Sequence alignment for CL0086

PF02219

MTHR2_YEAST/6-298--KLEQH.RQTSGKPT--Y-SFEY------------------------------FVPKTTQGVQNLYDRMD---------
MTHR1_SCHPO/6-292--KLL.HPD.WKEKVT--Y-SYEF------------------------------FPPKTSTGVQNLYNRID---------
METF_AQUAE/2-288--KIGDILR..KGVFS--I-SFEF------------------------------FPPKTEEGERQLFETIR---------
MTHR2_SCHPO/6-305--LIDKIPN...GNAF--Y-SFEY------------------------------FPPKTTVGLENLSSRIT---------
MTHR_CAEEL/61-350--RIERLID..EKQQF--F-SLEF------------------------------FPPRFVNGVPNFLERVE---------
METF_HAEIN/9-289--TLNQHIADFNKKIN--V-SFEF------------------------------FPPKNEKMETLLWDSIH---------
MTHR1_YEAST/6-302--LYHAR.....ASPF--I-SLEF------------------------------FPPKTELGTRNLMERMH---------
P73677_SYNY3/47-334--RFRQAAE..AKEFL--I-TAEV------------------------------TPPKGGNPERMLAVAAK---------
MTHR_HUMAN/48-337--KMRRRLE..SGDKW--F-SLEF------------------------------FPPRTAEGAVNLISRFD---------
MTHR2_ARATH/6-301--KIQSLAD..EGKTA--F-SFEF------------------------------FPPKTEDGVDNLFERMD---------
Q6CZA9_PECAS/14-291--...QSLAELQGRIN--V-SFEF------------------------------FPPRTSDMEETLWNSID---------
Q9S2V3_STRCO/16-300--.VRDILA..TGKTT--Y-SFEF------------------------------SAPKTPKGERNLWSALR---------

PF01619

Q2Y8S2_NITMU/179-490GETIEEALERSREREM..R.GYRY..............................SYDMLGEAAITEADAQR.........
E4TLC6_MARTH/72-378GVTIKDSQGTIDELAS..H.GIGT..............................ILDYSVEGAKNEKGFDK.........
J7Q7E1_METSZ/171-468GETIEAAIRREQGRRE......RF..............................SYDMLGEGARTAEDAER.........
G8R191_OWEHD/67-375GETIKDCRDTIEELHK..Y.QVYS..............................ILDYSVEGAKTEDAFDD.........
D8PFZ8_9BACT/123-436GASMEQAVPALRKLWE..D.GRAF..............................SVDLLGEASVSEREADG.........
G8MHC3_9BURK/186-488GQTIEEAIGVAKGRES..N.GYRY..............................SYDMLGEAALTDEDAQA.........
Q3IHR2_PSEHT/183-485GRTIDEAIVRAADKEQ..K.GYVY..............................SYDMLGEGARTMKDAQR.........
A9TJ40_PHYPA/151-463.....................................................................DK.........
Q5DZ94_VIBF1/199-500GRTIEEAQKKGLSMRE..K.GYTY..............................SFDMLGEAALTQTDAHK.........
C7R7N1_KANKD/190-491GRSIKEAMKRGVKSVE..K.GYTH..............................SFDMLGEAAYTAHDAHR.........
H1Y3P5_9SPHI/81-387.ETIAGCDATIANLNK..G.GVGT..............................ILDYSIEGEDEEAVFDE.........
Q725V6_DESVH/123-440GDNSKEAVKGLAKLRK..D.GFTF..............................TVDLLGEATVSEEESEA.........
V4JH86_9DELT/123-438GENAKEAIKSIKKLRE..D.GFAF..............................TLDILGEATVSEAEADS.........
G9MLF6_HYPVG/155-487GENAAEVRQTVGRLKN..I.GFTG.............................VILGYAKEVVLDKSDAKDMTMANLGKE
T2GB03_DESGI/123-437GQDAKEAVSSIEKLRK..D.GFAF..............................VIDSLGEATMSEEEADE.........
Q5NFS5_FRATT/186-490GETIEEALKVSEAKVA..R.GYSY..............................SYDMLGEAAMTMDDAEY.........
Q0BXX8_HYPNA/181-485GRTVSEALKRGRRMVKSGE.AAHF..............................SFDMLGEGARTTADADR.........
A4VIY6_PSEU5/189-494GRTIAEALKNGRPERE..K.GYTY..............................SFDMLGEAALTAEDAAK.........
F6EJT8_AMYSD/134-430.......GKTIGKIKR..D.GIHL..............................NINLLGEAILGESEAAR.........
D3FDW7_CONWI/118-434GESPAAASPTLRRLWR..H.GVAS..............................SLDLLGEATVTDAEADA.........
Q4FSA9_PSYA2/201-502GETIEGANKNSQPYRN..K.GYTY..............................SFDMLGEAAITHKDAEK.........
Q8D2C0_WIGBR/261-570GENIQQALKNTNILEK..K.GFSY..............................SYDMLGEAALTEEDAQK.........
E6VSX4_DESAO/125-438GQTAKEAVKGIRKLRK..D.GFAF..............................VIDLLGEATVSEAESAA.........
G0IXE5_CYCMS/72-380GESFETSQKTVESLGK..Y.GVSS..............................VLDYSVEGKEEDHILEA.........
M4NAF6_9GAMM/187-490GRSIDEALDRCAKKEY..A.VYRY..............................SYDMLGESALTAETAER.........
B9M0V5_GEODF/120-434GENTTEAISNIERLRH..Q.GFAA..............................VVDVLGEATLSEKEADA.........
Q3J4G7_RHOS4/170-470GETIEGAMARAAELEA..K.GYSY..............................SYDMLGEAARTEADARR.........
C4XQY2_DESMR/124-436GEKTKEAVKNIAKIRK..D.GFAF..............................TVDLLGEATVSEEESDA.........
I2EXL9_EMTOG/75-383GESIETCQKTIENLAR..G.NVGT..............................ILDYSVEGEDNENDFDK.........
A9C1A6_DELAS/259-571GQDIAEALANSRAYEK..Q.GFRY..............................SYDMLGEAAATDSDAQR.........
C9SYF0_VERA1/146-464GESPAEVRRTVSRLKG..L.GFSG.............................VILGYAREVVMTEAQTRGLSGASETSS
Q30QX6_SULDN/125-424..EDASLNAHLQKRLA..Q.KTRV..............................NINIIGEAVLGEAEAKE.........
W8KJQ4_HALHR/185-488GRTIDEAMKRARRNEK..H.GYLY..............................SYDMLGEAARTEEDAQA.........
C4K5M4_HAMD5/205-515GETIEKALKKSKKYEN..K.GFLY..............................SYDMLGEAALTEEDAKA.........
E8UGG0_TAYEM/196-505GETIEKALSNGKSMIE..K.GFNY..............................SFDMLGEAAMTDEDALR.........
E8R5H9_ISOPI/161-474GSTPDEALRTILRNRR..H.NLAF..............................TADLLGEAVVTEAEADA.........
N4VCC3_COLOR/121-460GENIPQVRKTVEAVKK..M.GYQG.............................VILNYAREIVLDAGAAAS.........
H2FVF0_OCESG/190-493GRTITEALKASRKSRE..Q.GYTH..............................SYDMLGEAAMTAADAEK.........
F8EFK6_RUNSL/77-382GEDIKECDKTVKNLAN..S.KIGT..............................ILDYSVEGEDNESSFDK.........
V4J1J7_9GAMM/170-474......LIKHLQRRRE..D.GVRM..............................NVNYLGEALLGEEQAQR.........
A2QWR7_ASPNC/131-458......VQQSIQTIKQ..L.GYRG.............................VLLGYAREVLVGEGNVDPRDEKAAR..
G7YAY9_CLOSI/137-446QLRVLDVNNFRQRLER..L.GVKISYDDNL...KWFTLLDVSGDGVVDLLDWSHLKSFEHDLAAIFTVRNR.........
B1ZUG1_OPITP/125-452GETPADLVQRIRANTA..A.GIAT..............................TIDLLGETVVNDAEADA.........
K9TNG5_9CYAN/130-444GENIKQALKTIERLRK..D.KMAF..............................TMDLLGEAVITEAEAQS.........
B7K0R9_CYAP8/129-443GETVQQVIKAVEKLRK..E.KMAF..............................SIDLLGEAVITESEAKA.........
A7IKY5_XANP2/198-502GRTIEEALHRAGRREA..Q.GFSY..............................SFDMLGEAAMTAADAER.........
A0KGC8_AERHH/190-492GRDMKEALKASRKSRE..K.GYTH..............................TYDMLGESALTLADADK.........
I0K8U0_9BACT/91-399GETIRDCEKTIQYLHN..A.HVGT..............................ILDYSVEGEENEKCFDS.........
F4CCZ8_SPHS2/81-387GETIEGCEKTIQQLAS..Q.HVGT..............................ILDYSVEGEESEQAFDH.........
B6ITG0_RHOCS/194-497GGTIDAALAVARSARP..A.STVF..............................SFDMLGEGARNPEQAER.........
F0XMR1_GROCL/143-478GETAAEARKTIAGLKN..I.GFSG.............................VILGYAKEAVLQDGETESLSVKGADEA
Q5FP43_GLUOX/195-501GETIEEARKVSTEPEE..R.GFKY..............................SYDMLGEAAMTEADALR.........
Q5QY28_IDILO/189-494GRTIEEALKESRDNRD..K.GYTH..............................AYDMLGEAALTMKDADY.........
M3XYT7_MUSPF/325-634.VAAVDTKLEVAALQE..S.VAKMGIASRTEIKNWFTAETLGVSGTVDLLDWSSLIDSRTELSKHLVVPNM.........
C5CN52_VARPS/156-462GQTIAEAMDEARSAHRRQG.ALRF..............................SYDMLGEGARTDADALR.........
K9WDJ4_9CYAN/129-443GENIKQTLKTIERLRK..D.KMGF..............................TLDLLGEAVITEAEAQS.........
F7QI31_9BRAD/181-485GETIESALARAADHDAPHH.HHRY..............................SFDMLGEGARTAHDAAR.........
Q0ASP6_MARMM/187-482.......LKRAKKGE.....GELC..............................SFDMLGEGARTAKDAAR.........
K9XU71_STAC7/130-444GENIAEVIKTIERLRK..E.GMAF..............................TIDLLGEAVITEAEAQS.........
E4PKH6_MARAH/181-483GRDIDEAQDEAKEYMA..K.GYTY..............................SYDMLGEAARTDDDAKR.........
L0DPG6_SINAD/130-444GATPDEALKTVLALRR..Q.RIAF..............................TADLLGEAVISEHEAER.........
N0BF27_9RHIZ/186-492GSTIEGALSRARALEE..K.GYRF..............................SYDMLGEAARSERDAER.........
K6YYW9_9ALTE/183-488GETIQDATDHATKKER..Q.GFVY..............................SYDMLGEGARTMSDAEK.........
Q73IQ2_WOLPM/178-482GETIEEALRYAKLDDN..S.KFLY..............................SFDMLGETAHTAEDAEE.........
H6BYZ9_EXODN/152-491GETPEEVKQTIASLKS..I.GFKG.............................VILGHAKEVVLSKEEEEGLDQAKDAME
Q6MF92_PARUW/144-448......FAKHMKKRCQ..E.GVRI..............................NLNHLGEAILGEDEARR.........
A1WUH9_HALHL/185-489GRDIPEAQRRARKLEA..K.GYRY..............................SYDMLGEAARTEADAEH.........
Q5ZUU6_LEGPH/186-490GRTINEALARAKKKED..R.GYRY..............................SYDMLGEAALTSADAAR.........
F0SR05_PLABD/129-443GSKPEEVLKAIRKIRD..S.GFAF..............................TLDLLGEAVLSEEEADR.........
G7UWP8_PSEUP/155-463GQTLDEALDDARKQRKARD.GLRF..............................SYDMLGEGARTEADALQ.........
E3I4E3_RHOVT/184-490GQTIEEALDHAAPFEA..Q.GFSY..............................SFDMLGEAAMTDADALA.........
Q5LP42_RUEPO/171-472GETIQSAMKRASGMEA..K.GYTY..............................SYDMLGEAARTEADAAR.........
Q47VW3_COLP3/183-488GETIKAATERAATKEQ..Q.GYVY..............................SYDMLGEGARTMADANM.........
K9SGB6_9CYAN/140-451GANLKEALKSIEKLRR..D.RYCF..............................TMDLLGEAVISEKEAQS.........
E1V8R1_HALED/190-497GRDVDEALKRSKPLFD..Q.GYTY..............................SYDMLGEAARTRDDAKR.........
PUT1_YEAST/146-461..........................................................EGTKSLSSTPVDQ.........
G2KP47_MICAA/168-477GRTIDEGMKNAQAYEA..K.GYRM..............................SYDMLGEGARTMADAER.........
K4BCB4_SOLLC/171-478................................................................................
W1PD27_AMBTC/253-566....................................................................CDE.........
Q2N7F6_ERYLH/176-484GRTIGEALKRAKPERA..K.GLTH..............................SFDMLGEAAMTFEDAER.........
B0RBJ3_CLAMS/105-406.ATSEKLGPAIQKLRE..G.GSRL..............................NLNLLGEAVLGEKEAAR.........
K4KRT3_SIMAS/178-479GRTIKEGIKRGATQTA....ATRF..............................SFDMLGEGARTQADADR.........
Q0BVZ4_GRABC/195-514GETIEAALAATSLLWT..Q.GFRH..............................SYDMLGEAAMTRADADR.........
A8IG36_AZOC5/237-536GQTIHAALDRAESASG..R.AYRY..............................SFDMLGEGARTFTDAKR.........
Q2SL11_HAHCH/190-493GRDISEALQNGRKYRD..K.GYSY..............................SFDMLGEAALTAEDAER.........
K4BCB3_SOLLC/174-480................................................................................
H8KZM8_FRAAD/187-490GRTIGEALDRCAKPEH..A.AFRH..............................SFDMLGESALTAATAER.........
I4AGT6_FLELS/91-397GETIEESERTVIQLTQ..A.GIGT..............................ILDYSVEGEKSTEGFEK.........
A4Z2X8_BRASO/171-473GETIAQALDRANSGTG..R.LFRY..............................SFDMLGEGARTSADAER.........
B0UDE2_METS4/170-473GETIEAALKRAGSGQG..R.LYRY..............................SFDMLGEGARTAEDAAG.........
A8LRL6_DINSH/181-482GQTIEEGLKNARELEK..K.GFTY..............................SYDMLGEAARTDADARR.........
V5FUL1_BYSSN/140-491..TPQEVKESIQNLKR..M.GYTG.............................VILGYAKEVVMDEDEASA...SGATAG
R5X0A3_9BACT/67-376GETLEECGPTVDGLER..A.GVKA..............................ALDYSAESEQTPVGIEA.........
Q6LFT6_PHOPR/190-497GRTISEAMKNGKSNRD..K.GFTY..............................SFDMLGEAALTAQDAQK.........
D6WUI6_TRICA/274-587.GNVLSHHMTIQDLER..K.LSKMK..DQESVKKFLSQITADEKGILHLFPWSGIIDENQELSSTFRVPDL.........
B1M5K8_METRJ/198-504GRTIAEALRHAAPLEA..K.GFTY..............................SYDMLGEAAVTAEDAER.........
H6L1M4_SAPGL/39-347GRNLPETLKAVRELKV..Y.GVET..............................VLDYGAEAKDTEADFDK.........
H5WQD6_9BURK/219-528GQTIAEALANARAREA..Q.GFRF..............................SYDMLGEAALTARDAQA.........
Q8NU48_CORGL/130-428.....QFAKAVAEIQS..D.GHRL..............................NINLLGEAVLGRKEAAK.........
A4G6Z2_HERAR/192-497GRTIEEALDNSREHEA..H.GYRY..............................SFDMLGEAAMTAADAAT.........
A1KC13_AZOSB/186-495GETIGAALRRSRDSES..R.GYSH..............................SFDMLGEAALTAADAER.........
F3Z0N8_DESAF/122-437GENSKEAMKSLRKLRK..D.GFAF..............................VVDFLGEATVSEIEAQA.........
E1FT57_LOALO/261-563.......EEFLKRIKD..R.GVQI...DEDMMQKWLKTVDFDESGFVDFYDWHKLIEEHERLDQIFQVYNV.........
C5C6T6_MICLC/150-444.......GKAITALRD..E.HTRL..............................NINLLGEAILGQGEADR.........
Q10YY5_TRIEI/130-444GENVKQIIKTLEKLRK..D.KMCF..............................TVDLLGEAVITETEAQL.........
I4C375_DESTA/122-433GRTVADALSTLHAFRT..Q.GLAA..............................SLDIVGEEVLSDDEAGH.........
E3F3C6_KETVY/202-507GETIDQGLKNAEAFEK..L.GFTN..............................SYDMLGEAARTAADADK.........
W0AMX3_9SPHN/178-477.RTIADALARARKE......KTLC..............................SFDMLGEGARTAADAER.........
A3QAI9_SHELP/192-495GRTVQEALKNSTDKRK..L.GYTH..............................SYDMLGEAALTMKDAQK.........
A1B0L0_PARDP/176-476GQTIEAALERAAKREA..Q.GFTY..............................SYDMLGEAAMTGADAAR.........
W8S551_9RHOB/180-481GETIPDAMARAATQEA..E.GYTY..............................SYDMLGEAAMTAADAAA.........
K8GCC7_9CYAN/128-442GETIQQAIKTIERLRK..E.RMAF..............................TVDLLGEAVITETEAQS.........
M4VRQ9_9DELT/119-431GENPQDALTVLKKARK..N.NLTF..............................TVDILGEATLSEKEAMD.........
PROD1_ARATH/168-483....................................................................CDD.........
C8X4M0_DESRD/123-436GENTKQAIKNLNKLRK..D.GFAF..............................TVDILGEATVSEEEGVE.........
A9CG59_AGRT5/200-506GETIGEAIKRSKPLEE..Q.GFQY..............................SYDMLGEAATTAKDAER.........
Q6FBR9_ACIAD/206-516GETIEEALDNAKSHEH..K.GFRY..............................SYDMLGEAALTTHDAER.........
C1E2C6_MICSR/197-496GANIEAAARRAMRAETYNP.QRSH..............................SFDMLGEGARTYEDSAR.........
D5VBX7_MORCR/179-481GQTIQEALSNGKEREK..L.GYRF..............................SFDMLGEAAMTAEDADR.........
K7SL66_GLUOY/193-490...LGMALRASAAGEK..L.GLTY..............................AYDLQVNTALTAEQALN.........
C4QVR0_PICPG/110-457GQTVEDVRKTGQRLKS..R.GIQN................MMASLTIEGCNGNDNIDIPFILKETNKSVDK.........
Q746X3_GEOSL/122-437GETTKEAVKNLEKLRK..D.GFAA..............................VVDVLGEATLSEEEAEV.........
C1D8Q5_LARHH/181-483GETIDEALANGREREA..R.GYRF..............................SYDMLGEAAMTEADARR.........
L0DXC8_THIND/182-482GETLGDAWEHGQAERD..R.GFRH..............................SYDMLGEAALTAADAER.........
Q2JNZ3_SYNJB/130-434GETLQQVSKTLEALHR..Q.GMAF..............................TLDLLGEAVITEAEAQS.........
M9R8D6_9RHOB/175-480GTDITSAMKRAAGMEA..K.GFTY..............................SYDMLGEAARTEKDAKQ.........
Q5P8F4_AROAE/237-543GRNIAEALERSAAARR..R.GYRY..............................SFDMLGEAAMTAADAQR.........
H0PXL0_9RHOO/189-495GRTIEEALERGREREG..R.GYRY..............................SFDMLGEAAMTAADAQR.........
Q7NGY2_GLOVI/131-445GENLKTAVKTIEKLRS..Q.NMAV..............................SLDLLGEAVVSEAEAEV.........
R7J8S3_9PORP/67-375GETLQDCEKAINHLKE..F.NVMS..............................TLDFSAEGEQTPEGIQA.........
E6WK59_PANSA/62-361GETIHEATTACENLAR..T.GVYG..............................ILDYAVEGESDEFHFET.........
B1XJU5_SYNP2/128-442GENVKQVLKTVERLRR..D.KMAF..............................TIDLLGEAVITESEAQK.........
B2FJY7_STRMK/201-509GRTISEALARSHKGDN..A.SYRY..............................SFDMLGEGALTMKDALR.........
B2IK06_BEII9/172-472GRTIEEGLARAHLDRS....ENFY..............................SFDMLGEGARTADDAAL.........
I1N4V3_SOYBN/171-468................................................................................
A1U2B1_MARAV/181-483GRTIEEAQDRGKSQEE..R.GYTY..............................SYDMLGEAARTDADAQR.........
B8FJG0_DESAA/132-432.......HKHLEKRKN..Q.GVRM..............................NINHLGEAVLGEEEAHH.........
X4QUP9_9ACTO/125-423.TTPKKFGPAVKKLRA..D.GSRL..............................NLNLLGEAVLGKKEAAH.........
D5BFD6_ZUNPS/70-376GETMEDCKPTIKTMYQ..A.KLHS..............................ILDYSVEGKETEEEFDA.........
E9F9P4_METAR/159-490.ENPAEVQATINRLKN..I.GFTG.............................VILGYAREVVLTEKQAEEVELA.AGQE
B0JY14_MICAN/130-444GEDLGQITRTVTRLRK..E.KMAF..............................TIDLLGEAVITEAETQV.........
A9HPN9_GLUDA/185-491GQTIETALGNSRRLNA..R.GFRY..............................SYDMLGEAATTAADAAR.........
K9RFZ5_9CYAN/129-443GENIKQALKSIERLRK..E.KMAF..............................TVDLLGEAVITEVEAES.........
Q28LK1_JANSC/174-475GQTIAEAMKRGRDRAA..Q.GYTY..............................SYDMLGEAAVTADEARI.........
Q15TQ2_PSEA6/187-491GRDIKEAAKRGRKGNV..E.GTRF..............................SFDMLGEGARTYKDANK.........
C6W220_DYAFD/77-382GETINECDATIVSLRN..S.GIGT..............................ILDYSVEGEDKEASFDA.........
A9SC33_PHYPA/80-388................................................................................
Q8YZD7_NOSS1/129-443GENIKQVIKTVERLRK..E.KMAF..............................TIDLLGEAVITETEAQS.........
A3I0V1_9BACT/72-380GETIKKSIQACEKLSQ..F.GIEA..............................ILDYSVEGKGDEESFER.........
Q6MNK1_BDEBA/118-429GESPDEALPVLKKARK..N.KMTF..............................TVDILGEATLSEKEAQD.........
H8GI70_METAL/170-467.ETIEGAVEKLAAE....P.GARY..............................SFDMLGEAALTAADAER.........
F2J2U8_POLGS/179-476GETIGQALERASGQEA..K.GYRY..............................SYDMLGEGARTAADAQR.........
Q2W4B4_MAGSA/178-477GRTIAEALDNARAWEA..R.GYRH..............................SFDMLGEAARCEQAAQD.........
I0HCU0_ACTM4/124-415.........AIARIKK..R.NVRL..............................NVNLLGEAVLGRGEAAQ.........
P74275_SYNY3/130-444GETIAQVIKTVERLRK..E.KMGF..............................TIDLLGEAVITESEAAE.........
B6JH11_OLICO/199-505GETIDDALERARSLEV..S.GFRY..............................SYDMLGEAAMTAADAER.........
A9RSW8_PHYPA/157-460................................................................................
I2BAI5_SHIBC/262-571GETIAEALANARKLED..K.GFRY..............................SYDMLGEAALTAADADA.........
Q6N9G9_RHOPA/172-474GETIDAALARAQPYAR..E.GSRY..............................SYDMLGEGARTAADAER.........
H8KRQ0_SOLCM/83-389GESIKDCENTINQLAN..Y.KVGT..............................ILDYSIEGENNEKAFDE.........
O24897_HELPY/120-425DQEESQLKERILKRKN..E.KIIL..............................NVNFIGEEVLGEEEANA.........
D2QSB3_SPILD/40-348GESIQDSEKTIRHLHD..V.HVGT..............................ILDYSIEGEETEKSFDE.........
U5T1S9_9GAMM/185-490GESIEAALKRARSQEK..K.GFTY..............................SYDMLGEAARTAADAQT.........
E9HR55_DAPPU/103-411.DDPQSLKETASKLKQ..L.GIKL.............................MILPSLEEDIGQKSDQNR.........
W5XW07_9CORY/130-427.AESDKLNKTLAKAAE..S.GEQL..............................NLNLLGEAVLGEDEARS.........
B9KII4_ANAMF/179-481GRTIEEAIARSYDA......GHVC..............................SFDVLGEAAKTRADADK.........
K9ULL5_9CHRO/143-454GENLPAATKTIERLRR..E.RLAF..............................TMDLLGEAVISEVEAEG.........
Q21UN0_ALBFT/267-576GQTISEALANSRALEK..K.GFRY..............................SYDMLGEAATTELDAER.........
Q2RWN5_RHORT/175-476GRTIDEAWRNGGPLIE..K.GYTY..............................SFDMLGEAARTAADATH.........
E1VMJ8_9GAMM/209-510GENMEDALHLARKEAK..R.GYFH..............................SFDRLGEAAITATDVQH.........
Q83DR6_COXBU/186-490GRTIEEAVKRSQSAIK..E.GFRH..............................SYDMLGEVARTQEDADR.........
F4KQ39_HALH1/97-405GTTLLEAQKTIDRLQR..S.NIKT..............................ILDYGAEAKEDESELNH.........
F2G8W7_ALTMD/183-485GETIEDAVDRAKEKET..K.GYVY..............................SYDMLGEGARTMRDADR.........
I4A307_ORNRL/66-371GENLQESLQTVDRLYE..Q.NVGS..............................ILDYSIEGKEDEKSYDA.........
Q1QI19_NITHX/186-488GETIEAALERAHAHAA..G.HARY..............................SFDMLGEGARTAADADR.........
A1SRQ1_PSYIN/183-485GETIVAAVKRAEQKER..N.GYVY..............................SYDVLGEGARTEKDAER.........
I3TI59_TISMK/188-494GRNIQEALDRARAGWA..K.GWRH..............................SFDMLGEAARTEADATR.........
M4U3Z5_9GAMM/195-498GRSIKEAQKNGKNFTD..Q.GINY..............................SYDMLGESALTSEDAKK.........
C6XJL8_HIRBI/186-488GKTIGLALKKSAMYEK..K.GFSF..............................SYDMLGEAAHTQADADH.........
A3MYH8_ACTP2/181-483GETIQLALKNSEARFN..K.GFRF..............................TYDMLGESAFTEQDAQH.........
K0CHY5_ALCDB/195-485......ALRRRD......P.SLRY..............................SFDMLGEAAQSDAEAKH.........
C7RS12_ACCPU/178-484GRDIHEALERARSAEE..A.GYRH..............................SYDMLGESARTGADALR.........
E1SPV0_FERBD/192-495GRDIGEALKNSDDNRA..L.GYTH..............................SYDMLGEAALTAADATK.........
D5A2Q2_ARTPN/130-444GADIPQIIKTLERLRK..D.KLGF..............................TVDLLGEAVITETEAES.........
V5SEX9_9RHIZ/191-499GRSIHDAIGRSAPYEA..R.GFRF..............................SYDMLGEAAMTAKDAER.........
Q7VJT7_HELHP/125-423.....QLTSHILARKN..QGNIIL..............................NVNLIGEEVLGEIESKY.........
Q89E26_BRADU/170-472GETIEQALERGKPRSG..Q.KTRY..............................SFDMLGEGARTAADARR.........
Q11IQ4_CHESB/173-474GRTIAEAIKRGRAMTA..K.GYTY..............................SYDMLGEAARTEADARR.........
K9SCU8_9CYAN/129-443GATLPQVIKTVERLRK..E.SMAF..............................TIDLLGEAVITEAEAQG.........
K9YQR1_CYASC/130-444GETIKEVIKAVERMRK..E.KMGF..............................TIDLLGEAVITEAEAQS.........
S5YB79_PARAH/170-468GQTIEEAMKRAAEDPK..S...TQ..............................SYDMLGEAAMTAGDARK.........
C1GAY3_PARBD/149-507GETRAEVKGNIKELKK..I.GFSG.............................VILGYAREVTMDEAEIQSLAQATVTKE
B4RDQ4_PHEZH/172-472GATIEKAIRRAAAD......GFVC..............................SFDMLGEGARTDADADR.........
B8EK67_METSB/174-474GDEIEEALRRASSREG..R.RHLY..............................SFDMLGEGARTKADADR.........
C7LXP8_DESBD/125-438GENTPDAMKNLKKIRK..D.GFAF..............................TVDILGEASVSEIESEA.........
W8EVF8_9BACT/75-382GETIQECLPVIQELGR..Y.HIGT..............................ILDYSVEGEGNDKSFDA.........
E2SAB5_9ACTO/132-425.......TRTIAKLRS..R.GDRL..............................NLNLLGEAVLGEAEAAR.........
A0RQB5_CAMFF/120-419...ENSLKKHIKLRNE..D.NITL..............................NINLIGEEVLSEAESLY.........
D0J1C3_COMT2/206-515GETISQALERARELQA..R.GFRY..............................SYDMLGEAALTAEDAQR.........
G8PFS8_PSEUV/176-479GRTIREAMRNARAEEG..Q.GFTY..............................SYDMLGEAARTEADAKR.........
F2K118_MARM1/190-495GRSISEALTRGKSYRD..D.GYTY..............................SFDMLGEAALTADDAKK.........
C7JEM3_ACEP3/214-519GQTIDQARKNSAKLEA..V.GFSY..............................SYDMLGEAAFTAHDAER.........
F8KUD6_HELBC/124-429DESSDSLKNMIEKREA..E.HITL..............................NINLIGEEVLGESEAAY.........
Q8DLR2_THEEB/124-425GETTEQVLKTIGRLRK..Q.GMLV..............................TMDILGEAVITEAEAQQ.........
D7SMI9_VITVI/173-476................................................................................
G0A0F2_METMM/181-477...IDTALDRAAAQ....P.YYRY..............................SFDMLGEAALTTADAER.........
E4RQ43_LEAB4/72-381GEDIKECEKTIDKLHQ..Y.KVGT..............................ILDYSVEGEDDEKSFDD.........
Q20YI8_RHOPB/172-468GETIAAALQRAQGG......GARY..............................SFDMLGEGARTQADADR.........
G4RBU0_PELHB/190-496GQDIAEALKNARSWEA..K.GFGY..............................SYDMLGEAATTAHDAER.........
D5AN87_RHOCB/170-470GETIEKALERAEKREA..E.GYTF..............................SYDMLGEAALTAADAER.........
E8RP12_ASTEC/170-466GRTIDEALDVAAKPEN..K.GFTA..............................SFDMLGESARTFADAEK.........
Q1GPE4_SPHAL/177-477GETIDAAVKRADRQ....K.SELA..............................SFDMLGEAARTAGDAAR.........
D5SZA2_PLAL2/143-464GESTDDVLKTIHKLYR..Q.GYLF..............................SLNYLSSKVVSQAEADQ.........
A1WR88_VEREI/191-506GETIDAALHQARALQA..R.GFRH..............................SFDMLGEAALTAADARR.........
B4R3R9_DROSI/14-329QGNVLTHHKTIKDLEK..Y.YATLG..DNKDVKEFLNNVTSDKEGILHLFPWSGIVDEDSQLSDTFRVPDP.........
B1XXB4_LEPCP/183-494GQSIAEALDIARAASRKEP.GLVH..............................SFDMLGEGARTDADARH.........
A0LGH8_SYNFM/123-435..NPSEALPNLERLRG..Q.GMAF..............................TIDLLGEAVVSEKEAEE.........
Q9CN54_PASMU/180-482GETIEQAIKNGEKRFQ..Q.GFRY..............................SYDMLGEAALTEEDAAR.........
K9RTF2_SYNP3/123-424GETTPQVLKTIDRLKK..A.GMAF..............................TIDILGEAVITETESQA.........
B0SX13_CAUSK/176-473...IEAAIKRAAHD......GDIC..............................SFDMLGEGARTAADAAR.........
I0HK91_RUBGI/171-476....DEAMKEAAAQRKAQP.MLRF..............................SYDMLGEGARTEDDAER.........
Q0A545_ALKEH/185-489GRDIDEALKRAHPNER..K.GYRY..............................SYDMLGEAARTDADAQA.........
G8UMQ7_TANFA/67-376GETLQDCQKTIRLLKR..F.GVKS..............................TLDFSAEGEQSPDGIKE.........
G7ZID6_AZOL4/210-517GQTIDEALSNSRKMEA..E.GFRY..............................SYDMLGEAATTAADADR.........
F4HDV6_GALAU/183-485GETMEEALKNIIPREK..M.GYRF..............................SFDMLGEAAMTMADADR.........
E0TFB1_PARBH/171-472GQTIEDALDRARKQEK..K.GYRY..............................SYDMLGEAARTYDDAER.........
A8ZMR8_ACAM1/128-442GETLPQTLPRLVQLRQ..H.CLAF..............................TLDRLGEAVITEAEATA.........
G2X8S4_VERDV/146-474GETPAEVRRTVSRLKG..L.GFSG.............................VILGYAREVVMTEAQTRGLSGASETSR
M2NL10_BAUCO/149-482GETPAQVAKATAELRE..Q.GYSG.............................VILEYALEVLKDAEGNEA.........
Q12GH2_POLSJ/160-462.....EAMNEADDARRKMP.NLRF..............................SYDMLGEGARTDADALR.........
F0NYJ2_WEEVC/69-373GETPQEAIKVANELYR..Y.HVSS..............................ILDYSVEGQTEESDFDH.........
Q6AA40_PROAC/139-437....AQLTRTLKALRS..A.GVRL..............................NLNLLGEAVLGDREAAS.........
Q98L65_RHILO/187-488GRTIAEAVKRGRPMTQ..K.GYLY..............................SFDMLGEAARTEADALR.........
Q87FF3_VIBPA/190-492GRTIEEAQKNGRPMRD..K.GFTY..............................SFDMLGEAALTTADANK.........
C1DQT9_AZOVD/189-493GRNIAEALRNARRARE..R.GYGH..............................SFDMLGEAALTEAAAER.........
M5E4Q0_9GAMM/195-495GHTIDQALSNAGRMAS..D.KICY..............................SFDMLGEAAMTEDDAES.........
X6PEJ3_RETFI/230-571GETMEECVRTSTIFQK..N.GVRL..............................VIDLSTEETEEAHLWDL.........
G0AEN1_COLFT/169-474GQTIAEALGNSRDNEK..R.GYRY..............................SYDMLGEAALTEEDAAA.........
D2R6H7_PIRSD/157-469GETAEQVLRTAEQERT..L.GRSF..............................TLDILGEAVTSEVEANR.........
A5FXC3_ACICJ/246-552GRTIGEALANARKREA..K.GFAY..............................SYDMLGEAALTAADAAR.........
C7PKU9_CHIPD/72-379GENLQEAAATASSLGK..F.HVGV..............................ALDYGVEAMEGEENYDH.........

PF02219

MTHR2_YEAST/6-298---------------------RMYEASLPQFIDI-------------------------------TWNAGG.....GRLS
MTHR1_SCHPO/6-292---------------------RMKTWGRPMFVDV-------------------------------TWGAGG.....TSS.
METF_AQUAE/2-288---------------------KLEKLN.PTFVSV-------------------------------TYGAGG.....STR.
MTHR2_SCHPO/6-305---------------------RMSRNMMPLFSSV-------------------------------TWGTAG.....STA.
MTHR_CAEEL/61-350---------------------RLSEGG.SVFVDM-------------------------------TWHMGSDPANVDKV.
METF_HAEIN/9-289---------------------RLKVLK.PKFVSV-------------------------------TYGANS.....GER.
MTHR1_YEAST/6-302---------------------RMT.ALDPLFITV-------------------------------TWGAGG.....TTA.
P73677_SYNY3/47-334---------------------LRGRVH...GVNV-------------------------------TDGSRA......VL.
MTHR_HUMAN/48-337---------------------RMAAGG.PLYIDV-------------------------------TWHPAGDP.GSDKE.
MTHR2_ARATH/6-301---------------------RMVAYG.PTFCDI-------------------------------TWGAGG.....STA.
Q6CZA9_PECAS/14-291---------------------RLSSLK.PKFVSV-------------------------------TYGANS.....GER.
Q9S2V3_STRCO/16-300---------------------RVEAVA.PDFVSV-------------------------------TYGAGG.....STR.

PF01619

Q2Y8S2_NITMU/179-490.....................YWTSYA-SAIHAI.G...KSRGKG..........GIKSG.....IYR.GP---------
E4TLC6_MARTH/72-378.....................TMNEVL-RTIDRA.............................A.NDDNLP---------
J7Q7E1_METSZ/171-468.....................YFTAYA-HAIRAI.G...DSAGTS..........R.........LPT.RP---------
G8R191_OWEHD/67-375.....................TMEKTL-QTIKYG.............................G.ARAGVP---------
D8PFZ8_9BACT/123-436.....................YRDRCL-AALQTL.....GEACPGWS.....PAPLL...ERDHLGPLPRV---------
G8MHC3_9BURK/186-488.....................YFQSYR-HAIEAI.G...KDARGQ..........G.........PID.GP---------
Q3IHR2_PSEHT/183-485.....................YFDSYM-NAIHAI.G...KAANGR..........G.........PIK.SP---------
A9TJ40_PHYPA/151-463.....................NLQKFV-HVVRQS............................SRLPQGSVS---------
Q5DZ94_VIBF1/199-500.....................YFKDYI-MAIESV.G...RAASIA....................NSP.EP---------
C7R7N1_KANKD/190-491.....................YYEAYS-KAIQEI.GQIKVKEGQL........................AP---------
H1Y3P5_9SPHI/81-387.....................TCQEII-RTINRA.............................N.GDKAIP---------
Q725V6_DESVH/123-440.....................YAQGYH-EVVDAI.....AREQEKWK.....ALPGNGPVEGFDWGATPKV---------
V4JH86_9DELT/123-438.....................YANQYL-MLLDAL.....AEAAPGWK.....DIDGGD..TGLDWGYSPRI---------
G9MLF6_HYPVG/155-487TARDIE......KEINPWRDGTLE...-.TVRLA.................................DPGD---------
T2GB03_DESGI/123-437.....................HLEDHL-KLLDAL.....GAAQKKWK.....PLGNAG..NELDWGHAPKV---------
Q5NFS5_FRATT/186-490.....................YYSQYL-HAIHEL.A...KYATNT..........E.........IKK.NP---------
Q0BXX8_HYPNA/181-485.....................YYKAYH-DAIAAV.AAEKDPAQ......................PPEKAN---------
A4VIY6_PSEU5/189-494.....................YMADYR-QAVETV.G...AEP...........QVG.........PGP.RP---------
F6EJT8_AMYSD/134-430.....................RLDGTR-RLLARD..................................DVD---------
D3FDW7_CONWI/118-434.....................YEARCD-EALDVV.....AAEARRWP.....ARPLL...EADGSGPIPRA---------
Q4FSA9_PSYA2/201-502.....................YFNDYL-HAIKAT.A...SVK...........VKE.........GMP.KP---------
Q8D2C0_WIGBR/261-570.....................YMTSYE-NAIHCI.G...KSSLGK..........G.........IYK.GP---------
E6VSX4_DESAO/125-438.....................YRDGYL-EVLDAI.....HKELDKWP.....ALDGGS..GNADWGHAPRV---------
G0IXE5_CYCMS/72-380.....................TMEEIL-NSIHKA.............................K.GNALIP---------
M4NAF6_9GAMM/187-490.....................YQEDYR-RAIARI.GARGPFAN......................HTD.AP---------
B9M0V5_GEODF/120-434.....................YVDQYL-DLIGSI.....ERAMGRWK.....PLGAGRTSGSMDWGHAPRI---------
Q3J4G7_RHOS4/170-470.....................YHLAYS-RAITAI.A...AAAKSR..........D.........IRD.NP---------
C4XQY2_DESMR/124-436.....................YRDGYL-EVLDAI.....AAEQGSWK.....AFGGAG..DGLDWGSAPRV---------
I2EXL9_EMTOG/75-383.....................TTDEVE-RTIIRA.............................SQQATNIP---------
A9C1A6_DELAS/259-571.....................YLQAYE-QAIHAI.G...AASNGR..........G.........IFE.GP---------
C9SYF0_VERA1/146-464RSDE...................EEQQ-RTDR.......................................---------
Q30QX6_SULDN/125-424.....................RVEKYI-SLLQNP..................................NID---------
W8KJQ4_HALHR/185-488.....................YFQAYK-DAIVRI.G...KSVDPRIT..................MRE.RP---------
C4K5M4_HAMD5/205-515.....................YWMTYH-NAIDVI.G...AASKHR..........G.........VYE.SP---------
E8UGG0_TAYEM/196-505.....................YYKAYE-DSIHAI.G...KAATGR..........D.........VYE.KS---------
E8R5H9_ISOPI/161-474.....................YLNTCL-DLLRGM.....AAQLDREP.....ERPII...DRDHQGPIPRL---------
N4VCC3_COLOR/121-460RAEAGDYAPAVYEMVQQWKKGNLE...-.TLEMM.................................APGD---------
H2FVF0_OCESG/190-493.....................YRADYA-SAIAAV.G...GEKL..........NNP.........EVP.RP---------
F8EFK6_RUNSL/77-382.....................TAGEIL-LTIEKA.............................N.QTQAIP---------
V4J1J7_9GAMM/170-474.....................RVDAYL-AALQLE..................................QIE---------
A2QWR7_ASPNC/131-458............AEIQTWLDGTLQ...-.TVDMA............................Q.....EGD---------
G7YAY9_CLOSI/137-446.....................ETGKLE-QLVPTL.....................................---------
B1ZUG1_OPITP/125-452.....................FLQRNL-EVLDTV.....SRFLVQEP.....APGFS...DLGPRGPLPRL---------
K9TNG5_9CYAN/130-444.....................YLERYL-DLMTQL.....TDVAKKWS.....KVPQI...DEADGETIPQV---------
B7K0R9_CYAP8/129-443.....................YFQKYL-DLMEEL.....SQQSQKWS.....KVPEI...DEADGEALPKV---------
A7IKY5_XANP2/198-502.....................YFAAYA-AAIEAI.G...KAAGGR..........G.........IHA.GP---------
A0KGC8_AERHH/190-492.....................YFGDYQ-RAIEAV.G...NERISD....................GGP.AP---------
I0K8U0_9BACT/91-399.....................TVLEIL-RTIERA.............................S.ESQDIP---------
F4CCZ8_SPHS2/81-387.....................VLAETI-RTIERA.............................K.KDTNIP---------
B6ITG0_RHOCS/194-497.....................YFDAYQ-QAIDAV.G...AQAGGR....................GPQESS---------
F0XMR1_GROCL/143-478TK..........QEIASWTEGTLE...-.TVRIA.................................APGD---------
Q5FP43_GLUOX/195-501.....................YRRDYE-RAIDVI.G...QTARGA..........N.........VYE.KA---------
Q5QY28_IDILO/189-494.....................YKQQYV-NSIKTI.T...KEEF..........NNP.........DAP.RP---------
M3XYT7_MUSPF/325-634.....................QTGQLE-PLLSRF.....................................---------
C5CN52_VARPS/156-462.....................YLESYT-QAIGAI.AAGADAAR......................GPEHND---------
K9WDJ4_9CYAN/129-443.....................YLQSYL-DLMEKL.....TQEAQNWS.....SVPEI...DVADGEPLPRV---------
F7QI31_9BRAD/181-485.....................YFESYA-AAIAAI.G...AAAGDR..........K.........PED.RP---------
Q0ASP6_MARMM/187-482.....................YHKRYL-EAIAAV.GKAREDG.......................PVERVH---------
K9XU71_STAC7/130-444.....................YLDRYI-ELIQQL.....SQKAQTWT.....RQAGI...DLAEGKEISSV---------
E4PKH6_MARAH/181-483.....................YYDSYS-NAIDSI.A...KASKGD....................VRK.NP---------
L0DPG6_SINAD/130-444.....................YQQTCL-ELIRGL.....SRPLAAEP.....EIPQI...DRDHRGSIPRV---------
N0BF27_9RHIZ/186-492.....................YFQRYM-AAIDAV.G...TAAPPFTATNVDA.............IFE.RP---------
K6YYW9_9ALTE/183-488.....................YFKAYQ-VAIDTI.G...AVARAS..........GKND......PRK.VP---------
Q73IQ2_WOLPM/178-482.....................YFNSYM-HSIKAI.GESTEINDCFK.......................SH---------
H6BYZ9_EXODN/152-491QSEI......NAREISGWKQNTMD...-.TINLT.................................QPGD---------
Q6MF92_PARUW/144-448.....................RLQIYL-DDLANP..................................LIE---------
A1WUH9_HALHL/185-489.....................FFQAYC-RGIEHF.G...RSADPDAP..................MDA.RA---------
Q5ZUU6_LEGPH/186-490.....................YFEAYK-EAIISI.G...EKADKHSD..................VYR.RP---------
F0SR05_PLABD/129-443.....................YQQAYI-DLIGQI.....SEPINALP.....ESAQV...DANHLGSIPRV---------
G7UWP8_PSEUP/155-463.....................YMHRYQ-AAIAAL.AAARERSV......................PVEQAD---------
E3I4E3_RHOVT/184-490.....................YLASYE-HAIRAI.G...GKRQGR..........S.........IYE.AP---------
Q5LP42_RUEPO/171-472.....................YHLSYS-RAIAAI.A...EACTHG..........D.........IRA.NP---------
Q47VW3_COLP3/183-488.....................YLKAYQ-DAINAI.G...EVAVAS..........GKND......PRK.VP---------
K9SGB6_9CYAN/140-451.....................YLDKYL-QIMQDL.....TESAKSWH.....TIDQI...DRADGENLPRV---------
E1V8R1_HALED/190-497.....................YFDDYA-NAIERV.G...KASAR.........LSD.........KTP.SP---------
PUT1_YEAST/146-461.....................IVKETI-SSVHNI.................LLPNIIGQLESKPINDIAPG---------
G2KP47_MICAA/168-477.....................YFNSYV-SALNVI.AANGKTVNGV........................MP---------
K4BCB4_SOLLC/171-478........................VFL-QTAELT............................KSLPSSSVS---------
W1PD27_AMBTC/253-566.....................NLDQFL-KTVEMA............................SFLPPSSVS---------
Q2N7F6_ERYLH/176-484.....................YRRAYE-RAIERLAGETDGTIQS.........................SP---------
B0RBJ3_CLAMS/105-406.....................RLAGTR-ELLARD..................................DVD---------
K4KRT3_SIMAS/178-479.....................YFADYQ-QAIKNI.AAHNKADN......................VID.AD---------
Q0BVZ4_GRABC/195-514.....................YYRAYE-HAIDCI.G...ATLRAR..........GYEPAEDMTALLE.AP---------
A8IG36_AZOC5/237-536.....................YFDSYA-TAIDDI.G...RRAGNM..........K.........LPD.RP---------
Q2SL11_HAHCH/190-493.....................YFQSYI-KAIETV.G...ADQY..........DT...........RPGAS---------
K4BCB3_SOLLC/174-480.........................FI-QTIEST............................KSLPESSAS---------
H8KZM8_FRAAD/187-490.....................YQQDYR-DAIAAV.GARGPFPS......................HIE.AP---------
I4AGT6_FLELS/91-397.....................TKGEII-RTIERA.............................K.GDANIP---------
A4Z2X8_BRASO/171-473.....................YKQSYA-AAIDAI.G...RAAGNA..........A.........LPE.RP---------
B0UDE2_METS4/170-473.....................YAEAYR-AAIEAI.G...RAAGNR..........P.........LPD.RP---------
A8LRL6_DINSH/181-482.....................YHAAYA-QAITAI.A...RQATGD....................VRS.SP---------
V5FUL1_BYSSN/140-491RAEDVAEKQKNTREILDWKDGTMR...-.TVELA.................................DDGD---------
R5X0A3_9BACT/67-376.....................VFAETE-RSIEYA.............................A.RNKNVA---------
Q6LFT6_PHOPR/190-497.....................YFKDYI-MAVESV.G...RDEYASQK.....GSNQ.........QSP.DP---------
D6WUI6_TRICA/274-587.....................TTGRMS-RLITQL.....................................---------
B1M5K8_METRJ/198-504.....................FRRAYA-EAIAAI.G...AASAGR..........G.........VLL.GP---------
H6L1M4_SAPGL/39-347.....................TLDEFL-KTLAFA.............................E.EQESLE---------
H5WQD6_9BURK/219-528.....................YFASYE-RAIQAI.G...QAAAGR..........G.........IYE.GP---------
Q8NU48_CORGL/130-428.....................HLDDTV-RLLRRP..................................DVE---------
A4G6Z2_HERAR/192-497.....................YYQSYL-SAIHAI.G...KSGNGR..........G.........IRN.GP---------
A1KC13_AZOSB/186-495.....................YTRAYE-EAIHAI.G...AAAAGH..........G.........PRA.GP---------
F3Z0N8_DESAF/122-437.....................YHDGYM-EILDAM.....AAEQHKWD.....CLGKSS..NGQDWGHAPKV---------
E1FT57_LOALO/261-563.....................KTKKME-PLLNCL.....................................---------
C5C6T6_MICLC/150-444.....................RLEGIA-ALIRRD..................................DVD---------
Q10YY5_TRIEI/130-444.....................YLDRYL-ELMTQL.....SQAANSWS.....SIPQI...DEAEGEKLPRV---------
I4C375_DESTA/122-433.....................YVNRYL-EVMNVL.....GPAARSWQ.....DMPLL...DADDRGPIPRL---------
E3F3C6_KETVY/202-507.....................YFREYE-AGIAAI.A...TRCTHG..........S.........IKT.NP---------
W0AMX3_9SPHN/178-477.....................YETIYA-DAIIAV.GKAADGAG.......................PELGH---------
A3QAI9_SHELP/192-495.....................YYQDYS-NAIAAL.G...AQQY..........DES.........EAP.RP---------
A1B0L0_PARDP/176-476.....................YDRAYS-DAIAAI.A...KACTRG..........S.........VED.NP---------
W8S551_9RHOB/180-481.....................YFDAYA-QAIAGL.A...AACRSD..........D.........IRA.NP---------
K8GCC7_9CYAN/128-442.....................YLDRYL-ELMAQL.....TDAAKRWS.....MIEQI...DRADGIDLPRV---------
M4VRQ9_9DELT/119-431.....................YQRRYL-ELIEWL.....AKDAATWN.....EIPQL...DRDADGSIPKV---------
PROD1_ARATH/168-483.....................NMQQFI-RTIEAA............................KSLPTSHFS---------
C8X4M0_DESRD/123-436.....................YQTNYL-HLMDAL.....AQEAKSWK.....GLGG....NSGDWGHAPLT---------
A9CG59_AGRT5/200-506.....................YYKDYE-NAIHAI.G...KASAGR..........G.........IYG.GP---------
Q6FBR9_ACIAD/206-516.....................YFNDYT-QAIHAI.G...QASNGK..........G.........VYD.GP---------
C1E2C6_MICSR/197-496.....................YLASYA-HAAEAI.....QAAGFR........................SP---------
D5VBX7_MORCR/179-481.....................YYQDYV-TAIHAI.G...KDSVGR..........G.........VYD.GN---------
K7SL66_GLUOY/193-490.....................ALTAYE-DALEDI.....SQHAGITG.....NFHE.............RP---------
C4QVR0_PICPG/110-457....................MIVPHTL-EMIKQA............................ENINDVAPG---------
Q746X3_GEOSL/122-437.....................YTNTYL-ELLEAL.....KKEQGSWK.....GLPGKGGDPGLDWGHAPKV---------
C1D8Q5_LARHH/181-483.....................YLDDYT-RAIHAI.G...QASAGR..........G.........VIE.GP---------
L0DXC8_THIND/182-482.....................YFDAYA-SAIRFL.G...AHSGSG..........D.........VEQ.AP---------
Q2JNZ3_SYNJB/130-434.....................YLDRYL-QVMEHL.....AKMVKTWP..................QPQPVP---------
M9R8D6_9RHOB/175-480.....................YHISYS-RAIASI.A...DACIND..........T.........VAE.NP---------
Q5P8F4_AROAE/237-543.....................YLAGYE-QAIHAI.G...KASAGR..........G.........VVD.GD---------
H0PXL0_9RHOO/189-495.....................YYDDYE-HAIHAI.G...NGSAKR..........G.........VVD.GN---------
Q7NGY2_GLOVI/131-445.....................YQRRYL-ELLSDL.....HAAQSRWP.....VIDQI...DRADGQLLPRV---------
R7J8S3_9PORP/67-375.....................TFEETI-RSIDYA.............................K.ENKNLA---------
E6WK59_PANSA/62-361.....................AINHTL-QLIDLA..............................HRSENMP---------
B1XJU5_SYNP2/128-442.....................YQQTYL-DLMADL.....AAAAKHWP.....KVDAI...DVADGEDLAKV---------
B2FJY7_STRMK/201-509.....................YLEDYR-RAIHAI.GGDHKARGGRPDGD................VNN.AP---------
B2IK06_BEII9/172-472.....................YYDAYA-QAIGRL.G...QRAGTR....................PLPARP---------
I1N4V3_SOYBN/171-468...........................-..IDVS............................RSLPPSSVS---------
A1U2B1_MARAV/181-483.....................YYQAYS-DAIDSI.S...KRCKGD....................VRT.NP---------
B8FJG0_DESAA/132-432.....................RLVTYI-QDMADP..................................DVE---------
X4QUP9_9ACTO/125-423.....................RLAAVT-QLLEYD..................................FVD---------
D5BFD6_ZUNPS/70-376.....................AVAKKI-ELIKFA.............................N.EEKEVP---------
E9F9P4_METAR/159-490TQKVID......NEIVPWAEGTLE...-.TVRLA.................................QPGD---------
B0JY14_MICAN/130-444.....................YLQSYL-DLMTHL.....AQEASKWN.....KVSQI...DEADGDLLPQV---------
A9HPN9_GLUDA/185-491.....................YYREYE-HAIHAI.G...GAAQRQ..........G.........VYR.GP---------
K9RFZ5_9CYAN/129-443.....................YLQRYM-DLMAQL.....AEASKKWK.....NVALI...DEADGEELPKV---------
Q28LK1_JANSC/174-475.....................FYASYA-DSIAYL.A...KQATHD..........D.........IRQ.NP---------
Q15TQ2_PSEA6/187-491.....................YYDAYL-SAIRSI.G...QSNDES..........D.........VNL.AD---------
C6W220_DYAFD/77-382.....................TTAEIL-KTIDKA.............................T.GSDTIP---------
A9SC33_PHYPA/80-388......................LEKFL-QVVRQT............................SLLPQGSVS---------
Q8YZD7_NOSS1/129-443.....................YLERYL-ELIAQL.....TEASKNWG.....TIAAI...DEADGEQLAKV---------
A3I0V1_9BACT/72-380.....................TTEEIK-QTMIES.............................A.KTDYMP---------
Q6MNK1_BDEBA/118-429.....................YSNKYM-ELVTWL.....AKDAEKWD.....EVPQI...DRDHEGALPKV---------
H8GI70_METAL/170-467.....................YFESYR-QAIEQL.A...EIAAFN..........D.........PLV.NS---------
F2J2U8_POLGS/179-476.....................YFQAYA-AAIEAI.G...TAAGNR..........P.........LPA.RP---------
Q2W4B4_MAGSA/178-477.....................YLRAYA-GAIEAL.GRHAKGAG......................PIA.GP---------
I0HCU0_ACTM4/124-415.....................RLKSTE-RLLARP..................................DVD---------
P74275_SYNY3/130-444.....................YWQNYL-DLMAQL.....SQQAKSWS.....KVPQI...DQADGEILPQV---------
B6JH11_OLICO/199-505.....................YYRAYE-AAINAI.G...KVAEGR..........G.........VYE.RP---------
A9RSW8_PHYPA/157-460.......................EKFL-QVVRQT............................SQLPPESVS---------
I2BAI5_SHIBC/262-571.....................YMVSYQ-QAIHAI.G...KASNGR..........G.........IYE.GP---------
Q6N9G9_RHOPA/172-474.....................YYQSYA-DAITAI.G...RRAGNA..........A.........LPA.RP---------
H8KRQ0_SOLCM/83-389.....................TCHEII-STINRA.............................T.KDHKVP---------
O24897_HELPY/120-425.....................RFEKYS-QALKSN..................................YIQ---------
D2QSB3_SPILD/40-348.....................TTLEIL-RTIERA.............................S.ESSDIP---------
U5T1S9_9GAMM/185-490.....................YFESYR-DAIIRI.S...GAARYS..........S.........GRD.NP---------
E9HR55_DAPPU/103-411.....................YNDNVE-VTLKLA..........................EIAYQHGGPLS---------
W5XW07_9CORY/130-427.....................RAERTL-ALIRNP..................................LVT---------
B9KII4_ANAMF/179-481.....................YFAAYM-GALETL.GSNAQAVD......................DLGSRH---------
K9ULL5_9CHRO/143-454.....................YLDRYL-TMMENL.....AARARNWP.....TIAEI...DRSELGSLDRV---------
Q21UN0_ALBFT/267-576.....................YVASYE-QSIRAI.G...MASNGR..........G.........IFE.GP---------
Q2RWN5_RHORT/175-476.....................YFKAYA-NAIAAV.G...ARATQA..........D.........VHA.NS---------
E1VMJ8_9GAMM/209-510.....................YLTAYE-TALTAL.ANLPGSQRI.........................HN---------
Q83DR6_COXBU/186-490.....................YYDSYH-RAISVL.G...KSHPTK..........S.........VHE.AP---------
F4KQ39_HALH1/97-405.....................TMNENL-RSIEFA.............................S.KQSFVP---------
F2G8W7_ALTMD/183-485.....................YYDAYV-KAIKVI.G...KAANGR..........G.........PKR.SP---------
I4A307_ORNRL/66-371.....................CFYEIL-SIIDLA.............................E.NNPKIP---------
Q1QI19_NITHX/186-488.....................YFKSYA-AAIEAI.G...QYAGDR..........P.........LPD.RP---------
A1SRQ1_PSYIN/183-485.....................YFQSYV-KALVVI.G...EAAKGR..........G.........PRK.SP---------
I3TI59_TISMK/188-494.....................YHEAYL-AAIRAV.G...KVAPREL.........D.........EIT.RP---------
M4U3Z5_9GAMM/195-498.....................YFKSYV-QAIESV.G...VQNNL.........EGA.........SKT.EA---------
C6XJL8_HIRBI/186-488.....................YFKNYL-NAANTI.AKTAKKYP......................SYKEAP---------
A3MYH8_ACTP2/181-483.....................YYQDYV-NSIHAV.G...AASKGL..........G.........VYH.SS---------
K0CHY5_ALCDB/195-485.....................YHHQYR-QAIEVLAG...QDPGLP....................VLA.RD---------
C7RS12_ACCPU/178-484.....................YFESYS-KAIAAI.G...KAATGR....................PAFDAP---------
E1SPV0_FERBD/192-495.....................YFDSYS-RAITAL.G...AHSY..........DVS.........QAP.RP---------
D5A2Q2_ARTPN/130-444.....................YLNSYL-ELMEKL.....SAAAQRWS.....TVPLI...DEADGKAIPRV---------
V5SEX9_9RHIZ/191-499.....................YFDRYM-AAIEAV.G...EAAGPNPLSHPDA.............LLA.RP---------
Q7VJT7_HELHP/125-423.....................RIKKYE-EAIKSN..................................YIT---------
Q89E26_BRADU/170-472.....................YFDAYA-SAIETI.G...KAAGNH..........A.........LPD.RP---------
Q11IQ4_CHESB/173-474.....................YFQAYR-NAIAAL.K...GEAKSE..........D.........IRA.NP---------
K9SCU8_9CYAN/129-443.....................YFRRYI-ELMTAL.....TAAAQHWS.....PVAAL...DHAEGDRLPTV---------
K9YQR1_CYASC/130-444.....................YLQNYL-DLITQL.....SNQAQKWS.....TIPEI...DTADGENLPKV---------
S5YB79_PARAH/170-468.....................YEAAYA-KAITAI.A...SACVKG..........R.........LRD.NP---------
C1GAY3_PARBD/149-507REED...KAQGIADLTAWKEGTLE...-.TVDLA.................................DDGD---------
B4RDQ4_PHEZH/172-472.....................YEAAYA-EAIRVV.GKSATGQG.......................PEAGH---------
B8EK67_METSB/174-474.....................YFQSYA-HAIESV.GGARGAGASE........................RL---------
C7LXP8_DESBD/125-438.....................YLKEYM-ELLDAL.....KKEHASWA.....GLGG....KDLDWGHAPKV---------
W8EVF8_9BACT/75-382.....................TTTELL-ATIDLA.............................H.RSQHIP---------
E2SAB5_9ACTO/132-425.....................RREAVT-GLMQRD..................................DVD---------
A0RQB5_CAMFF/120-419.....................RIQKYE-EAIKSK..................................YIT---------
D0J1C3_COMT2/206-515.....................YMQSYV-NAIHAI.G...KAADGK..........G.........VYE.RP---------
G8PFS8_PSEUV/176-479.....................YHLSYS-KAISAL.A...SNCVHS..........S.........IRD.NP---------
F2K118_MARM1/190-495.....................YLKSYE-DAVESV.G...KDSY......................NKGHRP---------
C7JEM3_ACEP3/214-519.....................YRQDYI-NAINTI.G...RSATGN..........N.........VYD.RP---------
F8KUD6_HELBC/124-429.....................RMHKYQ-EAIKSS..................................YIK---------
Q8DLR2_THEEB/124-425.....................YCDRYL-DLMEHL.....SPLGQREG....................VNPV---------
D7SMI9_VITVI/173-476.........................FI-RTVEGA............................KRLPPSSVS---------
G0A0F2_METMM/181-477.....................YFQAYH-DAIVTL.A...SVAG.A..........D.........LFA.NP---------
E4RQ43_LEAB4/72-381.....................TKIELL-KTIEMA.............................SLNPDKIP---------
Q20YI8_RHOPB/172-468.....................YFASYA-AAIDAI.G...RSAGTA..........R.........LPA.RP---------
G4RBU0_PELHB/190-496.....................YMAEYV-GAIHAI.G...KASAGK..........G.........PYG.GP---------
D5AN87_RHOCB/170-470.....................YRLAYA-QAITAI.G...KAATRG..........S.........IAA.NP---------
E8RP12_ASTEC/170-466.....................YFSAYE-QALDTV.GRSPKGT...........................GH---------
Q1GPE4_SPHAL/177-477.....................YFASYA-DAITRI.GRDAKPGD......................PHA.NH---------
D5SZA2_PLAL2/143-464.....................YQQRYL-DMLSSL.....GAEVSNWPAHTSYAHAAAVEGKSAATAEIPQL---------
A1WR88_VEREI/191-506.....................YYALYE-QAIHAI.G...KASNGR..........G.........IYE.GP---------
B4R3R9_DROSI/14-329.....................QTGQMR-RLISQI.....................................---------
B1XXB4_LEPCP/183-494.....................YLAAYQ-GAIAAI.AKPGRATS.......................PESAD---------
A0LGH8_SYNFM/123-435.....................YVSRYL-ELFDIL.....DEAQRKWP.....AIGGGA..QQADWGHAPKV---------
Q9CN54_PASMU/180-482.....................YYQDYV-DSIHAV.G...QRSSGL..........G.........VYA.AS---------
K9RTF2_SYNP3/123-424.....................YLQKYL-DLIQTL.....SPGSANPV....................ANKP---------
B0SX13_CAUSK/176-473.....................YEKSYA-DAIETV.GKLSNKAG.......................PEAGH---------
I0HK91_RUBGI/171-476.....................YLASYE-NAIAAI.ASGRAERGPL....................PPMEGD---------
Q0A545_ALKEH/185-489.....................YFEAYR-NAIHRV.G...KAVDPQAR..................IRD.RA---------
G8UMQ7_TANFA/67-376.....................TMEETL-RSIDNA.............................K.DNPDIA---------
G7ZID6_AZOL4/210-517.....................YHADYE-KAIHAI.G...KASAGR..........G.........IYD.GP---------
F4HDV6_GALAU/183-485.....................YMQDYV-EAIDAV.G...RQSAGR..........S.........LYD.SN---------
E0TFB1_PARBH/171-472.....................YRESYA-GAIAAI.GQRAKANM......................PPADRP---------
A8ZMR8_ACAM1/128-442.....................YLQGYL-HLMTQL.....AQAAKAWS.....EIALI...DRVEGVAFPKV---------
G2X8S4_VERDV/146-474RSDE........EEVRPWQEGTEQTQQ-RTDR.......................................---------
M2NL10_BAUCO/149-482............EDVARWRKRLLE...-.TVSMA............................Q.....PGD---------
Q12GH2_POLSJ/160-462.....................YLASYT-NAIESI.AAGASNAS......................PTEQND---------
F0NYJ2_WEEVC/69-373.....................VRDVML-ELIDIS.............................K.NNPSIP---------
Q6AA40_PROAC/139-437.....................RLEGTM-ALLARE..................................DVD---------
Q98L65_RHILO/187-488.....................YHKAYA-DAISSL.D...AGSNGP..........D.........IRQ.NH---------
Q87FF3_VIBPA/190-492.....................YFKDYL-MAIEAV.G...RETY..........GND.........TSP.AP---------
C1DQT9_AZOVD/189-493.....................FLTDYR-LAIEAL.G...REP...........QVG.........GGP.RP---------
M5E4Q0_9GAMM/195-495.....................YANSYL-MALQRI.AASQKTDGH.........................PH---------
X6PEJ3_RETFI/230-571.....................NAQNKV-DLAKNL............................AQNFKGSVR---------
G0AEN1_COLFT/169-474.....................YYRSYE-DAIHAI.G...KASNGR..........G.........IKQ.GP---------
D2R6H7_PIRSD/157-469.....................YFEAYL-KLLGDT.....SKVAAAWE.....AHPRV...DNDDRGPTPRV---------
A5FXC3_ACICJ/246-552.....................YYRDYE-QAIHAI.G...AAAGGK..........G.........IYR.GP---------
C7PKU9_CHIPD/72-379.....................AVPEFV-RAIEYA.............................A.GNPNIP---------

PF02219

MTHR2_YEAST/6-298HLSTDLVATAQS------------------------------------------VLGLETCMHLTCTNMPISMIDDALEN
MTHR1_SCHPO/6-292ELTPGIVNVIQT------------------------------------------DFEVDTCMHLTCTNMSTEMIDAALKR
METF_AQUAE/2-288DRTRNIVQKIHE------------------------------------------ETNLTVMAHLTCIAHTREELIDILQD
MTHR2_SCHPO/6-305EVSIYLAKMLEQ------------------------------------------HHKIPACLHLTCTNVDKAIIDKALET
MTHR_CAEEL/61-350TSSSSIAASMLD------------------------------------------YCGVDTMLHMTCVQYNKADTLKHLEQ
METF_HAEIN/9-289DRTHGIVKAIKQ------------------------------------------ETGLEAAPHLTGIDATPEELKQIARD
MTHR1_YEAST/6-302EKTLTLASLAQQ------------------------------------------TLNIPVCMHLTCTNTEKAIIDDALDR
P73677_SYNY3/47-334RMSSIAACVLLQ------------------------------------------QRGIEAICQMTCRDRNLIGLQADLMG
MTHR_HUMAN/48-337TSSMMIASTAVN------------------------------------------YCGLETILHMTCCRQRLEEITGHLHK
MTHR2_ARATH/6-301DLTLDIASRMQN------------------------------------------VVCVESMMHLTCTNMPVEKIDHALET
Q6CZA9_PECAS/14-291DRTHSIIKTIKE------------------------------------------RTGLEAAPHLTCIDASREQLREIAQD
Q9S2V3_STRCO/16-300AGTVRETQQIVA------------------------------------------DTTLTPVAHLTAVDHSVAELRNIIGQ

PF01619

Q2Y8S2_NITMU/179-490GISVKLSAL.............................................HPRYVRSQRERVMSELLPRLKSLLLL
E4TLC6_MARTH/72-378FCVFKPSGVSLGKIFTKIQ...................................AGKELTEKEKAIHQRDKERIEKICKA
J7Q7E1_METSZ/171-468GISIKLSAL.............................................HPRYEAISRERVLRELPPRLLDLARL
G8R191_OWEHD/67-375FAVFKMTGVARFGLLQKVS...................................EGKELTEAEKKEFARAKDRIETICKE
D8PFZ8_9BACT/123-436QLSIKISAL.............................................YSQLDPIDPESSYRAVAARLRPLLNL
G8MHC3_9BURK/186-488GVSVKISGL.............................................HPRYELAQRERVLAEMYPRLLQLAQI
Q3IHR2_PSEHT/183-485GISVKLSAI.............................................HPRYEFTHKERVMAEIVPKLKELALA
A9TJ40_PHYPA/151-463TSCVKISAICPIQLLERVSDLFRWQHVHKEFKLPWKQDVIPFLAEESPTHHVTSPPEPLTKEEEIDLTLAHKRLKDLCEA
Q5DZ94_VIBF1/199-500TVSIKLSAL.............................................HPRYEVANKERVMNEMYQSVLQLLER
C7R7N1_KANKD/190-491SISIKLSAL.............................................HPRYEVGQKDRVMTEMVDTLLKLVKQ
H1Y3P5_9SPHI/81-387LTVFKVTGVGRFALLEKLD...................................AKQALNETEQQEWTKVKARVKAICQK
Q725V6_DESVH/123-440NVSIKPSAL.............................................YSQAKPVDVEGSVRGILSRLVPIYRK
V4JH86_9DELT/123-438NISVKSSAL.............................................FSQTHPKDFEGSVAGILTRFTPIYRR
G9MLF6_HYPVG/155-487FVALKFTGAGSLAL........................................NQL...KNGLPPSQHLSESIDAICQL
T2GB03_DESGI/123-437NLAVKPTAF.............................................YSQATPRDFEGSVQGMLKRLLPMALK
Q5NFS5_FRATT/186-490GISIKLSAL.............................................HPRYEVAKHQRVHTELYPKLLKLTQL
Q0BXX8_HYPNA/181-485GVSVKLSAL.............................................HPRYLAIKEARVMAELYPRVLSLCEA
A4VIY6_PSEU5/189-494SVSIKLSAL.............................................HPRYEVAQRERVLNELFASVRELAIL
F6EJT8_AMYSD/134-430YVSIKVSST.............................................VAPHNHWAFDEAVTHVVENLTPLYRQ
D3FDW7_CONWI/118-434NLSVKVSAL.............................................TPRLRPEAPGPGQRDAARRLRRLLAR
Q4FSA9_PSYA2/201-502SVSIKLSAL.............................................HSRYEATQEAQVMGLLRQRCLLLIEA
Q8D2C0_WIGBR/261-570GISIKLSAI.............................................HPRYSRNKYEKVMSELYPRLRSLTLL
E6VSX4_DESAO/125-438NVAVKPSAF.............................................YSQSKAVDLDGTAEGMLASIEPVYRK
G0IXE5_CYCMS/72-380FAVFKVSGIAPSSILAKVQ...................................SKQELLPKERKRIDEAKERVFKLCEA
M4NAF6_9GAMM/187-490SISVKLSAL.............................................HPRYEVAKREDARRMLTAKLLELSQL
B9M0V5_GEODF/120-434NVSVKATAL.............................................SCLASPMDYEGSVAAILRRLRLICRR
Q3J4G7_RHOS4/170-470GISVKLSAL.............................................HPRYEVAKRTRVLAELVPRVTALAGL
C4XQY2_DESMR/124-436NASIKPSAL.............................................FSQAKPMDFEGSVEGILARMRPIYRK
I2EXL9_EMTOG/75-383FSVFKVSGVGSVELLEKVQE..................................RPEMLTKEDKAAFQRIHDRVNRLCQL
A9C1A6_DELAS/259-571GISIKLSAL.............................................HPRYSRAQYERVMAELLPRVLQLAEL
C9SYF0_VERA1/146-464...VRFTGAGQQAL........................................YAL...AERLPPSAALASAMDSICAC
Q30QX6_SULDN/125-424YVSIKISTI.............................................FSQINPISHHWSIEQISLRLQKIYRA
W8KJQ4_HALHR/185-488GISVKLSAL.............................................DNRYEPGHEERVHRRLMPRILELCQL
C4K5M4_HAMD5/205-515GISIKLSAL.............................................HPRYTRSQYKVLVEELYPRLLSLAQK
E8UGG0_TAYEM/196-505GISIKLSAL.............................................HARYSRSQIDRVMEELYPRLRDLTFL
E8R5H9_ISOPI/161-474NLSVKLTGL.............................................TSRFDPVAVEATTNRVMDRLRPLARQ
N4VCC3_COLOR/121-460FLAVKVSGAGPIAV........................................DAM...RNKAPIPPVLRSALDEICAA
H2FVF0_OCESG/190-493SISIKLSAL.............................................HPRYEEANRERVLTELYATVQGLLET
F8EFK6_RUNSL/77-382FSVFKVTGIGSTPLMEKIQ...................................AGEPLSAAEQAAFERIKGRVDQLCKK
V4J1J7_9GAMM/170-474CISVKISTI.............................................YSQISSLARERSLRILCERLELLYRA
A2QWR7_ASPNC/131-458FVALKFTGMGTQVL........................................EFL...QKQAAPSEFMDYAITKVCDL
G7YAY9_CLOSI/137-446...........................................................TPDGLEQMRNMLRRMDTIATY
B1ZUG1_OPITP/125-452NLSVKISAL.............................................TPEVQPADPENSILALKQRLRPILRR
K9TNG5_9CYAN/130-444QVSVKLTAF.............................................YSQFDPIDAEGSEARVIDRIRTLLRH
B7K0R9_CYAP8/129-443QVSVKLTAF.............................................YSQFDPIDPEGSKDKVCAFIRVLLRR
A7IKY5_XANP2/198-502GISVKLSAL.............................................HPRYARAKAGRVMAELLPRLQRLALL
A0KGC8_AERHH/190-492SISIKLSAL.............................................HPRYDVANRERVLGEMCERLVGLVRL
I0K8U0_9BACT/91-399FSVFKVTGVAETELLEAVQ...................................RGDELSEADQAAFARVRERVQTLCQR
F4CCZ8_SPHS2/81-387FSVFKVTGLGRFDLLAKVN...................................AGEPLTETEAAEFARVKNRVEKICAF
B6ITG0_RHOCS/194-497GVSIKLSAL.............................................HPRYEFAQRARVMTELVPRVKTLALS
F0XMR1_GROCL/143-478FVALKFTGAGREAL........................................YHL...SERKPPAPALAEAVDNICDL
Q5FP43_GLUOX/195-501GISIKLSAL.............................................HPRYAFAQRERVLKELGQTLKDLVIQ
Q5QY28_IDILO/189-494TISIKLSAL.............................................HPRYEASNHERVLTELATTLTELVKL
M3XYT7_MUSPF/325-634...........................................................TTEEEQQMTRMLQRMDVLAKR
C5CN52_VARPS/156-462GISIKLSAL.............................................HPRYEDAQRERVMRELVPRVWQLCEL
K9WDJ4_9CYAN/129-443QVSVKLTAF.............................................YSQFDPLDPQGSRERVCDRIRTLLRR
F7QI31_9BRAD/181-485GISIKLSAL.............................................HPRYDALSRTRVMSELVPRVLDLARR
Q0ASP6_MARMM/187-482GVSVKLSAL.............................................HPKYLAVKEKRVIEELYPLVLEQAVA
K9XU71_STAC7/130-444QVSVKLTAF.............................................YSQFDPLDPEGSKAKVCDRIRILLRK
E4PKH6_MARAH/181-483GISVKLSAL.............................................LARYEYGNKERVMNELLPRARELVKK
L0DPG6_SINAD/130-444NLSLKLTSL.............................................TARFDALYDRSTLRRVAHRLRPILRT
N0BF27_9RHIZ/186-492SISVKLSAL.............................................HPRFEPGKETRLHAELAPRLLTIARA
K6YYW9_9ALTE/183-488GISVKLSAI.............................................HPRYEFAQKERVMAEAAPKLKALCLQ
Q73IQ2_WOLPM/178-482GVSIKLSAL.............................................HPRYEFGQFDNIAEELRAKLLELCHE
H6BYZ9_EXODN/152-491FVALKFTGAGRQAL........................................QHL...KATIACSPEFEQAVHDMCKL
Q6MF92_PARUW/144-448YISIKISTI.............................................YSQIHLLAWEETLEILSERLRLLYRA
A1WUH9_HALHL/185-489EVSVKLSAL.............................................DPRFEPGQEERVQATVIPRLQALCRR
Q5ZUU6_LEGPH/186-490GISIKLSAL.............................................HPRYSEFQYERVMAELPPKLLALSRL
F0SR05_PLABD/129-443NVSLKLSAL.............................................DSHFNPADPEGTTDRVLDRLRPILRT
G7UWP8_PSEUP/155-463GISIKLSAI.............................................DARYEAVQHDQVMAHLVPRVCALAEA
E3I4E3_RHOVT/184-490GISVKLSAL.............................................HPRYTYAQMDRVGAELYPRLLRLATM
Q5LP42_RUEPO/171-472GISVKLSAL.............................................HPRYELAQDARVMDELVPRLRALALL
Q47VW3_COLP3/183-488GISIKLSAI.............................................HPRYEFSHKERVMTEIVPKLKALCLQ
K9SGB6_9CYAN/140-451QVSVKLSAF.............................................YSQFDPLDPVTTTEKVSEPARILLRR
E1V8R1_HALED/190-497SVSIKLSAL.............................................HPRYEFGRREQVLEELVASTLELVRM
PUT1_YEAST/146-461YIALKPSALVDNPHEV......................................LYNFSNPAYKAQRDQLIENCSKITKE
G2KP47_MICAA/168-477GISVKLSAL.............................................HPRYRYSQADHCIPALTDKLMDLARV
K4BCB4_SOLLC/171-478FVVVKITAICTPKLLKRMSDLLRWEQKDPSFNLPWKQKTLPLFAESSPFYHTLKRPEPLTIEEERDLQLGRDRLEKICKK
W1PD27_AMBTC/253-566FACVKITAICPLSLLERVSDLLRWEHKDPTLRLPWKRDTLPILSPSSPVYHTPNKPESLSQTEEARLNLAHERLEKLCKK
Q2N7F6_ERYLH/176-484GISVKLSAL.............................................YPKYDIFHQDAAVEALVPMLRDLAIK
B0RBJ3_CLAMS/105-406YVSIKVSSV.............................................VSQLSMWAFDEAVDKVVERLTPLYEL
K4KRT3_SIMAS/178-479GISIKISAL.............................................HARYQYSQSERVMNELLPRVRELALQ
Q0BVZ4_GRABC/195-514SISIKLSAL.............................................HPRYEHTQHARIMQDLPPLLRNLAAM
A8IG36_AZOC5/237-536GISVKLSAL.............................................HPRYDAVNRERVLIELVPQVIELARK
Q2SL11_HAHCH/190-493SISIKLSAL.............................................HPRYEQAHQDRVLTEMYEKVLLLVRA
K4BCB3_SOLLC/174-480FVVAKITAICTPRLLKRMSDLLRWEQKDPSFNLPWKRESLPLFAESSPVYHTCSKPEPLSVEEERDLQLAHERLRKICEK
H8KZM8_FRAAD/187-490SISVKLSAL.............................................HPRYDIGQRERACAQLGARLLELSQL
I4AGT6_FLELS/91-397FCVFKVTGIGDSKILEKIQ...................................ANEPLNTEEQNSWEEIQFRMNEICEA
A4Z2X8_BRASO/171-473GISVKLSAL.............................................HPRYEEISRERVLRELVPVVIDLAKQ
B0UDE2_METS4/170-473GISVKLSAL.............................................NPRYEPLSRGRVMDELVPVLLSLARA
A8LRL6_DINSH/181-482GISVKLSAL.............................................HPRYEYTHRHSVMADLVPRAAALVKQ
V5FUL1_BYSSN/140-491FVALKFTGAGKQAL........................................EHL...LRKLPPSSQLEDAIIEICDT
R5X0A3_9BACT/67-376YAVFKPSTLTTDTLLAKASE..................................HPETLTAAERTGFDAFAARFDALCAL
Q6LFT6_PHOPR/190-497TVSIKLSAL.............................................HPRYDVANEARVLDEMYESVLTLLSR
D6WUI6_TRICA/274-587...........................................................SPKEEEMFRNMIRRMNTIVKA
B1M5K8_METRJ/198-504GISIKLSAL.............................................HPRYVRAQRDRVLAELYPRVLDLARR
H6L1M4_SAPGL/39-347IISAKVTGLAQHALLEKIT...................................AADILSETELAAWDRAKERLRVLCQT
H5WQD6_9BURK/219-528GISIKLSAL.............................................HPRYQRAQLARVMDELYPRLLALALQ
Q8NU48_CORGL/130-428YVSIKVSSV.............................................ASQISMWGFEDTVNYVVEQLTPLYIE
A4G6Z2_HERAR/192-497GISVKLSAL.............................................HPRYARSQRIRVMQEMLPRLKNLVLL
A1KC13_AZOSB/186-495GISIKLSAL.............................................HPRYCRAQRSRVRAELLPRLAALMRL
F3Z0N8_DESAF/122-437NVAVKLSAF.............................................YSQAKPQDIPGSVAGMLTRIVPIYRK
E1FT57_LOALO/261-563...........................................................TESETQETANMMDRIVRTIEY
C5C6T6_MICLC/150-444YVSVKVSAA.............................................TAPHAPYAFDEAVADITERLTPLFEL
Q10YY5_TRIEI/130-444QVSVKLTAF.............................................YSQFDPLDVKGSQERVSDHVRTLLRH
I4C375_DESTA/122-433DVSLKVTSF.............................................YSQLDPVDWDGSILSTSKNLAPIFRA
E3F3C6_KETVY/202-507GISIKLSAL.............................................HPRYEVAQRDRVMAELAPRVLELCRQ
W0AMX3_9SPHN/178-477GVSVKLSAL.............................................SPRYEAVQEARVMEELYPRVKRLALI
A3QAI9_SHELP/192-495TISIKLSAL.............................................HPRYEVANEDRTMTELYDTLIKLVSQ
A1B0L0_PARDP/176-476GISIKLSAL.............................................HPRYEVAQESRVMTELVPVVLKLARQ
W8S551_9RHOB/180-481GISIKLSAL.............................................HPRYEAAQRDRVMAELVPRVRRLARA
K8GCC7_9CYAN/128-442QVSVKLTAF.............................................YSQFDPLDEKGSQEKVSDRIRLLLRR
M4VRQ9_9DELT/119-431NVSVKMSAL.............................................YSQINDKAWNETKTILKDRLRPVFKK
PROD1_ARATH/168-483SVVVKITAICPISLLKRVSDLLRWEYKSPNFKLSWKLKSFPVFSESSPLYHTNSEPEPLTAEEERELEAAHGRIQEICRK
C8X4M0_DESRD/123-436NISIKPSAL.............................................YSQARPSDFENTVQAIFDRLMPVLDK
A9CG59_AGRT5/200-506GISIKLSAL.............................................HPRYARAQAERVMAELLPRVKSLMLL
Q6FBR9_ACIAD/206-516GISIKLSAL.............................................HPRYQRSQIARVHDELYGKVFNLALL
C1E2C6_MICSR/197-496QMSVKLSSL.............................................SPRFDELSRRECVPDLSSKLGSLFPI
D5VBX7_MORCR/179-481GISVKLSAI.............................................HPRYFRAQHARVMNELLPRLKALFVL
K7SL66_GLUOY/193-490ILCVRLPAL.............................................SARFGRFRRERIMTELLPTLQRLAIR
C4QVR0_PICPG/110-457YVALKPTGMAEDAANV......................................LKNYNKPEYRERFEKLVDNCRNVTSN
Q746X3_GEOSL/122-437NIAVKPTAL.............................................FCLANPQDFEGSVVAILDRMRRIFKK
C1D8Q5_LARHH/181-483GISVKLSAI.............................................HPRYSRAQRDRVLAELLPRLKSLMML
L0DXC8_THIND/182-482GISVKLSAL.............................................HPRYVFAQRRRALPALVERLGTLAAD
Q2JNZ3_SYNJB/130-434QVSVKLTAF.............................................YSQFDPIDPLGAKAKVGERIRILLRR
M9R8D6_9RHOB/175-480GISVKLSAL.............................................HPRYEEAQRDRVMAELVPRLRSLAML
Q5P8F4_AROAE/237-543GISVKLSAL.............................................HPRYVWSQRGRVLAELLPRLKSLCML
H0PXL0_9RHOO/189-495GISVKLSAL.............................................HPRYNWAQRERVMAELLPRLKTLCEL
Q7NGY2_GLOVI/131-445HFALKLTSL.............................................YSQFDAIDPATTGRNVKARLRPILRK
R7J8S3_9PORP/67-375YAVFKPSTITTDELLAKASE..................................RHSELTIEEVKAFREFKERFMALCQR
E6WK59_PANSA/62-361FVVVKPTALGSSGVYEKVS...................................KNLINSDEEKEDWQKIINRFYTIFDC
B1XJU5_SYNP2/128-442QVSVKLTAF.............................................YSQFDPLDPAGSKENVAERVRLLLRH
B2FJY7_STRMK/201-509GISIKLSAL.............................................YPRYEHAKRERVLKDLVPGVLELAQL
B2IK06_BEII9/172-472GISVKLSAL.............................................HPRYEARKRTTILPELLPRISQLARL
I1N4V3_SOYBN/171-468FVIVKITAICPMSLLERMSDLLRWQHKDPSFSLPWKQDCFPIFSESSPLYHTSKRPEPLTREEESDLQLAMQRFLELCQK
A1U2B1_MARAV/181-483GISVKLSAL.............................................LARYEYGHKERVMNELMPRALKLARK
B8FJG0_DESAA/132-432YISVKISTL.............................................YSQISSLAFEHTVDVMVDRLSKLYAV
X4QUP9_9ACTO/125-423YVSIKVSSV.............................................LGVHNPWGYQQAVDQAIEALLPLYRT
D5BFD6_ZUNPS/70-376FAVFKPTGVGRFEIWEKMT...................................AKVSLSDEEKKEWENIKERVEKLCKT
E9F9P4_METAR/159-490FVALKFTGAGSLAL........................................HEL...KHKLPASPYLSKSIDSICQL
B0JY14_MICAN/130-444QVSVKLTAF.............................................YSQFDPMDPIGSKEKVCDRIRLLLRR
A9HPN9_GLUDA/185-491GISVKLSAL.............................................HPRYSRLQRQRAMTELLPRLTALARL
K9RFZ5_9CYAN/129-443QVSVKLTAF.............................................YSQFDPLDDKGSEEKVVSHIRSLLRR
Q28LK1_JANSC/174-475GISVKLSAL.............................................HPRYEEAQRDRVLSELVPRVLELAQA
Q15TQ2_PSEA6/187-491GISVKLSAL.............................................HPRYEFSHHHLVIDELLPSVLSLALE
C6W220_DYAFD/77-382FSVFKITGVASSELLEKVQ...................................RKDELSDDEKATFERARQRVQRLCAH
A9SC33_PHYPA/80-388SSCVKLSAVCPIELLERVSNLLRWQHVNRGFKLPWKQDVIPFLSENSLVYHVTSPPEPLTKEEEANLVSAHERLTRLCKA
Q8YZD7_NOSS1/129-443QVSVKLTAF.............................................YSQFDPLDAKGSEEKVSDRIRILLRR
A3I0V1_9BACT/72-380FGVIKVTGLGDYHHLIKIQ...................................AGEKLTAEEQKGFDKTKARVDMLCKT
Q6MNK1_BDEBA/118-429NVSVKMTAL.............................................YSQIKDAAWDESKKILKDRLRPVFRL
H8GI70_METAL/170-467GISVKLSAL.............................................CPRYEPLQEQRAVGELNRKLLDLSRL
F2J2U8_POLGS/179-476GISVKLSAL.............................................HPRYEAVKADRVQAELLPRLLELVRM
Q2W4B4_MAGSA/178-477GLSVKLSAL.............................................HPRFEMAQRQRVLGELVPRLRDLCHR
I0HCU0_ACTM4/124-415YVSIKVSST.............................................VAPHNPWAFEESVADIVDELTPLFTL
P74275_SYNY3/130-444QVSVKLTAF.............................................YSQFDPLDPAGSKAKVCERIRELLRR
B6JH11_OLICO/199-505GISIKLSAL.............................................HPRYSRAQAGRVMGELLPRVRGLARL
A9RSW8_PHYPA/157-460MACVKISAICPIQILERVSNLLRWQHVKKDHKLPWKQDAIPVLAESSPTYHVQSPPEPLSEVEESHLAHAHNRLAKLCQA
I2BAI5_SHIBC/262-571GISIKLSAL.............................................HPRYSRAQYERVMHELYPRLKSLTLL
Q6N9G9_RHOPA/172-474GISVKLSAL.............................................HPRFEAISRDRVMRELTPRLLELAQL
H8KRQ0_SOLCM/83-389FSVFKVTGLARLELLEKIQ...................................RGDQLSEKENLEWLRVQSRVDMICHA
O24897_HELPY/120-425YISIKITTI.............................................FSQINILDFEYSKKEIVKRLDALYAL
D2QSB3_SPILD/40-348FSVFKVTGVASTELLEAIQ...................................IGDSLNKEQKAEFDRVMKRVDTLCRR
U5T1S9_9GAMM/185-490GISVKLSAL.............................................HPRYELAQRDRVLHELVPRVTALAQL
E9HR55_DAPPU/103-411CLQTKITALISADLL............................................VKQENIELEMGLERLKSVGAF
W5XW07_9CORY/130-427YVSVKASSM.............................................VAQLNPWDIEGSLKRLKERLLPLYDE
B9KII4_ANAMF/179-481GISVKLSSL.............................................HPRYEFGQADYVLKDISSKLLELCQV
K9ULL5_9CHRO/143-454QVSVKLSAF.............................................YSQFDPLDPVMTTEKVSEPVRRLLRK
Q21UN0_ALBFT/267-576GISVKLSAL.............................................HTRYSRAQRDRVMGELLPRLTKLALL
Q2RWN5_RHORT/175-476GISVKLSAL.............................................HPRYEEVNRARVMAELVPRLSALAEM
E1VMJ8_9GAMM/209-510SLSVKLSAF.............................................HPRFEPRQPE.ALAALRKNLLFILEK
Q83DR6_COXBU/186-490GISVKLSAL.............................................YPRYDFKKRELAVPFLIERVKELALH
F4KQ39_HALH1/97-405IISTKLSGLGRFELLESVQ...................................AGVAFTEETKSEYKSILRRLDAICHA
F2G8W7_ALTMD/183-485GISVKLSAI.............................................HPRFEFSHRERAMVDIPPRLKALCMM
I4A307_ORNRL/66-371FVVFKPTGYGNIDLYEKVG...................................KKQQLSPAEHTAWEHIKTRYYKTCKK
Q1QI19_NITHX/186-488GISVKLSAL.............................................HPRFEAVSRQRVMAELVPRVIDLAAR
A1SRQ1_PSYIN/183-485GISVKLSAI.............................................HPRYEFSHRDRVLKELPQKLKSLCLL
I3TI59_TISMK/188-494SVSVKLSAL.............................................HPRYEAAKDGRMLKALGGRLAELARE
M4U3Z5_9GAMM/195-498TVSIKLSAL.............................................HPRYEVAQKDRVLNEMYNTVIRLIKL
C6XJL8_HIRBI/186-488GLSVKLSAL.............................................HPRYESVQRQECVPKLVESVGEIALI
A3MYH8_ACTP2/181-483GVSVKLSAI.............................................HPRYSLAQYDRVMDELYPRLRDLFLL
K0CHY5_ALCDB/195-485GISIKLSAL.............................................HPRFEFAQWATVQEQLWPRLQDLVSR
C7RS12_ACCPU/178-484SISIKLSAL.............................................HPRYEVANEARVRHELLPAVKALALR
E1SPV0_FERBD/192-495TISIKLSAL.............................................HPRYEVANEDRVMTELYDSVLRLIKQ
D5A2Q2_ARTPN/130-444QVSVKLTAF.............................................YSQFDPLDAKGSEAKVSDRIRTLLRR
V5SEX9_9RHIZ/191-499GLSVKLSAL.............................................HPRYEAGKEARLADELYPRLIALLKA
Q7VJT7_HELHP/125-423YISIKITTI.............................................FSQINIIDFDYSKAEIVKRLEHLYAL
Q89E26_BRADU/170-472GISVKLSAL.............................................HPRFEAISRARVMVELVPQLLDLAQR
Q11IQ4_CHESB/173-474GISVKLSAI.............................................HPRYEATQRERVMPVVTERLLLLAQD
K9SCU8_9CYAN/129-443QVSVKLTAF.............................................DSQFDPLDAAGSEARVGDRLRELLRQ
K9YQR1_CYASC/130-444QVSVKLTAF.............................................YSQFDAIDPEGSKMMVCDRIRTLLRH
S5YB79_PARAH/170-468GISVKLSAL.............................................HPRYETAQEARVLAELVPIVTRLARA
C1GAY3_PARBD/149-507FVALKFTGAGKGSV........................................RHL...LHGLPPSSELEEAIVEICER
B4RDQ4_PHEZH/172-472GVSVKLSAL.............................................SPRYEARQAERVFADLYPRILRLAQM
B8EK67_METSB/174-474GVSVKLSAL.............................................HPRFEPACRERVMSELTPRLIDLARL
C7LXP8_DESBD/125-438NISVKPTAL.............................................FSQASPKDFEGSVQGIEKRLAAILRK
W8EVF8_9BACT/75-382FSVFKVTGVGDAAILEKVQ...................................AGKALTPAEQSSFEKTKKRINAICAR
E2SAB5_9ACTO/132-425YVSVKVSAV.............................................ASQLSLWSFEQTVDRVVDQLVPLYET
A0RQB5_CAMFF/120-419YISIKITTI.............................................FSQINIIDFEYSKKEIVKRLDRLYQL
D0J1C3_COMT2/206-515GISIKLSAL.............................................HPRYSRAQWQRVMSELLPRVLQLCEL
G8PFS8_PSEUV/176-479GISVKLSAL.............................................HPRYEFAKRERVMKELVPRTLSLIML
F2K118_MARM1/190-495TISIKLSAL.............................................HPRYEVGSEERVMTELFESVKGLIKK
C7JEM3_ACEP3/214-519GISIKLSAL.............................................HPRYARAQYDRVMGELLPVVQELTLL
F8KUD6_HELBC/124-429YISIKITTI.............................................FSQINIIDFESSKEEVVKRLDTLYAL
Q8DLR2_THEEB/124-425QVSVKLTAF.............................................YSQFDPLDVSGCRAKVGEPIRRLLHR
D7SMI9_VITVI/173-476FVIAKMTAICSIDLLKRVSDLLRWQHRDPSFHLPWRQNCFPIFADSSPFYHTLERPDPLTPQEEKDLQLALQRLFKLCQK
G0A0F2_METMM/181-477GISIKLSAL.............................................YPRYEALQAAHAIPAISDQLLPLVTQ
E4RQ43_LEAB4/72-381FSVFKVTGIGSRELLTEVQEF.................................GMSCLDREKLAAYQRIVKRFQGLCKA
Q20YI8_RHOPB/172-468GISVKLSAL.............................................HPRFEALSRARVMDELVPRVIELARQ
G4RBU0_PELHB/190-496GISIKLSAL.............................................HPRYARTKYDRVMAELLPRLKELAAL
D5AN87_RHOCB/170-470GISIKLSAL.............................................HPRYEVAQEARVMAELVPVVRDLARA
E8RP12_ASTEC/170-466SISIKLSAL.............................................HPRYEVANRKTCVPQLIEMIRHLAAK
Q1GPE4_SPHAL/177-477GISIKLSAL.............................................HPRYEYLQAARVREELIPKVIELARR
D5SZA2_PLAL2/143-464QLSLKLSSL.............................................TSDFRPLDAQGTMRVVLERLRPILRL
A1WR88_VEREI/191-506GISIKLSAL.............................................HPRYSRAQWGRVMDELYPLVLRLGML
B4R3R9_DROSI/14-329...........................................................PPKEEEMFRNMIRRLNTIVKA
B1XXB4_LEPCP/183-494GISIKLSAL.............................................DARYEAAQSASVFKRLLPRLIALVDA
A0LGH8_SYNFM/123-435NVSIKASAM.............................................YSQMSARSFEDSVARSKEKLRPILRK
Q9CN54_PASMU/180-482GVSIKLSAI.............................................HPRYSLSQHQRVIDELYPKVKQLFLL
K9RTF2_SYNP3/123-424QVSVKLTAF.............................................YSQFDPLDEVGSAKKVGEQIRLLLRQ
B0SX13_CAUSK/176-473GVSVKLSAL.............................................TPRYEATQEARVWDELYPRILRLALV
I0HK91_RUBGI/171-476GISIKLSAL.............................................FSRYEDAQRERVFETLLPRVWTLVER
Q0A545_ALKEH/185-489GVSVKLSAL.............................................DPRYEPGQEARVMGTVLPRLLQLCEL
G8UMQ7_TANFA/67-376YAVFKPSTITTDALLSKASE..................................HPEQLTDAESSDYEIFQQRFMTLCRR
G7ZID6_AZOL4/210-517GISIKLSAL.............................................HPRYSRAQAGRVMAELLPRVTELARL
F4HDV6_GALAU/183-485GVSVKLSAI.............................................HPRYFRSQQQRVMDELYPRLKKLFLL
E0TFB1_PARBH/171-472GISVKLSAL.............................................TPRYFLKNSEELYEKLLPMVLALAEQ
A8ZMR8_ACAM1/128-442QVSVKLTAF.............................................YSQFDPLDAQGSQEIVSQHLRTLLRH
G2X8S4_VERDV/146-474...VRFTGAGQQAL........................................YAL...SERFPPSAALASAMDSICAC
M2NL10_BAUCO/149-482FVGLKWSGMGAAAM........................................RKM...KADDEPAERMSEAMHAVCKA
Q12GH2_POLSJ/160-462GISIKLSAL.............................................HPRYEDAQRERVMAELVPRVWGLCEL
F0NYJ2_WEEVC/69-373FVVFKPTAFGRIELWEKVG...................................KKTQLNPEETKAWENTRKRFEDVCEK
Q6AA40_PROAC/139-437YVSIKISAV.............................................VNQLDLWAHKATVDEVVEQLLPLYHL
Q98L65_RHILO/187-488GISVKLSAL.............................................HPRYEVAQKEEMLPVMAERLLSLALA
Q87FF3_VIBPA/190-492SVSIKLSAL.............................................HPRYEVANEERVMTELYETLMQLLKR
C1DQT9_AZOVD/189-493SISIKLSAL.............................................HPRYEAAQRRRVLAELFASVRELAEL
M5E4Q0_9GAMM/195-495SLSIKLSAL.............................................HPRYEESQHPRLISELGGRLASLVRE
X6PEJ3_RETFI/230-571FMPIKLTCLTSSSLFEKINHIIQSNMDSQ.............LPLPKVDDATILSNL..NEREQKLFQDCMKRLRQIIDT
G0AEN1_COLFT/169-474GISVKLSAL.............................................HPRYSRAQRQRTMEELLPRLKQLLLL
D2R6H7_PIRSD/157-469NLSVKLSAL.............................................DCRFDPIDPEGTFRRAGDKLRTIFHE
A5FXC3_ACICJ/246-552GISVKLSAL.............................................HPRYCRAQRARVMEELAPRLKALALL
C7PKU9_CHIPD/72-379FIAIKVTGFARFSLLEKLH...................................ANETLTPEEAAEYARVRQRIQTIAAT

PF02219

MTHR2_YEAST/6-298AYHSG--------CQNILA--------------LRGDPPRDAEN.WTPVEGG..FQYA-K---------DL---------
MTHR1_SCHPO/6-292AHETG--------CRNILA--------------LRGDPVKDTD..WTEGESG..FRYA-S---------DL---------
METF_AQUAE/2-288YKNIG--------IENILA--------------LRGDVPRD.KPDWRPPKGA..CKYA-K---------EL---------
MTHR2_SCHPO/6-305AKEYG--------IRNILA--------------LRGDPPLNSDH.WEGKVSE..FEHA-V---------DL---------
MTHR_CAEEL/61-350AKAMG--------LRSILA--------------LRGDLPPGTE..LEDTH.Q..FR.A-L---------DM---------
METF_HAEIN/9-289YWDSG--------IRRIVA--------------LRGDEPKG....YAKKP.....FYA-S---------DL---------
MTHR1_YEAST/6-302CYNAG--------IRNILA--------------LRGDPPIGEDW.LDSQSNESPFKYA-V---------DL---------
P73677_SYNY3/47-334AYALG--------LRNVLA--------------LTGDPLKAGDHAKARPVYDLESVRL-L---------SL---------
MTHR_HUMAN/48-337AKQLG--------LKNIMA--------------LRGD.PIGDQ..WEEEEGG..FNYA-V---------DL---------
MTHR2_ARATH/6-301IRSNG--------IQNVLA--------------LRGDPPHGQDK.FVQVEGG..FDCA-L---------DL---------
Q6CZA9_PECAS/14-291YWQSG--------IRHIVA--------------LRGDLPPEG....GKPE.....MYA-A---------DL---------
Q9S2V3_STRCO/16-300YADAG--------IRNMLA--------------VRGDPPGDPNADWIAHPEG..LTYA-A---------EL---------

PF01619

Q2Y8S2_NITMU/179-490AKHYD........MG..FN..............MDAEEADRLD.LSLDLLEALVF..D.P.........DL......AGW
E4TLC6_MARTH/72-378AYDNN........VR..VL..............IDAEESWLQD.PIDEIVYQMMEKYN.KET.......AI.........
J7Q7E1_METSZ/171-468AKERD........LV..FT..............IDAEEGDRLE.LSLDVIARVVD..D.P.........SL......SGW
G8R191_OWEHD/67-375AGEQH........IS..IL..............IDAEESWIQQ.AIDDIALEMMRKLN.KEE.......CI.........
D8PFZ8_9BACT/123-436AGTLP........AS..VI..............FDMEQADTKE.LILSIFMRLFM..E.E.........PY......RTF
G8MHC3_9BURK/186-488AKQYG........IG..FH..............LDQEESARFD.LTLEMLERLCS..E.P.........TL......RGW
Q3IHR2_PSEHT/183-485AKQYD........IG..FT..............VDAEEADRLD.ISLDVIEAVFS..D.D.........DL......AGW
A9TJ40_PHYPA/151-463CEQEG........LP..LL..............IDAEYSSVQP.AIDYIIHAAAAEFN.K.GDR.....PL.........
Q5DZ94_VIBF1/199-500ARELD........VG..IT..............IDAEEMDRLE.LSLELFEKLYR..S.D.........IV......KGW
C7R7N1_KANKD/190-491ARDLD........VA..VT..............IDAEEADRLE.LSLDIFEALYT..S.E.........IC......QDW
H1Y3P5_9SPHI/81-387AYDLN........IP..VM..............IDAEESWIQN.TIDGLALDMMRTFN.REK.......AL.........
Q725V6_DESVH/123-440VVAMG........GF..LC..............IDMEQLKYKE.MTLELFKRLRS..D.P.........EF......RHY
V4JH86_9DELT/123-438VIELG........GY..MC..............VDMEHHQLKD.ITLEVYRRLRS..D.P.........EF......RHY
G9MLF6_HYPVG/155-487ARDRG........VR..LL..............FDAEQDMLQD.GIDDWTMQFARKYN.DSPDT.....AT.........
T2GB03_DESGI/123-437VKEIG........GF..LC..............IDMEQLSVKD.ITIEAYKRLLL..H.P.........EL......KDY
Q5NFS5_FRATT/186-490AKDYN........VG..MN..............IDAEETERLQ.ISLELVERLAH..E.P.........SL......EGF
Q0BXX8_HYPNA/181-485AAKAN........IG..LC..............LDAEEAHRLV.ISLKIFERLAR..E.P.........SL......KDW
A4VIY6_PSEU5/189-494ARRLD........VG..IT..............IDAEEADRLE.LSLELFEKLMR..D.P.........AI......AGW
F6EJT8_AMYSD/134-430AANAS.......PKRKFIN..............LDMEEYKDLD.LTIAVFTELLD..K.P.........EF......RDL
D3FDW7_CONWI/118-434ADLHG........AH..LH..............VDMESLDSRD.AVLALVLELLD..E.P.........AF......AHG
Q4FSA9_PSYA2/201-502AREVN........VD..IS..............IDAEEADRLE.ISLKLFESLYR..D.N.........LT......ADW
Q8D2C0_WIGBR/261-570ARHYD........IG..MN..............IDAEEANRLE.ISIDLLDKLCC..E.P.........SL......FGW
E6VSX4_DESAO/125-438VMEMG........GF..LC..............IDMEQLKYKE.ATVELYKRLRS..............KY......PDY
G0IXE5_CYCMS/72-380ASKSG........VK..LM..............VDGEESWFQA.VTDHWILEAMKTYN.KEE.......AI.........
M4NAF6_9GAMM/187-490AMQQG........IA..LS..............VDAEEADRLE.LSLDILGDVFA..H.P.........SL......EGW
B9M0V5_GEODF/120-434VREVN........GF..LC..............LDMETYRYKE.IILEVYRRLKL..............EN......PDY
Q3J4G7_RHOS4/170-470ARAAG........LG..FN..............IDAEEADRLD.LSLEVIAAALA..E.P.........SL......AGW
C4XQY2_DESMR/124-436IVALG........GA..LC..............IDMEQLKYKD.ITIELFKRLRS..E.P.........EF......RDY
I2EXL9_EMTOG/75-383AAQLN........VR..IF..............LDAEESWIQD.VIDNLCYEMMKKYNVGGK.......TI.........
A9C1A6_DELAS/259-571AKQYD........IG..MN..............IDAEEADRLE.LSLDLLEALCA..A.P.........SL......KGW
C9SYF0_VERA1/146-464AAARG........VR..LL..............FDAEQAAVQQ.GIDDWTLTYQRKYN.TVPGR.....AV.........
Q30QX6_SULDN/125-424AIQNN.........SKFIN..............LDMEEYRDIN.LTIDVFIKTLS..L.D.........EF......KNL
W8KJQ4_HALHR/185-488ARDYY........IP..LC..............IDAEESWRLD.LSLDVVERLLD..E.S.........SL......ENW
C4K5M4_HAMD5/205-515ARRYN........IG..IN..............IDAEETERLP.ISLSFLEKLCF..E.P.........DL......KGW
E8UGG0_TAYEM/196-505AHKYD........IG..IN..............IDAEEADRLE.ISLDLLEKLCH..E.P.........QL......AGW
E8R5H9_ISOPI/161-474AMRLG........AF..LH..............LDVEHYAIKD.LTYSIFKTLLS..E.P.........EF......RGY
N4VCC3_COLOR/121-460TREQG........SR..AW..............IDAEQQALQP.TLDDWTIDLMRRHN.AAGR......PL.........
H2FVF0_OCESG/190-493ARKLD........VC..IT..............IDAEEMDRLE.LSLSLFEKLYR..S.E.........VN......RGW
F8EFK6_RUNSL/77-382AHDLD........VK..IF..............VDAEESWIQD.VIDQLAYQAMQKYN.TQK.......PV.........
V4J1J7_9GAMM/170-474AAKAKFKRADGSLQSKFVY..............LDMEAYGDLS.ITVDAFMATLD..R.A.........GL......EQV
A2QWR7_ASPNC/131-458AISRN........VR..LL..............VDAEEQAVQL.GIERWALKYQKYCN.AKTPGH....AI.........
G7YAY9_CLOSI/137-446AKSVG........VR..VM..............VDAEQSYFQP.AIRRLTMEMMRLFN.KDG.......AV.........
B1ZUG1_OPITP/125-452AAEVG........AL..VN..............FDMESYKLKD.LTLALFKSILE..E.P.........EF......AAA
K9TNG5_9CYAN/130-444AQAVG........AA..VH..............FDMEQYHYKD.LTLSILKRLLM..E.E.........EF......RSR
B7K0R9_CYAP8/129-443AQELG........VA..VH..............FDMEQYVYKD.LTLSILKELLL..E.E.........EF......LTR
A7IKY5_XANP2/198-502ARRHD........IG..LN..............IDAEEQDRLE.LSLDLLEALAA..H.P.........GL......AGW
A0KGC8_AERHH/190-492ARDKD........VA..IS..............IDAEEMDRLE.LSLDLFEQLYR..S.D.........AN......RGW
I0K8U0_9BACT/91-399AHDKN........VR..IF..............IDAEESWIQD.TIDCLAYEMMDRFN.HER.......CV.........
F4CCZ8_SPHS2/81-387AHQAG........VA..VL..............VDAEHSWIQD.TIDDLARDMMRKYN.TEK.......AI.........
B6ITG0_RHOCS/194-497AKRWN........IN..FT..............IDAEEADRLD.LSLDVVEALAT..D.P.........DL......AGW
F0XMR1_GROCL/143-478ALSRN........VR..LL..............FDAEQASLQK.GIDDWTLAYMRKYN.A..GKP....AL.........
Q5FP43_GLUOX/195-501ARRYD........IG..IN..............IDAEESERLD.LSLDLIEDLCH..C.P.........EL......DGW
Q5QY28_IDILO/189-494AKEAD........VG..VT..............IDAEEADRHE.LSMELFEKVYR..S.G.........VC......KGW
M3XYT7_MUSPF/325-634ATEMG........VR..LM..............VDAEQTYFQP.AISRLTLAMQRKFN.VGK.......PL.........
C5CN52_VARPS/156-462AADAG........LN..LT..............IDAEEVDRLE.LSLDVFEALAARVA.A.........ER......PQW
K9WDJ4_9CYAN/129-443AQELG........AA..VH..............FDMEQYVYKD.MTFAILKDLLM..E.E.........EF......RTR
F7QI31_9BRAD/181-485AKAHG........MN..FT..............VDAEEADRLE.LSLDVIGAVLA..D.P.........SL......HGW
Q0ASP6_MARMM/187-482AKSHD........IS..FC..............LDAEESDRLI.LSLKLLEKLAR..A.P.........EL......AGW
K9XU71_STAC7/130-444AQELG........AA..IH..............FDMEQYVYKD.LTLAILKELLL..E.E.........EF......RNR
E4PKH6_MARAH/181-483AAAAN........MG..FN..............IDAEEQDRLD.LSLDVIEELVA..D.P.........EL......AGW
L0DPG6_SINAD/130-444ARELG........AY..VH..............VDMEQYAHKD.LTLAIFKSVLS..E.P.........EF......RDW
N0BF27_9RHIZ/186-492ARAKG........LG..LT..............IDAEEQDRLE.VTAEMFGETLV..N.P.........QL......DNW
K6YYW9_9ALTE/183-488AKSYN........IG..LT..............VDAEESERLD.ISLDVIEAVFS..D.D.........EL......EGW
Q73IQ2_WOLPM/178-482AKKYN........IS..LC..............IDAEETERLE.MSLILFEQLRL..D.E.........SL......SEW
H6BYZ9_EXODN/152-491AQSRG........VR..LL..............FDAEQASLQQ.GIDNWTMYFAKIFN.KER.......AL.........
Q6MF92_PARUW/144-448AIKNKYRRATGEVISKFVN..............LDMEEYRDLN.LTVALFKKVLD..E.P.........EF......FQY
A1WUH9_HALHL/185-489AREAG........IA..LC..............VDAEEAARID.LTLDVLEAVMA..D.P.........EL......ADW
Q5ZUU6_LEGPH/186-490AKDYG........IA..LT..............IDAEESERLD.LSLDVIEKVFT..D.E.........SL......QGW
F0SR05_PLABD/129-443AQEYD........AF..VN..............IDMEQYEYKD.LTYAIFKQVFV..E.E.........EF......RDF
G7UWP8_PSEUP/155-463AAQAD........LN..LT..............IDAEESERLE.LSLDVLEAVAARTA.A.........KY......PQW
E3I4E3_RHOVT/184-490ATERD........IG..FN..............IDAEEADRLE.PSLDLMERLAF..D.P.........AL......GEW
Q5LP42_RUEPO/171-472AKAAG........MG..LN..............VDAEEADRLS.LSLQVIEAVMA..E.P.........AL......KGW
Q47VW3_COLP3/183-488AKQYN........IG..LT..............VDAEESERLD.ISLDIIEAVFS..D.S.........EL......GDW
K9SGB6_9CYAN/140-451AQELG........CA..VH..............FDMEQYEYKT.LTLAILKQVLS..E.L.........EF......KER
E1V8R1_HALED/190-497ARERD........VA..VT..............IDAEEVDRLE.LSLEVFRAVYE..H.D.........VC......RGW
PUT1_YEAST/146-461IFELN........QS..LLKKYPERKAPFMVSTIDAEKYDLQENGVYELQRILFQKFN.PTSSKLIS.............
G2KP47_MICAA/168-477AAAKD........VA..LT..............VDAEEVERLE.ISLDIIGAVAA..D.P.........SL......KHW
K4BCB4_SOLLC/171-478CLELD........VE..LL..............IDAEDTAIQP.AIDYLAYSAAIKYH.K.EDH.....PL.........
W1PD27_AMBTC/253-566CNEFS........SP..LL..............IDAEYTTVQP.AIDYLSNYASIMFN.K.DEN.....AL.........
Q2N7F6_ERYLH/176-484ARDAN........MH..FN..............IDAEEAERLE.ISLDIIERLAA..D.D.........ALFTKADGTRW
B0RBJ3_CLAMS/105-406ASEAA........TPKFIN..............LDMEEYKDLD.LTIEVFTRVLD..Q.P.........QV......KDL
K4KRT3_SIMAS/178-479AKAAN........MG..FN..............IDAEEAERLD.LSLDLFAALAH..D.P.........EL......AGW
Q0BVZ4_GRABC/195-514ARANG........IA..LT..............IDAEEADRLP.LSLDVLAALCA..D.P.........VV......AGW
A8IG36_AZOC5/237-536AKAYD........LN..FT..............IDAEEADRLE.LSLDVIDAVLA..D.P.........GL......AGW
Q2SL11_HAHCH/190-493ARERN........VS..LT..............IDAEEMDRLE.LSLRLFEKLYR..S.P.........DS......RGW
K4BCB3_SOLLC/174-480CLEHE........VP..LL..............IDAEDTTIQP.AIDYFAYSAAIKYH.K.DDQ.....PL.........
H8KZM8_FRAAD/187-490AMAQG........IA..LS..............VDAEEADRLE.LSLDIIGQVFA..D.P.........SL......EGW
I4AGT6_FLELS/91-397AHQNK........VR..IF..............VDGEETWFQE.TIDNLTYQMMRKFN.KTE.......PL.........
A4Z2X8_BRASO/171-473AKSYD........LN..FT..............VDAEEADRLD.LSMAVIAKVVA..D.P.........AL......AGW
B0UDE2_METS4/170-473ARAHD........LN..FT..............VDAEEADRLE.LSLDVVAAVLA..D.P.........SL......AGW
A8LRL6_DINSH/181-482AAQAG........IG..FN..............VDAEEQDRLD.LSLDVIEAMMS..D.P.........DL......DGW
V5FUL1_BYSSN/140-491AKQRN........VR..LL..............FDAEQQAVQH.TIDEWTIEFQRRYN.KHFSLRGQPHAL.........
R5X0A3_9BACT/67-376AHRHG........VR..IL..............VDAEDVRFQD.AVDRLTEEAMHRYN.GGR.......AI.........
Q6LFT6_PHOPR/190-497ARELN........VG..IT..............IDAEEADRLE.LSLKLFEKLYR..S.D.........AV......KGW
D6WUI6_TRICA/274-587AQDMD........VR..IM..............VDAEQTYFQP.AITRITLEFMRKYN.KDK.......AI.........
B1M5K8_METRJ/198-504AMGHG........IG..LN..............IDAEEADRLD.LSLDILERLAA..D.P.........EL......AGW
H6L1M4_SAPGL/39-347ALEKK........MA..LF..............IDAEESWIQG.AIDQLTDEMMAEFN.TER.......VV.........
H5WQD6_9BURK/219-528ARQHD........IG..LN..............IDAEESERLD.LSLDLLQRLCS..E.P.........SL......AGW
Q8NU48_CORGL/130-428AARAP.......KGTKFIN..............LDMEEYRDLR.LTMEVFKRLLS..N.P.........EL......HEL
A4G6Z2_HERAR/192-497AKQYD........IG..IN..............IDAEESERLE.LSLDLMEALAF..A.P.........EL......EGF
A1KC13_AZOSB/186-495ARGYD........IG..VN..............IDAEEADRLE.LSLDLFEALVA..D.P.........LL......AGW
F3Z0N8_DESAF/122-437IKAMG........GF..MC..............IDMEQLKYKE.MTIELFKQLRT..M.D.........EF......KDY
E1FT57_LOALO/261-563GKKHN........LR..TM..............IDAEQTYFQA.AISRLAMAMMRKYN.KEY.......AL.........
C5C6T6_MICLC/150-444ARDRD..........TFIN..............LDMEEYRDLD.LTLNVFTALLE..Q.P.........GL......RDY
Q10YY5_TRIEI/130-444AQKLG........VA..VH..............FDMEQYTYKD.LTIDILKELLM..E.E.........EF......RNR
I4C375_DESTA/122-433AQEQG........VS..VT..............IDMEQYYLKD.VTIEIFKALLL..............DH......PDF
E3F3C6_KETVY/202-507AKAAN........MG..LN..............IDAEEADRLQ.LSLDIIEWVIA..Q.P.........EL......AGW
W0AMX3_9SPHN/178-477AARYD........LN..FA..............IDAEEADRLV.LSLKLVERLVR..E.P.........EL......GAW
A3QAI9_SHELP/192-495ARSLN........VG..VS..............IDAEEVDRLE.LSLKLFQKLYN..S.D.........AA......KGW
A1B0L0_PARDP/176-476AKAAG........MG..MN..............IDAEEQDRLV.LSLKVIEAVLS..D.P.........SL......AGW
W8S551_9RHOB/180-481ACAAG........MG..LN..............IDAEEADRLD.LSLDVIAAVLA..D.D.........AL......SGW
K8GCC7_9CYAN/128-442AKELG........AA..VH..............FDMEQYQYKD.ITLAILKQLLL..E.E.........EF......RDR
M4VRQ9_9DELT/119-431GMDLG........VF..IN..............LDMEHYGVKH.LTVEVFKELIN..E.P.........EL......RSY
PROD1_ARATH/168-483CQESN........VP..LL..............IDAEDTILQP.AIDYMAYSSAIMFN.ADKDR.....PI.........
C8X4M0_DESRD/123-436AMAMG........CH..VC..............IDMEQYKYKD.ITLEVFKRLRS..H.E.........KF......REY
A9CG59_AGRT5/200-506SKTYD........IG..LN..............IDAEEADRLE.LSLDLLEELAL..D.K.........DL......AGW
Q6FBR9_ACIAD/206-516SKKYD........IG..LN..............IDAEEADRLE.ISLELLERLCF..E.P.........EL......ADW
C1E2C6_MICSR/197-496ADGPN........AFT.VF..............VDAEEQNRLE.LTLSVVENVIRERA.P.........PR.........
D5VBX7_MORCR/179-481AKEYN........IG..LN..............IDAEEANRLE.LSLDLMEKLVS..D.P.........DL......AGF
K7SL66_GLUOY/193-490ARHLD........VG..LL..............FSTEDSTHLE.TALDLLEALCI..L.P.........EL......GSW
C4QVR0_PICPG/110-457IYKTN........ID..LLKKYPDRVAPFVVAVIDAEKHQLQQ.GVYELQRRLFKEFN.PKGKPVS..............
Q746X3_GEOSL/122-437VMELN........GF..LC..............IDMESYRHKE.IILEVFRRLKL..............EY......RDY
C1D8Q5_LARHH/181-483ARQYD........IG..LN..............IDAEEADRME.LSLDLVEALAF..D.P.........DL......GGW
L0DXC8_THIND/182-482ARAAG........VG..LC..............VDAEEADRLD.LSLDLIEAVSS..R.P.........EL......RGW
Q2JNZ3_SYNJB/130-434AEALG........VG..IH..............FDMEQYRYKS.LTLAILQELLL..E.P.........EF......KSR
M9R8D6_9RHOB/175-480AKSAG........QG..FN..............VDAEEADRLS.LSLDVIEAVVS..D.T.........AL......AGW
Q5P8F4_AROAE/237-543ARHYD........LG..LN..............IDAEEADRLE.LSLDLLEALAL..D.D.........EL......AGW
H0PXL0_9RHOO/189-495ARGYD........IG..LN..............IDAEEADRLD.ISLDLLEALVE..D.E.........DL......AGW
Q7NGY2_GLOVI/131-445ARELG........AF..VH..............IDMEQSQHKD.LILQIFKEVMV..E.A.........DF......RDW
R7J8S3_9PORP/67-375AYDND........VR..IL..............VDAEDYCFQD.AIDKLTDEAMRKFN.KKR.......AI.........
E6WK59_PANSA/62-361ASSRG........VS..VM..............VDAEQTTVQP.AVDELMLLMMKKYN.HHY.......PA.........
B1XJU5_SYNP2/128-442AQELG........VA..VH..............FDMEHYEYKT.LTLQILKDVLL..E.E.........EF......RDR
B2FJY7_STRMK/201-509AKSYG........IG..CT..............VDAEESDRLE.LSLDIIEQVFS..D.A.........SL......SGW
B2IK06_BEII9/172-472AKTHD........LN..FT..............IDAEEADRLE.FSLDLVDALLR..D.P.........DL......AGW
I1N4V3_SOYBN/171-468CVQAN........IP..LL..............VDAEHTSVQP.AIDYFTYSSAILHN.K.GDN.....PI.........
A1U2B1_MARAV/181-483AAAAN........MG..FN..............IDAEEQDRLD.LSLDVIEAILS..D.P.........EL......KDW
B8FJG0_DESAA/132-432AKQNTFTRRDGTKVPKVVH..............LDMEEYRDLH.ITYQAFIRTLD..K.P.........EF......KDY
X4QUP9_9ACTO/125-423ALKGK..........KFVN..............LDMEEYHDLH.LTIDVFKGILE..R.A.........EF......KHL
D5BFD6_ZUNPS/70-376AYDLK........VR..LY..............ADGEETWMQT.AADDLMEEMMRKYN.KEE.......AL.........
E9F9P4_METAR/159-490AHERG........VR..LL..............FDAEQDALQD.GIDDWTMEFAKKYN.TSPDT.....CT.........
B0JY14_MICAN/130-444AQELG........VA..VH..............FDMEQYVYKN.LTLAILKELLL..E.E.........EF......RSR
A9HPN9_GLUDA/185-491ACCYD........IG..FN..............IDAEEADRLE.LSLDLLEALCF..D.D.........TL......APW
K9RFZ5_9CYAN/129-443AKELG........VA..IH..............FDMEQYIYKD.LTFGILKKLLM..E.E.........EF......KQR
Q28LK1_JANSC/174-475AKAAR........MG..FN..............IDAEEADRLD.LSLDVIEAVLR..D.E.........SL......AGW
Q15TQ2_PSEA6/187-491AKKFN........IG..FT..............IDAEEAARLD.IELDVFQALAF..A.P.........EL......ANW
C6W220_DYAFD/77-382AYEHN........VR..IF..............IDAEESWIQG.VIDDLAYEMMQQFN.REK.......PI.........
A9SC33_PHYPA/80-388CEQEG........LP..LL..............IDAEYSSVQP.AIDYIIHAAAAEFN.K.GAQ.....LL.........
Q8YZD7_NOSS1/129-443AKELG........AA..IH..............FDMEQYAYKD.LTLNILQKILL..E.D.........EF......RQR
A3I0V1_9BACT/72-380AHDLG........LK..IL..............IDAEESWFQD.TVDAMTYEMMEKYN.RER.......CV.........
Q6MNK1_BDEBA/118-429GMEKG........VF..VN..............LDMEQYSVKH.LTLEVFTELIN..E.P.........EF......KNY
H8GI70_METAL/170-467ARAAN........IG..LT..............VDAEESERLD.MSLDIFAWVFA..Q.P.........GL......EGW
F2J2U8_POLGS/179-476ARRYD........LN..FT..............IDAEEADRLE.ISLDLVAAVVA..D.P.........VT......AGW
Q2W4B4_MAGSA/178-477ARDAG........IG..LT..............IDAEEADRLD.ISLDVMEAALA..D.P.........AL......DGW
I0HCU0_ACTM4/124-415AAETG..........KFVN..............LDMEEYKDLD.LTIAVFTQLLD..R.P.........EL......LKL
P74275_SYNY3/130-444AQELG........VA..VH..............FDMEQYHYKD.LILNILKELLV..E.E.........EF......RSR
B6JH11_OLICO/199-505AKSYD........IG..LN..............IDAEESDRLD.LSLDLLEEISF..D.E.........SL......KGW
A9RSW8_PHYPA/157-460CESEG........IP..LL..............VDAEYSVVQP.AIDYIINVAASEFN.R.GRL.....PL.........
I2BAI5_SHIBC/262-571ARQYD........VG..IN..............IDAEEADRLE.LSLDLMEKLCF..E.P.........EL......SGW
Q6N9G9_RHOPA/172-474AKSHD........LA..FT..............VDAEEADRLE.LSLEVFAACFA..D.P.........SL......KGW
H8KRQ0_SOLCM/83-389AFQAG........IP..VM..............IDAEETWIQD.PIDNMTIDMMKKYN.RID.......PI.........
O24897_HELPY/120-425ALEEE....KKQGMPKFIN..............LDMEEFRDLE.LTVESFMESIA..K...................FDL
D2QSB3_SPILD/40-348AYERN........VR..IF..............IDAEESWIQD.TIDTLAYEMMNRYN.HER.......PI.........
U5T1S9_9GAMM/185-490AAEKG........LG..FN..............IDAEESDRLN.LSLEVAEAVLQ..D.P.........AT......AGW
E9HR55_DAPPU/103-411ASGLQ........LR..LL..............VDGEFTYLNR.AISIAALSMAGAFN.QTR.......PV.........
W5XW07_9CORY/130-427AVKRS........PSVFIN..............LDMEEYHDLH.LTIRLFKELLA..D.P.........KF......KDL
B9KII4_ANAMF/179-481AKKYN........VK..LT..............VDAEEARRLE.LSLMILDTVFS..D.S.........SL......NGW
K9ULL5_9CHRO/143-454AQAIG........CG..IH..............FDMEQYEFKS.LTLQILKQVLM..E.P.........EF......VDR
Q21UN0_ALBFT/267-576ARQYD........IG..IN..............IDAEESDRLE.LSLDLLESLCF..D.P.........RL......KGW
Q2RWN5_RHORT/175-476AAAVN........VG..MT..............VDAEEADRLD.LSLSVMEAVLR..N.P.........NL......AGW
E1VMJ8_9GAMM/209-510ARAAD........VA..VT..............IDAEESWRLE.ATLEIFGSVLC..E.P.........AF......RRW
Q83DR6_COXBU/186-490AKEQK........IG..MT..............IDAEEADRLD.ISLDIFEALFT..D.E.........AF......ENW
F4KQ39_HALH1/97-405ASTKG........MS..VF..............IDAEESWIQD.TVDHLAEMMMKRYN.TER.......AV.........
F2G8W7_ALTMD/183-485AKEYD........IG..LT..............VDAEEADRLE.LSLDIIEAVFR..D.D.........DL......NGW
I4A307_ORNRL/66-371AYEKG........VK..IM..............IDAEETWLQD.AADDLAQEMMKTFN.KER.......VV.........
Q1QI19_NITHX/186-488AKAHD........LN..FT..............VDAEEADRLE.LSLDVIAAVAA..N.P.........SL......AGW
A1SRQ1_PSYIN/183-485AKKYD........IG..LT..............VDAEESERLD.ISLDIIEIVFS..D.P.........EL......SDW
I3TI59_TISMK/188-494AKAVG........IG..LT..............IDAEEADRLD.ISLDLLEGAAA..D.P.........AL......AGW
M4U3Z5_9GAMM/195-498ARSLN........VG..LT..............IDAEEADRLE.LSLVLFEKLYR..S.E.........EA......QGW
C6XJL8_HIRBI/186-488AKQAG........FG..LT..............IDAEETERLE.VSLEVVHGLLN..N.P.........AL......HGW
A3MYH8_ACTP2/181-483AKRYN........IG..LN..............IDAEEANRLE.ISLDLIDRLLS..E.P.........EL......ADF
K0CHY5_ALCDB/195-485SAAIG........IP..VT..............LDAEEADRLE.IGLRLFGQALA..L.P.........EV......ADW
C7RS12_ACCPU/178-484AKARN........VG..FT..............IDAEEADRLE.LSLDLIEALAI..D.P.........EL......AGW
E1SPV0_FERBD/192-495ARSLD........VG..IS..............IDAEEMDRLE.LSLKLFEKLYR..S.N.........EA......KGW
D5A2Q2_ARTPN/130-444AKEVG........AA..VH..............FDMEQYAYKD.LTLSILKNLLM..E.E.........EF......RDR
V5SEX9_9RHIZ/191-499AESHG........LA..IT..............LDAEEQDRLE.VMLDLFQRAYL..D.P.........SL......ARW
Q7VJT7_HELHP/125-423ALEEE....QRQNQPKFIN..............LDMEEFRDLE.LTVAAFMESIA..Q...................FDI
Q89E26_BRADU/170-472AKAHD........LN..FT..............VDAEEADRLE.LSLDVIAATLA..D.P.........SL......KGW
Q11IQ4_CHESB/173-474ARAAR........MG..LN..............IDAEEADRLD.LSLDVIERVLA..D.P.........SL......EGW
K9SCU8_9CYAN/129-443AQSVG........AA..VH..............FDMEQFVYKD.ATLRILKNLLL..E.P.........EF......RQR
K9YQR1_CYASC/130-444AKEKG........AA..VH..............FDMEQYAYKD.LTISILQELLM..E.E.........EF......RSR
S5YB79_PARAH/170-468AAAAD........MP..LT..............IDAEESYRLT.LSLQVIEAVLA..D.P.........AL......AGW
C1GAY3_PARBD/149-507AKARN........VR..LL..............IDAEQQAVQP.AIDKWALDFQRRYN.KGPNQR....AI.........
B4RDQ4_PHEZH/172-472GAEAD........IN..LT..............LDAEEADRLV.ISLQLLDRLAR..E.P.........AL......RDW
B8EK67_METSB/174-474ARRHD........LQ..LT..............IDAEEADRLE.LSLDLIEAALA..D.G.........SL......KDW
C7LXP8_DESBD/125-438VKEMN........GF..MR..............IDMEQYKFKD.ITLEVYRRLRS..S.E.........EF......RDY
W8EVF8_9BACT/75-382AHQHG........VR..VF..............VDAEESWFQD.TIDQLAYEMMQRYN.RES.......AI.........
E2SAB5_9ACTO/132-425AASGA........VPTFVN..............LDMEEYRDLH.LTLAVFTRALD..............RF......PDL
A0RQB5_CAMFF/120-419ALEEE....KISGISKFIN..............LDMEEYRDLE.LTVEAFMDSIS..K...................FNI
D0J1C3_COMT2/206-515ARSYD........IG..LN..............IDAEEADRLE.LSLDLLEQLAH..A.P.........GL......AGW
G8PFS8_PSEUV/176-479AKSSN........MG..FN..............IDAEEADRLD.ISLDVIEALLA..D.P.........AT......EGW
F2K118_MARM1/190-495ARALD........VG..IT..............IDAEEADRLE.LSLHLFEKLYR..D.D.........VA......KGW
C7JEM3_ACEP3/214-519ARKYD........IG..LN..............IDAEETERLD.VSLDILEALCA..T.P.........GL......EGW
F8KUD6_HELBC/124-429ALEQK....KEHGIDKFIN..............LDMEEFRDLE.LTVESFMESIT..K...................FPI
Q8DLR2_THEEB/124-425AQELG........VA..VH..............FDMEQYAYKD.ITLAILKDILL..E.P.........EF......RDR
D7SMI9_VITVI/173-476CVEAN........LP..LS..............VDAEYTSVQP.AIDYLTYSAAIQYN.KDKNN.....PI.........
G0A0F2_METMM/181-477ARDAN........IS..VT..............IDAEEAERLE.MSLTIFEHLAR..H.S.........AL......AGW
E4RQ43_LEAB4/72-381AADKG........VR..LL..............VDAEETWIQD.IIDELTLEEMKKYNTPEK.......TI.........
Q20YI8_RHOPB/172-468AKSYD........LN..LT..............LDAEEADRLE.LSLEVFAAVLR..D.P.........SL......AGW
G4RBU0_PELHB/190-496AKSYD........IG..LN..............IDAEEMDRLE.LSLDLLEALAT..D.P.........AY......DGW
D5AN87_RHOCB/170-470AARAG........IA..LH..............IDAEEQDRLA.LSLRVMAAVIA..D.P.........ET......AGW
E8RP12_ASTEC/170-466AAGYN........MD..LT..............IDAEETERLM.ISLDIIEGVLL..D.P.........SL......SGW
Q1GPE4_SPHAL/177-477ARAAN........IP..LM..............IDAEESDRLE.PHMDVFAALVD..A.G.........IA......DGW
D5SZA2_PLAL2/143-464AIEQQ........AI..VQ..............IELEHSTTNR.LILDIVQQVLS..E.K.........EF......QSW
A1WR88_VEREI/191-506ARDYD........IG..LN..............IDAEEADRLE.LSLDLLERLCG..E.P.........AL......AGW
B4R3R9_DROSI/14-329AADLD........VR..IM..............VDAEQTYFQP.AISRITLEMMRKYN.KDK.......AI.........
B1XXB4_LEPCP/183-494AAAAN........IN..LT..............IDAEESERLE.LSLQVLDALAAHAA.R.........TH......PDW
A0LGH8_SYNFM/123-435ALATG........SF..VN..............LDMERHALKD.LTLALFRSLME..E.D.........EF......RDY
Q9CN54_PASMU/180-482AKQYD........IG..LN..............IDAEEADRLD.ISLDLVDRLLA..D.P.........DL......AHF
K9RTF2_SYNP3/123-424AWEYG........VA..IH..............FDMEQYRYKA.STLKILQDLLL..E.P.........EF......RER
B0SX13_CAUSK/176-473AAKYD........IN..FT..............IDAEEADRLA.LSLKLLDRLCR..E.P.........EL......GAW
I0HK91_RUBGI/171-476AAAAN........LN..LT..............IDAEEVDRLE.LSLDVFDAIADRIA.A.........AF......PQW
Q0A545_ALKEH/185-489ARDYN........IA..LC..............VDAEESWRLD.LSLDVIEAVLA..E.P.........GL......ADW
G8UMQ7_TANFA/67-376AYENG........VR..IL..............VDAEDYCFQD.AIDSMTDEAMRLFN.KER.......AI.........
G7ZID6_AZOL4/210-517ARRYD........IG..LN..............IDAEEADRLE.LSLDLLESLCF..D.P.........DL......KGW
F4HDV6_GALAU/183-485AKQYN........IG..LN..............IDAEEASRLE.LSLDLLEKLLQ..D.P.........DL......AGF
E0TFB1_PARBH/171-472AKAED........LN..FT..............MDAEEADRLE.VSLDIFRALTE..A.P.........SL......AGW
A8ZMR8_ACAM1/128-442AQKLG........VA..VH..............FDMEQFVYKD.LTLAILKDLLL..E.P.........EF......RNR
G2X8S4_VERDV/146-474AAARG........VR..LL..............FDAEQAAVQQ.GIDDWTLTYQRKYN.TVPGR.....AV.........
M2NL10_BAUCO/149-482AQDKG........VS..LL..............PAAEETWSLS.GFHNWCMAMQRVYN.LGGK......SV.........
Q12GH2_POLSJ/160-462AARAN........IN..LT..............VDAEEVDRLE.LSLDMFEALAARVA.Q.........HY......PQW
F0NYJ2_WEEVC/69-373GYQLD........VN..IM..............IDAEETWMQD.AADDLCDVMMMKYN.QKR.......PV.........
Q6AA40_PROAC/139-437AENSP........KPKFIN..............LDMEEYHDLD.LTMEVFQKLLD..R.P.........EL......RHV
Q98L65_RHILO/187-488ARHSR........MG..LN..............IDAEEADRLD.LSLDVIERVLA..E.P.........EL......AGW
Q87FF3_VIBPA/190-492AIEVD........VA..IT..............IDAEEADRLE.LSLKLFEKIYR..S.D.........LV......KGW
C1DQT9_AZOVD/189-493ARSLN........VG..IT..............IDAEEADRLE.LSLELFEKLLC..D.P.........AI......RGW
M5E4Q0_9GAMM/195-495ARQLN........VA..IT..............LDAEEADRLE.LSLSIFQSVFE..Q.E.........AI.......GW
X6PEJ3_RETFI/230-571CKSNQ........IG..VW..............LDAETYHKQP.ALNLFARQLMKEYN.V.NQQ.....VH.........
G0AEN1_COLFT/169-474AKQYD........IG..LN..............IDAEEADRLE.LSLDLMEALAF..D.P.........EL......AGF
D2R6H7_PIRSD/157-469ARRLG........AF..IN..............VDMESYAKKD.LTLDIFQRLLM..E.P.........EL......RDW
A5FXC3_ACICJ/246-552ARRYD........IG..IN..............IDAEEADRLD.LSLDLLEGLCF..E.P.........GL......AGW
C7PKU9_CHIPD/72-379AAKHK........VG..LL..............IDAEESWIQQ.PVDDLTEELMAQFN.TTN.......AI.........

PF02219

MTHR2_YEAST/6-298-----------------IKYIKS....KYGDHFAIGVAGYP..E-----CHPE....LPNKD...VKLDLEYLKQKIDAG
MTHR1_SCHPO/6-292-----------------VRYIRT....HYNDEFCIGVAGYP..E-----GY......SPDDD...IDESIKHLKLKVDEG
METF_AQUAE/2-288-----------------VELIRK....EFGDWFSIGVASYP..E-----GHP......ESPN...LEWEVKYFKEKVEAG
MTHR2_SCHPO/6-305-----------------VRYIRE....KYGDYFCIGVAAYP..E-----GHVDSNVPELSKD...PLRDIPFLIEKVEAG
MTHR_CAEEL/61-350-----------------IRWIRE....EYGNYFSIGCAGYP..L-----GHP......QAPS...YKADLMYLKAKCDAG
METF_HAEIN/9-289-----------------VELLR.....SVAD.FDISVAAYP..E-----VHP......EAKS...AQADLINLKRKIDAG
MTHR1_YEAST/6-302-----------------VRYIKQ....SYGDKFCVGVAAYP..E-----GHCEGEAEGHEQD...PLKDLVYLKEKVEAG
P73677_SYNY3/47-334-----------------IRSLNQGLDFNQAPLVDGRLDLFPGAA-----VDP......QLKS...WSGLQSRFERKLTAG
MTHR_HUMAN/48-337-----------------VKHIRS....EFGDYFDICVAGYP..K-----GHP......EAGS...FEADLKHLKEKVSAG
MTHR2_ARATH/6-301-----------------VNHIRS....KYGDYFGITVAGYP..E-----AHPDVIGENGLASNEAYQSDLEYLKKKIDAG
Q6CZA9_PECAS/14-291-----------------VSLLK.....EVGD.FDISVAAYP..E-----VHP......EAKS...AQADLINLKHKIDAG
Q9S2V3_STRCO/16-300-----------------VRLIK.....ESGD.FCVGVAAFP..E-----MHP......RSAD...WDTDVTNFVDKCRAG

PF01619

Q2Y8S2_NITMU/179-490DG...............IGFVVQAYQKRCPFVVDWLIDLAR..RS....GHRLMVRLVKGAY---WDGEIKRAQVEGLDG
E4TLC6_MARTH/72-378.................IYNTYQMYRADMFDNLKKAHKRAL..EK....GYYIGAKLVRGAY---MEKEADRAEEMGYP.
J7Q7E1_METSZ/171-468DG...............FGLAVQAYLKRAMAAIDYVASLAE..AN....HRRFMVRLVKGAY---WDSEIKRAQERGLAD
G8R191_OWEHD/67-375.................VYNTAQMYRWDRLEYIKHLHEIAE..KE....NFYCGLKLVRGAY---MEKERERAYEMGYK.
D8PFZ8_9BACT/123-436PH...............AGIALQAYRTDTYDDVQRLLAWSR..ER....LVPVTIRLVKGAY---WDSDAIRYRQRGWS.
G8MHC3_9BURK/186-488NG...............IGISLQAYQKRGRAVTEWIIALAR..AN....GRRINIRLVKGAY---WDTEIKLAQDTGAAG
Q3IHR2_PSEHT/183-485NG...............FGLAVQAYQKRAIFVIEWLTELAT..RV....GRKMMVRLVKGAY---WDTEIKTTQQDGLEH
A9TJ40_PHYPA/151-463.................IYGTMQAYLKDSFSRLSLAVRGSH..ER....GLSYGVKLVRGAY---LSRENEMASFLRVP.
Q5DZ94_VIBF1/199-500GK...............FGLVVQAYSKRALPVLVWLTALSK..EQ....EDLIPLRLVKGAY---WDTELKLSQQFGFAR
C7R7N1_KANKD/190-491AG...............LGMVIQAYSKRALPALGWLDALSR..KH....GRRIPLRLVKGAY---WDSEIKWSQQAGLSN
H1Y3P5_9SPHI/81-387.................IYNTYQLYRHDKVSSLQHDYEIAQ..AE....GFYLGAKLVRGAY---MEKERKRAAENGYT.
Q725V6_DESVH/123-440PH...............LSIVLQAYLRDTEKDLDDLLHWAR..SE....KLPIGIRLVKGAY---WDYETVIAKQNGWE.
V4JH86_9DELT/123-438PG...............LRIAMQSYLRDTDTDLAALLDWAR..RE....NLPISIRLVKGAY---WDYETLVARQHGWP.
G9MLF6_HYPVG/155-487.................IYGTYQAYKKNCPAVVSRHLADAQ..RE....GFTLGIKLVRGAY---LGSDPR.........
T2GB03_DESGI/123-437PH...............LGLVLQTYLRDTEADLDDLLAWAR..QH....NRPISLRMVKGAY---WDYETVVARQNGWE.
Q5NFS5_FRATT/186-490NG...............IGIVVQAYQKRAPYVLDYLANLAK..KT....NRRFMIRLVKGAY---WDAEIKHAQEQGLAG
Q0BXX8_HYPNA/181-485TG...............LGLAVQAYQKRARAVIDRLADLAR..QT....NRRFMVRLVKGAY---WDSEIKHAQVEGFSN
A4VIY6_PSEU5/189-494GE...............FGLVIQAYSKRCLPVLVWLTLLGR..EL....GARIPLRLVKGAY---WDSEIKQCQVQGLDG
F6EJT8_AMYSD/134-430EA................GIVLQAYLPDALPAMIHLQQWAS..DRVATGGAPIKVRVVKGAN---LPMEMADAELHGWP.
D3FDW7_CONWI/118-434PS...............VGVVVQAYLRDAGEQVDRLLAWARRSER....RPPLVVRLVKGAY---WDHEVVLARQHGWQ.
Q4FSA9_PSYA2/201-502DG...............LGLVVQGYSKRAIAILAWLARLAI..EV....GDRIPVRLVKGAY---WDTEIKLAQQKGLSG
Q8D2C0_WIGBR/261-570SG...............IGFVVQAYQKRCMYVIEELIDIAK..RT....KRRLMVRLVKGAY---WDSEIKNAQIEGIED
E6VSX4_DESAO/125-438PH...............LGIVFQAYLKSVDQDVSEFLAWAR..EK....QFPVSIRLVKGAY---WDYETVMAKQNGWP.
G0IXE5_CYCMS/72-380.................IYNTFQMYRKVMSRRLRDAHHEAV..AN....SFYLGVKLVRGAY---MEKERQKAKKEGYP.
M4NAF6_9GAMM/187-490NG...............LGIVVQAYSKRTPFVIDWLVETAR..AA....GRRWYVRLVKGAY---WDAEIKRAQEQGLAG
B9M0V5_GEODF/120-434HH...............LGLVLQSYLRDTDHDLDNLVTWAR..EN....CLGISIRLVKGAY---WDYEMIRSRQSGLP.
Q3J4G7_RHOS4/170-470DG...............FGVVVQAYGRRAGEVLDRLYGMAV..RL....DRKLMVRLVKGAY---WDGEVKRAQVLGLDD
C4XQY2_DESMR/124-436PY...............LSIVLQAYLRDTGHDLNQLIEWGR..AQ....GLPFGIRLVKGAY---WDYETVVAKQMGWP.
I2EXL9_EMTOG/75-383.................VYNTYQLYRWASLDNLINACENAR..KN....GYTVGAKLVRGAY---MEKERRRAAEMEYQ.
A9C1A6_DELAS/259-571NG...............IGFVVQAYQKRCPQVLDYLVDLAR..RS....RRRLMVRLVKGAY---WDSEIKRAQEGGQAG
C9SYF0_VERA1/146-464.................IYGTYQAYLKSTPATLTRHLLTAQ..EQ....GFTLGVKLVRGAY---LGSDPR.........
Q30QX6_SULDN/125-424HA................GIVLQAYIPETMTHLKKLYEWAK..RRVDDGGASIKVRLVKGAN---QEMELTEASLRDWE.
W8KJQ4_HALHR/185-488EG...............LGVAVQAYQKRAWEVLGWLENKAA..LK....RRQLMVRLVKGAY---WDTEIKDSQVQGLSD
C4K5M4_HAMD5/205-515SG...............IGFVIQSYQKRCPFVIDALIDLAK..RS....EHRLMIRLVKGAY---WDREIKHAQVEGLSD
E8UGG0_TAYEM/196-505KG...............IGFVVQAYSKRTPFVIDWLIDLAR..RT....NRRLMIRLVKGAY---WDTEIKRAQVDGLDG
E8R5H9_ISOPI/161-474PH...............FGIVSQAYLRDAERDLIDLNTFIA..DR....GVPVTIRLVKGAY---WDYEVVHARAMDWP.
N4VCC3_COLOR/121-460.................VFNTIQAYLKNSTANAERHIALAA..RE....GWGLGVKLVRGAY---IEHEVR.........
H2FVF0_OCESG/190-493GG...............LGLVVQAYSKRALPVLCWLTALAR..EQ....GDEIPLRLVKGAY---WDSEIKHSQQAGLDG
F8EFK6_RUNSL/77-382.................VYNTFQMYRRDMLENFKKATHEAK..VE....GYFLGAKLVRGAY---FEKERQRAYESEYQ.
V4J1J7_9GAMM/170-474SA................GIALQAYLPDSYLAQQQINAWAR..RRVANGGAPVGIRIVKGAN---REMERVDASLAGWP.
A2QWR7_ASPNC/131-458.................FYNTYQAYLRSTPATIAKHLEVAR..QE....GYTAGVKLVRGAY---LKTEPR.........
G7YAY9_CLOSI/137-446.................MFNTYQCYLKDAYDLLQQDLNHSE..VE....GFHFGAKLVRGAY---IDQERARARALDYE.
B1ZUG1_OPITP/125-452PDSRPSTLDSQRPAKPAFGIALQAYLRDCETDLRALIAWAR..AR....RQPLDVRLVKGAY---WDYETVLARQRSWP.
K9TNG5_9CYAN/130-444TD...............IGVTLQAYLRDSKQDLQGLIDWAK..ER....GNPVTVRLVKGAY---WDQETIKAIQKHWP.
B7K0R9_CYAP8/129-443TD...............IGVTLQAYLRDSQQDLHDLIAWAK..QR....GYPITIRLVKGAY---WDQETIKASQNHWP.
A7IKY5_XANP2/198-502NG...............IGFVVQAYGKRCPAVLDFIIDLAR..RT....GRRIMVRLVKGAY---WDAEIKRAQVDGMAD
A0KGC8_AERHH/190-492GK...............LGMVVQAYSKRALPVLCWLTALAR..EQ....GDLIPVRLVKGAY---WDSELKYAQQAGLPG
I0K8U0_9BACT/91-399.................VYNTYQMYRWEMYDQLTKATEQAR..LK....GYFLGAKLVRGAY---LEKERIRSHEDEYQ.
F4CCZ8_SPHS2/81-387.................VYNTYQLYRHDILAALKADVYLAQ..TD....NFYVGAKLVRGAY---MEIERKRAEERGYP.
B6ITG0_RHOCS/194-497NG...............LGVAVQAYQKRAPRVIDWLAATAR..RA....GRRFMVRLVKGAY---WDSEIKHSQQAGHED
F0XMR1_GROCL/143-478.................VYGTYQAYLKSTPSTLSGHLREAR..DG....GFSLGIKLVRGAY---IGSDPR.........
Q5FP43_GLUOX/195-501NG...............IGIVVQAYGRRAPKVLDYLIDLGR..RS....GHRLMIRLVKGAY---WDSEIKKAQVEGQTD
Q5QY28_IDILO/189-494PR...............FGLVVQAYSKRALPTLCWITALAK..EC....GDEIPVRLVKGAY---WDNEIKWTQENGLLG
M3XYT7_MUSPF/325-634.................IFNTYQCYLKDAYDNITLDVELAR..RE....GWCFGAKLVRGAY---MAQERSRAAEIGYE.
C5CN52_VARPS/156-462RG...............FGLALQAYQTRALELIAHVTAVAR..RH....KLRLMCRLVKGAY---WDAEIKRAQELGLPH
K9WDJ4_9CYAN/129-443TD...............IGMTVQAYLRDSENDAKALIDWAK..QR....GYPITVRLVKGAY---WDQETIKAAQKDWP.
F7QI31_9BRAD/181-485DG...............FGLAVQAYQKRAGAVIDHVHALAE..RM....DRRVTVRLVKGAY---WDTEIKRAQERGLDG
Q0ASP6_MARMM/187-482NG...............LGLAVQAYQKRARRVIETLVELGR..AS....ERRFMVRLVKGAY---WDSEIKFAHQNGWPD
K9XU71_STAC7/130-444TD...............LGVTLQAYLRDSYQDLQDLIVWAK..QR....GNPVTVRLVKGAY---WDQETIKSLQHHWQ.
E4PKH6_MARAH/181-483DG...............FGVVVQAYGKRSSFVLDWLYGLAE..KY....DRKFMVRLVKGAY---WDAEIKRAQVMGLNG
L0DPG6_SINAD/130-444PD...............AGIVIQGYLTETEADLGSLRDWVK..QR....GTPVTVRLVKGAY---WDYEVVLARQLGWP.
N0BF27_9RHIZ/186-492NG...............LGLAVQAYGKRAIPLIRWLRRLAE..QT....GKRIPVRLVKGAY---WDSEIKWAQERGLED
K6YYW9_9ALTE/183-488NG...............FSMALQAYQKRAIFIVDWLRELTM..RV....DRKMMVRLVKGAY---WDTQIKNSQKGGYQH
Q73IQ2_WOLPM/178-482EG...............LGLAVQAYQKRALSVLDFVEDVAI..RS....KHKIMVRLVKGAY---WDSEIKRTQELGLND
H6BYZ9_EXODN/152-491.................VFGTYQAYAKRTPKVLASHLDVAR..KE....GFVLGVKLVRGAY---LGSDPR.........
Q6MF92_PARUW/144-448QG................GIVLQSYLPDSFLIQQELTQWAM..QRVNRMGAPIKIRLVKGAN---LAMEQFESAVRLWP.
A1WUH9_HALHL/185-489DG...............LGIAVQAYQKRAPEWIDWLAERAG..HY....RRRLRIRLVKGAY---WDTEIKDSQIQGLDD
Q5ZUU6_LEGPH/186-490NG...............FGLAVQSYQKRAFYVLDWVAALAR..SK....QRRIMVRLIKGAY---WDSEIKKTQMQGFSE
F0SR05_PLABD/129-443PN...............AGIVCQAYLKDSADDLKQLKEWAE..QR....GTAITVRLVKGAY---WDYEVIQAGLKNWP.
G7UWP8_PSEUP/155-463NG...............FGLAVQAYQTRALETIEEVARIAR..SL....KVRFMVRLVKGAY---WDYEIKRAQELGLAA
E3I4E3_RHOVT/184-490HG...............LGFVVQAYQKRAAPVIDWIVDLAE..RS....GRRIMVRLVKGAY---WDSEIKRAQVDGLPG
Q5LP42_RUEPO/171-472DG...............FGIVVQAYGPRAGLVIDTLYEMAQ..RH....DRKLMVRLVKGAY---WDTEVKRAQVEGVDG
Q47VW3_COLP3/183-488QG...............FGIALQAYQKRAIHVVDWLRDLTL..RT....ERKMMVRLVKGAY---WDTEIKNAQKDGLNH
K9SGB6_9CYAN/140-451RD...............VGVTIQGYLRDSEADLLDLVEWAK..ER....GTPLTVRLVKGAY---WDQETILAYQQGWD.
E1V8R1_HALED/190-497GH...............FGLVVQAYAKRALPVLHYINRLAE..TQ....GDEIPLRLVKGAY---WDTEIKESQQLGVEG
PUT1_YEAST/146-461.................CVGTWQLYLRDSGDHILHELKLAQ..EN....GYKLGLKLVRGAY---IHSEKNRN.......
G2KP47_MICAA/168-477DG...............LGLAVQAYSKRTYPLIDRLAAMAR..AE....KRRLSVRLVKGAY---WDTEIKRAQVMGLRD
K4BCB4_SOLLC/171-478.................LFGTIQAYLKDSKERMIIAKKAAE..KM....GVPMGFKLVRGAY---MSSENQLASSLGFQ.
W1PD27_AMBTC/253-566.................VYGTIQAYLKDAKERLVMVLGEAE..KR....GISVGFKLVRGAY---ISREVALARSLGAP.
Q2N7F6_ERYLH/176-484DG...............FGLAIQAYQKRAAPLCDWIVKLAR..RH....DRRFMVRLVKGAY---WDTEIKLSQVGGYED
B0RBJ3_CLAMS/105-406EA................GIVLQAYLPDALAGLQRLTAWAQ..ERRAAGGAPIKVRIVKGAN---LAMEQVDGRMHDWP.
K4KRT3_SIMAS/178-479DG...............LGFVLQAYQKRAPHIAHWLIQLAR..DT....DRRFMVRLVKGAY---WDTEIKHAQELGLTD
Q0BVZ4_GRABC/195-514NG...............IGLAVQAYQRRAPAVIENLIDLAR..HH....DRRLMIRLVKGAY---WDSEIKRAQIDGLES
A8IG36_AZOC5/237-536DG...............FGLAIQAYQKRAAAVIDHMAALAE..RL....DRRLMLRLVKGAY---WDTEVKRAQERGLDD
Q2SL11_HAHCH/190-493GE...............FGLVVQAYSKRALPVLCWLTALAA..EQ....GDRIPVRLVKGAY---WDSEIKLCQQRGLPS
K4BCB3_SOLLC/174-480.................IFGTIQAYLKDAKERMVIAKKAAE..KM....GVPMGFKLVRGAY---MCSEKELASTLGFN.
H8KZM8_FRAAD/187-490NG...............LGIVIQAYSKRTPYVIDWLVEQAR..RH....NRRWCVRLVKGAY---WDAEIKRAQETGLAG
I4AGT6_FLELS/91-397.................IYNTYQMYTIDRLEKLKLAHQNAI..EG....EYYVGAKIVRGAY---MEKERKRAEEKGYT.
A4Z2X8_BRASO/171-473DG...............FGLAIQAYQKRAEKVIAFIVDLAA..TH....DRRFMVRLVKGAY---WDTEIKRAQERGLDD
B0UDE2_METS4/170-473DG...............FGLAVQAYQKRCLAVIDHVALLAE..RL....DRRLMVRLVKGAY---WDTEVKRAQERGLAD
A8LRL6_DINSH/181-482DG...............FGVVVQAYGRRAGPVIETLYDMAE..RY....DRKIMVRLVKGAY---WDTEIKLAQELGVER
V5FUL1_BYSSN/140-491.................IYGTYQAYLLSTPEILGRHLEAAQ..NE....GFVLGVKLVRGAY---IGSDPR.........
R5X0A3_9BACT/67-376.................VFATLQMYRCDRLPYLRRLYEDVR..QA....DCVAGVKFVRGAY---MEEERARAAAMGYP.
Q6LFT6_PHOPR/190-497GR...............FGIVVQSYSKRALPVLAWLAALSK..AQ....GDIIPLRLVKGAY---WDSELKLSQQSGFSD
D6WUI6_TRICA/274-587.................VFNTYQCYLRNAFDEVTTDMEQAK..RQ....NFYFGAKLVRGAY---LEQERARAAALGYP.
B1M5K8_METRJ/198-504DG...............LGFVVQAYGKRCPFVIDVLIDLAR..RC....RRRLMVRLVKGAY---WDSEIKRAQVDGLSD
H6L1M4_SAPGL/39-347.................VYNTFQLYRHDRLQFLKDSYEKAL..EG....GYLLGAKMVRGAY---MEKERERAQKMGYP.
H5WQD6_9BURK/219-528NG...............IGFVIQAYQKRCPAVVDYLIDLGR..RT....RRRLMVRLVKGAY---WDSEIKRAQVEGQDG
Q8NU48_CORGL/130-428EA................GIVLQAYLPDALGAIQDLAQFGR..ERVNTGGAGVKVRLVKGAN---LPMEHVHAQITGWP.
A4G6Z2_HERAR/192-497DG...............IGFVVQAYQKRCPYVIDYLIDLSH..HS....KRKFMVRLVKGAY---WDTEIKRAQVDGLSD
A1KC13_AZOSB/186-495DG...............LGFVVQAYQKRAPFVIDYLVDLAH..RS....GRRLMIRLVKGAY---WDSEIKRAQVEGQAG
F3Z0N8_DESAF/122-437PH...............LGIVLQSYLRDTENDLDGLLSWAR..AN....SLPISIRLVKGAY---WDFETVMAKQCGWD.
E1FT57_LOALO/261-563.................VFSTYQAYLKSCLRDIELDLHLAR..RE....GFHFGCKVVRGAY---IEQERKRAAALNYD.
C5C6T6_MICLC/150-444EA................GIVLQAYLPDALAAMVRLQEWAA..RRVAAGGAPVKVRVVKGAN---LPMERMQASLTGWP.
Q10YY5_TRIEI/130-444ND...............IGVTIQAYLRDSEKDLQGIIEWAK..IR....GRPVTVRLVKGAY---WDQETIKALQHDWP.
I4C375_DESTA/122-433EY...............PGIVLQTYLPETAADFTHLAEWAR..KH....DRRFGVRLVKGAY---WDYETVVNPRKGWP.
E3F3C6_KETVY/202-507DG...............FGIVVQAYGKRCGATIDFLYALAK..AY....DRKIMIRLVKGAY---WDAEIKRTQVEGLAD
W0AMX3_9SPHN/178-477RG...............LGVVVQAYQKRGRHVIAGLARLAR..ES....GRRIMVRLVKGAY---WDSEIKRSQIAGRPD
A3QAI9_SHELP/192-495GL...............LGLVVQAYSKRALPVLCWITRLAK..DQ....GDEIPVRLVKGAY---WDSELKWAQVAGEGG
A1B0L0_PARDP/176-476DG...............FGVVVQAYGKRAGQVIDWLYETAT..RL....DRRIMVRLVKGAY---WDTEIKRAQVEGFPG
W8S551_9RHOB/180-481DG...............FGVVVQAYGKRAAPLLDWLHALAE..GL....DRRIMVRLVKGAY---WDTEIKRAQVEGLPG
K8GCC7_9CYAN/128-442TD...............LGVTLQAYLRDSLHDLKDLIEWAK..ER....GNPVTVRLVKGAY---WDQETIKSVQKDWP.
M4VRQ9_9DELT/119-431RF...............FGCVVQAYLRDSFQDIKDLTEFAR..ER....GVPFTIRLVKGAY---WDSETIEAKQKDWP.
PROD1_ARATH/168-483.................VYNTIQAYLRDAGERLHLAVQNAE..KE....NVPMGFKLVRGAY---MSSEASLADSLGCK.
C8X4M0_DESRD/123-436PH...............IAIVLQSYLLDTDQDLDALLHWAR..TE....HLPISIRLVKGAY---WDYETVLAKQHGWD.
A9CG59_AGRT5/200-506NG...............LGFVVQAYGRRCPFVLDYIIDLAR..RS....GRRIMVRLVKGAY---WDAEIKRAQVEGLED
Q6FBR9_ACIAD/206-516KG...............IGFVIQAYQKRCFYVVDYVVDLAK..RS....KKRLMIRLVKGAY---WDSEIKKAQIDGMHD
C1E2C6_MICSR/197-496.................IGVVVQAYGRRAMETLEYLRELAV..RY...PETKISVRLVKGAY---WDAEIKQAQLLGADS
D5VBX7_MORCR/179-481NG...............IGFVVQAYQKRCPYVIDYLIDLAR..RN....HQKLMIRLVKGAY---WDSEIKWAQVDGLDG
K7SL66_GLUOY/193-490NG...............LGLTVQTYDRRASAVVAFLIDLGR..RT....GRRILVRLVKGAC---WDSEIRQAQKSGLAD
C4QVR0_PICPG/110-457.................VAGTIQMYLKEGLPLIELEKKLAS..EG....NYRVGLKLVRGAY---IHSEPDR........
Q746X3_GEOSL/122-437PH...............LGIVLQAYLKDNDKDLDDLLAWAK..EH....KVQISVRLVKGAY---WDYETVKAKQNDWE.
C1D8Q5_LARHH/181-483DG...............LGIVVQAYQKRCPFIIDFLIDLAR..RS....QRRFMVRLVKGAY---WDAEIKRAQVDGQAG
L0DXC8_THIND/182-482DG...............LGLAIQAYQKRCLALIDWLDDVGR..RH....GRRWMVRLVKGAY---WDTEIKLCQLQGLAD
Q2JNZ3_SYNJB/130-434TD...............VGLTLQAYLRDSYTDLQNLIAWAK..ER....GSPVTVRLVKGAY---WDQETILAAQKHWP.
M9R8D6_9RHOB/175-480DG...............FGVVVQAFGQRAGHVIDWLADLAA..RT....DRKLMVRLVKGAY---WDAEIKRAQVLGIDG
Q5P8F4_AROAE/237-543QG...............LGFVVQAYQKRAPRVVDWIIELAR..RS....GRRLMVRLVKGAY---WDAEIKRAQVEGLAG
H0PXL0_9RHOO/189-495DG...............IGFVVQAYQKRAPFVLDWIVDLAR..KN....NRRLMVRLVKGAY---WDAEIKRAQIDGLEG
Q7NGY2_GLOVI/131-445ID...............TGICLQAYLRSAELDAANVIAWSK..ER....GYPVTVRLVKGAY---WDGEVIRAAQQRWP.
R7J8S3_9PORP/67-375.................VFATLQMYRHDRMAYLQKIYADAL..EK....DYIPGIKFVRGAY---MEEERARAAAMGYP.
E6WK59_PANSA/62-361.................IILTMQFYLKGKFNTLKEYYHLAC..NN....DFILGIKVVRGAY---LEEEKKLDRE.....
B1XJU5_SYNP2/128-442SD...............IGVTLQGYLRDSYADLESLIEWAK..ER....GTPVTVRLVKGAY---WDQETITALQNHWE.
B2FJY7_STRMK/201-509DG...............FGVVVQAYQKRTPYTIDHLADMAR..RA....GRRLQVRLVKGAY---WDAEIKRAQIEGYPG
B2IK06_BEII9/172-472KG...............FGLAVQAYQKRAGTVIDHVVTSAR..QQ....GRQIMVRLVKGAY---WDTEIKRAQERGLAD
I1N4V3_SOYBN/171-468.................VFGTIQTYLKDAKERLVLAAEAAD..NM....GIPMGFKLVRGAY---MSSETKLAESLGYS.
A1U2B1_MARAV/181-483QG...............FGVVVQAFGKRASQTLDWLYALSE..KL....DRRIMVRLVKGAY---WDAEIKRAQVMGLSD
B8FJG0_DESAA/132-432SA................GIVLQAYIPDSHPIQQQLTEWAK..KRVAGGGAPVNLRIVKGAN---MEMEMIESHHFNWP.
X4QUP9_9ACTO/125-423KA................GIVLQAYLPDSLGAMEHLQEWAA..KRVADGGAPIKVRLVKGAN---LPMEQVDAAMHGWK.
D5BFD6_ZUNPS/70-376.................IFNTLQCYRWDRIEYLKDLHEKGK..AE....GFKIGAKIVRGAY---MEKENERAKRLGYP.
E9F9P4_METAR/159-490.................IYGTYQAYKKKTPAVLERHLAMAQ..EG....QFSLGVKLVRGAY---LGSDPR.........
B0JY14_MICAN/130-444TD...............IGITLQAYLRDSAQDLQDLINWAK..KR....GYPLTVRLVKGAY---WDQETIKSRQNHWP.
A9HPN9_GLUDA/185-491QG...............LGFVVQAYQKRAPLVLDWVIDLAR..RS....RRRLMIRLVKGAY---WDSEIKRAQVDGLTD
K9RFZ5_9CYAN/129-443TD...............IGMTIQAYLRDSEEDAKSLIEWAK..QR....DNPITIRLVKGAY---WDQETITAEQKHWK.
Q28LK1_JANSC/174-475DG...............FGVVVQAYGKRCAPVIDWLYALAE..IH....DRRIMVRLVKGAY---WDTEIKRAQVAGLPG
Q15TQ2_PSEA6/187-491NG...............LGFVLQAYQKRALFVVDWLVELAK..AS....ERTLMVRLVKGAY---WDAEIKHAQEMGLSE
C6W220_DYAFD/77-382.................VYNTYQLYRHETLEALKSAFLTAR..QK....GYFLGGKLVRGAY---MEKERLRAREQEYF.
A9SC33_PHYPA/80-388.................VYGTVQAYLKDSFSRLKLAARGSQ..YR....GLSYGVKLVRGAY---MSRESRLASSLGAL.
Q8YZD7_NOSS1/129-443TD...............IGITIQAYLRDSEQDARNAIAWLK..QR....GYPLTIRLVKGAY---WDQETIKAAQKHWP.
A3I0V1_9BACT/72-380.................VYNTFQMYRHDMLGRLKSAKEDAA..QK....GYFLGAKLVRGAY---MEKERERAEKFDYP.
Q6MNK1_BDEBA/118-429KF...............FGIVIQAYLRDSFEDVKSLTEFAQ..KR....GTPFWVRLVKGAY---WDYETIEAEQRGWP.
H8GI70_METAL/170-467EG...............FGLAVQAYQKRALPVIRWLAALAG..RQ....RRRIPLRLVKGAY---WDGEIKRAQELGLEG
F2J2U8_POLGS/179-476DG...............FGLAVQAYQKRGVEVVDWLVELAR..AG....NRCLMVRLVKGAY---WDTEIKRAQERGLAD
Q2W4B4_MAGSA/178-477DG...............FGMAVQAYQKRARPVIAWAGALAA..RR....QQRLMIRLVKGAY---WDGEVKRAQERGLGG
I0HCU0_ACTM4/124-415EA................GIVLQAYLPDALDAMMRLQVWSA..ARRERGGAGIKVRLVKGAN---LPMERVEAELHGWP.
P74275_SYNY3/130-444TD...............VGITMQAYLRDSTEDLEALIPWAK..HR....GYPVTVRLVKGAY---WDQETIKAQQNHWQ.
B6JH11_OLICO/199-505SG...............LGFVVQAYGKRCPFVLDYIIDLAR..RA....NRRMMVRLVKGAY---WDAEIKRAQVDGLDG
A9RSW8_PHYPA/157-460.................VYATIQTYLKDSFPRLSLAVKSSH..HR....GLSYGVKVVRGAY---ISRENALAAALRVP.
I2BAI5_SHIBC/262-571NG...............IGFVIQAYQKRCPFVIDYLVDLAS..RS....NRRLMIRLVKGAY---WDSEIKRAQVDGLEG
Q6N9G9_RHOPA/172-474DG...............YGLAVQAYQKRAATVIDHVAELAR..AF....DRRMMLRLVKGAY---WDTEIKRTQERGLAD
H8KRQ0_SOLCM/83-389.................VYNTYQIYRHDRLAFLKENAQEAE..EN....NYYLGAKLVRGAY---MEKERERAAEMGYE.
O24897_HELPY/120-425NA................GIVLQAYIPDSYEYLKKLHAFSK..ERVLKGLKPIKIRFVKGAN---MESEETIASVKDWA.
D2QSB3_SPILD/40-348.................VYNTYQMYRWESLAHLRRDTAEAQ..AK....GYYLGVKLVRGAY---LEKERLRAHEEEYQ.
U5T1S9_9GAMM/185-490DG...............FGMVIQAYGQRAADTVDWLYQLAQ..RL....DRRMTLRLVKGAY---WDTEIKRAQTLGVDG
E9HR55_DAPPU/103-411.................VWNTYQCYLKDAFDKICGEFDVAR..RM....GVGFGAKIVRGAY---LERERLLSAEGNYP.
W5XW07_9CORY/130-427EA................GIVLQAYLPDTFDSLVELAEFAK..ERVAAGGAPIKIRFVKGAN---LSMEHVQGEVHGWP.
B9KII4_ANAMF/179-481EG...............LGFVIQAYQKRALAAIDFVEDIAI..RA....NRKMIIRLVKGAY---WDYEIRNAQEMGLDG
K9ULL5_9CHRO/143-454TN...............VGLTIQGYLRDSEADLYDLIAWAK..ER....AHPVTVRLVKGAY---WDRETIRAYQQGWA.
Q21UN0_ALBFT/267-576NG...............IGFVVQAYLKRCPYVIDHVIDLAR..RS....GRRLMIRLVKGAY---WDAEIKRAQLDGLDG
Q2RWN5_RHORT/175-476GG...............FGIVVQAYLKSTLPTIDWIIALAR..DL....DRQLAVRLVKGAY---WDAEIKTAQSLALPA
E1VMJ8_9GAMM/209-510GK...............LGLAVQAYQKRALPVLHWLGDMSR..KL....QCAIPVRLVKGAY---WDSEIKWAQQQGLAD
Q83DR6_COXBU/186-490QG...............LGLAVQAYQKRAFYLIDWLIDLAQ..RQ....KRRIPVRLVKGAY---WDTEIKLAQMEGLSG
F4KQ39_HALH1/97-405.................VYTTCQMYRHDRLQYLYELYERAQ..KE....GYLLGVKLVRGAY---MEKERDRAEEMGYS.
F2G8W7_ALTMD/183-485TG...............FGLAVQAYQKRAIHVIEHLRNLTL..EV....GRPLMVRLVKGAY---WDTEIKLTQQAGLEE
I4A307_ORNRL/66-371.................VLNTLQMYRTDRLEYLKNEFKKAE..EE....GYYLGFKIVRGAY---MEKERERAQKMGYP.
Q1QI19_NITHX/186-488SG...............FGLAIQAYQKRASAVIDYIDDLAR..HL....NRRMMVRLVKGAY---WDTEIKRAQERGLDG
A1SRQ1_PSYIN/183-485DG...............FGLAVQAYQKRAIFVIDWLRELTE..KV....GRKMMVRLVKGAY---WDTEIKNAQKDGLEH
I3TI59_TISMK/188-494NG...............LGLAVQAYQKRAHAVIDHVVELAG..RT....GRIIPTRLVKGAY---WDTEIKRAQERGLSS
M4U3Z5_9GAMM/195-498GK...............LGLVVQAYMKRALPVLVWLAALAK..SQ....GDRIPLRLVKGAY---WDSELKLSQQKGYAA
C6XJL8_HIRBI/186-488DG...............LAVVVQAYQKRSQKTIEWLVNTAR..AA....NRCISIRLVKGAY---WDMEVKRAQELGLAD
A3MYH8_ACTP2/181-483DG...............IGIVVQAYQKRCRSVIDYLIAKAR..EN....NRKLMIRLVKGAY---WDSEVKLAQTESASG
K0CHY5_ALCDB/195-485QG...............LGVAMQAYQKRAPAVIDWLADRAR..EH....NLKLPVRLVKGAY---WDTEIKLAQQQSLCD
C7RS12_ACCPU/178-484NG...............LGLAVQAYQKRALPVIDWLADLAH..RA....NRRLMVRLCKGAY---WDAEIKMAQERGLSD
E1SPV0_FERBD/192-495GN...............LGLVIQAYSKRALPVLVWINALAR..EQ....GDLIPLRLVKGAY---WDSELKWCQQGGAQG
D5A2Q2_ARTPN/130-444TD...............IGVTVQAYLRDSPKDLEGIIEWAK..LR....GYPVTVRLVKGAY---WDQETIKAMQNDWL.
V5SEX9_9RHIZ/191-499TG...............LGIAVQAYGKRAIPVIRWLRRLAD..MG....GKRIPVRLVKGAY---WDSEIKWAQERGLSD
Q7VJT7_HELHP/125-423KA................GIVLQAYLPDSYEYLKKLYAFSK..ERVLKGMKPIKIRFVKGAN---MESEALIASQRGWA.
Q89E26_BRADU/170-472DG...............FGLAIQAYQKRASAVIDYVDALAR..AH....DRKLMVRLVKGAY---WDTEIKRAQERGLDG
Q11IQ4_CHESB/173-474DG...............FGIVVQAYGRRAPFVIDWLYALAE..RL....DRRIMVRLVKGAY---WDTEIKRAQVMGLSS
K9SCU8_9CYAN/129-443TD...............VGLTLQAYLRDSEADLQGLIEWAK..ER....GYPVTVRLVKGAY---WDQETIKAAQRDWP.
K9YQR1_CYASC/130-444TD...............IGVTIQGYLRDSEEDLKNWIEWAK..KR....GNPITIRLVKGAY---WDQETIKSRQNHWQ.
S5YB79_PARAH/170-468EG...............FGIVVQAYGRRAGPAIDWLYDMAS..RL....DRKVMIRLVKGAY---WDAEIKRAQVTGLPD
C1GAY3_PARBD/149-507.................VYSTYQAYLRSTPKTLSEHLAIAK..AE....GFVLGVKLVRGAY---LGTEPR.........
B4RDQ4_PHEZH/172-472KG...............LGLAVQAYQKRGPEVIAAVADIAR..SS....GRRLMVRLVKGAY---WDSEIKRAQVAGLSG
B8EK67_METSB/174-474GG...............FGLAVQAYQKRAEAVIDHVVELAS..RH....RTRMTLRLVKGAY---WDAEIKRAQERGLAD
C7LXP8_DESBD/125-438PH...............LGIVLQAYLKDTDQDLADLLAWAR..AE....KLPISVRLVKGAY---WDSETVIAKQNGWD.
W8EVF8_9BACT/75-382.................VWNTYQLYRHDRLEALKKAQADAV..AG....GYYLGGKLVRGAY---MEKEGRVAAQQGRE.
E2SAB5_9ACTO/132-425EA................GIVLQAYLPDSLQVLGRLQTWAY..ERHLRGGKPVKVRIVKGAN---LAMERVDAEIHGWP.
A0RQB5_CAMFF/120-419KA................GIVLQAYIPDSYHYLQRLFEFSK..ERVLKGFAPIKIRLVKGAN---KQSEEAISSQKGWA.
D0J1C3_COMT2/206-515NG...............LGFVIQAYQKRCPYVIDYLIDLAR..RS....ERRLMVRLVKGAY---WDSEIKRAQIDGLSD
G8PFS8_PSEUV/176-479DG...............FGVVVQAFGPRAIHVIEWLYAVAE..KY....DRKIMVRLVKGAY---WDSEIKRAQTLGIDG
F2K118_MARM1/190-495GL...............FGLVIQAYSKRALPVLGWLAALSK..EQ....GDRIPLRLVKGAY---WDSEIKLCQQKGLSG
C7JEM3_ACEP3/214-519NG...............IGFVVQAYGKRCPYVLDYIIDLAR..RT....NRRIMVRLVKGAY---WDSEIKKAQVEGMAD
F8KUD6_HELBC/124-429SA................GIVLQAYIPDSYAYLQKLHAFSK..ERVLNNLPPIKIRFVKGAN---MESEETIASIKGWE.
Q8DLR2_THEEB/124-425AD...............IGLTLQAYLRDSYQDAQDLITWVQ..QR....GTPITVRVVKGAY---WDQELIKAVQHHWP.
D7SMI9_VITVI/173-476.................VYGTIQAYLKDAKERLLLAVQAAD..KM....GVPIGFKLVRGAY---ISSETQLASSLGYD.
G0A0F2_METMM/181-477QG...............LGLAVQAYQKRALPVIEWLAELAT..QQ....QRWIPLRLVKGAY---WDTEIKRAQENGWSD
E4RQ43_LEAB4/72-381.................IYNTYQMYRTASYGILSSHLEAAK..EA....GFTVGAKIVRGAY---MEKERKRAEEKGYA.
Q20YI8_RHOPB/172-468DG...............FGLAVQAYQKRALAVIDHAADLAQ..RL....DRRLMLRLVKGAY---WDSEIKRAQERGLAD
G4RBU0_PELHB/190-496HG...............IGFVVQAYSKRCPFVLDWIIDLAR..RS....GHRIMVRLVKGAY---WDSEIKRAQIDGLED
D5AN87_RHOCB/170-470EG...............FGAVVQAYGKRAGAAIDALAAMAR..AA....GRRINIRLVKGAY---WDAEMKRAQVEGHPG
E8RP12_ASTEC/170-466DG...............LGMAAQAYGKRARPLIGWAQAIGQ..ET....GHRLKVRLVKGAY---WDSEIKRAQVEGLSD
Q1GPE4_SPHAL/177-477TG...............LGIVIQAYQKRAPAVIDWLAKRAR..TR....GVRLSMRLVKGAY---WDTEIKRAQTLGLGD
D5SZA2_PLAL2/143-464AD...............CGITLPAYLKTAESDLTALATWVQ..KR....GTPIRICLTKGEY---WNQEIALAQSKSWP.
A1WR88_VEREI/191-506NG...............IGFVVQAYQKRCPFVIDWLIALAR..RT....QRRLMVRLVKGAY---WDSEIKRAQVDGLAD
B4R3R9_DROSI/14-329.................VFNTYQCYLRETFREVNTDLEQAK..RQ....NFYFGAKLVRGAY---MDQERDRAKSLGYP.
B1XXB4_LEPCP/183-494TG...............LGLAVQAYQTRASDTVAAVVQIAR..QH....QRRLMVRLVKGAY---WDSEIKRAQELGLAA
A0LGH8_SYNFM/123-435PH...............VGIVIQAYLKDSERDLEEILGWAK..AT....GRHFTIRLVKGAY---WDSEVIWARQSEWP.
Q9CN54_PASMU/180-482NG...............IGLVVQAYQKRCTFVIDYLIEQAR..KH....QHKIMVRLVKGAY---WDSEIKRAQTDGAEG
K9RTF2_SYNP3/123-424TD...............IGMTLQAYLRDSYQDAQDVIAWLQ..KR....NYPLTVRLVKGAY---WDQETIQAVQKDWP.
B0SX13_CAUSK/176-473TG...............LGLAVQAYQKRCPEVIARLTALSK..ET....GRRLMVRLVKGAY---WDSEIKRAQVAGRPD
I0HK91_RUBGI/171-476QG...............FGLAMQAYQTRALAVIDEVAAIAR..RH....GLRFMVRLVKGAY---WDGEAKRAQELGLPA
Q0A545_ALKEH/185-489EG...............FGLAIQAYQKRCYALVGWLEAQAA..RQ....NRALMVRLVKGAY---WDTEIKETQVQGLRD
G8UMQ7_TANFA/67-376.................VFATLQMYRHDRLPYLHRILTDAK..EK....GYIAGIKFVRGAY---MENERARATAMGYP.
G7ZID6_AZOL4/210-517NG...............IGFVVQAYGKRCPYVIDFIVDLAR..RS....GHRLMVRLVKGAY---WDSEIKRAQVDGLED
F4HDV6_GALAU/183-485DG...............IGFVVQAYSKRCPFVLDYIIEMNR..RY....QRKMMVRLVKGAY---WDSEIKWAQTEGVSG
E0TFB1_PARBH/171-472DG...............LGLAVQAYQKRAPEVIQYVDTLAK..ES....GRRFTVRLVKGAY---WDTEIKRAQERGIEN
A8ZMR8_ACAM1/128-442TD...............IGLTLQAYLRDSNQDLHTLIDWAQ..ER....GTSITIRLVKGAY---WDQETIKAIQNHWP.
G2X8S4_VERDV/146-474.................IYGTYQAYLKSTPATLTRHLLTAQ..EQ....GFTLGVKLVRGAY---LGSDPR.........
M2NL10_BAUCO/149-482.................VYNTYQAYLKQTPETISKHLTEAK..TQ....GFTLGVKLVRGAY---LGSEER.........
Q12GH2_POLSJ/160-462QG...............FGLAMQAYQTRSLALIEQVIAIGR..RY....KLRLMCRLVKGAY---WDSEIKRAQELGLPH
F0NYJ2_WEEVC/69-373.................IWNTLQMYRHDRLAYLKTMYEKAQ..KD....NYFLGYKIVRGAY---MEKERERAQAEAYP.
Q6AA40_PROAC/139-437EA................GIVLQAYLPDSLSALQGLVEWAD..RRTAAGGAGIKVRLVKGAN---LAMEKVDAEIHGWQ.
Q98L65_RHILO/187-488NG...............FGVVVQAYGPRAAFVIDWLYALAR..KY....DRTIMVRLVKGAY---WDTEIKRAQTLGLAG
Q87FF3_VIBPA/190-492GK...............FGLVVQAYSKRALPVLVWLNALAK..EQ....GDLIPLRLVKGAY---WDSEIKWSQQAGYEN
C1DQT9_AZOVD/189-493GE...............FGLVVQAYSKRALPVLVWLTLLGR..EL....DTRIPVRLVKGAY---WDSEIKQCQVQGLEG
M5E4Q0_9GAMM/195-495GG...............FGMAVQAYSKRALPVLGWLNQLAL..EH....DTHIKVRLVKGAY---WDTEIKLCQQRGLEG
X6PEJ3_RETFI/230-571.................VYNTYQMYLKDSYYWLLYDLETAQ..IN....SASMGIKLVRGAY---MEYEKKYSKLENKP.
G0AEN1_COLFT/169-474EG...............IGFVVQGYQKRCPFVIDYLVDLAH..RS....GRKFMVRLVKGAY---WDSEIKRAQVDGLPG
D2R6H7_PIRSD/157-469TD...............CGIVLQCYLRDTPRDVVELRNWAA..QR....GTPVWVRLVKGAY---WDYETLHARANHWP.
A5FXC3_ACICJ/246-552NG...............IGFVVQAYQKRARSVIEFLIDLAR..RS....RHRLMVRLVKGAY---WDSEIKRAQLDGLEG
C7PKU9_CHIPD/72-379.................VYNTFQMYRHDRLAFLKRSFEKAQ..QQ....GYLLGAKLVRGAY---MEKERKRAEEMGYP.

PF02219

MTHR2_YEAST/6-298GDFIITQMFYDVDNFINWCSQVRA---------------AGM....DVPIIPGIMPITTYAAFLRRAQW-----------
MTHR1_SCHPO/6-292ADFIVTQMFYDVDNFIAWVDKVRA---------------AGI....NIPIFPGIMPIQAWDSFIRRAKW-----------
METF_AQUAE/2-288ADFSITQMFFVNDYYYRFVEMCKN---------------AGI....DISIIPGIMPITNFKQIRKFASL-----------
MTHR2_SCHPO/6-305ADFIITQIFYEPEAFIKFENFVRN---------------HSSNALRNIPIIPAIMPIQSYGSLKRMTRL-----------
MTHR_CAEEL/61-350ANFVITQLFFEAETFEKFVRDCRE---------------IGI....TQPIIPGIMPIMGYESIKRIAKL-----------
METF_HAEIN/9-289ANHVITQFFFDIENYLRFRDRCAS---------------IGI....DTEIVPGILPVTNFKQLQKMASF-----------
MTHR1_YEAST/6-302ADFVITQLFYDVEKFLTFEMLFRE---------------RIS...QDLPLFPGLMPINSYLLFHRAAKL-----------
P73677_SYNY3/47-334AQFFQSQLITDFDRLDKFMTQVAV---------------GCG.....KPILAGIFLFKSAKNATFIKRV-----------
MTHR_HUMAN/48-337ADFIITQLFFEADTFFRFVKACTD---------------MGI....TCPIVPGIFPIQGYHSLRQLVKL-----------
MTHR2_ARATH/6-301ADLIVTQLFYDTDIFLKFVNDCRQ---------------IGI....SCPIVPGIMPINNYRGFLRMTGF-----------
Q6CZA9_PECAS/14-291ANRAITQFFFDVESYLRFRDRCVA---------------TGI....DVEIVPGILPVSNFKQLQRFATM-----------
Q9S2V3_STRCO/16-300ADYAITQMFFQPDSYLRLRDRVAA---------------AGC....ATPVIPEVMPVTSVKMLERLPKL-----------

PF01619

Q2Y8S2_NITMU/179-490YPVYTRKIHTDICYMVCAQKLL.R......................AAEAVFPQFATHNAHTLSAVYQI..AQDADIE..
E4TLC6_MARTH/72-378NPIQISKERTDIDYNSALEYCVEN.......................LERIYVFNGTHNQYSNYFLAYM..........M
J7Q7E1_METSZ/171-468YPVFTRKTMTDLNFDACAARLF........................DQPRLFPQIATHNARSVAAVLTM..AA