1NYW7_9FLAO/195-332--------------------------------------------------------------------------------
Q1QAH7_PSYCK/229-362--------------------------------------------------------------------------------
Q1R058_CHRSD/190-323--------------------------------------------------------------------------------
Q1R095_CHRSD/207-342--------------------------------------------------------------------------------
B3XNI8_LACRE/195-331--------------------------------------------------------------------------------
B3XR89_LACRE/202-331--------------------------------------------------------------------------------
A5WFU4_PSYWF/155-291--------------------------------------------------------------------------------
A5WFU5_PSYWF/195-322--------------------------------------------------------------------------------
A5WDF4_PSYWF/210-343--------------------------------------------------------------------------------
Q1V0A8_PELUQ/195-332--------------------------------------------------------------------------------
Q1VVK9_9FLAO/210-345--------------------------------------------------------------------------------
Q1WVB6_LACS1/198-333--------------------------------------------------------------------------------
Q1WVR0_LACS1/195-324--------------------------------------------------------------------------------
A5D4V9_PELTS/192-327--------------------------------------------------------------------------------
Q1YIT6_MOBAS/207-341--------------------------------------------------------------------------------
Q1YIU4_MOBAS/196-334--------------------------------------------------------------------------------
Q1YKX8_MOBAS/228-407--------------------------------------------------------------------------------
Q1YX19_PHOPR/200-338--------------------------------------------------------------------------------
Q1ZKY9_PHOAS/187-322--------------------------------------------------------------------------------
Q1ZSM4_PHOAS/192-327--------------------------------------------------------------------------------
Q21SN9_RHOFD/191-324--------------------------------------------------------------------------------
Q21T72_RHOFD/229-365--------------------------------------------------------------------------------
Q21VK8_RHOFD/229-357--------------------------------------------------------------------------------
Q220C3_RHOFD/190-328--------------------------------------------------------------------------------
Q24UP5_DESHY/194-329--------------------------------------------------------------------------------
Q24XT7_DESHY/200-336--------------------------------------------------------------------------------
Q251L0_DESHY/193-331--------------------------------------------------------------------------------
Q252I7_DESHY/193-328--------------------------------------------------------------------------------
Q28KM5_JANSC/191-323--------------------------------------------------------------------------------
Q28SI9_JANSC/198-334--------------------------------------------------------------------------------
Q28W58_JANSC/189-326--------------------------------------------------------------------------------
B8CX18_HALOH/193-328--------------------------------------------------------------------------------
B8CWB0_HALOH/189-317--------------------------------------------------------------------------------
Q2CC29_9RHOB/189-327--------------------------------------------------------------------------------
A5G0X6_ACICJ/217-351--------------------------------------------------------------------------------
A5FTR0_ACICJ/189-317--------------------------------------------------------------------------------
A5G2E1_ACICJ/199-336--------------------------------------------------------------------------------
A5GC69_GEOUR/192-327--------------------------------------------------------------------------------
A5FR34_DEHSB/193-328--------------------------------------------------------------------------------
Q2F5Z5_BOMMO/217-346--------------------------------------------------------------------------------
Q2FM35_METHJ/193-328--------------------------------------------------------------------------------
Q2G625_NOVAD/195-332--------------------------------------------------------------------------------
Q2GMZ7_CHAGB/217-331--------------------------------------------------------------------------------
Q2IJB5_ANADE/195-330--------------------------------------------------------------------------------
Q2IPR2_ANADE/234-362--------------------------------------------------------------------------------
Q2J1F2_RHOP2/193-331--------------------------------------------------------------------------------
Q2J6V0_FRASC/199-334--------------------------------------------------------------------------------
Q2JZ22_RHIEC/196-321--------------------------------------------------------------------------------
Q2KTL4_BORA1/228-365--------------------------------------------------------------------------------
Q2LXN9_SYNAS/193-328--------------------------------------------------------------------------------
Q2LXP1_SYNAS/192-327--------------------------------------------------------------------------------
Q2NBF4_ERYLH/186-319--------------------------------------------------------------------------------
Q2NI91_METST/191-326--------------------------------------------------------------------------------
Q2P758_XANOM/197-332--------------------------------------------------------------------------------
Q2RG94_MOOTA/203-338--------------------------------------------------------------------------------
Q2RG96_MOOTA/197-332--------------------------------------------------------------------------------
Q2RXQ6_RHORT/213-351--------------------------------------------------------------------------------
Q2S0N1_SALRD/216-351--------------------------------------------------------------------------------
Q2S798_HAHCH/191-326--------------------------------------------------------------------------------
Q2SJ09_HAHCH/200-336--------------------------------------------------------------------------------
Q2SM62_HAHCH/214-350--------------------------------------------------------------------------------
Q2SMT8_HAHCH/219-352--------------------------------------------------------------------------------
Q2U768_ASPOR/207-343--------------------------------------------------------------------------------
Q2UC40_ASPOR/202-333--------------------------------------------------------------------------------
Q2W471_MAGSA/196-334--------------------------------------------------------------------------------
Q2WFA8_MONVA/223-356--------------------------------------------------------------------------------
A6LXD5_CLOB8/198-332--------------------------------------------------------------------------------
A6LPX7_CLOB8/192-326--------------------------------------------------------------------------------
A6LWS0_CLOB8/194-329--------------------------------------------------------------------------------
A6M227_CLOB8/219-353--------------------------------------------------------------------------------
A6LX01_CLOB8/191-328--------------------------------------------------------------------------------
A5W954_PSEP1/196-331--------------------------------------------------------------------------------
A5W0I1_PSEP1/200-336--------------------------------------------------------------------------------
A5W364_PSEP1/198-328--------------------------------------------------------------------------------
Q877U6_PSEPK/187-320--------------------------------------------------------------------------------
A5W220_PSEP1/196-326--------------------------------------------------------------------------------
Q2YKW9_BRUA2/216-350--------------------------------------------------------------------------------
A4XIL5_CALS8/194-328--------------------------------------------------------------------------------
A4XHS0_CALS8/191-326--------------------------------------------------------------------------------
Q30RG2_SULDN/193-328--------------------------------------------------------------------------------
Q30YW8_DESDG/192-323--------------------------------------------------------------------------------
Q31JM5_THICR/186-321--------------------------------------------------------------------------------
A5EDH4_BRASB/198-324--------------------------------------------------------------------------------
A5ECG1_BRASB/192-328--------------------------------------------------------------------------------
Q38UJ8_LACSS/196-325--------------------------------------------------------------------------------
Q39P46_BURS3/215-348--------------------------------------------------------------------------------
Q39W78_GEOMG/193-328--------------------------------------------------------------------------------
Q3AEQ6_CARHZ/192-327--------------------------------------------------------------------------------
Q3AEQ9_CARHZ/192-327--------------------------------------------------------------------------------
Q3ALE4_SYNSC/204-340--------------------------------------------------------------------------------
Q3ALP1_SYNSC/196-331--------------------------------------------------------------------------------
Q3AM88_SYNSC/188-321--------------------------------------------------------------------------------
A6TTL0_ALKMQ/192-327--------------------------------------------------------------------------------
A6TTM8_ALKMQ/204-339--------------------------------------------------------------------------------
B9LGM6_CHLSY/196-331--------------------------------------------------------------------------------
B9LHS5_CHLSY/482-610--------------------------------------------------------------------------------
A6VLE4_ACTSZ/188-323--------------------------------------------------------------------------------
Q3ICC9_PSEHT/198-333--------------------------------------------------------------------------------
Q3IS45_NATPD/201-338--------------------------------------------------------------------------------
Q3JBM9_NITOC/217-353--------------------------------------------------------------------------------
Q3K7P6_PSEPF/191-324--------------------------------------------------------------------------------
A3D4X6_SHEB5/190-319--------------------------------------------------------------------------------
Q3SL06_THIDA/197-334--------------------------------------------------------------------------------
Q3V892_DESVH/193-328--------------------------------------------------------------------------------
Q3V893_DESVH/192-327--------------------------------------------------------------------------------
A8L943_FRASN/191-326--------------------------------------------------------------------------------
A8L1M3_FRASN/194-330--------------------------------------------------------------------------------
Q3XZD0_ENTFC/193-322--------------------------------------------------------------------------------
Q3Y3Q3_ENTFC/220-354--------------------------------------------------------------------------------
Q3YZF7_SHISS/201-329--------------------------------------------------------------------------------
Q3Z3R2_SHISS/191-319--------------------------------------------------------------------------------
A6WFD0_KINRD/239-373--------------------------------------------------------------------------------
B1YKG0_EXIS2/201-337--------------------------------------------------------------------------------
Q46SP4_CUPPJ/228-365--------------------------------------------------------------------------------
Q46VA1_CUPPJ/202-331--------------------------------------------------------------------------------
Q471R9_CUPPJ/220-358--------------------------------------------------------------------------------
Q47FL3_DECAR/193-328--------------------------------------------------------------------------------
Q47SH6_THEFY/199-330--------------------------------------------------------------------------------
Q47UP0_COLP3/160-295--------------------------------------------------------------------------------
Q47YT4_COLP3/192-325--------------------------------------------------------------------------------
Q48634_9LACT/192-327--------------------------------------------------------------------------------
Q4A101_STAS1/192-327--------------------------------------------------------------------------------
Q4BWI9_CROWT/189-323--------------------------------------------------------------------------------
A3DIY4_CLOTH/192-327--------------------------------------------------------------------------------
A3DID9_CLOTH/192-327--------------------------------------------------------------------------------
Q4FTE7_PSYA2/199-331--------------------------------------------------------------------------------
B9KGF5_CAMLR/194-329--------------------------------------------------------------------------------
Q4J6N9_SULAC/197-320--------------------------------------------------------------------------------
Q4J7J3_SULAC/185-313--------------------------------------------------------------------------------
Q4J9P1_SULAC/191-326--------------------------------------------------------------------------------
Q4JAP2_SULAC/203-338--------------------------------------------------------------------------------
Q4JWD0_CORJK/191-318--------------------------------------------------------------------------------
Q4L7T7_STAHJ/225-360--------------------------------------------------------------------------------
Q4V070_XANC8/193-321--------------------------------------------------------------------------------
Q4Y789_PLACH/107-235--------------------------------------------------------------------------------
POXB_STRPN/196-327--------------------------------------------------------------------------------
Q5AMN8_CANAL/91-249--------------------------------------------------------------------------------
Q5AZE4_EMENI/765-897--------------------------------------------------------------------------------
Q5B535_EMENI/204-350--------------------------------------------------------------------------------
Q5FHQ7_LACAC/194-323--------------------------------------------------------------------------------
Q5FLY7_LACAC/198-327--------------------------------------------------------------------------------
Q5FRZ0_GLUOX/205-342--------------------------------------------------------------------------------
Q5L322_GEOKA/194-329--------------------------------------------------------------------------------
Q5LKS2_SILPO/192-328--------------------------------------------------------------------------------
Q5LLG2_SILPO/190-321--------------------------------------------------------------------------------
Q5LQV0_SILPO/199-335--------------------------------------------------------------------------------
Q5NEA3_FRATT/213-346--------------------------------------------------------------------------------
Q5NPP9_ZYMMO/193-327--------------------------------------------------------------------------------
Q5QZF0_IDILO/186-322--------------------------------------------------------------------------------
Q5R276_DROSE/193-322--------------------------------------------------------------------------------
Q5UWG1_HALMA/202-340--------------------------------------------------------------------------------
Q5V522_HALMA/213-348--------------------------------------------------------------------------------
Q5V5J6_HALMA/187-321--------------------------------------------------------------------------------
Q5WGG1_BACSK/191-329--------------------------------------------------------------------------------
Q5WW44_LEGPL/218-352--------------------------------------------------------------------------------
Q5YN72_NOCFA/213-347--------------------------------------------------------------------------------
Q60021_THEAQ/190-323--------------------------------------------------------------------------------
Q601Q2_MYCH2/220-353--------------------------------------------------------------------------------
Q62KX9_BURMA/246-379--------------------------------------------------------------------------------
IOLD1_BACCZ/219-353--------------------------------------------------------------------------------
Q64BR9_9ARCH/196-332--------------------------------------------------------------------------------
Q64PS7_BACFR/197-332--------------------------------------------------------------------------------
Q67KX7_SYMTH/192-328--------------------------------------------------------------------------------
Q6AAK5_PROAC/228-362--------------------------------------------------------------------------------
Q6AEP0_LEIXX/219-354--------------------------------------------------------------------------------
Q6AJI2_DESPS/239-374--------------------------------------------------------------------------------
Q6APX2_DESPS/190-328--------------------------------------------------------------------------------
Q6C6Q2_YARLI/193-323--------------------------------------------------------------------------------
Q6CDI5_YARLI/273-418--------------------------------------------------------------------------------
Q6DDN7_XENLA/202-331--------------------------------------------------------------------------------
Q6FDG8_ACIAD/195-324--------------------------------------------------------------------------------
Q6FJV6_CANGA/193-324--------------------------------------------------------------------------------
Q6FYB3_CANGA/251-392--------------------------------------------------------------------------------
Q6G6D5_STAAS/193-322--------------------------------------------------------------------------------
Q6HKA3_BACHK/204-339--------------------------------------------------------------------------------
Q6HLF6_BACHK/202-337--------------------------------------------------------------------------------
Q6L042_PICTO/193-329--------------------------------------------------------------------------------
Q6LK31_PHOPR/222-355--------------------------------------------------------------------------------
Q6LK45_PHOPR/220-354--------------------------------------------------------------------------------
Q6LZH8_METMP/193-328--------------------------------------------------------------------------------
Q6N2J6_RHOPA/202-339--------------------------------------------------------------------------------
Q6N2Y1_RHOPA/196-336--------------------------------------------------------------------------------
Q6N3D1_RHOPA/193-319--------------------------------------------------------------------------------
Q6N658_RHOPA/218-353--------------------------------------------------------------------------------
Q6NDJ7_RHOPA/202-334--------------------------------------------------------------------------------
Q6SGJ7_9BACT/200-328--------------------------------------------------------------------------------
Q6W1J3_RHISN/220-353--------------------------------------------------------------------------------
Q6ZUX2_HUMAN/198-327--------------------------------------------------------------------------------
Q70I04_9ACTO/185-318--------------------------------------------------------------------------------
Q72SH3_LEPIC/221-355--------------------------------------------------------------------------------
Q737X8_BACC1/202-334--------------------------------------------------------------------------------
Q738G9_BACC1/193-321--------------------------------------------------------------------------------
Q73CV8_BACC1/203-338--------------------------------------------------------------------------------
Q73TP3_MYCPA/147-281--------------------------------------------------------------------------------
Q73U45_MYCPA/225-354--------------------------------------------------------------------------------
Q74H96_LACJO/195-324--------------------------------------------------------------------------------
Q757R7_ASHGO/187-316--------------------------------------------------------------------------------
Q75PZ0_9BIFI/209-338--------------------------------------------------------------------------------
Q7CL03_YERPE/186-321--------------------------------------------------------------------------------
A2VGF0_MYCTU/208-339--------------------------------------------------------------------------------
Q7MAQ0_WOLSU/193-328--------------------------------------------------------------------------------
Q7N5X4_PHOLL/224-358--------------------------------------------------------------------------------
Q7NR95_CHRVO/168-305--------------------------------------------------------------------------------
Q7UHW9_RHOBA/234-369--------------------------------------------------------------------------------
Q7VXC3_BORPE/196-334--------------------------------------------------------------------------------
Q7VY25_BORPE/197-335--------------------------------------------------------------------------------
Q7WBZ5_BORPA/205-338--------------------------------------------------------------------------------
Q7WCV8_BORBR/218-357--------------------------------------------------------------------------------
Q7WHS2_BORBR/197-328--------------------------------------------------------------------------------
Q7WPE1_BORBR/198-327--------------------------------------------------------------------------------
Q7WQI4_BORBR/197-333--------------------------------------------------------------------------------
Q7WQJ5_BORBR/206-345--------------------------------------------------------------------------------
Q82CK4_STRAW/220-354--------------------------------------------------------------------------------
Q82CQ7_STRAW/217-348--------------------------------------------------------------------------------
Q82PG6_STRAW/190-319--------------------------------------------------------------------------------
Q83HI7_TROW8/197-332--------------------------------------------------------------------------------
Q845Z6_SELRU/190-325--------------------------------------------------------------------------------
ILVI_BUCBP/196-331--------------------------------------------------------------------------------
Q89E01_BRAJA/194-322--------------------------------------------------------------------------------
Q89QL7_BRAJA/184-317--------------------------------------------------------------------------------
Q8A6Q6_BACTN/191-319--------------------------------------------------------------------------------
Q8DR05_STRR6/200-335--------------------------------------------------------------------------------
Q8EL23_OCEIH/193-321--------------------------------------------------------------------------------
Q8ELJ0_OCEIH/199-338--------------------------------------------------------------------------------
Q8EN64_OCEIH/207-342--------------------------------------------------------------------------------
Q8FQJ5_COREF/209-339--------------------------------------------------------------------------------
Q8G7H0_BIFLO/221-356--------------------------------------------------------------------------------
Q8PUJ4_METMA/186-320--------------------------------------------------------------------------------
Q8RDJ8_THETN/191-326--------------------------------------------------------------------------------
Q8TT45_METAC/203-335--------------------------------------------------------------------------------
Q8U2A4_PYRFU/195-330--------------------------------------------------------------------------------
Q92DT2_LISIN/193-321--------------------------------------------------------------------------------
Q92NJ5_RHIME/187-325--------------------------------------------------------------------------------
Q92X67_RHIME/197-327--------------------------------------------------------------------------------
Q92XQ1_RHIME/191-335--------------------------------------------------------------------------------
Q92ZG6_RHIME/197-336--------------------------------------------------------------------------------
XSC_DESTI/194-332--------------------------------------------------------------------------------
Q971A7_SULTO/197-333--------------------------------------------------------------------------------
Q97EE4_CLOAB/189-324--------------------------------------------------------------------------------
Q97TS2_CLOAB/199-331--------------------------------------------------------------------------------
Q97UP3_SULSO/187-315--------------------------------------------------------------------------------
Q97XR3_SULSO/187-318--------------------------------------------------------------------------------
Q988P8_RHILO/199-338--------------------------------------------------------------------------------
Q98CV8_RHILO/243-377--------------------------------------------------------------------------------
Q9A8Q4_CAUCR/219-353--------------------------------------------------------------------------------
Q9CE06_LACLA/194-323--------------------------------------------------------------------------------
Q9F7L7_PRB01/188-323--------------------------------------------------------------------------------
Q9HJZ5_THEAC/187-315--------------------------------------------------------------------------------
Q9HK28_THEAC/167-303--------------------------------------------------------------------------------
Q9HKB0_THEAC/203-342--------------------------------------------------------------------------------
Q9HTQ7_PSEAE/190-318--------------------------------------------------------------------------------
Q9I207_PSEAE/198-328--------------------------------------------------------------------------------
Q9K659_BACHD/188-324--------------------------------------------------------------------------------
IOLD_BACHD/219-353--------------------------------------------------------------------------------
Q9L123_STRCO/189-324--------------------------------------------------------------------------------
PDC3_SCHPO/210-342--------------------------------------------------------------------------------
Q9WZ18_THEMA/197-332--------------------------------------------------------------------------------
YGK4_SCHPO/192-322--------------------------------------------------------------------------------
Q9ZBT3_STRCO/192-320--------------------------------------------------------------------------------
Q9ZIA9_LEULA/196-332--------------------------------------------------------------------------------

PF02233

NNTM_BOVIN/618-1080SGAMALGGTIGLTIAKRIQISDLPQLVAAFHSLVGLAAVLTCIAEYIIEYPHFATDAA...............ANLTKIV
PNTB_HAEIN/4-474IIAMIIGGAIGVQRALKVEMTEMPELVAILHSFVGLAAVLVGFNSYGLHHEALMPEGLDAAAQAAFVAEQAVLTNIHNVE
PNTB_SHIFL/4-462LLAMVIGGAIGIRLAKKVEMTEMPELVAILHSFVGLAAVLVGFNSY.LHHDAGMAP...............ILVNIHLTE
Q18031_CAEEL/573-1036GGSVAMGSLIGLGIANRIKVTDLPQLVAAFHSFVGLAATLTCLANFIQEHPHFLEDPS............N..AAAAKLA
Q24813_ENTHI/17-526LGFLIPAACIGIFIASRVEMVQMPQLVAGFHSFVGLAAVFVGIAHWLKDAEAYNNDHSKYTE.....ENQFSYLVMIGLE
P73500_SYNY3/4-464LGAILPAVVIGSLLASRVAMTSMPELVAILHSFVGLAAVLVGIANY.LAPENGLAG...............SEAFIHQIE
Q9ZE72_RICPR/4-462IITILVGGIIGGIIALKISMTAIPQLVACFHSFVGLAAVFVAYATILAPENFSIGISG.............NLPVNSLIE
PNTB_RHORU/4-463VLAIAIGGAIGTVIAKKVLMTALPQLVAAFHSLVGMAAVLVATGALLNPEAYGIGSAG.............AIHAGSLVE
P96834_MYCTU/5-472IAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIALSEFIDTTGFSAFQHG............ESPTVHIVVA
Q07600_EIMTE/3-459FATAAPALGLGLYIAQSVNMTEMPQLVALFHSFVGLAAVMVGFANFHS..PAGVERAS...............SLLRLLE

PF02146

SIR2_TRYB2/37-220--------------------------------------------------------------------------------
SIR2_LEIMA/39-223--------------------------------------------------------------------------------
SIR2_DROME/229-434--------------------------------------------------------------------------------
SIR2_CANAL/246-437--------------------------------------------------------------------------------
NPD_PYRHO/20-197--------------------------------------------------------------------------------
NPD_BACSU/19-198--------------------------------------------------------------------------------
NPD_STAA8/23-198--------------------------------------------------------------------------------
SIR2_CAEEL/153-334--------------------------------------------------------------------------------
NPD2_ARCFU/23-198--------------------------------------------------------------------------------
SIR42_CAEEL/35-243--------------------------------------------------------------------------------
SIR2_KLULA/318-534--------------------------------------------------------------------------------
NPD_MYCTU/8-184--------------------------------------------------------------------------------
SIR2_YEAST/262-478--------------------------------------------------------------------------------
E9YAJ6_ECOLX/48-221--------------------------------------------------------------------------------
SIR2_SCHPO/164-380--------------------------------------------------------------------------------
O94066_CANAX/26-208--------------------------------------------------------------------------------
NPD1_ARCFU/20-192--------------------------------------------------------------------------------
NPD_AQUAE/11-183--------------------------------------------------------------------------------
NPD_AGGAC/10-177--------------------------------------------------------------------------------
SIR41_CAEEL/35-243--------------------------------------------------------------------------------

PF13289

C3WEJ8_FUSMR/103-239--------------------------------------------------------------------------------
E0WKU6_LISGR/186-358--------------------------------------------------------------------------------
B8FFN4_DESAA/108-257--------------------------------------------------------------------------------
C2VLS5_BACCE/130-263--------------------------------------------------------------------------------
C7RFY6_ANAPD/212-382--------------------------------------------------------------------------------
C7RVA1_ACCPU/142-298--------------------------------------------------------------------------------
A1TX65_MARAV/101-247--------------------------------------------------------------------------------
C6JRB3_FUSVA/103-240--------------------------------------------------------------------------------
A6DRE2_9BACT/143-270--------------------------------------------------------------------------------
C6I4U2_9BACE/102-244--------------------------------------------------------------------------------
D1AZA4_SULD5/145-284--------------------------------------------------------------------------------
C3JCK6_9PORP/114-255--------------------------------------------------------------------------------
B8EJ27_METSB/100-273--------------------------------------------------------------------------------
B0NWG4_9CLOT/150-288--------------------------------------------------------------------------------
Q1BDR9_MYCSS/245-384--------------------------------------------------------------------------------
A9KVJ0_SHEB9/173-321--------------------------------------------------------------------------------
B7J5Y3_ACIF2/103-252--------------------------------------------------------------------------------
D2R627_PIRSD/146-286--------------------------------------------------------------------------------
Q6ALX8_DESPS/166-342--------------------------------------------------------------------------------
A6G3D2_9DELT/43-176--------------------------------------------------------------------------------
C6B833_RHILS/108-250--------------------------------------------------------------------------------
A0QRW8_MYCS2/295-432--------------------------------------------------------------------------------
C3WNE7_9FUSO/40-180--------------------------------------------------------------------------------
Q0YTA6_9CHLB/271-402--------------------------------------------------------------------------------
D4G637_BACNA/107-249--------------------------------------------------------------------------------
B3PHQ7_CELJU/121-268--------------------------------------------------------------------------------
B1IFA3_CLOBK/211-355--------------------------------------------------------------------------------
B2RK70_PORG3/130-279--------------------------------------------------------------------------------
E6TR41_BACCJ/246-381--------------------------------------------------------------------------------
A3IA13_9BACI/104-251--------------------------------------------------------------------------------
C7HAZ7_9FIRM/289-441--------------------------------------------------------------------------------
C4ZMZ3_THASP/323-497--------------------------------------------------------------------------------
B1GAX3_9BURK/115-258--------------------------------------------------------------------------------
Q1D4W8_MYXXD/1238-1377--------------------------------------------------------------------------------
B8I4A6_CLOCE/97-241--------------------------------------------------------------------------------
A0LH81_SYNFM/83-241--------------------------------------------------------------------------------
B0UD07_METS4/36-185--------------------------------------------------------------------------------
B3JQ32_9BACE/138-309--------------------------------------------------------------------------------
D2B798_STRRD/104-265--------------------------------------------------------------------------------
A7GBJ3_CLOBL/118-257--------------------------------------------------------------------------------
A9FD38_SORC5/122-271--------------------------------------------------------------------------------
C3HSI6_BACTU/106-242--------------------------------------------------------------------------------
C3J834_9PORP/142-278--------------------------------------------------------------------------------
D0LP08_HALO1/119-264--------------------------------------------------------------------------------
C2NSI3_BACCE/166-312--------------------------------------------------------------------------------
B5UXF8_BACCE/31-164--------------------------------------------------------------------------------
C1M7E6_9ENTR/499-661--------------------------------------------------------------------------------
Q21D17_RHOPB/114-255--------------------------------------------------------------------------------
A8SDW3_9FIRM/117-269--------------------------------------------------------------------------------
Q6DF29_XENTR/142-286--------------------------------------------------------------------------------
Q4QK39_HAEI8/178-326--------------------------------------------------------------------------------
A7K172_VIBSE/104-251--------------------------------------------------------------------------------
Q223H0_RHOFD/193-348--------------------------------------------------------------------------------
C8NLF5_COREF/112-260--------------------------------------------------------------------------------
A4N3X2_HAEIF/175-323--------------------------------------------------------------------------------
A6G812_9DELT/112-246--------------------------------------------------------------------------------
A4X0P5_RHOS5/105-260--------------------------------------------------------------------------------
A1SJK6_NOCSJ/125-273--------------------------------------------------------------------------------
A6STW5_JANMA/147-314--------------------------------------------------------------------------------
Q48B89_PSE14/9-154--------------------------------------------------------------------------------
Q2RM32_MOOTA/133-297--------------------------------------------------------------------------------
Q0W7V8_UNCMA/109-246--------------------------------------------------------------------------------
C6I9L2_9BACE/137-277--------------------------------------------------------------------------------
Q54CK8_DICDI/935-1078--------------------------------------------------------------------------------
B1MA98_METRJ/103-241--------------------------------------------------------------------------------
Q5V033_HALMA/150-286--------------------------------------------------------------------------------
B9Y0H1_HELPX/107-243--------------------------------------------------------------------------------
A5L0C3_9GAMM/214-366--------------------------------------------------------------------------------
C1ERC3_BACC3/124-262--------------------------------------------------------------------------------
C8X684_NAKMY/91-246--------------------------------------------------------------------------------
B2IE38_BEII9/105-265--------------------------------------------------------------------------------
A3YXQ6_9SYNE/63-205--------------------------------------------------------------------------------
F0QDG8_ACIAP/134-282--------------------------------------------------------------------------------
C1DSG4_AZOVD/112-256--------------------------------------------------------------------------------
C2LUJ2_STRSL/225-405--------------------------------------------------------------------------------
Q6MH60_BDEBA/224-370--------------------------------------------------------------------------------
A6G9A9_9DELT/1210-1344--------------------------------------------------------------------------------
D4KUN5_9FIRM/115-253--------------------------------------------------------------------------------
A7BSX6_9GAMM/390-563--------------------------------------------------------------------------------
A7ABF7_9PORP/141-280--------------------------------------------------------------------------------
A5MFE1_STRPN/104-240--------------------------------------------------------------------------------
A9GWR7_SORC5/128-261--------------------------------------------------------------------------------
C4L4F1_EXISA/106-243--------------------------------------------------------------------------------
C7X7Y0_9PORP/105-251--------------------------------------------------------------------------------
A8IIJ2_AZOC5/116-266--------------------------------------------------------------------------------
B7ITB3_BACC2/116-253--------------------------------------------------------------------------------
D1A4U2_THECD/106-274--------------------------------------------------------------------------------
A9G7D0_SORC5/160-352--------------------------------------------------------------------------------
D3F474_CONWI/122-259--------------------------------------------------------------------------------
E3IX96_FRASU/105-267--------------------------------------------------------------------------------
B0RMG9_XANCB/115-257--------------------------------------------------------------------------------
Q38324_9CAUD/146-291--------------------------------------------------------------------------------
B8K7Z1_VIBPA/98-239--------------------------------------------------------------------------------
A9G5J6_SORC5/116-251--------------------------------------------------------------------------------
B0VP62_ACIBS/101-247--------------------------------------------------------------------------------
C2T6L1_BACCE/106-260--------------------------------------------------------------------------------
A3NCJ6_BURP6/175-318--------------------------------------------------------------------------------
C5BPH6_TERTT/174-345--------------------------------------------------------------------------------
Q468D1_METBF/112-267--------------------------------------------------------------------------------
A9GGY2_SORC5/142-276--------------------------------------------------------------------------------
C7RS50_ACCPU/115-274--------------------------------------------------------------------------------
Q74DF6_GEOSL/136-280--------------------------------------------------------------------------------
D5SSN9_PLAL2/125-270--------------------------------------------------------------------------------
C2W2L4_BACCE/159-308--------------------------------------------------------------------------------
A9E6S3_9FLAO/103-241--------------------------------------------------------------------------------
C9XIG8_CLODC/103-255--------------------------------------------------------------------------------
A3ZR10_9PLAN/69-211--------------------------------------------------------------------------------
C5P7U6_COCP7/141-273--------------------------------------------------------------------------------
A9NH35_ACHLI/152-331--------------------------------------------------------------------------------
D2SD45_GEOOG/295-434--------------------------------------------------------------------------------
B6W7K6_9FIRM/106-236--------------------------------------------------------------------------------
Q5Y0K2_9ARCH/104-253--------------------------------------------------------------------------------
C4X9G7_KLEPN/110-254--------------------------------------------------------------------------------
D2SAI3_GEOOG/505-643--------------------------------------------------------------------------------
D3PB24_DEFDS/122-262--------------------------------------------------------------------------------
A8V433_9AQUI/117-295--------------------------------------------------------------------------------
B1IFA2_CLOBK/117-257--------------------------------------------------------------------------------
A4INT2_GEOTN/98-236--------------------------------------------------------------------------------
A6UN29_SINMW/117-268--------------------------------------------------------------------------------
Q7BQV0_9ENTR/132-298--------------------------------------------------------------------------------
A9KLI0_CLOPH/125-265--------------------------------------------------------------------------------
B4BSV3_9BACI/147-291--------------------------------------------------------------------------------
C1FU09_CLOBJ/116-249--------------------------------------------------------------------------------
A9G4K5_SORC5/114-247--------------------------------------------------------------------------------
A9GB97_SORC5/76-223--------------------------------------------------------------------------------
A6WPG0_SHEB8/65-208--------------------------------------------------------------------------------
Q3BK53_9PROT/118-263--------------------------------------------------------------------------------
Q2YAQ1_NITMU/270-428--------------------------------------------------------------------------------
A1BG00_CHLPD/160-328--------------------------------------------------------------------------------
D2KYA1_CORGT/132-278--------------------------------------------------------------------------------
D1PKF2_9FIRM/165-305--------------------------------------------------------------------------------
C4UA68_YERAL/102-244--------------------------------------------------------------------------------
D0GZ99_VIBMI/58-197--------------------------------------------------------------------------------
A4YZ71_BRASO/96-242--------------------------------------------------------------------------------
B1Q6E3_CLOBO/113-269--------------------------------------------------------------------------------
C0ZNB5_RHOE4/283-422--------------------------------------------------------------------------------
A6DXW7_9RHOB/85-232--------------------------------------------------------------------------------
C7VB26_ENTFL/149-285--------------------------------------------------------------------------------
C4UXP5_YERRO/145-292--------------------------------------------------------------------------------
A6GR96_9BURK/96-234--------------------------------------------------------------------------------
D0LGB9_HALO1/120-267--------------------------------------------------------------------------------
B5UXD5_BACCE/105-241--------------------------------------------------------------------------------
A6SWS4_JANMA/63-201--------------------------------------------------------------------------------
Q6NBK9_RHOPA/152-303--------------------------------------------------------------------------------
C6J830_9FIRM/113-258--------------------------------------------------------------------------------
D9SP56_CLOC7/120-256--------------------------------------------------------------------------------
D1RZ28_SEROD/104-261--------------------------------------------------------------------------------
Q12QQ9_SHEDO/90-229--------------------------------------------------------------------------------
E0TDM6_PARBH/151-296--------------------------------------------------------------------------------
Q1Q2W8_9BACT/165-308--------------------------------------------------------------------------------
D4B7J4_9ENTR/118-255--------------------------------------------------------------------------------
D2SB42_GEOOG/148-291--------------------------------------------------------------------------------
B7L3H7_METC4/126-276--------------------------------------------------------------------------------
B9JR52_AGRVS/164-337--------------------------------------------------------------------------------
A7VYZ2_9CLOT/121-240--------------------------------------------------------------------------------
C2ZYS5_BACCE/126-295--------------------------------------------------------------------------------
C0ZFK0_BREBN/117-254--------------------------------------------------------------------------------
C8PPW3_9SPIO/130-269--------------------------------------------------------------------------------
A1A364_BIFAA/140-287--------------------------------------------------------------------------------
A4CA56_9GAMM/100-236--------------------------------------------------------------------------------
D4J271_BUTFI/140-278--------------------------------------------------------------------------------
A1F0G4_VIBCL/160-327--------------------------------------------------------------------------------
B5WD67_9BURK/102-236--------------------------------------------------------------------------------
Q08QJ5_STIAD/174-316--------------------------------------------------------------------------------

PF00766

ETFA_THETC/205-290--------------------------------------------------------------------------------
Q7CSV6_AGRT5/187-273--------------------------------------------------------------------------------
FIXB_AZOC5/234-319--------------------------------------------------------------------------------
Q7RVY2_NEUCR/223-309--------------------------------------------------------------------------------
Q6AIQ0_DESPS/306-391--------------------------------------------------------------------------------
Q978W1_THEVO/215-300--------------------------------------------------------------------------------
FIXB_CLOSA/206-291--------------------------------------------------------------------------------
ETFA_CLOAB/210-295--------------------------------------------------------------------------------
Q83RF6_SHIFL/188-274--------------------------------------------------------------------------------
Q8NKM5_9CREN/280-377--------------------------------------------------------------------------------
Q83QD8_SHIFL/174-256--------------------------------------------------------------------------------
Q8KZQ0_BUTFI/219-304--------------------------------------------------------------------------------
Q7NG11_GLOVI/221-307--------------------------------------------------------------------------------
FIXB_RHISN/234-319--------------------------------------------------------------------------------
Q9Y966_AERPE/222-307--------------------------------------------------------------------------------
Q8RMW1_AZOBR/227-312--------------------------------------------------------------------------------
ETFA_YEAST/218-304--------------------------------------------------------------------------------
FIXB_SHIFL/189-275--------------------------------------------------------------------------------
Q9HL11_THEAC/441-526--------------------------------------------------------------------------------
FIXB_AZOVI/228-313--------------------------------------------------------------------------------
ETFA_ORYSJ/233-318--------------------------------------------------------------------------------
Q7MVI3_PORGI/207-292--------------------------------------------------------------------------------
Q9FA09_GLUDI/231-317--------------------------------------------------------------------------------
Q8FQ06_COREF/191-277--------------------------------------------------------------------------------
Q8XNM1_CLOPE/270-355--------------------------------------------------------------------------------
Q8ZYL5_PYRAE/218-303--------------------------------------------------------------------------------
ETFA_SCHPO/219-305--------------------------------------------------------------------------------
Q750K5_ASHGO/222-308--------------------------------------------------------------------------------
Q97G29_CLOAB/269-354--------------------------------------------------------------------------------
Q749E7_GEOSL/207-292--------------------------------------------------------------------------------
Q6US86_RHORU/233-318--------------------------------------------------------------------------------
ETFA_HUMAN/209-294--------------------------------------------------------------------------------
ETFA_MEGEL/208-295--------------------------------------------------------------------------------
Q9X1L7_THEMA/206-291--------------------------------------------------------------------------------
Q892L4_CLOTE/208-293--------------------------------------------------------------------------------
Q8D6Q4_VIBVU/200-285--------------------------------------------------------------------------------
Q896M7_CLOTE/271-356--------------------------------------------------------------------------------
Q897M1_CLOTE/208-293--------------------------------------------------------------------------------
Q8XI26_CLOPE/207-292--------------------------------------------------------------------------------

PF01916

DHYS_HUMAN/42-356--------------------------------------------------------------------------------
DHYS_YEAST/45-377--------------------------------------------------------------------------------
DHYS_METJA/25-330--------------------------------------------------------------------------------
DHYS_PYRHO/31-334--------------------------------------------------------------------------------
DHYS_NEUCR/43-348--------------------------------------------------------------------------------
DHYS1_ARCFU/14-296--------------------------------------------------------------------------------
DHYS_METTH/17-305--------------------------------------------------------------------------------

PF02552

ACDE2_ARCFU/2-172--------------------------------------------------------------------------------
ACDE_METTH/4-171--------------------------------------------------------------------------------
ACDE_METJA/4-144--------------------------------------------------------------------------------
O67557_AQUAE/619-788--------------------------------------------------------------------------------
ACDE1_ARCFU/7-181--------------------------------------------------------------------------------
O67252_AQUAE/19-183--------------------------------------------------------------------------------

PF00205

PDC2_SCHPO/205-338--------------------------------------------------------------------------------
Q4KDI6_PSEF5/219-353--------------------------------------------------------------------------------
Q4WM01_ASPFU/222-353--------------------------------------------------------------------------------
Q4WC96_ASPFU/248-378--------------------------------------------------------------------------------
Q4WW88_ASPFU/200-331--------------------------------------------------------------------------------
HACL_ARATH/206-334--------------------------------------------------------------------------------
ILVB_SPIPL/206-344--------------------------------------------------------------------------------
IOLD_BACSU/220-354--------------------------------------------------------------------------------
ILVX_BACSU/200-335--------------------------------------------------------------------------------
ILVBL_BOVIN/273-405--------------------------------------------------------------------------------
IOLD_LISMF/221-354--------------------------------------------------------------------------------
Q86ZI4_NEUCS/227-359--------------------------------------------------------------------------------
O07043_AZOBR/192-324--------------------------------------------------------------------------------
O22578_VOLCA/289-422--------------------------------------------------------------------------------
O26576_METTH/240-367--------------------------------------------------------------------------------
O28180_ARCFU/201-335--------------------------------------------------------------------------------
O28554_ARCFU/190-325--------------------------------------------------------------------------------
ILVBL_CAEEL/277-409--------------------------------------------------------------------------------
O66759_AQUAE/198-333--------------------------------------------------------------------------------
O68497_CLOAT/208-342--------------------------------------------------------------------------------
O87839_STRCO/200-327--------------------------------------------------------------------------------
PDC_ZYMMO/199-331--------------------------------------------------------------------------------
MDLC_PSEPU/190-325--------------------------------------------------------------------------------
DCIP_ENTCL/199-331--------------------------------------------------------------------------------
ILVB_KLEPN/197-331--------------------------------------------------------------------------------
PDC1_MAIZE/246-379--------------------------------------------------------------------------------
PDC_NEUCR/205-336--------------------------------------------------------------------------------
ILVB_SCHPO/285-430--------------------------------------------------------------------------------
POXB_LACPL/202-333--------------------------------------------------------------------------------
YEC0_YEAST/195-327--------------------------------------------------------------------------------
OXC_OXAFO/203-333--------------------------------------------------------------------------------
ILVB_CORGL/216-351--------------------------------------------------------------------------------
ILVI_HAEIN/196-331--------------------------------------------------------------------------------
BZNB_PSEFL/194-329--------------------------------------------------------------------------------
ILVB_PORPU/206-341--------------------------------------------------------------------------------
P94896_OENOE/194-330--------------------------------------------------------------------------------
YDAP_BACSU/193-321--------------------------------------------------------------------------------
P97113_LEUMC/201-336--------------------------------------------------------------------------------
ILVB_LACLA/200-335--------------------------------------------------------------------------------
ARO10_YEAST/244-383--------------------------------------------------------------------------------
THI3_YEAST/212-344--------------------------------------------------------------------------------
PDC1_KLULA/201-333--------------------------------------------------------------------------------
Q17474_CAEEL/261-391--------------------------------------------------------------------------------
Q1LF51_RALME/275-402--------------------------------------------------------------------------------
Q1LM48_RALME/189-317--------------------------------------------------------------------------------
Q1M4I8_RHIL3/188-321--------------------------------------------------------------------------------
Q1M4Y3_RHIL3/204-337--------------------------------------------------------------------------------
Q1MJ71_RHIL3/230-364--------------------------------------------------------------------------------
Q1N3D1_9GAMM/189-317--------------------------------------------------------------------------------
Q1NYW7_9FLAO/195-332--------------------------------------------------------------------------------
Q1QAH7_PSYCK/229-362--------------------------------------------------------------------------------
Q1R058_CHRSD/190-323--------------------------------------------------------------------------------
Q1R095_CHRSD/207-342--------------------------------------------------------------------------------
B3XNI8_LACRE/195-331--------------------------------------------------------------------------------
B3XR89_LACRE/202-331--------------------------------------------------------------------------------
A5WFU4_PSYWF/155-291--------------------------------------------------------------------------------
A5WFU5_PSYWF/195-322--------------------------------------------------------------------------------
A5WDF4_PSYWF/210-343--------------------------------------------------------------------------------
Q1V0A8_PELUQ/195-332--------------------------------------------------------------------------------
Q1VVK9_9FLAO/210-345--------------------------------------------------------------------------------
Q1WVB6_LACS1/198-333--------------------------------------------------------------------------------
Q1WVR0_LACS1/195-324--------------------------------------------------------------------------------
A5D4V9_PELTS/192-327--------------------------------------------------------------------------------
Q1YIT6_MOBAS/207-341--------------------------------------------------------------------------------
Q1YIU4_MOBAS/196-334--------------------------------------------------------------------------------
Q1YKX8_MOBAS/228-407--------------------------------------------------------------------------------
Q1YX19_PHOPR/200-338--------------------------------------------------------------------------------
Q1ZKY9_PHOAS/187-322--------------------------------------------------------------------------------
Q1ZSM4_PHOAS/192-327--------------------------------------------------------------------------------
Q21SN9_RHOFD/191-324--------------------------------------------------------------------------------
Q21T72_RHOFD/229-365--------------------------------------------------------------------------------
Q21VK8_RHOFD/229-357--------------------------------------------------------------------------------
Q220C3_RHOFD/190-328--------------------------------------------------------------------------------
Q24UP5_DESHY/194-329--------------------------------------------------------------------------------
Q24XT7_DESHY/200-336--------------------------------------------------------------------------------
Q251L0_DESHY/193-331--------------------------------------------------------------------------------
Q252I7_DESHY/193-328--------------------------------------------------------------------------------
Q28KM5_JANSC/191-323--------------------------------------------------------------------------------
Q28SI9_JANSC/198-334--------------------------------------------------------------------------------
Q28W58_JANSC/189-326--------------------------------------------------------------------------------
B8CX18_HALOH/193-328--------------------------------------------------------------------------------
B8CWB0_HALOH/189-317--------------------------------------------------------------------------------
Q2CC29_9RHOB/189-327--------------------------------------------------------------------------------
A5G0X6_ACICJ/217-351--------------------------------------------------------------------------------
A5FTR0_ACICJ/189-317--------------------------------------------------------------------------------
A5G2E1_ACICJ/199-336--------------------------------------------------------------------------------
A5GC69_GEOUR/192-327--------------------------------------------------------------------------------
A5FR34_DEHSB/193-328--------------------------------------------------------------------------------
Q2F5Z5_BOMMO/217-346--------------------------------------------------------------------------------
Q2FM35_METHJ/193-328--------------------------------------------------------------------------------
Q2G625_NOVAD/195-332--------------------------------------------------------------------------------
Q2GMZ7_CHAGB/217-331--------------------------------------------------------------------------------
Q2IJB5_ANADE/195-330--------------------------------------------------------------------------------
Q2IPR2_ANADE/234-362--------------------------------------------------------------------------------
Q2J1F2_RHOP2/193-331--------------------------------------------------------------------------------
Q2J6V0_FRASC/199-334--------------------------------------------------------------------------------
Q2JZ22_RHIEC/196-321--------------------------------------------------------------------------------
Q2KTL4_BORA1/228-365--------------------------------------------------------------------------------
Q2LXN9_SYNAS/193-328--------------------------------------------------------------------------------
Q2LXP1_SYNAS/192-327--------------------------------------------------------------------------------
Q2NBF4_ERYLH/186-319--------------------------------------------------------------------------------
Q2NI91_METST/191-326--------------------------------------------------------------------------------
Q2P758_XANOM/197-332--------------------------------------------------------------------------------
Q2RG94_MOOTA/203-338--------------------------------------------------------------------------------
Q2RG96_MOOTA/197-332--------------------------------------------------------------------------------
Q2RXQ6_RHORT/213-351--------------------------------------------------------------------------------
Q2S0N1_SALRD/216-351--------------------------------------------------------------------------------
Q2S798_HAHCH/191-326--------------------------------------------------------------------------------
Q2SJ09_HAHCH/200-336--------------------------------------------------------------------------------
Q2SM62_HAHCH/214-350--------------------------------------------------------------------------------
Q2SMT8_HAHCH/219-352--------------------------------------------------------------------------------
Q2U768_ASPOR/207-343--------------------------------------------------------------------------------
Q2UC40_ASPOR/202-333--------------------------------------------------------------------------------
Q2W471_MAGSA/196-334--------------------------------------------------------------------------------
Q2WFA8_MONVA/223-356--------------------------------------------------------------------------------
A6LXD5_CLOB8/198-332--------------------------------------------------------------------------------
A6LPX7_CLOB8/192-326--------------------------------------------------------------------------------
A6LWS0_CLOB8/194-329--------------------------------------------------------------------------------
A6M227_CLOB8/219-353--------------------------------------------------------------------------------
A6LX01_CLOB8/191-328--------------------------------------------------------------------------------
A5W954_PSEP1/196-331--------------------------------------------------------------------------------
A5W0I1_PSEP1/200-336--------------------------------------------------------------------------------
A5W364_PSEP1/198-328--------------------------------------------------------------------------------
Q877U6_PSEPK/187-320--------------------------------------------------------------------------------
A5W220_PSEP1/196-326--------------------------------------------------------------------------------
Q2YKW9_BRUA2/216-350--------------------------------------------------------------------------------
A4XIL5_CALS8/194-328--------------------------------------------------------------------------------
A4XHS0_CALS8/191-326--------------------------------------------------------------------------------
Q30RG2_SULDN/193-328--------------------------------------------------------------------------------
Q30YW8_DESDG/192-323--------------------------------------------------------------------------------
Q31JM5_THICR/186-321--------------------------------------------------------------------------------
A5EDH4_BRASB/198-324--------------------------------------------------------------------------------
A5ECG1_BRASB/192-328--------------------------------------------------------------------------------
Q38UJ8_LACSS/196-325--------------------------------------------------------------------------------
Q39P46_BURS3/215-348--------------------------------------------------------------------------------
Q39W78_GEOMG/193-328--------------------------------------------------------------------------------
Q3AEQ6_CARHZ/192-327--------------------------------------------------------------------------------
Q3AEQ9_CARHZ/192-327--------------------------------------------------------------------------------
Q3ALE4_SYNSC/204-340--------------------------------------------------------------------------------
Q3ALP1_SYNSC/196-331--------------------------------------------------------------------------------
Q3AM88_SYNSC/188-321--------------------------------------------------------------------------------
A6TTL0_ALKMQ/192-327--------------------------------------------------------------------------------
A6TTM8_ALKMQ/204-339--------------------------------------------------------------------------------
B9LGM6_CHLSY/196-331--------------------------------------------------------------------------------
B9LHS5_CHLSY/482-610--------------------------------------------------------------------------------
A6VLE4_ACTSZ/188-323--------------------------------------------------------------------------------
Q3ICC9_PSEHT/198-333--------------------------------------------------------------------------------
Q3IS45_NATPD/201-338--------------------------------------------------------------------------------
Q3JBM9_NITOC/217-353--------------------------------------------------------------------------------
Q3K7P6_PSEPF/191-324--------------------------------------------------------------------------------
A3D4X6_SHEB5/190-319--------------------------------------------------------------------------------
Q3SL06_THIDA/197-334--------------------------------------------------------------------------------
Q3V892_DESVH/193-328--------------------------------------------------------------------------------
Q3V893_DESVH/192-327--------------------------------------------------------------------------------
A8L943_FRASN/191-326--------------------------------------------------------------------------------
A8L1M3_FRASN/194-330--------------------------------------------------------------------------------
Q3XZD0_ENTFC/193-322--------------------------------------------------------------------------------
Q3Y3Q3_ENTFC/220-354--------------------------------------------------------------------------------
Q3YZF7_SHISS/201-329--------------------------------------------------------------------------------
Q3Z3R2_SHISS/191-319--------------------------------------------------------------------------------
A6WFD0_KINRD/239-373--------------------------------------------------------------------------------
B1YKG0_EXIS2/201-337--------------------------------------------------------------------------------
Q46SP4_CUPPJ/228-365--------------------------------------------------------------------------------
Q46VA1_CUPPJ/202-331--------------------------------------------------------------------------------
Q471R9_CUPPJ/220-358--------------------------------------------------------------------------------
Q47FL3_DECAR/193-328--------------------------------------------------------------------------------
Q47SH6_THEFY/199-330--------------------------------------------------------------------------------
Q47UP0_COLP3/160-295--------------------------------------------------------------------------------
Q47YT4_COLP3/192-325--------------------------------------------------------------------------------
Q48634_9LACT/192-327--------------------------------------------------------------------------------
Q4A101_STAS1/192-327--------------------------------------------------------------------------------
Q4BWI9_CROWT/189-323--------------------------------------------------------------------------------
A3DIY4_CLOTH/192-327--------------------------------------------------------------------------------
A3DID9_CLOTH/192-327--------------------------------------------------------------------------------
Q4FTE7_PSYA2/199-331--------------------------------------------------------------------------------
B9KGF5_CAMLR/194-329--------------------------------------------------------------------------------
Q4J6N9_SULAC/197-320--------------------------------------------------------------------------------
Q4J7J3_SULAC/185-313--------------------------------------------------------------------------------
Q4J9P1_SULAC/191-326--------------------------------------------------------------------------------
Q4JAP2_SULAC/203-338--------------------------------------------------------------------------------
Q4JWD0_CORJK/191-318--------------------------------------------------------------------------------
Q4L7T7_STAHJ/225-360--------------------------------------------------------------------------------
Q4V070_XANC8/193-321--------------------------------------------------------------------------------
Q4Y789_PLACH/107-235--------------------------------------------------------------------------------
POXB_STRPN/196-327--------------------------------------------------------------------------------
Q5AMN8_CANAL/91-249--------------------------------------------------------------------------------
Q5AZE4_EMENI/765-897--------------------------------------------------------------------------------
Q5B535_EMENI/204-350--------------------------------------------------------------------------------
Q5FHQ7_LACAC/194-323--------------------------------------------------------------------------------
Q5FLY7_LACAC/198-327--------------------------------------------------------------------------------
Q5FRZ0_GLUOX/205-342--------------------------------------------------------------------------------
Q5L322_GEOKA/194-329--------------------------------------------------------------------------------
Q5LKS2_SILPO/192-328--------------------------------------------------------------------------------
Q5LLG2_SILPO/190-321--------------------------------------------------------------------------------
Q5LQV0_SILPO/199-335--------------------------------------------------------------------------------
Q5NEA3_FRATT/213-346--------------------------------------------------------------------------------
Q5NPP9_ZYMMO/193-327--------------------------------------------------------------------------------
Q5QZF0_IDILO/186-322--------------------------------------------------------------------------------
Q5R276_DROSE/193-322--------------------------------------------------------------------------------
Q5UWG1_HALMA/202-340--------------------------------------------------------------------------------
Q5V522_HALMA/213-348--------------------------------------------------------------------------------
Q5V5J6_HALMA/187-321--------------------------------------------------------------------------------
Q5WGG1_BACSK/191-329--------------------------------------------------------------------------------
Q5WW44_LEGPL/218-352--------------------------------------------------------------------------------
Q5YN72_NOCFA/213-347--------------------------------------------------------------------------------
Q60021_THEAQ/190-323--------------------------------------------------------------------------------
Q601Q2_MYCH2/220-353--------------------------------------------------------------------------------
Q62KX9_BURMA/246-379--------------------------------------------------------------------------------
IOLD1_BACCZ/219-353--------------------------------------------------------------------------------
Q64BR9_9ARCH/196-332--------------------------------------------------------------------------------
Q64PS7_BACFR/197-332--------------------------------------------------------------------------------
Q67KX7_SYMTH/192-328--------------------------------------------------------------------------------
Q6AAK5_PROAC/228-362--------------------------------------------------------------------------------
Q6AEP0_LEIXX/219-354--------------------------------------------------------------------------------
Q6AJI2_DESPS/239-374--------------------------------------------------------------------------------
Q6APX2_DESPS/190-328--------------------------------------------------------------------------------
Q6C6Q2_YARLI/193-323--------------------------------------------------------------------------------
Q6CDI5_YARLI/273-418--------------------------------------------------------------------------------
Q6DDN7_XENLA/202-331--------------------------------------------------------------------------------
Q6FDG8_ACIAD/195-324--------------------------------------------------------------------------------
Q6FJV6_CANGA/193-324--------------------------------------------------------------------------------
Q6FYB3_CANGA/251-392--------------------------------------------------------------------------------
Q6G6D5_STAAS/193-322--------------------------------------------------------------------------------
Q6HKA3_BACHK/204-339--------------------------------------------------------------------------------
Q6HLF6_BACHK/202-337--------------------------------------------------------------------------------
Q6L042_PICTO/193-329--------------------------------------------------------------------------------
Q6LK31_PHOPR/222-355--------------------------------------------------------------------------------
Q6LK45_PHOPR/220-354--------------------------------------------------------------------------------
Q6LZH8_METMP/193-328--------------------------------------------------------------------------------
Q6N2J6_RHOPA/202-339--------------------------------------------------------------------------------
Q6N2Y1_RHOPA/196-336--------------------------------------------------------------------------------
Q6N3D1_RHOPA/193-319--------------------------------------------------------------------------------
Q6N658_RHOPA/218-353--------------------------------------------------------------------------------
Q6NDJ7_RHOPA/202-334--------------------------------------------------------------------------------
Q6SGJ7_9BACT/200-328--------------------------------------------------------------------------------
Q6W1J3_RHISN/220-353--------------------------------------------------------------------------------
Q6ZUX2_HUMAN/198-327--------------------------------------------------------------------------------
Q70I04_9ACTO/185-318--------------------------------------------------------------------------------
Q72SH3_LEPIC/221-355--------------------------------------------------------------------------------
Q737X8_BACC1/202-334--------------------------------------------------------------------------------
Q738G9_BACC1/193-321--------------------------------------------------------------------------------
Q73CV8_BACC1/203-338--------------------------------------------------------------------------------
Q73TP3_MYCPA/147-281--------------------------------------------------------------------------------
Q73U45_MYCPA/225-354--------------------------------------------------------------------------------
Q74H96_LACJO/195-324--------------------------------------------------------------------------------
Q757R7_ASHGO/187-316--------------------------------------------------------------------------------
Q75PZ0_9BIFI/209-338--------------------------------------------------------------------------------
Q7CL03_YERPE/186-321--------------------------------------------------------------------------------
A2VGF0_MYCTU/208-339--------------------------------------------------------------------------------
Q7MAQ0_WOLSU/193-328--------------------------------------------------------------------------------
Q7N5X4_PHOLL/224-358--------------------------------------------------------------------------------
Q7NR95_CHRVO/168-305--------------------------------------------------------------------------------
Q7UHW9_RHOBA/234-369--------------------------------------------------------------------------------
Q7VXC3_BORPE/196-334--------------------------------------------------------------------------------
Q7VY25_BORPE/197-335--------------------------------------------------------------------------------
Q7WBZ5_BORPA/205-338--------------------------------------------------------------------------------
Q7WCV8_BORBR/218-357--------------------------------------------------------------------------------
Q7WHS2_BORBR/197-328--------------------------------------------------------------------------------
Q7WPE1_BORBR/198-327--------------------------------------------------------------------------------
Q7WQI4_BORBR/197-333--------------------------------------------------------------------------------
Q7WQJ5_BORBR/206-345--------------------------------------------------------------------------------
Q82CK4_STRAW/220-354--------------------------------------------------------------------------------
Q82CQ7_STRAW/217-348--------------------------------------------------------------------------------
Q82PG6_STRAW/190-319--------------------------------------------------------------------------------
Q83HI7_TROW8/197-332--------------------------------------------------------------------------------
Q845Z6_SELRU/190-325--------------------------------------------------------------------------------
ILVI_BUCBP/196-331--------------------------------------------------------------------------------
Q89E01_BRAJA/194-322--------------------------------------------------------------------------------
Q89QL7_BRAJA/184-317--------------------------------------------------------------------------------
Q8A6Q6_BACTN/191-319--------------------------------------------------------------------------------
Q8DR05_STRR6/200-335--------------------------------------------------------------------------------
Q8EL23_OCEIH/193-321--------------------------------------------------------------------------------
Q8ELJ0_OCEIH/199-338--------------------------------------------------------------------------------
Q8EN64_OCEIH/207-342--------------------------------------------------------------------------------
Q8FQJ5_COREF/209-339--------------------------------------------------------------------------------
Q8G7H0_BIFLO/221-356--------------------------------------------------------------------------------
Q8PUJ4_METMA/186-320--------------------------------------------------------------------------------
Q8RDJ8_THETN/191-326--------------------------------------------------------------------------------
Q8TT45_METAC/203-335--------------------------------------------------------------------------------
Q8U2A4_PYRFU/195-330--------------------------------------------------------------------------------
Q92DT2_LISIN/193-321--------------------------------------------------------------------------------
Q92NJ5_RHIME/187-325--------------------------------------------------------------------------------
Q92X67_RHIME/197-327--------------------------------------------------------------------------------
Q92XQ1_RHIME/191-335--------------------------------------------------------------------------------
Q92ZG6_RHIME/197-336--------------------------------------------------------------------------------
XSC_DESTI/194-332--------------------------------------------------------------------------------
Q971A7_SULTO/197-333--------------------------------------------------------------------------------
Q97EE4_CLOAB/189-324--------------------------------------------------------------------------------
Q97TS2_CLOAB/199-331--------------------------------------------------------------------------------
Q97UP3_SULSO/187-315--------------------------------------------------------------------------------
Q97XR3_SULSO/187-318--------------------------------------------------------------------------------
Q988P8_RHILO/199-338--------------------------------------------------------------------------------
Q98CV8_RHILO/243-377--------------------------------------------------------------------------------
Q9A8Q4_CAUCR/219-353--------------------------------------------------------------------------------
Q9CE06_LACLA/194-323--------------------------------------------------------------------------------
Q9F7L7_PRB01/188-323--------------------------------------------------------------------------------
Q9HJZ5_THEAC/187-315--------------------------------------------------------------------------------
Q9HK28_THEAC/167-303--------------------------------------------------------------------------------
Q9HKB0_THEAC/203-342--------------------------------------------------------------------------------
Q9HTQ7_PSEAE/190-318--------------------------------------------------------------------------------
Q9I207_PSEAE/198-328--------------------------------------------------------------------------------
Q9K659_BACHD/188-324--------------------------------------------------------------------------------
IOLD_BACHD/219-353--------------------------------------------------------------------------------
Q9L123_STRCO/189-324--------------------------------------------------------------------------------
PDC3_SCHPO/210-342--------------------------------------------------------------------------------
Q9WZ18_THEMA/197-332--------------------------------------------------------------------------------
YGK4_SCHPO/192-322--------------------------------------------------------------------------------
Q9ZBT3_STRCO/192-320--------------------------------------------------------------------------------
Q9ZIA9_LEULA/196-332--------------------------------------------------------------------------------

PF02233

NNTM_BOVIN/618-1080AYLGTYIGGVTFSGSLVAYGKLQGILKSAPLLLPG..RHLLNAGLLAGSVGGIIPFMMDPSFTTGITCLGSVS.......
PNTB_HAEIN/4-474VFLGIFIGAVTFTGSVVAFGKLSGKINSKALMLPH..RHKLNLAALVVSALLMVAFLNNPES...IFPVLLMT.......
PNTB_SHIFL/4-462VFLGIFIGAVTFTGSVVAFGKLCGKISSKPLMLPN..RHKMNLAALVVSFLLLIVFVRTDSVGLQVLALLIMT.......
Q18031_CAEEL/573-1036LFLGTYIGGVTFTGSLMAYGKLQGILASAPTYLPA..RHVLNGALLAGNVGALGTYMYSTDFGTGMSMLGG..T......
Q24813_ENTHI/17-526TVLGIFIGGMTFTGSIVAFGKLQGIIRSKPLIIGGNFRHVLNAGLVIFGCLLCIPYIIFEYLTLNDSTLISNLETYSVYI
P73500_SYNY3/4-464IYVGVFIGAVTFTGSIVAFGKLRAIISSKPLMLPA..RHFLNISLLVATVIFGVQFMQLNSPAG.LTPLLIMT.......
Q9ZE72_RICPR/4-462ISIGVSIGALTFSGSIVAFLKLQGLMKSNTFKFYG..QQYICLFTAIILVIIVVAFIRSENIFLFNLIVLL.........
PNTB_RHORU/4-463MSLGLAVGAITFSGSVIAFGKLQGLIAGKPVTFPM..QHPLNAVLGILLVVLLVVFAATESHTAYFALMIL.........
P96834_MYCTU/5-472SLFAAIIGSISFWGSIVAFGKLQEIISGRPIGLGK.AQQPINLLLLAVAVAAAVVIGLHAHPGSGGVALWWMIG......
Q07600_EIMTE/3-459VYAGVFVAGITFTGSVVAAAKLHGSMESRSLRVPG..RHALNTATIAAIGVLGALFCVSSGHFTRMLCLYVN........

PF02146

SIR2_TRYB2/37-220--------------------------------------------------------------------------------
SIR2_LEIMA/39-223--------------------------------------------------------------------------------
SIR2_DROME/229-434--------------------------------------------------------------------------------
SIR2_CANAL/246-437--------------------------------------------------------------------------------
NPD_PYRHO/20-197--------------------------------------------------------------------------------
NPD_BACSU/19-198--------------------------------------------------------------------------------
NPD_STAA8/23-198--------------------------------------------------------------------------------
SIR2_CAEEL/153-334--------------------------------------------------------------------------------
NPD2_ARCFU/23-198--------------------------------------------------------------------------------
SIR42_CAEEL/35-243--------------------------------------------------------------------------------
SIR2_KLULA/318-534--------------------------------------------------------------------------------
NPD_MYCTU/8-184--------------------------------------------------------------------------------
SIR2_YEAST/262-478--------------------------------------------------------------------------------
E9YAJ6_ECOLX/48-221--------------------------------------------------------------------------------
SIR2_SCHPO/164-380--------------------------------------------------------------------------------
O94066_CANAX/26-208--------------------------------------------------------------------------------
NPD1_ARCFU/20-192--------------------------------------------------------------------------------
NPD_AQUAE/11-183--------------------------------------------------------------------------------
NPD_AGGAC/10-177--------------------------------------------------------------------------------
SIR41_CAEEL/35-243--------------------------------------------------------------------------------

PF13289

C3WEJ8_FUSMR/103-239--------------------------------------------------------------------------------
E0WKU6_LISGR/186-358--------------------------------------------------------------------------------
B8FFN4_DESAA/108-257--------------------------------------------------------------------------------
C2VLS5_BACCE/130-263--------------------------------------------------------------------------------
C7RFY6_ANAPD/212-382--------------------------------------------------------------------------------
C7RVA1_ACCPU/142-298--------------------------------------------------------------------------------
A1TX65_MARAV/101-247--------------------------------------------------------------------------------
C6JRB3_FUSVA/103-240--------------------------------------------------------------------------------
A6DRE2_9BACT/143-270--------------------------------------------------------------------------------
C6I4U2_9BACE/102-244--------------------------------------------------------------------------------
D1AZA4_SULD5/145-284--------------------------------------------------------------------------------
C3JCK6_9PORP/114-255--------------------------------------------------------------------------------
B8EJ27_METSB/100-273--------------------------------------------------------------------------------
B0NWG4_9CLOT/150-288--------------------------------------------------------------------------------
Q1BDR9_MYCSS/245-384--------------------------------------------------------------------------------
A9KVJ0_SHEB9/173-321--------------------------------------------------------------------------------
B7J5Y3_ACIF2/103-252--------------------------------------------------------------------------------
D2R627_PIRSD/146-286--------------------------------------------------------------------------------
Q6ALX8_DESPS/166-342--------------------------------------------------------------------------------
A6G3D2_9DELT/43-176--------------------------------------------------------------------------------
C6B833_RHILS/108-250--------------------------------------------------------------------------------
A0QRW8_MYCS2/295-432--------------------------------------------------------------------------------
C3WNE7_9FUSO/40-180--------------------------------------------------------------------------------
Q0YTA6_9CHLB/271-402--------------------------------------------------------------------------------
D4G637_BACNA/107-249--------------------------------------------------------------------------------
B3PHQ7_CELJU/121-268--------------------------------------------------------------------------------
B1IFA3_CLOBK/211-355--------------------------------------------------------------------------------
B2RK70_PORG3/130-279--------------------------------------------------------------------------------
E6TR41_BACCJ/246-381--------------------------------------------------------------------------------
A3IA13_9BACI/104-251--------------------------------------------------------------------------------
C7HAZ7_9FIRM/289-441--------------------------------------------------------------------------------
C4ZMZ3_THASP/323-497--------------------------------------------------------------------------------
B1GAX3_9BURK/115-258--------------------------------------------------------------------------------
Q1D4W8_MYXXD/1238-1377--------------------------------------------------------------------------------
B8I4A6_CLOCE/97-241--------------------------------------------------------------------------------
A0LH81_SYNFM/83-241--------------------------------------------------------------------------------
B0UD07_METS4/36-185--------------------------------------------------------------------------------
B3JQ32_9BACE/138-309--------------------------------------------------------------------------------
D2B798_STRRD/104-265--------------------------------------------------------------------------------
A7GBJ3_CLOBL/118-257--------------------------------------------------------------------------------
A9FD38_SORC5/122-271--------------------------------------------------------------------------------
C3HSI6_BACTU/106-242--------------------------------------------------------------------------------
C3J834_9PORP/142-278--------------------------------------------------------------------------------
D0LP08_HALO1/119-264--------------------------------------------------------------------------------
C2NSI3_BACCE/166-312--------------------------------------------------------------------------------
B5UXF8_BACCE/31-164--------------------------------------------------------------------------------
C1M7E6_9ENTR/499-661--------------------------------------------------------------------------------
Q21D17_RHOPB/114-255--------------------------------------------------------------------------------
A8SDW3_9FIRM/117-269--------------------------------------------------------------------------------
Q6DF29_XENTR/142-286--------------------------------------------------------------------------------
Q4QK39_HAEI8/178-326--------------------------------------------------------------------------------
A7K172_VIBSE/104-251--------------------------------------------------------------------------------
Q223H0_RHOFD/193-348--------------------------------------------------------------------------------
C8NLF5_COREF/112-260--------------------------------------------------------------------------------
A4N3X2_HAEIF/175-323--------------------------------------------------------------------------------
A6G812_9DELT/112-246--------------------------------------------------------------------------------
A4X0P5_RHOS5/105-260--------------------------------------------------------------------------------
A1SJK6_NOCSJ/125-273--------------------------------------------------------------------------------
A6STW5_JANMA/147-314--------------------------------------------------------------------------------
Q48B89_PSE14/9-154--------------------------------------------------------------------------------
Q2RM32_MOOTA/133-297--------------------------------------------------------------------------------
Q0W7V8_UNCMA/109-246--------------------------------------------------------------------------------
C6I9L2_9BACE/137-277--------------------------------------------------------------------------------
Q54CK8_DICDI/935-1078--------------------------------------------------------------------------------
B1MA98_METRJ/103-241--------------------------------------------------------------------------------
Q5V033_HALMA/150-286--------------------------------------------------------------------------------
B9Y0H1_HELPX/107-243--------------------------------------------------------------------------------
A5L0C3_9GAMM/214-366--------------------------------------------------------------------------------
C1ERC3_BACC3/124-262--------------------------------------------------------------------------------
C8X684_NAKMY/91-246--------------------------------------------------------------------------------
B2IE38_BEII9/105-265--------------------------------------------------------------------------------
A3YXQ6_9SYNE/63-205--------------------------------------------------------------------------------
F0QDG8_ACIAP/134-282--------------------------------------------------------------------------------
C1DSG4_AZOVD/112-256--------------------------------------------------------------------------------
C2LUJ2_STRSL/225-405--------------------------------------------------------------------------------
Q6MH60_BDEBA/224-370--------------------------------------------------------------------------------
A6G9A9_9DELT/1210-1344--------------------------------------------------------------------------------
D4KUN5_9FIRM/115-253--------------------------------------------------------------------------------
A7BSX6_9GAMM/390-563--------------------------------------------------------------------------------
A7ABF7_9PORP/141-280--------------------------------------------------------------------------------
A5MFE1_STRPN/104-240--------------------------------------------------------------------------------
A9GWR7_SORC5/128-261--------------------------------------------------------------------------------
C4L4F1_EXISA/106-243--------------------------------------------------------------------------------
C7X7Y0_9PORP/105-251--------------------------------------------------------------------------------
A8IIJ2_AZOC5/116-266--------------------------------------------------------------------------------
B7ITB3_BACC2/116-253--------------------------------------------------------------------------------
D1A4U2_THECD/106-274--------------------------------------------------------------------------------
A9G7D0_SORC5/160-352--------------------------------------------------------------------------------
D3F474_CONWI/122-259--------------------------------------------------------------------------------
E3IX96_FRASU/105-267--------------------------------------------------------------------------------
B0RMG9_XANCB/115-257--------------------------------------------------------------------------------
Q38324_9CAUD/146-291--------------------------------------------------------------------------------
B8K7Z1_VIBPA/98-239--------------------------------------------------------------------------------
A9G5J6_SORC5/116-251--------------------------------------------------------------------------------
B0VP62_ACIBS/101-247--------------------------------------------------------------------------------
C2T6L1_BACCE/106-260--------------------------------------------------------------------------------
A3NCJ6_BURP6/175-318--------------------------------------------------------------------------------
C5BPH6_TERTT/174-345--------------------------------------------------------------------------------
Q468D1_METBF/112-267--------------------------------------------------------------------------------
A9GGY2_SORC5/142-276--------------------------------------------------------------------------------
C7RS50_ACCPU/115-274--------------------------------------------------------------------------------
Q74DF6_GEOSL/136-280--------------------------------------------------------------------------------
D5SSN9_PLAL2/125-270--------------------------------------------------------------------------------
C2W2L4_BACCE/159-308--------------------------------------------------------------------------------
A9E6S3_9FLAO/103-241--------------------------------------------------------------------------------
C9XIG8_CLODC/103-255--------------------------------------------------------------------------------
A3ZR10_9PLAN/69-211--------------------------------------------------------------------------------
C5P7U6_COCP7/141-273--------------------------------------------------------------------------------
A9NH35_ACHLI/152-331--------------------------------------------------------------------------------
D2SD45_GEOOG/295-434--------------------------------------------------------------------------------
B6W7K6_9FIRM/106-236--------------------------------------------------------------------------------
Q5Y0K2_9ARCH/104-253--------------------------------------------------------------------------------
C4X9G7_KLEPN/110-254--------------------------------------------------------------------------------
D2SAI3_GEOOG/505-643--------------------------------------------------------------------------------
D3PB24_DEFDS/122-262--------------------------------------------------------------------------------
A8V433_9AQUI/117-295--------------------------------------------------------------------------------
B1IFA2_CLOBK/117-257--------------------------------------------------------------------------------
A4INT2_GEOTN/98-236--------------------------------------------------------------------------------
A6UN29_SINMW/117-268--------------------------------------------------------------------------------
Q7BQV0_9ENTR/132-298--------------------------------------------------------------------------------
A9KLI0_CLOPH/125-265--------------------------------------------------------------------------------
B4BSV3_9BACI/147-291--------------------------------------------------------------------------------
C1FU09_CLOBJ/116-249--------------------------------------------------------------------------------
A9G4K5_SORC5/114-247--------------------------------------------------------------------------------
A9GB97_SORC5/76-223--------------------------------------------------------------------------------
A6WPG0_SHEB8/65-208--------------------------------------------------------------------------------
Q3BK53_9PROT/118-263--------------------------------------------------------------------------------
Q2YAQ1_NITMU/270-428--------------------------------------------------------------------------------
A1BG00_CHLPD/160-328--------------------------------------------------------------------------------
D2KYA1_CORGT/132-278--------------------------------------------------------------------------------
D1PKF2_9FIRM/165-305--------------------------------------------------------------------------------
C4UA68_YERAL/102-244--------------------------------------------------------------------------------
D0GZ99_VIBMI/58-197--------------------------------------------------------------------------------
A4YZ71_BRASO/96-242--------------------------------------------------------------------------------
B1Q6E3_CLOBO/113-269--------------------------------------------------------------------------------
C0ZNB5_RHOE4/283-422--------------------------------------------------------------------------------
A6DXW7_9RHOB/85-232--------------------------------------------------------------------------------
C7VB26_ENTFL/149-285--------------------------------------------------------------------------------
C4UXP5_YERRO/145-292--------------------------------------------------------------------------------
A6GR96_9BURK/96-234--------------------------------------------------------------------------------
D0LGB9_HALO1/120-267--------------------------------------------------------------------------------
B5UXD5_BACCE/105-241--------------------------------------------------------------------------------
A6SWS4_JANMA/63-201--------------------------------------------------------------------------------
Q6NBK9_RHOPA/152-303--------------------------------------------------------------------------------
C6J830_9FIRM/113-258--------------------------------------------------------------------------------
D9SP56_CLOC7/120-256--------------------------------------------------------------------------------
D1RZ28_SEROD/104-261--------------------------------------------------------------------------------
Q12QQ9_SHEDO/90-229--------------------------------------------------------------------------------
E0TDM6_PARBH/151-296--------------------------------------------------------------------------------
Q1Q2W8_9BACT/165-308--------------------------------------------------------------------------------
D4B7J4_9ENTR/118-255--------------------------------------------------------------------------------
D2SB42_GEOOG/148-291--------------------------------------------------------------------------------
B7L3H7_METC4/126-276--------------------------------------------------------------------------------
B9JR52_AGRVS/164-337--------------------------------------------------------------------------------
A7VYZ2_9CLOT/121-240--------------------------------------------------------------------------------
C2ZYS5_BACCE/126-295--------------------------------------------------------------------------------
C0ZFK0_BREBN/117-254--------------------------------------------------------------------------------
C8PPW3_9SPIO/130-269--------------------------------------------------------------------------------
A1A364_BIFAA/140-287--------------------------------------------------------------------------------
A4CA56_9GAMM/100-236--------------------------------------------------------------------------------
D4J271_BUTFI/140-278--------------------------------------------------------------------------------
A1F0G4_VIBCL/160-327--------------------------------------------------------------------------------
B5WD67_9BURK/102-236--------------------------------------------------------------------------------
Q08QJ5_STIAD/174-316--------------------------------------------------------------------------------

PF00766

ETFA_THETC/205-290--------------------------------------------------------------------------------
Q7CSV6_AGRT5/187-273--------------------------------------------------------------------------------
FIXB_AZOC5/234-319--------------------------------------------------------------------------------
Q7RVY2_NEUCR/223-309--------------------------------------------------------------------------------
Q6AIQ0_DESPS/306-391--------------------------------------------------------------------------------
Q978W1_THEVO/215-300--------------------------------------------------------------------------------
FIXB_CLOSA/206-291--------------------------------------------------------------------------------
ETFA_CLOAB/210-295--------------------------------------------------------------------------------
Q83RF6_SHIFL/188-274--------------------------------------------------------------------------------
Q8NKM5_9CREN/280-377--------------------------------------------------------------------------------
Q83QD8_SHIFL/174-256--------------------------------------------------------------------------------
Q8KZQ0_BUTFI/219-304--------------------------------------------------------------------------------
Q7NG11_GLOVI/221-307--------------------------------------------------------------------------------
FIXB_RHISN/234-319--------------------------------------------------------------------------------
Q9Y966_AERPE/222-307--------------------------------------------------------------------------------
Q8RMW1_AZOBR/227-312--------------------------------------------------------------------------------
ETFA_YEAST/218-304--------------------------------------------------------------------------------
FIXB_SHIFL/189-275--------------------------------------------------------------------------------
Q9HL11_THEAC/441-526--------------------------------------------------------------------------------
FIXB_AZOVI/228-313--------------------------------------------------------------------------------
ETFA_ORYSJ/233-318--------------------------------------------------------------------------------
Q7MVI3_PORGI/207-292--------------------------------------------------------------------------------
Q9FA09_GLUDI/231-317--------------------------------------------------------------------------------
Q8FQ06_COREF/191-277--------------------------------------------------------------------------------
Q8XNM1_CLOPE/270-355--------------------------------------------------------------------------------
Q8ZYL5_PYRAE/218-303--------------------------------------------------------------------------------
ETFA_SCHPO/219-305--------------------------------------------------------------------------------
Q750K5_ASHGO/222-308--------------------------------------------------------------------------------
Q97G29_CLOAB/269-354--------------------------------------------------------------------------------
Q749E7_GEOSL/207-292--------------------------------------------------------------------------------
Q6US86_RHORU/233-318--------------------------------------------------------------------------------
ETFA_HUMAN/209-294--------------------------------------------------------------------------------
ETFA_MEGEL/208-295--------------------------------------------------------------------------------
Q9X1L7_THEMA/206-291--------------------------------------------------------------------------------
Q892L4_CLOTE/208-293--------------------------------------------------------------------------------
Q8D6Q4_VIBVU/200-285--------------------------------------------------------------------------------
Q896M7_CLOTE/271-356--------------------------------------------------------------------------------
Q897M1_CLOTE/208-293--------------------------------------------------------------------------------
Q8XI26_CLOPE/207-292--------------------------------------------------------------------------------

PF01916

DHYS_HUMAN/42-356--------------------------------------------------------------------------------
DHYS_YEAST/45-377--------------------------------------------------------------------------------
DHYS_METJA/25-330--------------------------------------------------------------------------------
DHYS_PYRHO/31-334--------------------------------------------------------------------------------
DHYS_NEUCR/43-348--------------------------------------------------------------------------------
DHYS1_ARCFU/14-296--------------------------------------------------------------------------------
DHYS_METTH/17-305--------------------------------------------------------------------------------

PF02552

ACDE2_ARCFU/2-172--------------------------------------------------------------------------------
ACDE_METTH/4-171--------------------------------------------------------------------------------
ACDE_METJA/4-144--------------------------------------------------------------------------------
O67557_AQUAE/619-788--------------------------------------------------------------------------------
ACDE1_ARCFU/7-181--------------------------------------------------------------------------------
O67252_AQUAE/19-183--------------------------------------------------------------------------------

PF00205

PDC2_SCHPO/205-338--------------------------------------------------------------------------------
Q4KDI6_PSEF5/219-353--------------------------------------------------------------------------------
Q4WM01_ASPFU/222-353--------------------------------------------------------------------------------
Q4WC96_ASPFU/248-378--------------------------------------------------------------------------------
Q4WW88_ASPFU/200-331--------------------------------------------------------------------------------
HACL_ARATH/206-334--------------------------------------------------------------------------------
ILVB_SPIPL/206-344--------------------------------------------------------------------------------
IOLD_BACSU/220-354--------------------------------------------------------------------------------
ILVX_BACSU/200-335--------------------------------------------------------------------------------
ILVBL_BOVIN/273-405--------------------------------------------------------------------------------
IOLD_LISMF/221-354--------------------------------------------------------------------------------
Q86ZI4_NEUCS/227-359--------------------------------------------------------------------------------
O07043_AZOBR/192-324--------------------------------------------------------------------------------
O22578_VOLCA/289-422--------------------------------------------------------------------------------
O26576_METTH/240-367--------------------------------------------------------------------------------
O28180_ARCFU/201-335--------------------------------------------------------------------------------
O28554_ARCFU/190-325--------------------------------------------------------------------------------
ILVBL_CAEEL/277-409--------------------------------------------------------------------------------
O66759_AQUAE/198-333--------------------------------------------------------------------------------
O68497_CLOAT/208-342--------------------------------------------------------------------------------
O87839_STRCO/200-327--------------------------------------------------------------------------------
PDC_ZYMMO/199-331--------------------------------------------------------------------------------
MDLC_PSEPU/190-325--------------------------------------------------------------------------------
DCIP_ENTCL/199-331--------------------------------------------------------------------------------
ILVB_KLEPN/197-331--------------------------------------------------------------------------------
PDC1_MAIZE/246-379--------------------------------------------------------------------------------
PDC_NEUCR/205-336--------------------------------------------------------------------------------
ILVB_SCHPO/285-430--------------------------------------------------------------------------------
POXB_LACPL/202-333--------------------------------------------------------------------------------
YEC0_YEAST/195-327--------------------------------------------------------------------------------
OXC_OXAFO/203-333--------------------------------------------------------------------------------
ILVB_CORGL/216-351--------------------------------------------------------------------------------
ILVI_HAEIN/196-331--------------------------------------------------------------------------------
BZNB_PSEFL/194-329--------------------------------------------------------------------------------
ILVB_PORPU/206-341--------------------------------------------------------------------------------
P94896_OENOE/194-330--------------------------------------------------------------------------------
YDAP_BACSU/193-321--------------------------------------------------------------------------------
P97113_LEUMC/201-336--------------------------------------------------------------------------------
ILVB_LACLA/200-335--------------------------------------------------------------------------------
ARO10_YEAST/244-383--------------------------------------------------------------------------------
THI3_YEAST/212-344--------------------------------------------------------------------------------
PDC1_KLULA/201-333--------------------------------------------------------------------------------
Q17474_CAEEL/261-391--------------------------------------------------------------------------------
Q1LF51_RALME/275-402--------------------------------------------------------------------------------
Q1LM48_RALME/189-317--------------------------------------------------------------------------------
Q1M4I8_RHIL3/188-321--------------------------------------------------------------------------------
Q1M4Y3_RHIL3/204-337--------------------------------------------------------------------------------
Q1MJ71_RHIL3/230-364--------------------------------------------------------------------------------
Q1N3D1_9GAMM/189-317--------------------------------------------------------------------------------
Q1NYW7_9FLAO/195-332--------------------------------------------------------------------------------
Q1QAH7_PSYCK/229-362--------------------------------------------------------------------------------
Q1R058_CHRSD/190-323--------------------------------------------------------------------------------
Q1R095_CHRSD/207-342--------------------------------------------------------------------------------
B3XNI8_LACRE/195-331--------------------------------------------------------------------------------
B3XR89_LACRE/202-331--------------------------------------------------------------------------------
A5WFU4_PSYWF/155-291--------------------------------------------------------------------------------
A5WFU5_PSYWF/195-322--------------------------------------------------------------------------------
A5WDF4_PSYWF/210-343--------------------------------------------------------------------------------
Q1V0A8_PELUQ/195-332--------------------------------------------------------------------------------
Q1VVK9_9FLAO/210-345--------------------------------------------------------------------------------
Q1WVB6_LACS1/198-333--------------------------------------------------------------------------------
Q1WVR0_LACS1/195-324--------------------------------------------------------------------------------
A5D4V9_PELTS/192-327--------------------------------------------------------------------------------
Q1YIT6_MOBAS/207-341--------------------------------------------------------------------------------
Q1YIU4_MOBAS/196-334--------------------------------------------------------------------------------
Q1YKX8_MOBAS/228-407--------------------------------------------------------------------------------
Q1YX19_PHOPR/200-338--------------------------------------------------------------------------------
Q1ZKY9_PHOAS/187-322--------------------------------------------------------------------------------
Q1ZSM4_PHOAS/192-327--------------------------------------------------------------------------------
Q21SN9_RHOFD/191-324--------------------------------------------------------------------------------
Q21T72_RHOFD/229-365--------------------------------------------------------------------------------
Q21VK8_RHOFD/229-357--------------------------------------------------------------------------------
Q220C3_RHOFD/190-328--------------------------------------------------------------------------------
Q24UP5_DESHY/194-329--------------------------------------------------------------------------------
Q24XT7_DESHY/200-336--------------------------------------------------------------------------------
Q251L0_DESHY/193-331--------------------------------------------------------------------------------
Q252I7_DESHY/193-328--------------------------------------------------------------------------------
Q28KM5_JANSC/191-323--------------------------------------------------------------------------------
Q28SI9_JANSC/198-334--------------------------------------------------------------------------------
Q28W58_JANSC/189-326--------------------------------------------------------------------------------
B8CX18_HALOH/193-328--------------------------------------------------------------------------------
B8CWB0_HALOH/189-317--------------------------------------------------------------------------------
Q2CC29_9RHOB/189-327--------------------------------------------------------------------------------
A5G0X6_ACICJ/217-351--------------------------------------------------------------------------------
A5FTR0_ACICJ/189-317--------------------------------------------------------------------------------
A5G2E1_ACICJ/199-336--------------------------------------------------------------------------------
A5GC69_GEOUR/192-327--------------------------------------------------------------------------------
A5FR34_DEHSB/193-328--------------------------------------------------------------------------------
Q2F5Z5_BOMMO/217-346--------------------------------------------------------------------------------
Q2FM35_METHJ/193-328--------------------------------------------------------------------------------
Q2G625_NOVAD/195-332--------------------------------------------------------------------------------
Q2GMZ7_CHAGB/217-331--------------------------------------------------------------------------------
Q2IJB5_ANADE/195-330--------------------------------------------------------------------------------
Q2IPR2_ANADE/234-362--------------------------------------------------------------------------------
Q2J1F2_RHOP2/193-331--------------------------------------------------------------------------------
Q2J6V0_FRASC/199-334--------------------------------------------------------------------------------
Q2JZ22_RHIEC/196-321--------------------------------------------------------------------------------
Q2KTL4_BORA1/228-365--------------------------------------------------------------------------------
Q2LXN9_SYNAS/193-328--------------------------------------------------------------------------------
Q2LXP1_SYNAS/192-327--------------------------------------------------------------------------------
Q2NBF4_ERYLH/186-319--------------------------------------------------------------------------------
Q2NI91_METST/191-326--------------------------------------------------------------------------------
Q2P758_XANOM/197-332--------------------------------------------------------------------------------
Q2RG94_MOOTA/203-338--------------------------------------------------------------------------------
Q2RG96_MOOTA/197-332--------------------------------------------------------------------------------
Q2RXQ6_RHORT/213-351--------------------------------------------------------------------------------
Q2S0N1_SALRD/216-351--------------------------------------------------------------------------------
Q2S798_HAHCH/191-326--------------------------------------------------------------------------------
Q2SJ09_HAHCH/200-336--------------------------------------------------------------------------------
Q2SM62_HAHCH/214-350--------------------------------------------------------------------------------
Q2SMT8_HAHCH/219-352--------------------------------------------------------------------------------
Q2U768_ASPOR/207-343--------------------------------------------------------------------------------
Q2UC40_ASPOR/202-333--------------------------------------------------------------------------------
Q2W471_MAGSA/196-334--------------------------------------------------------------------------------
Q2WFA8_MONVA/223-356--------------------------------------------------------------------------------
A6LXD5_CLOB8/198-332--------------------------------------------------------------------------------
A6LPX7_CLOB8/192-326--------------------------------------------------------------------------------
A6LWS0_CLOB8/194-329--------------------------------------------------------------------------------
A6M227_CLOB8/219-353--------------------------------------------------------------------------------
A6LX01_CLOB8/191-328--------------------------------------------------------------------------------
A5W954_PSEP1/196-331--------------------------------------------------------------------------------
A5W0I1_PSEP1/200-336--------------------------------------------------------------------------------
A5W364_PSEP1/198-328--------------------------------------------------------------------------------
Q877U6_PSEPK/187-320--------------------------------------------------------------------------------
A5W220_PSEP1/196-326--------------------------------------------------------------------------------
Q2YKW9_BRUA2/216-350--------------------------------------------------------------------------------
A4XIL5_CALS8/194-328--------------------------------------------------------------------------------
A4XHS0_CALS8/191-326--------------------------------------------------------------------------------
Q30RG2_SULDN/193-328--------------------------------------------------------------------------------
Q30YW8_DESDG/192-323--------------------------------------------------------------------------------
Q31JM5_THICR/186-321--------------------------------------------------------------------------------
A5EDH4_BRASB/198-324--------------------------------------------------------------------------------
A5ECG1_BRASB/192-328--------------------------------------------------------------------------------
Q38UJ8_LACSS/196-325--------------------------------------------------------------------------------
Q39P46_BURS3/215-348--------------------------------------------------------------------------------
Q39W78_GEOMG/193-328--------------------------------------------------------------------------------
Q3AEQ6_CARHZ/192-327--------------------------------------------------------------------------------
Q3AEQ9_CARHZ/192-327--------------------------------------------------------------------------------
Q3ALE4_SYNSC/204-340--------------------------------------------------------------------------------
Q3ALP1_SYNSC/196-331--------------------------------------------------------------------------------
Q3AM88_SYNSC/188-321--------------------------------------------------------------------------------
A6TTL0_ALKMQ/192-327--------------------------------------------------------------------------------
A6TTM8_ALKMQ/204-339--------------------------------------------------------------------------------
B9LGM6_CHLSY/196-331--------------------------------------------------------------------------------
B9LHS5_CHLSY/482-610--------------------------------------------------------------------------------
A6VLE4_ACTSZ/188-323--------------------------------------------------------------------------------
Q3ICC9_PSEHT/198-333--------------------------------------------------------------------------------
Q3IS45_NATPD/201-338--------------------------------------------------------------------------------
Q3JBM9_NITOC/217-353--------------------------------------------------------------------------------
Q3K7P6_PSEPF/191-324--------------------------------------------------------------------------------
A3D4X6_SHEB5/190-319--------------------------------------------------------------------------------
Q3SL06_THIDA/197-334--------------------------------------------------------------------------------
Q3V892_DESVH/193-328--------------------------------------------------------------------------------
Q3V893_DESVH/192-327--------------------------------------------------------------------------------
A8L943_FRASN/191-326--------------------------------------------------------------------------------
A8L1M3_FRASN/194-330--------------------------------------------------------------------------------
Q3XZD0_ENTFC/193-322--------------------------------------------------------------------------------
Q3Y3Q3_ENTFC/220-354--------------------------------------------------------------------------------
Q3YZF7_SHISS/201-329--------------------------------------------------------------------------------
Q3Z3R2_SHISS/191-319--------------------------------------------------------------------------------
A6WFD0_KINRD/239-373--------------------------------------------------------------------------------
B1YKG0_EXIS2/201-337--------------------------------------------------------------------------------
Q46SP4_CUPPJ/228-365--------------------------------------------------------------------------------
Q46VA1_CUPPJ/202-331--------------------------------------------------------------------------------
Q471R9_CUPPJ/220-358--------------------------------------------------------------------------------
Q47FL3_DECAR/193-328--------------------------------------------------------------------------------
Q47SH6_THEFY/199-330--------------------------------------------------------------------------------
Q47UP0_COLP3/160-295--------------------------------------------------------------------------------
Q47YT4_COLP3/192-325--------------------------------------------------------------------------------
Q48634_9LACT/192-327--------------------------------------------------------------------------------
Q4A101_STAS1/192-327--------------------------------------------------------------------------------
Q4BWI9_CROWT/189-323--------------------------------------------------------------------------------
A3DIY4_CLOTH/192-327--------------------------------------------------------------------------------
A3DID9_CLOTH/192-327--------------------------------------------------------------------------------
Q4FTE7_PSYA2/199-331--------------------------------------------------------------------------------
B9KGF5_CAMLR/194-329--------------------------------------------------------------------------------
Q4J6N9_SULAC/197-320--------------------------------------------------------------------------------
Q4J7J3_SULAC/185-313--------------------------------------------------------------------------------
Q4J9P1_SULAC/191-326--------------------------------------------------------------------------------
Q4JAP2_SULAC/203-338--------------------------------------------------------------------------------
Q4JWD0_CORJK/191-318--------------------------------------------------------------------------------
Q4L7T7_STAHJ/225-360--------------------------------------------------------------------------------
Q4V070_XANC8/193-321--------------------------------------------------------------------------------
Q4Y789_PLACH/107-235--------------------------------------------------------------------------------
POXB_STRPN/196-327--------------------------------------------------------------------------------
Q5AMN8_CANAL/91-249--------------------------------------------------------------------------------
Q5AZE4_EMENI/765-897--------------------------------------------------------------------------------
Q5B535_EMENI/204-350--------------------------------------------------------------------------------
Q5FHQ7_LACAC/194-323--------------------------------------------------------------------------------
Q5FLY7_LACAC/198-327--------------------------------------------------------------------------------
Q5FRZ0_GLUOX/205-342--------------------------------------------------------------------------------
Q5L322_GEOKA/194-329--------------------------------------------------------------------------------
Q5LKS2_SILPO/192-328--------------------------------------------------------------------------------
Q5LLG2_SILPO/190-321--------------------------------------------------------------------------------
Q5LQV0_SILPO/199-335--------------------------------------------------------------------------------
Q5NEA3_FRATT/213-346--------------------------------------------------------------------------------
Q5NPP9_ZYMMO/193-327--------------------------------------------------------------------------------
Q5QZF0_IDILO/186-322--------------------------------------------------------------------------------
Q5R276_DROSE/193-322--------------------------------------------------------------------------------
Q5UWG1_HALMA/202-340--------------------------------------------------------------------------------
Q5V522_HALMA/213-348--------------------------------------------------------------------------------
Q5V5J6_HALMA/187-321--------------------------------------------------------------------------------
Q5WGG1_BACSK/191-329--------------------------------------------------------------------------------
Q5WW44_LEGPL/218-352--------------------------------------------------------------------------------
Q5YN72_NOCFA/213-347--------------------------------------------------------------------------------
Q60021_THEAQ/190-323--------------------------------------------------------------------------------
Q601Q2_MYCH2/220-353--------------------------------------------------------------------------------
Q62KX9_BURMA/246-379--------------------------------------------------------------------------------
IOLD1_BACCZ/219-353--------------------------------------------------------------------------------
Q64BR9_9ARCH/196-332--------------------------------------------------------------------------------
Q64PS7_BACFR/197-332--------------------------------------------------------------------------------
Q67KX7_SYMTH/192-328--------------------------------------------------------------------------------
Q6AAK5_PROAC/228-362--------------------------------------------------------------------------------
Q6AEP0_LEIXX/219-354--------------------------------------------------------------------------------
Q6AJI2_DESPS/239-374--------------------------------------------------------------------------------
Q6APX2_DESPS/190-328--------------------------------------------------------------------------------
Q6C6Q2_YARLI/193-323--------------------------------------------------------------------------------
Q6CDI5_YARLI/273-418--------------------------------------------------------------------------------
Q6DDN7_XENLA/202-331--------------------------------------------------------------------------------
Q6FDG8_ACIAD/195-324--------------------------------------------------------------------------------
Q6FJV6_CANGA/193-324--------------------------------------------------------------------------------
Q6FYB3_CANGA/251-392--------------------------------------------------------------------------------
Q6G6D5_STAAS/193-322--------------------------------------------------------------------------------
Q6HKA3_BACHK/204-339--------------------------------------------------------------------------------
Q6HLF6_BACHK/202-337--------------------------------------------------------------------------------
Q6L042_PICTO/193-329--------------------------------------------------------------------------------
Q6LK31_PHOPR/222-355--------------------------------------------------------------------------------
Q6LK45_PHOPR/220-354--------------------------------------------------------------------------------
Q6LZH8_METMP/193-328--------------------------------------------------------------------------------
Q6N2J6_RHOPA/202-339--------------------------------------------------------------------------------
Q6N2Y1_RHOPA/196-336--------------------------------------------------------------------------------
Q6N3D1_RHOPA/193-319--------------------------------------------------------------------------------
Q6N658_RHOPA/218-353--------------------------------------------------------------------------------
Q6NDJ7_RHOPA/202-334--------------------------------------------------------------------------------
Q6SGJ7_9BACT/200-328--------------------------------------------------------------------------------
Q6W1J3_RHISN/220-353--------------------------------------------------------------------------------
Q6ZUX2_HUMAN/198-327--------------------------------------------------------------------------------
Q70I04_9ACTO/185-318--------------------------------------------------------------------------------
Q72SH3_LEPIC/221-355--------------------------------------------------------------------------------
Q737X8_BACC1/202-334--------------------------------------------------------------------------------
Q738G9_BACC1/193-321--------------------------------------------------------------------------------
Q73CV8_BACC1/203-338--------------------------------------------------------------------------------
Q73TP3_MYCPA/147-281--------------------------------------------------------------------------------
Q73U45_MYCPA/225-354--------------------------------------------------------------------------------
Q74H96_LACJO/195-324--------------------------------------------------------------------------------
Q757R7_ASHGO/187-316--------------------------------------------------------------------------------
Q75PZ0_9BIFI/209-338--------------------------------------------------------------------------------
Q7CL03_YERPE/186-321--------------------------------------------------------------------------------
A2VGF0_MYCTU/208-339--------------------------------------------------------------------------------
Q7MAQ0_WOLSU/193-328--------------------------------------------------------------------------------
Q7N5X4_PHOLL/224-358--------------------------------------------------------------------------------
Q7NR95_CHRVO/168-305--------------------------------------------------------------------------------
Q7UHW9_RHOBA/234-369--------------------------------------------------------------------------------
Q7VXC3_BORPE/196-334--------------------------------------------------------------------------------
Q7VY25_BORPE/197-335--------------------------------------------------------------------------------
Q7WBZ5_BORPA/205-338--------------------------------------------------------------------------------
Q7WCV8_BORBR/218-357--------------------------------------------------------------------------------
Q7WHS2_BORBR/197-328--------------------------------------------------------------------------------
Q7WPE1_BORBR/198-327--------------------------------------------------------------------------------
Q7WQI4_BORBR/197-333--------------------------------------------------------------------------------
Q7WQJ5_BORBR/206-345--------------------------------------------------------------------------------
Q82CK4_STRAW/220-354--------------------------------------------------------------------------------
Q82CQ7_STRAW/217-348--------------------------------------------------------------------------------
Q82PG6_STRAW/190-319--------------------------------------------------------------------------------
Q83HI7_TROW8/197-332--------------------------------------------------------------------------------
Q845Z6_SELRU/190-325--------------------------------------------------------------------------------
ILVI_BUCBP/196-331--------------------------------------------------------------------------------
Q89E01_BRAJA/194-322--------------------------------------------------------------------------------
Q89QL7_BRAJA/184-317--------------------------------------------------------------------------------
Q8A6Q6_BACTN/191-319--------------------------------------------------------------------------------
Q8DR05_STRR6/200-335--------------------------------------------------------------------------------
Q8EL23_OCEIH/193-321--------------------------------------------------------------------------------
Q8ELJ0_OCEIH/199-338--------------------------------------------------------------------------------
Q8EN64_OCEIH/207-342--------------------------------------------------------------------------------
Q8FQJ5_COREF/209-339--------------------------------------------------------------------------------
Q8G7H0_BIFLO/221-356--------------------------------------------------------------------------------
Q8PUJ4_METMA/186-320--------------------------------------------------------------------------------
Q8RDJ8_THETN/191-326--------------------------------------------------------------------------------
Q8TT45_METAC/203-335--------------------------------------------------------------------------------
Q8U2A4_PYRFU/195-330--------------------------------------------------------------------------------
Q92DT2_LISIN/193-321--------------------------------------------------------------------------------
Q92NJ5_RHIME/187-325--------------------------------------------------------------------------------
Q92X67_RHIME/197-327--------------------------------------------------------------------------------
Q92XQ1_RHIME/191-335--------------------------------------------------------------------------------
Q92ZG6_RHIME/197-336--------------------------------------------------------------------------------
XSC_DESTI/194-332--------------------------------------------------------------------------------
Q971A7_SULTO/197-333--------------------------------------------------------------------------------
Q97EE4_CLOAB/189-324--------------------------------------------------------------------------------
Q97TS2_CLOAB/199-331--------------------------------------------------------------------------------
Q97UP3_SULSO/187-315--------------------------------------------------------------------------------
Q97XR3_SULSO/187-318--------------------------------------------------------------------------------
Q988P8_RHILO/199-338--------------------------------------------------------------------------------
Q98CV8_RHILO/243-377--------------------------------------------------------------------------------
Q9A8Q4_CAUCR/219-353--------------------------------------------------------------------------------
Q9CE06_LACLA/194-323--------------------------------------------------------------------------------
Q9F7L7_PRB01/188-323--------------------------------------------------------------------------------
Q9HJZ5_THEAC/187-315--------------------------------------------------------------------------------
Q9HK28_THEAC/167-303--------------------------------------------------------------------------------
Q9HKB0_THEAC/203-342--------------------------------------------------------------------------------
Q9HTQ7_PSEAE/190-318--------------------------------------------------------------------------------
Q9I207_PSEAE/198-328--------------------------------------------------------------------------------
Q9K659_BACHD/188-324--------------------------------------------------------------------------------
IOLD_BACHD/219-353--------------------------------------------------------------------------------
Q9L123_STRCO/189-324--------------------------------------------------------------------------------
PDC3_SCHPO/210-342--------------------------------------------------------------------------------
Q9WZ18_THEMA/197-332--------------------------------------------------------------------------------
YGK4_SCHPO/192-322--------------------------------------------------------------------------------
Q9ZBT3_STRCO/192-320--------------------------------------------------------------------------------
Q9ZIA9_LEULA/196-332--------------------------------------------------------------------------------

PF02233

NNTM_BOVIN/618-1080.........ALSAVMGVTLTAAIGGADMPVVITVLNSYSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRS
PNTB_HAEIN/4-474.........AIALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFILNNDLLIVTGALVGSSGAILSYIMCKAMNRS
PNTB_SHIFL/4-462.........AIALVFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLIVTGALVGSSGAILSYIMCKAMNRS
Q18031_CAEEL/573-1036........VGLSSLMGVTLTMAIGGADMPIVITVLNSYSGWALCAEGFMLDNSLLTVLGALIGSSGAILSHIMCKAMNRS
Q24813_ENTHI/17-526NGGILIVVIIISFFIGWHMVMAIGGADMPVVVSMLNSYSGWATAASGFLLNNYAMIVGGALIGSSGAILSYIMCKAMNRS
P73500_SYNY3/4-464.........AIAGVLGLHLVAAIGGADMPVVISMLNSYSGWAAAAAGFMLSNDLLIITGALVGSSGAILSYIMCKAMNRS
Q9ZE72_RICPR/4-462...........SLLSGILLIIPVGSADMPVIVSMLNSYSGFATAGIGFTLSNSLLIITGSLIGSSGAILSYIMCKAMNRS
PNTB_RHORU/4-463...........AFALGFLLIIPIGGADMPVVISMLNSYSGWAAAGIGFTLGNPLLIIAGALVGSSGAILSYIMCKGMNRS
P96834_MYCTU/5-472.......LLVAAGVLGLMVVLPIGGADMPVVISMLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRS
Q07600_EIMTE/3-459........AGLSMWLGFHLVAAIGGADMPVVISLLNSYSGVALAASGFMLDNNLLIIAGALIASSGAILSYIMCKGMNRS

PF02146

SIR2_TRYB2/37-220--------------------------------------------------------------------------------
SIR2_LEIMA/39-223--------------------------------------------------------------------------------
SIR2_DROME/229-434--------------------------------------------------------------------------------
SIR2_CANAL/246-437--------------------------------------------------------------------------------
NPD_PYRHO/20-197--------------------------------------------------------------------------------
NPD_BACSU/19-198--------------------------------------------------------------------------------
NPD_STAA8/23-198--------------------------------------------------------------------------------
SIR2_CAEEL/153-334--------------------------------------------------------------------------------
NPD2_ARCFU/23-198--------------------------------------------------------------------------------
SIR42_CAEEL/35-243--------------------------------------------------------------------------------
SIR2_KLULA/318-534--------------------------------------------------------------------------------
NPD_MYCTU/8-184--------------------------------------------------------------------------------
SIR2_YEAST/262-478--------------------------------------------------------------------------------
E9YAJ6_ECOLX/48-221--------------------------------------------------------------------------------
SIR2_SCHPO/164-380--------------------------------------------------------------------------------
O94066_CANAX/26-208--------------------------------------------------------------------------------
NPD1_ARCFU/20-192--------------------------------------------------------------------------------
NPD_AQUAE/11-183--------------------------------------------------------------------------------
NPD_AGGAC/10-177--------------------------------------------------------------------------------
SIR41_CAEEL/35-243--------------------------------------------------------------------------------

PF13289

C3WEJ8_FUSMR/103-239--------------------------------------------------------------------------------
E0WKU6_LISGR/186-358--------------------------------------------------------------------------------
B8FFN4_DESAA/108-257--------------------------------------------------------------------------------
C2VLS5_BACCE/130-263--------------------------------------------------------------------------------
C7RFY6_ANAPD/212-382--------------------------------------------------------------------------------
C7RVA1_ACCPU/142-298--------------------------------------------------------------------------------
A1TX65_MARAV/101-247--------------------------------------------------------------------------------
C6JRB3_FUSVA/103-240--------------------------------------------------------------------------------
A6DRE2_9BACT/143-270--------------------------------------------------------------------------------
C6I4U2_9BACE/102-244--------------------------------------------------------------------------------
D1AZA4_SULD5/145-284--------------------------------------------------------------------------------
C3JCK6_9PORP/114-255--------------------------------------------------------------------------------
B8EJ27_METSB/100-273--------------------------------------------------------------------------------
B0NWG4_9CLOT/150-288--------------------------------------------------------------------------------
Q1BDR9_MYCSS/245-384--------------------------------------------------------------------------------
A9KVJ0_SHEB9/173-321--------------------------------------------------------------------------------
B7J5Y3_ACIF2/103-252--------------------------------------------------------------------------------
D2R627_PIRSD/146-286--------------------------------------------------------------------------------
Q6ALX8_DESPS/166-342--------------------------------------------------------------------------------
A6G3D2_9DELT/43-176--------------------------------------------------------------------------------
C6B833_RHILS/108-250--------------------------------------------------------------------------------
A0QRW8_MYCS2/295-432--------------------------------------------------------------------------------
C3WNE7_9FUSO/40-180--------------------------------------------------------------------------------
Q0YTA6_9CHLB/271-402--------------------------------------------------------------------------------
D4G637_BACNA/107-249--------------------------------------------------------------------------------
B3PHQ7_CELJU/121-268--------------------------------------------------------------------------------
B1IFA3_CLOBK/211-355--------------------------------------------------------------------------------
B2RK70_PORG3/130-279--------------------------------------------------------------------------------
E6TR41_BACCJ/246-381--------------------------------------------------------------------------------
A3IA13_9BACI/104-251--------------------------------------------------------------------------------
C7HAZ7_9FIRM/289-441--------------------------------------------------------------------------------
C4ZMZ3_THASP/323-497--------------------------------------------------------------------------------
B1GAX3_9BURK/115-258--------------------------------------------------------------------------------
Q1D4W8_MYXXD/1238-1377--------------------------------------------------------------------------------
B8I4A6_CLOCE/97-241--------------------------------------------------------------------------------
A0LH81_SYNFM/83-241--------------------------------------------------------------------------------
B0UD07_METS4/36-185--------------------------------------------------------------------------------
B3JQ32_9BACE/138-309--------------------------------------------------------------------------------
D2B798_STRRD/104-265--------------------------------------------------------------------------------
A7GBJ3_CLOBL/118-257--------------------------------------------------------------------------------
A9FD38_SORC5/122-271--------------------------------------------------------------------------------
C3HSI6_BACTU/106-242--------------------------------------------------------------------------------
C3J834_9PORP/142-278--------------------------------------------------------------------------------
D0LP08_HALO1/119-264--------------------------------------------------------------------------------
C2NSI3_BACCE/166-312--------------------------------------------------------------------------------
B5UXF8_BACCE/31-164--------------------------------------------------------------------------------
C1M7E6_9ENTR/499-661--------------------------------------------------------------------------------
Q21D17_RHOPB/114-255--------------------------------------------------------------------------------
A8SDW3_9FIRM/117-269--------------------------------------------------------------------------------
Q6DF29_XENTR/142-286--------------------------------------------------------------------------------
Q4QK39_HAEI8/178-326--------------------------------------------------------------------------------
A7K172_VIBSE/104-251--------------------------------------------------------------------------------
Q223H0_RHOFD/193-348--------------------------------------------------------------------------------
C8NLF5_COREF/112-260--------------------------------------------------------------------------------
A4N3X2_HAEIF/175-323--------------------------------------------------------------------------------
A6G812_9DELT/112-246--------------------------------------------------------------------------------
A4X0P5_RHOS5/105-260--------------------------------------------------------------------------------
A1SJK6_NOCSJ/125-273--------------------------------------------------------------------------------
A6STW5_JANMA/147-314--------------------------------------------------------------------------------
Q48B89_PSE14/9-154--------------------------------------------------------------------------------
Q2RM32_MOOTA/133-297--------------------------------------------------------------------------------
Q0W7V8_UNCMA/109-246--------------------------------------------------------------------------------
C6I9L2_9BACE/137-277--------------------------------------------------------------------------------
Q54CK8_DICDI/935-1078--------------------------------------------------------------------------------
B1MA98_METRJ/103-241--------------------------------------------------------------------------------
Q5V033_HALMA/150-286--------------------------------------------------------------------------------
B9Y0H1_HELPX/107-243--------------------------------------------------------------------------------
A5L0C3_9GAMM/214-366--------------------------------------------------------------------------------
C1ERC3_BACC3/124-262--------------------------------------------------------------------------------
C8X684_NAKMY/91-246--------------------------------------------------------------------------------
B2IE38_BEII9/105-265--------------------------------------------------------------------------------
A3YXQ6_9SYNE/63-205--------------------------------------------------------------------------------
F0QDG8_ACIAP/134-282--------------------------------------------------------------------------------
C1DSG4_AZOVD/112-256--------------------------------------------------------------------------------
C2LUJ2_STRSL/225-405--------------------------------------------------------------------------------
Q6MH60_BDEBA/224-370--------------------------------------------------------------------------------
A6G9A9_9DELT/1210-1344--------------------------------------------------------------------------------
D4KUN5_9FIRM/115-253--------------------------------------------------------------------------------
A7BSX6_9GAMM/390-563--------------------------------------------------------------------------------
A7ABF7_9PORP/141-280--------------------------------------------------------------------------------
A5MFE1_STRPN/104-240--------------------------------------------------------------------------------
A9GWR7_SORC5/128-261--------------------------------------------------------------------------------
C4L4F1_EXISA/106-243--------------------------------------------------------------------------------
C7X7Y0_9PORP/105-251--------------------------------------------------------------------------------
A8IIJ2_AZOC5/116-266--------------------------------------------------------------------------------
B7ITB3_BACC2/116-253--------------------------------------------------------------------------------
D1A4U2_THECD/106-274--------------------------------------------------------------------------------
A9G7D0_SORC5/160-352--------------------------------------------------------------------------------
D3F474_CONWI/122-259--------------------------------------------------------------------------------
E3IX96_FRASU/105-267--------------------------------------------------------------------------------
B0RMG9_XANCB/115-257--------------------------------------------------------------------------------
Q38324_9CAUD/146-291--------------------------------------------------------------------------------
B8K7Z1_VIBPA/98-239--------------------------------------------------------------------------------
A9G5J6_SORC5/116-251--------------------------------------------------------------------------------
B0VP62_ACIBS/101-247--------------------------------------------------------------------------------
C2T6L1_BACCE/106-260--------------------------------------------------------------------------------
A3NCJ6_BURP6/175-318--------------------------------------------------------------------------------
C5BPH6_TERTT/174-345--------------------------------------------------------------------------------
Q468D1_METBF/112-267--------------------------------------------------------------------------------
A9GGY2_SORC5/142-276--------------------------------------------------------------------------------
C7RS50_ACCPU/115-274--------------------------------------------------------------------------------
Q74DF6_GEOSL/136-280--------------------------------------------------------------------------------
D5SSN9_PLAL2/125-270--------------------------------------------------------------------------------
C2W2L4_BACCE/159-308--------------------------------------------------------------------------------
A9E6S3_9FLAO/103-241--------------------------------------------------------------------------------
C9XIG8_CLODC/103-255--------------------------------------------------------------------------------
A3ZR10_9PLAN/69-211--------------------------------------------------------------------------------
C5P7U6_COCP7/141-273--------------------------------------------------------------------------------
A9NH35_ACHLI/152-331--------------------------------------------------------------------------------
D2SD45_GEOOG/295-434--------------------------------------------------------------------------------
B6W7K6_9FIRM/106-236--------------------------------------------------------------------------------
Q5Y0K2_9ARCH/104-253--------------------------------------------------------------------------------
C4X9G7_KLEPN/110-254--------------------------------------------------------------------------------
D2SAI3_GEOOG/505-643--------------------------------------------------------------------------------
D3PB24_DEFDS/122-262--------------------------------------------------------------------------------
A8V433_9AQUI/117-295--------------------------------------------------------------------------------
B1IFA2_CLOBK/117-257--------------------------------------------------------------------------------
A4INT2_GEOTN/98-236--------------------------------------------------------------------------------
A6UN29_SINMW/117-268--------------------------------------------------------------------------------
Q7BQV0_9ENTR/132-298--------------------------------------------------------------------------------
A9KLI0_CLOPH/125-265--------------------------------------------------------------------------------
B4BSV3_9BACI/147-291--------------------------------------------------------------------------------
C1FU09_CLOBJ/116-249--------------------------------------------------------------------------------
A9G4K5_SORC5/114-247--------------------------------------------------------------------------------
A9GB97_SORC5/76-223--------------------------------------------------------------------------------
A6WPG0_SHEB8/65-208--------------------------------------------------------------------------------
Q3BK53_9PROT/118-263--------------------------------------------------------------------------------
Q2YAQ1_NITMU/270-428--------------------------------------------------------------------------------
A1BG00_CHLPD/160-328--------------------------------------------------------------------------------
D2KYA1_CORGT/132-278--------------------------------------------------------------------------------
D1PKF2_9FIRM/165-305--------------------------------------------------------------------------------
C4UA68_YERAL/102-244--------------------------------------------------------------------------------
D0GZ99_VIBMI/58-197--------------------------------------------------------------------------------
A4YZ71_BRASO/96-242--------------------------------------------------------------------------------
B1Q6E3_CLOBO/113-269--------------------------------------------------------------------------------
C0ZNB5_RHOE4/283-422--------------------------------------------------------------------------------
A6DXW7_9RHOB/85-232--------------------------------------------------------------------------------
C7VB26_ENTFL/149-285--------------------------------------------------------------------------------
C4UXP5_YERRO/145-292--------------------------------------------------------------------------------
A6GR96_9BURK/96-234--------------------------------------------------------------------------------
D0LGB9_HALO1/120-267--------------------------------------------------------------------------------
B5UXD5_BACCE/105-241--------------------------------------------------------------------------------
A6SWS4_JANMA/63-201--------------------------------------------------------------------------------
Q6NBK9_RHOPA/152-303--------------------------------------------------------------------------------
C6J830_9FIRM/113-258--------------------------------------------------------------------------------
D9SP56_CLOC7/120-256--------------------------------------------------------------------------------
D1RZ28_SEROD/104-261--------------------------------------------------------------------------------
Q12QQ9_SHEDO/90-229--------------------------------------------------------------------------------
E0TDM6_PARBH/151-296--------------------------------------------------------------------------------
Q1Q2W8_9BACT/165-308--------------------------------------------------------------------------------
D4B7J4_9ENTR/118-255--------------------------------------------------------------------------------
D2SB42_GEOOG/148-291--------------------------------------------------------------------------------
B7L3H7_METC4/126-276--------------------------------------------------------------------------------
B9JR52_AGRVS/164-337--------------------------------------------------------------------------------
A7VYZ2_9CLOT/121-240--------------------------------------------------------------------------------
C2ZYS5_BACCE/126-295--------------------------------------------------------------------------------
C0ZFK0_BREBN/117-254--------------------------------------------------------------------------------
C8PPW3_9SPIO/130-269--------------------------------------------------------------------------------
A1A364_BIFAA/140-287--------------------------------------------------------------------------------
A4CA56_9GAMM/100-236--------------------------------------------------------------------------------
D4J271_BUTFI/140-278--------------------------------------------------------------------------------
A1F0G4_VIBCL/160-327--------------------------------------------------------------------------------
B5WD67_9BURK/102-236--------------------------------------------------------------------------------
Q08QJ5_STIAD/174-316--------------------------------------------------------------------------------

PF00766

ETFA_THETC/205-290--------------------------------------------------------------------------------
Q7CSV6_AGRT5/187-273--------------------------------------------------------------------------------
FIXB_AZOC5/234-319--------------------------------------------------------------------------------
Q7RVY2_NEUCR/223-309--------------------------------------------------------------------------------
Q6AIQ0_DESPS/306-391--------------------------------------------------------------------------------
Q978W1_THEVO/215-300--------------------------------------------------------------------------------
FIXB_CLOSA/206-291--------------------------------------------------------------------------------
ETFA_CLOAB/210-295--------------------------------------------------------------------------------
Q83RF6_SHIFL/188-274--------------------------------------------------------------------------------
Q8NKM5_9CREN/280-377--------------------------------------------------------------------------------
Q83QD8_SHIFL/174-256--------------------------------------------------------------------------------
Q8KZQ0_BUTFI/219-304--------------------------------------------------------------------------------
Q7NG11_GLOVI/221-307--------------------------------------------------------------------------------
FIXB_RHISN/234-319--------------------------------------------------------------------------------
Q9Y966_AERPE/222-307--------------------------------------------------------------------------------
Q8RMW1_AZOBR/227-312--------------------------------------------------------------------------------
ETFA_YEAST/218-304--------------------------------------------------------------------------------
FIXB_SHIFL/189-275--------------------------------------------------------------------------------
Q9HL11_THEAC/441-526--------------------------------------------------------------------------------
FIXB_AZOVI/228-313--------------------------------------------------------------------------------
ETFA_ORYSJ/233-318--------------------------------------------------------------------------------
Q7MVI3_PORGI/207-292--------------------------------------------------------------------------------
Q9FA09_GLUDI/231-317--------------------------------------------------------------------------------
Q8FQ06_COREF/191-277--------------------------------------------------------------------------------
Q8XNM1_CLOPE/270-355--------------------------------------------------------------------------------
Q8ZYL5_PYRAE/218-303--------------------------------------------------------------------------------
ETFA_SCHPO/219-305--------------------------------------------------------------------------------
Q750K5_ASHGO/222-308--------------------------------------------------------------------------------
Q97G29_CLOAB/269-354--------------------------------------------------------------------------------
Q749E7_GEOSL/207-292--------------------------------------------------------------------------------
Q6US86_RHORU/233-318--------------------------------------------------------------------------------
ETFA_HUMAN/209-294--------------------------------------------------------------------------------
ETFA_MEGEL/208-295--------------------------------------------------------------------------------
Q9X1L7_THEMA/206-291--------------------------------------------------------------------------------
Q892L4_CLOTE/208-293--------------------------------------------------------------------------------
Q8D6Q4_VIBVU/200-285--------------------------------------------------------------------------------
Q896M7_CLOTE/271-356--------------------------------------------------------------------------------
Q897M1_CLOTE/208-293--------------------------------------------------------------------------------
Q8XI26_CLOPE/207-292--------------------------------------------------------------------------------

PF01916

DHYS_HUMAN/42-356--------------------------------------------------------------------------------
DHYS_YEAST/45-377--------------------------------------------------------------------------------
DHYS_METJA/25-330--------------------------------------------------------------------------------
DHYS_PYRHO/31-334--------------------------------------------------------------------------------
DHYS_NEUCR/43-348--------------------------------------------------------------------------------
DHYS1_ARCFU/14-296--------------------------------------------------------------------------------
DHYS_METTH/17-305--------------------------------------------------------------------------------

PF02552

ACDE2_ARCFU/2-172-------------...FDVANIPGPKMATLLEKGKPVANMIKKAK---RP--LL-----IVGPDM.T-------------
ACDE_METTH/4-171-------------...WQPTVIAGPKQAMLVTP.ETATMMIKKAR---RP--LM-----VVGPLAKR-------------
ACDE_METJA/4-144-------------......TAGSNVAHAEITSP.TLVKMMIRRAK---KP--IL-----ILGENLEE-------------
O67557_AQUAE/619-788-------------RETSTEIGFINGQKVSFEEALQVAVELLSKAK---RP--TL-----IVGPLVLW-------------
ACDE1_ARCFU/7-181-------------.KRFDIADIQVSREATAVKP.KVVANMIKRAK---RP--LL-----VTGGQLLK-------------
O67252_AQUAE/19-183-------------.....GKALMFNEIVDEEIAMREAAKAMLTRD---NP--TI-----FPGPQVLY-------------

PF00205

PDC2_SCHPO/205-338---------------------------------TDIAAELISKKE...KP..IL-----LAGPKLRA-------------
Q4KDI6_PSEF5/219-353---------------------------------LADAVALLRGKR...KP..LL-----ICGGGVKY-------------
Q4WM01_ASPFU/222-353---------------------------------VERIAAALLGAK...RP..LI-----ITGYMGRN-------------
Q4WC96_ASPFU/248-378---------------------------------ILKAAQLLKAAR...AP..LL-----IIGKGAAY-------------
Q4WW88_ASPFU/200-331---------------------------------IDCAADYLSGKE...KP..II-----LAGPKVRR-------------
HACL_ARATH/206-334---------------------------------IESAVSLLRKAE...RP..LI-----VFGKGAAY-------------
ILVB_SPIPL/206-344---------------------------------INQALQLISEAT...KP..LL-----YVGGGAIM-------------
IOLD_BACSU/220-354---------------------------------LQGAAELIKSSK...KP..VI-----LVGGGAKY-------------
ILVX_BACSU/200-335---------------------------------ISAAIAKIQTAK...LP..VV-----LVGMKGGR-------------
ILVBL_BOVIN/273-405---------------------------------VQRCVEILSRAK...KP..LM-----LIGSQALL-------------
IOLD_LISMF/221-354---------------------------------LTEAARLIKASK...TP..VI-----IVGGGARY-------------
Q86ZI4_NEUCS/227-359---------------------------------VQEMAGALAGAK...KP..LV-----VTGYAGRN-------------
O07043_AZOBR/192-324---------------------------------ADEVLAAMRSAT...SP..VL-----MVCVRSAA-------------
O22578_VOLCA/289-422---------------------------------MIPVLRAIQSAS...KP..VI-----YYGGGCL.-------------
O26576_METTH/240-367---------------------------------LRAAADLINRAE...RP..VI-----IAGFGAL.-------------
O28180_ARCFU/201-335---------------------------------VEKAAEMLYNAE...RP..LI-----HAGTGVLR-------------
O28554_ARCFU/190-325---------------------------------IAKAAELIMKAE...RP..VI-----LAGGGVII-------------
ILVBL_CAEEL/277-409---------------------------------IQEIVQLVKSAK...RP..VL-----LIGSQATL-------------
O66759_AQUAE/198-333---------------------------------IKKAAELIMSAK...RP..VL-----YVGGGAVN-------------
O68497_CLOAT/208-342---------------------------------IEKAAIAISRAK...SP..LI-----LSGNGAIR-------------
O87839_STRCO/200-327---------------------------------VERLADLLVHAE...KP..AV-----LLGSQVWT-------------
PDC_ZYMMO/199-331---------------------------------VEETLKFIANRD...KV..AV-----LVGSKLRA-------------
MDLC_PSEPU/190-325---------------------------------LDILVKALNSAS...NP..AI-----VLGPDVDA-------------
DCIP_ENTCL/199-331---------------------------------RDAAENKLAMSK...RT..AL-----LADFLVLR-------------
ILVB_KLEPN/197-331---------------------------------IDQVAKLIAQAK...NP..IF-----LLGLMASQ-------------
PDC1_MAIZE/246-379---------------------------------VEAAADFLNKAV...KP..VM-----VGGPKIRV-------------
PDC_NEUCR/205-336---------------------------------AKCAAEYLDGKL...KP..VI-----LVGPKAGR-------------
ILVB_SCHPO/285-430---------------------------------IDRVANLLKLAK...KP..VI-----FCGHGVLA-------------
POXB_LACPL/202-333---------------------------------VTRLTQTLLAAE...RP..LI-----YYGIGAR.-------------
YEC0_YEAST/195-327---------------------------------IKKVVQLILQHK...NKNILI-----VIGKGAV.-------------
OXC_OXAFO/203-333---------------------------------IARAADLIKNAK...RP..VI-----MLGKGAAY-------------
ILVB_CORGL/216-351---------------------------------IEQAVKLIGEAK...KP..VL-----YVGGGVIK-------------
ILVI_HAEIN/196-331---------------------------------IKKALKALLVAK...KP..IL-----FVGGGAIT-------------
BZNB_PSEFL/194-329---------------------------------LDQALALLRKAE...RP..VI-----VLGSEASR-------------
ILVB_PORPU/206-341---------------------------------ILMAAKMIQQSS...QP..LL-----YIGGGAII-------------
P94896_OENOE/194-330---------------------------------IEFLAGKIRQAK...LP..VI-----LVGQRGSD-------------
YDAP_BACSU/193-321---------------------------------LVTCAQYINNAK...KP..II-----LAGQGMK.-------------
P97113_LEUMC/201-336---------------------------------IHQLVAALSKAR...QP..LI-----ITGAGVLK-------------
ILVB_LACLA/200-335---------------------------------LQELLTELSVSK...KP..VI-----IAGGGINY-------------
ARO10_YEAST/244-383---------------------------------INKITSWIYSSK...TP..AI-----LGDVLTDR-------------
THI3_YEAST/212-344---------------------------------ISRILSFIYKSQ...NP..AI-----IVDACTSR-------------
PDC1_KLULA/201-333---------------------------------IENVLQLIKEAK...NP..VI-----LADACCSR-------------
Q17474_CAEEL/261-391---------------------------------IEKAIDTLKSAK...KP..LV-----IVGKGAAW-------------
Q1LF51_RALME/275-402---------------------------------IEKLADILVNAE...RP..AI-----LYGQQVWT-------------
Q1LM48_RALME/189-317---------------------------------IGAIAEVLNAGR...KT..AI-----YAGSGCE.-------------
Q1M4I8_RHIL3/188-321---------------------------------LDRAADLIAAAK...RP..LL-----MFGAAASR-------------
Q1M4Y3_RHIL3/204-337---------------------------------VVDLAESLLAAK...NP..VI-----LAGQGVLS-------------
Q1MJ71_RHIL3/230-364---------------------------------LANAIALIKASQ...KP..VI-----VAGGGVLY-------------
Q1N3D1_9GAMM/189-317---------------------------------CNEALKLIDDAQ...RI..CI-----LAGIGTA.-------------
Q1NYW7_9FLAO/195-332---------------------------------IKKAATVIKNSS...KP..FI-----LIGQGVIL-------------
Q1QAH7_PSYCK/229-362---------------------------------LDLIVEQLKSAK...NP..VL-----LYGGGC..-------------
Q1R058_CHRSD/190-323---------------------------------LAWAADWLADAE...RP..LV-----LLGGGC..-------------
Q1R095_CHRSD/207-342---------------------------------IKKAVDMMLKAR...RP..VF-----YTGGGIVT-------------
B3XNI8_LACRE/195-331---------------------------------LQKLVELIKNSK...MP..VI-----LVGQRGAD-------------
B3XR89_LACRE/202-331---------------------------------ISRAVDLIKNAK...KP..LI-----ILGKGAAY-------------
A5WFU4_PSYWF/155-291---------------------------------LERVAEALSKAK...RP..AL-----VVGTEIDI-------------
A5WFU5_PSYWF/195-322---------------------------------VEKVLDLLKQSS...RP..II-----YFGRGAQ.-------------
A5WDF4_PSYWF/210-343---------------------------------LAELVEVMSTSQ...NM..AL-----VVGSDVDR-------------
Q1V0A8_PELUQ/195-332---------------------------------IDQLIDLMSKSK...KP..IF-----YTGGGVIN-------------
Q1VVK9_9FLAO/210-345---------------------------------IEAAAALINSAK...QP..LI-----VWGQGIIL-------------
Q1WVB6_LACS1/198-333---------------------------------STLLAQRIKTAK...LP..VL-----LLGMRASD-------------
Q1WVR0_LACS1/195-324---------------------------------ITDALELIKAAK...AP..MV-----YFGIGAK.-------------
A5D4V9_PELTS/192-327---------------------------------VRQAARIIMESE...RP..VI-----YAGGGVRI-------------
Q1YIT6_MOBAS/207-341---------------------------------VGTILDAVANAE...RP..LV-----VTSYVGRN-------------
Q1YIU4_MOBAS/196-334---------------------------------AEAIRAILTEAK...NP..LM-----LVGGSGWT-------------
Q1YKX8_MOBAS/228-407---------------------------------VREIATGLRAAR...RP..VI-----LVGRVSRS-------------
Q1YX19_PHOPR/200-338---------------------------------LNEAADLLAEAK...FP..VI-----ISGGGVVM-------------
Q1ZKY9_PHOAS/187-322---------------------------------ITVAQQLLDQSH...RP..VM-----YVGGGVQI-------------
Q1ZSM4_PHOAS/192-327---------------------------------IRQAADRINAAK...NP..VL-----LLGMDASQ-------------
Q21SN9_RHOFD/191-324---------------------------------IDAAVALLQNAR...KP..GL-----FVGWGAR.-------------
Q21T72_RHOFD/229-365---------------------------------IRKALQLLLAAK...RP..YI-----YTGGGVLL-------------
Q21VK8_RHOFD/229-357---------------------------------LQAALAALAKAE...RP..LL-----VIGSQALV-------------
Q220C3_RHOFD/190-328---------------------------------LTELQERLANAQ...RP..VV-----ILGGSRWS-------------
Q24UP5_DESHY/194-329---------------------------------IAQVAEELSKAQ...RP..LL-----FVGGGVNL-------------
Q24XT7_DESHY/200-336---------------------------------IEEAARVIAQSQ...RP..VL-----YAGGGVIT-------------
Q251L0_DESHY/193-331---------------------------------LDKAAELLISAQ...RP..VI-----ISGRGVVD-------------
Q252I7_DESHY/193-328---------------------------------INKALDCISHSK...KP..VF-----LIGGGVNI-------------
Q28KM5_JANSC/191-323---------------------------------IADAQARLSKAK...RP..LI-----LAGGGA..-------------
Q28SI9_JANSC/198-334---------------------------------AEAAVDAILSAK...NP..LI-----VCGGGVVI-------------
Q28W58_JANSC/189-326---------------------------------IAPMVEAFKLAK...RP..LI-----LCGGPHWG-------------
B8CX18_HALOH/193-328---------------------------------INKAAHEINKAE...KP..VI-----FAGGGVIA-------------
B8CWB0_HALOH/189-317---------------------------------LDRAATSINNTE...KI..SI-----LYGRGAK.-------------
Q2CC29_9RHOB/189-327---------------------------------VAEAAALLAQAE...RP..LV-----VVGGGRWS-------------
A5G0X6_ACICJ/217-351---------------------------------VADVAALLRAAR...RP..VI-----VAGGGVIH-------------
A5FTR0_ACICJ/189-317---------------------------------LDALARDLDSAA...RV..TI-----YAGIGAR.-------------
A5G2E1_ACICJ/199-336---------------------------------IAEAVSALKGAK...RP..II-----YTGGGLIN-------------
A5GC69_GEOUR/192-327---------------------------------LKKAAEIINRAK...RP..LI-----YAGGGITL-------------
A5FR34_DEHSB/193-328---------------------------------IQKAARLIETAE...KP..VI-----IAGHGVNI-------------
Q2F5Z5_BOMMO/217-346---------------------------------VDQAAELLSKAE...RP..LI-----IVGKGAAY-------------
Q2FM35_METHJ/193-328---------------------------------IQRAVDLLLQAK...RP..VI-----YAGGGVIS-------------
Q2G625_NOVAD/195-332---------------------------------IAEAIELIAKAK...AP..VF-----YTGGGVIN-------------
Q2GMZ7_CHAGB/217-331---------------------------------LRILASRLAAAK...NP..LI-----VAGDAVGL-------------
Q2IJB5_ANADE/195-330---------------------------------LKDAAQLMRASS...RP..VV-----YLGGGVRT-------------
Q2IPR2_ANADE/234-362---------------------------------VERIAARLSRAE...RP..VL-----ILGSQALA-------------
Q2J1F2_RHOP2/193-331---------------------------------MDELAALLAGAE...RP..LI-----VLGGSRWS-------------
Q2J6V0_FRASC/199-334---------------------------------VREAAKMISAAR...RP..VL-----YIGGGVLR-------------
Q2JZ22_RHIEC/196-321---------------------------------IAAAAALISGAS...NP..MI-----MVGGGAA.-------------
Q2KTL4_BORA1/228-365---------------------------------LRRAAAMIAQAR...RP..VF-----YGGGGLIN-------------
Q2LXN9_SYNAS/193-328---------------------------------CAAALTMIRTAR...KP..VI-----FAGGGVLR-------------
Q2LXP1_SYNAS/192-327---------------------------------LEKIARALNQSE...RP..VI-----IMGGGVKL-------------
Q2NBF4_ERYLH/186-319---------------------------------LDEAAERIIAAE...RP..LL-----LIGAGANR-------------
Q2NI91_METST/191-326---------------------------------IKRAIETIVESK...KP..VI-----IAGGGVIL-------------
Q2P758_XANOM/197-332---------------------------------LAEALAAIASAE...RP..VV-----YGGGGIAL-------------
Q2RG94_MOOTA/203-338---------------------------------VAQAAAAIGAAE...KP..LL-----FIGGGVIT-------------
Q2RG96_MOOTA/197-332---------------------------------LRSLARILGEAE...RP..LI-----FAGGGVQV-------------
Q2RXQ6_RHORT/213-351---------------------------------MADLASRLAAAE...RP..LV-----IVGGGTWT-------------
Q2S0N1_SALRD/216-351---------------------------------VDRAAAMIEEAE...KP..LL-----YVGGGTIN-------------
Q2S798_HAHCH/191-326---------------------------------LGQARKMIKAAK...RP..LI-----YSGGGVML-------------
Q2SJ09_HAHCH/200-336---------------------------------VHRLLKELAYVQ...KA..TL-----VIGEGCA.-------------
Q2SM62_HAHCH/214-350---------------------------------LQRLNTILRGYQ...RG..VI-----VIGNGCA.-------------
Q2SMT8_HAHCH/219-352---------------------------------LADAIAMIKASK...KP..LL-----VAGGGVHY-------------
Q2U768_ASPOR/207-343---------------------------------LTTVLERIYSAK...RP..LI-----FVDGESRA-------------
Q2UC40_ASPOR/202-333---------------------------------LSAVLKRIYSSK...KP..MI-----LVDGETRS-------------
Q2W471_MAGSA/196-334---------------------------------LDKMVELLAKAR...RP..LM-----LVGGGGWT-------------
Q2WFA8_MONVA/223-356---------------------------------LERIIRLVSASS...HP..VL-----YVGGGCL.-------------
A6LXD5_CLOB8/198-332---------------------------------IEEAASEIFKAK...NP..VI-----LAGSGAIR-------------
A6LPX7_CLOB8/192-326---------------------------------LQEAVGLINQSK...RP..LI-----YAGGGIGI-------------
A6LWS0_CLOB8/194-329---------------------------------LYCIAELINDSK...KP..II-----YAGGGVVN-------------
A6M227_CLOB8/219-353---------------------------------FKECVELITKRK...KP..II-----ICGGGVRY-------------
A6LX01_CLOB8/191-328---------------------------------LDEFVSKLNNAR...KP..VI-----LAGKGVHS-------------
A5W954_PSEP1/196-331---------------------------------IRKAAEMLLAAK...RP..VV-----YSGGGVIL-------------
A5W0I1_PSEP1/200-336---------------------------------CRDIVGKLLQSH...RP..VV-----LGGTGVRL-------------
A5W364_PSEP1/198-328---------------------------------LQRAADILNTGH...KV..AI-----LVGAGAL.-------------
Q877U6_PSEPK/187-320---------------------------------IEAAVEKLQNAR...NP..IL-----VIGAGANR-------------
A5W220_PSEP1/196-326---------------------------------LDQAALKLAAAE...RP..MI-----IAGGGA..-------------
Q2YKW9_BRUA2/216-350---------------------------------LETAAAAIKTAL...KP..VI-----VAGGGVHY-------------
A4XIL5_CALS8/194-328---------------------------------IKRAVEAIENSQ...RP..VI-----CSGGGVIA-------------
A4XHS0_CALS8/191-326---------------------------------IEKAIELINSSQ...RP..FI-----CSGGGVIS-------------
Q30RG2_SULDN/193-328---------------------------------IKKAMEAISKAR...RP..IF-----YLGGGIIN-------------
Q30YW8_DESDG/192-323---------------------------------ARDVLQRVQSAA...LP..MM-----MVGVEVRR-------------
Q31JM5_THICR/186-321---------------------------------IEKAASIIQQAK...KP..LI-----LVGNGAVR-------------
A5EDH4_BRASB/198-324---------------------------------VEKAVELLWSAR...RV..LV-----ISGRGAR.-------------
A5ECG1_BRASB/192-328---------------------------------LQALAQRILRAQ...RP..VI-----ITGDEIVK-------------
Q38UJ8_LACSS/196-325---------------------------------IQQTLQLIKEAK...QP..II-----YFGQGAK.-------------
Q39P46_BURS3/215-348---------------------------------LAAAADLLAHAR...RP..LI-----LAGGGAI.-------------
Q39W78_GEOMG/193-328---------------------------------IEKAVSMLLAAK...KP..VM-----YVGGGAIS-------------
Q3AEQ6_CARHZ/192-327---------------------------------IAEAVKLIREAK...RP..VI-----IAGGGVLA-------------
Q3AEQ9_CARHZ/192-327---------------------------------VNKAIALINSSE...RP..LI-----FSGGGTVN-------------
Q3ALE4_SYNSC/204-340---------------------------------LDRMVSAIQSAQ...NP..II-----LVGDGVAW-------------
Q3ALP1_SYNSC/196-331---------------------------------ILSALELIAEAE...RP..LL-----YLGGGAIS-------------
Q3AM88_SYNSC/188-321---------------------------------LKTAVDILKDLQ...RP..LL-----LLGMQASD-------------
A6TTL0_ALKMQ/192-327---------------------------------LLSAIQMIKTAK...RP..LI-----YMGGGVVR-------------
A6TTM8_ALKMQ/204-339---------------------------------IEKIANMINSSK...RP..LF-----YIGGGILQ-------------
B9LGM6_CHLSY/196-331---------------------------------IREAIKLLISAK...KP..LI-----IAGHGIIM-------------
B9LHS5_CHLSY/482-610---------------------------------LRQVIEMLRKAR...RP..LI-----IAGSGVWW-------------
A6VLE4_ACTSZ/188-323---------------------------------LKSAVELLKVSK...RP..VV-----YVGGGVGM-------------
Q3ICC9_PSEHT/198-333---------------------------------IRKAVTAILEAK...KL..VV-----YSGGGIVI-------------
Q3IS45_NATPD/201-338---------------------------------IATAADYFVEAD...QP..VL-----VLGDHVAR-------------
Q3JBM9_NITOC/217-353---------------------------------IEALCDQIASAK...KV..VF-----VVGEDCR.-------------
Q3K7P6_PSEPF/191-324---------------------------------VSRMTELLAGAR...RP..LI-----LAGGGAI.-------------
A3D4X6_SHEB5/190-319---------------------------------LQELASVINQHE...KV..ML-----FCGHGCR.-------------
Q3SL06_THIDA/197-334---------------------------------VSELAALIADAR...AP..VI-----VAGYGCIA-------------
Q3V892_DESVH/193-328---------------------------------IRRAADAFFEAE...RP..LL-----FVGGGVVM-------------
Q3V893_DESVH/192-327---------------------------------LARAARMLAEAE...RP..IL-----FIGGGVVA-------------
A8L943_FRASN/191-326---------------------------------LRGFAERLSASR...RP..AL-----VFGPEVDR-------------
A8L1M3_FRASN/194-330---------------------------------IAEAVQYIRAAK...QP..VL-----LVGHGVHT-------------
Q3XZD0_ENTFC/193-322---------------------------------LLAALPYLEKAK...KP..VL-----YVGQGTR.-------------
Q3Y3Q3_ENTFC/220-354---------------------------------LSEAVKLIERSL...KP..VI-----IVGGGAKY-------------
Q3YZF7_SHISS/201-329---------------------------------VTSAISLLAKAE...RP..LI-----ILGKGAAY-------------
Q3Z3R2_SHISS/191-319---------------------------------LRKLAQLLRYSS...NI..AL-----MCGSGCA.-------------
A6WFD0_KINRD/239-373---------------------------------IAEAADLIRSAK...AP..LV-----VAGGGVVY-------------
B1YKG0_EXIS2/201-337---------------------------------IDETATLIEQAK...LP..VL-----LLGMRSSQ-------------
Q46SP4_CUPPJ/228-365---------------------------------RARFFDLLGQSR...RP..LL-----YVGGGVIA-------------
Q46VA1_CUPPJ/202-331---------------------------------IDALAERLANAK...RP..ML-----WLGGGAR.-------------
Q471R9_CUPPJ/220-358---------------------------------ANALATALRAAQ...RP..LV-----IAGGANWT-------------
Q47FL3_DECAR/193-328---------------------------------IAQATAMINAAE...RP..IL-----YLGGGVVH-------------
Q47SH6_THEFY/199-330---------------------------------VAAVARLLSEAE...RP..VL-----VYGSDVWL-------------
Q47UP0_COLP3/160-295---------------------------------ISKALDLLTHAK...QP..IL-----YVGGGVGM-------------
Q47YT4_COLP3/192-325---------------------------------LEEAVALIKAAK...MP..LI-----LIGAGANR-------------
Q48634_9LACT/192-327---------------------------------INYLAQAIKNAV...LP..VI-----LVGAGASD-------------
Q4A101_STAS1/192-327---------------------------------VNEVIEAIKNAK...FP..VL-----LAGMRSSS-------------
Q4BWI9_CROWT/189-323---------------------------------LNAAAMAISKAK...NP..LI-----LVGNGTIR-------------
A3DIY4_CLOTH/192-327---------------------------------IDEAAEAINKAE...RP..VI-----LAGGGVSI-------------
A3DID9_CLOTH/192-327---------------------------------IKKIAQAIEKAK...KP..VI-----CAGGGVIN-------------
Q4FTE7_PSYA2/199-331---------------------------------FKQALIAFLPNK...TT..TL-----MADLMVHR-------------
B9KGF5_CAMLR/194-329---------------------------------IKKLVSLIKNAQ...KP..LF-----YLGGGCVA-------------
Q4J6N9_SULAC/197-320---------------------------------LKEAVDFINSCS...KP..IL-----LLGYGA..-------------
Q4J7J3_SULAC/185-313---------------------------------FSKVKELIERSE...KP..VL-----MIGGGAR.-------------
Q4J9P1_SULAC/191-326---------------------------------ITEALKILYSAK...NP..VI-----VCGQGVLL-------------
Q4JAP2_SULAC/203-338---------------------------------VAKVAELLNNSK...NP..VI-----LAGYGVLA-------------
Q4JWD0_CORJK/191-318---------------------------------AARLAKAINDAK...TV..TL-----FCGEGVK.-------------
Q4L7T7_STAHJ/225-360---------------------------------ISQLIQYLENAK...QP..LI-----LAGAGINH-------------
Q4V070_XANC8/193-321---------------------------------VQQLAEILQQSK...AV..TL-----LCGSGCA.-------------
Q4Y789_PLACH/107-235---------------------------------VKQIKQIYKSNS...KG..AI-----FVGTNCN.-------------
POXB_STRPN/196-327---------------------------------IDKAVEILNNAE...RP..VI-----YAGFGGV.-------------
Q5AMN8_CANAL/91-249---------------------------------IDRILGMVSKAS...NP..IV-----LVDACASR-------------
Q5AZE4_EMENI/765-897---------------------------------VELIAQELASAK...EP..LV-----IVGYSGRT-------------
Q5B535_EMENI/204-350---------------------------------VKDAVGLLKAAT...RP..AI-----IIGSGGQG-------------
Q5FHQ7_LACAC/194-323---------------------------------VEEAVKLLKEAK...NP..TM-----YIGAGAK.-------------
Q5FLY7_LACAC/198-327---------------------------------INRAVELLKDAK...HP..VI-----LLGKGSAY-------------
Q5FRZ0_GLUOX/205-342---------------------------------IARTVEAMKTAK...RP..LF-----YTGGGIIN-------------
Q5L322_GEOKA/194-329---------------------------------IRNIKERLERAK...RP..LV-----IAGGGVKW-------------
Q5LKS2_SILPO/192-328---------------------------------VSAIAALLAGAV...RP..VI-----FAGGGFKW-------------
Q5LLG2_SILPO/190-321---------------------------------LDTAAARLDAAR...RT..VI-----LIGGGAK.-------------
Q5LQV0_SILPO/199-335---------------------------------LDVVLGLIRNAE...RP..VI-----IGGHGTWW-------------
Q5NEA3_FRATT/213-346---------------------------------TNLVLEHLSKAK...KV..VA-----IPAIKLDR-------------
Q5NPP9_ZYMMO/193-327---------------------------------VAATIDLIKKAK...QP..II-----LAGHGVAR-------------
Q5QZF0_IDILO/186-322---------------------------------VRHVLELLREAK...HP..VL-----LIGAAANR-------------
Q5R276_DROSE/193-322---------------------------------VIRAAKLLRQAK...RP..LV-----IVGKGSAY-------------
Q5UWG1_HALMA/202-340---------------------------------VKTAITALSEAD...RP..VI-----IAGNGVHA-------------
Q5V522_HALMA/213-348---------------------------------VQEAAEALAEAD...RP..VI-----LSGGGVIK-------------
Q5V5J6_HALMA/187-321---------------------------------VSTAAEHLLAAE...RP..LI-----LAGGGVRA-------------
Q5WGG1_BACSK/191-329---------------------------------IQLAIKALNRAK...RP..LM-----LVGKGAHF-------------
Q5WW44_LEGPL/218-352---------------------------------LAEAIRHIRKAK...QP..LI-----IAGGGVHY-------------
Q5YN72_NOCFA/213-347---------------------------------LEHVRAMLHTARRLGKV..VI-----VAGDQVAR-------------
Q60021_THEAQ/190-323---------------------------------IERALDALEKAE...RP..IL-----MVGGGAQ.-------------
Q601Q2_MYCH2/220-353---------------------------------IEKLVDLIKNAQ...QP..LV-----IIGGGIRY-------------
Q62KX9_BURMA/246-379---------------------------------LDAALAPLRASA...RP..FI-----VAGGGALY-------------
IOLD1_BACCZ/219-353---------------------------------LADAVEMIKRKK...KP..VM-----ICGGGVRY-------------
Q64BR9_9ARCH/196-332---------------------------------TKKAAEVLANAE...RP..LI-----LAGGGIIS-------------
Q64PS7_BACFR/197-332---------------------------------VKAAAELINGAE...RP..LV-----LVGQGVEL-------------
Q67KX7_SYMTH/192-328---------------------------------VAAAAEAIRSAR...QP..VL-----ICGGGVVS-------------
Q6AAK5_PROAC/228-362---------------------------------VVRAAQAIRAAR...CP..LI-----ISGGGTIY-------------
Q6AEP0_LEIXX/219-354---------------------------------ILAAAQLLAEAK...KP..IL-----YVGGGVIR-------------
Q6AJI2_DESPS/239-374---------------------------------ITKACKLLMQAK...KP..VL-----YVGGGVIL-------------
Q6APX2_DESPS/190-328---------------------------------LEKAAELLSKAK...FP..VI-----LNGAGVIL-------------
Q6C6Q2_YARLI/193-323---------------------------------IAEAAALIRASK...FP..LL-----VIGKGAAY-------------
Q6CDI5_YARLI/273-418---------------------------------IQRAANLINQSK...KP..VL-----YVGQGILG-------------
Q6DDN7_XENLA/202-331---------------------------------VNKAVSLLKNAQ...QP..LI-----IVGKGAAF-------------
Q6FDG8_ACIAD/195-324---------------------------------VDFLADQIKQAK...RP..VF-----WIGGGAL.-------------
Q6FJV6_CANGA/193-324---------------------------------IAEVTSLIKEHQ...DKNILV-----VLGKGCI.-------------
Q6FYB3_CANGA/251-392---------------------------------VAKVAQLIYNSS...NP..CI-----LGDVLTDR-------------
Q6G6D5_STAAS/193-322---------------------------------IKKAVKLINKSK...KP..VM-----LIGVGAK.-------------
Q6HKA3_BACHK/204-339---------------------------------LREVAKAISEAK...RP..LL-----YIGGGIIH-------------
Q6HLF6_BACHK/202-337---------------------------------INKLLQAIQVAN...KP..LI-----LAGAGVLH-------------
Q6L042_PICTO/193-329---------------------------------ISKALSLLLNAE...RP..IM-----LVGTGVAW-------------
Q6LK31_PHOPR/222-355---------------------------------IEQAIELLKTAK...NP..VV-----IAGGGLHY-------------
Q6LK45_PHOPR/220-354---------------------------------IEEAKEILLNAE...RP..LI-----ISGGGVHY-------------
Q6LZH8_METMP/193-328---------------------------------IKKAAELMKIAQ...RP..VI-----IAGGGVQI-------------
Q6N2J6_RHOPA/202-339---------------------------------SQAIFDRIAKAE...RP..VI-----FAGGGVRL-------------
Q6N2Y1_RHOPA/196-336---------------------------------IAALLPLIARAK...RP..VL-----VLGGGLST-------------
Q6N3D1_RHOPA/193-319---------------------------------VAAAAKLIAQSK...TP..MI-----FVGSGAL.-------------
Q6N658_RHOPA/218-353---------------------------------VARLVELLQAAK...RP..VL-----IAGNGAAN-------------
Q6NDJ7_RHOPA/202-334---------------------------------IKAAIAILKASE...RP..VI-----VVGGEARY-------------
Q6SGJ7_9BACT/200-328---------------------------------IEELAELVKKAK...RP..ML-----WLGGGSR.-------------
Q6W1J3_RHISN/220-353---------------------------------VNEAIAALSQAH...AP..LI-----IAGGGVRY-------------
Q6ZUX2_HUMAN/198-327---------------------------------VHQAVALLKHAK...SP..LI-----VIGKGAAY-------------
Q70I04_9ACTO/185-318---------------------------------LDGALGLIGSAK...RP..LV-----LAGHGAAV-------------
Q72SH3_LEPIC/221-355---------------------------------LEEFAEAINRSQ...KP..LL-----YVGGGAIN-------------
Q737X8_BACC1/202-334---------------------------------LLHATSKINSAR...KP..VI-----LADFEVAR-------------
Q738G9_BACC1/193-321---------------------------------LDAAKLAINEAK...KP..VI-----LAGKGTK.-------------
Q73CV8_BACC1/203-338---------------------------------ITYVVEKIKAAK...LP..VI-----LLGMRAST-------------
Q73TP3_MYCPA/147-281---------------------------------VERAAQILRNAK...RP..VV-----LAGHGAAR-------------
Q73U45_MYCPA/225-354---------------------------------VDRALDVLADAR...RP..LI-----VLGKGAAY-------------
Q74H96_LACJO/195-324---------------------------------IDKALELIKEAK...NP..II-----YFGHGAQ.-------------
Q757R7_ASHGO/187-316---------------------------------VQGAAKLLQDGR...NI..LV-----VVGRGCA.-------------
Q75PZ0_9BIFI/209-338---------------------------------VDEALKLLSEAK...NP..LM-----LVGKGAAL-------------
Q7CL03_YERPE/186-321---------------------------------LQHAWDMLANAQ...KP..ML-----YVGGGVGM-------------
A2VGF0_MYCTU/208-339---------------------------------TKAAIELIADHQ.......LT-----VLADLLVH-------------
Q7MAQ0_WOLSU/193-328---------------------------------IKKAAESIKHAK...KP..LL-----YVGGGVIA-------------
Q7N5X4_PHOLL/224-358---------------------------------INDAVALINRKK...KP..LL-----ICGGGVRY-------------
Q7NR95_CHRVO/168-305---------------------------------VAAIADLLKQAE...RP..LI-----LAGHGVRI-------------
Q7UHW9_RHOBA/234-369---------------------------------IKQMAAAIKLAR...RP..VI-----YAGGGIIS-------------
Q7VXC3_BORPE/196-334---------------------------------LARMVELLDQAK...RP..FM-----LLGGTGWS-------------
Q7VY25_BORPE/197-335---------------------------------MDQLAQMLAQAK...AP..VA-----ILGGSRWN-------------
Q7WBZ5_BORPA/205-338---------------------------------VRAACRLLLAAE...RP..VL-----HAGAGVLQ-------------
Q7WCV8_BORBR/218-357---------------------------------LAQLAQRLLDAK...RP..LV-----VAGGGVHL-------------
Q7WHS2_BORBR/197-328---------------------------------LDQLAQKVRAAR...RP..LV-----WAGGGAR.-------------
Q7WPE1_BORBR/198-327---------------------------------IAAAAALIGQAR...LP..VL-----YVGGGVFP-------------
Q7WQI4_BORBR/197-333---------------------------------IEQAAARLVGAR...AP..VI-----LCGGGVVI-------------
Q7WQJ5_BORBR/206-345---------------------------------IARAASLLAQAQ...RP..VV-----VAGGGVHI-------------
Q82CK4_STRAW/220-354---------------------------------LAEAVRAIRVAR...RP..LL-----VAGGGVHH-------------
Q82CQ7_STRAW/217-348---------------------------------TAVAAHLLSNAA...RP..AI-----IAGGGVVR-------------
Q82PG6_STRAW/190-319---------------------------------VRRAAELLDRAE...RI..TL-----LVGRGAR.-------------
Q83HI7_TROW8/197-332---------------------------------ADGFFDMLSGSI...RP..VI-----YAGGGTVR-------------
Q845Z6_SELRU/190-325---------------------------------AAEAAREIVKAQ...RP..VV-----IVGGGVVS-------------
ILVI_BUCBP/196-331---------------------------------IKKALHILIKAK...QP..II-----YIGGGIIT-------------
Q89E01_BRAJA/194-322---------------------------------LKALADLLNGAE...RI..TL-----FCGRGCA.-------------
Q89QL7_BRAJA/184-317---------------------------------VKEAAALLVNAK...RP..VI-----YAGQGVHY-------------
Q8A6Q6_BACTN/191-319---------------------------------LIQLAELLNNHK...RI..TL-----FCGIGCR.-------------
Q8DR05_STRR6/200-335---------------------------------IKKILKQLSKAK...KP..VL-----LAGGGISY-------------
Q8EL23_OCEIH/193-321---------------------------------MEKALELIGNAK...KP..II-----LAGTGTK.-------------
Q8ELJ0_OCEIH/199-338---------------------------------AKEIILSLLEAK...SP..VI-----YAGGGVIL-------------
Q8EN64_OCEIH/207-342---------------------------------ITKVNEALKRAE...KP..VL-----LAGAGILI-------------
Q8FQJ5_COREF/209-339---------------------------------LDHAIRVLSEGR...KV..AI-----LAGRGVQ.-------------
Q8G7H0_BIFLO/221-356---------------------------------LSDAAKLFSQSY...RP..VL-----YVGGGAAR-------------
Q8PUJ4_METMA/186-320---------------------------------IETAAGMIREAK...NP..LI-----IVSSGANR-------------
Q8RDJ8_THETN/191-326---------------------------------LSKAVELILESK...KP..VI-----FAGGGVIW-------------
Q8TT45_METAC/203-335---------------------------------VSTIINRLSGAE...KA..CI-----IPGIFVDR-------------
Q8U2A4_PYRFU/195-330---------------------------------VKKAVDMILSAE...RP..VI-----IVGGGVVW-------------
Q92DT2_LISIN/193-321---------------------------------IQEAVTLIDKAE...KP..VI-----LAGLGTK.-------------
Q92NJ5_RHIME/187-325---------------------------------IAKLAELLSTAK...RP..IA-----ILGGTRWS-------------
Q92X67_RHIME/197-327---------------------------------LSRAADLLNAGR...KV..AI-----LAGRGAL.-------------
Q92XQ1_RHIME/191-335---------------------------------LDRIFAMLAAAA...KP..LV-----VVGGSGWS-------------
Q92ZG6_RHIME/197-336---------------------------------LAEVASLIAAAH...AP..II-----IAGGGVHC-------------
XSC_DESTI/194-332---------------------------------LARATEILAAAK...NP..VI-----ISGRGVVD-------------
Q971A7_SULTO/197-333---------------------------------LKKAAEILVNAE...RP..II-----LVGTGVVW-------------
Q97EE4_CLOAB/189-324---------------------------------VEGAIELLLESK...RP..VI-----IVGGGCNI-------------
Q97TS2_CLOAB/199-331---------------------------------VTEIVPIINRAK...KP..VI-----LADYGVYR-------------
Q97UP3_SULSO/187-315---------------------------------LDKAIELIDKSK...SP..VI-----MIGGGAR.-------------
Q97XR3_SULSO/187-318---------------------------------IEFVLDKVKSAS...SI..AI-----VAGYEVSI-------------
Q988P8_RHILO/199-338---------------------------------VERAVKLLLSAE...RP..VI-----VAGGGAIS-------------
Q98CV8_RHILO/243-377---------------------------------LAAAVTALKGAK...KP..LV-----IAGGGVLY-------------
Q9A8Q4_CAUCR/219-353---------------------------------LDDLVGLIKAAE...RP..LI-----VAGGGVLY-------------
Q9CE06_LACLA/194-323---------------------------------IQEAWKILKEAK...RP..LI-----YIGQGTR.-------------
Q9F7L7_PRB01/188-323---------------------------------IDRAVEAILISK...KP..VI-----YAGGGAIA-------------
Q9HJZ5_THEAC/187-315---------------------------------PGAAEKIINESK...KP..LL-----FVGRGII.-------------
Q9HK28_THEAC/167-303---------------------------------VNRIAQAINESE...NP..AI-----IFGSEIDE-------------
Q9HKB0_THEAC/203-342---------------------------------IRKAVDFILQHE...KI..LI-----LAGGGVRL-------------
Q9HTQ7_PSEAE/190-318---------------------------------LQDVARLLAHGK...KI..GI-----YAGSGCQ.-------------
Q9I207_PSEAE/198-328---------------------------------LEAAAAILNRGR...RV..AI-----LAGAGAL.-------------
Q9K659_BACHD/188-324---------------------------------VKQAARELTELK...NG..IV-----FIGQGVR.-------------
IOLD_BACHD/219-353---------------------------------LKGAADLIKKSK...RP..LL-----VVGGGAKY-------------
Q9L123_STRCO/189-324---------------------------------RRWLVEQVASAR...RP..AL-----VLGGDIDS-------------
PDC3_SCHPO/210-342---------------------------------VDISAKIVNGKQ...KP..VL-----LAGPKLRS-------------
Q9WZ18_THEMA/197-332---------------------------------IKKAVELLKESK...RP..VV-----IVGGGANL-------------
YGK4_SCHPO/192-322---------------------------------LQKAAYYLKNAK...AP..LL-----VVGKGAAY-------------
Q9ZBT3_STRCO/192-320---------------------------------IDRLVRMIDDAD...KV..TL-----FCGSGTA.-------------
Q9ZIA9_LEULA/196-332---------------------------------LDWLAEQIKQAK...LP..VL-----LVGARGSD-------------

PF02233

NNTM_BOVIN/618-1080LANVILGGYGTT.STAGGKPME..ISGTHTEINLDNAIDMIREAN---SI--II-----TPGYGLCA-------------
PNTB_HAEIN/4-474FVSVIAGGFGNDVQVSSSE.....EQGEHRETTAEEVAELLKNAS---SV--II-----TPGYGMAV-------------
PNTB_SHIFL/4-462FISVIAGGFGTDGSSTGDDQ....EVGEHREITAEETAELLKNSH---SV--II-----TPGYGMAV-------------
Q18031_CAEEL/573-1036LLNVILGGVGTK.SKGTGEAKA..IEGTAKEIAPVETADMLLNAR---SV--II-----IPGYGLCA-------------
Q24813_ENTHI/17-526FMSVIFGGFGATPSKTRNQEDE..GPKEANTIQTPELAKLLMEAY---NI--AI-----VPGYGMAV-------------
P73500_SYNY3/4-464FISVILGGFG.EGSSAASKGPAQEVIGTVTKTSAEEVAEELLDAQ---SV--II-----TPGYGMAV-------------
Q9ZE72_RICPR/4-462LIKVIFGAFLPPP.TGINKDIC.D.DKIAKISTPEEAAHLLLNAS---SV--II-----VPGYGMAV-------------
PNTB_RHORU/4-463IFNVILGGFGSEGGVAAAGGAA.G.DRSVKAGSAEDAAFIMKNAS---KV--II-----VPGYGMAV-------------
P96834_MYCTU/5-472IPAIVAGGFGGGGVAPSGGGD....DKHVKATSAADAAIQMAYAN---QV--IV-----VPGYGLAV-------------
Q07600_EIMTE/3-459LWNVVLGGFEEAEDVGAASPQ.....GAVQQATADQVADELLAAR---KV--LI-----VPGYGMAV-------------

PF02146

SIR2_TRYB2/37-220------------------------------------GAGISVAAG---IP--DF-----RSPHTGLY-------------
SIR2_LEIMA/39-223------------------------------------GAGASVAAG---IP--DF-----RSSDTGIY-------------
SIR2_DROME/229-434------------------------------------GAGVSVSCG---IP--DF-----RS.TNGIY-------------
SIR2_CANAL/246-437------------------------------------GAGISTSLG---IP--DF-----RS.FKGLY-------------
NPD_PYRHO/20-197------------------------------------GAGISAESG---IP--TF-----R.GKDGLW-------------
NPD_BACSU/19-198------------------------------------GAGMSTESG---IP--DF-----RS.AGGIW-------------
NPD_STAA8/23-198------------------------------------GAGVSVASG---VP--DF-----RS.MGGLF-------------
SIR2_CAEEL/153-334------------------------------------GAGVSVSCG---IP--DF-----RS.KDGIY-------------
NPD2_ARCFU/23-198------------------------------------GAGISAESG---IP--TF-----R.GEDGLW-------------
SIR42_CAEEL/35-243------------------------------------GAGISTESG---IP--DY-----RSKDVGLY-------------
SIR2_KLULA/318-534------------------------------------GAGISTSLG---IP--DF-----RS.SEGFY-------------
NPD_MYCTU/8-184------------------------------------GAGISAESG---VP--TF-----RDDKNGLW-------------
SIR2_YEAST/262-478------------------------------------GAGVSTSLG---IP--DF-----RS.SEGFY-------------
E9YAJ6_ECOLX/48-221------------------------------------GAGISAESG---IR--TF-----R.AADGLW-------------
SIR2_SCHPO/164-380------------------------------------GAGISTSLG---IL--DF-----RS.DNGFY-------------
O94066_CANAX/26-208------------------------------------GAGISTGAG---IP--DF-----RSPDTGLY-------------
NPD1_ARCFU/20-192------------------------------------GAGVSAESG---IP--TF-----R.GKDGLW-------------
NPD_AQUAE/11-183------------------------------------GAGISAESG---IP--TF-----R.GKDGLW-------------
NPD_AGGAC/10-177------------------------------------GAGISAESG---IP--TY-----R.AEDGLW-------------
SIR41_CAEEL/35-243------------------------------------GAGISTESG---IP--DY-----RSKDVGLY-------------

PF13289

C3WEJ8_FUSMR/103-239---------------------------------ETIFTINFDGIL---EN--NF.....SDKIEKIT.............
E0WKU6_LISGR/186-358---------------------------------PKIFTLNYDTLF---EQ--AA.....EENGYMIIDGFSFNF......
B8FFN4_DESAA/108-257---------------------------------KTVITTNYDRLL---ED--AF.....NQEGVDYL.............
C2VLS5_BACCE/130-263---------------------------------DFVLTTNYDNAL---SV--YR.....QEYNTPSP.............
C7RFY6_ANAPD/212-382---------------------------------LSIVTTNYDTLF---EE--AA.....ESLNFTVMDGFSFTAKP....
C7RVA1_ACCPU/142-298---------------------------------PLTINYNFDDSV---ER--MLGHTYSAEQEACNE.............
A1TX65_MARAV/101-247---------------------------------RAIFTTNYDMLV---ER--CY.....TLNRDPMQSL...........
C6JRB3_FUSVA/103-240---------------------------------ESIFTMNYDVMI---EQ--LF.........TNLV.............
A6DRE2_9BACT/143-270---------------------------------VRIVTTNFDKLF---TD--TL.....GAKKFNVE.............
C6I4U2_9BACE/102-244---------------------------------QRIYTTNYDNVF---EL--AC.....EKNKKKIQ.............
D1AZA4_SULD5/145-284---------------------------------DGIITTNYDLLI---ES--IF.....PDFKPFIG.............
C3JCK6_9PORP/114-255---------------------------------TKIITTNYDRAF---EV--AV.....PQLQSQKA.............
B8EJ27_METSB/100-273---------------------------------PVLVNAWYDDLL---QK--AFAGRADWGMAQGVSQAEHFG.......
B0NWG4_9CLOT/150-288---------------------------------VKVITTNYDKLL---EK--LA.....GNANCQSI.............
Q1BDR9_MYCSS/245-384---------------------------------RRMVTTNFDSCM---EE--AL....KAPAGERFR.............
A9KVJ0_SHEB9/173-321---------------------------------DSIITYNYDDLM---EQ--CL.......RNIDVD.............
B7J5Y3_ACIF2/103-252---------------------------------DTVITTNYDRLL---EQ--SF.....ETGEAGGV.............
D2R627_PIRSD/146-286---------------------------------SLAITTNYDCLL---ES--AY.....HSSVPRLT.............
Q6ALX8_DESPS/166-342---------------------------------TTFFTTNYDTLL---ED--AL.....ALHKKAVCDGFSGGA......
A6G3D2_9DELT/43-176---------------------------------PLVVTTAYDMWI---EH--IC.....PDSSPESY.............
C6B833_RHILS/108-250---------------------------------PFIYTTNYDANL---EA--AY.....EAFGKPYV.............
A0QRW8_MYCS2/295-432---------------------------------SEAVTTNYDNLF---ET--AY.....KTRGRDVA.............
C3WNE7_9FUSO/40-180---------------------------------SSIISTNYDYTL---EE--NF.........LNLI.............
Q0YTA6_9CHLB/271-402---------------------------------RAIITFNFDDLI---EE--NL.....AKEKIEFK.............
D4G637_BACNA/107-249---------------------------------AHVITTNYDNLI---DT--AC.....WKRGKYFSV............
B3PHQ7_CELJU/121-268---------------------------------TRLITTNFDQLF---EE--VI.....SRKGLKVE.............
B1IFA3_CLOBK/211-355---------------------------------SKIINYNYDDTL---YH--SL.....REVGQFFK.............
B2RK70_PORG3/130-279---------------------------------KKVITTNYDLAM---DK--TV.....GWADCHII.............
E6TR41_BACCJ/246-381---------------------------------NFYLTTNYDLIL---SK--YL.....SKFNEYTS.............
A3IA13_9BACI/104-251---------------------------------DTYWTTNYDSLI---ED--TL.....ETIGKKVD.............
C7HAZ7_9FIRM/289-441---------------------------------FRILSYNYDDFL---EQ--YL.....AFLDVKCCSIFT.........
C4ZMZ3_THASP/323-497---------------------------------LLIITTNYDTLI---EQ--VF.....RNAQKPYDLVVYSELKEL...
B1GAX3_9BURK/115-258---------------------------------QTVWTTNFDGLI---AR--AA.....AATNLTPI.............
Q1D4W8_MYXXD/1238-1377---------------------------------RAILTTNYDQLL---EL--TP.....EMPRRQPY.............
B8I4A6_CLOCE/97-241---------------------------------KEIYSVNFDDLV---EQ--SY.....KSYRGLYDC............
A0LH81_SYNFM/83-241---------------------------------RLYVTASLNSFL---SD--AL.....RRSGKAPQEV...........
B0UD07_METS4/36-185---------------------------------RHIITTNYDPCI---EL--AM.....RRAGRSFTPI...........
B3JQ32_9BACE/138-309---------------------------------LNVISTNYDRIA---EY--AA.....CQTDAYINIGFTHGL......
D2B798_STRRD/104-265---------------------------------RVFLTTNYDNFL---ME--AL.....AGEGKAAHTAI..........
A7GBJ3_CLOBL/118-257---------------------------------KDIFTTNYDTLL---ER--AS.....ENIITTTYN............
A9FD38_SORC5/122-271---------------------------------RLVITTNYDQIL---RY--AL.....DDPNDLVQ.............
C3HSI6_BACTU/106-242---------------------------------KKIVTTNYDDLF---EK--AY.....GKKDISVI.............
C3J834_9PORP/142-278---------------------------------GSVITTNYDSLI---EE--LF.....EFNP.................
D0LP08_HALO1/119-264---------------------------------PRLVTTNFDNLF---KR--AA.....NANNVKIV.............
C2NSI3_BACCE/166-312---------------------------------QIILTTNYDKLI---ED--IF.....VEGDEALNPQ...........
B5UXF8_BACCE/31-164---------------------------------SFYITTNYDMAL---TD--YR.....SENVSPYC.............
C1M7E6_9ENTR/499-661---------------------------------PVYITTDPSDLL---ID--AL.....REEGKAPKVRLFRWN......
Q21D17_RHOPB/114-255---------------------------------SIYYTTNYDNFI---ER--AL.....NKRGRPCQ.............
A8SDW3_9FIRM/117-269---------------------------------PYAYTINFDDGI---EQ--SV.....PEGNTKFR.............
Q6DF29_XENTR/142-286---------------------------------ALVLTTNFDNLL---EI--YA.....IHQGKQLE.............
Q4QK39_HAEI8/178-326---------------------------------TPIITTNYDNIL---ST--VY.....QKCDYPFS.............
A7K172_VIBSE/104-251---------------------------------TSFVTTNYDNLI---EE--SV.....RKWLPDKFFR...........
Q223H0_RHOFD/193-348---------------------------------GCIVTTNFDDAI---EK--TY.....EGATHQGKQLV..........
C8NLF5_COREF/112-260---------------------------------TSLVTLNFDNLL---EI--AL.....EREAHEKA.............
A4N3X2_HAEIF/175-323---------------------------------ETIITTNYDDLL---KK--IY.....ADQDIHFDQE...........
A6G812_9DELT/112-246---------------------------------RGVVTPNLDRVL---ER--AF.....ESRLVPHL.............
A4X0P5_RHOS5/105-260---------------------------------KFIWTTNYDRLI---ER--AF.....GGVNRPID.............
A1SJK6_NOCSJ/125-273---------------------------------DAILTTNFDPFL---VG--SV.....PGPDAYQQ.............
A6STW5_JANMA/147-314---------------------------------VEIFTTNYDLLF---EE--SF.....ERARAPYFDGFSGGS......
Q48B89_PSE14/9-154---------------------------------KTIYTTNYDNLI---GQ--SF.....ALHRQSIN.............
Q2RM32_MOOTA/133-297---------------------------------NEIITTNYDTCM---EK--AY.....EKSFNRNFTSR..........
Q0W7V8_UNCMA/109-246---------------------------------EVIVTTNYDKLF---EM--AY.....ANNILKIV.............
C6I9L2_9BACE/137-277---------------------------------DSVWTTNLDDLV---VT--AC.....IGNGIQAI.............
Q54CK8_DICDI/935-1078---------------------------------QEIVTTNYDQCF---EI--AS.....RSIGKEIC.............
B1MA98_METRJ/103-241---------------------------------GVLYTTNQDNQF---EL--AS.......SKKGRPHR...........
Q5V033_HALMA/150-286---------------------------------HAVITTNYDTFL---ED--FI.....FQDYERVI.............
B9Y0H1_HELPX/107-243---------------------------------KNLITTNWDNLF---EQ--AI.....NEEGRFFN.............
A5L0C3_9GAMM/214-366---------------------------------SCVVTTNFDRLI---EK--KF......ELVSGKPLS...........
C1ERC3_BACC3/124-262---------------------------------INIVTTNYDNIL---SE--YV.....LKDNRRVI.............
C8X684_NAKMY/91-246---------------------------------TSILTTNYDWIL---EL--AI.....EGLGIKASD............
B2IE38_BEII9/105-265---------------------------------PLVVHAWYDDLM---LQ--ALAARDNWGFVQAVSQAEHLA.......
A3YXQ6_9SYNE/63-205---------------------------------QLVMTTNFDKLY---EN--RA.....NQLQANTVIV...........
F0QDG8_ACIAP/134-282---------------------------------PCVFTTNFDSLI---ES--AATIASQLLPASERGTP...........
C1DSG4_AZOVD/112-256---------------------------------RIILTTNFDLFL---EK--AW.....DEVNSDST.............
C2LUJ2_STRSL/225-405---------------------------------FSIITTNYDVLI---EE--AA.....EENNFVIFDGFNFTPLP....
Q6MH60_BDEBA/224-370---------------------------------NGVITTNFDEVL---EK--TY.....ALKSRPLD.............
A6G9A9_9DELT/1210-1344---------------------------------RAVMTTNVDTLL---ER--AF.....KGRWWSTA.............
D4KUN5_9FIRM/115-253---------------------------------KNIYTVNIDDLV---EN--IY.....EEQGENIV.............
A7BSX6_9GAMM/390-563---------------------------------LMIIYAGYDSSL---ED--TF.....LQAQKKFVVLSHSHHSHEIGT
A7ABF7_9PORP/141-280---------------------------------KSVWSTNFDGLV---ER--AA.....QQANITPI.............
A5MFE1_STRPN/104-240---------------------------------KHIITTNYDSLL---ES--QF.....ESGLLKYN.............
A9GWR7_SORC5/128-261---------------------------------RAVLTTNLNHLL---ER--AF.....GFEWDTMW.............
C4L4F1_EXISA/106-243---------------------------------THIITTNYDTLL---EE--AA.....IEEGQFFH.............
C7X7Y0_9PORP/105-251---------------------------------KAIVTTNYDTII---EK--AY.....SYSSKKRQTLV..........
A8IIJ2_AZOC5/116-266---------------------------------PMIVDTWYDGAM---RA--ALAERSDWGEAQGITRAGIGED......
B7ITB3_BACC2/116-253---------------------------------NTVVTTNYDDLL---RI--YL.....GQKGFIAQNLC..........
D1A4U2_THECD/106-274---------------------------------PMYLTTNYDDFM---AR--AL.....REAGRSPRVLSCP........
A9G7D0_SORC5/160-352---------------------------------TEIITTNYDTCI---EQ--AF.....RESFGPTDDAKSAAR......
D3F474_CONWI/122-259---------------------------------KVVFTTNYDKLF---EV--AS.....KSGFAAHS.............
E3IX96_FRASU/105-267---------------------------------AVYVTTSYDDFM---VT--AL.....RQEGRQPRALVC.........
B0RMG9_XANCB/115-257---------------------------------RFTITPNFDAIY---DT--YV.....KKETGNTILV...........
Q38324_9CAUD/146-291---------------------------------RFIVTTNYDNFI---EE--CF.....SKRNVSIK.............
B8K7Z1_VIBPA/98-239---------------------------------FRVYTLNIDDAF---EK--AA....LNQSNRFFN.............
A9G5J6_SORC5/116-251---------------------------------RAVLTTNLDRFL---VR--AF.....KGEWSELT.............
B0VP62_ACIBS/101-247---------------------------------KAIFTTNYDEAI---EK--AY.....RENKSALQKI...........
C2T6L1_BACCE/106-260---------------------------------RKIWTTNYDDFL---EK--AYL...DDNKVIDVK.............
A3NCJ6_BURP6/175-318---------------------------------KTAFSFNIDDAL---EA--AY.....ESQQRPRQ.............
C5BPH6_TERTT/174-345---------------------------------VNIFTTNYDTLL---ED--AL.....ALNKIPYWDGFD.........
Q468D1_METBF/112-267---------------------------------SVYITTTYDDLM---VQ--AL.....KSRGKTPIQEICRWN......
A9GGY2_SORC5/142-276---------------------------------RAVITTNYDSLI---ED--AW.....PLPRPAAY.............
C7RS50_ACCPU/115-274---------------------------------PLVVTTNYDNCY---AA--AL.....CRFAAGRDFA...........
Q74DF6_GEOSL/136-280---------------------------------KVVFTTNFDDVI---ET--AF....SDISGKHLS.............
D5SSN9_PLAL2/125-270---------------------------------VAALSSNYDGLI---EG--AY.....ALETGGIVP............
C2W2L4_BACCE/159-308---------------------------------CLFITTNYDNQI---EK--HSE...TKGQGMSIY.............
A9E6S3_9FLAO/103-241---------------------------------KTIITTNYDKLF---ES--SY.....ESLNHNVI.............
C9XIG8_CLODC/103-255---------------------------------STIWTTNYDMLL---ED--AF.....YDFDTSVK.............
A3ZR10_9PLAN/69-211---------------------------------ADVFTTNYDRML---EW--AT.....RSRSSKTL.............
C5P7U6_COCP7/141-273---------------------------------AILVTTNYDHIL---DD--HG....EKLRSISPS.............
A9NH35_ACHLI/152-331---------------------------------IEIFTTNYDLLL---EK--AL.....EDREIPYFDGFIGS.......
D2SD45_GEOOG/295-434---------------------------------QEFVTTNYDPLV---EL--AA.....ADIGRDLS.............
B6W7K6_9FIRM/106-236---------------------------------IRIVTTNYDIML---ES--AL.....EKKGRKAN.............
Q5Y0K2_9ARCH/104-253---------------------------------KLIFTTNFDLLI---EK--AL.....EEEGLKRDKDF..........
C4X9G7_KLEPN/110-254---------------------------------RIILTTNFDKLI---ES--AW.....TSSLADGDRHF..........
D2SAI3_GEOOG/505-643---------------------------------PIYVTTTWNSLL---ED--AL.....VDAGRPPVVGSF.........
D3PB24_DEFDS/122-262---------------------------------ALFITTNIDSHF---HK--YF.....EPANIVFK.............
A8V433_9AQUI/117-295---------------------------------LILFTTNYDLIL---EE--AF.....SPKSSDIHQKWIERG......
B1IFA2_CLOBK/117-257---------------------------------DTIITTNWDDYF---ER--YC........NATPI.............
A4INT2_GEOTN/98-236---------------------------------PVIYTTNQDNVM---EK--AF.....EKYGRKYRT............
A6UN29_SINMW/117-268---------------------------------PIIVTTNFDTLF---ER--SL.....MVSHSAAFAT...........
Q7BQV0_9ENTR/132-298---------------------------------INIVTTNYDRLA---EY--AC.....DQEGTHHYTGFSH........
A9KLI0_CLOPH/125-265---------------------------------GLLITTNYDKVI---EK--IF.....TLHEKVIT.............
B4BSV3_9BACI/147-291---------------------------------VTVITTNYDTFL---ED--HI.....FVNHKRLI.............
C1FU09_CLOBJ/116-249---------------------------------QVYLTTNYENLI---YE--HL.....RCKNIPIL.............
A9G4K5_SORC5/114-247---------------------------------KAVLTTNIDRFL---ER--AF.....QGEWRMID.............
A9GB97_SORC5/76-223---------------------------------STIYTTNFEHHI---EE--AL.....RDAGKEAVA............
A6WPG0_SHEB8/65-208---------------------------------SIVASPNFDNIY---DT--YA.....LTTSGSSV.............
Q3BK53_9PROT/118-263---------------------------------HRVVTTNFDDRF---ER--AK.....PGLKWQAA.............
Q2YAQ1_NITMU/270-428---------------------------------DSIITYNIDALM---SE--AL.....AEQKIPHAA............
A1BG00_CHLPD/160-328---------------------------------SEIFTTNYDYLF---EI--AL.....EDSGIPYFDGFSGS.......
D2KYA1_CORGT/132-278---------------------------------DTIFTTNWDTNV---ED--YC........AATPF.............
D1PKF2_9FIRM/165-305---------------------------------KVVVTTNFDRLT---ED--AV.....TLYAHEFS.............
C4UA68_YERAL/102-244---------------------------------PIIYTTNYDRWI---EN--SL.....ENYGKQFI.............
D0GZ99_VIBMI/58-197---------------------------------NMIVTTNWDNVL---EN--IF.......DGLANV.............
A4YZ71_BRASO/96-242---------------------------------KSIFTTNYDDLV---EQ--CY.....HRRNLPIS.............
B1Q6E3_CLOBO/113-269---------------------------------HHIITTNFDCLI---EM--SL.....EKNNIYGC.............
C0ZNB5_RHOE4/283-422---------------------------------KKVVTTNYDALY---ER--AF.....ESAHGENS.............
A6DXW7_9RHOB/85-232---------------------------------RRIYSLNVDNCF---ES--AFASVVEAHEFSSSS.............
C7VB26_ENTFL/149-285---------------------------------ASFITTNYDSQI---EN--NF......KQGFGTYPE...........
C4UXP5_YERRO/145-292---------------------------------HAIITTNYDDLL---EK--VF.....DNYQPIVG.............
A6GR96_9BURK/96-234---------------------------------PQIVTTNFDRLF---EG--RD.....QEEHTYEP.............
D0LGB9_HALO1/120-267---------------------------------ELMITTNYDSVL---RW--AG.....PKDVQIVA.............
B5UXD5_BACCE/105-241---------------------------------KYFFTTNIDDLP---QR--IF.....EGSGDKFLN............
A6SWS4_JANMA/63-201---------------------------------ICIVTMAYDKLV---EA--LT.....DKRKYHSI.............
Q6NBK9_RHOPA/152-303---------------------------------PIYITTNYDVLF---EK--AF.....KEIHRGGKIP...........
C6J830_9FIRM/113-258---------------------------------NSIWTTNYDKSI---ET--EL.....GKKCIPHN.............
D9SP56_CLOC7/120-256---------------------------------DIFLTTNYDHLL---SD--YL.....NSNYVPVK.............
D1RZ28_SEROD/104-261---------------------------------SSLWTTNYDDLF---EK--TY.....ARYNRVCD.............
Q12QQ9_SHEDO/90-229---------------------------------LKFITTNYDLLI---EN--EL.....LGLDKATS.............
E0TDM6_PARBH/151-296---------------------------------DIVWTTNFDRLV---ED--AA....AAKFETTGR.............
Q1Q2W8_9BACT/165-308---------------------------------SAVITTNFDNAI---EL--CN.......NSIRLL.............
D4B7J4_9ENTR/118-255---------------------------------SEILTTNWDSLL---ER--TS.....AEVHSPVY.............
D2SB42_GEOOG/148-291---------------------------------RAFITTNYDDLL---ET--AY.....VRTQRKVL.............
B7L3H7_METC4/126-276---------------------------------LHYLTTNFDPCI---AS--AL.....RAAGKPNKVI...........
B9JR52_AGRVS/164-337---------------------------------VHLFTTNYDLLM---EQ--AL.....EESSAPYFDGF..........
A7VYZ2_9CLOT/121-240---------------------------------KRVWTTNFDALT---ET--AI.....NIINPQQELLI..........
C2ZYS5_BACCE/126-295---------------------------------AIYITTNYDECL---DR--IA.....KEVENSRKLDEDINTNV....
C0ZFK0_BREBN/117-254---------------------------------NTFLTTNYDDLL---YQ--YL.....QGEKYHPI.............
C8PPW3_9SPIO/130-269---------------------------------NTVWTTNFDDLI---EK--AI.....NGLNYTSC.............
A1A364_BIFAA/140-287---------------------------------VHLATLNFDLLL---EY--AI.......ARIAVD.............
A4CA56_9GAMM/100-236---------------------------------QHIITTNWDDLL---EK--SI.....SSNGDLYF.............
D4J271_BUTFI/140-278---------------------------------SGVITTNYDKLL---ED--VF.......DGYASY.............
A1F0G4_VIBCL/160-327---------------------------------NEVITTNYDCNF---EK--AYVE.LSGGSNSDVI.............
B5WD67_9BURK/102-236---------------------------------RTIWTTNFDGLV---SR--AC.....TAANVVCV.............
Q08QJ5_STIAD/174-316---------------------------------SAWVTTNYDKLL---ER--AYS...EVKGGFPKT.............

PF00766

ETFA_THETC/205-290------------------------------------VVN.LEEAD-------II-----VSGGRGIG-------------
Q7CSV6_AGRT5/187-273------------------------------------RPE.LTSAK-------II-----ISGGRALG-------------
FIXB_AZOC5/234-319------------------------------------KSN.LAYAD-------VV-----VAGGLGLG-------------
Q7RVY2_NEUCR/223-309------------------------------------RPD.LSTAE-------KV-----VSGGRGLK-------------
Q6AIQ0_DESPS/306-391------------------------------------DID.ISSTE-------FI-----VAGGRGMM-------------
Q978W1_THEVO/215-300------------------------------------STD.LTSAK-------IV-----VAGGLGLG-------------
FIXB_CLOSA/206-291------------------------------------IVD.ISEAK-------II-----VAGGRGVG-------------
ETFA_CLOAB/210-295------------------------------------IAD.IGEAK-------VL-----VAGGRGVG-------------
Q83RF6_SHIFL/188-274------------------------------------SVD.LSKAK-------RV-----VGVGRGLA-------------
Q8NKM5_9CREN/280-377------------------------------------KVD.FSNKK-------II-----VSFGRGIK-------------
Q83QD8_SHIFL/174-256------------------------------------DP..LAEAR-------RV-----LVVGQGGE-------------
Q8KZQ0_BUTFI/219-304------------------------------------TVD.IMDAK-------IL-----VSGGRGVG-------------
Q7NG11_GLOVI/221-307------------------------------------QVE.LQGAE-------VI-----VSGGYGLG-------------
FIXB_RHISN/234-319------------------------------------NAN.LAYAD-------VV-----VAGGLGLS-------------
Q9Y966_AERPE/222-307------------------------------------EVP.IEKAE-------VI-----VSGGRGLG-------------
Q8RMW1_AZOBR/227-312------------------------------------EAH.VAFAD-------II-----VAAGKGLG-------------
ETFA_YEAST/218-304------------------------------------RPE.LTSAQ-------NV-----VTGGRALK-------------
FIXB_SHIFL/189-275------------------------------------SVD.LDKAR-------LV-----VSVGRGIG-------------
Q9HL11_THEAC/441-526------------------------------------FKP.LEGSR-------LI-----LGIGRGLK-------------
FIXB_AZOVI/228-313------------------------------------KPN.LPFAD-------II-----VAGGRGLR-------------
ETFA_ORYSJ/233-318------------------------------------RPD.LANAP-------VV-----VTGGRGLK-------------
Q7MVI3_PORGI/207-292------------------------------------MVD.ITEAH-------IL-----VSGGRGVG-------------
Q9FA09_GLUDI/231-317------------------------------------EAEQMAFAD-------IV-----VAGGMGLR-------------
Q8FQ06_COREF/191-277------------------------------------RPE.LPQAK-------VV-----IAGGRGVG-------------
Q8XNM1_CLOPE/270-355------------------------------------EHS.ISDAE-------VI-----VVAGRGVK-------------
Q8ZYL5_PYRAE/218-303------------------------------------LPP.VESAD-------IV-----VAGGRGLG-------------
ETFA_SCHPO/219-305------------------------------------RPD.LSSAE-------RV-----VAGGRPLK-------------
Q750K5_ASHGO/222-308------------------------------------RPE.LGSAK-------RV-----VSGGRGLK-------------
Q97G29_CLOAB/269-354------------------------------------EEN.IADAE-------VI-----VSVGRAVK-------------
Q749E7_GEOSL/207-292------------------------------------HVD.LAGAE-------FI-----VSGGRGMM-------------
Q6US86_RHORU/233-318------------------------------------EAH.LAYAD-------IV-----VAGGLGMG-------------
ETFA_HUMAN/209-294------------------------------------RPE.LTGAK-------VV-----VSGGRGLK-------------
ETFA_MEGEL/208-295------------------------------------GVK.IEDAD-------VI-----VAGGRGMN-------------
Q9X1L7_THEMA/206-291------------------------------------QVN.LEYAP-------VV-----VAGGKGVG-------------
Q892L4_CLOTE/208-293------------------------------------EIA.LEEAN-------II-----VSGGRGLG-------------
Q8D6Q4_VIBVU/200-285------------------------------------RPD.LPNAR-------VV-----VSGGRGLG-------------
Q896M7_CLOTE/271-356------------------------------------EED.ISEAD-------VI-----VVAGRGIK-------------
Q897M1_CLOTE/208-293------------------------------------VMD.IGEAE-------FL-----VAGGRGIG-------------
Q8XI26_CLOPE/207-292------------------------------------IVD.ISEAN-------VL-----VAGGRGIG-------------

PF01916

DHYS_HUMAN/42-356---------------------------------YRALLEAFGTTGFQAT.--NFGRAVQQVNAMIEKKLEPLSQDEDQHA
DHYS_YEAST/45-377---------------------------------ATDLIEAMKTMGFQAS.--SVGTACEIIDSMRSWRGKHIDELDDHEK
DHYS_METJA/25-330---------------------------------EEIIKKYYLKIGFQAS.--HIGKAIKIWKHIEEKR............
DHYS_PYRHO/31-334---------------------------------EEVVS.YYYRIGFQAT.--HLGRAIEIWRKVEEKR............
DHYS_NEUCR/43-348---------------------------------VDDLLQGMKHMGFQAS.--SMCEAVRIINEMRAYR............
DHYS1_ARCFU/14-296---------------------------------VSELLDMFGSTAFNAR.--RLGEAAKICEEMVKSD............
DHYS_METTH/17-305---------------------------------VAELIEEMGRSGVLGAG--RVHRATKLLRGMIDDL............

PF02552

ACDE2_ARCFU/2-172--------------D-E--.MFE--RVK------------------KFVEK-DITVVATGSAITRFI-D-----------
ACDE_METTH/4-171--------------Q-E--VLEH--TVK------------------IIRHF-DLPVVATADTYRALS-E-----------
ACDE_METJA/4-144--------------N-E--.KEL--ISK------------------LIEKF-NLKTIKTP.......-.-----------
O67557_AQUAE/619-788--------------A-W--NEEA--KKK------------------GEIIK-RLKEKYPN.....LN-I-----------
ACDE1_ARCFU/7-181--------------D-E--KLVE--FAV------------------KFAEK-GIPIAATAGSSKPLI-E-----------
O67252_AQUAE/19-183--------------A-W--NEEA--KEK------------------AKLVR-KMAEVLGA......K-I-----------

PF00205

PDC2_SCHPO/205-338--------------A.G..AESA--FVK------------------LAEAL.NCAA.FIM-----PA-A..---------
Q4KDI6_PSEF5/219-353--------------A.A..ANQA--LQA------------------FAERF.AIPV.AET-----QA-G..---------
Q4WM01_ASPFU/222-353--------------P.R..TPPL--LAE------------------LCDKL.PISV.IET-----VG-S..---------
Q4WC96_ASPFU/248-378--------------A.R..AEGG--IRK------------------LVEQT.QIPF.LPT-----PM-G..---------
Q4WW88_ASPFU/200-331--------------A.G..AETE--ILR------------------LAEAM.GCAV.VVQ-----PA-A..---------
HACL_ARATH/206-334--------------S.R..AEDE--LKK------------------LVEIT.GIPF.LPT-----PM-G..---------
ILVB_SPIPL/206-344--------------A.G..AHAE--IAE------------------LSERF.QIPV.TST-----LM-G..---------
IOLD_BACSU/220-354--------------S.G..ARDE--LVA------------------ISEAY.NIPL.VET-----QA-G..---------
ILVX_BACSU/200-335--------------P.E..AIKA--VRK------------------LLKKV.QLPF.VET-----YQ-A..---------
ILVBL_BOVIN/273-405--------------PPT..SSDK--LRV------------------AVETL.GIPC.FLA-----GM-A..---------
IOLD_LISMF/221-354--------------S.R..AREE--LIA------------------LSEQT.NIPL.VET-----HA-G..---------
Q86ZI4_NEUCS/227-359--------------H...AIPPA--LVE------------------LANTVKGLRV.LDT-----GG-S..---------
O07043_AZOBR/192-324--------------T.G..LEAK--VAD------------------VAHGL.GVPV.VTT-----FM-G..---------
O22578_VOLCA/289-422--------------..D..ARDE--LRE------------------FAART.GIPL.AST-----FM-G..---------
O26576_METTH/240-367--------------..E..AADS--VVE------------------LAERI.GAAI.VST-----FR-G..---------
O28180_ARCFU/201-335--------------A.K..AWNE--LRE------------------LAEYL.GAVV.TTT-----MG-G..---------
O28554_ARCFU/190-325--------------S.N..ASKE--LVE------------------LAETI.PAFV.VTT-----LM-G..---------
ILVBL_CAEEL/277-409--------------PPV..KPAD--LVK------------------AVEAL.GCPV.FLG-----GM-A..---------
O66759_AQUAE/198-333--------------S.E..AQEE--LIE------------------LAELM.QIPV.TTT-----TQ-G..---------
O68497_CLOAT/208-342--------------S.K..ASKA--VLD------------------MAERL.NIPV.ANT-----FM-G..---------
O87839_STRCO/200-327--------------T.R..ATEA--AVE------------------LVRTL.NVPA.YMN-----GA-G..---------
PDC_ZYMMO/199-331--------------A.G..AEEA--AVK------------------FADAL.GGAV.ATM-----AA-A..---------
MDLC_PSEPU/190-325--------------A.N..ANAD--CVM------------------LAERL.KAPVWVAP-----SA-P..---------
DCIP_ENTCL/199-331--------------H.G..LKHA--LQK------------------WVKEV.PMAH.ATM-----LM-G..---------
ILVB_KLEPN/197-331--------------P.E..NSKA--LRR------------------LLETS.HIPV.TST-----YQ-A..---------
PDC1_MAIZE/246-379--------------A.K..AREA--FAA------------------VADAS.GYPF.AVM-----PA-A..---------
PDC_NEUCR/205-336--------------A.G..SEKE--LIE------------------FAEAM.GCAV.ALQ-----PA-A..---------
ILVB_SCHPO/285-430--------------NPE..CPTL--LRK------------------FSERL.QIPV.TTS-----LL-G..---------
POXB_LACPL/202-333--------------..K..AGKE--LEQ------------------LSKTL.KIPL.MST-----YP-A..---------
YEC0_YEAST/195-327--------------..K..NSHE--IRR------------------LVNTF.NLPF.LPT-----PM-A..---------
OXC_OXAFO/203-333--------------A.Q..CDDE--IRA------------------LVEET.GIPF.LPM-----GM-A..---------
ILVB_CORGL/216-351--------------A.D..AHEE--LRA------------------FAEYT.GIPV.VTT-----LM-A..---------
ILVI_HAEIN/196-331--------------A.E..CSEQ--LIQ------------------FAQRL.NLPV.TSS-----LM-G..---------
BZNB_PSEFL/194-329--------------T.A..RKTA--LSA------------------FVAAT.GVPV.FAD-----YE-G..---------
ILVB_PORPU/206-341--------------S.D..AHSI--IKE------------------LVDLY.KIPV.TTT-----LM-G..---------
P94896_OENOE/194-330--------------E.K..TVKA--LHD------------------FLHVT.KLPV.VET-----FQ-G..---------
YDAP_BACSU/193-321--------------..K..AKRE--LLE------------------FADKA.AAPI.VVT-----LP-A..---------
P97113_LEUMC/201-336--------------S.N..AQDL--LRT------------------LIQHY.HIPT.VST-----LL-G..---------
ILVB_LACLA/200-335--------------S.G..SVDI--FRA------------------FVEKY.QIPV.VST-----LL-G..---------
ARO10_YEAST/244-383--------------Y.G..VSNF--LNK------------------LICKT.GIWN.FST-----VM-G..---------
THI3_YEAST/212-344--------------Q.N..LIEE--TKE------------------LCNRL.KFPV.FVT-----PM-G..---------
PDC1_KLULA/201-333--------------H.D..AKAE--TKK------------------LIDLT.QFPA.FVT-----PM-G..---------
Q17474_CAEEL/261-391--------------SER..GATQ--VQQ------------------FLTKS.KLPW.LAT-----PG-G..---------
Q1LF51_RALME/275-402--------------A.R..GHEE--AVD------------------LLRGL.DIPG.YFN-----GA-A..---------
Q1LM48_RALME/189-317--------------..Q..ALAE--IMA------------------VAERL.KAPV.AHT-----SR-A..---------
Q1M4I8_RHIL3/188-321--------------P.R..STSD--IAQ------------------FVIRT.RIPF.FTT-----QM-G..---------
Q1M4Y3_RHIL3/204-337--------------A.S..ATPE--LIE------------------LAELL.NIPV.MTT-----PN-G..---------
Q1MJ71_RHIL3/230-364--------------SQ...ATKE--LAA------------------FAEAH.GIPV.VVS-----QA-G..---------
Q1N3D1_9GAMM/189-317--------------..C..AKPE--LLE------------------LSEKL.KAPI.VRT-----LR-A..---------
Q1NYW7_9FLAO/195-332--------------A.N..AEKE--LQK------------------FIEKT.NIPA.AST-----LL-G..---------
Q1QAH7_PSYCK/229-362--------------V.D..VNHD--AQK------------------LAELI.DAPT.FLT-----IN-A..---------
Q1R058_CHRSD/190-323--------------V.A..AGDA--VRT------------------LVERL.DAPA.MTT-----IN-A..---------
Q1R095_CHRSD/207-342--------------S.G..ASEN--LTA------------------LVRRL.GFPI.TTT-----LM-G..---------
B3XNI8_LACRE/195-331--------------E.E..ITTA--LRK------------------LLSDY.SLPV.VET-----YQ-A..---------
B3XR89_LACRE/202-331--------------D.R..TEKQ--VQQ------------------LVAET.NIPF.LPM-----SM-A..---------
A5WFU4_PSYWF/155-291--------------F.D..AYDN--AVT------------------LAERT.GATAYVAP-----VV-A..---------
A5WFU5_PSYWF/195-322--------------..G..AADE--LRE------------------LAALL.KLPM.VSS-----YL-A..---------
A5WDF4_PSYWF/210-343--------------Q.G..GFEL--AVS------------------VAEAC.QAPVWEAP-----NS-S..---------
Q1V0A8_PELUQ/195-332--------------S.GPKASEL--LRE------------------LVSLT.GFPI.TST-----LQ-G..---------
Q1VVK9_9FLAO/210-345--------------S.E..AEDI--FKA------------------LVEKS.GIPA.AWT-----IL-G..---------
Q1WVB6_LACS1/198-333--------------P.E..TTKS--IRN------------------LVEET.HLPV.VET-----FQ-G..---------
Q1WVR0_LACS1/195-324--------------..H..AAKE--LKE------------------ISAKF.KLPL.VSS-----VL-A..---------
A5D4V9_PELTS/192-327--------------S.G..AAPE--LLE------------------LSETI.SAPV.THT-----LM-G..---------
Q1YIT6_MOBAS/207-341--------------R.E..AVPE--LVR------------------FCERL.GIGV.LES-----VP-N..---------
Q1YIU4_MOBAS/196-334--------------D.A..ACRD--ITA------------------FAEAN.GLPV.ASS-----FR-R..---------
Q1YKX8_MOBAS/228-407--------------Q.E..GWAQ--RIA------------------LAEAT.GARV.LTD-----LK-I..---------
Q1YX19_PHOPR/200-338--------------A.G..AVEE--CKA------------------LAERL.GAPV.VNS-----YL-H..---------
Q1ZKY9_PHOAS/187-322--------------A.H..ATDT--LRQ------------------FLSLN.PMPS.VST-----LK-G..---------
Q1ZSM4_PHOAS/192-327--------------P.F..VADA--IRQ------------------LLKQT.PIAV.VNT-----FA-A..---------
Q21SN9_RHOFD/191-324--------------..D..CSAE--LMA------------------LADHL.QAPV.ATT-----LQ-G..---------
Q21T72_RHOFD/229-365--------------S.N..ASAE--LRT------------------LVDML.GYPC.TNT-----LM-G..---------
Q21VK8_RHOFD/229-357--------------LSK..QAEH--LAE------------------AVARL.GIPV.YLS-----GM-A..---------
Q220C3_RHOFD/190-328--------------D.A..AVQQ--FTR------------------FAEAF.SLPV.FCS-----FR-R..---------
Q24UP5_DESHY/194-329--------------A.D..VSPA--LRE------------------FVEYT.RIPV.ISS-----LM-G..---------
Q24XT7_DESHY/200-336--------------A.G..ASEI--LQQ------------------VVERA.NLPV.VTT-----LM-G..---------
Q251L0_DESHY/193-331--------------T.Q..SKDI--VAK------------------IAEIL.TAPV.ACT-----YL-H..---------
Q252I7_DESHY/193-328--------------S.H..ANNE--MTL------------------LAEKT.GIPV.VTT-----IM-G..---------
Q28KM5_JANSC/191-323--------------V.G..AADA--LQT------------------LAETL.DAPV.VTT-----TN-G..---------
Q28SI9_JANSC/198-334--------------A.G..AMEE--LAR------------------LANRL.DIPV.ATS-----IS-G..---------
Q28W58_JANSC/189-326--------------D.V..EKQT--AQA------------------LAERT.GAPI.AVT-----FR-R..---------
B8CX18_HALOH/193-328--------------S.E..ASTE--LRK------------------LVKKS.SIPI.TTS-----LM-G..---------
B8CWB0_HALOH/189-317--------------..N..CRQE--LIE------------------LAQKI.NAPL.INT-----LP-V..---------
Q2CC29_9RHOB/189-327--------------Q.E..AAHE--LRA------------------LAERC.GLPV.AAE-----FR-C..---------
A5G0X6_ACICJ/217-351--------------SG...AEER--LAT------------------FAAQH.NIPL.VET-----QA-G..---------
A5FTR0_ACICJ/189-317--------------..G..AAAR--VVQ------------------LAGLL.KAPI.VHT-----SR-A..---------
A5G2E1_ACICJ/199-336--------------S.GPESAEL--IVQ------------------LAKLT.GAPV.TST-----LM-G..---------
A5GC69_GEOUR/192-327--------------A.G..ASAE--LRA------------------LAAKG.GIPV.THT-----LM-A..---------
A5FR34_DEHSB/193-328--------------S.G..ANEE--LKT------------------LAENC.QLPV.ITT-----LL-G..---------
Q2F5Z5_BOMMO/217-346--------------G.K..AEEA--IRK------------------LVENT.KLPF.LPT-----PM-G..---------
Q2FM35_METHJ/193-328--------------S.N..ASAE--LVA------------------LAEKM.CMPV.TTT-----LM-G..---------
Q2G625_NOVAD/195-332--------------A.GPEAARL--LRE------------------LQSLT.GAPV.TST-----LM-G..---------
Q2GMZ7_CHAGB/217-331--------------A.D..AWAE--LRD------------------LAHAT.GAPV.LPA-----CS-R..---------
Q2IJB5_ANADE/195-330--------------A.D..AHKE--VFA------------------FAEFL.GAPV.VTT-----LH-G..---------
Q2IPR2_ANADE/234-362--------------GCQ..DPGR--LAA------------------SVRAL.GVPV.YLG-----GM-A..---------
Q2J1F2_RHOP2/193-331--------------L.K..AREQ--IEQ------------------IATRT.GLPV.ATS-----YR-R..---------
Q2J6V0_FRASC/199-334--------------A.R..AAAE--LRT------------------LAELT.GIPV.VTT-----LM-A..---------
Q2JZ22_RHIEC/196-321--------------..D..ASAE--IAA------------------LAELL.QAPV.TSH-----RS-G..---------
Q2KTL4_BORA1/228-365--------------S.GAQACAA--FTE------------------LVRRT.GAPC.TLT-----LM-G..---------
Q2LXN9_SYNAS/193-328--------------G.K..AVSE--LMT------------------FANCI.HAPV.TAS-----LM-G..---------
Q2LXP1_SYNAS/192-327--------------S.N..SCDL--MLG------------------LIEKG.GIPF.TTT-----MM-G..---------
Q2NBF4_ERYLH/186-319--------------R.R..ASKA--LRK------------------FVSDT.GFPF.FDT-----QM-G..---------
Q2NI91_METST/191-326--------------S.N..ASDE--LVK------------------FATLT.NIPI.ATT-----LM-G..---------
Q2P758_XANOM/197-332--------------A.G..AVEA--FRR------------------FVEAT.GIPT.ALT-----LR-G..---------
Q2RG94_MOOTA/203-338--------------S.E..AHEE--VRQ------------------LAEGQ.DIPV.VMS-----MM-G..---------
Q2RG96_MOOTA/197-332--------------S.R..AEDY--LRQ------------------LVEKL.QIPV.VTS-----LT-G..---------
Q2RXQ6_RHORT/213-351--------------P.R..AAKL--VTT------------------WAEAS.GLPV.VAA-----FR-R..---------
Q2S0N1_SALRD/216-351--------------A.D..APEV--LTA------------------FARAA.NLPV.TTT-----LH-G..---------
Q2S798_HAHCH/191-326--------------A.K..AVTS--YRH------------------FADAT.GIPQ.VVT-----LK-G..---------
Q2SJ09_HAHCH/200-336--------------..G..AMEP--LLA------------------LAESR.NWLI.VTT-----PM-G..---------
Q2SM62_HAHCH/214-350--------------..G..AMRE--ILC------------------YAERR.AWPI.VTT-----PM-G..---------
Q2SMT8_HAHCH/219-352--------------SG...ALAE--LDR------------------LASTY.ALPV.GET-----QA-G..---------
Q2U768_ASPOR/207-343--------------L.N..ILPQ--VDE------------------LIQTT.HWPT.WTS-----AY-G..---------
Q2UC40_ASPOR/202-333--------------F.G..MHGR--VNH------------------LVRTI.SWPT.FTS-----GF-G..---------
Q2W471_MAGSA/196-334--------------P.E..AARL--ITA------------------FAEGW.SLPV.AAC-----FR-R..---------
Q2WFA8_MONVA/223-356--------------..H..ASEE--LRR------------------FADLT.GIPI.AST-----LM-G..---------
A6LXD5_CLOB8/198-332--------------N.N..AAKA--VTE------------------FASNL.KIPV.INT-----MM-A..---------
A6LPX7_CLOB8/192-326--------------S.G..ATSE--LIK------------------FAEKI.NCPV.STS-----LM-C..---------
A6LWS0_CLOB8/194-329--------------S.N..ASSN--LYK------------------IAKKN.NIPV.SLS-----LM-G..---------
A6M227_CLOB8/219-353--------------SE...AGEV--LER------------------FAEKF.NIPI.GET-----QA-G..---------
A6LX01_CLOB8/191-328--------------S.L..AYEE--VKN------------------IAEIW.DIPV.MTT-----PG-G..---------
A5W954_PSEP1/196-331--------------G.G..GSEA--LTE------------------IAKSL.NLPV.TNT-----LM-G..---------
A5W0I1_PSEP1/200-336--------------S.R..TEQR--LLA------------------LVERY.GIPL.ATA-----W.-T..---------
A5W364_PSEP1/198-328--------------..Q..ATEQ--VIA------------------IAEKL.GAGV.AKA-----LL-G..---------
Q877U6_PSEPK/187-320--------------K.M..TAKV--LKQ------------------LIDKT.GIPF.ITT-----QM-G..---------
A5W220_PSEP1/196-326--------------L.H..AAEQ--LAQ------------------LSARL.AAPV.FTS-----VA-G..---------
Q2YKW9_BRUA2/216-350--------------SG...AHEV--LRA------------------FVETH.GIPV.IET-----QA-G..---------
A4XIL5_CALS8/194-328--------------S.R..ASDE--LKI------------------LVEKQ.KIPV.IST-----LM-G..---------
A4XHS0_CALS8/191-326--------------S.E..ASEE--LIQ------------------FAEKI.NAPV.ATT-----LM-G..---------
Q30RG2_SULDN/193-328--------------S.N..AAYE--VRE------------------LVKKT.GIPA.VET-----FM-A..---------
Q30YW8_DESDG/192-323--------------Y.G..IEDK--VAL------------------LAERL.GVPV.VTS-----FM-G..---------
Q31JM5_THICR/186-321--------------A.N..ASRQ--LEA------------------FSKHY.QIPL.VNT-----FM-A..---------
A5EDH4_BRASB/198-324--------------..G..AGPE--LIG------------------LLDRL.GAVY.LDT-----GE-S..---------
A5ECG1_BRASB/192-328--------------S.D..ALQA--AAD------------------FASAL.GAPV....-----.H-Q..---------
Q38UJ8_LACSS/196-325--------------..A..AGDE--LVA------------------LSDKL.SIPM.MSS-----AL-S..---------
Q39P46_BURS3/215-348--------------..H..AAAE--LRE------------------LAERL.HAPV.ALT-----IN-A..---------
Q39W78_GEOMG/193-328--------------G.D..AAGE--LTA------------------LATRL.HIPV.TTT-----LM-G..---------
Q3AEQ6_CARHZ/192-327--------------A.N..ASQE--LYE------------------FAVRA.EIPV.TNT-----LM-G..---------
Q3AEQ9_CARHZ/192-327--------------A.G..AEQL--LLA------------------FAEKI.NAPV.VAS-----LM-G..---------
Q3ALE4_SYNSC/204-340--------------T.G..GVEK--IVD------------------LAETL.GAKV.YSA-----.D-G.G---------
Q3ALP1_SYNSC/196-331--------------A.G..AHDS--LRM------------------IAERY.QIPV.TTT-----LM-G..---------
Q3AM88_SYNSC/188-321--------------P.C..ISEA--LQT------------------YVQRS.GIPY.CAT-----FQ-G..---------
A6TTL0_ALKMQ/192-327--------------S.G..AAEA--FKD------------------FVDKV.QAPV.AST-----MM-G..---------
A6TTM8_ALKMQ/204-339--------------S.N..SHEL--LHQ------------------LAKKN.HIPV.AST-----LM-G..---------
B9LGM6_CHLSY/196-331--------------A.G..AHRE--LQE------------------FAERL.RIPV.ITT-----LH-G..---------
B9LHS5_CHLSY/482-610--------------A.H..GEAE--LVR------------------FVQTT.GIPV.LTR-----NL-A..---------
A6VLE4_ACTSZ/188-323--------------A.H..AVPA--LRR------------------FLEIS.RIPS.VST-----LK-G..---------
Q3ICC9_PSEHT/198-333--------------S.N..TSEQ--LTH------------------LVESL.NAPI.TNT-----LM-G..---------
Q3IS45_NATPD/201-338--------------A.GRDAVEA--AVE------------------LAEAT.GARV.HGE-----IL-A.S---------
Q3JBM9_NITOC/217-353--------------..E..AIDA--ILD------------------LAFLI.QSDV.VTT-----PH-G..---------
Q3K7P6_PSEPF/191-324--------------..D..AAAE--LTE------------------LAELL.DAPM.ALT-----IN-A..---------
A3D4X6_SHEB5/190-319--------------..Y..AVEE--VMA------------------LAKRL.NAPL.GYS-----FR-G..---------
Q3SL06_THIDA/197-334--------------A.G..AREL--VGT------------------LSEKF.RIPV.TSS-----LK-A..---------
Q3V892_DESVH/193-328--------------S.D..ASEE--LGW------------------FARTL.RIPV.AST-----LM-G..---------
Q3V893_DESVH/192-327--------------S.G..AGEV--ARV------------------FAERT.GLPT.AMS-----LL-G..---------
A8L943_FRASN/191-326--------------S.G..GWHA--AVA------------------LAEKL.RASVYGAP-----LP-D..---------
A8L1M3_FRASN/194-330--------------S.R..AGES--VRA------------------LAEAM.ACPV.IQT-----SG-G..---------
Q3XZD0_ENTFC/193-322--------------..N..GFPQ--IKE------------------FSEHF.SVPV.VAS-----VL-A..---------
Q3Y3Q3_ENTFC/220-354--------------SE...AGSA--LKR------------------FSEKH.KIPL.VET-----QA-G..---------
Q3YZF7_SHISS/201-329--------------S.Q..ADEQ--LRE------------------FIESA.QIPF.LPM-----SM-A..---------
Q3Z3R2_SHISS/191-319--------------..G..AHKE--LVE------------------FAGKI.KAPI.VHA-----LR-G..---------
A6WFD0_KINRD/239-373--------------SQ...ATEA--LRA------------------FVEAT.GIPV.GQS-----QA-G..---------
B1YKG0_EXIS2/201-337--------------P.R..VVQA--IRA------------------LLERV.SIPV.VQT-----FQ-A..---------
Q46SP4_CUPPJ/228-365--------------A.G..ATAE--LRQ------------------FSERY.GIPI.VTT-----LM-G..---------
Q46VA1_CUPPJ/202-331--------------..H..ASKQ--VKR------------------LLDL..GFGV.VTS-----TQ-G..---------
Q471R9_CUPPJ/220-358--------------E.Q..ATID--FAA------------------FVRAW.DLPV.ACA-----FR-R..---------
Q47FL3_DECAR/193-328--------------S.G..AART--AVD------------------LAEKS.NLPT.VMT-----LM-A..---------
Q47SH6_THEFY/199-330--------------D.H..AEQA--ALE------------------AAEEL.GVPV.VTN-----GQ-G..---------
Q47UP0_COLP3/160-295--------------A.N..AVEE--VRD------------------FAEKT.GMPS.VST-----LK-G..---------
Q47YT4_COLP3/192-325--------------Q.N..VRAA--MCD------------------FVHST.RIPF.FVT-----QM-G..---------
Q48634_9LACT/192-327--------------A.K..VASS--LRN------------------LLTHV.NIPV.VET-----FQ-G..---------
Q4A101_STAS1/192-327--------------S.D..ETNA--IRK------------------LVEKT.NLPV.VET-----FQ-G..---------
Q4BWI9_CROWT/189-323--------------A.Q..ASEA--LTE------------------FATTL.NIPV.ANT-----FM-G..---------
A3DIY4_CLOTH/192-327--------------A.G..ANKE--LFE------------------FATNA.QIPV.TTT-----LM-G..---------
A3DID9_CLOTH/192-327--------------S.N..ASEE--LLT------------------LSRKC.GIPV.VTT-----LM-G..---------
Q4FTE7_PSYA2/199-331--------------L.G..LQNQ--LKA------------------LIADT.DIPY.TTL-----SW-G..---------
B9KGF5_CAMLR/194-329--------------S.N..ASDE--LRE------------------LIHFC.QIPA.VET-----LM-A..---------
Q4J6N9_SULAC/197-320--------------.....SRSN--VLK------------------YVEKL.GIPV.VVT-----VR-G..---------
Q4J7J3_SULAC/185-313--------------..G..LGEQ--ISK------------------FAERI.GSPV.IYA-----LN-G..---------
Q4J9P1_SULAC/191-326--------------S.N..ASEE--VVK------------------LAEAL.SIPV.ATT-----IT-G..---------
Q4JAP2_SULAC/203-338--------------S.G..AHKE--LLE------------------LAELL.DIPV.ILT-----FR-A..---------
Q4JWD0_CORJK/191-318--------------..N..SREK--VLE------------------LAEKI.KSPI.GHA-----FG-G..---------
Q4L7T7_STAHJ/225-360--------------S.Q..SNEL--LTQ------------------FVTKH.QIPV.ATT-----LL-G..---------
Q4V070_XANC8/193-321--------------..G..AHDA--VVA------------------LADTL.GAPI.VHA-----LR-G..---------
Q4Y789_PLACH/107-235--------------..N..GIKY--VLK------------------LSKLL.KIPI.YTN-----TM-G..---------
POXB_STRPN/196-327--------------..K..AGEV--ITE------------------LSRKI.KAPI.ITT-----GK-N..---------
Q5AMN8_CANAL/91-249--------------H.D..CKKE--VKQ------------------LVETT.QFPV.YVT-----PM-G..---------
Q5AZE4_EMENI/765-897--------------A.R..GVEQ--LVK------------------LADTYKGIRV.LDT-----GG-S..---------
Q5B535_EMENI/204-350--------------E.E..TTAH--LLS------------------LSNSH.NIPV.FDT-----QK-CML---------
Q5FHQ7_LACAC/194-323--------------..D..AGEE--VKE------------------FAEKF.KTPI.MSS-----YL-G..---------
Q5FLY7_LACAC/198-327--------------A.Q..SEDE--IRE------------------LVNKT.NIPF.LPM-----SM-A..---------
Q5FRZ0_GLUOX/205-342--------------S.GPEASEL--LRR------------------LARKT.GFPV.TST-----LM-G..---------
Q5L322_GEOKA/194-329--------------S.G..AEQL--LRL------------------WAEKY.ALPV.MAA-----FR-R..---------
Q5LKS2_SILPO/192-328--------------G.A..GRDA--LTA------------------LAETL.EVPV.VAS-----TG-H..---------
Q5LLG2_SILPO/190-321--------------..G..META--LQA------------------LAERL.DAPV.VQT-----VN-A..---------
Q5LQV0_SILPO/199-335--------------S.G..GEEA--LAR------------------AGETL.RIPI.FNV-----PY-H..---------
Q5NEA3_FRATT/213-346--------------F.G..VTEK--AIN------------------LIEKL.NIPF.SIM-----PH-D..---------
Q5NPP9_ZYMMO/193-327--------------S.H..ASKQ--LIE------------------LSELL.NVPV.ATT-----FM-A..---------
Q5QZF0_IDILO/186-322--------------K.I..TAKM--LRA------------------FVDKT.GIPF.ITT-----QM-G..---------
Q5R276_DROSE/193-322--------------A.H..AENT--LRH------------------FIENT.NLPF.LPT-----PM-G..---------
Q5UWG1_HALMA/202-340--------------A.D..AYDQ--LET------------------VAEAT.DAVV.TTS-----YL-G..---------
Q5V522_HALMA/213-348--------------A.D..ASSA--LRE------------------FAKEY.EIPV.ITT-----MP-G..---------
Q5V5J6_HALMA/187-321--------------S.G..GTAA--LRS------------------LAERL.DAPV.VTT-----YK-G..---------
Q5WGG1_BACSK/191-329--------------S.G..AYKE--VEQ------------------VAEKW.SLPV.VTT-----PG-G..---------
Q5WW44_LEGPL/218-352--------------SL...ASET--LSE------------------FALKH.RIPV.AET-----QA-G..---------
Q5YN72_NOCFA/213-347--------------D.D..ARAE--LAA------------------LAGAL.DAAV.AVT-----PE-A..---------
Q60021_THEAQ/190-323--------------..H..AHAE--LLA------------------FAEKT.GLPV.ITT-----LM-G..---------
Q601Q2_MYCH2/220-353--------------SQ...ASSQ--LLE------------------FLRKT.KIPF.SFT-----QA-G..---------
Q62KX9_BURMA/246-379--------------SEG..GAAA--LAA------------------FAERH.GIPV.GET-----QA-G..---------
IOLD1_BACCZ/219-353--------------AE...AAEE--LKQ------------------FAETF.HIPF.GET-----QA-G..---------
Q64BR9_9ARCH/196-332--------------A.D..ATEE--LRQ------------------LVELL.GTGV.VTT-----LM-G..---------
Q64PS7_BACFR/197-332--------------G.N..AQQE--LRA------------------FIEKA.DMPA.GCT-----LL-G..---------
Q67KX7_SYMTH/192-328--------------SPD..ATGP--FRT------------------LAERM.DAPV.VET-----LM-G..---------
Q6AAK5_PROAC/228-362--------------SE...ASQE--LRD------------------FASAT.GIPV.ADT-----QA-G..---------
Q6AEP0_LEIXX/219-354--------------S.R..ASQE--LLE------------------LAETT.GLPV.TTT-----LM-A..---------
Q6AJI2_DESPS/239-374--------------S.N..SHKE--LSA------------------LAEKL.QIPV.TMT-----LM-G..---------
Q6APX2_DESPS/190-328--------------G.G..AIKD--TIE------------------LAERL.DAPV.CCG-----YQ-H..---------
Q6C6Q2_YARLI/193-323--------------A.K..AEPT--IRR------------------FQEST.NIQF.LPT-----PM-G..---------
Q6CDI5_YARLI/273-418--------------SEE..GPKL--LKE------------------LAEKA.EIPV.TTT-----LQ-G..---------
Q6DDN7_XENLA/202-331--------------S.H..AEKS--IRK------------------LVQDY.GLPF.LPT-----PM-G..---------
Q6FDG8_ACIAD/195-324--------------..N..CVDE--IKA------------------IAD.L.GIPI.VSS-----TH-G..---------
Q6FJV6_CANGA/193-324--------------..N..SSLA--LRH------------------FIEEF.NFPF.LPT-----PM-A..---------
Q6FYB3_CANGA/251-392--------------Y.G..VSQQ--LNS------------------LISHC.QMWN.FST-----VM-G..---------
Q6G6D5_STAAS/193-322--------------..H..AKDE--LRA------------------FVEAA.KIPV.VHS-----LP-A..---------
Q6HKA3_BACHK/204-339--------------A.D..GSEE--LIQ------------------FARKK.GIPV.VST-----LM-G..---------
Q6HLF6_BACHK/202-337--------------A.K..ASKE--LTS------------------FARKY.EIPV.VHT-----LL-G..---------
Q6L042_PICTO/193-329--------------S.G..ATDE--VIK------------------LSKML.GMPV.VST-----LP-G..---------
Q6LK31_PHOPR/222-355--------------SE...ALPE--FHQ------------------LVETY.QLPV.GET-----QA-G..---------
Q6LK45_PHOPR/220-354--------------SL...ATDE--LAD------------------FAEKH.NIPV.VET-----IA-G..---------
Q6LZH8_METMP/193-328--------------A.N..ATPE--LIK------------------LSEYA.QIPV.CTT-----LM-G..---------
Q6N2J6_RHOPA/202-339--------------S.G..RHDA--FLK------------------LIDKL.GIPV.VTG-----WN-A..---------
Q6N2Y1_RHOPA/196-336--------------P.R..IGSM--LDH------------------LVDRL.GMPV.LTT-----WA-A..---------
Q6N3D1_RHOPA/193-319--------------..E..AGDE--ILE------------------LAEMI.DAPV.VAF-----RS-G..---------
Q6N658_RHOPA/218-353--------------H.E..TAEA--LRA------------------LCARV.PLPV.FTK-----SL-A..---------
Q6NDJ7_RHOPA/202-334--------------S.N..CRDD--LVA------------------LAEAT.QIPV.VSN-----TR-G..---------
Q6SGJ7_9BACT/200-328--------------..S..ASVE--ATE------------------LINR..GFGV.VTS-----TN-G..---------
Q6W1J3_RHISN/220-353--------------SA...AERA--LRD------------------FANQF.GIPV.AET-----HA-G..---------
Q6ZUX2_HUMAN/198-327--------------A.R..AENE--IRA------------------LVEKT.QAPF.LPT-----PM-G..---------
Q70I04_9ACTO/185-318--------------A.G..AREA--LVE------------------LADRT.GAAL.ATT-----VL-G..---------
Q72SH3_LEPIC/221-355--------------A.G..ASKE--ILE------------------LATKG.GIPV.TTT-----LM-G..---------
Q737X8_BACC1/202-334--------------F.H..AEEY--LHQ------------------FVEKT.GFPI.ATL-----SM-G..---------
Q738G9_BACC1/193-321--------------..H..ARES--LLA------------------LAEHI.GAPI.VLT-----LP-A..---------
Q73CV8_BACC1/203-338--------------N.E..VTKA--VRE------------------LIADT.ELPV.VET-----YQ-A..---------
Q73TP3_MYCPA/147-281--------------A.D..ATKA--LVR------------------FSEEF.GIQV.ANT-----FH-G..---------
Q73U45_MYCPA/225-354--------------A.Q..ADNE--IRR------------------FVEST.GIPF.LPM-----SM-A..---------
Q74H96_LACJO/195-324--------------..D..ASAE--LKE------------------FSDKF.KMPL.VSS-----VL-G..---------
Q757R7_ASHGO/187-316--------------..E..YPGV--VRS------------------FLERY.RLPF.LPV-----PM-A..---------
Q75PZ0_9BIFI/209-338--------------A.Q..AEDE--LRE------------------FVEKT.DMPF.QPM-----SM-A..---------
Q7CL03_YERPE/186-321--------------A.Q..AVPA--LRD------------------FIAMT.GIPA.VAT-----LK-G..---------
A2VGF0_MYCTU/208-339--------------RLQ..AVKE--LEA------------------LLAAD.VVPH.ATL-----MW-G..---------
Q7MAQ0_WOLSU/193-328--------------S.E..ASGL--LRE------------------LSHTT.SIPV.VET-----LM-A..---------
Q7N5X4_PHOLL/224-358--------------SE...AHNA--FRQ------------------FAEHF.NIPF.AET-----QA-G..---------
Q7NR95_CHRVO/168-305--------------A.G..GADA--LRR------------------LSETL.QVPV.AAT-----WN-A..---------
Q7UHW9_RHOBA/234-369--------------G.E..ASEE--LRE------------------LIKKT.GIPT.VTT-----IM-G..---------
Q7VXC3_BORPE/196-334--------------A.E..AIGQ--AAA------------------FAERF.ELPV.GTA-----WR-R..---------
Q7VY25_BORPE/197-335--------------A.Q..AVQQ--FAD------------------FAQRH.ALPT.AVS-----FR-R..---------
Q7WBZ5_BORPA/205-338--------------S.G..ATPE--LVE------------------LAELL.SIPT.MTT-----LS-G..---------
Q7WCV8_BORBR/218-357--------------S.G..ACDA--LAR------------------LQSLA.GLPV.ATT-----NM-G..---------
Q7WHS2_BORBR/197-328--------------..A..AGKE--LAA------------------LVE.L.GFGM.VTS-----WN-G..---------
Q7WPE1_BORBR/198-327--------------T.G..AHEA--VRR------------------VAERI.GAPV.VMS-----DN-G..---------
Q7WQI4_BORBR/197-333--------------S.G..ACAA--LEE------------------LAVTL.NAPV.CTT-----VS-G..---------
Q7WQJ5_BORBR/206-345--------------S.D..ASAA--MAA------------------LQETA.HLPV.ATT-----VM-G..---------
Q82CK4_STRAW/220-354--------------SR...AEEA--LAE------------------FAEAT.RIPV.AST-----QA-G..---------
Q82CQ7_STRAW/217-348--------------A.D..AAGK--LRA------------------LAEKL.DAPV.ITT-----FG-G..---------
Q82PG6_STRAW/190-319--------------..A..ARAD--VLT------------------LADRL.AAPM.VLT-----LK-A..---------
Q83HI7_TROW8/197-332--------------S.G..ASEE--LIR------------------FAEGF.GIPV.VTT-----LT-A..---------
Q845Z6_SELRU/190-325--------------A.G..ATAE--VTA------------------FVEKY.NLPV.AHT-----LM-G..---------
ILVI_BUCBP/196-331--------------S.N..SHKE--LKL------------------LAETL.NIPV.TTS-----LM-A..---------
Q89E01_BRAJA/194-322--------------..G..AHAP--LMQ------------------LAEAL.KSPI.VHA-----LG-G..---------
Q89QL7_BRAJA/184-317--------------A.Q..AWPQ--LKR------------------LAERL.AIPV.TTS-----LG-G..---------
Q8A6Q6_BACTN/191-319--------------..G..AHEE--VIA------------------LSEKL.NAPV.VYT-----FK-G..---------
Q8DR05_STRR6/200-335--------------A.E..AATE--LNE------------------FAERY.QIPV.VTS-----LL-G..---------
Q8EL23_OCEIH/193-321--------------..G..AKQE--LEQ------------------FSDKI.AAPV.IVS-----LP-A..---------
Q8ELJ0_OCEIH/199-338--------------A.D..AAEE--LLE------------------FVNHF.DIPV.AHT-----LM-G..---------
Q8EN64_OCEIH/207-342--------------S.D..ASNE--LKQ------------------FAQHY.QLPV.VTT-----LL-G..---------
Q8FQJ5_COREF/209-339--------------..D..AQTE--VLA------------------LAERL.GAGV.TTA-----LL-G..---------
Q8G7H0_BIFLO/221-356--------------S.N..AGAQ--VKA------------------LADLT.GAPV.VTT-----LP-A..---------
Q8PUJ4_METMA/186-320--------------K.A..VTEE--LED------------------FANRT.GIYV.VHT-----QM-G..---------
Q8RDJ8_THETN/191-326--------------G.E..ACGE--LLE------------------FAEKT.NIPV.ATS-----LM-G..---------
Q8TT45_METAC/203-335--------------F.G..LKDL--TTE------------------VVNAS.GLPY.VTM-----PM-D..---------
Q8U2A4_PYRFU/195-330--------------S.G..ATDE--VLA------------------IAEYL.LIPI.MAT-----FM-G..---------
Q92DT2_LISIN/193-321--------------..H..AGPE--LIA------------------FAEKA.KIPI.IHS-----LP-A..---------
Q92NJ5_RHIME/187-325--------------A.E..SVAG--FQS------------------FAERW.QLPV.GCS-----FR-R..---------
Q92X67_RHIME/197-327--------------..E..AKEA--LRE------------------TAELL.GAPV.AKA-----LL-G..---------
Q92XQ1_RHIME/191-335--------------E.T..ARED--VQR------------------FATNL.GLPV.VTT-----FR-R..---------
Q92ZG6_RHIME/197-336--------------G.G..ATHE--LAA------------------LQQEA.CLPV.FTT-----NM-G..---------
XSC_DESTI/194-332--------------A.D..AFAE--VKE------------------IAHML.TAPV.AMS-----YL-H..---------
Q971A7_SULTO/197-333--------------S.N..ATQE--VLE------------------LAEYL.HIPI.VST-----FP-G..---------
Q97EE4_CLOAB/189-324--------------S.E..ASKE--LKI------------------LQEKL.KCPV.CST-----MM-G..---------
Q97TS2_CLOAB/199-331--------------Y.Q..VQHV--LKN------------------LAEKT.GFPV.ATL-----SM-G..---------
Q97UP3_SULSO/187-315--------------..D..KSKI--VND------------------FSEKI.GAPI.IYA-----LN-G..---------
Q97XR3_SULSO/187-318--------------F.S..AHEE--LVR------------------LAEKL.NAPIYTEP-----YL-S..---------
Q988P8_RHILO/199-338--------------A.N..ASGE--LTR------------------LAEKL.GAAV.SIT-----WN-G..---------
Q98CV8_RHILO/243-377--------------SQ...ASDA--LAK------------------FVEGA.GIPV.CET-----QG-G..---------
Q9A8Q4_CAUCR/219-353--------------AR...AEAA--LAD------------------LANDA.GLPV.VET-----QG-G..---------
Q9CE06_LACLA/194-323--------------..G..ARKE--ILE------------------LSKML.HAPI.LSS-----AL-G..---------
Q9F7L7_PRB01/188-323--------------S.N..AEKE--LLE------------------LNEII.DAPV.TNT-----LM-G..---------
Q9HJZ5_THEAC/187-315--------------..G..HSDE--VLK------------------FAERI.GSPI.IYS-----VN-A..---------
Q9HK28_THEAC/167-303--------------F.N..AFSE--AVE------------------FARKV.GCPVYSEP-----LG-N..---------
Q9HKB0_THEAC/203-342--------------S.E..AGKE--IEE------------------LSELL.NAPV.ATT-----MG-G..---------
Q9HTQ7_PSEAE/190-318--------------..G..AHDL--LVA------------------LADRL.KAPI.AHT-----SR-A..---------
Q9I207_PSEAE/198-328--------------..G..AHRQ--LEA------------------VAERL.AAGV.AKA-----LL-G..---------
Q9K659_BACHD/188-324--------------..R..AVRE--AIE------------------MAERL.RWPI.VTT-----PQ-A..---------
IOLD_BACHD/219-353--------------SE...AREA--LIA------------------FSETF.NVPL.TET-----QA-G..---------
Q9L123_STRCO/189-324--------------A.G..RFDD--AVR------------------LAERL.GGPVWAAP-----SQ-F..---------
PDC3_SCHPO/210-342--------------F.K..AESA--FLE------------------LANSL.NCSV.AVM-----PN-A..---------
Q9WZ18_THEMA/197-332--------------S.G..AMDL--VNQ------------------FIDKF.KVPA.VST-----LM-G..---------
YGK4_SCHPO/192-322--------------A.C..AEKQ--LLE------------------FVEHT.GIPF.LPS-----PM-G..---------
Q9ZBT3_STRCO/192-320--------------..G..AHAE--VME------------------FAGKL.KAPV.GHA-----LR-G..---------
Q9ZIA9_LEULA/196-332--------------D.D..TVAA--LHK------------------LLKQT.TLPV.VET-----FQ-G..---------

PF02233

NNTM_BOVIN/618-1080--------------AKAQYPIAD--LVK------------------MLSEQ-GKKVRFGI-----HP-V-----------
PNTB_HAEIN/4-474--------------AQAQYPVAD--ITA------------------KLRER-GVNVRFGI-----HP-V-----------
PNTB_SHIFL/4-462--------------AQAQYPVAE--ITE------------------KLRAR-GINVRFGI-----HP-V-----------
Q18031_CAEEL/573-1036--------------AQAQYPIAQ--LVK------------------ELQQR-GVRVRFAI-----HP-V-----------
Q24813_ENTHI/17-526--------------AKAQHVVAS--LAE------------------ELIKA-GKEVRFII-----HP-V-----------
P73500_SYNY3/4-464--------------AQAQHPVAE--ITK------------------LLKEK-GVKVRFGI-----HP-V-----------
Q9ZE72_RICPR/4-462--------------AQSQHSIKE--MVD------------------ILERS-DINVRFAI-----HP-V-----------
PNTB_RHORU/4-463--------------AQAQHALRE--MAD------------------VLKKE-GVEVSYAI-----HP-V-----------
P96834_MYCTU/5-472--------------AQAQHAVKD--LAT------------------LLEDR-GVPVKYAI-----HP-V-----------
Q07600_EIMTE/3-459--------------ARCQSELAD--IAK------------------NLMNC-GITVDFGI-----HP-V-----------

PF02146

SIR2_TRYB2/37-220--------------AKL--SRYN..LNS------------------PEDAF-SLPLLRQQPSVFYNI-L-----------
SIR2_LEIMA/39-223--------------AKL--GKYN..LDD------------------PTDAF-SLTLLREKPEIFYSI-A-----------
SIR2_DROME/229-434--------------ARL--AHDFPDLPD------------------PQAMF-DINYFKRDPRPFYKF-A-----------
SIR2_CANAL/246-437--------------NQL--SKLN..LSD------------------PQKVF-DLQTFMREPGLFYTI-A-----------
NPD_PYRHO/20-197--------------KKY--RPEE..LAT------------------PEAFE-RNPKLVWD...FYKW-R-----------
NPD_BACSU/19-198--------------TED--ASRM.EAMS------------------LDYFL-SYPRLFWP..KFKEL-F-----------
NPD_STAA8/23-198--------------DEI--SKDG...LS------------------PEYLL-SRDYLEDDPEGFINF-C-----------
SIR2_CAEEL/153-334--------------ARL--RSEFPDLPD------------------PTAMF-DIRYFRENPAPFYNF-A-----------
NPD2_ARCFU/23-198--------------RKY--DPEE..VAS------------------ISGFK-RNPRAFWE...FSME-M-----------
SIR42_CAEEL/35-243--------------TKT--ALEP..IYF------------------QDFMK-SKKCRQRY...WSRS-Y-----------
SIR2_KLULA/318-534--------------SKL--GDLG..LND------------------PQDVF-SLEVFTEDPSVFYNI-A-----------
NPD_MYCTU/8-184--------------ARF--DPYE..LSS------------------TQGWL-RNPERVWG...WYLW-R-----------
SIR2_YEAST/262-478--------------SKI--KHLG..LDD------------------PQDVF-NYNIFMHDPSVFYNI-A-----------
E9YAJ6_ECOLX/48-221--------------EEH--RVED..VAT------------------PEGFD-RDPELVQA...FYNA-R-----------
SIR2_SCHPO/164-380--------------ARL--ARHG..LSE------------------PSEMF-DIHTFRENPEIFYTF-A-----------
O94066_CANAX/26-208--------------ANL--AKLN..LPF------------------AEAVF-DIDFFKEDPKPFYTL-A-----------
NPD1_ARCFU/20-192--------------NRY--RPEE..LAN------------------PQAFA-KDPEKVWK...WYAW-R-----------
NPD_AQUAE/11-183--------------NKF--KPEE..LAT------------------PEAFF-RNPKLVWE...WYDW-K-----------
NPD_AGGAC/10-177--------------AGH--KIED..VCT------------------PEALQ-RNRKQVLA...FYNE-R-----------
SIR41_CAEEL/35-243--------------ARI--AHKP..IYF------------------QDYMR-SNRCRQRY...WSRN-F-----------

PF13289

C3WEJ8_FUSMR/103-239.............PY----EMKE--ISD.......................-NKIG-YYK-----FL.GDI.........
E0WKU6_LISGR/186-358.......PRKFKGTN----FDLD--VVTRITN.........KSVLEDNFTP-NVVH-IYK-----PH.GSI........D
B8FFN4_DESAA/108-257..............P----QVLE--NNL..................RIPTD-GKVR-LIK-----IH.GDV.........
C2VLS5_BACCE/130-263.............ID----DIEE--LQE...................LFGA-KQKK-VIH-----FH.GMI.........
C7RFY6_ANAPD/212-382.....SFDVDLFNWF----LVKP--ILNVN.............SDKVEYKK-NIIN-LLK-----IH.GSLTRKQEGGKI
C7RVA1_ACCPU/142-298..............R----VYET--VWD................PSTQFRR-SKGV-IYH-----PN.GFLPTRLVEGFS
A1TX65_MARAV/101-247...........SIII----SNED--NFD.................ETRVTN-DLLP-YVK-----LH.GCL........T
C6JRB3_FUSVA/103-240..............A----VSTP--LKP..................AKSSE-GKIR-FYK-----IM.GTI.........
A6DRE2_9BACT/143-270..............T----YTAP--ALP....................LGS-DFSG-LVY-----LH.GTV.........
C6I4U2_9BACE/102-244.............SV----TLSD--RPN...................DFKN-KSNL-CIH-----IN.GDIKRLTQEKLN
D1AZA4_SULD5/145-284..............Q----SEML--FGR.....................SH-NIAE-IYK-----IH.GCC........S
C3JCK6_9PORP/114-255..............Y----KGKD--YEL..................NGLKK-DPVF-LFK-----LH.GCI.......EH
B8EJ27_METSB/100-273........EWVHYFR----ADGS--QVPGVSRIQDGSGAKAPADAPDETLK-WTTL-IYQ-----PI.GSV........S
B0NWG4_9CLOT/150-288..............A----PGLP--IPR.....................SQ-SRVK-VYH-----VH.GSI.........
Q1BDR9_MYCSS/245-384..............V----LTRQ--LAA......................G-GSRW-LLK-----IN.GDV........D
A9KVJ0_SHEB9/173-321..............I----PFKP--IHA................RGMKHEH-HQLP-IYH-----VH.GYLP......QK
B7J5Y3_ACIF2/103-252..............Q----VING--LNA.................LEQPDP-KKIT-VIK-----LH.GDI.........
D2R627_PIRSD/146-286.............WQ----NPHD--VLQ...................NLRS-GIFC-VLK-----LH.GDY.........
Q6ALX8_DESPS/166-342.......VGFWNAEK----EFSD--ISI.....................DS-NTYQ-LYK-----LH.GSI.........
A6G3D2_9DELT/43-176..............V----VPRS--SAP....................WLT-RRQS-VWH-----IN.GVA.........
C6B833_RHILS/108-250..............K----ITGA--ADL..................AAALP-GLTQ-IIK-----FH.GDF........S
A0QRW8_MYCS2/295-432..............V----LPEN--PRT......................T-EGHW-LLK-----LH.GSV.........
C3WNE7_9FUSO/40-180..............K----ISTP--FNV..................SNDES-GRVA-FYK-----IY.GDY.........
Q0YTA6_9CHLB/271-402..............C----IFSE--GER....................FTD-KQIP-IYH-----PH.GCLP......RK
D4G637_BACNA/107-249.............IS----AEED--VAN.....................AT-SSRY-LLK-----VH.GDF.........
B3PHQ7_CELJU/121-268..............R----FRAP--LLP...................VPKN-RWDG-LVY-----LH.GLL.........
B1IFA3_CLOBK/211-355..............N----IYQG--TST......................F-GKYS-IFY-----PH.GYI........P
B2RK70_PORG3/130-279..............L----PHLT--TKYQ...............VLIGEER-HRSF-LWH-----LH.GSV........E
E6TR41_BACCJ/246-381.............AM----NFNE--FDD.................SQELHI-GSNQ-VLH-----LH.GNI.........
A3IA13_9BACI/104-251..............T----KRVP--ENL.................ANSVSK-TDAI-VYK-----MH.GDK........S
C7HAZ7_9FIRM/289-441.........TKVRYS----NGRD--SADF..............YGMNGQPN-QSLR-LYH-----VH.GFL.........
C4ZMZ3_THASP/323-497...GNAVLWWPHGAL----KPET--VAPN...............ELSIELE-KKTV-IFK-----MH.GSIVP...QTSD
B1GAX3_9BURK/115-258..............E----IGVD--SQQR...............LYRAPGK-GELA-CVS-----MH.GDY.........
Q1D4W8_MYXXD/1238-1377..............T----WKDS--DKA.................LADLRA-GRKI-LLK-----VH.GTS.........
B8I4A6_CLOCE/97-241............KIM----TEDN--LQD...................EIES-NQIP-LYK-----MH.GSI........G
A0LH81_SYNFM/83-241............VLG----LGEP--AGVR...............LRSEPSP-EQPL-VYH-----LF.GHF.........
B0UD07_METS4/36-185............HWS----DAAD--VRTF..............FRALSDRS-APPC-IVY-----LH.GRF.........
B3JQ32_9BACE/138-309.......MGKLKDNI----MLNP--KKP..................EADYT-GFIN-ILK-----VH.GSL.........
D2B798_STRRD/104-265...........CSWA----DRNP--QETP...............ELPEPSV-EEPL-VYH-----LH.GSW.......AE
A7GBJ3_CLOBL/118-257............VIN----CKED--LVN.....................SS-STPR-IIK-----LH.GSF.........
A9FD38_SORC5/122-271..............I----SVDA--TAEL..............SAMLRDEI-DRPT-VWH-----LH.GFI.........
C3HSI6_BACTU/106-242..............I----KNSQ--VPL.....................AN-KRVS-LYK-----IH.GDI.......ND
C3J834_9PORP/142-278..............L----VGND--ILL.....................SN-PYGS-VYK-----IH.GCI.........
D0LP08_HALO1/119-264...............----..QD--LAPA...............LPVPKPA-EWHS-IVY-----LH.GAL.........
C2NSI3_BACCE/166-312............IFI----GQKG--LFK....................QAT-DWGE-IFK-----IH.GCV.........
B5UXF8_BACCE/31-164.............LN----DIED--IQD...................FIYE-NKQR-VIH-----LH.GHV.........
C1M7E6_9ENTR/499-661.......HAAEVWDK----NNEK--RDGR..............VAANKATV-DAPI-VLK-----LF.GTL.........
Q21D17_RHOPB/114-255..............I----VTAE--HTM...................SHDR-SMVE-VVK-----FH.GDF.........
A8SDW3_9FIRM/117-269..............I----VLPY--RGF..................RKPRS-SVRL-LYK-----LH.GDAEYECRYYRN
Q6DF29_XENTR/142-286.............SL----DLTD--EKKV...............LEWAQEK-KKLS-VLH-----IH.GVY.........
Q4QK39_HAEI8/178-326..............D----ELNG--LYLE..............DLYNKLLD-KQNF-LLK-----IH.GTF.........
A7K172_VIBSE/104-251............PPV----TNRH--LTET...............AGIAHAR-SRDF-IFK-----PH.GDA.........
Q223H0_RHOFD/193-348...........