Sequence alignment for CL0087

PF00441

Q746I1_THET2/271-431EEGIY-YTLET.LTVSRLANAIAAMGIAAKALLETRERVR-RR..QS-----FG.RFLADHPLVRYDLLDLS-----VRQ
O01590_CAEEL/830-981GKGFE-IAQGR.LGPGRIHHAMRLIGHAERAIDVIKDRLL-TR..IA-----FG.RKLVQFDSLRKELALSR-----CEV
O53549_MYCTU/234-393NAGWK-LVTNQ.LNHERVALV..SPAPIFGCLREVREWAQ-NT..KD-----AGGTRLIDSEWVQLNLARVH-----AKA
P96842_MYCTU/231-377GDGWR-VAMAT.LTFERGVSTLGQQIVYARELSNLVELAR-R.....-----...TAAADDPLIRERLTRAW-----TGL
Q6L0T7_PICTO/229-380NRGFY-YSMDG.FNHARIAVAAACNGLSEKILDLGIDYIK-NR..SA-----FG.KKLMDFQSISFEAAELR-----TEL
O33229_MYCTU/236-385GMGFI-YLMQN.LPQERISIAIMAAAGMESVLEQTLQYAK-ER..KA-----FG.RSIGSFQNSRFLLAELA-----TEA
Q96ZN0_SULTO/214-364NGGWR-VVKYA.LLVGRIAISAIAIGLSICAIEEAIQWSK-HR..EL-----FD.SKLIEKQGIQWYLAKSV-----ANL
O33331_MYCTU/253-403GDGRD-SARAN.FAVERLGVALMSLGIINECHRLCVDYAK-TR..TL-----WG.RNIGQFQLIQLKLAKME-----VAR
Q88L96_PSEPK/235-384GQGFK-LAMGR.ITLNRLLHCPTLLGLAGLALNLSIDYAR-TR..KQ-----FG.QPIAMFQSINHMIADMA-----TEL
Q8YTN6_NOSS1/794-944GKGMN-VAQDA.MMYGRLAIASACVGGMQRCVQLMWRYSQ-RR..QI-----AT.GKLLDHPIVLHRLQELT-----CAI
Q83X47_STRRO/309-460GDGVG-LALRV.FQVNRSVICGLVTAAAGTVLD.....AA-VR..SA-----AGGRGATVTGRRRAPLAGVF-----ADL
Q979G0_THEVO/234-391NRGFN-IVHEG.FEFARGLISVISASMALKSIENGAAYMK-QR..KA-----FG.NSIATFEGLQFQLADDV-----AKM
Q72MA7_LEPIC/234-386HSGFL-RIGKATLEWERTVLLAALMGGMENILENCIRYSW-QR..QQ-----FG.KSILNFFAIKEKIARIW-----VYL
Q72U63_LEPIC/236-385GEGFK-WSQER.LGPARLTHCMRWIGLARRSMEVAREYAL-KR..EV-----FG.QRIADHQGIQWMFAESA-----VEI
Q7NQK1_CHRVO/288-439GRGIP-TIIEM.ATYTRLSCVIGSAALIRQGLVQAIAYAR-RR..VA-----FG.KRLAEQPLMRGVLADLA-----LES
Q82KR6_STRAW/219-369DHGFR-VAMHT.LNLFRPSVGAFAVGMAQAALDATLAHTS-GR..DA-----FG.GKLRDLQTVAHQVAEMA-----LRT
CAIA_ECOLI/227-376GNGFN-RVKEE.FDHERFLVALTNYGTAMCAFEDAARYAN-QR..VQ-----FG.EAIGRFQLIQEKFAHMA-----IKL
O01502_CAEEL/286-435GRGFG-YQMKQ.FNDERLVTVAVGLLPLQKCIDETIEYAR-DR..LL-----FG.KTLLDQQYIQFQLAELE-----AEL
Q8CXY8_ECOL6/186-337TPGVP-LAVNFALNEGRFTTACGSLGLCQAAVDVATRYIR-QR..KQ-----FK.RRLFSHGIVQHLFATML-----TQT
Q82SH8_NITEU/238-387GGGLE-LMNKR.LGLGRLLRAMNWIGLARRCMDLMGGRVH-ST..RG-----KL.GLLVEKQLVRQHFFNTY-----QAI
O54143_STRCO/233-381GSGAS-IFSSS.MKWERTCLFAAYLGAMRRVLESTVDHVR-DR..EQ-----FG.SPIGGFQAVSHRIVDML-----GRY
Q7WBL7_BORPA/220-369GHGLK-LALAT.LTIGRVVVAAQANGIALCAYAEACDFAV-SR..ET-----FG.RSIIDHQGIGFKLADAM-----TGL
Q7S582_NEUCR/378-536NQGFR-VIMTN.FNHERIGIIIQCLRFSRVCYEESVKYAN-KR..RT-----FG.KKLIEHPVIRLKLAHMA-----RQI
Q7WBV7_BORPA/237-385NRGFA-ALMRN.VQNERLVLAAQALGGSQAAIAQTLDYTR-LR..KA-----FG.ATLWDKQAIRHRLAMLA-----ARV
O53577_MYCTU/309-462GKGLT-RMMEL.TNRLRLGTASFALGNARRALVESLCYAG-QR..RA-----FG.GALIDKPLMRRKLAEMV-----VDV
Q73V99_MYCPA/567-712NSGWT-VARAT.LGNERVSI.GGSGSFYEGLADQLVQLAQ-QR..PD-----RL.......AGGKIRVGSYL-----AEE
Q86ZG6_NEUCS/353-511NKGIY-VILSN.FNHERWMMACATIRYMRLVVEESLKWSH-QR..LV-----FG.KRLIDQPVIRQKLAKMI-----ALC
Q8VW50_BACTK/146-297GGGWS-YVVNTALDHGRYSIAWAGVAIAQEALEAMVAYSR-RR..KQ-----GN.KYICEYEAIQTILAEAS-----VNI
Q72US4_LEPIC/278-427GEGFK-IAMGA.FDHTRPGVAIGAVGVARAAMEHSIQYAN-TR..NT-----FG.RPIMENQGISFMIAEMA-----RDI
Q6N0G3_RHOPA/236-389NRGWD-VAKYL.LQHERAMISGMGGRDGGRPLGQVAADSL-GT..DE-----KG.R..LDDPILRGQIATFD-----VDE
Q7VRY9_BORPE/300-458RDGIR-YAVLP.INASRLSHGVRAAGMMRRCLNESLHFAR-RR..AA-----FG.KPVIAHPLMKRSLLKIM-----VPT
Q8X1D8_FUSOX/265-418AQG..-.LVETAFAMSAALVGAMAIGTARAAFEEALVFAK-SD..TR-----GGSKHIIEHQSVADKLIDCK-----IRL
Q89PN2_BRAJA/242-397DEGWA-AAIRV.LEIERATNRMYRAWRFENELRHLISACK-TD..PA-----LS..AMVADRHYAVRLGEVA-----VEI
O07455_RHOPL/228-376NKGFV-QVMQG.FDFSRALIGLQVLAVARVALEETWAHVA-ER..QA-----FG.KPLSAFQGVSHPLADLD-----TQV
O86319_MYCTU/229-379NSGFT-QIARA.FVSERIGLAAQAYSSAQRCLDLTAQWCR-DR..ET-----FG.RPLISRQSVQNTLAEMA-----RRI
Q72VB9_LEPIC/297-445AHGIA-NLIKYVIGISRLHVSIAASGISRRAWMEAYEYAK-FR..TA-----YG.SKILEFSSLLKQLSDQR-----LKH
O29271_ARCFU/236-385ARGLG-APLSC.LNQARFGISWGAIGAAMDCYETALNYTK-ER..KQ-----FG.APLASYQLVQEKLVNML-----IEI
Q73V20_MYCPA/256-407DRGLE-VAQTF.LHENRIRQAASSLGAAQYCIDRAAEYAG-SR..TV-----FG.KPLSVNQAVQWPLAELQ-----TEA
Q89GG8_BRAJA/255-404DNGLS-VAIGG.VSVGRLAMAGSCIGLARWALRQAVDYAA-IR..KT-----GG.RPIASHQAIQTMIARCA-----TDI
Q6N940_RHOPA/240-392GDGWN-VSLTT.LMNERMSIGAR....LATGFPEIFAFCN-DL..VT-----EN.GPAIDDPAVRSKLANWA-----VKA
O31251_ACIAD/242-393AKGFA-GVMET.FDNTRPLVAAMAVGCAKASLERIKEIFK-DELDTD-----YA.TPYLQTSFIAAQIYRME-----AEW
Q9KYK3_STRCO/242-392GQGLA-VAQSSSILYGRPNLAAVSLGVHEAVVDTTTARLK-AR..PR-----YQ.GALSALPVLRDRVGDME-----ARL
Q73ZZ3_MYCPA/230-385NHGWT-YITGA.LDLERGAL..TNAGDLRRAVEELHELAR-RP..RR-----DR.TVPADDPWLCRRLAQAE-----ADV
Q7MB81_PHOLL/221-359ERGMH-SVIKT.FYRMRPCVCAMALGSAQSLLDFAISHIR-NV..KA-----............RELHSSLQ-----IEI
O28039_ARCFU/236-386GQGFY-QTMMF.FNITRIPVAFQALGLAQGAFELAYHYAR-NR..EV-----FE.RKLADFQVTQEKLAKMR-----TEL
Q8ZV35_PYRAE/224-374NGGWS-VAMWG.INMGRLNVGAIGLGIAEEAFYQAYDYAH-KR..EA-----FG.RLIADFQAIQHYLAEMY-----ARV
P95281_MYCTU/209-359TAGTP-DDMERVLDVARVLLAAEMLGGAEACLDLAVQYAG-RR..TQ-----FD.RPIGSFQAVKHACADMM-----IEI
Q72N29_LEPIC/402-551GKGFY-FQMEG.FAGGRIQTAARAHGVMQAALEAALRYAR-ER..AV-----FQ.KPIYEYNLTKYKIARMA-----VIL
O06164_MYCTU/243-392GSGYA-NFLSI.LDEGRIAIAALATGAAQGCVDESVKYAN-QR..QS-----FG.QPIGAYQAIGFKIARME-----ARA
Q6SH30_9BACT/238-395HGGWA-VAKEV.LRHERQLMASFESMAEKPKLNIIDLFNE-HM..GN-----EN.AYGISSTDIRSRLASHL-----MRD
Q82GQ8_STRAW/233-378NDGWR-VTMVT.LSFERGTAFVGEVVACRRVLG...ELAR-EA..HR-----NG.RW..DDPVLRRHLGRLN-----AEF
Q6FZS6_BARQU/342-487GEGLK-VIKDI.ETMMRFDQSVISAGVLRAALQFGIDFFR-QK..MP-----NQ....PLPPLTERIFADIA-----LDI
Q73XF8_MYCPA/231-370HGGWD-VALSS.LHHERQMIWIMNWVEINRGLD......A-VR..TA-----NG...AGPGHDIHTELGSLL-----ADA
Q6N0G4_RHOPA/228-378DRG.G-ALLEAVLNVGRAAVAAEMLGVADEAFGRTVSYLK-ER..KQ-----FG.KLIGEFQALQHRAAHLY-----TEI
MBTN_MYCPA/226-373GTGLA-AISWG.LAHERMSIAGQIAASCQRAIGITLARMM-TR..RQ-----FG.RTLFEHQALRLRMADLQ-----ARV
ACAD8_MOUSE/261-411GQGFL-IAMKG.LNGGRINVASCSLGAAHASVILTQEHLK-VR..KQ-----FG.APLARSQYLQFQLADMA-----TKL
P71858_MYCTU/228-380NDGWR-LITTQ.LNNERVMLG..PAGRFASIYDRVHAWAS-VP..GG-----NG.VTPIDHDDVKRALGEIR-----AIW
Q7BGH0_9NOCA/228-377GDGWT-VVGSH.LEWERLSLAATYVGNARTALDDTIRYTK-DR..TQ-----FG.RPLSSFQVLKHRMAEDE-----CEV

PF08028

Q7CWU4_AGRT5/248-389-----------------SCLAAAGVGAAKGALAAYVDHVG.GR--VTRGAVAGGNNRMAEFPTIQLRVAEAA-----ASV
Q7TW64_MYCBO/239-373-----------------TTISAPIVGMAYGAYAAHVEHQG.KR--VR...AAFAGEKAKDDPFAKVRIAEAA-----SDI
Q6SI41_9BACT/253-376-----------------IGIGAQMIGLASGALDHAIAYTK.ER--KQ......FGKPIAEFQGVQFQLAQAA-----TEL
PIGM_RHOST/235-366-----------------AEVTPVVVGALRGAADAFVQRTK.DR--QG....TISQEKASGKQAAQMRLGRAL-----AAA
Q6B6H3_9ACTO/255-392-----------------LIFANVYLGIAHGALDAAREYTR.TQ--ARP.WTPAGVQQATEDPYVLRAYGEFT-----IAL
Q8GRC5_BACIU/254-391-----------------LVFATVYLGIARGALETAREYTR.TQ--ARP.WTPAGVTQAVEDPYTIRSYGEFG-----IEL
Q9ZGA9_STRCY/246-378-----------------LSFAAPALGAARGALAVWSDYAT.AK--FRS.APREPGGPGISRGFYATTLARAA-----GEI
Q81JV7_BACAN/243-366-----------------IGIGAQALGIAEAALACAIDYAK.ER--EQ......FGKPIAEQQGIGFKLADMA-----TSV
Q73ZE7_MYCPA/241-374-----------------AGHASWALGVAKSMLDDVQELAA.TK--FR....MSDMASLASRPTFQKGLAHHR-----AAW
Q82KU6_STRAW/243-369-----------------LLFCAPALGAARRALAEWSSWAARAQ--TR.......GRPQDDGSRLHHALARSA-----DDM
Q6T1C5_STRGL/242-374-----------------LSFAPPTLGAARGALAHWTDYAT.AK--FRR.APEAAGGPGLTRGHWLTTLARSA-----GEI
Q8FWK5_BRUSU/242-365-----------------IGIAAQAVGMARAAFEAARDYAR.ER--IT......FGKPIIEHQAVAFRLADMA-----TRI
O69789_RHOOP/244-378-----------------AMSVGPAIGLGRAALRAFEERVG.SR--GI...TYTNYARQADAPITFHQLAEAR-----MKL
Q7ML36_VIBVY/236-369-----------------CGFAAISLGIAERMLVVFAEKQK.NR--VR....AYTGANVGVATPALMRLAEST-----HQV
Q89H98_BRAJA/262-395-----------------YVLSGVALGNAQACLNDYIEVVR.HR--IS....TYNRAKLSDFQSTQIKIAEAS-----AKI
HPAH_ACIBA/268-401-----------------SGFSAVSLGIAERMIEAFKEKQR.NR--VR....AYTGANVGLATPALMRIAEST-----HQV
Q82NJ4_STRAW/252-386-----------------AWSAPVALGLARAAVAEFTERIH.RR--GI...TYTFHERQNEATVTHLQVAEAE-----MRV
Q53907_STRCH/232-363-----------------LAFALPMLGAARGAAAVWTSWTA.GR--LAG.PTGQNAVSSQDRVVYEHTLARAT-----GEI
Q8XTR8_RALSO/249-372-----------------TSVAAAALGFARRALDEALARAT.TR--KM......FNGVLADFQLTQAKLAQMA-----TAI
Q6SH77_9BACT/226-355-----------------RVVNSAAIGALKKALKIFIETRT.AS--AT.....SDPTKLAGDVETQTRIAQVM-----NTI
Q9ZA38_STRVN/260-385-----------------LCFAAPVLGAARAALTAWREGTA.PR--HT.......SASGGLESAAAVVLGRAA-----GEV
Q45413_GEOSE/245-379-----------------LGFPLVSLGGDERLVSLFQERTE.KR--IR...VFKGGAKEKDSAASQRLLAEMK-----TEL
Q9F0J3_STRAE/257-387-----------------LSFAAPVLGAAKGLLAEWTRWAA.PR--ITG..TGDGDPRLAENALRHGVLARAA-----GEV
Q83VZ8_COMTE/242-374-----------------RAVSTACLGALESAIASFTERAT.AH--VG.....KHGNRMAEDVNAQTAVTEAT-----IAL
PIGM_RHOER/237-369-----------------LGITAATIGICEGMLFHANEYQA.GR--IN.....AQGTAVKDDPYTLFAIGQAT-----ADI
Q7WT11_9ACTO/232-362-----------------LTLTAPLLGAARGALRHWSGLVR.GK--LQA..PAAAVTGAADRTPHELTLARTD-----GEV
A3KCV4_RHORH/234-366-----------------LGITSSLIGMTEGALACYIAAQK.ER--VQ.....VTGVPIKEDPYVLFAISEAA-----AEI
Q73YD4_MYCPA/236-369-----------------LTAAMPVLGAAERVVQLFADRLG.ER--VL....AYSAVAQKDQPAAQIRLGEAR-----VRL
Q8XT96_RALSO/240-373-----------------LSIAAVALGIAHRAIESLIDLSK.QK--TP....QGSTRPLAERSGTQLAIAYCS-----ARL
Q89IL9_BRAJA/246-380-----------------LVHGAFVVGMAESTVDELLALANTGR--QQ....LYAAVPMRESEIFQYELGRIS-----AEL
Q740A3_MYCPA/237-369-----------------LGISAATIGIAEGALAAHLDYQR.SR--VG.....ATGTAIKDDPYVMYAIGEAA-----ADI
Q7D650_MYCTU/242-375-----------------LSIGAAALGNARAAIDDLVELAG.GK--KG....LGSTRTLAERSATQAAAATAE-----SAL
Q7D2V7_AGRT5/257-391-----------------IIQVAVDTGIARAAIDETVSFVR.TK--SRA.WVDSGVDHAWDDPYTIQAVGDLT-----LRL
Q6QF57_9NOCA/130-264-----------------LGITSSLIGIAEGALNCYIESQR.ER--VT.....VSGTAIKQDPYVLSNLGDAA-----AEI
Q6PV90_9NOCA/243-377-----------------AVLVCPALGATKRMLEEYLKQVP.KR--KI...AYTIYEKAAESVVTQTRLAEAA-----MLI
Q9JN91_STRCH/232-353-----------------LMFAFPVLGAARGALDAWTHAAT.ER--QG...........TAVPPASNTLTRAA-----ARI
O68921_9ACTO/257-379-----------------LPVVTPLVGAARGALRAWTERAAQGR--AP.............SPGALGELSRAA-----GEA

PF03241

YOAI_BACSU/277-479EAAKD-FMTKS.SFHAFTFHQVVIRQMIKIEFLLGVAQLL-VD---------TINV..SEYQHIQEKLSEII-----VGL
A0AYG2_BURCH/276-479AMCAK-QFHAT.PAHVYQNYQCQVRLMTKLRFLVGLGLKI-SE---------VNGT..NTFPQVRETLGQLA-----AEA
B8GBV1_CHLAD/298-503EKVNT-FFPIS.GFGHRFPLHGGTRFAVKLDFITGLMLKA-VE---------STGV..AEFRGVQARLGEIV-----TYR
B1KR96_SHEWM/302-502EVAAK-GFHEL.NKWSLYVGQ..IRFYHRLRTFLGVTSLV-AK---------SIGV..DGFREIMNRVGELT-----SYV
A0JW97_ARTS2/305-510EKINN-FFPQT.GFINRFTFQGVIRLATKLDFIAGLLMKA-LE---------VAGT..QDFRGVQTRVGEVL-----GWR
A0JY28_ARTS2/280-482QLCNA-FYTET.GAGALMTHQVVTRTIAKSEFFLGLASEL-AE---------SIGI..DGFQHIQEDIAELI-----IDV
A0LN12_SYNFM/277-476EFAVE-MVNRF.SAYHRQSHGG.CKSGK.IDCMVGAALTM-MD---------YNGT..EKAGHLKQKAIEMV-----HRA
A0LQ99_SYNFM/277-476KFAGK-VIEYF.TANYRACIGA.CVAGQ.GDVMIGAGALM-AR---------TNGL..A.AATFSAKMVEMA-----VNN
A0NTU7_9RHOB/294-499HKPID-FLMDT.GYLQGTCFHGCTRFAVKLDFLAGLLTRA-LH---------ITSG..DEFRGNQVLQGEVI-----ALR
A0RD61_BACAH/302-506EAGNQ-LYPKT.GIGHQPAHQSGVRGLVKLSFAAEVAMKL-AD---------SIGV..DGFLNVQNQLAELM-----QDV
A0RTL3_CENSY/278-479EFASM-LVERF.TCYHRRSYV..CKTGV.GDVLIGAAGTI-AD---------YNGV..PKVSHIREKMIEMT-----HLN
A0Z8Z1_9GAMM/280-484DQTEH-LVTSY.ANHHRHSCIG.ARAGF.GDLLIGAGALM-TD---------ANGLDMDDVSHLRETMVELI-----KIV
A8M0F3_SALAI/290-495AKVQM-FAGQS.GFTERFTFHGCTRLAVKLEFLAGLLAKA-VE---------LTGT..AEFRGVQSRLGEVL-----AWR
A1HPH9_9FIRM/279-481EFSGA-LVERF.AGYHRQSYGG.CKVGV.GDVLIGAAALA-AE---------YNGA..AKASHIKDKLIEMI-----HLN
A1HSG7_9FIRM/280-478EFSGL-LVERF.ACYHRQNYGG.CKGGV.SDVVIGAAAVM-AD---------MSGY..GKAAHIKEKINEMI-----HLT
A8ZWR4_DESOH/278-479EFAGH-LVERF.ASYHRQSYA..CKVGV.GDVLIGASQTI-AE---------YNGA..EKAHHIKDKIVEMN-----HLN
A1R2G2_ARTAT/273-478DTLRR-QFFDT.GAHALGNWQAQIRFSTKLKFIASVARKV-TQ---------VNGT..DKIPGVQEKLGELA-----AIV
A1RR46_PYRIL/278-478QWAGP-LVEVF.SAFHRQGYAG.CKSGL.GDVIIGAAYNL-AK---------QIGV..ADKPNIVDKLTEMV-----FLN
A1T9V8_MYCVP/264-468TVVNS-QFFGT.AAHQIGNLQSIIRLTAKLRFVTGVASLI-VK---------ANGR..DTDPAIKGQLAELA-----TVQ
A1UG98_MYCSK/231-433DLCNA-FYAET.GAGALMTHQVVTRTVAKTEFFLGLASEI-GA---------AIGI..EGFQHIQEDLAELI-----VDL
A1UX33_BURMS/272-476KRATG-FYAAS.GFANLYNFQSGIRLAVKLELMIGLLSLG-TQ---------ANGT..QSFRGIQAALGELI-----SLQ
A2SIT2_METPP/294-499EHSGV-LTYSY.ATHHRHSCIA.ARAGF.GDLLIGAGALM-CE---------ANGFDPGEKSNLREPMVELI-----KIT
B7LXQ8_ECO8A/286-491DRCRR-WTMEG.GFARMYPLQACVRLAVKLDFITALLKKS-LE---------CTGT..LEFRGVQADLGEVV-----AWR
A3IG07_9BACI/272-473EVANQ-FMNVS.GFQAYTLHHVLSRQIAKTEFTLGIVQTI-VD---------TINI..GDYQHVHQKVVDVI-----VAL
A3JWH7_9RHOB/273-475RAAS.-.FIRA.TLHRYSALPFVQRTLSFADLIIGAALWN-VK---------QTGL..DKQQAVQEKLAELA-----VWR
A3K7D3_9RHOB/280-487EKINA-FFPAS.GFIPRFTLHGVTRLAVKLDFISGLFAKA-LE---------ATGS..GVFRGPQTAVGEVI-----AWR
A3KYZ0_PSEAI/286-491ERCKQ-WFPQG.GFGRLFPMQGCTRLAVKLDFITGALYKA-LQ---------CTGS..LEFRGVQAQVGEVV-----AWR
A3L967_PSEAI/278-482RRATG-FYAES.GFANLYNFQSGIRLGVKLELMIGLLSLG-VR---------ANGT..QGFRGIQAALGELI-----ALQ
A4ISN3_GEOTN/277-480SICNR-TFRET.NAVVHMSHQVVAKNIVKTEFLLGVTLCL-IE---------AIGI..GEFQHVKDKGAEIM-----LAL
A4IT51_GEOTN/280-484EAANL-LYPKT.GIAQQPAHQTGVRGLIKLQFATEVAIRL-AD---------SIGV..DVYLNVQNDLGELL-----QSV
A4X8F7_SALTO/280-485GKVHL-FGAES.GFIQRFTFHGCTRMAVKLEFLAGLLAKA-LE---------IGGT..QDFRGVQSRLGEVL-----AWR
A4YFG2_METS5/275-482ELIED-LMWHTVGLRGWFNWHFMIQHYTRLKFLAGLAMTI-TE---------AAGT..STFINVQEKIGEIL-----LYV
A4YG29_METS5/261-459KFAGQ-LATLF.ATFHRFTALS.YRVAT.ANLFLGAARLA-SF---------VNGI..QNEKQVRDDIVDMI-----MYK
A4YGC7_METS5/279-478EYTGT-LVEIF.SAYHRQGYGG.CKAGL.GDVIIGASADL-AK---------QIGV..DRASHVQDKLTEMI-----FLT
A5D2Y1_PELTS/278-477QYAGR-LIARF.AKTHRMNCGGACKVGF.ADLIIGAAQLA-AE---------YSGV..QKAPHIIDKITEMI-----RIS
A5UWE2_ROSS1/284-489EKVNA-FFPLS.GFIPRFTFHGCTRMAVKLDFIAGLFLKA-ID---------ATGA..KDFRGVQARVGEVL-----AWR
A6GEF7_9DELT/289-490EFAAT-LVERF.TCYHRRSYV..CKSGV.GDVLIGAAATI-AE---------QNGV..PRASHIRDKLVEMT-----HLN
A6LV87_CLOB8/280-482DFAGM-IVERF.AGYHRQSYGG.CKVGV.GDVLIGAAAVA-AD---------YNGA..HKASHVKDKLIEMT-----HLN
A7GMD9_BACCN/280-482GVCNQ-AYNES.NAVVHMTHQVVSKNIAKTEFVLGILQLM-VE---------TINI..GQFQHVQEKMSEVI-----MAL
A7HU20_PARL1/275-477AVYNS-VMMRS..WWPNVMQQTTVRALTKLEFAWGLASRM-TE---------VIN...DVKPQTWEMLGEIW-----SYA
A7IC92_XANP2/275-478AMTGR-QFHAT.PAHVYQNYQAQIRLSVKLKFLLAIARRT-AE---------VNGT..TGFPQVRETLGQLA-----AEA
A7IIH3_XANP2/273-475KAAQ.-.FVRG.TLHRYSAYPYVLRLLYVADMMIGAALWN-AK---------QTGL..DKLQSVQEKLADLA-----VYR
A7LCL0_RHOER/310-515NRINA-FFPQS.GFLPRFTFQGCTRLAVKLDFIAGLLMKA-LE---------ATGA..GGFRGVQTRVGEVI-----GWR
A7YVV2_9MICC/278-479DHAKW-YPQRQ...FDWVHLETQIRQTVHAELMVGLGLLI-TQ---------SLGT..SKNPVVQSQLAELI-----RFR
A7Z0Y6_BACA2/169-371EAAFD-FNMKS.SFNAFAFHQVITRQIVKTEFLLGLAQTL-VE---------AIDV..GEYQHIQAKMAEII-----TGL
A8AA25_IGNH4/298-497QFAAE-LVEIF.SSYHRQAYGG.CKPGL.ADVIIGGAYHL-AK---------QMGI..ANKCHIREKLTEMI-----FLT
O29235_ARCFU/271-473KYATL-AAHLF.ALFHRHSYTG.CKPAT.TDMIMGFGALI-AE---------YNGV..YEKHNIREKLVELA-----ATA
O29377_ARCFU/270-461KAARD-VVSYF.APSHRCVGAA.CKAGF.IDSMAGAASLM-LK---------TSGL..ENVSALQQKVAEMV-----AVS
O29914_ARCFU/281-479DFASE-LVETF.ATYHRQNYGG.CKVGV.ADVLIGASAAI-AE---------YNGV..ERASHIVDKLTEMV-----HLA
O68231_PHOLU/286-491DRARN-WAIQA.GFTSLYPLQACVRLAVKLDFITALLQRS-LE---------CTGV..IEFRGVQANLGEVV-----AWR
O68312_GEOTH/292-497EKVNT-FFPRS.GFINRFTLHGLTRLAVKLDFIAGLVLKA-TE---------ATGV..KDFRGVQARVGEIL-----AWR
HDVD_CLOAM/279-489DFAGM-MVERF.AGYHRQSYGG.CKVGV.GDVVIGAAALA-AD---------YNGA..QKASHVKDKLIEMT-----HLN
Q0S9W4_RHOSR/289-494DTANG-FVMKS.GFLSRFMFHGCARLAVKLDFIAGCVMKG-VE---------MTGS..AGFRGVQMQIGEIL-----NWR
Q0S9Y3_RHOSR/274-479TGVRR-QFFET.GAHVLGNWQAQIRFATKLEFIAGVARRV-TQ---------VNGV..DKIPSVQEKLGELA-----ALV
Q0SFU1_RHOSR/275-477RAAT.-.FIRS.TLHRYSAFPFVQRTLHLADLMIGSALWN-VK---------QSGL..EKQQAVQEKLAQLA-----CYR
Q11FH6_MESSB/285-490AKILS-FHPAS.GFMHGYCFQGCTRLAVKLDFLAGLLAKA-LR---------ATGG..DAFRGNQAMLGEVF-----AIR
Q1AUW7_RUBXD/275-476ESAQ.-.YIRA.TLHRYSAFNYVLRVLRRADLLLGTALLN-VE---------QTGL..TKIPAVKEKLAQLI-----GYR
Q1J3T2_DEIGD/284-486ELANK-AYAAT.DAVLHMAYQVVNLKIAKTEAFLGTAQSI-VN---------AIGS..GGFQHVQSKVAEII-----IML
Q1NCP8_9SPHN/273-476AMVMK-QFHAT.PAHVLQNYQCQVRLMVKMRFLMGIARRT-AE---------INGT..LALPPVRDMLGQLA-----AEA
Q24N71_DESHY/291-493QYAGY-LALMF.AHFHRHSYTG.CKTAV.SEVIGAQAALV-AD---------VNDI..AKEHHVREKVCEII-----STA
Q2BDF2_9BACI/285-487EAALA-FKNKS.SFHSFAYHQALIRQIVKTEFILGIAESI-VK---------CLNV..SEYQHIQAKMAEII-----IGL
Q2EYY8_9PSEU/287-492GAANS-FATGS.GFLERFTFHGCTRLAVKLDFIAGCVMKA-VE---------VTGT..THFRGVQAQVGEVL-----NWR
Q2J9B2_FRASC/272-471NLARV-GLGRI.NAWSAAAGH..IRYQERLRTLLAVGTLL-AD---------AIGA..SGLRHVQEDLGELA-----SYV
Q2LR84_SYNAS/278-477EFAVD-MVVKF.SSFHRQSHGG.CKSGK.IDCMTGAALTM-MD---------YNGT..AKMSHLKQKVIDMI-----HRA
Q39TI2_GEOMG/281-479KYAGL-LVERF.ASYHRQNYGG.CKAGV.SDVIIGATTAM-AE---------YNGA..AKASHVRDKIVEMV-----HLT
Q3ABD4_CARHZ/271-473QYAGQ-LALLF.ATYHRHSYTG.CKPAV.TDIIMGTAALV-AE---------YNGV..EKASHVRDALAELI-----AVA
Q3ACI6_CARHZ/280-482EFAGN-LVEYF.ASYHRQSYGG.CKVGV.GDVLIGAAANI-AE---------FNGV..DKASHIKDKIVEMI-----HLN
Q46ML0_CUPPJ/298-502QVARD-QWWKT.PAHLYGNLQAQARYITKLRFMMGLAKRM-NE---------MTGN..DANPAVQIQMGELA-----SLV
Q483J1_COLP3/274-476KAAM.-.FIRS.TLHRYSAFAYIQRNLKVAELLIGASILN-VQ---------QTGT..DNQPAVQERLAKLA-----CYR
Q53008_BURPI/276-477NHAKL-YPQRV...FDWLHYHALIRQMVRAELVAGLAVLI-TE---------HIGT..NKIPAVQTRVAKLI-----GFH
Q53VT6_THET8/296-500EKVNA-FFPLS.GFVHRFPFQGCTRLAVKLDFIAGLTMKA-LD---------VTGA..SQFRGVQARLGEIL-----TYR
Q5KY13_GEOKA/276-478WVAKE-LDEET.HLAIMLLHQVLARRIVKTEFFLGTVELL-SE---------AIQI..GGYQHVQEKIGEIA-----AAL
HPAB_THET8/269-471ELCNN-AYAAT.GALNHMAHQVVALKTAKTEAFLGVAALM-AE---------GIGA..DVYGHVQEKIAEII-----VYL
Q5WJM6_BACSK/273-477WLMSQ-LFART.GIEAFLLYQAANRQIVKTEWLLGVAQAL-VD---------TLNI..GQHTHVQGKVSEVI-----VAL
Q6F4M8_RHOOP/279-480DHAKW-YPQRQ...FDWVHIETQIRHAVHAELIVGLALLL-TN---------ALGT..NNNPIVQSQLADLV-----RFR
Q7MZM5_PHOLL/274-477DMCRR-QFLAT.GADVLMDVQGMARYAVKLHFLTGLAHQL-TE---------TTGV..NEFPAVRESLAELA-----CYA
Q7N069_PHOLL/285-490GSSRH-WAVQS.GFARLFPMQACVRLAVKLDFITALLQKS-LE---------CTGV..VDFRGVQADLGEVV-----AWR
Q7N9R8_PHOLL/291-496DKVSL-FFAES.GYFHRAMLHGVTRLAVKLDFLSGLLIKG-VE---------ATGT..KDFRGVQARVGEVL-----SWR
Q7P6F6_FUSNV/282-484EFSNS-LVERF.AGFHRQSYGG.CKVGV.GDVLIGATALI-SD---------YNGT..KKASHIKDKIIEMT-----HLN
Q8EMH2_OCEIH/277-480EICNG-AFAET.NAVVHMSHQVIAKDIAKVEFLLGVVLKL-MD---------SIGI..DGFQHVKDKGTEIM-----LAL
Q8GMG6_STRGL/290-495GKVHL-LAGQS.GMIERATFHGCTRLAVKLEFIAGLLAKA-LD---------ITGA..KDFRGVQTRLGEVL-----AWR
Q8ZUN5_PYRAE/280-480RWSGV-FVEVF.SNYHRQGYAG.CKSGL.GDVIIGASYGL-AR---------RLGV..ADKPHIQEKLTEMA-----FLN
Q97V96_SULSO/277-477QMSGI-LVEIF.SSYHRQGYGG.CKSGL.GDVIIGAAYNL-AK---------QIGV..EKAPHIQNKLNEMV-----LLN
Q9CKT3_PASMU/295-500ERCRT-WAQYA.GFATLFPMQACTRLAVKLDFITGLLHKA-LQ---------CTGV..IEFRGVAAQMGEVM-----MYR
Q9F0I2_9PSED/285-488ELASA-GFFSL..WTSYSHWYTLVRLETKADLYAGLAKVI-ME---------VLGL..EGIAVVRQRVSEIV-----QLA
Q9K693_BACHD/276-478SQVQT-MYDET.NMNVLLLYQAVSRQAVKSEWLLGLSEWM-VR---------TINV..VEHQHIHEKMSEMI-----ISL
Q9LAG3_BACTR/276-479KVVNG-FFVET.GFVNRFTFQGCTRFAVKLDFMVGLLMKA-TE---------AAGT..KQFRGVQANIGEVV-----AFR

PF01756

ACOX2_MOUSE/492-677DFRCP.EVYTTAWAYVSARLIRDATQHTQTLMRSGVDQYD-AWNQTS.VIHLQAAKAHCYFLTVRNFKEAVE....KLDN
ACOX1_HUMAN/476-660DINSP.ESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEV-AWNLTS.VDLVRASEAHCHYVVVKLFSEKLL.....KIQ
O62137_CAEEL/476-659DLTSL.NGYVKMFENMARRQAWKATEKFLKLMESGESREV-AWNKSA.VELTRASRLHTRLFIIEAFMRRVS.....RIE
ACOX_DEBHA/507-686DLKDL.KKVLLAIEVAIIRVAYQASQTLKE.......NKG-DFDTVG.AEMVTLSKLNAHHFMLSEFLDRMD.....SFE
Q6BRD8_DEBHA/507-686DLQDL.SLVFKALEVLICRLANQSIDVLES......SGDN-NWDLVS.YQRVVLSKLRCHHYLLQNFMSRID......SA
Q7Q3S7_ANOGA/519-705RLEST..ECNQCYEWLMCWLLKQSVAQMEEASKAGVDTFT-ARNNCQVYRARDLSRAYAEYYALESFRSRCA....RADV
Q7PZ92_ANOGA/485-674DWDESIGGIVRALQTVAAGKLRLAAEHIEQRQKRGATLEE-ATNQTS.IELARTADAHCRAFLVQSGCEMIEK..GCATA
Q7QHJ6_ANOGA/523-708QIEDP.KVILNVLSWLTAYTLEGTYRRAEGLLKRGDSKFD-VRNDTQIFYAKDLAIVFGERIIFNAFCTFLD.....TME
ACOX4_CANMA/512-689DLNDI.NKVIKSIEVAIIRLAHEAAISVRK.........E-SLDFAG.AELVQISKLKAHHYLLTEFVKRVG.....EFE
ACOX5_CANTR/470-642DLDDP.AKLVKAFDHALSGLARDIGAVAED.........K-GFDITG.PSLVLVSKLNAHRFLIDGFFKRIT........
ACOX2_CANTR/526-704HVDDV.DRVLKAIAGLISKFSKDLIPI..........SYQ-SWDSIG.AQRVILSKLRCHYYLLETFNERLN...DKIKA
ACOX3_HUMAN/507-696DCLDS.AVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFE-ARNKCQVSHGRPLALAFVELTVVQRFHEHVH....QPSV
ACOX4_CANTR/512-689DLDDI.KTVIKAIEVAIIRLSQEAASIVKK.........E-SFDYVG.AELVQLSKLKAHHYLLTEYIRRID.....TFD
ACOX3_YARLI/503-688DLKDP.KVLIEAWEKVANGAIQRATDKFVELTKGGLSPDQ-AFEELS.QQRFQCAKIHTRKHLVTAFYERIN.....ASA
ACOX1_YARLI/495-678QLLSP.EFLVEAFRTASRNNILRTTDKYQELVK.TLNPDQ-AFEELS.QQRFQCARIHTRQHLISSFYARIA......TA
ACOX2_YARLI/503-688SLTDP.KVLVEAWEVAAGNIINRATDQYEKLIGEGLNADQ-AFEVLS.QQRFQAAKVHTRRHLIAAFFSRID.....TEA
ACOX2_RABIT/492-677DFFCP.ALYTAAWAHVAARLTKDSVHHLQALRQSGADEHE-AWNQTT.IIHLQAAKAHCYYISVKSFKEALE....KLEN
O74938_YARLL/504-688PLTDP.AVLITAWEKVACEAINRATDSFIKLTQEGLSPDQ-AFEELS.QQRFECARIHTRKHLITSFYARIS......KA
O74937_YARLL/504-688SLEDP.KLLVEAWEAVSAGAINAATDAYEELSKQGVSVDE-CFEQVS.QERFQAARIHTRRALIEAFYSRIA......TA
Q6P421_XENLA/476-661DINDI.QNLVEAYKQRAAWLVVAAAKNVNADTKRGKRKED-AWNKNS.VDLVRASEAHCHYVVVRLFAEKLS.....EVL
Q9W3U0_DROME/485-676GKNLV.ANCVRALEISAMEQVRDAWQTQKMHQSGKVSPEM-ASNLAG.RQLTSAAIAHAHAFFTRNALEQVEALRKKGDL
ACOX_PICPA/519-697KQVCT.VKLINAIQGTIIRLGVRVPNI........GSKKS-TWDDIA.AQRVVLSKLNAVLYMLQHLVLKIK....QLGD
Q6C6T0_YARLI/492-677NLYDP.KVMIGAWETVSRALINRTTDEFEVLAKKGLSTAQ-AYEELS.QQRFLCTRIHTRLYMVKNFYERIA.....EEG
ACOX_KLULA/531-716KFDNK.KDFTEIWAVMIIRLIHHVVELISK........GT-KIDSLS.KTLVQISKFHAIHSMLLTYQDKLNNESEASVK
Q93839_CAEEL/480-663HHYTD.ADIVEDLEHVARKQVFRAYDRLKKAQE.HLRPED-AWNSVS.VELAKASRWHVRLYLVKNLLHKVS......IA
ACOX_YEAST/543-727GLKEL.GDYTEIWSITLIKLLAHIGTLVEK........SR-SIDSVS.KLLVLVSKFHALRCMLKTYYDKLNS.RDSHIS
O23977_HORVU/455-637RLVNP.AAVKEVFEARALRMAVNCAQNISKA....PSQEE-GFSELS.PDLLEAAVAHVQLIIVTKFIEKIE....EDIP
Q6BVP3_DEBHA/505-684DMNDT.RKVLHAVEVAIIRASNQALTTLDAH.......GE-DWDFIG.ANLVQLSKLLAHFFLLKAFLDKVD.....SIE
ACOX_CANGA/543-728KLDDL.YDYTNIWAVALLKLLRHIAKQVDS........TK-DLDGAS.KLLVLVSKFHALYVMLNTYYEKLNSPTDSYVT
Q6NTR5_XENLA/481-666DFLNP.EVYIKAYQHRAHRLIASAAFKMRNLVQFGMEQYD-AWNSTS.VELVKASIAHSHYIIVKLFADVTG....SLSS
Q7T2B6_DANRE/499-688ECMNS.AVPLAAYKWLVCFLLGESQKKLFEEKSSGLGDFE-ARNNSQVYYCRSLAIAFIEHTVLQRFHDLIQ....DEQT
Q8SYT1_DROME/467-655EVLDP.LNLLNALNWLTVWQLDTTVKRVEEQQREGKDAFE-TRNNIQVFAAQKLSIIYGERTIYYVFYKFVI.....GLP
O62140_CAEEL/484-669PNGGI.TEYIKTFQHIAKRQTLKAANKFFGLMENGEKREI-AWNKSS.VELNRASRLHTRLFIVEAFARRVN.....EIG
Q9W2G8_DROME/486-676KWDDSWQCIIKALQYTAAHKTRIAFENLANRMASGQSQGV-AANNTG.IELTRAAELHGRQFVCQTFLEQITG.AKAQKR
Q95TH0_DROME/505-692PIASW.QFSLRCYEWLLCHLMAKTTAHIEGQLAAGSSKFE-ARNNSQVAGARELSLAYAEYYALTRYVDHVS....TLTV
Q945U3_SOYBN/477-659DWLKP.NAVLGAFEARAAKKVVACAQNLSKF....TNPEE-GFQELS.VDLVEAAVAHCQLIVVSKFIEKLQ....QDIP
ACOX_CAEEL/475-659TNDKF.AKMLSHFEHIARHRVMHAYRQMIEEEKQGIERDY-AFANHS.VDWTKAARAHTKLFIARGFVKSVQ.....EVS

PF00441

Q746I1_THET2/271-431AGG.LALALAAVEAFDR--------AWHERPPYGEAYHLARFLSHL.A----KNRTA-EHSAEITRLAMELFGGLGF...
O01590_CAEEL/830-981EQA.RLLVLKAAH...M--------IDTVGPK......EAKSEIAM.I----KVVAP-NMAISILDRAMQQQGARGL...
O53549_MYCTU/234-393EVL.KLINWELASSQSG--------PKDAGPS........PADASA.A----KVFGT-ELATEAYRLLMEVLGTAATLRQ
P96842_MYCTU/231-377RAM.RSYALATME....--------....GPA.....VEQPGQDNV.S----KLLWA-NWHRNLGELAMDVIGKPGM...
Q6L0T7_PICTO/229-380EMT.KLLTYKAAY...L--------ADKNSDE.......LPVYSAM.A----KLRAP-QLALKILKSVMMWYGAYGY...
O33229_MYCTU/236-385TVV.RIMVDEFIK...L--------HLAGKLT........AEQAAM.A----KWYAT-EKQVYLNDRCLQLHGGYGY...
Q96ZN0_SULTO/214-364YSI.KSMIREIS....K--------YPLDRLF......EIEGKISA.L----KFVSS-NVAENIIDTALQIMGGLGY...
O33331_MYCTU/253-403INV.QNMVFQAIE...R--------LKAGKQL.......TLAEASA.I----KLYSS-EAATDVAMEAVQLFGGNGY...
Q88L96_PSEPK/235-384HAA.RSMVYATAA...V--------NDAGGNI........RTQAPM.C----KLFVS-ETAFRIADRAVQIHGGAGL...
Q8YTN6_NOSS1/794-944TVV.QSLVMRVGK...L--------LDAGETV........PAEVYAAC----KISAP-EFYWQAADLLVQTLGGRGY...
Q83X47_STRRO/309-460LAA.DAMSMVVLRALSL--------LPDRAHL..........FAAA.V----KYVVP-DLLREGLQELATVLGARGF...
Q979G0_THEVO/234-391EAA.LNFAYKALW...I--------YDQEQRYGKYSRFQVSKMIAM.A----KLIST-TWGFDAVNDAMQWQGAYGY...
Q72MA7_LEPIC/234-386CAA.RRMTYFVAR...K--------KDFEPNV......SLPMESSI.L----KVFAS-EVSEEVASDAVQIYGGMGY...
Q72U63_LEPIC/236-385ESG.YMLTLKAAH...T--------LRAGEDA........RQIISM.A----KWQVS-ETLCKVIDRAIQICGSHGY...
Q7NQK1_CHRVO/288-439EAA.LCLAARLAE...G--------FENDEPA......WKRIVTPA.A----KFWVC-KRAVEAVGETMEVFGGNGY...
Q82KR6_STRAW/219-369EAA.RLMVYAAAA...A--------YDEAAPD.......VPRRAAM.A----KLLAT-ETAQYVVDAAVQLHGARAL...
CAIA_ECOLI/227-376NSM.KNMLYEAAW...K--------ADNGTIT........SGDAAM.C----KYFCA-NAAFEVVDSAMQVLGGVGI...
O01502_CAEEL/286-435EAT.RALLYRTVL...A--------RSRGDDV........SMLTAM.A----KLKIG-RLARAITDQCLQVWGGAGY...
Q8CXY8_ECOL6/186-337RSA.QLMCFSAAE...Y--------RETLHPA.......MINQILM.A----KYVAS-KAAVDVAGKAVQLLGANGC...
Q82SH8_NITEU/238-387AGA.RELVRIAAR...G--------VDAQCPD........EIAINV.A----KMAAS-RALCIASDSAMQLYGAEGL...
O54143_STRCO/233-381EGA.RLLLYRAAR...S--------LSDGTAD........EVGPAL.A----KIAVS-EAAVQLGLDAVQLRGGLGI...
Q7WBL7_BORPA/220-369SSS.RMMVYEAAR...A--------YDAGEDI........STLGAM.A----KLLAS-EVSHTVVDDAMQVLGGRGY...
Q7S582_NEUCR/378-536EAS.YNWLENLIY...Q--------CEKMGET..EAMLRLGGAIAS.L----KAQAT-VTFEFCAREASQIFGGLSY...
Q7WBV7_BORPA/237-385ESA.RHFVYSVAA...L--------DARGVEC........VKEVSM.I----KALCG-ELVNEVMDDCVQFHGATGY...
O53577_MYCTU/309-462EAA.LAMVFDGFG...A--------ANHRQPR....CLPQRIAVPV.T----KLKTC-RLGITVASDAIEIHGGNGY...
Q73V99_MYCPA/567-712TAL.RLLNLRRAA...R--------SVEGTGP........GPEGNV.T----KLKLA-EHMVEGAAIMAALLGPEVA...
Q86ZG6_NEUCS/353-511ESH.QSWLETITY...Q--------MNHMPYS..EQAKHLGGPIAL.L----KMSCT-RAAHEIADESVQIWGGRGL...
Q8VW50_BACTK/146-297KAA.RSLCQEAGK...K--------RQDRHTD.......AVIETTI.A----KYFAS-KMAMKVATNAVQVFGGNGF...
Q72US4_LEPIC/278-427EAG.RLLCYQAAW...M--------IDNGFRN........TYQASI.A----KMFCA-DMCMRVCTDAVQVLGGYGF...
Q6N0G3_RHOPA/236-389AAL.ACAAERAVD...L--------AKAGQLH........PAFSSA.M----KYYGT-ELNKRRHEI...LMSAGGIDAL
Q7VRY9_BORPE/300-458EQA.LSACMFVAS...T--------MHRAGADDPRDRKIVRLATAL.L----KFRAC-RDNATVATAAMEVRGGSGY...
Q8X1D8_FUSOX/265-418ETS.RLLVWKAVT...T--------LEDEALE.....WKVKLEMAMQT----KIYTT-DVAVECVIDAMKAVGMKSY...
Q89PN2_BRAJA/242-397EVL.KAHVETAVE...A--------LVNGDKI........GARGSL.A----KLYWS-ESHQRFAALAIELLSQASL...
O07455_RHOPL/228-376EAA.RLLCLQALW...L--------KDHGAPH........SAEAAM.C----KWWAP-KLAYDVIHQCLLMHGHGGY...
O86319_MYCTU/229-379DVA.RVYAHHVVE...R--------QLAGETD.......LIAQVCF.A----KNTAV-QAGEWVANQAVQLFGGMGY...
Q72VB9_LEPIC/297-445TAM.LTSIFRHFH...T--------PETLKLA.......GEVLAPL.L----KYKCS-ATSTEITYNSILVLGGNGI...
O29271_ARCFU/236-385TKG.QLLAWRLAK...L--------MDEGKAT........TEQISM.A----KKNNV-RVARYCARTARELLGANGI...
Q73V20_MYCPA/256-407QMV.RLLVQYAAW...H--------LDRDHHM......EVSDKVSM.A----NYRAN-RLVCDAADRAMQIFGGLGY...
Q89GG8_BRAJA/255-404YAA.KSMTRDCAW...R--------IDQGLPA........TKQVSM.V----KMYAT-EMLNRVMDQCIQVHGAMGL...
Q6N940_RHOPA/240-392SGL.KYTSYRSIS...A--------LSKGQRP........GPENSI.G----KLVAG-PMLQDIAAFAMDLEGAAGVFTD
O31251_ACIAD/242-393EAA.RLLTLKATW...M--------ADNKKPN........SKEASI.A----KAKAG-RICNEITLKCVELAASVGY...
Q9KYK3_STRCO/242-392RAA.RILAYQAVH...L--------LDQGLPC........DAELIN.S----KYLGH-RWAMQSAQDAMELHGAHAL...
Q73ZZ3_MYCPA/230-385AVA.TLMGYEAAS...I--------LDSGVIP........TVEVSV.E----KIFTS-ELRQRIADLALDLLGVDGLLAH
Q7MB81_PHOLL/221-359EAI.RNLNYRAAS...R--------IDDDILD........GAAVSL.A----KACST-EFVEKVVHIMPQLVGTELF...
O28039_ARCFU/236-386EAA.RLLAYQAAY...F--------QDKMGMP.......DPGLTAM.A----KYYTA-KAAQFIVNEALQIHGGYGF...
Q8ZV35_PYRAE/224-374EAL.RALVYKTAK...M--------RDENHPD.......FPLYAQV.A----KLMGS-RTAVETARLAVQILGGYGY...
P95281_MYCTU/209-359DAT.RATVMFAAM...S--------AANGDEL........QTVAPL.A----KAQTA-ETFVLCAGSALQIHGAIAF...
Q72N29_LEPIC/402-551QAS.RQYANHVAN...L--------LDNHKGQ.........MEATL.I----KFYAS-KVAEWVTREAMQIHGGMGY...
O06164_MYCTU/243-392HVA.RTAYYDAAA...K--------MLAGKPF........KKEAAI.A----KMISS-EAAMDNSRDATQIHGGYGF...
Q6SH30_9BACT/238-395SAV.KQLGNRIAQ...Q--------HEVQSVD........SRLPLL.M----KYLST-REVQHKNEIILDILGTRGL.SL
Q82GQ8_STRAW/233-378RALWRLTQWNVSE...A--------QSTGGVP........GVGGSV.F----KLRYS-HARQELYDAAAEVLGPDAA...
Q6FZS6_BARQU/342-487AAS.QVLVLRLAR...A--------FDNAAND........HSEAAF.A----RIMTP-IIAYHVSQLAVPIIGE......
Q73XF8_MYCPA/231-370EAL.RATGYRALA...N--------ELAGRPS.........PEADT.M----KLLGS-LTLQRVWELAAAAAGPDSA...
Q6N0G4_RHOPA/228-378EIL.RAAVLKALQ...A--------VDADAVQ.......ARVAVSV.A----KAKAG-TVATLAVQEGVQMHGGMGM...
MBTN_MYCPA/226-373DLL.QHGLNGIAA....--------....QGR......LDLRAAAG.V----KVTAA-RLGEEVMSECMHIFGGAGY...
ACAD8_MOUSE/261-411VAS.RLMIRTAAV...A--------LQEERED.......AVALCSM.A----KLFAT-EECFAICNQALQMHGGYGY...
P71858_MYCTU/228-380RIN.ELLNWQVAS...A--------GEDINMA..........DAAA.T----KVFGT-ERVQRAGRLAEEIVGKYGN...
Q7BGH0_9NOCA/228-377EAA.RLLVYSAAT...K--------LARGEKA........LKEVSM.A----KVFAA-KTAFRVATNGMQALGGYAT...

PF08028

Q7CWU4_AGRT5/248-389DAA-CEILLRDVS---RAQALAQARIEGRAEF---.TVDDRLLSRR-G....QSFAV-SLSLRAVQALNDSTGGVGL---
Q7TW64_MYCBO/239-373DAA-WRQLIGNVS---DEYAL....LAAGKEI---.PFELRARARR-D....QVRAT-GRSIASIDRLFEASGATAL---
Q6SI41_9BACT/253-376EAA-RLTVYNAAR---L........RDGGHKF---.....LTESAM-C....KLFSS-NVAEKVTSLAVQLFGGYGY---
PIGM_RHOST/235-366DAA-ETLLDAFFE---RLT......AQRPEQS---.DPRDRAEMKL-K....AAYLA-DLARNALNDMVRGIGGDGY---
Q6B6H3_9ACTO/255-392QGA-DAAAREAAH---LLQTV....WDKGDAL---.TPEDRGELMV-KISGVKALAT-NAALDVNSGIFEVIGARGT---
Q8GRC5_BACIU/254-391QAG-DAAAREAAQ---LLQTA....WDKGDAL---.TPQERGELAV-QVAGVKAIAT-KAGLDVTSRIFEVIGARGT---
Q9ZGA9_STRCY/246-378DMA-YLLLDRAGR---V........ADRGAGV---.TPLEAPRNTR-D....CALAV-ETSVTAVNRIFAAAGTSGH---
Q81JV7_BACAN/243-366EAA-RLLVYRAAS---L........RAQGLPC---.....GKEASI-A....KLFAS-KTAVEVAIEAVQVFGGYGY---
Q73ZE7_MYCPA/241-374RAA-RLLVLDAFT---TAEAA....VAAGQEL---.TPALRADMRV-A....AVYAT-DTARGCAEWAHLVAGTSSI---
Q82KU6_STRAW/243-369EAA-QLLLQDAAR---C........ADTGTR.---.AEADVLRNRR-I....TAAAA-DLLVDGVERLFRTAGVHAC---
Q6T1C5_STRGL/242-374DAA-QLLIERASE---V........ADRGAEI---.TPLEVVRNGR-D....CSLAV-ELLVTAVNRVFGAAGTSGH---
Q8FWK5_BRUSU/242-365ETA-RQMVLRAAA---L........REAGKPC---.....LTEASM-A....KLVAS-EMAEQVCSAAIQIHGGYGY---
O69789_RHOOP/244-378DQA-KFHADRITT---AVDEH....AASGAAW---.DVVERVRCRA-D....IAWAI-KLTREACEIVEHGSGANAL---
Q7ML36_VIBVY/236-369AAA-RALLEKTWN---DHKEH....GERKEYP---.DAETLTYWRT-N....QAYAV-KMCIAAVDRLFEAMGGMAW---
Q89H98_BRAJA/262-395DAA-RRTMRSACI---DAME.....DARRSHI---PDMATKTRYRR-D....GAFSV-NLCTDAVSMLFAASGARGL---
HPAH_ACIBA/268-401AAA-RALLEKTWE---DHRIH....GLNHQYP---.NKETLAFWRT-N....QAYAV-KMCIEAVDRLMAAAGATSF---
Q82NJ4_STRAW/252-386GGA-ELHLARLTA---EIEAK....ARDDLPY---.TPLERARIRA-E....SGYVT-RICREAVDLLAAASGASSL---
Q53907_STRCH/232-363DAA-QLLLERVAA---V........ADAGSA.---.TGVLVGRGAR-D....CALAA-ELLTAATDRLFASAGTRAQ---
Q8XTR8_RALSO/249-372DSA-ALLTYRAAW---Q........RDQGRSV---.....TREAAM-A....KMTAT-ENAQQVIDAAVQMWGGLGV---
Q6SH77_9BACT/226-355AEL-EAVMFHNFD---K........MEDSDWK---PSIEERVLFRY-Q....ASLVI-DKAIAAIDTLFDVAGGRAV---
Q9ZA38_STRVN/260-385DTA-ALLLESAVR---R........ADSGRV.---.TDLEVARNSR-D....CALAA-ELATAVVDRLFTSVGTRAH---
Q45413_GEOSE/245-379NAM-EGIVEQYIR---QLEAC....QKEGKTV---MNDMEREQLFA-W....RGYVA-KASANIAVRTLLTLGGNSI---
Q9F0J3_STRAE/257-387DGA-ELLLDRTAR---A........ADTGAL.---.DPLLTARGGR-D....CALAA-ELLLTAADRLFRAAGTSAQ---
Q83VZ8_COMTE/242-374DQL-KMVLFRNYA---RIVDA....AKTGIQL---.TLEERLLQRA-Q....ASYVP-KLTGFHANELMRACAASGT---
PIGM_RHOER/237-369RAA-RDTLLANVD---RMWDR....VDAGKEV---.TFEQRAEGRQ-T....QVQAA-WRAINAIDQVYPRCGGNAL---
Q7WT11_9ACTO/232-362DAA-ALLLGRVAE---.........VLDHDAV---.DPLLTARNGR-D....CALAA-ELLAGAVDRLLRSSGSRGQ---
A3KCV4_RHORH/234-366ESA-RVTLLETVD---RFWDK....TDRGDEI---.SFEERAVGRR-T....QISSA-WRAVRAMDEIFARAGGAAV---
Q73YD4_MYCPA/236-369DAL-RALVAQTAD---RIEAI....VAGGDRV---.SRSVRADARL-A....AARTV-HESRAIIADVMEASGASAH---
Q8XT96_RALSO/240-373RAA-RAFLHEVLE---DTWAV....SKGSDPI---.AVSHRRDIRL-A....ATFAT-TESASVVDRMHRLAGGSAV---
Q89IL9_BRAJA/246-380GAA-QAFHEVQAA---SHWRH....ALAGTLN---.DEDLVVEGTR-S....ATWLA-TTCVGIADACFSLAGSSAV---
Q740A3_MYCPA/237-369NAA-RQELLANAD---RIYDI....VASGKEV---.SFADRAAGRR-T....QVRAV-WRAVSAVDEIFARSGGNAA---
Q7D650_MYCTU/242-375GAA-RALFYEVIE---AAWQV....SHDAEAV---.PVTMRNRLRL-A....ATHAV-RTSADVVRSMYDLAGGTAI---
Q7D2V7_AGRT5/257-391HAA-QALLEKAGY---A........IDRAIQN---PNAETVAEAQV-VTAEAKILAT-EIAIAATNKLFELAGTRST---
Q6QF57_9NOCA/130-264AAS-RAALLETVD---RFWDL....TERGI..---.RGHLRATRDR-TPDPGRRGHG-GPCAPSNEIFFAGRRAGAL---
Q6PV90_9NOCA/243-377DEA-QFHQDRLGD---DIDK.....WAEGAEY---MPESLRVRARM-D....IGRAL-DLCRDAANLIFSLGGGSGI---
Q9JN91_STRCH/232-353RAA-GLLLEAAAE---.........RADHAPV---.TPLLVAEGQR-D....AAAAV-ELCSEAVDQLLRASGSRGQ---
O68921_9ACTO/257-379DAA-ELLVLRAAA---A........ADGTVSL---PEPAAAVRGKR-D....TALAA-ELAVGAVQRLVRASGTSGQ---

PF03241

YOAI_BACSU/277-479ETI-KALIDKSEN------------DAQLD..EFGYMRPCLIPLQV-I----STIIP-KLYPRFTEIIQLIGASGMVT..
A0AYG2_BURCH/276-479SMV-EAWVYGMEA------------KGTV...VNGFYVPDRNMLYG-S----QVVTQ-QLYSKVLNTLRELAGGGMIM..
B8GBV1_CHLAD/298-503NLF-WHLTEAMVR------------NPMPW..VDGYLLPNLEAAFA-Y----RVLAP-DAYVKIKDLIEKDVASALIY..
B1KR96_SHEWM/302-502ELV-RSCLVGIDS------------ETRIS..SAGNIAPG..STLA-L----DSFAS-QIAPRINEILRDIGGSGIIM..
A0JW97_ARTS2/305-510NMF-HALIDGMTL------------NPDQG..PNGTVLPKLDYGLS-Y----RMFMA-IGYPRIKEIIEQDVASGLIY..
A0JY28_ARTS2/280-482EIG-KALVRASEA------------DAGLN..EAGVMLPKWTTLNA-A----RNWYP-KIAQRFPQIIRKFSASGLMA..
A0LN12_SYNFM/277-476ETL-YGCSLAASY------------EGKKE.P.SGTYFIDTVLANA-S----KIHEG-KEMSEAGRLLVDIAGGFVAD..
A0LQ99_SYNFM/277-476ETT-YCMGIGAMA------------LGKKG.P.GGMWVADSLTAHT-N----KVHVA-TLPYETKRLCQDIGGGVVETGC
A0NTU7_9RHOB/294-499HLF-WSLSDAMAR------------TPEAF..ADSAFLPGLSAAQA-Y----RALAP-DAYGRVKEIVQKIVASALIY..
A0RD61_BACAH/302-506ETI-RALLQVAEY------------EYETN..SYGEVIPARLPLDT-I----RSLLP-KMYPRAIEIIQTIGAGGLLM..
A0RTL3_CENSY/278-479ETI-YAAGIASSY------------QAQKM.K.SGVYLNDDMLAQV-C----KHNVT-KFPYEIARLTQDIAGGLMVT..
A0Z8Z1_9GAMM/280-484EGF-YACGVAASV------------YGIQD.P.CGSWMPEPVFSNI-G----KLLLA-TQIYDMHRTAHEVSGGLIVA..
A8M0F3_SALAI/290-495NLF-WGLSDAAAR------------NPVPW..KNGALLPNPQYGMA-Y----RWFMQ-IGYPRIREIAMQDVASGLIY..
A1HPH9_9FIRM/279-481ETL-YACGIACSA------------EGYKT.A.SGTYLIDLLLANV-C----KQNVT-RFPYEIARLAEDIAGGLMVT..
A1HSG7_9FIRM/280-478ETL-YACSIACSA------------EGKPT.A.SGAYYVDPLLANV-G----KHNVT-RLIYEIDRLAQDIGGGITAT..
A8ZWR4_DESOH/278-479ESL-FCGSLACAA------------TGHKE.P.SGTYYVNNLLANV-F----KQNVT-RFPYELSRLAQDIAGGLMVT..
A1R2G2_ARTAT/273-478QSV-ESAVLAAEY------------TATTD..DAGMRVPGKSALYG-A----MGLQS-ETYPRVISILRDVVGGGVLQ..
A1RR46_PYRIL/278-478ESM-YSAGLAASW------------EGKKLLK.DGGWWVNPMYANV-T----KHLVS-RFPYEIARLAHDIAGGIIGT..
A1T9V8_MYCVP/264-468TVS-EALTHAAHS------------HAERD..EYGVYRPAGKYLYA-A----LGMQT-EVYPKAIKLLGELAGGGVIQ..
A1UG98_MYCSK/231-433EIG-RALLRAAEA------------DGAIN..DWGVYLPRWETLNA-A----RNWYP-KVSQRFPQIIRKFSASGLMA..
A1UX33_BURMS/272-476HLL-KTITAAMAR------------DPERT..PSGVVVPKLQYASA-L----RIQVP-QIWKRVRELMETALGGSPLV..
A2SIT2_METPP/294-499EGF-FACGVAASV------------YGTAD.PYSGSFMPEPVFSNI-G----KLLMS-TQIYDMHRLAHEVSGGLIVA..
B7LXQ8_ECO8A/286-491NTF-WALSDSMCS------------EATPW..VNGAYLPDHAALQT-Y----RVLAP-MAYAKIKNIIERNVTSGLIY..
A3IG07_9BACI/272-473ETM-KALQLKSEI------------EAQRD..SFGFIRPDLSTLQV-A----IHIFP-KVYPTFTDIIQLLGASGLMS..
A3JWH7_9RHOB/273-475EGI-EAFLTASIA------------TAEKS..PSGLLMPNQSMLMS-G----RVHAL-SNLPKMMHMARELCGGQICV..
A3K7D3_9RHOB/280-487NLF-WGLSDAMVK------------SPVPWEGTGGYVLPNVNYGLA-Y----RVFAP-MAYSRIKELIERHVASGLIY..
A3KYZ0_PSEAI/286-491NLF-WSLTDAMYG------------NASEW..HGGAFLPSAEALQA-Y----RVLAP-QAYPEIKKTIEQVVASGLIY..
A3L967_PSEAI/278-482HLL-QALTTAMAR------------DPERN..AAGSAVPRLEYANA-L----RIQVP-QIWKRVRELLEGALGGAPLV..
A4ISN3_GEOTN/277-480ETM-KSHLYRAEH------------NAKPD..RWGTMTPDFAALDA-A----RNWYP-RVYPRLVEIIRILGASGLMA..
A4IT51_GEOTN/280-484EAI-RALLHLAEH------------ELEVL..PSGEVMPGWVPLET-I----RGLLP-KLYPRAVEVLQIIGAGGLLM..
A4X8F7_SALTO/280-485NLF-WGLSDAAAR------------NPVQW..KNGAVLPNLDYGLA-Y----RWFMQ-VGYPRVREIILQDVASGLIF..
A4YFG2_METS5/275-482ALN-EAALYGSVA------------RAQE...LPNIVRPDPYISIS-A----SHFNM-KAVPRANEILRLISAGSSIP..
A4YG29_METS5/261-459EVM-RATALSAAM------------SPVIE...EGVAIPNPVFTNV-G----KLYSN-AHFHDVVRDLIDVSGGIIAT..
A4YGC7_METS5/279-478ETM-YSAGIAASL------------NAVKM.C.DNCWWVNPMHANV-T----KHLVA-RFPSQIAQLSIDLAGGIVGT..
A5D2Y1_PELTS/278-477ETA-RACTIAAAL------------KGREEPAGSGFFQPDDIFGNA-A----KLTIA-DGFWEIMKWVGDIGGGMAVT..
A5UWE2_ROSS1/284-489NLF-WAISDAMAR------------TPIPW..NEGAVLPNLDYGLA-Y----RVFAT-VAYPRIKELIENDVASALIY..
A6GEF7_9DELT/289-490ETI-YATGIAASH------------QGQAT.A.SGAYINDEMLANV-C----KHHVT-RLPFELGRLAQDLAGGLVAT..
A6LV87_CLOB8/280-482ETL-FSCGIACSA------------MGSKT.E.AGNYYIDNLLANV-C----KQNVT-RFPYEICRLAEDIAGGIMVT..
A7GMD9_BACCN/280-482ETV-KAYVTAAEA------------NAKLD..KWGIMTPDFTPLNV-A----RHYYP-KIYPRFSEIMQLLGASGLMA..
A7HU20_PARL1/275-477ELT-RACLKAAED------------GAIDY..GNGVWLPDAQPFAA-L----RASMP-RWMARVSEIIQLIGSHNVFA..
A7IC92_XANP2/275-478AMV-DAFVAAMEA------------KGSF...YGPYFVPDRHTLYA-A----QTLTQ-QLYGKFITSLRELAGGGMIM..
A7IIH3_XANP2/273-475EGI-NAHLTASIA------------LAEKS..PAGLLMPNQSILYA-G----RVLAC-SQLPAMMHATRELIGGQICV..
A7LCL0_RHOER/310-515NLF-WSLTESMAR------------DPEQW..VGDSVIPKLEYGLT-Y----RMFMI-QGYPRIKEIIEQDVASGLIY..
A7YVV2_9MICC/278-479ETC-RAFMIAAEE------------TGFHT..PGGLYKPNNIFIDF-G----RAHYL-EHQHEMVNMLIEFCGRGIVI..
A7Z0Y6_BACA2/169-371ETM-KALLEKSEN------------DAETD..EWGYMRPSVTPLRV-V----SAIFP-DIYPRFTEIIQLIGASGMVT..
A8AA25_IGNH4/298-497EAM-HAGGLAAAW------------EGKKA.A.SGTYYVDQMKANV-T----KQMVT-RFPYEIARLAHDIAGGLIGT..
O29235_ARCFU/271-473ELV-FAAGVAAAH------------YGQKS.P.AGTFIPNEVYANV-G----RRHAG-LNYYKELEILAELSGGLPAA..
O29377_ARCFU/270-461EGA-FAISVGAAV------------KGANH...NGCWLPNFQMANS-G----KVIGV-EGFAKALMNLIDISGGIIGT..
O29914_ARCFU/281-479ETC-WCCSLACSY------------EGFKT.P.SGAYMPNLLLANV-T----KLNIT-RFPYEWSRLAQDIVGGLVAT..
O68231_PHOLU/286-491NLF-WALSDCMWA------------EANRG..KSGAYLPDTQAIQT-Y----RVMAP-TAYTKIKNIIESNVTSGLIY..
O68312_GEOTH/292-497HLF-WSLSEAQVR------------NPEPW..VDDYVLPNLSAGLA-Y----RVFAS-EAYPKIKDLIEKDLASSLIY..
HDVD_CLOAM/279-489ETL-YCCGIACSA------------EGYPT.A.AGNYQIDLLLANV-C----KQNIT-RFPYEIVRLAEDIAGGLMVT..
Q0S9W4_RHOSR/289-494DMF-WGLSDAMAK------------SPEQW..VNGAVQPNLNYGLA-Y----RTFMG-VGYPRVKEIIQQVLGSGLIY..
Q0S9Y3_RHOSR/274-479SGV-RSAVLAAEY------------TAEPD..SAGMWLPGRQALYG-S----MGLQS-EIYPRVIAILRDLVGGGVLQ..
Q0SFU1_RHOSR/275-477ETI-NAHLTAAIS------------LAEPS..PGGLLMPNQSLLYT-G----RVMAL-SQLPAMMHIARELCGGQICI..
Q11FH6_MESSB/285-490HQF-WSFSNAMAY------------NPIPW..SNGAVLPNLEAALC-Y----RTFMS-EAYPKVIDIIRRTVASGLIY..
Q1AUW7_RUBXD/275-476ETI-NAHLTAAVA------------EAQES..PSGLMMPNQSLLYT-G----RVYAL-TNFPAMAHLTRELVGGQLAV..
Q1J3T2_DEIGD/284-486EIM-KALEVAAVA------------GAAVN..ESGVMTPARGPLDA-A----RNYYP-SVYARLPELLQLLGASGIIM..
Q1NCP8_9SPHN/273-476ALV-EGMVHGMEA------------KGKV...RNGYYIPDGHLLYA-S----QVLTQ-QLYSKVITSLRDLAGGGLIM..
Q24N71_DESHY/291-493ELV-FAAGQASAL------------RAVKF.P.NGSWVPDEILTNA-G----RKLAG-QKIYHEYETLADLTGGICAS..
Q2BDF2_9BACI/285-487ESM-KALLEKSEN------------DAIPD..EFGCMRPSIVPLQI-A----SNLFP-ELYPRFCEIIQVIGASGLTS..
Q2EYY8_9PSEU/287-492DVF-WGLSDAMAK------------SPNSW..VGGSVQPNLNYGLA-Y----RTFMG-VGYPRIKEIIQQTLGSGLIY..
Q2J9B2_FRASC/272-471DLV-GYFLDAGEA------------RAETT..DGGLLAPG..NTDA-S----RVWSA-QVAGRAVEIVRRIGSSGVLM..
Q2LR84_SYNAS/278-477ETL-YGCCLASSY------------EGKQQ.P.SGNYFIDTVLANA-S----KIHEG-KEMAEATRLMIDCAGGYVAD..
Q39TI2_GEOMG/281-479ETL-YCGSIACSC------------EGAPT.P.SGAYFVNPLLANT-V----KQNVT-RFIYEIARLSHDISGGCMAT..
Q3ABD4_CARHZ/271-473ELV-YGAGIAAGV------------KAKRA.A.SGTYIPEVVYANV-A----RYHAG-VNVYREFELLAELAGGLPAT..
Q3ACI6_CARHZ/280-482ETI-FSCGVACSC------------LGYKT.S.AGNYMVDRLLANV-C----KQNVT-RMPYEIARLLQDIAGGLFVT..
Q46ML0_CUPPJ/298-502SII-EHALISQEV------------AATTD..ANGVLWPSRTGLYS-I----MALQS-ELNARMVEIIRELSGAGMIT..
Q483J1_COLP3/274-476EGI-DAHLISSIA------------MAEES..PGGLTMPNQSLLYA-G----RVFAC-SQLYEMVNIARELGGGQVCL..
Q53008_BURPI/276-477QAM-LAHLIASEE------------LGFHT..PGGHYKPNILIYDF-G----RALYL-ENFSQMIYELVDLSGRSALI..
Q53VT6_THET8/296-500NLF-WALTEAMAR------------DPMPW..VDGYVLPNLWAGLT-Y----RVLAP-EVYPKIKDIIERDLASALIY..
Q5KY13_GEOKA/276-478EAL-RAMLLAAEL------------QAKPD..RRGTMVPDPAPLYA-A----AFLYP-RLYPRFVDIVQLLGASGLVC..
HPAB_THET8/269-471EAM-RAFWTRAEE------------EAKEN..AYGLLVPDRGALDG-A----RNLYP-RLYPRIREILEQIGASGLIT..
Q5WJM6_BACSK/273-477EAM-RGFVYSAET------------QAQAN..EYEIMVPKLEPLKA-S----ACYFQ-MTYARLIEIIQLLGASHFIS..
Q6F4M8_RHOOP/279-480ETC-KAFAIAAEE------------TGFTT..AGGLFKPNNIYVDL-G----RAHYL-ENIHNAVNQLIEFCGRGVVM..
Q7MZM5_PHOLL/274-477TNI-EGLFRGLIS------------NPDR...HNEYYIPNRLQLYA-C----QVALQ-STYPKVIESIRKLSGGGVIM..
Q7N069_PHOLL/285-490NLF-WSLTDAMWA------------EAKPW..EGNAYLPDTQAIQT-Y----LVMAP-IAYTKIRNIIESNVTSGLIY..
Q7N9R8_PHOLL/291-496NMF-WALSDAMIK------------SPEPW..SGDALLPRYEYGIA-Y----RWFMT-LGYPRVKEIIEQDLGSALIY..
Q7P6F6_FUSNV/282-484ETL-YCAGIACSS------------EGHKT.A.AGSYEIDLLLANV-C----KQNVT-RFPYEIARLAEDIAGGILVT..
Q8EMH2_OCEIH/277-480ENM-KSHLYKAEY------------NAKID..RWGMMTPDFEALNA-A----RNWFP-RVYPRLAEILRVLGASGLMG..
Q8GMG6_STRGL/290-495NLF-WSLSDAAAR------------NPVPW..KNGTLLPNPQAGMA-Y----RWFMQ-IGYPRVLEIVQQDVASGLMY..
Q8ZUN5_PYRAE/280-480ETM-YSAGLAASW------------EARKLLR.DGGWWVNPMYANV-T----KHLVT-RFPYEISRLAHDIAGGLLGT..
Q97V96_SULSO/277-477ENM-YGSGIAASL------------DAVKLCE.DGCWWVNPMFANV-T----KQLVT-RFPYEITKFSTDIAGGIIGT..
Q9CKT3_PASMU/295-500NLF-WTLTDAMAG------------SSYQW..KNGCQMPSAQAIQT-Y----RVMAP-MAYHTVKKIIEQTVTSGLIY..
Q9F0I2_9PSED/285-488EIL-KGMCIASIE------------TAEMS..DGDILLPGHNALAA-G----RVFAM-EKLPRVLHLLRELCGQGLIL..
Q9K693_BACHD/276-478EIM-NSLLIAAEE------------EAQPN..KHGTMIPDIRKLGA-A----CSYYQ-KTYPRLVDALQQIGASGFIS..
Q9LAG3_BACTR/276-479NMF-WALSTAMAA------------NCEM...RNGVALPNLQYGAA-Y----RVLAP-MVWPRVKQIFEQVVAGGLIQ..

PF01756

ACOX2_MOUSE/492-677EPEIQRVLQNLCD---LY.ALNGILTNSGDFLHDGFL..SGAQVDMAR----T.AFL.DLLPLIRKDAILLTDAFDFSDH
ACOX1_HUMAN/476-660DKAIQAVLRSLCL---LY.SLYGISQNAGDFLQGSIM..TEPQITQVN----Q.RVK.ELLTLIRSDAVALVDAFDFQDV
O62137_CAEEL/476-659DIPVKEVLTDLLH---LH.VNYELLDVATYALEF..M..SFTQLDYVR----D.QLY.LYLEKIRPNAVSLVDSFQISDM
ACOX_DEBHA/507-686SKQLVPYLESVAK---LYSATIVLEKFAGDFLAQGVF..PPKLNGELN----SKHIP.ELCKEIRPNVIALTDSFQQSDM
Q6BRD8_DEBHA/507-686DESTKPMLKDVAK---TYAYTSILENFSAELLSLNVT..SPKFINRLK----SSVIP.TYLKKLRNQAITLTDSFQQPDM
Q7Q3S7_ANOGA/519-705NADLKPVLFRVYL---IY.GMWCLDRHMTTFYAGSFA.KGSAFADAVR----G.TLL.RMCGELKDSAVAIADALAPPDW
Q7PZ92_ANOGA/485-674SPELAKVLRTIYH---LY.AYDEALKSLGDLLRFTTI..SESDINRLQ----A.KLE.DALTELRPNAVGIVDSFDLPDD
Q7QHJ6_ANOGA/523-708QGPERNYLTRLAQ---LY.GATLLLKHMATLQSAGYL..TVDALPLVQ----E.SIL.RLLPIVKQDAVAMIDSLAPPDF
ACOX4_CANMA/512-689HKELVPFLNTIGR---LYSATVVLDKFAGVFLTFNVA..SPQAITDLA----STQIP.KLCAEVRPNVVAYTDSFQQSDM
ACOX5_CANTR/470-642.PEWSEVLRPLGF---LY.ADWILTNFGATFLQYGII..TPDVSRKIS----SEHFP.ALCAKVRPNVVGLTDGFNLTDM
ACOX2_CANTR/526-704KSPARPHLENIIK---LYYVTNILGPFIDEFLRFGVI..SPQVAKYIT----Y.EYPQKLCANIRPYVIGLTDSFQQPDN
ACOX3_HUMAN/507-696PPSLRAVLGRLSA---LY.ALWSLSRHAALLYRGGYF..SGEQAGEVL----ESAVL.ALCSQLKDDAVALVDVIAPPDF
ACOX4_CANTR/512-689QKELAPYLITLGK---LYAATIVLDRFAGVFLTFNVA..STEAITALA----SVQIP.KLCAEVRPNVVAYTDSFQQSDM
ACOX3_YARLI/503-688KADVKPYLINLAN---LF.TLWSIEEDSGLFLREGFL..QPKDIDQVT----E.LVN.HYCKEVRDQVAGYTDAFGLSDW
ACOX1_YARLI/495-678KDDIKPHLLKLAN---LF.ALWSIEEDTGIFLRENIL..TPGDIDLIN----S.LVD.ELCVAVRDQVIGLTDAFGLSDF
ACOX2_YARLI/503-688GEAIKQPLLNLAL---LF.ALWSIEEDSGLFLREGFL..EPKDIDTVT----E.LVN.KYCTTVREEVIGYTDAFNLSDY
ACOX2_RABIT/492-677EPAIQQVLKRLCD---LH.ALHGILTNSGDFLHDGFL..SGAQVDMAR----T.AYM.DLLPLIRKDAILLTDAFDFTDQ
O74938_YARLL/504-688KARVKPHLTVLAN---LF.AVWSIEEDSGLFLREGCF..EPAEMDEIT----A.LVD.ELCCEAREQVIGFTDAFNLSDF
O74937_YARLL/504-688DEKVKPHLIPLAN---LF.ALWSIEEDSALFLAEGYF..EPEDIIEVT----S.LVN.KYCGIVRKNVIGYTDAFNLSDY
Q6P421_XENLA/476-661DVAAHRILSSLCL---FY.ALHGISKNTGDFLQAGLL..TALQVDQVQ----Q.RVK.DLLAVIRPNALALVDAFDYSDT
Q9W3U0_DROME/485-676SPNVSLILGQLVE---LF.VIDTFLRQSGCVLRWNNG.ITGTQLRFVE----R.RFE.ELLAKLRPNAVALVDGFDFHDR
ACOX_PICPA/519-697EEAHKQYLVQIAA---LFATSQIEMNFASYFLQFKAI....DSLEPVA----D.VVS.ELCLSVRDQVIGLTDSFQFSDY
Q6C6T0_YARLI/492-677TEFTKEPLTRLAN---LY.AFWSVEEEAGIFLREGYI..TPQELKYIS----A.EIR.KQLLEVRKDVIGYTDAFNVPDF
ACOX_KLULA/531-716DAYTKGYLWKLYE---LF.SLYFIDQHLGEFLLLKVV..TSDQMSQVL----QPRLL.QLLPEIRKECIALTDAFKLPDA
Q93839_CAEEL/480-663PQDLKIVLFDVAR---LY.AYDIITSSIGAFLEDGYM..SSNQMNEVK----E.GIY.KCLSNMRPNAVGLVDCWDYDDK
ACOX_YEAST/543-727DEITKESMWNVYK---LF.SLYFIDKHSGEFQQFKIF..TPDQISKVV----QPQLL.ALLPIVRKDCIGLTDSFELPDA
O23977_HORVU/455-637GPGVKEQLQKLCS---IY.ALHLLHKHLGDSLSTGCV..TARQGALAN----E.QLG.KLYAQVRPNAVALVDAFDYTDH
Q6BVP3_DEBHA/505-684EKELVPVLDKLAQ---LYSATIILEEFSGIFLTYSVV..STESISILT----DQHIP.KLCKDLRPHVIPLTDSFQLSDM
ACOX_CANGA/543-728CPKTKEQLWNVYK---LF.SLYFIDKHAGEFQQFKIL..SPDQISQVV----QPRLL.KLLPEIRKECISLTDSFKWPDG
Q6NTR5_XENLA/481-666SPEIKKLLKSLCD---LH.ALHGIFTSSGDFLQDGHL..SGHQLEMVT----E.AYL.SLLTLIRRDAVLLVDAFDYADQ
Q7T2B6_DANRE/499-688PAVLRSVLGRLCA---LY.GLWTLTNHMAILYQGGYF.SGGQPVDFIQ----T.AIL.TLCGQLKDDAVALVDVFAPPDF
Q8SYT1_DROME/467-655DSAEKKVLQQVLS---FY.GAHLVTKYSAAFYRGGYFRENSNQLELYE----Q.GIL.ALLPLLKNEAIALVDAIAPTDF
O62140_CAEEL/484-669DITIKEALSDLLH---LH.VNYELLDVATYALEDGFM..SSTQLDYVR----D.QLY.FYLQKIRPNAVSLLDSWEFSDR
Q9W2G8_DROME/486-676SPALNKILENVLE---LF.LVQTVLNNLNDILRFIKL..SDADLRSLQ----K.RLE.DSLAQFRPNAVAICDGFEFHDR
Q95TH0_DROME/505-692EAPYASVLRLLFD---VY.AMWLLEKHMTTFYVGGFA..AGRDFSAAV----RQLLL.DSCLKLKDVAVSVADAISPPDF
Q945U3_SOYBN/477-659GKGVKQQLELLCS---IY.ALFLLHKHLGDFLATGCI..TPKQGSLAN----E.LLR.SLYSQVRPNAIALVDAFNYTDH
ACOX_CAEEL/475-659DEAVHDVLTTLAE---LY.LSYELIEMSADLTANGYL..SESDVQQIR----H.QIY.DSMRKTRRNAVSIVDSFDICDR

PF00441

Q746I1_THET2/271-431....L.E------------EYA..VARWHRES---------------------------LITPIWE---.GPSNI.QALD
O01590_CAEEL/830-981....T.P------------FTP..LASFYVWA---------------------------RSLRIAD---.GPDAV.HLET
O53549_MYCTU/234-393NSPGALL------------RGR..VERMHRAC---------------------------LILTFGG---.GTNEV.QRDI
P96842_MYCTU/231-377..TMP.D------------GEFDEWQRLYLFT---------------------------RADTIYG---.GSNEI.QRNI
Q6L0T7_PICTO/229-380....T.K------------DAG..LERAARGI---------------------------YSYLVGA---EGALNI.MKLI
O33229_MYCTU/236-385....M.R------------EYP..VARAYLDS---------------------------RVQTIYG---.GTTEI.MKEI
Q96ZN0_SULTO/214-364....A.K------------GSK..VERAFRDV---------------------------RLTRIGE---.GTDEV.QLSI
O33331_MYCTU/253-403....M.A------------EYR..VEQLARDA---------------------------KSLMIYA---.GSNEV.QVTH
Q88L96_PSEPK/235-384....L.R------------GNP..VEWIFRAT---------------------------RMMRILT---.GTSEI.QRNT
Q8YTN6_NOSS1/794-944....I.E------------SNI..APQILRDA---------------------------RVLRIFE---.GPTET.LCGF
Q83X47_STRRO/309-460.DHAGPE------------HGA..LDKLVRDL---------------------------PVAGLGH---AGSASC.QAVL
Q979G0_THEVO/234-391....S.K------------DCP..EEWALRGI---------------------------RSFQLAE---.GSREI.MKII
Q72MA7_LEPIC/234-386....M.R------------EVS..VSRFYRDV---------------------------KLGTIGG---.GTSEI.QRSI
Q72U63_LEPIC/236-385....G.R------------DMK..LELFYRDA---------------------------RAARIAD---.GPSEV.HKMV
Q7NQK1_CHRVO/288-439....V.D------------DGP..MARLFREA---------------------------PVNSIWE---.GSGNV.MCLD
Q82KR6_STRAW/219-369....R.R------------GHL..LEHLYREV---------------------------RAPRIYE---.GASEV.QRAV
CAIA_ECOLI/227-376....A.G------------NHR..ISRFWRDL---------------------------RVDRVSG---.GSDEM.QILT
O01502_CAEEL/286-435....L.N------------ENG..ISRAFRDF---------------------------RLFSIGA---.GCDEV.MMRI
Q8CXY8_ECOL6/186-337....H.A------------DYA..VERYYRDA---------------------------KIMEIIE---.GTSQI.HEIQ
Q82SH8_NITEU/238-387....S.D------------LTP..LYGIHRIA---------------------------RTSRILD---.GNDES.LISS
O54143_STRCO/233-381....M.D------------GE...AETLLRDA---------------------------LPARIFS---.GTNEI.QKNN
Q7WBL7_BORPA/220-369....V.K------------PSA..AERCYRDQ---------------------------RITEIYE---.GTSEI.QRVV
Q7S582_NEUCR/378-536....SRG------------GQGGKVERLYRDV---------------------------RAYAIPG---.GSEEI.MLDL
Q7WBV7_BORPA/237-385....M.Q------------GTA..VERMYRDA---------------------------RVHAIGG---.GATEI.MLEE
O53577_MYCTU/309-462....I.E------------TWP..VARLLRDA---------------------------QVNTIWE---.GPDNI.LCLD
Q73V99_MYCPA/567-712....LTD------------GPGALSGRLMMGA---------------------------RGMAIAG---.GTSEV.TRNQ
Q86ZG6_NEUCS/353-511....TQT------------GMGRVIENFNRGY---------------------------KFDAILG---.GAEEV.LGDL
Q8VW50_BACTK/146-297....S.R------------EYP..VERLFREA---------------------------KVLEIIE---.GTSQV.LQPI
Q72US4_LEPIC/278-427....N.T------------EYP..VEKLMRDA---------------------------KIFQIYE---.GTSQI.QRMI
Q6N0G3_RHOPA/236-389EWESE.R------------SQEGARARAWLRT---------------------------KANSIEG---.GTSEV.MLGI
Q7VRY9_BORPE/300-458....I.E------------EWI..NARLVRDA---------------------------QTGLLWE---.GTSNINALDI
Q8X1D8_FUSOX/265-418....A.K------------DMS..FPRLLNEV---------------------------MCYPLFD---GGNIGL.RRRQ
Q89PN2_BRAJA/242-397PQNPAIT------------VARRRFEAIYLQA---------------------------RAETIYA---.GTTEI.QLGI
O07455_RHOPL/228-376......D------------RGP..MEQRLRDV---------------------------LGFQIGD---.GTAQI.MKTI
O86319_MYCTU/229-379....M.A------------ESE..VERQYRDM---------------------------RILGIGG---.GTTEI.LTAL
Q72VB9_LEPIC/297-445....VGD------------FSP..LPRLHNDS---------------------------IINETWE---.GTHLL.....
O29271_ARCFU/236-385....S.L------------DYS..PIRHMANI---------------------------ESVYTYE---.GTDDI.HTLI
Q73V20_MYCPA/256-407....S.R------------HEP..FEHIYRHH---------------------------RRYRITE---.GAEEI.QIRR
Q89GG8_BRAJA/255-404....S.N------------ELR..LEAGYRWA---------------------------RLLRIPD---.GTTEI.QLRT
Q6N940_RHOPA/240-392PAEAE.A------------GGS..FQAMLLGS---------------------------PSMRIAG---.GTDEI.LRNI
O31251_ACIAD/242-393....N.E------------DEL..LEKWARDS---------------------------KILDIFE---.GTQQI.QLLI
Q9KYK3_STRCO/242-392....D.R------------DYV..LQRLWRDI---------------------------QYTYPPA---.GTGEV.QRIR
Q73ZZ3_MYCPA/230-385RSENAPL------------AGK..FERLYRAA---------------------------PLMRFGG---.GANEV.LRDI
Q7MB81_PHOLL/221-359....L.T------------DIW..LQKTITDI---------------------------QGYEWME---.GSLDM.QRLN
O28039_ARCFU/236-386....M.G------------EQH..ISRMYRDV---------------------------RILEIYE---.GTREI.EMEV
Q8ZV35_PYRAE/224-374....S.T------------DSH..VEMLYRDA---------------------------KVTEIYE---.GTNEI.ILNT
P95281_MYCTU/209-359....T.W------------EHD..LHLYYRRA---------------------------KTTEALF---.GSSAR.NRAL
Q72N29_LEPIC/402-551....A.E------------EYA..VSRYFVDA---------------------------RVFSIFE---.GAEEVMALRV
O06164_MYCTU/243-392....M.N------------EYP..VARHYRDS---------------------------KVLEIGE---.GTTEV.QLML
Q6SH30_9BACT/238-395ASPDN.P------------ELYDSMVKQWAFD---------------------------KALTIAG---.GTSEI.QLNI
Q82GQ8_STRAW/233-378..DLG.R------------EWT..LDRL..SS---------------------------LSYTIAA---.GTSQI.QRNI
Q6FZS6_BARQU/342-487....IIA------------QVG..IESFIEGN---------------------------PLSQILC---NGPARI.IRNT
Q73XF8_MYCPA/231-370....TDP------------DLL..FER..QDA---------------------------LAATIYG---.GTSEV.QRNI
Q6N0G4_RHOPA/228-378....T.D------------QFD..IGLFMKRA---------------------------RVLQELL---.GDSAY.HAEA
MBTN_MYCPA/226-373....LVE------------ETP..LGRWWRDM---------------------------KLARVGG---.GTDEV.LWEL
ACAD8_MOUSE/261-411....L.K------------DYA..VQQYMRDS---------------------------RVHQILE---.GSNEV.MRML
P71858_MYCTU/228-380PAEPDTA------------ELLRWLDAQTKRN---------------------------LVITFGG---.GVNEV.MREM
Q7BGH0_9NOCA/228-377....L.P------------EYD..MERYFREA---------------------------KHGMVGG---.GTNEI.QHSI

PF08028

Q7CWU4_AGRT5/248-389----D-L------------ANP--VQRAWRDA---------------------------NAVGRHI----SMNW------
Q7TW64_MYCBO/239-373----S-N------------EAP--IQRFWRDA---------------------------HAGRVHA----ANDP------
Q6SI41_9BACT/253-376----V-K------------DYP--VEKLYRDA---------------------------KIGQIYE----GTSN------
PIGM_RHOST/235-366----R-N------------SAP--IQRYFRDL---------------------------SVLSVHA----FLDI------
Q6B6H3_9ACTO/255-392----H-P------------KYG--FDRFWRNV---------------------------RT...HT----LHDP------
Q8GRC5_BACIU/254-391----H-P------------NYG--FDRFWRNI---------------------------RT...HT----LHDP------
Q9ZGA9_STRCY/246-378----S-T------------ASS--LQRFWRDA---------------------------NAAATHI----GLQF------
Q81JV7_BACAN/243-366----T-K------------DYP--VERFFRDA---------------------------KITQIYE----GTSE------
Q73ZE7_MYCPA/241-374----R-E------------GSR--LERAFRDI---------------------------YTGTQHA----FISE------
Q82KU6_STRAW/243-369----G-G------------PGV--LERSWRDV---------------------------HTVAAHQ----MLRR------
Q6T1C5_STRGL/242-374----S-V------------TSP--LQRDWRDV---------------------------NAASTHV----GLQF------
Q8FWK5_BRUSU/242-365----L-A------------DYP--VERIYRDV---------------------------RVCQIYE----GTSD------
O69789_RHOOP/244-378----R-A------------QDK--LGSILRDI---------------------------RTMSVHS----FLLH------
Q7ML36_VIBVY/236-369----F-S------------DNE--GQRLFRDS---------------------------HMTGAHA----YTDY------
Q89H98_BRAJA/262-395----F-T------------AGV--LQRQFRDA---------------------------HAINSHL----AFNF------
HPAH_ACIBA/268-401----M-D------------NSE--LQRLFRDA---------------------------HMTGAHA----YTDY------
Q82NJ4_STRAW/252-386----H-Q------------EVP--MQRITRDI---------------------------HALCLHS----FVNP------
Q53907_STRCH/232-363----A-Q------------DSP--MQRLWRDV---------------------------HAAGSHI----GLQF------
Q8XTR8_RALSO/249-372----V-S------------EQP--VERLYREI---------------------------RALRIYE----GATE------
Q6SH77_9BACT/226-355----F-N------------GHP--LQNLWHDI---------------------------HIARCHV----ANNP------
Q9ZA38_STRVN/260-385----Q-E------------SVP--LQCHWWHA---------------------------HSVAGHV----VLGF------
Q45413_GEOSE/245-379----F-K------------GDP--VELFTRDL---------------------------LAVAAHP----NSL.------
Q9F0J3_STRAE/257-387----V-E------------GSP--FERGWRDV---------------------------SAAVSHL----VLRF------
Q83VZ8_COMTE/242-374----F-K------------NNP--IERIFRDI---------------------------HQGRTHI----ANNT------
PIGM_RHOER/237-369----R-M------------DKP--LQRFWRDA---------------------------HAGQHHA----IHVP------
Q7WT11_9ACTO/232-362----A-D------------TEP--LQRFWRDV---------------------------NAGAGHS----GLQF------
A3KCV4_RHORH/234-366----H-R------------KTP--MQRFWRDA---------------------------HVGLTHA----IHVP------
Q73YD4_MYCPA/236-369----F-L------------SSP--MQRAKRDV---------------------------DIAAGHV----VFDY------
Q8XT96_RALSO/240-373----Y-Q------------ASP--IQRCLRDI---------------------------HVATQHI----MVSE------
Q89IL9_BRAJA/246-380----Y-D------------SSP--LQRRLRDL---------------------------HVAAQHA----HAQQ------
Q740A3_MYCPA/237-369----R-M------------DKP--LQRYWRDV---------------------------HVGQMHA----IHVP------
Q7D650_MYCTU/242-375----Y-D------------NAP--LQRRFRDA---------------------------FTATAHF----QVNE------
Q7D2V7_AGRT5/257-391----L-A------------EHH--LDRHWRNA---------------------------RT...HT----LHDP------
Q6QF57_9NOCA/130-264----Q-L------------SNP--LQRFWRDA---------------------------HAGLSHA----IHVP------
Q6PV90_9NOCA/243-377----A-R------------TNP--VQRLFRDV---------------------------QASNSHP----LQMA------
Q9JN91_STRCH/232-353----A-E------------DDP--VQRHWRDI---------------------------TTAATHR----ALSI------
O68921_9ACTO/257-379----S-P------------HDP--VQRFWRDV---------------------------QTGASHV----ALSP------

PF03241

YOAI_BACSU/277-479LPTEN.AFD.S........EIREDLDQYLQAT.NTNAEERVKIFRLAWDLTMSSFGTRQTHYERYF---FGDPIRIS.SR
A0AYG2_BURCH/276-479LPSSVRDFENP........DLLRIIEKTQKSP.VCSSEERVKFFKLAWDAVGSEFASRHNQYELFY---AGASFVTK.GH
B8GBV1_CHLAD/298-503LPSHAADLKNP........EVRAYLDRFVRGSNGTSAFDRIKLMKLLWDAIGTEFGGRHELYERNY---AGNHENIR.IE
B1KR96_SHEWM/302-502QPSAK.DLANP........ELRPYLEKYMKGK.GVDVDFKTDLFRLAFELIGDRFGARQELYEIWN---RGDIVRTR.MA
A0JW97_ARTS2/305-510LNSSALDFKTP........EIRPYLDKYIRGSDGVEAVDRVKLMKLLWDSIGTEFGGRHELYERNY---SGNHENVK.AE
A0JY28_ARTS2/280-482LPGEA.DVN.S........EARADIEMYLQGK.TLTGPERVRLFKLAFDASISGFSGRQSLYEYFF---FGDPVRMA.GA
A0LN12_SYNFM/277-476LPSDR.DLAIP........EVGELLKKYLKGVASVPVEDRVKMYRLIEKLVMESA...DTISDIHG---GGSPEAHR.IT
A0LQ99_SYNFM/277-476FPSSK.DFNDP........KYGHLVRKALQASAKFSAETRARAARLSEWLTLGAGVPG....CMHG---GGSPDGAK.LV
A0NTU7_9RHOB/294-499LPSSAKDFQNP........EIDGYLERYVRGSNGVGYKDRIKLMKLLWDATGSEFAGRHELYERNY---AGNHEEVK.LQ
A0RD61_BACAH/302-506SPTGA.DFMNP........EIHDDMQKYYIGREGVSSEERVRLFKLAWDLCGEAFGQRLLQYERYY---SGDPVRKM.GM
A0RTL3_CENSY/278-479LPSEK.DFRNP........ETGPLLKKYLVGRKGVDVENRMRILRLIENMTMGRNAVGYLTESMHG---AGSPQAQR.IQ
A0Z8Z1_9GAMM/280-484LPGPD.EDHNP........ATAGDLAAVLSARPDVPYDKRMEVSRFIEDLTASSTGGWYSVISLHG---GGSPQAMK.RE
A8M0F3_SALAI/290-495VNSSADDFHNP........DIRPYLDTYLRGSGGADAVERVKLMKLLWDAIGTEFGGRHELYERNY---AGNHENVR.VE
A1HPH9_9FIRM/279-481MPSEQ.DLRHP........EIGKVVEKYLRGVASVPTEYRMRVLRLIENLTLGTAAVGYRTESMHG---AGSPQAQR.IM
A1HSG7_9FIRM/280-478MPSES.DLRNP........EIGKYVEKYLKGVSTIPTEYRMRIARLIENMTGGTA....LVESMHG---AGSPQAQK.VF
A8ZWR4_DESOH/278-479LPSEQ.DFNDP........ETGPVLKKYFQTRDGVLPENRARILRLIENITLGTAAVGYLTESMHG---AGSPQAQR.IM
A1R2G2_ARTAT/273-478LPSSIADMTSS........VTRPDMERYVQSP.GVTSEERVKLFKLAWDIIGSEFAGRHQQYEMFY---AGAPFVVRGAY
A1RR46_PYRIL/278-478APSEF.DLKNS........EIKHLVEKYLQGVPEFTAEDRLRMLRLLENVSIS...VGFLIESVHG---AGSPAAQK.IV
A1T9V8_MYCVP/264-468VPSSVRDFDDP........EELAAMDVLMGSD.RFPVAERVKLFKLAWDLVGSEFAGRHVQYERFY---SGAVATVR.AH
A1UG98_MYCSK/231-433LPGEA.DIA.S........DARADIEQYLQGA.TVSGTDRVQLFKLAFDASISGFSSRQALYEYFF---FGDPVRMA.GA
A1UX33_BURMS/272-476TVSGAADLLDP........RVKGLIDAYYRGA.ALEPQQRIKLFKLIWDATGSEFGSRHSVYETHY---SGNFDQIR.LD
A2SIT2_METPP/294-499LPGPD.EDHNP........ATAATLSEVLRANPTVPYDKRIEVARFIEDLTASYQGGWYSVISLHG---GGSPAALK.QE
B7LXQ8_ECO8A/286-491LPSSARDLNNP........QIDQYLAKYVRGSNGMDHVQRIKILKLMWDAIGSEFGGRHELYEINY---SGSQDEIR.LQ
A3IG07_9BACI/272-473IPSAK.AFA.T........D.NGDLDHYLQSF.QDKGEERVKKFRLAWDLTMSNFGTRQTLYERFF---FGDPVRLS.SL
A3JWH7_9RHOB/273-475TPDAA.TFAAA........GTKPWMDKFYTINEQWVADDRRKLLSLARDLLNSDYAGHRLTFQLFA---QSPPFAQL.AA
A3K7D3_9RHOB/280-487LPSSAMDFGSE........EIRPYIDRFVRGSNGMVAVDRVKLLKLLWDAMGSEFGGRHELYESNY---AGNYENIR.IE
A3KYZ0_PSEAI/286-491LPSGVRDLHNP........QLDKYLSTYCRGSGGMGHRERIKILKLLWDAIGSEFGGRHELYEINY---AGSQDEIR.MQ
A3L967_PSEAI/278-482TVSGAADLRDG........EARRLVDSYYRGA.ELEPEQRLKLFKLIWDATGSEFGARHAVYESHY---SGNAEQIR.LD
A4ISN3_GEOTN/277-480IPTEA.DFEHE........EIGDIVRRAMQGA.TVDGYERVQLFRLAWDLTMSAFGARQTHYEYYF---FGDPVRMG.MA
A4IT51_GEOTN/280-484SPTGA.DFANP........ELAADMEKYYAGRIGVGGEERVRLFKLAWDLCGEAFGQRLLQYERFY---TGDPIRKR.AI
A4X8F7_SALTO/280-485VNSGAEDFAHQ........SVGPYLDKYLRGSGGTDAVTRVKVMKLLWDAVGSEFGGRHELYERNY---AGSHENTR.VE
A4YFG2_METS5/275-482IPAGAKDFTNP........EERAYLEKYMAMK.GFDALERVKTFNLLWDVIGSEVGMRYEQYDRFS---RGDPTIRWAQT
A4YG29_METS5/261-459MPSEE.DLTG.........EGREEIMKYLRGA..VDGKERTQVLKIAKELGSSNFTGYILTLMIHA---EGSMEASK.IE
A4YGC7_METS5/279-478APSEW.DLKNP........KLKEYISRYLQGAEDFTAEDRLRMVRLVENVSMG...VAFQIESVHG---AGSPAAQR.IM
A5D2Y1_PELTS/278-477MPSEL.ELENP........ATSGYVRKFMK..ASAPAEKRLRVAKFIQNWCAGLHGAG....TWHG---AGSPMAQK.MA
A5UWE2_ROSS1/284-489LNSHAVDFKTP........EIRGYLDKYLRGSNGYSSLDRVKLMKLLWDAIGSEFGGRHELYERNY---AGNHENIR.LE
A6GEF7_9DELT/289-490LPTGA.DLESE........EVGPLLRKYLATTAEVSVEDRWKILRLIENMTLGRNAVGYLTESLHG---AGSPQAQR.IQ
A6LV87_CLOB8/280-482MPSEA.DFKDE........KIGPYIDKYLRGVNSVSTENRMRILRLIENICLGTAAVGYRTESMHG---AGSPQAQR.IM
A7GMD9_BACCN/280-482IPSES.DFQ.S........ELRPDLDKYLQAA.NGDAYNRVKLYRLAWDVCMSAFGTRQTLYERFF---FGDPVRMA.SA
A7HU20_PARL1/275-477APSRA.QLDDA........GLRPLIDHYLRGAGDVGAEQRARVFRLAWDFVGTGLAGRNLQYERFY---LGSSVRNY.QM
A7IC92_XANP2/275-478LPSSVHDYQNP........ELAALIAKTQQSP.AASAEEKVKFYKLAWDAVGSEFASRHAQYEMFY---AGAGFVVK.NH
A7IIH3_XANP2/273-475TPNVA.AFEAE........GTSDWLKKFYTLNDNWESEDRRKLLAFARDLVSSDYAGHRLAFVQFA---QAPHFNHL.AA
A7LCL0_RHOER/310-515LPSSSLDFKSP........DVRPYLDKYVRGSDGITAVDRVKVMKALWDSIGTEFGGRHELYERNY---SGNHENVK.AE
A7YVV2_9MICC/278-479QPTAR.ELDHP........YIGPKLQEALRGS.EISARDRIKIFRQISERFLTEFGTRHEMFEKFN---GTPPYLIN.IL
A7Z0Y6_BACA2/169-371LPTEK.AFR.S........DIRGDLDQYLQAA.ELNAEDRVKVFRLAWDLTMSPFGTRQTQYERYF---FGDPVRLT.SH
A8AA25_IGNH4/298-497LPSYK.DLMHE........KIGKYLQQYLQCLPDYPAEWRHRVLRLLENITLS...VEFLIESVHG---AGSPEAQR.IW
O29235_ARCFU/271-473LPFAE.DFLSE........EVGPYIRKYIKRRADVPAEHVYRCLFGISNILCSSLGGVQAVAGVHG---GGSPVMEE.IA
O29377_ARCFU/270-461SPSEF.DLE..............MVGDFLRASEKFTAEQRLKIVKFIEFWTTSSH....LVGAFHG---GGSPTAAL.IT
O29914_ARCFU/281-479TPSEL.DYKNP........ETRDLIEKYLKGKADVPTEHRVRMIRLIENLSIGAE....LPESMHG---AGSPAAQK.IM
O68231_PHOLU/286-491LPSSVRDMNNP........EIDKYLARYVRGSNGIDHIERIKILKLMWDAIGSEFGGRHELYEINY---AGSQDEIR.MQ
O68312_GEOTH/292-497LPSNAADFLEP........EIRPYLEKYVRGSNGYDAESRVKLLKLLWDAVGSEFGGRHELYERNY---AGNHENIR.LE
HDVD_CLOAM/279-489MPSEA.DFKSETVVGRDGETIGDFCNKFFAAAPTCTTEERMRVLRFLENICLGASAVGYRTESMHG---AGSPQAQR.IM
Q0S9W4_RHOSR/289-494LNSHASDWANP........AMRPYLDQYVRGSNGVAAIDRVQLLKLLWDAVGTEFGGRHELYERNY---GGDHEAVR.FQ
Q0S9Y3_RHOSR/274-479LPSSVKDLTSP........LTSRDIEHYVQSP.GVPSEERVKLFKLAWDIIGSEFAGRHQQYEMFY---AGAPFVVKGAY
Q0SFU1_RHOSR/275-477TPDAA.TFADP........DVAPWLEKFYSINDNWVADDRRKLLAFARDLLNSDYAGHRLTFQLFA---QSPPFAQL.AA
Q11FH6_MESSB/285-490LPSSAKDFANP........EIDRYLSQYVRGSNDMGHIERIKIMKLLWDATGTEFGGRHALYELNY---AGAPEEVR.LQ
Q1AUW7_RUBXD/275-476TPDAK.TVADP........RIKGYIDKYYSVG.GWSSEDRTKLLYFARDLLNSSYAGHKITFELFA---QSPPFAQN.LA
Q1J3T2_DEIGD/284-486MPGKA.DRE.G........PLGPQIQKYLQAG.NASAEDRLKLFRLAWDMSMSSFGGRQSLYEKFF---FGDPVRMH.SA
Q1NCP8_9SPHN/273-476LPSSIADFVNP........ETAALIGKTQQSP.VANSQDRVKFFKLAWDAIGSEFASRHNQYEMFY---AGATFVTK.GH
Q24N71_DESHY/291-493LPTEE.SFFAP........ETAELCNKYIMRNPDYTAEETHRVMRMMEDKLCDAFESAQAVAGVHG---GGSPLMET.IT
Q2BDF2_9BACI/285-487LPTEK.DFE.S........GIRADLDQYLQAE.GLNAKERVQLFRLAWDLTMSPFGTRQTHYERYF---SGDPVRLA.ST
Q2EYY8_9PSEU/287-492LNSSAADWKNP........DVRPYLDRYLRGSRGIQAIDRVKLLKLLWDAVGTEFAGRHELYERNY---GGDHEGIR.VQ
Q2J9B2_FRASC/272-471QPSER.DLAAA........DLRPYLDRYMRGA.NLPVEEKSRLFRLAWELTADSFGQRQDLYEFVH---RGDITRNR.IN
Q2LR84_SYNAS/278-477LPSDR.DFSNP........EIGDLLKKYLKGVDKIPVEDRVKMFRLIEKMAMESA...DTISDIHG---GGSAEAHR.VT
Q39TI2_GEOMG/281-479MPSEK.DLHHD........EIGKYVEKYFRGVDEAPTEERMRMARLVENMTGGTA....LVESMHG---AGSPQAQR.VM
Q3ABD4_CARHZ/271-473LPPEG.DFYNE........ETKGYLEKYLMRKAGISAENQHRCFRFISDLLVSAQAGVKQVAGVHG---GGSPIMEK.IT
Q3ACI6_CARHZ/280-482MPSWK.DLENG........KVGELLQKYLVGKKGVKVKDRVKLMRLIENLTLGRSAVGYLPESMHG---AGSPQAQR.IM
Q46ML0_CUPPJ/298-502LPSSVEDFRNP........ETAEDVQRYYASS.SSDAKERVALMRMAWDFIGSEFGNRHQQYEKFY---GGASFLVK.QN
Q483J1_COLP3/274-476TPSFD.TFNHK........EIKPWLDKFYSLNDQWSAEDRRKLLAYSRDLCNSDYAGHRLTFQEFA---QSPRFAHL.AS
Q53008_BURPI/276-477FASED.QWNDD........KLNGWFERMNNGP.VGRPHDRVKIGRVIRDLFLTDWGSRLFVFENFN---GTPLQGIR.ML
Q53VT6_THET8/296-500LPSHAKDFQNP........QIRRYLDQYVRG.NGVDAVTRVKIMKALWDAVGTEFGGRHELYERNY---AGNHENIR.IE
Q5KY13_GEOKA/276-478LPTEA.DFS.S........PLRPDLERYLQAA.TLPAEQRVQLFRFAWDLAMSAFGTRQTLYERFF---FGDPARFA.TT
HPAB_THET8/269-471LPSEK.DFK.G........PLGPFLEKFLQGA.ALEAKERVALFRLAWDMTLSGFGARQELYERFF---FGDPVRMY.QT
Q5WJM6_BACSK/273-477APSKK.DFA.S........PIAGRLERFMRGE.YTSAKEKTKLLRLARDLSISEFGSRQMLYERYF---FGDPVRVA.SG
Q6F4M8_RHOOP/279-480SPTKA.DFDHP........FLGPKLEEALRGT.SISARDRVSIFRQISERYLTQWGARHEMFEKFN---GTPLYLVR.LL
Q7MZM5_PHOLL/274-477LPSNYIDLANP........EIRDLIEKTQYST.LLPPIERVKLLKLVWDAIGSEFASRHTQYEMFY---SGAHYVAL.SR
Q7N069_PHOLL/285-490LPSSIRDMNNP........EINKYLEQYVRGSNGIDYVERIKILKLMWDAIGSEFGSRHQLYEINY---AGSQDGVR.LQ
Q7N9R8_PHOLL/291-496INSHARDFSNP........ELSPYLDKYMRGSNGYSAVERVKLMKLIWDSIGTEFAGRHELYERNY---SGNHEAIR.VD
Q7P6F6_FUSNV/282-484LPSEA.DLNSK........EVGHYVEKYLKGVATVPTLTRMKVLRFIENLTLGTAAVGYRTESLHG---AGSPQAQR.IM
Q8EMH2_OCEIH/277-480IPTYD.DFANK........ELGPILNRAMQGK.NVEGFERVQLFRLAWDMTMSSFGSRQTHYEYYF---FGDPVKMG.MA
Q8GMG6_STRGL/290-495VNSSTEDFRNP........ETGPYLEKYLRGSDGAGAVERVKVMKLLWDAVGSDFGGRHELYERNY---SGNHENTR.IE
Q8ZUN5_PYRAE/280-480APSEA.DFKNP........ELRPLLEKYLQGVPEFPAEERLRLLRLLENTSIS...VAYLIESVHG---AGSPQAQR.LS
Q97V96_SULSO/277-477APSEW.DLKNP........KLKPYIEKYLQGMMDYSTEDRLRMVRLLENVGFS...VAFLIESVHG---AGSPEAQR.IA
Q9CKT3_PASMU/295-500LPSHIRDFNNP........EIDQYLEKYVRGSNNIEYRDRIKILKLLWDAIGTEFGGRHELYEINY---AGSQEEVR.LQ
Q9F0I2_9PSED/285-488RFNEKDLAADA........AFGQKFSWFLDTQ.SVGAREKNLLMNLVWDVAASEHSTRALVFEEQH---ALSEPLLR.DN
Q9K693_BACHD/276-478LPSEA.DFH.S........SIKEDLHQYLQAA.NEDAYERVRMFRLAWDLTMSPFGSRQTQYERFF---FGDQVRLS.SS
Q9LAG3_BACTR/276-479LPSSANDFLNP........ELRPYLDRYYRGS.GIGAEERVKLMKMIWDAIGTEFGGRHELYEINY---AGNHENIR.LE

PF01756

ACOX2_MOUSE/492-677CLNSALGC-----------YDGHVYQRLFEWA---------------------------QKSPANT....QENPAYKKY.
ACOX1_HUMAN/476-660TLGSVLGR-----------YDGNVYENLFEWA---------------------------KNSPLNK...AEVHESYKH..
O62137_CAEEL/476-659QLRSVLGR-----------RDGHVYENLFKWA---------------------------KSSPLNN...ADVLPSVEKY.
ACOX_DEBHA/507-686MINSAIGS-----------YDGNIYENYFGVV---------------------------KANNPPS...KTKAPYSGA..
Q6BRD8_DEBHA/507-686VLNSAIGN-----------YNGDIYEDYFKVV---------------------------KQANPPT...QTKAPYSAA..
Q7Q3S7_ANOGA/519-705VLNSVIAK-----------SDGRLYENIQSVF---------------------------MTNPGAL....ERASWWKDV.
Q7PZ92_ANOGA/485-674VLGSPLGA-----------YDGNVYERLYEEA---------------------------KKSPLNQ...EPVNQSFHMY.
Q7QHJ6_ANOGA/523-708VLNSPLGA-----------ADGNVYARMESEL---------------------------MAGQDVT....GRATWWHEI.
ACOX4_CANMA/512-689VINSAIGK-----------YDGDVYENYFDLV---------------------------KQLNPPK...NTKAPYTAA..
ACOX5_CANTR/470-642MTNAAIGR-----------YDGNVYEHYFETV---------------------------KALNPPE...NTKAPYSKA..
ACOX2_CANTR/526-704FINSLIGK-----------YDGNIYTNYLESV---------------------------KDVNDPS...NYKAPYSEA..
ACOX3_HUMAN/507-696VLDSPIGR-----------ADGELYKNLWGAV---------------------------LQESKVL....ERASWWPEFS
ACOX4_CANTR/512-689IVNSAIGR-----------YDGDIYENYFDLV---------------------------KLQNPPS...KTKAPYSDA..
ACOX3_YARLI/503-688FINAPIGN-----------YDGDVYKHYFAKV---------------------------NQQNPAQ...NPRPPYYEST.
ACOX1_YARLI/495-678FINAPIGS-----------YDGNVYEKYFAKV---------------------------NQQNPAT...NPRPPYYEST.
ACOX2_YARLI/503-688FINAPIGC-----------YDGDAYRHYFQKV---------------------------NEQNPAR...DPRPPYYAST.
ACOX2_RABIT/492-677CLNSALGC-----------YDGNVYERLFEWA---------------------------QRSPTNT....QENPAYKKY.
O74938_YARLL/504-688FINAPIGR-----------FDGDAYKHYMDEV---------------------------KAANNPR...NTHAPYYETK.
O74937_YARLL/504-688FINAAIGR-----------YDGDVYKNYFEKV---------------------------KQQYPPE...GGKPHYYEDV.
Q6P421_XENLA/476-661QLGSVLGR-----------YDGNVYENMFEWA---------------------------KKSPLNK...TQVHESFHKY.
Q9W3U0_DROME/485-676VLGSTLGC-----------HDGRVYERLMEEA---------------------------RRNPINQ...EPVNSSFHNH.
ACOX_PICPA/519-697FINSALGS-----------HSGDIYNTYFDTV---------------------------NNLNNPQV.RDGKAAYSEA..
Q6C6T0_YARLI/492-677FLNSAIGR-----------ADGDVYKNYFKVV---------------------------NTQNPPQ...DPRPPYYESV.
ACOX_KLULA/531-716MINAPIGY-----------YDGDIYHNYFNEV---------------------------TNNNKLEPDGAGRPPYYPL..
Q93839_CAEEL/480-663ELKSVLGR-----------RDGNVYPALLQWA---------------------------QNSQLNR...SEVLPAYEKY.
ACOX_YEAST/543-727MLNSPIGY-----------FDGDIYHNYFNEV---------------------------CRNNPVEADGAGKPSYHAL..
O23977_HORVU/455-637YLGSVLGR-----------YDGDVYPALYEEA---------------------------WKDPLNE...TVVPDGYQEH.
Q6BVP3_DEBHA/505-684MINSSLGS-----------YNGDIYENYFKIV---------------------------KEANPPF...NHKAPYSTD..
ACOX_CANGA/543-728MLNAPIGY-----------YDGDIYHNYFNEV---------------------------VKNNPVEKDGAGIPPYHEL..
Q6NTR5_XENLA/481-666QLLSALGS-----------YDGNVYHNLLECA---------------------------QKNPDNK....KVNAVFENY.
Q7T2B6_DANRE/499-688ILNSPIGK-----------SDGELYKNLWSTV---------------------------MQGKNVL....ERPSWWAEFC
Q8SYT1_DROME/467-655ILNSPLGM-----------SDGNVYQHLQRTL---------------------------VSTPGVY....ERPHWWRDV.
O62140_CAEEL/484-669ELRSVLGR-----------RDGHVYENLFKWA---------------------------KESPLNK...TDVLPSVDTY.
Q9W2G8_DROME/486-676VLNSVLGS-----------YDGNVYPRLFDSA---------------------------KRSTMNQ...KPVQTSFETY.
Q95TH0_DROME/505-692ALNSVIAR-----------ADGLLYENLQNEF---------------------------MTNEGAF....QRPSWWRDV.
Q945U3_SOYBN/477-659YLGSVLGR-----------YDGDVYPKLYEEA---------------------------WKDPLND...SVVPDGFQEY.
ACOX_CAEEL/475-659ELRSVLGR-----------RDGHVYENLYKWA---------------------------QMSPLNE....RNLPHVEKY.

PF00441

Q746I1_THET2/271-431LLEAMQ----------------
O01590_CAEEL/830-981IAKIEM----------------
O53549_MYCTU/234-393IGMVAL----------------
P96842_MYCTU/231-377IAERVL----------------
Q6L0T7_PICTO/229-380ISKRIF----------------
O33229_MYCTU/236-385IGRGLG----------------
Q96ZN0_SULTO/214-364INKVLM----------------
O33331_MYCTU/253-403IAKGLL----------------
Q88L96_PSEPK/235-384IAKGVL----------------
Q8YTN6_NOSS1/794-944LGARVL----------------
Q83X47_STRRO/309-460VPQLRG----------------
Q979G0_THEVO/234-391IARETL----------------
Q72MA7_LEPIC/234-386ISASYG----------------
Q72U63_LEPIC/236-385IGRNLI----------------
Q7NQK1_CHRVO/288-439VMRALQ----------------
Q82KR6_STRAW/219-369IAKELY----------------
CAIA_ECOLI/227-376LGRAVL----------------
O01502_CAEEL/286-435IHKAQS----------------
Q8CXY8_ECOL6/186-337IAMNYM----------------
Q82SH8_NITEU/238-387VGRRLI----------------
O54143_STRCO/233-381VARALG----------------
Q7WBL7_BORPA/220-369LARAIK----------------
Q7S582_NEUCR/378-536SIRQSL----------------
Q7WBV7_BORPA/237-385VAKRM.----------------
O53577_MYCTU/309-462VRRGIE----------------
Q73V99_MYCPA/567-712IAERIL----------------
Q86ZG6_NEUCS/353-511GVRQAM----------------
Q8VW50_BACTK/146-297IAQHAL----------------
Q72US4_LEPIC/278-427VSRFLA----------------
Q6N0G3_RHOPA/236-389VAKRIL----------------
Q7VRY9_BORPE/300-458VTRAVA----------------
Q8X1D8_FUSOX/265-418MQRVMA----------------
Q89PN2_BRAJA/242-397IADRIL----------------
O07455_RHOPL/228-376IARHRA----------------
O86319_MYCTU/229-379AAKTLG----------------
Q72VB9_LEPIC/297-445LSEHVL----------------
O29271_ARCFU/236-385LGRAIT----------------
Q73V20_MYCPA/256-407VAQRLF----------------
Q89GG8_BRAJA/255-404IARHVL----------------
Q6N940_RHOPA/240-392IAERVL----------------
O31251_ACIAD/242-393IARREL----------------
Q9KYK3_STRCO/242-392LADAAF----------------
Q73ZZ3_MYCPA/230-385IAQRGH----------------
Q7MB81_PHOLL/221-359ILAGSI----------------
O28039_ARCFU/236-386IARSLL----------------
Q8ZV35_PYRAE/224-374IYKFLK----------------
P95281_MYCTU/209-359LAERAG----------------
Q72N29_LEPIC/402-551IAKSLM----------------
O06164_MYCTU/243-392IARSLG----------------
Q6SH30_9BACT/238-395IAKRAL----------------
Q82GQ8_STRAW/233-378VAERIL----------------
Q6FZS6_BARQU/342-487SANQLV----------------
Q73XF8_MYCPA/231-370IAERLL----------------
Q6N0G4_RHOPA/228-378LAEWKK----------------
MBTN_MYCPA/226-373VAAGMA----------------
ACAD8_MOUSE/261-411ISRNLL----------------
P71858_MYCTU/228-380IAASGL----------------
Q7BGH0_9NOCA/228-377IAKQMG----------------

PF08028

Q7CWU4_AGRT5/248-389----------------------
Q7TW64_MYCBO/239-373----------------------
Q6SI41_9BACT/253-376----------------------
PIGM_RHOST/235-366----------------------
Q6B6H3_9ACTO/255-392----------------------
Q8GRC5_BACIU/254-391----------------------
Q9ZGA9_STRCY/246-378----------------------
Q81JV7_BACAN/243-366----------------------
Q73ZE7_MYCPA/241-374----------------------
Q82KU6_STRAW/243-369----------------------
Q6T1C5_STRGL/242-374----------------------
Q8FWK5_BRUSU/242-365----------------------
O69789_RHOOP/244-378----------------------
Q7ML36_VIBVY/236-369----------------------
Q89H98_BRAJA/262-395----------------------
HPAH_ACIBA/268-401----------------------
Q82NJ4_STRAW/252-386----------------------
Q53907_STRCH/232-363----------------------
Q8XTR8_RALSO/249-372----------------------
Q6SH77_9BACT/226-355----------------------
Q9ZA38_STRVN/260-385----------------------
Q45413_GEOSE/245-379----------------------
Q9F0J3_STRAE/257-387----------------------
Q83VZ8_COMTE/242-374----------------------
PIGM_RHOER/237-369----------------------
Q7WT11_9ACTO/232-362----------------------
A3KCV4_RHORH/234-366----------------------
Q73YD4_MYCPA/236-369----------------------
Q8XT96_RALSO/240-373----------------------
Q89IL9_BRAJA/246-380----------------------
Q740A3_MYCPA/237-369----------------------
Q7D650_MYCTU/242-375----------------------
Q7D2V7_AGRT5/257-391----------------------
Q6QF57_9NOCA/130-264----------------------
Q6PV90_9NOCA/243-377----------------------
Q9JN91_STRCH/232-353----------------------
O68921_9ACTO/257-379----------------------

PF03241

YOAI_BACSU/277-479LYTSYP..KQEQLNMIKTFLHA
A0AYG2_BURCH/276-479AYRTYD..WQRASHLVDSMLGS
B8GBV1_CHLAD/298-503TLGAAM..AMGVTANLKAFAER
B1KR96_SHEWM/302-502LCKSYP.DLNNCEEEIKDLIKE
A0JW97_ARTS2/305-510ILFAAQ..AQGTTDYMKGFADQ
A0JY28_ARTS2/280-482LVNSYD..REPVRARVREFLNR
A0LN12_SYNFM/277-476ILRESN..LKAKKDAAKRLAGI
A0LQ99_SYNFM/277-476VRAFTP..VNEFADYARKIAGI
A0NTU7_9RHOB/294-499LPAIAK..RDGSMDQMLSLVDQ
A0RD61_BACAH/302-506FYNAYK..KQQTFSLVNNALQS
A0RTL3_CENSY/278-479IQRQMQ..LGYKMNLAKNLAGI
A0Z8Z1_9GAMM/280-484IYRRYP..VEERKALVERLLDR
A8M0F3_SALAI/290-495LFNAQT..LGGEVDDYKAFVDE
A1HPH9_9FIRM/279-481ISRQSN..LEHKKELAKAIAGI
A1HSG7_9FIRM/280-478YSKLSN..LEHKKRCALDIAGV
A8ZWR4_DESOH/278-479ISRLAN..MEEKKKKAKALCGI
A1R2G2_ARTAT/273-478TYRNYG..YDALVAELDTFLGS
A1RR46_PYRIL/278-478FSRLYD..FQGAETIARRLARM
A1T9V8_MYCVP/264-468AHRFYP..FADAEALVGDFLAS
A1UG98_MYCSK/231-433LVNGYD..RDPARERIRKLLNE
A1UX33_BURMS/272-476SLTWAT..RSGQLAGCEAFARQ
A2SIT2_METPP/294-499IWRNYP..VGSKVELVERLLDR
B7LXQ8_ECO8A/286-491CLRQAQ..SSGNMDKMMAMVDR
A3IG07_9BACI/272-473LYQSYK..RDHLVQRVEDFLKN
A3JWH7_9RHOB/273-475VYRNFD..WGGPLDFAHKAAGL
A3K7D3_9RHOB/280-487TMLTAQ..ATGEMEMMQNLVEE
A3KYZ0_PSEAI/286-491ALRQAI..GSGAMKGMLGMVEQ
A3L967_PSEAI/278-482SLAWAS..RRGHLAYCEAMVQR
A4ISN3_GEOTN/277-480YFDGYE..KESYKQFVQEFLRT
A4IT51_GEOTN/280-484FYNNIK..RERTLVMVDEALRM
A4X8F7_SALTO/280-485LLSAQL..ADGQLDQHKAFVDR
A4YFG2_METS5/275-482YTEVFRDRRNEFVKLVKEILDQ
A4YG29_METS5/261-459LYRGYD..FSDSEKLVKSLLNR
A4YGC7_METS5/279-478FSRLYD..LNFAQEVAKKLAGR
A5D2Y1_PELTS/278-477LYALAD..LEKKKALARNLAGL
A5UWE2_ROSS1/284-489VLLTAM..ATGAADRYKGFADQ
A6GEF7_9DELT/289-490IGRQQQ..LDYKKRLARRIAGI
A6LV87_CLOB8/280-482IARQGN..LAAKKKIAKKIARI
A7GMD9_BACCN/280-482LYNGYD..KQVYVDRVKEFLNR
A7HU20_PARL1/275-477AHLFGD..RTRANELVDRFLTE
A7IC92_XANP2/275-478SFRTYD..WAGAERLLDMMLSS
A7IIH3_XANP2/273-475VYKSFD..FEGPLDFVRKTAGL
A7LCL0_RHOER/310-515LLFAAQ..NRGHASSMKGLAEQ
A7YVV2_9MICC/278-479TMQRTE..YQVDGPLTQLARDV
A7Z0Y6_BACA2/169-371LYRSYP..KEEQTAVIKEFLHI
A8AA25_IGNH4/298-497MRRFYP..LEEMEDVALSLAGI
O29235_ARCFU/271-473IWRSYD..FEKKKDIAKYLSGI
O29377_ARCFU/270-461LRFLMD..LSSREEAVKNCIDF
O29914_ARCFU/281-479IARRAN..IDVKKEEAKRVAGI
O68231_PHOLU/286-491CLRHAH..GSGNMKKMMDMVDR
O68312_GEOTH/292-497VLLTAL..NTGDADRFKEFAEQ
HDVD_CLOAM/279-489IARQGN..INAKKELAKAIAGI
Q0S9W4_RHOSR/289-494TLFAYQ..ATGQDLALKGFAEQ
Q0S9Y3_RHOSR/274-479TYRNYD..YDSAVAAVQQFTDG
Q0SFU1_RHOSR/275-477VYRNFD..FDGPLGLVKAAAGL
Q11FH6_MESSB/285-490VLKVAE..RGGRLKEMEALVDR
Q1AUW7_RUBXD/275-476IYNNFD..PEPAREMVRKAANL
Q1J3T2_DEIGD/284-486LYEVYD..KAPYVKRIQAFLKR
Q1NCP8_9SPHN/273-476SFRTFD..WESSTNLVDTMLAS
Q24N71_DESHY/291-493MMSRYD..LEPLKDIAKYLAGF
Q2BDF2_9BACI/285-487LYHTYP..KEDFVRNISEFLQQ
Q2EYY8_9PSEU/287-492TLQAYQ..ANGQAAALKGFAEQ
Q2J9B2_FRASC/272-471LLRR.D.DLGPVTDQIRELITR
Q2LR84_SYNAS/278-477IFRESD..TESKKKAAKRLAGI
Q39TI2_GEOMG/281-479ILRQAN..LGHKVKLAKKLAGI
Q3ABD4_CARHZ/271-473IYGQYN..IEEKKKLAKYLAGI
Q3ACI6_CARHZ/280-482ITRLAD..IEKKKKFALRLAGI
Q46ML0_CUPPJ/298-502VHRHFD..YDRSKKMVESALAL
Q483J1_COLP3/274-476VYHHFD..FDGPIDLVRQAAGL
Q53008_BURPI/276-477TMQRAE..FSGSGPYGKLARQV
Q53VT6_THET8/296-500VLGAME..AAGVNEALRAFVDK
Q5KY13_GEOKA/276-478FYHRYD..REACAQMVRRFLDS
HPAB_THET8/269-471LYNVYN..KEPYKERIRAFLKE
Q5WJM6_BACSK/273-477LYHFADCQKQKYVEWVQTFLKK
Q6F4M8_RHOOP/279-480TMQRTE..YQVDGPLTDLARQV
Q7MZM5_PHOLL/274-477LYDQYD..WDFAKNMSRGILDS
Q7N069_PHOLL/285-490CLRHAY..SSGNMKKMMDLVES
Q7N9R8_PHOLL/291-496VLLASQ..ATGLVDQLKGFAEQ
Q7P6F6_FUSNV/282-484ISRQSN..LEAKKQLVKDILDI
Q8EMH2_OCEIH/277-480YFDNYD..KEPYKAMVDEFLES
Q8GMG6_STRGL/290-495LLLSQT..ASGKLDSYMDFAQA
Q8ZUN5_PYRAE/280-480IQRVYD..FQKVEQIASSLAGI
Q97V96_SULSO/277-477INRVYD..YEYAEKIAKYLSQI
Q9CKT3_PASMU/295-500VLGQST..GNGTLQRCFDLVDK
Q9F0I2_9PSED/285-488LVLDYD..YRESTSLIRRLVGL
Q9K693_BACHD/276-478LYMNYP..KEPFVQQVQSFLKK
Q9LAG3_BACTR/276-479TLKIAD..VTGDSERFKAFVDS

PF01756

ACOX2_MOUSE/492-677.IRPLMQSW-------------
ACOX1_HUMAN/476-660.LKSLQSKL-------------
O62137_CAEEL/476-659.LKPMMEKA-------------
ACOX_DEBHA/507-686.LEAMLNRP-------------
Q6BRD8_DEBHA/507-686.IESMLNRP-------------
Q7Q3S7_ANOGA/519-705.IPSKLRAK-------------
Q7PZ92_ANOGA/485-674.LKPFMKSS-------------
Q7QHJ6_ANOGA/523-708.LTPTSAKL-------------
ACOX4_CANMA/512-689.LEGMLNRP-------------
ACOX5_CANTR/470-642.LEDMLNRP-------------
ACOX2_CANTR/526-704.LEAMLNRS-------------
ACOX3_HUMAN/507-696VNKPVIGSL-------------
ACOX4_CANTR/512-689.LEAMLNRP-------------
ACOX3_YARLI/503-688.LRPFLFRE-------------
ACOX1_YARLI/495-678.LKPFLFRE-------------
ACOX2_YARLI/503-688.LKPFLFRE-------------
ACOX2_RABIT/492-677.IQPLLQSW-------------
O74938_YARLL/504-688.LRPFLFRP-------------
O74937_YARLL/504-688.MKPFLHRE-------------
Q6P421_XENLA/476-661.LKPLQSKL-------------
Q9W3U0_DROME/485-676.LLPMMRGK-------------
ACOX_PICPA/519-697.LEAMLRRD-------------
Q6C6T0_YARLI/492-677.IRPFLFRK-------------
ACOX_KLULA/531-716.LTSMLGRD-------------
Q93839_CAEEL/480-663.LGPMMKDA-------------
ACOX_YEAST/543-727.LSSMLGRG-------------
O23977_HORVU/455-637.LRPLLKQQ-------------
Q6BVP3_DEBHA/505-684.LEAMLNRP-------------
ACOX_CANGA/543-728.LANMLTRG-------------
Q6NTR5_XENLA/481-666.LKPHLQSN-------------
Q7T2B6_DANRE/499-688SDKPVVGSL-------------
Q8SYT1_DROME/467-655TYKDYLKRA-------------
O62140_CAEEL/484-669.LKPMMEKA-------------
Q9W2G8_DROME/486-676.LKPLMKAK-------------
Q95TH0_DROME/505-692.IIPQAQSK-------------
Q945U3_SOYBN/477-659.IRPMLKQQ-------------
ACOX_CAEEL/475-659.LKPMTSKL-------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window