Sequence alignment for CL0088

PF00884

C3LB12_BACAC/143-439-PNI-----IFIMSEAFWDPTKLTNLSFSED--PV...................PN...L---------HRY........
O06776_MYCTU/43-460-PNV-----LLILLDDVGFG....ASSAFGG--PC...................R....T---------STA........
O25301_HELPY/294-587-QHV-----FYIVSESLSSWHFDPKFDAIGL--TS...................AL....---------...........
O34609_NEIME/232-524-RFV-----VLVVGETTRAA....NWGLNGY--SR...................QT...T---------PLLA.......
LTAS2_BACSU/245-536-KNV-----IYVSLESLQSF....IIDYKID--GK...................EV...T---------PFL........
O43113_NEUCS/45-420-PNI-----VFILTDDQ.......DLHLQSL--DY........................L---------PLLK.......
O65931_MYCTU/212-635-PNV-----LIVLIDDAGFG....GPDTFGG--AI...................R....T---------PTL........
O82879_STRMU/460-745-QTV-----IYILSESFSDPDRVQGVNLSRD--VI...................PN...I---------KQI........
O85099_ECOLX/237-530-RTL-----VLVIGESTQRE....RMSLYGY--LR...................ET...T---------PELD.......
YEJM_ECOLI/260-505-QNV-----LLITVDGLNYSRFEKQ......--..........................M---------PAL........
ARS_HEMPU/52-373-PNV-----VLLVADHMGSG....DLTSYGH--PT...................QE...A---------GFI........
ARS_CHLRE/27-385-PNF-----VVIFTDDQ.......DAIQNST--HP...................HY...M---------PSLH.......
ARSA_HUMAN/21-346-PNI-----VLIFADDLGYG....DLGCYGH--PS...................ST...T---------PNL........
ASLA_ECOLI/86-419-PNV-----VVFLLDDVGWM....DVGFNGG--GV...................AVGNPT---------PDI........
EPTA_ECOLI/236-527-NLT-----ILIVGETSRAE....NFSLNGY--PR...................ET...N---------PRLA.......
YIDJ_ECOLI/4-341-PNF-----LFVMTDTQATN....MVGCYSG--KP...................LN...T---------QNI........
ARSB_FELCA/47-366-PHL-----VFVLADDLGWN....DVSFHGS--NI...................R....T---------PHL........
GALNS_HUMAN/31-355-PNI-----LLLLMDDMGWG....DLGVYGE--PS...................RE...T---------PNL........
EPTB_ECOLI/248-538-TYV-----VFIIGETTRWD....HMGIFGY--ER...................NT...T---------PKLA.......
Y1005_HAEIN/211-475-KNY-----ILIIGESMRKD....YMSLYGF--PL...................KT...T---------PFLE.......
GNS_CAPHI/54-391-PNV-----VLVLADDQ.......DEVLGGM--..........................T---------PLKK.......
STS_MOUSE/35-421-PNF-----LLIMADDLGIG....DLGCYGN--KT...................LR...T---------PHL........
ARS_STRPU/67-388-PNV-----ILLLADDMGVG....DLSVYGH--PT...................QE...P---------GFI........
SPHM_HUMAN/23-328-RNA-----LLLLADDGGF.....ESGAYNN--SA...................IA...T---------PHL........
ARS_PSEAE/5-420-PNF-----LVIVADDLGFS....DIGAFGG--EI...................A....T---------PNL........
YHBX_ECO57/223-491-DTY-----VLIVGESVRVD....NMSLYGY--TR...................ST...T---------PQVE.......
CGMA_RHIME/269-561-PDV-----IVLMSESFWDPTRLPKVKLTPD--PM...................PT...I---------REL........
YBIP_ECOLI/217-483-QTY-----VVVIGESARRD....ALGAFGG--HW...................DN...T---------PFAS.......
YDEN_ECOLI/58-408-PNI-----IVLTMDDLGYGQLPFDKGSFDP--KTMENREVVDTYKIGIDKAIEAAQKST---------PTL........
P95059_MYCTU/37-466-PNI-----LYLVWDDVGIA....TWDCFGG--LV...................E....M---------PAM........
P95081_MYCTU/5-389-PDI-----IIVMTDEERAVPPYESAEVLAW--RQ...................RS....---------..LT.......
ARS_VOLCA/26-386-PNF-----VVIFTDDQ.......DGIQNST--HP...................RY...Q---------PKLH.......
Q45087_9BURK/4-384-KNV-----LLIVVDQWRADFIPHLMRAEGR--EP...................FL..KT---------PNL........
Q833K3_ENTFA/256-543-PNI-----VFVMSESFSNPDHLKGLSIIGN--PL...................AD...Y---------QQI........
Q840W2_STRMU/270-555-RTV-----IYILSESFSDPWNVPSVTLSQD--VM...................PN...I---------RQI........
Q8DUS0_STRMU/503-788-QTV-----IYILSESFSDPDRVKGVNLSRD--VI...................PN...I---------KQI........
Q8G592_BIFLO/306-604-STV-----VYVLSESFSDPSRVPGLKTNKD--SM...................PN...I---------RKI........
Q8K804_STRP3/480-765-QTV-----IYLLSESLSDPDRVSNVTVSHD--VL...................PN...I---------KAI........
Q8P1I3_STRP8/480-765-QTV-----IYLLSESLSDPDRVSNVTVSHD--VL...................PN...I---------KAI........
Q8XK47_CLOPE/257-551-PNI-----IIVQLESFMDLHRINGLTFKED--PI...................PT...F---------RKI........
Q984T6_RHILO/281-574-PDI-----IIVMSESFWDPTKLPGVTITPD--PI...................PT...V---------RAL........
Q98EG2_RHILO/158-441-KNL-----VHIFIESAERT....YMNEVEF--GD...................VM...A---------PLLEFDRRGVS
Q9A0F9_STRP1/480-765-QTV-----IYLLSESLSDPDRVSNVTVSHD--VL...................PN...I---------KAI........
Q9AI31_BURML/214-497-PDV-----IVIQSESFFDPRPL.SAAIDSS--IL...................GH...F---------DRVC.......
Q9CKD9_PASMU/287-557-KNI-----VIILEESLGAQ....FIGSLGG--LP...................L....S---------PEF........
Q9CM05_PASMU/231-523-HVT-----VLIIGETTRAK....NWGLNHY--ER...................QT...T---------PLLA.......
Q9HVQ5_PSEAE/238-530-RTL-----VLVIGESTSRK....HMSLYGY--PR...................ET...T---------PQLD.......
Q9HYT4_PSEAE/238-529-SLL-----VFVVGETARAD....HFSLNGY--AR...................ET...N---------PELS.......
Q9I2D3_PSEAE/231-522-SLT-----VLVVGESARAQ....NFGLNGY--AR...................ET...N---------PRLK.......
Q9I4M0_PSEAE/223-501-RNV-----LIVAMEGIPGAYIAANRAAINS--SY...................HEA.PM---------PRL........
Q9JXJ7_NEIMB/214-487-QNI-----VLIMGESESAA....HLKLFGY--GR...................ET...S---------PFLT.......
Q9KKK2_VIBCH/240-530-TLV-----FFVLGETARVQ....NYQYLGY--PR...................DT...N---------AYTA.......
Q9PGC7_XYLFA/245-535-RLL-----VIVVGETARAQ....NWGLNGY--VR...................QT...T---------PQLA.......
Q9RBI1_ACIAD/237-531-QVM-----VLVIGETGRAQ....SFGLNGY--AR...................QT...T---------PALS.......
Q9RMJ0_NEIME/232-495-KNY-----VVVIGESARSD....YMNVYGF--PL...................PD...T---------PFLS.......
Q9X6R2_PSEAI/20-300-ATW-----WWSCWKAFAGH....YVGALGA--PG...................NI...T---------PYF........
Q9ZDJ9_RICPR/218-505-IIG-----VLVIGESARFD....HFGINGY--KR...................NT...T---------PYLK.......
Q9ZJJ5_HELPJ/225-518-SNV-----VLVIGESASRN....FMQLYGY--SV...................PN...N---------PLSSELA..NE
Q9ZN39_HELPJ/222-504-SFV-----VLVIGESARKS....NYALYGY--EK...................PT...T---------PRLS.......

PF01663

ENPP3_MOUSE/161-485---V-----ILFSMDGFRAEYLQTWS.....--..-------------------TL---L---------PNI--------
O29992_ARCFU/4-416---A-----VIVVVDGVSHGVFWRLFK....--.A-------------------GK---L---------PFL--------
O50518_STRCO/58-383---N-----CVFLIDGLGWEQLRAHP.....--..-------------------ED---A---------PFL--------
Q73VT6_MYCPA/42-363---V-----LVLLVDGLGWQLLAQLA.....--..-------------------GD---A---------PLL--------
Q6A8W7_PROAC/44-359---Y-----VFLLVDGMGQENLEHFR.....--..-------------------HL---A---------PTL--------
Q6N507_RHOPA/30-497---L-----ILFIPDGLRAKSVSP.......--..-------------------ET---A---------PAM--------
Q7WNM8_BORBR/6-370---A-----ILIICDSLRRDLVTA.......--..-------------------RT---C---------PTL--------
O58841_PYRHO/4-322---L-----ALISLDGNGIYNL.........--..-------------------KY---M---------PFL--------
O69954_STRCO/13-378---L-----LVLDVVGLTPRLL.........--..-------------------DH---M---------PHL--------
Q7AYA7_9RHIZ/4-370---T-----VVINVVGLTPALLG........--..-------------------PR---T---------PNL--------
Q7NU73_CHRVO/4-375---L-----LLLNVVGLTSRLIG........--..-------------------EF---T---------PRL--------
Q8YZP2_NOSS1/4-370---T-----VILNVVGLTPKLIC........--..-------------------EH---T---------PFL--------
Q7UKE3_RHOBA/4-350---L-----CILNVVGLTPKLL.........--..-------------------RH---A---------PNL--------
Q71ZQ2_LISMF/5-366---L-----FVISLDALGALDLKDT......--..-------------------TD---L---------PVL--------
Q73E52_BACC1/9-380---V-----IILSFDCLSALDFPIL......--..-------------------QK---L---------PHF--------
Q8XKL9_CLOPE/10-374---M-----VVISLDAVSSKDIEIM......--..-------------------KE---L---------PNI--------
Q97LS7_CLOAB/8-378---L-----IVISIDALNAKDFDFI......--..-------------------KE---L---------PNF--------
O45359_CAEEL/26-353---L-----AVVVIDGLAANTFYKF......--..-------------------SH---L---------SVF--------
Q22129_CAEEL/24-374---L-----IVILADGYGATLLNNTK.....--.P-------------------DA---T---------FGI--------
Q981Q5_RHILO/5-379---L-----ISILVDGVSADTFEKHA.....--..-------------------HR---L---------PNM--------
O69013_ZYMMB/50-367---L-----ILISIDGFRADYIKR.......--..-------------------GL---T---------PNL--------
Q9A8S4_CAUCR/74-393---T-----ILVSIDGFRADYLDR.......--..-------------------GD---T---------PVM--------
Q8PIS1_XANAC/48-366---L-----LLISIDGLRADMLDR.......--..-------------------GI---T---------PNL--------
Q9PAB9_XYLFA/40-358---L-----LLILIDGLRADALEH.......--..-------------------GQ---A---------PQL--------
Q7MXP5_PORGI/37-349---V-----VVLSLDGFRPDYTDR.......--..-------------------AR---T---------PAL--------
ENPP2_RAT/165-477---L-----IIFSVDGFRASYMKKGS.....--..-------------------KV---M---------PNI--------
Q7ZXN7_XENLA/166-476---L-----IIFSVDGFRASYMKKGH.....--..-------------------KV---M---------PNI--------
Q6PGY9_DANRE/161-472---V-----IMLSVDGFRASYMKRGG.....--..-------------------TV---I---------PNI--------
ENPP1_RAT/194-520---T-----LLFSLDGFRAEYLHTWG.....--..-------------------GL---L---------PVI--------
Q6VZU9_CNPV/107-431---L-----ILVALDGFRYDYLKKWS.....--..-------------------NY---T---------PAI--------
Q70HC0_FOWPV/120-443---L-----ILIAMNGFRYDYLNKWE.....--..-------------------KY---I---------PTI--------
Q7F5L2_ORYSJ/92-418---V-----ILISSDGFRFGYQHK.......--..-------------------AA---T---------PHI--------
Q9FS13_SPIOL/96-418---V-----ILISSDGFRFGYQFK.......--..-------------------AP---T---------PNI--------
Q9SU83_ARATH/109-435---V-----LLISSDGFRFGYQFK.......--..-------------------TK---L---------PSI--------
Q9SU81_ARATH/60-394---V-----LMISCDGFRFGYQFK.......--..-------------------TD---T---------PNI--------
Q9SU82_ARATH/57-390---V-----LLISCDGFRFGYQFK.......--..-------------------TE---T---------PNI--------
YGK5_SCHPO/76-404---V-----IVISLDGFRADYLYR.......--..-------------------GF---T---------PNL--------
Q6BTN4_DEBHA/173-514---T-----VVISLDGFHPHYINP.......--..-------------------LL---T---------PTL--------
Q6C6J4_YARLI/277-608---T-----LVISLDGFHPHYISP.......--..-------------------EL---T---------PHL--------
Q7SI20_NEUCR/254-584---T-----IIFSLDGFRADFLNR.......--..-------------------GL---T---------PRL--------
NPP1_YEAST/170-545---T-----IVISLDGFHPSLISK.......--..-------------------RN---T---------PFL--------
Q6FKX1_CANGA/187-587---N-----IVISLSGFYPGLISD.......--..-------------------ER---T---------PFI--------
Q757R2_ASHGO/153-497---T-----LLVSIDGFHPSYINN.......--..-------------------ES---T---------PFI--------
Q6CX45_KLULA/136-460---T-----LVISLDGFHPGYISE.......--..-------------------LR---T---------PFL--------
ENPP4_XENLA/30-339---L-----ILLSFDGFRADYLTR.......--..-------------------FP---M---------PNL--------
ENPP4_HUMAN/28-339---L-----LLVSFDGFRADYLKN.......--..-------------------YE---F---------PHL--------
ENPP5_HUMAN/30-342---V-----LLVSFDGFRWDYLYK.......--..-------------------VP---T---------PHF--------
ENPP7_HUMAN/33-356---L-----LLVSFDGFRWNYDQD.......--..-------------------VD---T---------PNL--------
Q6ZM30_DANRE/31-356---L-----LLISFDGFRWDYDRD.......--..-------------------VD---T---------PNL--------
ENPP6_XENLA/26-357---L-----LLFLIDGFRFDYISDGE.....--.L-------------------QH---L---------PGF--------
ENPP6_MOUSE/26-357---L-----LVLLLDGFRSDYISEDA.....--.L-------------------AS---L---------PGF--------
ENPP1_CAEEL/182-494---L-----VILSLDGFAREYVDR.......--..-------------------NI---V---------QTL--------
ENPP2_CAEEL/81-386---L-----VILSFDGFAKEYLER.......--..-------------------RI---V---------KSL--------
Q47910_9FLAO/52-512---V-----VGLVVDQMRWDYLYRYYD....--.R-------------------YS---E---------NGF--------
Q9KJX5_FLAME/32-489---V-----VGLVVDQMRWDYLYRYYS....--.K-------------------YG---E---------GGF--------
Q55320_SYNE7/42-494---V-----VGMVIDQMRWDYLYRFYA....--.R-------------------YG---N---------GGF--------
Q89ZL4_BACTN/29-473---V-----VGLTIDQLRTDYLEAFSS....--.L-------------------YG---E---------RGF--------
Q7MEK0_VIBVY/30-506---V-----LQITVDGLRGDLLDRYKH....--.N-------------------FA---E---------KGF--------
Q84EY0_9GAMM/27-481---V-----VQLVIDQLRGDLIFQHQQ....--.Q-------------------FG---N---------GGF--------
Q60113_ZYMMB/62-511---I-----VAISVDQFSSDLFSEYR.....--.G-------------------RF---R---------SGM--------
Q98IY7_RHILO/32-447---V-----LLISVDGLHALDLANYVA....--.A-------------------NP---K---------SSL--------
Q7NDL2_GLOVI/4-434---T-----LAIGLDGATFTVLDQMVEELPG--LG-------------------LA---M---------PFM--------
Q9UZH6_PYRAB/14-420---V-----FVIGLDSAPPELLFNRF.....--.I-------------------ND---L---------PHI--------
Q9YCR2_AERPE/4-405---L-----LVIGLDSVPPLLIEKFR.....--..-------------------DL---I---------PNL--------
Q9X5S9_STRLA/7-409---V-----AVIGLDSATPQYMFDRF.....--.A-------------------ED---M---------PVF--------
Q9HSF0_HALSA/15-396---V-----AFVGIDGVPFSLIRDHP.....--..-------------------DT---F---------PNL--------
Q9X5S1_STRLA/5-395---A-----LVIGLDGMPRTLLTRLAG....--.D-------------------GT---M---------PHT--------
Q9X5R9_STRLA/7-410---A-----LVIGIDGGTFDTVDPLIE....--.C-------------------GL---L---------PHM--------
Q9X5T4_STRLA/7-389---V-----VVVITEGAAPELLDRWCA....--.Q-------------------GL---L---------PGF--------
Q9YCS9_AERPE/3-432---T-----VLLGLDGCTWSILRPLAE....--.K-------------------GV---M---------HNL--------

PF02995

Q9VSJ3_DROME/115-607-KRI-----KYKSCQKLTPLTQVKFEAKSQK--YLLSIDG.AAFGRYP..VGKQLH---C---------CY.--------
Q19148_CAEEL/75-621-DDN-----IKTEIERDPLLTHHPFDNTCKF--PLPNSYAEDIIPFHLSERMRQLK---C---------EVK--------
Q21671_CAEEL/74-651-NEN-----PLKKCDTSFKPLTKLENSKWGV--TFA.........H.......NLT---C---------RA.--------
Q9VGG4_DROME/77-573-TPM-----PSSACPMIKLMKPQSID.GMNY--LYLIASAKELWKKLGVRRLSDIF---C---------AY.--------
Q9VQH3_DROME/74-555-EPI-----EPVLCRMEQLMVAETIG.DRNY--LVRNIS......RHGILSWRQVS---C---------IY.--------
Q9VAU4_DROME/90-580-HPE-----HFETCSNETALVTPIYDISRQR--YVLFINESLASIILN.SNGGEYN---C---------YY.--------
Q9VKK3_DROME/98-598-KPR-----PYS.CNRALIRTSDTIP...GQ--LHLNLEASELLAYYNISDLSSVN---C---------NY.--------
Q9VIP6_DROME/62-563-HRK-----TLRHCHNDSDMVTSEFDFETHQ--YRLHVHEHLAKPIMNRKGNATLE---C---------EY.--------
Q19486_CAEEL/79-568-SKP-----SPLVCSTMQVQAVKSFNNGILT--FEPQVIK.............NAR---C---------YK.--------
Q9V9Q1_DROME/66-560-RGL-----RRDFCASNLNLTSFS.NCTYNY--LRTEVNMELAKARFGVETLESFK---C---------MY.--------
Q9VF91_DROME/73-581-KPV-----ERINCGEGMDWVMCEKSICFVR--PEIASS............HEDVI---C---------SY.--------
Q9VLG3_DROME/84-577-KPQ-----TLITCSNETDLISTTYNEIIKR--HILHIDDEVAQKLLN.FTDKDYN---C---------FY.--------
Q9V9P7_DROME/68-547-EPV-----NKLRCRMTQLLTAITQD...GS--NFLEAK......RIS....EDLS---C---------RYW--------
O18062_CAEEL/82-553-EYN-----PARNCYKNYVQWTELVN...ST--WRIVKDG..............AN---C---------LA.--------
O62436_CAEEL/78-581-TAL-----QSQKCNIPKLEINGSEVINFFK--THAPLECQKKNSIEDNWVFINDE---A---------IIR--------
Q9W0F7_DROME/16-518-KRR-----QFRECSSDKDLLISEFDSHLRQ--YRIKIDENSAQQHLKKFGNATLK---C---------EY.--------
Q8SY05_DROME/180-657-KKH-----SYIVCDKSRDMITVNYNVTDST--YRLHKNE.............NST---C---------CF.--------

PF01676

DEOB_LACLM/6-406-GRI-----HLVVMDSVGIGAAPD...ADKFFNHD-------------------VE---THEAINDVKSDTI--------
DEOB_GEOSE/6-388-KRV-----FLIVMDSVGIGEAPD...AEKY..ND-------------------KG---A.........DTL--------
DEOB_BACSU/7-389-NRV-----FLIVMDSVGIGEAPD...AADF..ND-------------------EG---A.........HTL--------
DEOB_SHIFL/2-406-KRA-----FIMVLDSFGIGATED...AERF..GD-------------------VG---A.........DTL--------
DEOB_HELPY/3-406-KRV-----VILLLDSFGIGASED...AKDF..GD-------------------LG---A.........NTL--------
YHFW_ECOLI/2-397-ARF-----VVLVIDSFGVGAMKD...VTLVRPQD-------------------AG---A.........NTC--------
APGM2_ARCFU/1-380-MKY-----LLLIPDGMADWEVEELDGRTPL..EV-------------------AE---T.........ENM--------
APGM2_METTH/4-396-MKH-----VILVGDGMADYPLDELDGKTPL..QV-------------------AD---K.........PNM--------
APGM1_ARCFU/1-399-MPV-----LLIVVDGLSDRPIDG...KTPL..SV-------------------AR---K.........PNL--------
APGM1_METJA/4-402-GKC-----VIFIIDGLGDRPNEK..GLTPL..KE-------------------AK---T.........PTM--------
APGM1_METTH/1-400-MKG-----VIMIIDGMADRPLEKLSGRTPL..EA-------------------AS---T.........PNM--------
APGM_PYRHO/5-403-RKG-----LLIILDGLGDRPIKELNGLTPL..EY-------------------AN---T.........PNM--------
APGM_AQUAE/13-398-SKI-----LLIVLDGLGGLPVKE..GKTEL..EL-------------------AK---T.........PNL--------
APGM2_METJA/1-398-MRA-----ILILLDGLGDRASEILNNKTPL..QF-------------------AK---T.........PNL--------
GPMI_PORPU/7-514-HPI-----VLAILDGWGHSNSHQ...GNAI..KI-------------------AK---T.........PTI--------
GPMI_ANTSP/7-506-SPI-----ILMILDGWGHSTNAK...GNAI..HE-------------------AN---T.........PII--------
GPMI_SYNY3/7-511-APV-----VLVILDGWGYRPDTR...ANAI..AQ-------------------AN---T.........PIM--------
GPMI_PSESM/6-504-KPL-----VLIILDGFGHSESHE...GNAI..LA-------------------AK---M.........PVM--------
GPMI_ECOLI/6-508-KPM-----VLVILDGYGYREEQQ...DNAI..FS-------------------AK---T.........PVM--------
GPMI_BACSU/4-506-KPA-----ALIILDGFGLRNETV...GNAV..AL-------------------AK---K.........PNF--------
GPMI_MYCGE/3-500-KKV-----LLAILDGYGISNAIY...GNAV..QN-------------------AN---T.........PML--------
GPMI_MYCPN/3-501-KKV-----LLAILDGYGISNKQH...GNAV..YH-------------------AK---T.........PAL--------
GPMI_HELPY/3-489-QKT-----LLIITDGIGYRKDSD...HNAF..FH-------------------AK---K.........PTY--------
PMGI_MAIZE/20-552-KSV-----AVVVLDGWGEANPDQ...YNCI..HV-------------------AQ---T.........PVM--------
PMGI_TOBAC/20-552-KTV-----AVIVLDGWGEAKPNE...FNAI..HV-------------------AE---T.........PVM--------
PMGI_MESCR/20-552-KTL-----AMVVLDGWGEASANQ...YNCI..HV-------------------AE---T.........PTM--------
PMGI_RICCO/17-549-KTI-----AMVVLDGWGEAKPDQ...YNCI..HV-------------------AE---T.........PTM--------

PF00245

PPBN_MOUSE/51-486AKNL-----VILMGDGMGVSTVTATRILKGQ-----------------------QQ------------------------
PPB4_BACSU/49-459IRNV-----IVMIGDGMGTPYIRAYRSMKNN-----------------------GD------------------------
PPB3_BACSU/43-455IKNV-----IVLIGDGMGVSYTSAYRYLKDN-----------------------KK------------------------
PPBT_BOVIN/51-490AKNV-----IMFLGDGMGVSTVTAARILKGQ-----------------------LH------------------------
PPB_BOMMO/74-515AKNV-----VMFLGDGMSVPTLAAARTLLGQ-----------------------RR------------------------
PPB_YEAST/66-527KKNV-----IFFVTDGMGPASLSMARSFNQH-----------------------VN------------------------
STRK_STRGR/41-448ARSV-----ILLIGDGMGDAEITAARNYSVG-----------------------AA------------------------
PPB1_HUMAN/55-490AKNL-----IIFLGDGMGVSTVTAARILKGQ-----------------------KK------------------------
PPBI_MOUSE/52-486AKNL-----IIFLGDGMGVPTVTATRILKGQ-----------------------LE------------------------
PPB_ECOLI/64-470AKNI-----ILLIGDGMGDSEITAARNYAEG-----------------------AG------------------------

PF08665

Q2RKS0_MOOTA/260-429-AKK-----VLICMDGMGFQEWCCLKQYLAG-------------------------------------------------
O32495_DICNO/401-579-SRA-----ALIVVDGLALDQWVTIRQLLQK-------------------------------------------------
B0K8X1_THEP3/380-556-DRI-----ALLVFDGMSVDNWYLIRRYLNK-------------------------------------------------
Q72AH5_DESVH/438-616-NKV-----CVIISDAMRYEIGDELLSLIRQ-------------------------------------------------
Q4BWC0_CROWT/438-619-KKV-----CVIISDALRYEIGDELVSLIRQ-------------------------------------------------
Q8Q0H3_METMA/497-672-TRV-----AVIISDAMRYEVAVEISEILNK-------------------------------------------------
Q8TNC5_METAC/496-671-SKV-----AVIVSDALRYEAAAELFETLNK-------------------------------------------------
Q3A8U0_CARHZ/461-637-ERV-----FVIISDALRFEAGRELAEMLNT-------------------------------------------------
B1YIB9_EXIS2/462-638-ERV-----FVIVSDAMRYEVGLELIDLLNF-------------------------------------------------
Q5P0R1_AROAE/485-661-KRV-----FVVISDAFRFEAAEELVQQLNS-------------------------------------------------
A4JFG3_BURVG/484-660-KRV-----FVIISDAFRYEAAEELARDLNS-------------------------------------------------
Q2W5M5_MAGSA/475-648-RRV-----FVIISDALRYEAAKELVDVLNG-------------------------------------------------
Q8RL18_PRORE/500-676-KRV-----FVIISDALRFEIANELGAIINN-------------------------------------------------
Q8ZK15_SALTY/474-650-KRV-----FVIISDALRYEVAEELGNQINT-------------------------------------------------
Q7MVV4_PORGI/231-425-EKV-----FFILIDNFRQDQWESVKSMLSE-------------------------------------------------
Q53943_STRCH/527-704-RRT-----LMLVLDGMSAAIANELGEELR.-------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480AKAV-----IMLFMEG-GPGQMDTFDPKPELDRLHVTE.......SKRTEGLATGK-------------RFYVGSP...F
Q7UHL2_RHOBA/84-501AKRV-----IWLFMHG-GPSHVDLFDPKPALTKYSGQP..LPESFGNVMTRRDVKK-------------NPLLAPI...R
Q7UN58_RHOBA/63-468AKRV-----IFLFMHG-GPSHVDTFDYKPMLIRDNGKDLPFE......LPPQISAK-------------PTLLASP...W
Q98BS1_RHILO/39-404DPRL-----IVIVLRG-ALDGLSAVGPVGDPDYAGLHGDI................-------------...........
Q7UHK7_RHOBA/71-478VKSV-----IWLFMEG-APSAVDMFDRKPELDKRDGDTTDIQAFFGNP........-------------GPLMKSP...F
Q7UKW9_RHOBA/100-522AKRI-----IYLFQSG-GPAQQDLFDHKPMLEQMHGRELPPEVRGEQRLTGMSVNQ-------------SSLPVAASK.F
Q8P3X8_XANCP/29-384SARM-----LVVFLRG-GYDSNNLLVPHGSDFYYQARPTL................-------------...........
Q7UZ35_RHOBA/49-467AKTV-----IHLCMAG-GPSHVESLDPKPELDKINDQPFPASMTDGQQLAQLQGSK-------------LVARGSF...C
Q7UFP1_RHOBA/49-464IKRV-----IHLCMAG-GPSHLETFDYKPELARLDGQPMPESLTKGQPIAQLQN..-------------KALRVMGPQ.H
Q7MLK9_VIBVY/33-420YKAL-----VCVFLFG-GNDGFNMLVPTSDAHYDEYARAR................-------------...........
Q7US09_RHOBA/66-482AKSV-----IFLFMDG-GPSHLDTFDPKPELERLAGKP..IPESFGRVLTAMGEFD-------------SPILPTQ...R
Q7VYL6_BORPE/29-381DTRL-----LVVFMRG-AYDAASLLVPTTSEFYYESRPHI................-------------...........
Q7UDW2_RHOBA/77-502VKRV-----IYLHMVG-APSQLELFDYKPDLKELDGKECPQSFLEGKRFAFINGTP-------------RMLGPQ....Y
Q87HJ3_VIBPA/35-425FRAL-----ICVYLAG-GNDAINTILPLSDFHYNQYANVR................-------------...........
Q7UM62_RHOBA/63-489AKRV-----IFLHMAG-GPSQLELFDYKPDLQQLDGKDTPASFLEGKRFAFIQGVP-------------KMLGPQ....F
Q7UJ64_RHOBA/59-474AKNC-----IFLMMEG-GPSHIDTFDPKPKLNQLHLQEFVRQ...GQQKSAMESGK-------------RYFVRSP...F
Q7UIF5_RHOBA/61-494AKSV-----IWLFMIG-GASHMETFDPKPQLNKLAGKTIKETPYAKVLESPYLANE-------------RVVAFDPNNGF
Q7UYJ8_RHOBA/60-484AKNV-----LVIFCAG-ACSQLDTFDYKPELIKRHGQPMPGA....ESLVTFQGEQ-------------GMLTKSP...W
Q7MCK0_VIBVY/38-408YKAI-----VVISLGG-GNDGFNTIVATEQYDL.......................-------------...........
Q9A5N3_CAUCR/44-506YKAI-----VCLFLVG-GNDANNLLVATDDASWQRYWSARFRGATPIALMPPGTAP-------------TPIGSVNAVSK
Q7ULC1_RHOBA/52-445ADAC-----ILVWMDG-GPSHYETFDPKPDAPVEIRGSY.................-------------...........
Q7UQT8_RHOBA/50-438AKRA-----IFIELNG-GPSHIDTFDPKPDASDEVRGPF.................-------------...........
Q7UQ29_RHOBA/54-472AKRV-----IHLFMNG-GPSQVDSFDRKPALEEFDGKSAPMANLKTERPT......-------------GNVMRSP...Y
Q7UGB9_RHOBA/69-492AKSV-----IYIHMVG-APSHLDLFDYKPVLQERSGQLCPDEFFNGKQLAFIREQP-------------KLFGTPTDQAF
Q7UPP6_RHOBA/56-434AKHI-----IYLFMDG-AMSHLDTFDPKEGVEEAGET...................-------------...........
Q7UI66_RHOBA/46-421RKSA-----ILLWMGG-GPATIDIWDLKPGAPTGGP....................-------------...........
Q7UVE3_RHOBA/81-505AKRV-----IFLTQSG-GPSQIELFDHKPELPKLAGTELPDSVRQGQRLTGMTKNQ-------------KQLILPAIT..
Q7UW70_RHOBA/70-497AKSI-----IMVYLQG-GPSHLDLWDPKENVPDNVKSQF.................-------------...........
Q7UKM6_RHOBA/69-495AKRV-----IYLFQSG-GPSHIDLFDHKEELEQLHGTNLPDSIRGGQRLTGMTSRQ-------------SQFPVVKPL.W
Q7UTL9_RHOBA/100-490AEHV-----ISIWLGG-GMGQIDTFDPKRMGDQKARKPGSLY..............-------------...........
Q7UGF5_RHOBA/94-499RKSC-----IMIFNLG-APSQMDTFDPKPNAPVEVRGP..................-------------...........
Q9A6V4_CAUCR/38-393RKKL-----VIVICRG-GMDGLSVSPPVGDANYAALRGSI................-------------...........
Q7UYC8_RHOBA/101-527AKRV-----IFLFMAG-APSQIDLFDYKPELVKQFNQPLPPSVSQGQRVTAMTRGK-------------EQLIVPSR..F
Q7UR29_RHOBA/60-444AKSV-----IHIYLPG-GMAQQESWDPKPYSPMEYRGD..................-------------...........
Q7UYM7_RHOBA/45-446RRHC-----ILLWMSG-GPTQTDTFDMKPNHENGGEF...................-------------...........
Q7UV65_RHOBA/50-468AKRV-----IFLFMKG-GPSHMDTFDYKPQLQKDDGKP..LP..FEKPRVQFAPT.-------------SNLLASP...W
Q7UJ54_RHOBA/70-497AKRV-----IFLFMAG-APSQMDLFDYKPELAKQFKQPLPPSVSNGQRVTAMTRGT-------------KQIIAPSM..F
Q7UJ36_RHOBA/99-512IKNV-----ILLFMGG-GPSQFEMFDYKPELERLDGTLPPAELLDGYRAAFINPNS-------------KLLGPK....F
Q7NT93_CHRVO/33-383KRLL-----VLVELKG-GNDGLNTVVPYASADYYRLRPGI................-------------...........
Q7UEK9_RHOBA/80-501AKSV-----IVVFCSG-ALSHVDTFDFKPELERRHGQPMPGN....ENLVSFQGPN-------------GNLTRPL...W
Q7UQW1_RHOBA/70-487AKNV-----IFLYMDG-GPSQIDTFDPKPLLTKMDGRE..PGDLFRVEPTQFNNN.-------------GKVLGSP...W
Q7UPF7_RHOBA/65-448PKSV-----ILLWMEG-GPSQLETFDPHPGTKFGGDV...................-------------...........
Q7UYR5_RHOBA/95-521AKRA-----IYLFMSG-APSQMDMWDHKPQMADWFDKDLPESIRQGQRLTTMTSGQ-------------SRFPIAPSI.Y
Q7UWA1_RHOBA/72-492AKTV-----IFLFMYG-GPSHIDTFDHKPAMKGMDGKTVDVK.TFGRGGHKAG...-------------GRIVEPR...W
Q89DL5_BRAJA/42-392DPRL-----IVVILRG-ALDGLSTVAPVGDPDYAGLHGSI................-------------...........
Q7URV7_RHOBA/77-499AKQV-----LVIFCPG-AVSHVDTFDYKPALTKLHGQKPPGI.....PAVTFEGPT-------------GNIAKPF...W
Q7MDY0_VIBVY/67-457FKAL-----VCIYLAG-GNDAINTVLAKDNEHYLQYKNVR................-------------...........
Q7UH70_RHOBA/75-488AKRV-----IHLFANG-GPSQIDTFDPKPMLAKMHGKTLDDKLKNNRRLGGVAHQS-------------P.........F
Q7UVE1_RHOBA/82-507VKRV-----IFLHMIG-APSQLELFDYKPELKRLDGKDCPQSFLEGKRFAFIQGTP-------------KMLGPQ....Y
Q7UQ53_RHOBA/45-480AKRV-----VQLFMAG-AASHIDLWDHKPLLEKLHGQQ....SDFGEPVETFQDGL-------------GPWMKSP...F
Q7UP10_RHOBA/69-492AKRV-----IFLFQSG-APSQLDLFDYKPLLNQKHGTELPDEIRGGQRLTGMSGNQ-------------SSLPLVGSP.F

PF04185

PHOX_KLULA/65-312FKRF-----FIIFLENTDYDKAAG....................................--------------------
Q9S816_ARATH/13-380IKTI-----VVLVQENRSFDHTLGWFKELNREIDGVMKS.DQKFNPGFSSDLNSHNVVFG--------------------
Q9SRQ6_ARATH/16-381IKTI-----VVLVQENRSFDHMLGWFKELNPEIDGVSES.EPRSNPLSTSDPNSAQIFFG--------------------
Q47936_FRANO/55-471IKHV-----VIIFQENNSFDRYFGMYPNAKNPEGE........................P--------------------
Q97V43_SULSO/27-365IRHV-----IIIIEENHSFDNLFGTYPFGYPPILN......................NIT--------------------
Q9LML5_ARATH/38-396IKTI-----VVVVMENRSFDHILGWLKSTRPEIDGLTG...KESNPLNVSDPNSKKIFVS--------------------
PHLB_MYCTU/52-435IEHI-----VLLMQENRSFDHYFGTLSDTRG...........................FD--------------------
Q9A412_CAUCR/40-437VEHV-----VILMQENRSFDHYFGTLNGVRG.................FGDRFPIPVRDA--------------------
PHLC_PSEAE/51-437VQHV-----VILMQENRSFDHYFGHLNGVRG.................FNDPRALKRQDG--------------------
PHLD_MYCTU/50-429IEHF-----VFFMQENRSFDHYFGTLSGTDG.FNTVSP......................--------------------
Q9SMN8_ARATH/1-336MKNS-----V.....NPTINGVTGQECNPVPNSTQT....................ICFT--------------------
O53361_MYCTU/50-282FAHV-----VIVVEENRSQAAIIGNKSAP...............................--------------------
O81020_ARATH/27-389IKTI-----VVVVMENRSFDHMLGWMKKLNPEINGVDG...SESNPVSVSDPSSRKIKFG--------------------
Q9KH04_BURML/84-547VRTI-----VVIYAENRSFANLFGDFPGVQQPLGAVSPERYAQLDRDGKTPLATLPKIWG--------------------
PHLN_PSEAE/48-422VEHV-----VILMQENRSFDHYFGTLKGVRG.................FGDRMAIPLPDG--------------------
PHLN_BURPS/47-438VEHI-----VILMQENRSFDHYFGKLRGVRG.................FGDPRPLALQNG--------------------
Q983N8_RHILO/60-507IETV-----VVIFAENRAFDNLYGHFPGAEGIDKASQE.......SLQQRDRDGSVLSEL--------------------
PHLA_MYCTU/51-431IEHI-----VLLMQENRSFDHYFGTLSSTNG.FNAASP......................--------------------
Q98ES1_RHILO/58-274YDHV-----VVVIMENHTFEQI......................................--------------------
PHLC_MYCTU/52-433IEHI-----VLCLQENRSFDHYFGTLSAVDG.............................--------------------

PF14707

F1QB82_DANRE/433-568SEHE.....LLFHYCNAE.............-------------------------------------------------
F1QQ07_DANRE/367-495SKRQ.....TMFYYPTDPSV........KYG-------------------------------------------------
ARSA_HUMAN/368-502SPRQ.....SLFFYPSYPDE........VRG-------------------------------------------------
F2UD41_SALS5/491-612GARD.....YYFYWAANVAN........MSD-------------------------------------------------
F1QFT2_DANRE/220-353LIDR.....PIFYYRGNQ.............-------------------------------------------------
ARSH_HUMAN/418-551SDHE.....FLFHYCGVY.............-------------------------------------------------
ARSG_CANFA/402-522GHRV.....LFHPNSGAAGE........FGA-------------------------------------------------
A8XD87_CAEBR/394-528GKAR.....PIIYYCNT.............H-------------------------------------------------
ARSG_MOUSE/402-522GHRV.....LFHPNSGAAGE........YGA-------------------------------------------------
A0YAF7_9GAMM/381-478NERK.....NIFYYHGD.............K-------------------------------------------------
C3YQ76_BRAFL/419-552TDHR.....FLIHYCGST.............-------------------------------------------------
Q5XG10_XENLA/375-508ETER.....PIFYYRGNE.............-------------------------------------------------
A7V8P9_BACUN/356-447SSRD.....EMYYWRGSH.............-------------------------------------------------
ARS_HEMPU/396-526SPHS.....SFFYYCKDN.............-------------------------------------------------
Q4RYA1_TETNG/304-429SEHE.....FLFHYCNSY.............-------------------------------------------------
F2UCT8_SALS5/90-221SQHD.....CLFIYKGTTGAACPRQHPNCPG-------------------------------------------------
C3YZM0_BRAFL/417-549TEHE.....FLIHYCGQS.............-------------------------------------------------
A7SK49_NEMVE/435-563SAHE.....FMYHYCGKD.............-------------------------------------------------
GALNS_CANFA/377-510LTDR.....PIFYYRGDT.............-------------------------------------------------
Q6GMA1_XENLA/439-573SEHE.....FLYHYCGPH.............-------------------------------------------------
A9VBN0_MONBE/428-544DERI.....LFFPEDGN..............-------------------------------------------------
C3ZST4_BRAFL/433-562SPHD.....FLFHYCADY.............-------------------------------------------------
A6QLR7_BOVIN/402-522GHRV.....LFHPNSGAAGE........DGA-------------------------------------------------
STS_HUMAN/437-572SDHE.....FLFHYCNAY.............-------------------------------------------------
Q4TCJ7_TETNG/242-385SEHE.....FMFHYCGIY.............-------------------------------------------------
F1NFQ0_CHICK/445-579SEHK.....FLFHYCGTH.............-------------------------------------------------
E4YGB6_OIKDI/449-582SPHE.....FMFHYCGDN.............-------------------------------------------------
D2HFI2_AILME/436-570SAHE.....FLFHYCGKY.............-------------------------------------------------
E1FX25_LOALO/406-541ALER.....PIFYYCNTH.............-------------------------------------------------
F1R580_DANRE/251-371GHES.....LMHPNSGAAGQ........YGD-------------------------------------------------
O16138_HELER/402-534SPHD.....SFFYYCKDN.............-------------------------------------------------
Q32KK0_RAT/450-603SAHE.....VLLHYCEVF.............-------------------------------------------------
D2HXW7_AILME/434-569SDHE.....FLFHYCNFY.............-------------------------------------------------
D7VQY4_9SPHI/353-442KGRD.....EFFYFGLDH............Q-------------------------------------------------
Q6DJK3_XENLA/433-566SSHD.....FMFHYCTDQ.............-------------------------------------------------
Q32KK2_RAT/368-502SPRN.....SVFFYPPFPDE........IHG-------------------------------------------------
Q32KI1_CANFA/444-578SDHE.....FLLHYCENF.............-------------------------------------------------
E4XNY3_OIKDI/402-533SPSG.....THFFYRGDT.............-------------------------------------------------
C3ZQB5_BRAFL/418-551TSKSPPSPRTLFHYCSNR.............-------------------------------------------------
E6ZGQ8_DICLA/413-534GHEF.....LFHPNSGAAGK........FGD-------------------------------------------------
A9UXW0_MONBE/287-431VRNR.....TMWHYCGHN.............-------------------------------------------------
Q1YP24_9GAMM/409-501SPRT.....SIPFYSGS.............E-------------------------------------------------
ARSE_HUMAN/448-582SDHE.....FLMHYCERF.............-------------------------------------------------
F1KQC6_ASCSU/1702-1837GVRR.....PIFYYCNEH.............-------------------------------------------------
F0Y2N2_AURAN/404-544SARDEA.GDCLFFFGGPHGA.........DA-------------------------------------------------
Q4S4L1_TETNG/407-528GHEF.....LFHPNSGAAGT........FGY-------------------------------------------------
Q7ZWB8_DANRE/433-548SEHE.....FLFHYCNAE.............-------------------------------------------------
A3XMW9_LEEBM/382-476SPRE.....TMFYYRGDE.............-------------------------------------------------
C3YBU1_BRAFL/392-524SPHD.....FLFHYCDEY.............-------------------------------------------------
Q4RJR3_TETNG/343-474SKRE.....AMMFYPTDPSE........KNG-------------------------------------------------
ARS_STRPU/411-541SPHD.....DFFYYCKDT.............-------------------------------------------------
F2UKF0_SALS5/383-527RPDP.....IIWHYCGHN.............-------------------------------------------------
Q0C069_HYPNA/397-504SPRE.....TLYYYRFTD.............-------------------------------------------------
ARSF_HUMAN/440-574SEHE.....FLFHYCGSY.............-------------------------------------------------
A4AN36_MARSH/378-468SPRQ.....HILYYRGTE.............-------------------------------------------------
F1NW57_CHICK/376-509LIDR.....PIFYYRGNE.............-------------------------------------------------
C3Y4J9_BRAFL/389-521SPHE.....FLFHYCGTW.............-------------------------------------------------
C1BQY6_9MAXI/368-497NPRE.....TLMYFPGNAQR........RLG-------------------------------------------------
C3ZQC1_BRAFL/339-471TSKLPPSPRTLFHYCSDR.............-------------------------------------------------
Q4SI19_TETNG/404-542VLDRRVHVWPIFYYRGNE.............-------------------------------------------------
STS_MOUSE/445-581SEHE.....FLFHYCNAY.............-------------------------------------------------
A4CMB0_ROBBH/401-491SPRK.....EMFYYQGAD.............-------------------------------------------------
STS_RAT/436-573SEHE.....FLFHYCNAY.............-------------------------------------------------
ARSD_HUMAN/451-585SAHE.....FLFHYCGQH.............-------------------------------------------------
B4DQ74_HUMAN/301-421GHRV.....LFHPNSGAAGE........FGA-------------------------------------------------
A5D7J7_BOVIN/445-576SDHE.....FLMHYCESF.............-------------------------------------------------
Q32KI0_CANFA/435-568SEHE.....FLYHYCGAF.............-------------------------------------------------
F1R2X2_DANRE/342-476SQHE.....FMFHYCGMY.............-------------------------------------------------
F2U742_SALS5/410-536QGHD.....CIMFYHNAAAVN......ASGE-------------------------------------------------
A9V957_MONBE/437-571RGHT.....SMFHPSYGEGSP......HFGA-------------------------------------------------
A9UPM8_MONBE/326-452KGHE.....CIMFYHNAVAAN......ASGE-------------------------------------------------
B9QU81_9RHOB/44-158SSRD.....EIIYYEGTD.............-------------------------------------------------
Q6AX40_XENLA/368-500SPRN.....TFHYYPSSIDR........NKG-------------------------------------------------
F1NWF7_CHICK/360-492SPRQ.....TMFFYPPSPDP........LHG-------------------------------------------------
C3Z258_BRAFL/432-564SPHE.....FLFHYCGGH.............-------------------------------------------------
A9V7E7_MONBE/452-571SQHD.....CIFIYKGTP............G-------------------------------------------------
ARSA_BOVIN/368-502SPRH.....TLFFYSAYPDE........VRG-------------------------------------------------
A6CB11_9PLAN/382-473SPRE.....ELAYYRGTK.............-------------------------------------------------
F0SFZ7_PLABD/380-468SPRQ.....DVFYWRSEQ.............-------------------------------------------------
C3Y4X6_BRAFL/434-568SPHD.....FLFHYCGNI.............-------------------------------------------------
C6W2Y6_DYAFD/349-461TPRE.....SFLYYYRKN............N-------------------------------------------------
E1BU03_CHICK/378-498GHKV.....LLHPNSGAAGK........DGA-------------------------------------------------
A7SK50_NEMVE/483-612SPHK.....FMYHYCAKA.............-------------------------------------------------
A1L2N0_XENLA/374-506SPRK.....MFYYYPPSIDP........SRG-------------------------------------------------
C3ZV84_BRAFL/657-790EVDR.....PVFYYRGDE.............-------------------------------------------------
A7SQ82_NEMVE/425-557SPHE.....FLFHYCAKS.............-------------------------------------------------

PF00884

C3LB12_BACAC/143-439.TEN---------F..PGGQTIAP----------TF..G-----G..NT----ANTE-----------------------
O06776_MYCTU/43-460.ELL---------A..GNGLRYNR----------FH..T-----TA.LC----SPTR-----------------------
O25301_HELPY/294-587.QDL---------VKKEHAHMLSA----------FI..E-----SAPRT----VKSL-----------------------
O34609_NEIME/232-524....---------ARGDEIVNFPQ----------VR..S-----CGTST----AHSL-----------------------
LTAS2_BACSU/245-536.NKL---------AHDNETFYFDN----------FFHQT-----GQGKT----SDAE-----------------------
O43113_NEUCS/45-420.KYL---------A..DEGTTYKR----------HY..C-----TTAIC----CPAR-----------------------
O65931_MYCTU/212-635.SRL---------A..QNGLIYNR----------FH..V-----TA.VC----SPTR-----------------------
O82879_STRMU/460-745.KEK---------T..TSGLMHSD----------GY..G-----G..GT----ANME-----------------------
O85099_ECOLX/237-530.ALR---------KTDPGLTVFNN----------VV..A-----SRPYT----IEAL-----------------------
YEJM_ECOLI/260-505.AGF---------A..EQNISFTR----------HM..S-----SGNTT----DNGI-----------------------
ARS_HEMPU/52-373.DKM---------A..AEGLRFTN----------GY..V-----GDAVC----TPSR-----------------------
ARS_CHLRE/27-385.KYI---------R..YPGVELSQ----------YF..V-----TTPVC----CPSR-----------------------
ARSA_HUMAN/21-346.DQL---------A..AGGLRFTD----------FY..V-----PVSLC----TPSR-----------------------
ASLA_ECOLI/86-419.DAV---------A..SQGLILTS----------AY...-----SQPSS----SPTR-----------------------
EPTA_ECOLI/236-527....---------K..DNVVYFPN----------TA..S-----CGTAT----AVSV-----------------------
YIDJ_ECOLI/4-341.DSL---------A..AEGIRFNS----------AY..T-----CSPVC----TPAR-----------------------
ARSB_FELCA/47-366.DEL---------A..AGGVLLDN----------YY...-----TQPLC----TPSR-----------------------
GALNS_HUMAN/31-355.DRM---------A..AEGLLFPN----------FY..S-----ANPLC----SPSR-----------------------
EPTB_ECOLI/248-538....---------.QEKNLAAFRG----------Y...S-----CDTAT----KLSL-----------------------
Y1005_HAEIN/211-475....---------..RVKGTVFEN----------YY..S-----AAPNT----QPSL-----------------------
GNS_CAPHI/54-391.TKA---------LIGEMGMTFSS----------AY..V-----PSALC----CPSR-----------------------
STS_MOUSE/35-421.DRL---------A..REGVKLTQ----------HL..A-----AAPLC----TPSR-----------------------
ARS_STRPU/67-388.DQM---------A..NQGLRFTQ----------GY..S-----GDSVC----TPSR-----------------------
SPHM_HUMAN/23-328.DAL---------A..RRSLLFRN----------AF..T-----SVSSC----SPSR-----------------------
ARS_PSEAE/5-420.DAL---------A..IAGLRLTD----------FH..T-----AS.TC----SPTR-----------------------
YHBX_ECO57/223-491....---------AQRKQIKLFNQ----------AI..S-----GAPYT----ALSV-----------------------
CGMA_RHIME/269-561....---------...QGGNVFSP----------EF..G-----G..MT----ANVE-----------------------
YBIP_ECOLI/217-483....---------..SVNGLIFAD----------YI..A-----ASGST----QKSL-----------------------
YDEN_ECOLI/58-408.LSL---------M..DEGVRFTN----------GY..V-----AHGVS----GPSR-----------------------
P95059_MYCTU/37-466.TRV---------A..ERGVRLSQ----------FH..T-----TA.LC----SPTR-----------------------
P95081_MYCTU/5-389.GRR---------WFDEHGISFTR----------HY..T-----GSLAC----VPSR-----------------------
ARS_VOLCA/26-386.EHI---------R..YPGIELKN----------YF..V-----TTPVC----CPSR-----------------------
Q45087_9BURK/4-384.DRL---------C..REGLTFRN----------HV..T-----TCVPC----GPAR-----------------------
Q833K3_ENTFA/256-543.ADK---------T..YSGQMLSQ----------NY..G-----G..GT----ANIE-----------------------
Q840W2_STRMU/270-555.GRT---------T..TSGLMKSD----------GF..G-----G..GT----ANME-----------------------
Q8DUS0_STRMU/503-788.KEK---------T..TSGLMHSD----------GY..G-----G..GT----ANME-----------------------
Q8G592_BIFLO/306-604.KAG---------T..TSGLMLSS----------GY..G-----G..GT----ANLE-----------------------
Q8K804_STRP3/480-765.KNS---------T..TAGLMQSD----------SY..G-----G..GT----ANME-----------------------
Q8P1I3_STRP8/480-765.KNS---------T..TAGLMQSD----------SY..G-----G..GT----ANME-----------------------
Q8XK47_CLOPE/257-551.SSE---------S..TKGFLKVP----------TY..G-----G..GT----VRSE-----------------------
Q984T6_RHILO/281-574....---------...RSGSMFSP----------EF..G-----G..MT----ANIE-----------------------
Q98EG2_RHILO/158-441ASNM---------V..QLAYTNNS----------ISGMV-----AANCG----TPLL-----------------------
Q9A0F9_STRP1/480-765.KNS---------T..TAGLMQSD----------SY..G-----G..GT----ANME-----------------------
Q9AI31_BURML/214-497.RES---------V..EHGQLAVP----------AW..G-----A..NT----MRSE-----------------------
Q9CKD9_PASMU/287-557.DKL---------A..QEGWLFEN----------LY..A-----TGTRS----VRGI-----------------------
Q9CM05_PASMU/231-523....---------NRGEDVINFQH----------MT..S-----CGTST----AVSV-----------------------
Q9HVQ5_PSEAE/238-530.ALK---------AANRNLTVFNN----------VV..A-----SRPYT----IEVL-----------------------
Q9HYT4_PSEAE/238-529....---------K..QDIVNFTQ----------VR..S-----CGTST----AVSV-----------------------
Q9I2D3_PSEAE/231-522....---------AE.EGLINFSN----------VH..S-----CGTET----AVSV-----------------------
Q9I4M0_PSEAE/223-501.SGW---------A..ERAMTTPD----------YV..L-----HSHQT----IRGL-----------------------
Q9JXJ7_NEIMB/214-487..RL---------SQADFKPIVKQ----------SY..S-----AGFMT----AVSL-----------------------
Q9KKK2_VIBCH/240-530....---------P..FQPIFFKD----------VA..S-----CGTAT----AVSV-----------------------
Q9PGC7_XYLFA/245-535....---------Q..NDVINFPD----------MH..S-----CGTNT----EVSV-----------------------
Q9RBI1_ACIAD/237-531....---------K..LDIINFSQ----------AS..S-----CGTQT----SVSV-----------------------
Q9RMJ0_NEIME/232-495....---------..QTKGLLING----------YQ..S-----TAHAT----NLSL-----------------------
Q9X6R2_PSEAI/20-300.DKL---------S..KEGLLFTQ----------FF..S-----NGTHT----HQGM-----------------------
Q9ZDJ9_RICPR/218-505....---------.TAQNIISFKA----------K...S-----SYNLT----YLSV-----------------------
Q9ZJJ5_HELPJ/225-518RERE---------RESNNLFVFSD----------TI..S-----KEAHT----SDVF-----------------------
Q9ZN39_HELPJ/222-504..KR---------LENHELTLFNA----------T...S-----CATYT----TASL-----------------------

PF01663

ENPP3_MOUSE/161-485-NKL.........K--TCGIHSKY----------.MRAM-----YPTKT----FPNH-----------------------
O29992_ARCFU/4-416-EEI.........S--KESLLIDE----------.CISV-----FPSAT----VSGH-----------------------
O50518_STRCO/58-383-SSLL.......GS--SRGGTGRP----------.ITAG-----YPATT----ATSL-----------------------
Q73VT6_MYCPA/42-363-AAV.........R--AGEVGRLT----------RLDCT-----FPSTT----PTSL-----------------------
Q6A8W7_PROAC/44-359-SEM.........K--NCHD....----------.LTCY-----VPSTT----ATSL-----------------------
Q6N507_RHOPA/30-497-AAL.........R--DQGVNFKN----------.PHSL-----FPTFT----MANG-----------------------
Q7WNM8_BORBR/6-370-TGL.........A--QASTWFSR----------.AGSV-----FPSTT----RVSS-----------------------
O58841_PYRHO/4-322-SEL.........A--EKGDIFT.----------.VDSI-----FPTLT----DLVH-----------------------
O69954_STRCO/13-378-KQL.........G--QSGSRAP.----------.LGTV-----LPAVT----CAAQ-----------------------
Q7AYA7_9RHIZ/4-370-SRL.........A--ANGCQRP.----------.LRTV-----TPAVT----CSAQ-----------------------
Q7NU73_CHRVO/4-375-AEF.........A--RQGFVQP.----------.LRNI-----VPAVT----CSVQ-----------------------
Q8YZP2_NOSS1/4-370-SRW.........S--STGKIAT.----------.VTPV-----LPAVT----CTAQ-----------------------
Q7UKE3_RHOBA/4-350-AAM..........--..GNHRA.----------.WTSP-----VPAVT----CTSQ-----------------------
Q71ZQ2_LISMF/5-366-REL.........I--KTGTHIQE----------.VETI-----YPSLT----YPAH-----------------------
Q73E52_BACC1/9-380-QSL.........I--KKGTVVEK----------.VEPI-----YPSVT----YPSH-----------------------
Q8XKL9_CLOPE/10-374-SKL.........M--KEGSLIKN----------.VETI-----YPSLT----YPAH-----------------------
Q97LS7_CLOAB/8-378-SNI.........I--NNGSYVRE----------.VTGV-----YPSVT----YPSH-----------------------
O45359_CAEEL/26-353-RTF.........E--EEGVWSTK----------.VFPV-----FPTFS----ISNR-----------------------
Q22129_CAEEL/24-374-RHL.........A--TNGVQVDY----------.VTPS-----FPTHT----WPQW-----------------------
Q981Q5_RHILO/5-379-RHL.........A--ERGLRVRR----------.LKSA-----VPATS----VPGR-----------------------
O69013_ZYMMB/50-367-VSL.........A--ENGSYAKV----------.MHPS-----FPSIT----FPNH-----------------------
Q9A8S4_CAUCR/74-393-KAL.........A--ENGARAA.----------.MRPS-----FPSVT----FPNH-----------------------
Q8PIS1_XANAC/48-366-SHL.........A--REGVRARW----------.MAPS-----YPSLT----FPNH-----------------------
Q9PAB9_XYLFA/40-358-ARL.........A--SDGVHALW----------.MTPS-----YPALT----LPNA-----------------------
Q7MXP5_PORGI/37-349-DRM.........A--QEGLSGS.----------.LQPC-----FPSLT----FPNH-----------------------
ENPP2_RAT/165-477-EKL.........R--SCGTHAPY----------.MRPV-----YPTKT----FPNL-----------------------
Q7ZXN7_XENLA/166-476-DKL.........R--SCGTHSPY----------.MRPV-----YPTKT----FPNL-----------------------
Q6PGY9_DANRE/161-472-EKL.........R--SCGTHAPY----------.MRPM-----YPTKT----YPNL-----------------------
ENPP1_RAT/194-520-SKL.........K--NCGTYTKN----------.MRPV-----YPTKT----FPNH-----------------------
Q6VZU9_CNPV/107-431-NEL.........V--LHGVSAP.----------.MRPV-----FPTNT----FPNL-----------------------
Q70HC0_FOWPV/120-443-KDL.........M--EHGVTAP.----------.MRPV-----YPTNT----FPNL-----------------------
Q7F5L2_ORYSJ/92-418-HRL.........I--GNGTSAAT----------GLVPI-----FPTLT----FPNH-----------------------
Q9FS13_SPIOL/96-418-HRL.........I--NNGTSAEL----------GLIPV-----FPTLT----FPNH-----------------------
Q9SU83_ARATH/109-435-HRL.........I--ANGTEAET----------GLIPV-----FPTLT----FPNH-----------------------
Q9SU81_ARATH/60-394-DLL.........I--SGGTEAKH----------GLIPV-----FPTMT----FPNH-----------------------
Q9SU82_ARATH/57-390-DLL.........I--SRGTEAKT----------GLIPV-----FPTMT----FPNH-----------------------
YGK5_SCHPO/76-404-LSL.........A--ERNVHVPF----------.LIPS-----FPSIT----FPNH-----------------------
Q6BTN4_DEBHA/173-514-HEM.........M--LNDYGAPY----------.MIPS-----FPSST----FPNH-----------------------
Q6C6J4_YARLI/277-608-DNL.........M--RKESGAPY----------.MLPS-----FPTST----FPNH-----------------------
Q7SI20_NEUCR/254-584-SSF.........I--KEGVSPLY----------.MLPS-----FPSVT----FPNH-----------------------
NPP1_YEAST/170-545-HDLYEL..KYDGG--MNITSTPF----------.MVPS-----FPTET----FPNH-----------------------
Q6FKX1_CANGA/187-587-SALFKREHNEILK--QNITTSPY----------.MRPQ-----FPLQS----IPNM-----------------------
Q757R2_ASHGO/153-497-NELYS....GTYA--KSGVLTTP----------YMRPS-----FPSET----FPNH-----------------------
Q6CX45_KLULA/136-460-NQLFTP...SNQI--NDTLVAPY----------.MIPS-----FPSQT----FPNH-----------------------
ENPP4_XENLA/30-339-QEF.........M--KEGVEVEE----------.VKNV-----FITKT----FPNH-----------------------
ENPP4_HUMAN/28-339-QNF.........I--KEGVLVEH----------.VKNV-----FITKT----FPNH-----------------------
ENPP5_HUMAN/30-342-HYI.........M--KYGVHVKQ----------.VTNV-----FITKT----YPNH-----------------------
ENPP7_HUMAN/33-356-DAM.........A--RDGVKARY----------.MTPA-----FVTMT----SPCH-----------------------
Q6ZM30_DANRE/31-356-DKM.........A--VDGVKAAY----------.VTPP-----FLTIT----SPTH-----------------------
ENPP6_XENLA/26-357-RHM.........V--ERGVKVDY----------.MTPA-----FPSLS----YPNY-----------------------
ENPP6_MOUSE/26-357-REI.........V--NRGVKVDY----------.LTPD-----FPSLS----YPNY-----------------------
ENPP1_CAEEL/182-494-NHI.........A--DCGVKADK----------.VYPS-----YPSKT----FPNH-----------------------
ENPP2_CAEEL/81-386-ELI.........A--ECGVKADR----------.VYPS-----FPSKT----FPNH-----------------------
Q47910_9FLAO/52-512-KRL.........L--NEGFSSEN----------TLIDY-----VPTYT----AIGH-----------------------
Q9KJX5_FLAME/32-489-KRM.........L--NTGYSLNN----------VHIDY-----VPTVT----AIGH-----------------------
Q55320_SYNE7/42-494-KRL.........I--NEGFSAEN----------TLIPY-----TPTLT----ACGH-----------------------
Q89ZL4_BACTN/29-473-KRL.........W--KEGRVFHN----------AEYTF-----SGVDR----ASAM-----------------------
Q7MEK0_VIBVY/30-506-RYL.........M--DEGVYYTN----------AHYQH-----GNTET----IVGH-----------------------
Q84EY0_9GAMM/27-481-NYL.........L--SHAIDYHN----------THHPH-----ANTTT----CAGH-----------------------
Q60113_ZYMMB/62-511-KQL..........--QNGVVYPM----------AYHSH-----AATET----CPGH-----------------------
Q98IY7_RHILO/32-447-AAL.........A--DTGIFYPN----------.ALAS-----APSDS----FPGL-----------------------
Q7NDL2_GLOVI/4-434-KKI.........F--EQGSRSK.----------.LLST-----PNPLT----PPAW-----------------------
Q9UZH6_PYRAB/14-420-KKL.........L--KKSVYGP.----------.MKTG-----IPAIT----IPMW-----------------------
Q9YCR2_AERPE/4-405-QSL..........--.LNVKGK.----------.LLSG-----HPPIT----VPMW-----------------------
Q9X5S9_STRLA/7-409-TAL.........R--RKSLWGP.----------.MRSI-----DPPIT----MPAW-----------------------
Q9HSF0_HALSA/15-396-HDA.........M--AAGSGGA.----------.IESI-----VPPES----SACW-----------------------
Q9X5S1_STRLA/5-395-AAL.........L--AEGHCAE.----------.LLAP-----VPEIS----STSW-----------------------
Q9X5R9_STRLA/7-410-AKL.........L--RESASAA.----------.TDCT-----WPAHT----APGW-----------------------
Q9X5T4_STRLA/7-389-AAL.........R--SQGASGP.----------.LHAE-----GTPYE----PPGL-----------------------
Q9YCS9_AERPE/3-432-AKL.........M--KQCSWGI.----------.LRST-----IPPIT----GAAW-----------------------

PF02995

Q9VSJ3_DROME/115-607-MSVQRVD........EMKVKYTK----------C.QTF-----KGSIL----LPDS.......................
Q19148_CAEEL/75-621-QKDYATMDS...EGYIYVHPHFV----------DWPRL-----ERDVQ----CKVDIIEGGLRKPERNMTKNSMFIKKT
Q21671_CAEEL/74-651-RCHTRKRDK...ENLVGNWTYTP----------G....-----.....----.KIN.......................
Q9VGG4_DROME/77-573-KRFVRFNDF...VNIYFESTLFR----------F.SKL-----RNFTK----VDSG.......................
Q9VQH3_DROME/74-555-REFVRVDDA...HNKYISLKFFK----------L.TDR-----TRYLE----VGTG.......................
Q9VAU4_DROME/90-580-QEITRDR......KHDSYDKMER----------..KYF-----SQNYE----VPLH.......................
Q9VKK3_DROME/98-598-TEVKRKTDS...SNTHSPAVSFK----------....L-----DKVMK----LPLS.......................
Q9VIP6_DROME/62-563-QEISRDNSD...QKPDNAYNQLR----------R.RPI-----EQHQF----VPNN.......................
Q19486_CAEEL/79-568-.TGIRHDEN...VTDLDVIYEKP----------VPLNL-----THTSS----IKIS.......................
Q9V9Q1_DROME/66-560-YAMERHTDF...DNRYLYSREFE----------L..LT-----DGNNT----IEPH.......................
Q9VF91_DROME/73-581-TDIIRKSDY...KVRFGQSLRMK----------EPYVL-----QASDF----VKVV.......................
Q9VLG3_DROME/84-577-REIKYGK......IADTYDNLKA----------K.KYF-----TSGYE----VPVH.......................
Q9V9P7_DROME/68-547-LKSGHTRNH...SGHYTAYGHFD----------LKRGA-----TRKIK----IGTG.......................
O18062_CAEEL/82-553-RCFSGIGGS...KNVKIGPWMKP----------G....-----HV...----D.CE.......................
O62436_CAEEL/78-581-FTEKRAKAK...CKIQYFSRVDD----------NNNKY-----EEPVE----VLDGDR.....................
Q9W0F7_DROME/16-518-QVIGRNKKDSFPDNHFSFSKLQP----------....L-----SQSFL----VPKT.......................
Q8SY05_DROME/180-657-KQILRAGTS...ANADHKYKLGP----------C.VEF-----HQDFL----VPTE.......................

PF01676

DEOB_LACLM/6-406-GHISEI............RGLDV----------PNLQK-----LGWGN----IPRE--------------S........
DEOB_GEOSE/6-388-GHIAE...........HRGGLNM----------PNMAK-----LGLSN----IREI--------------E........
DEOB_BACSU/7-389-GHIAE...........HMNGLHM----------PNMAK-----LGLGL----IEDI--------------K........
DEOB_SHIFL/2-406-GHIAEACAKGEADNGRKGP.LNL----------PNLTR-----LGLAK----AHEG--------------S........
DEOB_HELPY/3-406-GNIAKACFNNLADSNDRSGALKL----------PYLES-----LGLGL----SALK--------------A........
YHFW_ECOLI/2-397-GHILSQLP...........HLQL----------PTLET-----LGLIN----A...--------------.........
APGM2_ARCFU/1-380-DFLAK........EGACGIAKTV----------P.DGF-----EPGSD----VANL--------------TI.......
APGM2_METTH/4-396-DQLAG........MGACGLLRTV----------P.EGM-----EAGSD----VANL--------------SI.......
APGM1_ARCFU/1-399-DRLAE........MGINGIMDTI----------A.PGI-----RPGSD----TSHL--------------AL.......
APGM1_METJA/4-402-DKIAK........EGICGLMNAI----------D.IGI-----RPGSD----TAHL--------------AI.......
APGM1_METTH/1-400-DRIAE........SGINGIMDPI----------K.PGV-----RAGSD----TSHL--------------SI.......
APGM_PYRHO/5-403-DKLAE........IGILGQQDPI----------K.PGQ-----PAGSD----TAHL--------------SI.......
APGM_AQUAE/13-398-DKLVK........NSATGLHIPV----------D.WGI-----TPGSG----PGHL--------------GL.......
APGM2_METJA/1-398-DRLAE........NGMCGLMTTY----------K.EGI-----PLGTE----VAHF--------------LL.......
GPMI_PORPU/7-514-DSLLETYPNT..LLVASGEEVGL----------P.KGQ-----MGNSE----VGHT--------------TIGGGRVVE
GPMI_ANTSP/7-506-DKLWDNYPKT..LLSASGEHVGL----------P.HKQ-----MGNSE----VGHT--------------TIGAGRIIN
GPMI_SYNY3/7-511-DSLIAAYPNT..LVNTSGKDVGL----------P.KGQ-----MGNSE----VGHL--------------NLGAGRVVP
GPMI_PSESM/6-504-DRLYKTMPNG..LISGSGMDVGL----------P.DGQ-----MGNSE----VGHM--------------NLGAGRVVY
GPMI_ECOLI/6-508-DALWANRPHT..LIDASGLEVGL----------P.DRQ-----MGNSE----VGHV--------------NLGAGRIVY
GPMI_BACSU/4-506-DRYWNQYPHQ..TLTASGEAVGL----------P.EGQ-----MGNSE----VGHL--------------NIGAGRIVY
GPMI_MYCGE/3-500-DELINSYPCV..LLDASGEAVGL----------P.MGQ-----IGNSE----VGHL--------------NIGAGRVVY
GPMI_MYCPN/3-501-DSLIKDYPCV..MLEASGEAVGL----------P.QGQ-----IGNSE----VGHL--------------NIGAGRIVY
GPMI_HELPY/3-489-DLMFKTLPYS..LIDTHGLSVGL----------P.KGQ-----MGNSE----VGHM--------------CIGAGRVLY
PMGI_MAIZE/20-552-DSLKNGAPEKWRLVKAHGTAVGL----------PSDDD-----MGNSE----VGHN--------------ALGAGRIFA
PMGI_TOBAC/20-552-YSLKNGAPEKWRLIKAHGNAVGL----------PTEDD-----MGNSE----VGHN--------------ALGAGRIFA
PMGI_MESCR/20-552-DSLKQGAPEKWRLIRAHGKAVGL----------PTEDD-----MGNSE----VGHN--------------ALGAGRIYA
PMGI_RICCO/17-549-DSFKKTAPERWRLIKAHGTAVGL----------PTEDD-----MGNSE----VGHN--------------ALGAGRIYA

PF00245

PPBN_MOUSE/51-486-GHLGPETQLAMDRFPHMALSKTY----------NTDKQ......IPDS----AGTG-----------------------
PPB4_BACSU/49-459-TPNNPKL.TEFDR.NLTGMMMTH----------PDDPDY....NITDS----AAAG-----------------------
PPB3_BACSU/43-455-TKVVEP..TAFDQ.YLVGQQTTY----------PDDPEQ....NVTDS----AAAA-----------------------
PPBT_BOVIN/51-490-HSPGEETKLEMDKFPYVALSKTY----------NTNAQ......VPDS----AGTA-----------------------
PPB_BOMMO/74-515-GQTGEEASLHFEQFPTLGLAKTY----------CVNAQ......VPDS----SCTA-----------------------
PPB_YEAST/66-527-DLPIDDI.LTLDE.HFIGSSRTR----------SSDSL......VTDS----AAGA-----------------------
STRK_STRGR/41-448-GR......LAMDTLDASGRRTTY----------AVDERGR.PVYVTDS----AAGA-----------------------
PPB1_HUMAN/55-490-DKLGPEIPLAMDRFPYVALSKTY----------NVDKH......VPDS----GATA-----------------------
PPBI_MOUSE/52-486-GHLGPETPLAMDRFPYMALSKTY----------SVDRQ......VPDS----ASTA-----------------------
PPB_ECOLI/64-470-GFF.....KGIDALPLTGQYTHY----------ALNKKTGKPDYVTDS----AASA-----------------------

PF08665

Q2RKS0_MOOTA/260-429----------------RGIDSFSV..T.......AVFTL-----LPTLT----RVSR-----------------------
O32495_DICNO/401-579----------------QDA.NLVMRES.......ATFAW-----IPTLT----SVSR-----------------------
B0K8X1_THEP3/380-556----------------NALWNIEE..K.......KSFAW-----IPTLT----SISR-----------------------
Q72AH5_DESVH/438-616----------------EDRYSAEL..E.......PALSM-----LPSYT----QLGM-----------------------
Q4BWC0_CROWT/438-619----------------EDRYEATL..D.......AAVTL-----LPSYT----QLGM-----------------------
Q8Q0H3_METMA/497-672----------------DTWGLIDL..D.......YMAGV-----LPSYT----KLGM-----------------------
Q8TNC5_METAC/496-671----------------DTWGIPEL..S.......YMAGV-----LPSYT----KLGM-----------------------
Q3A8U0_CARHZ/461-637----------------ERRGTTEI..S.......AMQGV-----LPSYT----KLGM-----------------------
B1YIB9_EXIS2/462-638----------------ETTGICEM..Q.......SMLGV-----VPSVT----KLGM-----------------------
Q5P0R1_AROAE/485-661----------------KSRFKAAL..S.......SQLGV-----LPSYT----TLGM-----------------------
A4JFG3_BURVG/484-660----------------RNRVKARL..D.......AMLGV-----LPSYT----TLGM-----------------------
Q2W5M5_MAGSA/475-648----------------TYRIQAEI..Q.......PMLGV-----LPSYT----ALGM-----------------------
Q8RL18_PRORE/500-676----------------EKRFKAEV..S.......TQLGV-----LPSYT----QLGM-----------------------
Q8ZK15_SALTY/474-650----------------EKRFTAEL..R.......SQLGV-----LPSYT----QLGM-----------------------
Q7MVV4_PORGI/231-425----------------FYTFEEDM...........YLSI-----LPTAT----QYAR-----------------------
Q53943_STRCH/527-704----------------RSWAEFDPLPEGDTPYRRAMAAA-----LPTVT----AVSR-----------------------

PF07394

Q7UT83_RHOBA/61-480..........KTRKVGQSGLDMCD----------QFVHLAQP--EVADE....LCVY-----------------------
Q7UHL2_RHOBA/84-501..........RFRPRGQSGLEISD----------FLPHM..S--EHADD....LCVI-----------------------
Q7UN58_RHOBA/63-468..........KWSQHGEAGLWATD----------LLQEM..N--KHLDS....LCVV-----------------------
Q98BS1_RHILO/39-404.....................ALS----------LAGPHAAL--PLDGF....FAVN-----------------------
Q7UHK7_RHOBA/71-478..........SFKQYGESGQWVCD----------RYTNV..A--KHVDK....MAFI-----------------------
Q7UKW9_RHOBA/100-522..........KFAQHGQSGAWLSE----------LLPYH..R--DIVDD....VCFI-----------------------
Q8P3X8_XANCP/29-384..................AIARPD----------TNNPRSAL--ALDAQ....WGLN-----------------------
Q7UZ35_RHOBA/49-467..........KFKKWGQSGLEISE----------LFPNI..G--SVADD....LCII-----------------------
Q7UFP1_RHOBA/49-464..........AFAKHGKSGLEISS----------VLPHL..S--KMADD....LCVV-----------------------
Q7MLK9_VIBVY/33-420...............PDIALAKES----------LLPLTLAT--GSTLS....LGLH-----------------------
Q7US09_RHOBA/66-482..........KWAQHGEGGLWISD----------WLPHT..A--KMADE....LAVI-----------------------
Q7VYL6_BORPE/29-381........................----------AIARDAAA--ALSDG....WALH-----------------------
Q7UDW2_RHOBA/77-502..........DFQQHGESGAWVSE----------LMPNL..A--KQVDD....LCFL-----------------------
Q87HJ3_VIBPA/35-425...............GSLSVAKNT----------IIPIRLNA--HDANNNAVPLGLH-----------------------
Q7UM62_RHOBA/63-489..........PFAQHGESGAWVSD----------RLPHF..Q--SVVDK....VCFV-----------------------
Q7UJ64_RHOBA/59-474..........SFSRHGESGAPMAD----------NWTHL..P--KVADE....LCFY-----------------------
Q7UIF5_RHOBA/61-494IRNEIYPLQVGFAPRGESGIEISD----------WFPHV..G--ECADD....LCVI-----------------------
Q7UYJ8_RHOBA/60-484..........AFKPRGQSGKMISE----------LVPQL..G--ELADD....MCFL-----------------------
Q7MCK0_VIBVY/38-408..........YYQARQKLAIPLND----------LLPIN..T--QGENT....LALH-----------------------
Q9A5N3_CAUCR/44-506RTVSATNFPEYWGGVLPITPKTPQ----------RAAGAAPG--APART....FGLH-----------------------
Q7ULC1_RHOBA/52-445..........QPIATQTPGIQFAQ----------PMQKM..A--AISDD....LAIV-----------------------
Q7UQT8_RHOBA/50-438..........NPISTNVPGVQISE----------HLPKL..A--QVADK....FAIL-----------------------
Q7UQ29_RHOBA/54-472..........KWDKYGECGLEVSE----------LFEHT..A--THADD....LCVI-----------------------
Q7UGB9_RHOBA/69-492..........QFQRCGESGAQISN----------LMPNL..Q--TVADE....LCFI-----------------------
Q7UPP6_RHOBA/56-434..........KPISTRVPGIQFGD----------RFPKL..S--YLAGA....IATV-----------------------
Q7UI66_RHOBA/46-421..........FRPISTTGNAQICE----------HMPMV..A--QQMKH....LSVV-----------------------
Q7UVE3_RHOBA/81-505..........KFHRHGDCGRLVGE----------WLPHI..G--AISDD....LCFV-----------------------
Q7UW70_RHOBA/70-497..........NPISTKIPGVKFTE----------NLPRL..S--QVNDK....FTMI-----------------------
Q7UKM6_RHOBA/69-495..........GGKRCGQHGTWVGN----------LLPHL..Q--EITDD....ISIV-----------------------
Q7UTL9_RHOBA/100-490..........KSIDTAVAGVSVCE----------HLPRL..A--ERMDR....VTAV-----------------------
Q7UGF5_RHOBA/94-499..........FKTIATRGDFELTE----------ILPKH..A--EIADM....FSIV-----------------------
Q9A6V4_CAUCR/38-393........................----------ALQRDQVR--MLDDT....FGLH-----------------------
Q7UYC8_RHOBA/101-527..........GFSQQGESGMWMSD----------LLPHL..S--TQVDK....LCFI-----------------------
Q7UR29_RHOBA/60-444..........LGTIKTNTGEVIGS----------AMPQL..A--KRADK....YCVI-----------------------
Q7UYM7_RHOBA/45-446..........KEVQTSAPGLRFSE----------HLPKL..G--SMADK....LAVL-----------------------
Q7UV65_RHOBA/50-468..........KFKQYGESGISVSE----------LFPHV..A--ECVDD....LCII-----------------------
Q7UJ54_RHOBA/70-497..........EFSRHGENGIHLSE----------LLPHL..G--TVIDD....ICLI-----------------------
Q7UJ36_RHOBA/99-512..........KFEKKGSAGTHISE----------LLPHT..A--GVLDD....ICLI-----------------------
Q7NT93_CHRVO/33-383........................----------AIAREQVL--QINGD....IGLH-----------------------
Q7UEK9_RHOBA/80-501..........KFQPRGESGKMISD----------LVPHI..G--EMADD....LCFF-----------------------
Q7UQW1_RHOBA/70-487..........KFKQHGESGIPVSS----------LFPHV..A--GCVDE....LAVV-----------------------
Q7UPF7_RHOBA/65-448..........GDVATTLKDVRIAD----------TMPRL..A--EQMHL....CSLV-----------------------
Q7UYR5_RHOBA/95-521..........KFSPHGANGTMASE----------LIPHM..A--KKVDE....IALV-----------------------
Q7UWA1_RHOBA/72-492..........DFAPHGECGKMVST----------LFPNV..A--KHVDD....IAFL-----------------------
Q89DL5_BRAJA/42-392.....................ALA----------ADGAHPAI--MLDSF....FALH-----------------------
Q7URV7_RHOBA/77-499..........DFKPRGESGKMVSD----------LLPHL..A--EQVDD....FCFL-----------------------
Q7MDY0_VIBVY/67-457...............GNLALSQSQ----------IIPLSLKA--QDNQGKPVTLGLH-----------------------
Q7UH70_RHOBA/75-488..........KFQKHGKSGIEISE----------LFPEL..S--KHADK....LCVI-----------------------
Q7UVE1_RHOBA/82-507..........PFEQHGESGAWVSD----------RMPHL..A--KQVDD....ICFI-----------------------
Q7UQ53_RHOBA/45-480..........RFSPYGESSKMLSE----------VVAPL..G--DCVDD....IAFV-----------------------
Q7UP10_RHOBA/69-492..........EFKQHGESGTWMSD----------QLPYT..S--KIADD....ICVV-----------------------

PF04185

PHOX_KLULA/65-312-.......................----------.....-----.....----....-----------------------
Q9S816_ARATH/13-380-D...QSQYV....DPNPGHSIRD----------IYEQV-----F....----...G-----------------------
Q9SRQ6_ARATH/16-381-K...ESQNI....DPDPGHSFQA----------IYEQV-----F....----...G-----------------------
Q47936_FRANO/55-471-KFVAKENT.....PNVNGLTKQL----------LENNP-----....N----TKNP-----------------------
Q97V43_SULSO/27-365-LSLMYPYGLYENYTQLQGAKNGV----------LYWIS-----V...P----DIPW-----------------------
Q9LML5_ARATH/38-396-DDAVFV.......DMDPGHSFQA----------IREQI-----FGSND----TS.G-----------------------
PHLB_MYCTU/52-435-DTTPPVVFAQSGWNPMTQAVDPA----------GVTLP-----YRF.D----TTRG-----------------------
Q9A412_CAUCR/40-437-AGRKESSVFVQAWSKDK......----------.LLAP-----FPLNS----AQ..-----------------------
PHLC_PSEAE/51-437-KPVWYQNYK..............----------.....-----YEFSP----YHWD-----------------------
PHLD_MYCTU/50-429-......LFQQKGWNPMTQALDAT----------GVTMP-----YRF.D----TTRG-----------------------
Q9SMN8_ARATH/1-336-SDAEFV.......DPDPGHSFEA----------VEQQV-----FGSGP----..GQ-----------------------
O53361_MYCTU/50-282-.......................----------.....-----.....----....-----------------------
O81020_ARATH/27-389-S...GSHYV....DPDPGHSFQA----------IREQV-----FGSND----TSMD-----------------------
Q9KH04_BURML/84-547-GLVPQAQVVDGKRYMIGEHDIVG----------LPNAP-----FVIPD----.AQG-----------------------
PHLN_PSEAE/48-422-QRVWHQKG.............SK----------GEILP-----YHFDT----ST..-----------------------
PHLN_BURPS/47-438-KSVFHQPVL...........LGP----------AELLP-----FHP.D----AS..-----------------------
Q983N8_RHILO/60-507-PPVWDGLTAKGVTPPVTQAMTEH----------LPNAP-----FTVND----.AKG-----------------------
PHLA_MYCTU/51-431-......AFQQMGWNPMTQALDPA----------GVTIP-----FRL.D----TTRG-----------------------
Q98ES1_RHILO/58-274-.......................----------.....-----.....----....-----------------------
PHLC_MYCTU/52-433-FDTPTPLFQQKGWNPETQALDPT----------GITLP-----YRI.N----TTGG-----------------------

PF14707

F1QB82_DANRE/433-568----------------LNAVRWRP--------------------PNS.S----AIWK-----------------------
F1QQ07_DANRE/367-495----------------VFAVRWEN--------------------.....----..FK-----------------------
ARSA_HUMAN/368-502----------------VFAVRTGK--------------------.....----..YK-----------------------
F2UD41_SALS5/491-612----------------LQAVRWRE--------------------.....----..WK-----------------------
F1QFT2_DANRE/220-353----------------MMAVRIGQ--------------------.....----..YK-----------------------
ARSH_HUMAN/418-551----------------LHTVRWHQ--------------------KDC.A----TVWK-----------------------
ARSG_CANFA/402-522----------------LQTVRLGS--------------------.....----..YK-----------------------
A8XD87_CAEBR/394-528----------------LMAIRIGD--------------------.....----..YK-----------------------
ARSG_MOUSE/402-522----------------LQTVRLNH--------------------.....----..YK-----------------------
A0YAF7_9GAMM/381-478----------------IFAVRQGD--------------------.....----..WK-----------------------
C3YQ76_BRAFL/419-552----------------IHAARYRP--------------------PTG.G----SIWK-----------------------
Q5XG10_XENLA/375-508----------------LMAVRLGQ--------------------.....----..HK-----------------------
A7V8P9_BACUN/356-447----------------LLAVRKGP--------------------.....----..WK-----------------------
ARS_HEMPU/396-526----------------LMAVRVGK--------------------.....----..YK-----------------------
Q4RYA1_TETNG/304-429----------------LNAVRWHP--------------------RNS.S----SVWK-----------------------
F2UCT8_SALS5/90-221----------------LWAVRCGA--------------------.....----..YK-----------------------
C3YZM0_BRAFL/417-549----------------LAAARYRP--------------------LTG.N----SVYK-----------------------
A7SK49_NEMVE/435-563----------------IHAVRYRP--------------------KRG.K----SIWK-----------------------
GALNS_CANFA/377-510----------------LMAVTLGQ--------------------.....----..YK-----------------------
Q6GMA1_XENLA/439-573----------------LHAARWHE--------------------KES.G----AVWK-----------------------
A9VBN0_MONBE/428-544----------------MAAMRFNE--------------------.....----..YK-----------------------
C3ZST4_BRAFL/433-562----------------LHAVRYRP--------------------REG.N----VTWK-----------------------
A6QLR7_BOVIN/402-522----------------LQTVRLEQ--------------------.....----..YK-----------------------
STS_HUMAN/437-572----------------LNAVRWHP--------------------QNS.T----SIWK-----------------------
Q4TCJ7_TETNG/242-385----------------LHAVRWHP--------------------PGS.D----SVFK-----------------------
F1NFQ0_CHICK/445-579----------------LHAVRWHQ--------------------KDS.G----AIWK-----------------------
E4YGB6_OIKDI/449-582----------------LNAIRWTE--------------------PQT.G----RVWK-----------------------
D2HFI2_AILME/436-570----------------LHAARWHE--------------------KDS.G----RLWK-----------------------
E1FX25_LOALO/406-541----------------LMAIRYGN--------------------.....----..HK-----------------------
F1R580_DANRE/251-371----------------LQTVRLKH--------------------.....----..HK-----------------------
O16138_HELER/402-534----------------LMAVRVGK--------------------.....----..YK-----------------------
Q32KK0_RAT/450-603----------------LHAVRWVQ--------------------RDS.G----QVWK-----------------------
D2HXW7_AILME/434-569----------------LNAVRWRP--------------------RNS.T----SVWK-----------------------
D7VQY4_9SPHI/353-442----------------LMAVRKGP--------------------.....----..WK-----------------------
Q6DJK3_XENLA/433-566----------------LHSVRWYQ--------------------KSN.Q----TVWK-----------------------
Q32KK2_RAT/368-502----------------VFAVRNGK--------------------.....----..YK-----------------------
Q32KI1_CANFA/444-578----------------LHAARWRQ--------------------RDG.G----RLWK-----------------------
E4XNY3_OIKDI/402-533----------------LGAVRRGD--------------------.....----..YK-----------------------
C3ZQB5_BRAFL/418-551----------------LMAVRYGE--------------------.....----..YK-----------------------
E6ZGQ8_DICLA/413-534----------------LQTVRTRK--------------------.....----..HK-----------------------
A9UXW0_MONBE/287-431----------------VTAARFGR--------------------.....----..YK-----------------------
Q1YP24_9GAMM/409-501----------------LRAFRYQD--------------------.....----..HK-----------------------
ARSE_HUMAN/448-582----------------LHAARWHQ--------------------RDR.G----TMWK-----------------------
F1KQC6_ASCSU/1702-1837----------------LMAIRYGN--------------------.....----..FK-----------------------
F0Y2N2_AURAN/404-544----------------PSAARCGP--------------------.....----..YK-----------------------
Q4S4L1_TETNG/407-528----------------LQTVRMGR--------------------.....----..YK-----------------------
Q7ZWB8_DANRE/433-548----------------LNAVRWRP--------------------PNS.S----AIWK-----------------------
A3XMW9_LEEBM/382-476----------------LYAVRYGS--------------------.....----..YK-----------------------
C3YBU1_BRAFL/392-524----------------VHAVRYRP--------------------KEG.N----VTWK-----------------------
Q4RJR3_TETNG/343-474----------------LFAIRLEK--------------------.....----..YK-----------------------
ARS_STRPU/411-541----------------LMAVRVGK--------------------.....----..YK-----------------------
F2UKF0_SALS5/383-527----------------VTAARNGR--------------------.....----..YK-----------------------
Q0C069_HYPNA/397-504----------------VFAVRKGK--------------------.....----..YK-----------------------
ARSF_HUMAN/440-574----------------LHAVRWIP--------------------KDDSG----SVWK-----------------------
A4AN36_MARSH/378-468----------------LYAARLGE--------------------.....----..YK-----------------------
F1NW57_CHICK/376-509----------------MMAVRVGL--------------------.....----..YK-----------------------
C3Y4J9_BRAFL/389-521----------------IHAARYRP--------------------RQG.N----STWK-----------------------
C1BQY6_9MAXI/368-497----------------PFAMRYHQ--------------------.....----..YK-----------------------
C3ZQC1_BRAFL/339-471----------------LMAVRYGE--------------------.....----..YK-----------------------
Q4SI19_TETNG/404-542----------------LMAVRRGQ--------------------.....----..YK-----------------------
STS_MOUSE/445-581----------------LQAVRWH.--------------------NG..S----AVWK-----------------------
A4CMB0_ROBBH/401-491----------------LYAVRLGA--------------------.....----..YK-----------------------
STS_RAT/436-573----------------LSAVAWRP--------------------HNS.S----SVWK-----------------------
ARSD_HUMAN/451-585----------------LHAARWHQ--------------------KDS.G----SVWK-----------------------
B4DQ74_HUMAN/301-421----------------LQTVRLER--------------------.....----..YK-----------------------
A5D7J7_BOVIN/445-576----------------LHAARWHQ--------------------R....----DLWK-----------------------
Q32KI0_CANFA/435-568----------------LHAVRWHP--------------------KDS.D----AVWK-----------------------
F1R2X2_DANRE/342-476----------------LNAVRWHP--------------------QNS.S----SIYK-----------------------
F2U742_SALS5/410-536----------------LYAMRCGD--------------------.....----..HK-----------------------
A9V957_MONBE/437-571----------------IETIRVGD--------------------.....----..YK-----------------------
A9UPM8_MONBE/326-452----------------LYAVRCGD--------------------.....----..MK-----------------------
B9QU81_9RHOB/44-158----------------LQAVRYRD--------------------.....----..WK-----------------------
Q6AX40_XENLA/368-500----------------IFAVRLGK--------------------.....----..YK-----------------------
F1NWF7_CHICK/360-492----------------PFAVRLGK--------------------.....----..YK-----------------------
C3Z258_BRAFL/432-564----------------LHAVRYMP--------------------SKG.N----VTWK-----------------------
A9V7E7_MONBE/452-571----------------LWAVRCGP--------------------.....----..YK-----------------------
ARSA_BOVIN/368-502----------------VFAVRSGK--------------------.....----..YK-----------------------
A6CB11_9PLAN/382-473----------------LMAFRKGP--------------------.....----..WK-----------------------
F0SFZ7_PLABD/380-468----------------LYAVRSGP--------------------.....----..WK-----------------------
C3Y4X6_BRAFL/434-568----------------LHAVRYRP--------------------RKG.K----VTWK-----------------------
C6W2Y6_DYAFD/349-461----------------LEAVRKGN--------------------.....----..WK-----------------------
E1BU03_CHICK/378-498----------------VEALRLAQ--------------------.....----..YK-----------------------
A7SK50_NEMVE/483-612----------------VHAVRYRP--------------------RSG.H----TTWK-----------------------
A1L2N0_XENLA/374-506----------------IFALRMGN--------------------.....----..YK-----------------------
C3ZV84_BRAFL/657-790----------------LMAVRYGL--------------------.....----..YK-----------------------
A7SQ82_NEMVE/425-557----------------IHATRYRP--------------------REG.K----TTWK-----------------------

PF00884

C3LB12_BACAC/143-439------------FEALTSYSMS-LLMPG.--------------SIPYQQA.........I--------------------
O06776_MYCTU/43-460------------QALLTGRNHH-SAGMGG--------------ITEIAT....GAPGYSS--------------------
O25301_HELPY/294-587------------DVQITGLPYI-NDNNLV--------------NSG.............V--------------------
O34609_NEIME/232-524------------PCMFSTFDRT-DYD...--------------................E--------------------
LTAS2_BACSU/245-536------------FMMENSLYPL-AQGSVF--------------V...............N--------------------
O43113_NEUCS/45-420------------VSLWTGKQAH-NTNVTD--------------VSPPYGGYPKF.....I--------------------
O65931_MYCTU/212-635------------AALLTGRNHH-RVGFGS--------------VCEFPG....PYPGYSA--------------------
O82879_STRMU/460-745------------FQSLTGLPYY-NFNSSV--------------STLYTEV.........V--------------------
O85099_ECOLX/237-530------------QQALTFANEK-N.....--------------................P--------------------
YEJM_ECOLI/260-505------------FGLFYGISPS-YMDG..--------------................I--------------------
ARS_HEMPU/52-373------------SAIMTGRLPV-RIGTFG--------------ETRVFLPWTK......T--------------------
ARS_CHLRE/27-385------------TNLXRGQFAH-NTNFTS--------------VLPPYGGWAKW.....K--------------------
ARSA_HUMAN/21-346------------AALLTGRLPV-RMGMYP--------------GVLVPSSR........G--------------------
ASLA_ECOLI/86-419------------ATILTGQYSI-HHGILM--------------PPMYGQ..........P--------------------
EPTA_ECOLI/236-527------------PCMFSDMPRE-HYK...--------------................E--------------------
YIDJ_ECOLI/4-341------------AGLFTGIYAN-QSGPWT--------------NN..............V--------------------
ARSB_FELCA/47-366------------SQLLTGRYQI-HTGLQH--------------QIIWPCQP........S--------------------
GALNS_HUMAN/31-355------------AALLTGRLPI-RNGFYT--------------TNAHARNAYTPQEIV.G--------------------
EPTB_ECOLI/248-538------------RCMFVRQGGA-EDN...--------------................P--------------------
Y1005_HAEIN/211-475------------QLTLYRAE..-......--------------................K--------------------
GNS_CAPHI/54-391------------ASILTGKYPH-NHHVVN--------------NTLEGNCSSKS.....W--------------------
STS_MOUSE/35-421------------AAFLTGRYPP-RSGMAA--------------HGRVGVYLFTASS...G--------------------
ARS_STRPU/67-388------------SAIVTGRQPI-RTGVYG--------------EERIFLPWTT......T--------------------
SPHM_HUMAN/23-328------------ASLLTGLPQH-QNGMYG--------------LHQDVH....HFNSFD.--------------------
ARS_PSEAE/5-420------------SMLLTGTDHH-IAGIGT--------------MAEALTPELEGKPGYEG--------------------
YHBX_ECO57/223-491------------PLSLTADSVL-S.....--------------................H--------------------
CGMA_RHIME/269-561------------FEALTGFSNA-FLPYG.--------------SIPYQ...........Q--------------------
YBIP_ECOLI/217-483------------GLTLNRVV..-......--------------................D--------------------
YDEN_ECOLI/58-408------------AAIMTGRAPA-RFGVYS--------------NTDAQ...........D--------------------
P95059_MYCTU/37-466------------ASLLTGRNAT-TVGMAT--------------IEEFTD....GFPNCNG--------------------
P95081_MYCTU/5-389------------PTIFTGQYPD-LHGVTQ--------------TDGIGKRFDDSRLR..W--------------------
ARS_VOLCA/26-386------------TNLWRGQFSH-NTNFTD--------------VLGPHGGYAKW.....K--------------------
Q45087_9BURK/4-384------------ASLLTGLYLM-NHRAVQ--------------NT..............V--------------------
Q833K3_ENTFA/256-543------------FEALTSFSME-LMNAQM--------------TTPYTMM.........I--------------------
Q840W2_STRMU/270-555------------FQTLTGLPFY-NFSSSV--------------STLYTEV.........V--------------------
Q8DUS0_STRMU/503-788------------FQSLTGLPYY-NFNSSV--------------STLYTEV.........V--------------------
Q8G592_BIFLO/306-604------------YMGLSGLSMA-NFESSL--------------SSPYQQL.........V--------------------
Q8K804_STRP3/480-765------------FQTLTSLPFY-NFSSSV--------------SVLYSEV.........F--------------------
Q8P1I3_STRP8/480-765------------FQTLTSLPFY-NFSSSV--------------SVLYSEV.........F--------------------
Q8XK47_CLOPE/257-551------------FEVLTGLSTD-YLPVGE--------------IPNNN...........I--------------------
Q984T6_RHILO/281-574------------FEALTGFSNA-FLPAG.--------------SIPYQ...........Q--------------------
Q98EG2_RHILO/158-441------------ITFFTSRQYL-EEH...--------------................S--------------------
Q9A0F9_STRP1/480-765------------FQTLTSLPFY-NFSSSV--------------SVLYSEV.........F--------------------
Q9AI31_BURML/214-497------------FAFLTGLPSS-HLGYAR--------------FYPY............A--------------------
Q9CKD9_PASMU/287-557------------EAVTAGFTPT-PARAVV--------------KL..............S--------------------
Q9CM05_PASMU/231-523------------PCMFSSLDRK-HFS...--------------................N--------------------
Q9HVQ5_PSEAE/238-530------------QQVLTFADQE-H.....--------------................P--------------------
Q9HYT4_PSEAE/238-529------------PCMFSQYPRE-DYS...--------------................D--------------------
Q9I2D3_PSEAE/231-522------------PCMFSNLGRA-DYS...--------------................D--------------------
Q9I4M0_PSEAE/223-501------------YAMLCGDYSK-LDSGTP--------------KGVELL..........N--------------------
Q9JXJ7_NEIMB/214-487------------PSFFNAIPHA-NGL...--------------................E--------------------
Q9KKK2_VIBCH/240-530------------PCMFSNMNRQ-NFD...--------------................R--------------------
Q9PGC7_XYLFA/245-535------------PCMFSPYGRR-NYD...--------------................E--------------------
Q9RBI1_ACIAD/237-531------------PCMFSGMPRQ-NYD...--------------................E--------------------
Q9RMJ0_NEIME/232-495------------PQTL......-......--------------................G--------------------
Q9X6R2_PSEAI/20-300------------FATMACFPNL-PGFEYL--------------MQT.............P--------------------
Q9ZDJ9_RICPR/218-505------------PSLLSRYPAS-Q.....--------------................I--------------------
Q9ZJJ5_HELPJ/225-518------------ESLLNYSDAE-T.....--------------................T--------------------
Q9ZN39_HELPJ/222-504------------ECILDSSFKN-SLG...--------------.................--------------------

PF01663

ENPP3_MOUSE/161-485------------YTIVTGLYPE-SHGIID--------------NNMYD................................
O29992_ARCFU/4-416------------ASISTAAFPG-EHGLVG--------------QAWYD................................
O50518_STRCO/58-383------------ASVGTGLPPG-AHGLPG--------------YTV.RN...............................
Q73VT6_MYCPA/42-363------------VSLATGAAPG-QHGILG--------------FTL.RV...............................
Q6A8W7_PROAC/44-359------------SCIGTGAVPG-CHGVVG--------------YTF.RA...............................
Q6N507_RHOPA/30-497------------SAMATGHYLG-DTGTFS--------------NTIYTGY..............................
Q7WNM8_BORBR/6-370------------ASIATGCRPA-RHGLLG--------------NCM..................................
O58841_PYRHO/4-322------------TTVMTGVEPR-HHWVVE--------------NGYYD................................
O69954_STRCO/13-378------------STFLTGTMPS-EHGIVG--------------NGWY.................................
Q7AYA7_9RHIZ/4-370------------ATFVTGLPPS-EHGIVG--------------NGWL.................................
Q7NU73_CHRVO/4-375------------ASMLTGLTPE-QHGIVG--------------NGWL.................................
Q8YZP2_NOSS1/4-370------------ATYLTGKSPD-EHGIVA--------------NGWY.................................
Q7UKE3_RHOBA/4-350------------ATMLTGLSPR-DHGIVG--------------NGWL.................................
Q71ZQ2_LISMF/5-366------------TSIITGHYPA-THGIIN--------------NTKVQ................................
Q73E52_BACC1/9-380------------STIVTGNYPN-KHGVVS--------------NTLLQ................................
Q8XKL9_CLOPE/10-374------------VSIITGKYPV-NHGITN--------------NIVLN................................
Q97LS7_CLOAB/8-378------------TSIITGTYPE-KHGIFN--------------NEKMQ................................
O45359_CAEEL/26-353------------HSLLTGTLPR-RHGIIG--------------DYI..................................
Q22129_CAEEL/24-374------------MSLSTGLYTE-NHGFTA--------------DYMWD................................
Q981Q5_RHILO/5-379------------ATMLTGVGPE-THGIYG--------------NHI..................................
O69013_ZYMMB/50-367------------YTLVTGLYPD-HHGIVG--------------NNMDD................................
Q9A8S4_CAUCR/74-393------------YTLITGKRPD-RNGIVA--------------NTMVD................................
Q8PIS1_XANAC/48-366------------YTLVTGLRPD-HHGIVH--------------NSMRD................................
Q9PAB9_XYLFA/40-358------------YTLITGLRPD-HHGIVH--------------NTMED................................
Q7MXP5_PORGI/37-349------------YSMATGLYPD-HHGIVA--------------NEFVD................................
ENPP2_RAT/165-477------------YTLATGLYPE-SHGIVG--------------NSMYD................................
Q7ZXN7_XENLA/166-476------------YTLATGLYPE-SHGIVG--------------NSMYD................................
Q6PGY9_DANRE/161-472------------YTITTGLYPE-SHGIVG--------------NSIHD................................
ENPP1_RAT/194-520------------YSIVTGLYPE-SHGIID--------------NKMYD................................
Q6VZU9_CNPV/107-431------------YSIVTGLYPT-SHGIVN--------------NEFLD................................
Q70HC0_FOWPV/120-443------------YSIVTGLYPI-SHGITD--------------NEFID................................
Q7F5L2_ORYSJ/92-418------------YSIATGLYPS-SHGIIN--------------NYFPD................................
Q9FS13_SPIOL/96-418------------YSIVTGLYPP-HHGIIN--------------NYFVD................................
Q9SU83_ARATH/109-435------------YSIVTGLYPA-YHGIIN--------------NHFVD................................
Q9SU81_ARATH/60-394------------YSIATGLYPA-YHGIIM--------------NKFTD................................
Q9SU82_ARATH/57-390------------YSIATGLYPA-SHGIIM--------------NKFTD................................
YGK5_SCHPO/76-404------------YTIVTGLYPE-SHGIVS--------------NNFFD................................
Q6BTN4_DEBHA/173-514------------WTLVTGLYPS-EHGIVG--------------NTFFD................................
Q6C6J4_YARLI/277-608------------WTLITGLYPS-SHGIVG--------------NTFFD................................
Q7SI20_NEUCR/254-584------------YTLATGLYPE-AHGVVG--------------NTFWD................................
NPP1_YEAST/170-545------------WTLVTGQYPI-HHGIVS--------------NVFWD................................
Q6FKX1_CANGA/187-587------------WTMVTGLYPS-MHKMIA--------------NSFWD................................
Q757R2_ASHGO/153-497------------WTLVTGRRPG-HHGIVS--------------NVFYD................................
Q6CX45_KLULA/136-460------------WTMITGQFPH-HHGIIA--------------NRFWD................................
ENPP4_XENLA/30-339------------YSLVTGLYAE-SHGIVA--------------NRMYD................................
ENPP4_HUMAN/28-339------------YSIVTGLYEE-SHGIVA--------------NSMYD................................
ENPP5_HUMAN/30-342------------YTLVTGLFAE-NHGIVA--------------NDMFD................................
ENPP7_HUMAN/33-356------------FTLVTGKYIE-NHGVVH--------------NMYYN................................
Q6ZM30_DANRE/31-356------------FTLLSGRYIE-NHGVIH--------------NNWFN................................
ENPP6_XENLA/26-357------------YTLMTGRHCE-THHMTG--------------NFMWD................................
ENPP6_MOUSE/26-357------------YTLMTGRHCE-VHQMIG--------------NYMWD................................
ENPP1_CAEEL/182-494------------YSIVTGLWPE-SHGITD--------------NSVFD................................
ENPP2_CAEEL/81-386------------YTMVTGLYPE-SHGITD--------------NYVFD................................
Q47910_9FLAO/52-512------------STIYTGSVPA-INGIAG--------------NDFIIQATGQNMYCTQDDS...............VQA
Q9KJX5_FLAME/32-489------------TSIFTGSVPS-IHGIAG--------------NDWYDKELGKSVYCTSDET..............VQPV
Q55320_SYNE7/42-494------------SSIYTGSVPA-INGIIG--------------NNWFDPQLGRDVYCVEDKS...............VKT
Q89ZL4_BACTN/29-473------------AAIYSGSTPS-VNGIIS--------------NRWMDVATLRPVNSTDD..................AA
Q7MEK0_VIBVY/30-506------------VSLATGAPPS-VHGMVG--------------NVWYDRQKERLVYNVEDENYAMLNSHAGVNKATEIDP
Q84EY0_9GAMM/27-481------------ATVATGSFPA-LHGIVN--------------NEWYDRKSRQMVYCMEDLKT............NILQT
Q60113_ZYMMB/62-511------------SVLLTGDHPA-RTGIIA--------------NNWYDFSVKRADKKV......................
Q98IY7_RHILO/32-447------------VAQVTGGTPK-STGVFY--------------DDSYDRTYFAPASDC......................
Q7NDL2_GLOVI/4-434------------VSFMTGRTPG-NHGVYD--------------FI...................................
Q9UZH6_PYRAB/14-420------------MVMVTSKTPG-ELGLYG--------------F....................................
Q9YCR2_AERPE/4-405------------GVMLAGRSAG-ELGVYG--------------F....................................
Q9X5S9_STRLA/7-409------------SCMMSGRSPG-ELGVYG--------------F....................................
Q9HSF0_HALSA/15-396------------PSLTTGVNPG-ETGVYG--------------.....................................
Q9X5S1_STRLA/5-395------------ATFLTGTNPG-RHGIYG--------------F....................................
Q9X5R9_STRLA/7-410------------STFVSASDPG-GHGIYQ--------------.....................................
Q9X5T4_STRLA/7-389------------LSVLTGRRAA-DHGFYS--------------.....................................
Q9YCS9_AERPE/3-432------------PSLATGLNPG-KTGIVD--------------.....................................

PF02995

Q9VSJ3_DROME/115-607............AEGIIVKCDS.GGRQIYIN.......GHATVPVKEAVQQ.....RLRMA............SEADAKG
Q19148_CAEEL/75-621LEIPSNERLFVNADAFVINCYN.HSKKAVKPEVPIWKKPFPGMKDKNLPED.....EILRVKDLYSYGDYGNKIREQVSK
Q21671_CAEEL/74-651............CEILETVCAE.KGGEQR..............DVYGYLHS.....QIIPTKP..........KLSRTNA
Q9VGG4_DROME/77-573............NITLRVWCWM.DYGRLV............YHDVFIFLPF.....PNPQK............VNNSAP.
Q9VQH3_DROME/74-555............LQHIRTWCWV.DFGRII............FHDVMYFLP......PLPQA............TNRSTEH
Q9VAU4_DROME/90-580............VEGLILTCHR.LGNESDI..........LQSDAYNLIQY.....RPPPKG............LSLKP.
Q9VKK3_DROME/98-598............SEFICMWCYD.SLDKLF............YKDCHFFAVDKP.RIRPPLKTGTD.....RVSFNKSKE.
Q9VIP6_DROME/62-563............TDYMITSCYV.RDVTKHRE........LLQQDAISFIED.....RLPKEK.V........KDFVKDES
Q19486_CAEEL/79-568............DEVFQITCES.DNLLKS..............EIFKYHYT.....QIVPKSSN.......IKNKVIEQS
Q9V9Q1_DROME/66-560............ADIIRAECFI.NATSIY.............NGVHFYVHPTDEWLRTAQGLP..........PLKLAS.
Q9VF91_DROME/73-581............CRSSSGESWF.GMAHGIRD.......TVPRPPASNFSPN....LAVLPPEAVA.....QAQQQMQDGA
Q9VLG3_DROME/84-577............VEGMIVECQT.ADDPIVV..........LQKDAFAFIQH.....RPLPK.............DSIRPR
Q9V9P7_DROME/68-547............EQIVRIRCSD.KFKASK............YHDVLYFLS......PPDPK.............LMSTE.
O18062_CAEEL/82-553..............FLETVCWE.DNIEVY.................GHIHT.....QIIPR.............KASPTK
O62436_CAEEL/78-581.........MNGSDYATISCIQ.GFQKWKSI.......LWDVNDEPEIHER....ARKMRK.............EQADP.
Q9W0F7_DROME/16-518............IDFISTQCHA.VHGNIDLK........LLQKDAFLFVQD.....RLNHEHK.........NTEHHRPD
Q8SY05_DROME/180-657............VSAMITYCRRPPFDKVS............QKDAFSFVHP.....RKDQIE............NPTTP.

PF01676

DEOB_LACLM/6-406..........PLKTIPAAQKPAAYVTKLEEISK...........GKDTMTGHWEIMGLNIQ..................T
DEOB_GEOSE/6-388.............GIPKAEKPLAYYTKMQEASA...........GKDTMTGHWELMG..............LRID....T
DEOB_BACSU/7-389.............GVEKTEHPLAYYGKMQEASN...........GKDTMTGHWEIMG..............LYID....K
DEOB_SHIFL/2-406.......TGFIPAGMDGNAEVIGAYAWAHEMSS...........GKDTPSGHWEIAG............VPVLFEW...G
DEOB_HELPY/3-406.......ANELPLGFQSQPNLIGAYAYAQELSS...........AKDTISGHWEMMG............APVLFEW...G
YHFW_ECOLI/2-397.......LGYAPGDMQPSDSATWGVAELQHE.............GGDTFMGHQEILG........TRPLPPLRMPFR..D
APGM2_ARCFU/1-380.......LGVDVRKHYTGRGPIEALAR.................GVK...GKLVFRCNLVKVE......DGVMVDYSGGR
APGM2_METTH/4-396.......MGYDPRRYYTGRGPLEAASI.................GVELGDDDVAFRCNLINADER.......IVDFNAGH
APGM1_ARCFU/1-399.......LGYDPYKYYSGRGPIEAAGV.................GIEIKPGDVAFRANFATVEGEGSIFDKTVVDRRAGR
APGM1_METJA/4-402.......LGYNPYEVYTGRGPLEAFGV.................GLDLKEGDIAFRCNFATVDE.....NFVVLDRRAGR
APGM1_METTH/1-400.......LGYDPYRVYTGRGPFEAAGV.................GLDVKPGDIAFRCNFATADE.....DMIITDRRAGR
APGM_PYRHO/5-403.......FGYDPYETYRGRGFFEALGV.................GLDLSKDDLAFRVNFATLE......NGIITDRRAGR
APGM_AQUAE/13-398.......FGYDPIKYQIGRGILEALGL.................GIDVKDTDIAVRGNYATVEYRNG..KPIVVDRRAGR
APGM2_METJA/1-398.......WGYSLEEF.PGRGVIEALGE.................DIEIEKNAIYLRASLGFVKKDEK..GFLVIDRRTKD
GPMI_PORPU/7-514QELVKIGNSIENKSFFNNVQLNCACDHAISTQTSLHLIGLCSNGGVHSHLDHLLALIHVAESKKVPNLYIHLITDGR..D
GPMI_ANTSP/7-506QDLVKISKSIKNKEFFNNYQLHNIYKYSCEKNSKVHIVGLCSNGGVHSHINHLKALIQI.SKQYKVMTCLHLITDGR..D
GPMI_SYNY3/7-511QELVRISDAIEDGTFFDNQALIEVCQRVRDRRGKLHLIGLCSDGGVHSHIDHLLGLIDLAKLQGISQLCIHAITDGR..D
GPMI_PSESM/6-504QDFTRVTKAIRDGEFFENPTICAAVDKAVSAGKAVHIMGLLSDGGVHSHQDHLVAMAELAVRRGADKIYLHAFLDGR..D
GPMI_ECOLI/6-508QDLTRLDVEIKDRAFFANPVLTGAVDKAKNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGR..D
GPMI_BACSU/4-506QSLTRVNVAIREGEFERNQTFLDAISNAKENNKALHLFGLLSDGGVHSHINHLFALLKLAKKEGLTKVYIHGFLDGR..D
GPMI_MYCGE/3-500TGLSLINQHIKDRSFFANKAFLKTIEHVEKNHSKIHLIGLFSNGGVHSHNEHLLALIELFSKH..AKVVLHLFGDGR..D
GPMI_MYCPN/3-501TGLSLINQNIKTGAFHHNQVLLEAIARAKANNAKLHLIGLFSHGGVHSHMDHLYALIKLAAPQ..VKMVLHLFGDGR..D
GPMI_HELPY/3-489QDLVKISLSLQNDELKNNPAFLNTIQK....SPVVHLMGLMSDGGVHSHIEHFIALA.LECEKSHKKVCLHLITDGR..D
PMGI_MAIZE/20-552QGAKLVDQALASGKIYDGDGF..NYIKESFESGTLHLIGLLSDGGVHSRLDQLQLLLKGVSERGAKKIRVHILTDGR..D
PMGI_TOBAC/20-552QGAKLVDLALASGKIYEGEGF..KYVKECFEKGTLHLIGLLSDGGVHSRLDQVQLLLKGAAKHGAKRIRVHALTDGR..D
PMGI_MESCR/20-552QGAKLVDLALESGKIYDGEGF..NYIKESFETNTLHLIGLLSDGGVHSRLDQLQLLLKGSAERGAKRIRVHILTDGR..D
PMGI_RICCO/17-549QGAKLVDLALASGKIYEGEGF..KYVKECFDKGTLHLIGLLSDGGVHSRLDQLQLLLKGAAEHGAKRIRVHVLTDGR..D

PF00245

PPBN_MOUSE/51-486------------TAFLCGVKT--NMKVIG------------------------------------------------LSA
PPB4_BACSU/49-459------------TALATGVKT--YNNAIG------------------------------------------------VD.
PPB3_BACSU/43-455------------TAMSAGIKT--YNNAIA------------------------------------------------VD.
PPBT_BOVIN/51-490------------TAYLCGVKA--NEGTVG------------------------------------------------VSA
PPB_BOMMO/74-515------------TAYLCGVKA--NQGTPG------------------------------------------------VTA
PPB_YEAST/66-527------------TAFACALKS--YNGAIG------------------------------------------------VD.
STRK_STRGR/41-448------------TAWATGRRT--VNGRVS------------------------------------------------KS.
PPB1_HUMAN/55-490------------TAYLCGVKG--NFQTIG------------------------------------------------LSA
PPBI_MOUSE/52-486------------TAYLCGVKT--NYKTIG------------------------------------------------LSA
PPB_ECOLI/64-470------------TAWSTGVKT--YNGALG------------------------------------------------VD.

PF08665

Q2RKS0_MOOTA/260-429------------RALFCGRP.......AL---------------------------------------------------
O32495_DICNO/401-579------------QSIFSGKPPLYFPSSIN---------------------------------------------------
B0K8X1_THEP3/380-556------------QAIFSGDIPLYFKDTIF---------------------------------------------------
Q72AH5_DESVH/438-616------------AALLPNKALAIADNETG---------------------------------------------------
Q4BWC0_CROWT/438-619------------AALLPHDTLEIIDHPQA---------------------------------------------------
Q8Q0H3_METMA/497-672------------ASLLPHKTLEYK...EK---------------------------------------------------
Q8TNC5_METAC/496-671------------ASLLPHNALEYR...GR---------------------------------------------------
Q3A8U0_CARHZ/461-637------------AALLPHKKIEID..SDY---------------------------------------------------
B1YIB9_EXIS2/462-638------------AALLPHRKLDFD..ENG---------------------------------------------------
Q5P0R1_AROAE/485-661------------AALLPHHSLAYKINSNL---------------------------------------------------
A4JFG3_BURVG/484-660------------ASLLPHERLAYKSNANL---------------------------------------------------
Q2W5M5_MAGSA/475-648------------AALLPHSKISYS..DKG---------------------------------------------------
Q8RL18_PRORE/500-676------------AALLPHKALSYQPEQGT---------------------------------------------------
Q8ZK15_SALTY/474-650------------AALLPHDEICYQPGSGD---------------------------------------------------
Q7MVV4_PORGI/231-425------------NAIFSGLMPLQIEKMFP---------------------------------------------------
Q53943_STRCH/527-704------------TSLFAGTL.......TK---------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480------------RGCQAESLN...HPEAL--------------LHMNTGSR..............LGGDPAVGAWATYGL
Q7UHL2_RHOBA/84-501------------RSMHGDSVN...HPQSV--------------YQMNTGSI..............LMGNPSVGSWVAYGL
Q7UN58_RHOBA/63-468------------RSMHTRGQS...HGQAV--------------GMVNTGSD..............NFVRPSVGAWISYAL
Q98BS1_RHILO/39-404------------PAM.PVFARLFKANQAA--------------VVHAA................................
Q7UHK7_RHOBA/71-478------------KSCYSESND...HVPAI--------------YQINSGLP..............RPGFPTAGAWVTYGL
Q7UKW9_RHOBA/100-522------------KSMHTEAIN...HDPAI--------------TFFQTGSQ..............IAGRPSLGSWISYGL
Q8P3X8_XANCP/29-384------------PVVGESLLPLWQRKQLA--------------FVPFA................................
Q7UZ35_RHOBA/49-467------------RSMHTEQIN...HDPAH--------------AFMNTGSI..............QKGRPSMGSWFLYGL
Q7UFP1_RHOBA/49-464------------KSMHTEQIN...HDPAH--------------TFFNTGTA..............ISGRPSMGSWVLYGL
Q7MLK9_VIBVY/33-420------------PAM.SELQGLVNRGKAI--------------PIVNSGVL....................VEPTTKAEL
Q7US09_RHOBA/66-482------------RSCWTNGIN...HSGGI--------------CQMNTGSQ..............FAGRPSLGSWVTYGM
Q7VYL6_BORPE/29-381------------PAVKDSLLPFYQRGELA--------------FVPFA................................
Q7UDW2_RHOBA/77-502------------KTVKTDQFN...HGPAQ--------------LMVHTGAA..............PMGSPSIGSWVTYGL
Q87HJ3_VIBPA/35-425------------PKL.SALAPLFQQGDAN--------------LVLNSGIL....................NQPVTKQAI
Q7UM62_RHOBA/63-489------------KSMHTTQFN...HAPAQ--------------LLLHTGSQ..............NLGSASFGAWTMYGL
Q7UJ64_RHOBA/59-474------------RGCQVDSVN...HPTAM--------------YQMNCGNR..............FGGDPGIGAWVTYGL
Q7UIF5_RHOBA/61-494------------RSMWTEDSN...HG.AQ--------------LQFHTGR............HRVDGFFPTVGSWATYGL
Q7UYJ8_RHOBA/60-484------------HSLTGKTNT...HGPGE--------------NFMSTGQT..............LDGFPSMGAWATWAL
Q7MCK0_VIBVY/38-408------------PAL.DALVPLIDEGYGL--------------PIMANGQC.............................
Q9A5N3_CAUCR/44-506------------PLM.PNMQKAFNAGRLA--------------ALANVGTL....................VAPLTKAQY
Q7ULC1_RHOBA/52-445------------RSIRHDQGN...HGAGN--------------HYMMTGAPPRIPVGC....GAFVSFHPSLGSVVSKEI
Q7UQT8_RHOBA/50-438------------RGVSHTLAA...HQLGR--------------EYINCGTR...........PIPSLEYPSYGAVMTREC
Q7UQ29_RHOBA/54-472------------NSMYADVPN...HEPSL--------------LLMNCGEA..............RLIRPAMGSWLTYGL
Q7UGB9_RHOBA/69-492------------KTLHTDQFN...HAPAQ--------------MCLLSGFE..............RFGRPSIGSWVSYGI
Q7UPP6_RHOBA/56-434------------RSLSTETGA...HEQGR--------------YLMRTAYK...........QINSIQHPGMGAWMVDRQ
Q7UI66_RHOBA/46-421------------RSMSTREAD...HSRGS--------------YYMHTGYV...........PNPNIEHPSYGSVIAHEL
Q7UVE3_RHOBA/81-505------------KSMVTDEIN...HAPAM--------------TKFLTGHQ..............LPGRPSFGAWASYGL
Q7UW70_RHOBA/70-497------------RSMSYTPNGLFNHTAAI--------------YQMMTGYTTDKVSPSGQLEPPSPKDFPNFGSNIVKMK
Q7UKM6_RHOBA/69-495------------RSMWTEAIN...HDPAV--------------TYINTGSQ..............QMGHASMGAWLSYGL
Q7UTL9_RHOBA/100-490------------RTVHHDVID..EHAAAT--------------NRMHTGRV...........VTGTVTYPSLGSVVAHEL
Q7UGF5_RHOBA/94-499------------RSCYHTAAA..VHDAGW--------------QMLQTGRQ...........FTGGVNYPHAGAVVEYLQ
Q9A6V4_CAUCR/38-393------------PDL.KAVHALTQKGQAR--------------IAPAI................................
Q7UYC8_RHOBA/101-527------------DSMHTESIN...HDPGK--------------TAFCTGTE..............LPGKPSMGAWLSYGL
Q7UR29_RHOBA/60-444------------RSMSHGEAA...HERGT--------------HNMFTGYK...........PSPALSYPSFGAVVSHEY
Q7UYM7_RHOBA/45-446------------RGLSTKEGD...HGRGS--------------YLMRTGQK...........PMGPVQYPCIGSAIGKQL
Q7UV65_RHOBA/50-468------------NSLHGTNPA...HGGAS--------------MKLHTGSD..............VFVRPSMGAWVTYGL
Q7UJ54_RHOBA/70-497------------RSTHTDAIN...HDPGK--------------TLFCTGSE..............IPGKASLGSWLSYGL
Q7UJ36_RHOBA/99-512------------RSMKTDAFN...HAPAQ--------------LMMSTGSQ..............QFGRPSMGSWTTYGL
Q7NT93_CHRVO/33-383------------PSL.APLMPLWQDKQLA--------------LLQGV................................
Q7UEK9_RHOBA/80-501------------HSLTNKSNT...HGPAE--------------NVMNTGFT..............FDGFPSMGAWVNFAL
Q7UQW1_RHOBA/70-487------------RSMVSEFSE...HTFAN--------------YFLHTGSG..............LQGRPSMGAWVNYGL
Q7UPF7_RHOBA/65-448------------RSVVGKEGD...HERAI--------------YAMKSGYR...........PDPTLEHPSIGSILCHAD
Q7UYR5_RHOBA/95-521------------KSMYTEAIN...HDPAI--------------TYICTGNQ..............LPGKASLGSWLSYGL
Q7UWA1_RHOBA/72-492------------HSLTADSPI...HGSAM--------------LMMNSGKI..............LSGSPALGSWLTYGL
Q89DL5_BRAJA/42-392------------PAM.PEFARMYRDMHAA--------------VIHAV................................
Q7URV7_RHOBA/77-499------------HSLNTDTSA...HPQGE--------------NFLNTGFT..............MEGFPSFGSWVTYAL
Q7MDY0_VIBVY/67-457------------PAM.SKLANVFNQGDAN--------------VVLNSGIL....................CQPTTKQQI
Q7UH70_RHOBA/75-488------------RSMVTDVPN...HEPGL--------------MMMNCGDI..............VRPRPSVGAWTLYGM
Q7UVE1_RHOBA/82-507------------KSMQTDQFN...HGPAQ--------------LMVHTGQT..............RMGNPSIGSWVTWGL
Q7UQ53_RHOBA/45-480------------HNMVGKTGV...HSQAT--------------YLQATGFQ..............RPGFPGMGSWVSYGL
Q7UP10_RHOBA/69-492------------RSMYTEAIN...HGPAV--------------TFMQTGSM..............FPGRPSMGAWVDYGL

PF04185

PHOX_KLULA/65-312------------.................---------------------------............DE..........
Q9S816_ARATH/13-380------------KPWDSG.......HPDP---------------------------NPGPATMSGFAQ.....NA..ERK
Q9SRQ6_ARATH/16-381------------KPFSDESPYPDPK....---------------------------......MNGFVQN.......AEAI
Q47936_FRANO/55-471------------YRLDRNFQPCSQNHEYH---------------------------QEISSFNGGLMNKFVEHGGHDNDT
Q97V43_SULSO/27-365------------LPIAYSHPYYSNAYSTR---------------------------DPYEGWDS.YHGDYWF...DTDKG
Q9LML5_ARATH/38-396------------DPKMNGFAQQ.......---------------------------....................SESM
PHLB_MYCTU/52-435------------.PLVAGECVNDPDHSWI---------------------------GMHNSWNGGA.NDNWL.PAQVPFS
Q9A412_CAUCR/40-437------------..TFAHMRVEGTPHSWT---------------------------DAQDAWDQGR.MDRW.........
PHLC_PSEAE/51-437------------TKVTSAQWVSSQNHEWS---------------------------AFHAIWNQGR.NDKWM........
PHLD_MYCTU/50-429------------.PFLDGACVNDPDHSWV---------------------------AMHESWNGGV.NDNWL.PAQAKTR
Q9SMN8_ARATH/1-336------------IPSMMGFVEQ.......---------------------------....................ALSM
O53361_MYCTU/50-282------------................F---------------------------INSLAANGAM..............
O81020_ARATH/27-389------------PPPMNGFV.........---------------------------......QQAYSED..........P
Q9KH04_BURML/84-547------------KPLPNGVITRDLWHRFY---------------------------QNQMQINGGR.NDQF........A
PHLN_PSEAE/48-422------------...TSAQRVDGTPHTWP---------------------------DAQQAWNEGR.MDKWL........
PHLN_BURPS/47-438------------.NLGMQFL.QDLPHGWQ---------------------------DMHGAWNKGR.YDRWI........
Q983N8_RHILO/60-507------------FNVPLSVTTHDLWHRYY---------------------------QNQMQINGGK.NDMF........V
PHLA_MYCTU/51-431------------.PFLDGECVNDPEHQWV---------------------------GMHLAWNGGA.NDNWL..PAQATT
Q98ES1_RHILO/58-274------------.................---------------------------........................
PHLC_MYCTU/52-433------------.PNGVGECVNDPDHQWI---------------------------AAHLSWNGGA.NDGWL..PAQART

PF14707

F1QB82_DANRE/433-568------------AFFFTPDFYP----------------------------------------------------------
F1QQ07_DANRE/367-495------------AHYYTRGAAH----------------------------------------------------------
ARSA_HUMAN/368-502------------AHFFTQGSAH----------------------------------------------------------
F2UD41_SALS5/491-612------------MHFKTGGSHA----------------------------------------------------------
F1QFT2_DANRE/220-353------------AHYWTWSNSM----------------------------------------------------------
ARSH_HUMAN/418-551------------AHYVTPKFYP----------------------------------------------------------
ARSG_CANFA/402-522------------AFYVSGGAKA----------------------------------------------------------
A8XD87_CAEBR/394-528------------VHYKT.SPIF----------------------------------------------------------
ARSG_MOUSE/402-522------------AFYITGGAKA----------------------------------------------------------
A0YAF7_9GAMM/381-478------------VHFKTVANIY----------------------------------------------------------
C3YQ76_BRAFL/419-552------------AHYATPKWDP----------------------------------------------------------
Q5XG10_XENLA/375-508------------AHYWTWSNSW----------------------------------------------------------
A7V8P9_BACUN/356-447------------IHFSTLTDPY----------------------------------------------------------
ARS_HEMPU/396-526------------AHFRTQRVRS----------------------------------------------------------
Q4RYA1_TETNG/304-429------------AFYFTPNFYP----------------------------------------------------------
F2UCT8_SALS5/90-221------------MHYVTSESLK----------------------------------------------------------
C3YZM0_BRAFL/417-549------------AHYITPIWDE----------------------------------------------------------
A7SK49_NEMVE/435-563------------AVFKTPN...----------------------------------------------------------
GALNS_CANFA/377-510------------AHFWTWTNSW----------------------------------------------------------
Q6GMA1_XENLA/439-573------------AHFITPVFFP----------------------------------------------------------
A9VBN0_MONBE/428-544------------LFYKTRGVEP----------------------------------------------------------
C3ZST4_BRAFL/433-562------------AHFVSYNWDP----------------------------------------------------------
A6QLR7_BOVIN/402-522------------AFYVTGGARA----------------------------------------------------------
STS_HUMAN/437-572------------AFFFTPNFNP----------------------------------------------------------
Q4TCJ7_TETNG/242-385------------VHFFTPNFSP----------------------------------------------------------
F1NFQ0_CHICK/445-579------------AHYVTPNFHP----------------------------------------------------------
E4YGB6_OIKDI/449-582------------LHYFQPSWDE----------------------------------------------------------
D2HFI2_AILME/436-570------------VHYMTPRFHP----------------------------------------------------------
E1FX25_LOALO/406-541------------VHFKT.SPIF----------------------------------------------------------
F1R580_DANRE/251-371------------AFYITGGSVA----------------------------------------------------------
O16138_HELER/402-534------------AHFKTQRVLS----------------------------------------------------------
Q32KK0_RAT/450-603------------AHFVTPTFDP----------------------------------------------------------
D2HXW7_AILME/434-569------------AFFFTPKFSP----------------------------------------------------------
D7VQY4_9SPHI/353-442------------LHVKT....Y----------------------------------------------------------
Q6DJK3_XENLA/433-566------------VHYMSPKFSP----------------------------------------------------------
Q32KK2_RAT/368-502------------AHFFTQGSAH----------------------------------------------------------
Q32KI1_CANFA/444-578------------VHYMTPLFHP----------------------------------------------------------
E4XNY3_OIKDI/402-533------------MHVYTWSGTK----------------------------------------------------------
C3ZQB5_BRAFL/418-551------------AHFYSMELPG----------------------------------------------------------
E6ZGQ8_DICLA/413-534------------AFYITGAAEA----------------------------------------------------------
A9UXW0_MONBE/287-431------------LHFATPVWTS----------------------------------------------------------
Q1YP24_9GAMM/409-501------------VHFVTQGAYG----------------------------------------------------------
ARSE_HUMAN/448-582------------VHFVTPVFQP----------------------------------------------------------
F1KQC6_ASCSU/1702-1837------------VHFKT.SPIF----------------------------------------------------------
F0Y2N2_AURAN/404-544------------LHYATGP...----------------------------------------------------------
Q4S4L1_TETNG/407-528------------AFYLTGAAKA----------------------------------------------------------
Q7ZWB8_DANRE/433-548------------AFFFTPDFYP----------------------------------------------------------
A3XMW9_LEEBM/382-476------------AHYVTQSAYA----------------------------------------------------------
C3YBU1_BRAFL/392-524------------AHFVSYNWDP----------------------------------------------------------
Q4RJR3_TETNG/343-474------------AHFYTQGASH----------------------------------------------------------
ARS_STRPU/411-541------------AHFKTQTDSS----------------------------------------------------------
F2UKF0_SALS5/383-527------------LHFATQIWAS----------------------------------------------------------
Q0C069_HYPNA/397-504------------AHFSTYGAFG----------------------------------------------------------
ARSF_HUMAN/440-574------------AHYVTPVFQP----------------------------------------------------------
A4AN36_MARSH/378-468------------AHYITQGVYG----------------------------------------------------------
F1NW57_CHICK/376-509------------AHYWTWSNSW----------------------------------------------------------
C3Y4J9_BRAFL/389-521------------VHFTTPNWTP----------------------------------------------------------
C1BQY6_9MAXI/368-497------------AHFYTQGNEL----------------------------------------------------------
C3ZQC1_BRAFL/339-471------------AHFYSMELPT----------------------------------------------------------
Q4SI19_TETNG/404-542------------AHYWTWSNSW----------------------------------------------------------
STS_MOUSE/445-581------------AFYFTPNFAP----------------------------------------------------------
A4CMB0_ROBBH/401-491------------AHFYTKEAYV----------------------------------------------------------
STS_RAT/436-573------------AFYFTPNFDP----------------------------------------------------------
ARSD_HUMAN/451-585------------VHYTTPQFHP----------------------------------------------------------
B4DQ74_HUMAN/301-421------------AFYITGGARA----------------------------------------------------------
A5D7J7_BOVIN/445-576------------VHFTTPIFQP----------------------------------------------------------
Q32KI0_CANFA/435-568------------VHYVTPVFQP----------------------------------------------------------
F1R2X2_DANRE/342-476------------VVFFSPVFSP----------------------------------------------------------
F2U742_SALS5/410-536------------IYWATQSTTT----------------------------------------------------------
A9V957_MONBE/437-571------------AKYRISNTAG----------------------------------------------------------
A9UPM8_MONBE/326-452------------VYWATASTTS----------------------------------------------------------
B9QU81_9RHOB/44-158------------AHFVIQEHGW----------------------------------------------------------
Q6AX40_XENLA/368-500------------AHFYTQGALH----------------------------------------------------------
F1NWF7_CHICK/360-492------------AHYFTQGSFH----------------------------------------------------------
C3Z258_BRAFL/432-564------------AHFVSYNWDP----------------------------------------------------------
A9V7E7_MONBE/452-571------------AHYVTSHWYT----------------------------------------------------------
ARSA_BOVIN/368-502------------AHFFTQGSVH----------------------------------------------------------
A6CB11_9PLAN/382-473------------AHFITKPAYG----------------------------------------------------------
F0SFZ7_PLABD/380-468------------AHFITEGCYG----------------------------------------------------------
C3Y4X6_BRAFL/434-568------------AQFATYPWLP----------------------------------------------------------
C6W2Y6_DYAFD/349-461------------LVFAHPGRTY----------------------------------------------------------
E1BU03_CHICK/378-498------------AFYTTGGAKA----------------------------------------------------------
A7SK50_NEMVE/483-612------------AHFMTPKYTP----------------------------------------------------------
A1L2N0_XENLA/374-506------------AHFYTQGAFH----------------------------------------------------------
C3ZV84_BRAFL/657-790------------AHFWTWTNGQ----------------------------------------------------------
A7SQ82_NEMVE/425-557------------AFFFTPKWRP----------------------------------------------------------

PF00884

C3LB12_BACAC/143-439-----------PSQKEI--PSVASELKK------------------------------------Q.GYYASAIH------
O06776_MYCTU/43-460-----------VLPNTM--SPIARTLKL------------------------------------N.GYNTAQFG------
O25301_HELPY/294-587-----------ILPSFP--MAIGNITKT------------------------------------L.GYKNNFYY------
O34609_NEIME/232-524-----------IKAEHQ--DNLLDIVQR------------------------------------A.GVEV....------
LTAS2_BACSU/245-536-----------KAQNTL--QSVPAILKS------------------------------------K.NYTSATFH------
O43113_NEUCS/45-420-----------SQGFNE--AYLPVWLQK------------------------------------A.GYDTYYTG------
O65931_MYCTU/212-635-----------VRPRSC--AALPRILRD------------------------------------N.GYVTGAFG------
O82879_STRMU/460-745-----------PDMSVF--PSISNQFKS------------------------------------K...NRVVIH------
O85099_ECOLX/237-530-----------DLYLTQ--PSLMNMMKQ------------------------------------A.GYKT....------
YEJM_ECOLI/260-505-----------LSTRTP--AALITALNQ------------------------------------Q.GYQLGLFS------
ARS_HEMPU/52-373-----------GLPKSE--LTIAEAMKE------------------------------------A.GYATGMVG------
ARS_CHLRE/27-385-----------GLGIDQ--SYLPLWLKD------------------------------------Q.GYNTYYVG------
ARSA_HUMAN/21-346-----------GLPLEE--VTVAEVLAA------------------------------------R.GYLTGMAG------
ASLA_ECOLI/86-419-----------GGLQGL--TTLPQLLHD------------------------------------Q.GYVTQAIG------
EPTA_ECOLI/236-527-----------ELAQHQ--EGVLDIIQR------------------------------------A.GINV....------
YIDJ_ECOLI/4-341-----------APGKNI--STMGRYFKD------------------------------------A.GYHTCYIG------
ARSB_FELCA/47-366-----------CVPLDE--KLLPQLLKE------------------------------------A.GYTTHMVG------
GALNS_HUMAN/31-355-----------GIPDSE--QLLPELLKK------------------------------------A.GYVSKIVG------
EPTB_ECOLI/248-538-----------QRTLKE--QNIFAVLKQ------------------------------------L.GFSSDLYA------
Y1005_HAEIN/211-475-----------GETVYT--DNIISLAKK------------------------------------A.GVKT....------
GNS_CAPHI/54-391-----------QKIQEP--NTFPAILRS------------------------------------MCGYQTFFAG------
STS_MOUSE/35-421-----------GLPPSE--VTMARLLKG------------------------------------R.GYATALIG------
ARS_STRPU/67-388-----------GLPLYE--VTIAEAMKG------------------------------------A.GYTTGMVG------
SPHM_HUMAN/23-328-----------....KV--RSLPLLLSQ------------------------------------A.GVRTGIIG------
ARS_PSEAE/5-420-----------HLNERV--VALPELLRE------------------------------------A.GYQTLMAG------
YHBX_ECO57/223-491-----------DIHNYP--DNIINMANQ------------------------------------A.GFQT....------
CGMA_RHIME/269-561-----------YIRNPI--PSLATFFRG------------------------------------E.GYVSRAIH------
YBIP_ECOLI/217-483-----------GKPQFQ--DNFVTLANR------------------------------------A.GFQT....------
YDEN_ECOLI/58-408-----------GIPLTE--TFLPELFQN------------------------------------H.GYYTAAVG------
P95059_MYCTU/37-466-----------RIPADT--ALLPEVLAE------------------------------------H.GYNTYCVG------
P95081_MYCTU/5-389-----------LRAGEV--PTLGNWFRA------------------------------------A.GYDTHYDG------
ARS_VOLCA/26-386-----------SLGIDK--SYLPVWLQN------------------------------------L.GYNTYYVG------
Q45087_9BURK/4-384-----------PLDQRH--LNLGKALRA------------------------------------I.GYDPALIG------
Q833K3_ENTFA/256-543-----------PKMTEL--PSIVSLLKE------------------------------------Q.KYQTTAIH------
Q840W2_STRMU/270-555-----------PSMSVF--PSISDQFKS------------------------------------K...NRIVIH------
Q8DUS0_STRMU/503-788-----------PDMSVF--PSISNQFKS------------------------------------K...NRVVIH------
Q8G592_BIFLO/306-604-----------PSQHWT--PTINQLWGA------------------------------------P..VNSLGYH------
Q8K804_STRP3/480-765-----------PKMAKP--HTISEFYQG------------------------------------K...NRIAMH------
Q8P1I3_STRP8/480-765-----------PKMAKP--HTISEFYQG------------------------------------K...NRIAMH------
Q8XK47_CLOPE/257-551-----------LKKQPV--ESLAYILHD------------------------------------Y.GYGTNVIH------
Q984T6_RHILO/281-574-----------YVRTPT--PSVATFLKS------------------------------------E.GYRARAIH------
Q98EG2_RHILO/158-441-----------QFLPGL--TCLGDVLKA------------------------------------R.GYRQNFVT------
Q9A0F9_STRP1/480-765-----------PKMAKP--HTISEFYQG------------------------------------K...NRIAMH------
Q9AI31_BURML/214-497-----------FVRRIS--ASLAGWFRR------------------------------------A.GYRTTAIH------
Q9CKD9_PASMU/287-557-----------NSQHGF--FTIAELLAK------------------------------------Q.GYHTSFIY------
Q9CM05_PASMU/231-523-----------VQADHQ--DNLLDILQR------------------------------------A.GIAI....------
Q9HVQ5_PSEAE/238-530-----------DRFLTD--PSLMNLMKQ------------------------------------A.GYKT....------
Q9HYT4_PSEAE/238-529-----------KKAKTH--EGLLDILQR------------------------------------A.GVQV....------
Q9I2D3_PSEAE/231-522-----------ARARTQ--EGLLDVLQR------------------------------------A.GLRV....------
Q9I4M0_PSEAE/223-501-----------NPARAR--ECLPAQLRQ------------------------------------H.GFSTHFLQ------
Q9JXJ7_NEIMB/214-487-----------QISGGD--TNMFRLAKE------------------------------------Q.GYET....------
Q9KKK2_VIBCH/240-530-----------SRADNQ--DNVLDILQR------------------------------------A.GISL....------
Q9PGC7_XYLFA/245-535-----------SKIRGH--QSLLHVLER------------------------------------A.RIST....------
Q9RBI1_ACIAD/237-531-----------SLATHR--EGLLDITQR------------------------------------A.GYDV....------
Q9RMJ0_NEIME/232-495-----------LPGEPN--NNIVSLAKQ------------------------------------A.GFRT....------
Q9X6R2_PSEAI/20-300-----------EGGHKF--SGLPQLLSA------------------------------------R.QYEDVYVY------
Q9ZDJ9_RICPR/218-505-----------ENSRLE--NSFLSILTN------------------------------------L.GFNT....------
Q9ZJJ5_HELPJ/225-518-----------KPWYHY--HNMIDIFKR------------------------------------S.HYET....------
Q9ZN39_HELPJ/222-504-----------....AY--ENLPTYLTK------------------------------------A.GVKV....------

PF01663

ENPP3_MOUSE/161-485...........VHLNKN--..FSLSSVE------------------------------------KSNPAWWS........
O29992_ARCFU/4-416...........RAKGEY--VGYDFELTM------------------------------------P...............
O50518_STRCO/58-383.........PDTGALMN--QLRWQPWTA------------------------------------PGPWQPY.........
Q73VT6_MYCPA/42-363.........PGTDRVLN--HVRWRDDPA------------------------------------PDAWQPL.........
Q6A8W7_PROAC/44-359..........PSGRVMN--ALSWVNGDD------------------------------------PEVIQPH.........
Q6N507_RHOPA/30-497........SVPPAGNTV--VPFIENDDV------------------------------------LGDIDNHFDGN...YL
Q7WNM8_BORBR/6-370...........LLREAD--GLANHSAGD------------------------------------PGFVERLRAA......
O58841_PYRHO/4-322...........RLSGVR--VKFYEYDVA------------------------------------FNPHKVIKAPLIQDIL
O69954_STRCO/13-378...........FRELGD--VLLWRQHNG------------------------------------LVAGD...........
Q7AYA7_9RHIZ/4-370...........FRDLME--VWLWRQSNR------------------------------------LVAGE...........
Q7NU73_CHRVO/4-375...........FRELAE--VWFWRQSNR------------------------------------LVGGE...........
Q8YZP2_NOSS1/4-370...........FRDECE--IKFWRQSNK------------------------------------LIQAP...........
Q7UKE3_RHOBA/4-350...........YRDTQE--IRFWQQTRT------------------------------------LVQGD...........
Q71ZQ2_LISMF/5-366...........PEKDSP--DWYWYKKAI------------------------------------QVP.............
Q73E52_BACC1/9-380...........PGRESP--DWHWYRKSI------------------------------------QGT.............
Q8XKL9_CLOPE/10-374...........FKDENP--NWNWYGNKI------------------------------------KGE.............
Q97LS7_CLOAB/8-378...........IGVKTQ--EWYWQKKYI------------------------------------KVP.............
O45359_CAEEL/26-353...........NNWKDN--LKFQNFTAD------------------------------------SDFSRDWWS.......
Q22129_CAEEL/24-374...........RKTNFT--..FERGTGP------------------------------------NDTEDVWWDD......
Q981Q5_RHILO/5-379.................--..FRGDASV------------------------------------APLAEDLL........
O69013_ZYMMB/50-367...........AHITPD--SHFKMSDHQ------------------------------------A.ATDRRWWD......
Q9A8S4_CAUCR/74-393...........PSVSAE--K.FTMR...------------------------------------..SLDPAWWS......
Q8PIS1_XANAC/48-366...........PTLGG.--..FWLSKSE------------------------------------A.VGDARWW.......
Q9PAB9_XYLFA/40-358...........PLLGA.--..FESENQE------------------------------------A.ISDGRWW.......
Q7MXP5_PORGI/37-349...........SLLGI.--..FRISDRK------------------------------------A.VETPGFW.......
ENPP2_RAT/165-477...........PVFDAS--..FHLRGRE------------------------------------..KFNHRWW.......
Q7ZXN7_XENLA/166-476...........PVFDAN--..FSLRSRE------------------------------------..KFNHRWW.......
Q6PGY9_DANRE/161-472...........PSFDAN--..FNFRGKE------------------------------------..KLNHRWW.......
ENPP1_RAT/194-520...........PKMNAS--..FSLKSKE------------------------------------..KFNPLWY.......
Q6VZU9_CNPV/107-431...........REDDIE--..FTVQSEE------------------------------------TSEKD.WFK.......
Q70HC0_FOWPV/120-443...........RGTDIE--..FTIASEE------------------------------------TEEVE.WFG.......
Q7F5L2_ORYSJ/92-418...........PISGDY--..FTMS...------------------------------------..SHEPKWW.......
Q9FS13_SPIOL/96-418...........PITGDK--..FSMA...------------------------------------..SHEPKWW.......
Q9SU83_ARATH/109-435...........PETGNV--..FTMA...------------------------------------..SHEPEWW.......
Q9SU81_ARATH/60-394...........PVTGEV--..FNK....------------------------------------..GLQPKWW.......
Q9SU82_ARATH/57-390...........PVSGEL--..FNR....------------------------------------..NLNPKWW.......
YGK5_SCHPO/76-404...........PVTGKQ--..FVNSMPE------------------------------------C.NKDPTWWD......
Q6BTN4_DEBHA/173-514...........PKLNKQ--..FVNTNPK------------------------------------QGGLDPDFWQ......
Q6C6J4_YARLI/277-608...........PDLNKQ--..FVNTDPS------------------------------------R.SRDVAFW.......
Q7SI20_NEUCR/254-584...........PTLREE--..FYYTDPA------------------------------------R.SMDPKWW.......
NPP1_YEAST/170-545...........PDLNEE--..FHPG...------------------------------------..VLDPRIWNN....N
Q6FKX1_CANGA/187-587...........SKNEVE--..YRPG...------------------------------------..IIDPRVWV.....N
Q757R2_ASHGO/153-497...........DTLKKE--FVFVDS...------------------------------------..PQDPAFWK......
Q6CX45_KLULA/136-460...........SKNDVE--..FQIN...------------------------------------..DISSRMNTF...WN
ENPP4_XENLA/30-339...........ADTKQV--..FHMN...------------------------------------..DSHSKWWD......
ENPP4_HUMAN/28-339...........AVTKKH--..FSDSN..------------------------------------..DKDPFWWN......
ENPP5_HUMAN/30-342...........PIRNKS--..FSLDHMN------------------------------------..IYDSKFWE......
ENPP7_HUMAN/33-356...........TTSKVK--LPYHATLGI------------------------------------QR....WWDN......
Q6ZM30_DANRE/31-356...........TTTQEK--KQYYMTQFV------------------------------------ND....YWDN......
ENPP6_XENLA/26-357...........PKKNIS--..FDIGA..------------------------------------..NEDSRLPQW...WD
ENPP6_MOUSE/26-357...........PRTNKS--..FDIGV..------------------------------------..NRDSLMPLW...WN
ENPP1_CAEEL/182-494...........PTISPV--LESMKSTKY------------------------------------EKFFEGE.........
ENPP2_CAEEL/81-386...........PNLYPE--LLAMRKHEA------------------------------------KEFYQAE.........
Q47910_9FLAO/52-512VGGEGKVGQQSPKNLLV--STITDQLKL------------------------------------ATNFQSK.........
Q9KJX5_FLAME/32-489GTTSNSVGQHSPRNLWS--TTVTDQLGL------------------------------------ATNFTSK.........
Q55320_SYNE7/42-494VGSSSNEGLMSPKNLLV--TTVTDELRM------------------------------------ATNFRSK.........
Q89ZL4_BACTN/29-473FMGYYTDQTCAPTKLLT--STIADELKI------------------------------------ATQGKGI.........
Q7MEK0_VIBVY/30-506TQKTALKDGRSPQPILT--TTFSDELAL------------------------------------SSNGKAK.........
Q84EY0_9GAMM/27-481SHTRIAIPGRSPKNLYV--STLSDEVVL------------------------------------SQKGR...........
Q60113_ZYMMB/62-511YCSEDPSLSADPQNYKP--SVHYLKVPT------------------------------------LGDRMKKANP......
Q98IY7_RHILO/32-447KGEPGAEVAFAENIDVD--STRLDGGGK------------------------------------PGDYRSQIDP......
Q7NDL2_GLOVI/4-434...........RMEEKG--DDVFYTLYD------------------------------------ARDVQTE.........
Q9UZH6_PYRAB/14-420...........RHRKGN--SYTEYWIAH------------------------------------SKKVKEP.........
Q9YCR2_AERPE/4-405...........RHRRPG--DVGTSYVVT------------------------------------SRSIAEG.........
Q9X5S9_STRLA/7-409...........RDRGAY--DYGPLKFAT------------------------------------SHSIQAP.........
Q9HSF0_HALSA/15-396...........FQDRET--GSYETYVPM------------------------------------GQDVQAT.........
Q9X5S1_STRLA/5-395...........TDLAPG--DGYRITFPG------------------------------------VRQLREP.........
Q9X5R9_STRLA/7-410...........FYDTQD--PAYGARVTR------------------------------------SGDLGRS.........
Q9X5T4_STRLA/7-389...........YWTCHD--PEYAPQVLT------------------------------------PEHRRHP.........
Q9YCS9_AERPE/3-432...........FLGRKG--QEYRLYPAD------------------------------------SSWYRGY.........

PF02995

Q9VSJ3_DROME/115-607YQRPPSVLMLGIDSISR--VNLIRAMPK------------------------------------TAQYLY.DN-------
Q19148_CAEEL/75-621AVDRYSIDILGFDSTAR--TMFMRHMPR------------------------------------TVEVMA.KL-------
Q21671_CAEEL/74-651DLKEYDVFVILLDSLSY--SQAARSLPR------------------------------------TVSFFKSYM-------
Q9VGG4_DROME/77-573.VKRLSVLILGIDSISH--MHYQRYFSR------------------------------------VRDLIE.GL-------
Q9VQH3_DROME/74-555QKRKLSVMILGVDSISH--MHYMRYFHR------------------------------------VADFIE.HL-------
Q9VAU4_DROME/90-580SKRKPSVLMFGIDSLSR--INLRRTMPK------------------------------------VYKFLT.RD-------
Q9VKK3_DROME/98-598EQERLSVMILGMDSLSH--LNFLRQMRR------------------------------------TANYVRKHL-------
Q9VIP6_DROME/62-563EVHKPSVLIMGLDSTSR--INLRRAMPS------------------------------------VYKFVR.QP-------
Q19486_CAEEL/79-568TSDFPSVIMIGLDSMSR--GNFVRQMQK------------------------------------TYKYMK.EA-------
Q9V9Q1_DROME/66-560DVGSLSVLIVGLDSISQ--MHFHRSMAR------------------------------------TANFLL.SL-------
Q9VF91_DROME/73-581TAPIYNVLMFGFDSLSR--NAFIRKLPR------------------------------------TYEYLTQQL-------
Q9VLG3_DROME/84-577AARKPSVIMYGIDSLSR--INLRRTMPK------------------------------------VFNFLQ.GP-------
Q9V9P7_DROME/68-547SSEKLSVMVLGIDSVSH--MHFVRYFPL------------------------------------VMAFLE.NH-------
O18062_CAEEL/82-553FKDAPNVFIFTIDAMNT--GMAKRSFPK------------------------------------LLSYFKNEF-------
O62436_CAEEL/78-581EKKPYNVYFLGFDSLSQ--MSFRRKLPQ------------------------------------TVKFLEETL-------
Q9W0F7_DROME/16-518LQSKPNVIILGIDSTSR--MNLRRSMPK------------------------------------VHKFLQ.RP-------
Q8SY05_DROME/180-657HRRRPSVLLWGIDSISR--MNLELTMPR------------------------------------MYEYLN.NQ-------

PF01676

DEOB_LACLM/6-406-----------PFPTYP--EGYPEDLLE.KIEEF...............................SGRKIIREANKPYS.
DEOB_GEOSE/6-388-----------PFQVFP--DGFPKELID.ELEKQTG.................................RKVIGNKP...
DEOB_BACSU/7-389-----------PFKVFP--EGFPDELLQ.ELEKRSG.................................RKIIGNKP...
DEOB_SHIFL/2-406-----------YFSDHE--NSFPQELLD.KLVE................................RANLPGYLGNCH...
DEOB_HELPY/3-406-----------YFKDKT--HSFPKEILD.EIVR............................KTKIKGY....LGNCH...
YHFW_ECOLI/2-397-----------VIDRVE--QALVSA.........................G.........WQVERRGDDLQFLWVNQ...
APGM2_ARCFU/1-380-----------ISDEEA--RKVIEELNR.............AKPYDFVKFY............AGKSYRNLLVINKD...
APGM2_METTH/4-396-----------IETAEA--SSLIDALNH.ELET.............RGRFY............AGVSYRNLFVIEGR...
APGM1_ARCFU/1-399-----------I..EDT--SELIKALREIELP........VELLVERG.................TGHRAAVVFRGEG..
APGM1_METJA/4-402-----------ISPEEA--EELEKEIDGLEIDGVKV........................IFKSSKGYRGALVLRGEG..
APGM1_METTH/1-400-----------IRSGTS--.SIARTINSMTIEGFED....VEIIF.................RESTGHRAVLVLRGP...
APGM_PYRHO/5-403-----------ISTEEA--HELARAIQE.............EVDIGVDFIF...........KGATGHRAVLVLKGMSR.
APGM_AQUAE/13-398-----------IPTEEN--KRITAKLQE.AIKEIDG....VQVIIKPG.................MEHRLAIVFRFPEKL
APGM2_METJA/1-398-----------ISREEI--EKLVDSLPT.CVDGYKF..........................ELFYSFDVHFILKIKERN
GPMI_PORPU/7-514-----------TNSNSA--KSFIKLIAD.HIEKKSF....VIISTISGRYYAMD..RDFRWSRTKAAYTVLTSDNSDITN
GPMI_ANTSP/7-506-----------TLPKQA--KLFVKEIID.IIDENYN....TEICTISGRYYSMD..RDCRWSRTEKAYKAMVENSCNQNS
GPMI_SYNY3/7-511-----------TPTNEG--AHFVQQIQA.HLEKIGL....GRIVSVSGRYYALD..RDRRWDRVEKAYRV.MTEDGVGDG
GPMI_PSESM/6-504-----------TPPRSA--KKSLELMDE.TFARLGK....GRIATIIGRYFAMD..RDNRWDRVSTAYNLIVDSSAEFHA
GPMI_ECOLI/6-508-----------TPPRSA--ESSLKKFEE.KFAALGK....GRVASIIGRYYAMD..RDNRWDRVEKAYDLLTLAQGEFQA
GPMI_BACSU/4-506-----------VGPQTA--KTYINQLND.QIKEIGV....GEIASISGRYYSMD..RDKRWDRVEKAYRAMAYGEGP.SY
GPMI_MYCGE/3-500-----------VAPCSL--KQDLEKLMI.FLKNYPN....VVIGTIGGRYYGMD..RDQRWDREMIAYKA.LLGVSKNKF
GPMI_MYCPN/3-501-----------VAPCTM--KSDLEAFMV.FLKDYHN....VIIGTLGGRYYGMD..RDQRWDREEIAYNA.ILGNSKASF
GPMI_HELPY/3-489-----------VAPKSA--LTYLKQMQN.ICNES......IQIATISGRFYAMD..RDKRFERIELAYHSLMGLNHT..P
PMGI_MAIZE/20-552-----------VLDGSS--IGFVETLEN.DLLELRAKGVDAQIASGGGRMYVTMDRYENDWDVVKRGWDAQVLGEAPYKF
PMGI_TOBAC/20-552-----------VLDGSS--VGFMETLEN.SLAQLREKGIDAQVASGGGRMYVTMDRYENDWDVVKRGWDAQVLGEAPHKF
PMGI_MESCR/20-552-----------VLDGSS--VGFVETLEN.DLAQLRAKGVDAQIASGGGRMYVTMDRYENDWSVVKRGWDAQVLGEAPYKF
PMGI_RICCO/17-549-----------VIDGTS--VGFAETLEK.DLENLREKGVDAQVASGGGRMYVTMDRYENDWNVVKRGWDAQVLGEAPYKF

PF00245

PPBN_MOUSE/51-486AARF..NQCNTTWGNEV..VSVMHRAKK------------------------------------AGKSVGVVTTTSVQHA
PPB4_BACSU/49-459...........KNGKKV..KSVLEEAKQ------------------------------------QGKSTGLVATSEINHA
PPB3_BACSU/43-455...........NDGSEA..KTVLEAAKE------------------------------------KGKATGLVATSEITHA
PPBT_BOVIN/51-490ATQR..SQCNTTQGNEV..TSILRWAKD------------------------------------AGKSVGIVTTTRVNHA
PPB_BOMMO/74-515AVPRHDCEASTDVTKRV..QSIAEWALA------------------------------------DGRDVGIVTTTRITHA
PPB_YEAST/66-527...........PHHRPC..GTVLEAAKL------------------------------------AGYLTGLVVTTRITDA
STRK_STRGR/41-448............HDTDRPMPTLLELARD------------------------------------RGYATGSVTTASVADA
PPB1_HUMAN/55-490AARF..NQCNTTRGNEV..ISVMNRAKK------------------------------------AGKSVGVVTTTRVQHA
PPBI_MOUSE/52-486AARF..DQCNTTFGNEV..FSVMYRAKK------------------------------------AGKSVGVVTTTRVQHA
PPB_ECOLI/64-470...........IHEKDH..PTILEMAKA------------------------------------AGLATGNVSTAELQDA

PF08665

Q2RKS0_MOOTA/260-429-------------------GDRVEEERG----------------------------------------------------
O32495_DICNO/401-579-------------------STNSEEKLW----------------------------------------------------
B0K8X1_THEP3/380-556-------------------STNYEEKRW----------------------------------------------------
Q72AH5_DESVH/438-616-------------------TVLVDGQSS----------------------------------------------------
Q4BWC0_CROWT/438-619-------------------IVDVDGYSS----------------------------------------------------
Q8Q0H3_METMA/497-672-------------------EVFVDGINS----------------------------------------------------
Q8TNC5_METAC/496-671-------------------EIFVDGISS----------------------------------------------------
Q3A8U0_CARHZ/461-637-------------------EVFVDGISV----------------------------------------------------
B1YIB9_EXIS2/462-638-------------------RVLVDGKDS----------------------------------------------------
Q5P0R1_AROAE/485-661-------------------DVLADGQPV----------------------------------------------------
A4JFG3_BURVG/484-660-------------------DVMVDAKPS----------------------------------------------------
Q2W5M5_MAGSA/475-648-------------------DVLVDGQSS----------------------------------------------------
Q8RL18_PRORE/500-676-------------------AVYVDGISS----------------------------------------------------
Q8ZK15_SALTY/474-650-------------------IVYADGLST----------------------------------------------------
Q7MVV4_PORGI/231-425-------------------DLWVDEESE----------------------------------------------------
Q53943_STRCH/527-704-------------------GTQADEKRL----------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480GSEN..QNLPGFVVMTE......LAMP.------------------------------------QAGSANWSNGFLPAYY
Q7UHL2_RHOBA/84-501GSEN..QNMPAFVVLPD......PGGGL------------------------------------KGGPPAWGNGYLPASY
Q7UN58_RHOBA/63-468GAGH..PDLPAHVAIAP........ATA------------------------------------HGGPRNYGAAFLPAKH
Q98BS1_RHILO/39-404.......ATGYRERSHFDGQDVLESGFA------------------------------------GPGHVA..TGWLNRAL
Q7UHK7_RHOBA/71-478GSEN..QNLPGYVVLGN......TQGA.------------------------------------KGGPHNWGAGFLPSTF
Q7UKW9_RHOBA/100-522GSEN..DDLPAFVVLVTK.....GQGGQ------------------------------------PLYSRLWGNGFLDSKY
Q8P3X8_XANCP/29-384.......GTDDLSRSHFETQDDIESGQV------------------------------------ATQRRDYRSGFMARLS
Q7UZ35_RHOBA/49-467GAET..DSLPGFIVFTSQG....RHGAQ------------------------------------PVSARQWKAGFLPSRF
Q7UFP1_RHOBA/49-464GAET..QDLPGFIVLTSEG....GGQSQ------------------------------------PISSRQWHSGFLPSRV
Q7MLK9_VIBVY/33-420VNGT..RALPPFLFSHNSQQAEWQRGWA------------------------------------GSSSTL...GWAGRMM
Q7US09_RHOBA/66-482GTEN..ENLPAFVVMQE......GKGRV------------------------------------INGARNWGAGFMPAIY
Q7VYL6_BORPE/29-381.......GTDDASRSHFETQNRIELGRA------------------------------------GGSGAAPASGFLNRLA
Q7UDW2_RHOBA/77-502GSEN..EDLPGFIVLLS......GGRLP------------------------------------RVGKALWGSGFLPSVY
Q87HJ3_VIBPA/35-425EQGD..VPLPEQLFSHNSQTASWLRGGM------------------------------------DASTNL...GWAGRML
Q7UM62_RHOBA/63-489GSEN..QNLPGFVVLVS......GGKTP------------------------------------SAGKSVWGSGFLPSVH
Q7UJ64_RHOBA/59-474GSEN..QSLPGFIVLPE......VSYP.------------------------------------QGGAANWSNGYLPAFY
Q7UIF5_RHOBA/61-494GSLN..DNLPQFVVMGT......PVADC------------------------------------CGGRECHRANYLGPQY
Q7UYJ8_RHOBA/60-484GTEN..KNLPAYVAIAD......PRGTP------------------------------------QSSVNNWGPGFLPAAF
Q7MCK0_VIBVY/38-408.RGLDGDTLPIIPSGSGNHSNMLLGMHT------------------------------------GFVNGEIPGGWAGRAV
Q9A5N3_CAUCR/44-506QKPTAGVQIPPRLFSHNDQQQTWQTGQV------------------------------------GYGAL....GYGGQMG
Q7ULC1_RHOBA/52-445GAPH...GIPAYFSLP............------------------------------------.RMSRSGGPNFLGSKY
Q7UQT8_RHOBA/50-438PGDH...DIPNHVAIP............------------------------------------...KASHGAGFLGIQH
Q7UQ29_RHOBA/54-472GSDN..ENLPSFIAMC.......PGGYP------------------------------------IKESQNWQNGFLPGKY
Q7UGB9_RHOBA/69-492GSKN..KNLPDFVTLIT.......GQVL------------------------------------GAGNSAWGSGFLPTVH
Q7UPP6_RHOBA/56-434GRAN..KELPGNFLIG............------------------------------------.SGNRHPGAGFLPPAL
Q7UI66_RHOBA/46-421IDQRPELEIPPFVSVG............------------------------------------...GAGAGPGFLGMAW
Q7UVE3_RHOBA/81-505GSMN..SNLPDYVVLISKMK...RPSDQ------------------------------------PLYDHYWGSGFLPSKH
Q7UW70_RHOBA/70-497PLDE...PMLPFVMLPR......PLQES------------------------------------NVVGKGGTAGFLGKAF
Q7UKM6_RHOBA/69-495GSEN..EDFPAYMVLLSQGSG..KNPGQ------------------------------------PLFSRLWGSGYLPSSH
Q7UTL9_RHOBA/100-490GSAD..SSVPPYVLIG............------------------------------------.YPNVTRGPGFLGASS
Q7UGF5_RHOBA/94-499GRRT...DLPAHVVLPQT.....MGRGG------------------------------------GNLPNGQAGGFLGKAY
Q9A6V4_CAUCR/38-393.......ASPDRARSHFEAQDVLETGSA------------------------------------KVYGAE..TGWLNRTL
Q7UYC8_RHOBA/101-527GTLN..KDLPDYIVMPSAYWSG.KVNVQ------------------------------------ALYSRLWGSGFLPSKH
Q7UR29_RHOBA/60-444GPRN...NLPAYICVP............------------------------------------NVPNEFAGTGYLPSSY
Q7UYM7_RHOBA/45-446AEDT..MSLPSNVSIG.........TYR------------------------------------AFNQDAFGPGFLGPRF
Q7UV65_RHOBA/50-468GTEN..QNLPGFITICP......T.LA.------------------------------------HGGTKNWGSAFLPASV
Q7UJ54_RHOBA/70-497GRMN..ENLPDFIVLNSAFWSGDKANIQ------------------------------------ALYSRLWGSGYLPSKH
Q7UJ36_RHOBA/99-512GSES..RDLPAYVVFNS......GKKGP------------------------------------SAGSGNWNSGFLPSLH
Q7NT93_CHRVO/33-383.......GYPDPNLSHFRSIEIWDTASA------------------------------------SQQYLS..EGWLTRLF
Q7UEK9_RHOBA/80-501GSEN..RDLPSFVAMED......PRGMP------------------------------------QSGPNNWANGFLPAAF
Q7UQW1_RHOBA/70-487GSEC..NNLPGFVVLNG......GLIP.------------------------------------PGGLDCFGNGFLPATY
Q7UPF7_RHOBA/65-448DAGA...DIPRHISIL............------------------------------------.AGRSAATGGYLGPQF
Q7UYR5_RHOBA/95-521GTEN..EDLPAFLVMTASWTG..RKQAQ------------------------------------ALYNRLWGSGYLPSKF
Q7UWA1_RHOBA/72-492GSEN..QNMPGFVVMLD......PTGGP------------------------------------ISGAKNWSSGYMPATY
Q89DL5_BRAJA/42-392.......ATPYRDRSHFDGQDVLESGYA------------------------------------GPGRVQ..SGWLNRAL
Q7URV7_RHOBA/77-499GTEN..QELPAFVAIND......PRGLA------------------------------------RSGKNNFGNGFLPAAF
Q7MDY0_VIBVY/67-457LDGT..AMLPEQLFSHNSQSDEWMRGAA------------------------------------NSGINL...GWAGRLL
Q7UH70_RHOBA/75-488GTEN..QSLPGYVVMC.......PSGLP------------------------------------TAATANWRNAFLPGIF
Q7UVE1_RHOBA/82-507GSEN..EDLPGYMVLLS......GGRLP------------------------------------RVGKALWSSGFLPSVY
Q7UQ53_RHOBA/45-480GAIN..ENLPTFVVLPD......HRGFA------------------------------------SNGPKNWGAAFLPASA
Q7UP10_RHOBA/69-492GSEN..ENLPAFVVMTTKD....QNSGQ------------------------------------PLVSRFWGNGFLPSEH

PF04185

PHOX_KLULA/65-312....................SLSWLAEQ------------------------------------GITLTNYW.ALTHPSE
Q9S816_ARATH/13-380MKGMS.SAVMNGFKPDALPVY.KELVQN------------------------------------FAICDRWFASVPGATQ
Q9SRQ6_ARATH/16-381TKGMSEKVVMQGFPPEKLPVF.KELVQE------------------------------------FAVCDRWFSSLPSSTQ
Q47936_FRANO/55-471YKQNCDGQVMGYYDGNTVTAL.WNYAQN------------------------------------FALNDNTFGTTFGPST
Q97V43_SULSO/27-365FVYYSGPQSLAYFSYQQTWIL.WDYAEE------------------------------------YVLADDYFSPVLGLTE
Q9LML5_ARATH/38-396EPGMA.KNVMSGFKPEVLPVY.TELANE------------------------------------FGVFDRWFASVPTSTQ
PHLB_MYCTU/52-435PLQGNVPVTMGFYTRRDLPIH.YLLADT------------------------------------FTVCDGYFCSLLGGTT
Q9A412_CAUCR/40-437.PDAKKPWSMGYFQRADIPFQ.FALADA------------------------------------FTLCDAYHCSTQTGTN
PHLC_PSEAE/51-437..AVQYPEAMGYFKRGDIPYY.YALADA------------------------------------FTLCEAYHQSMMGPTN
PHLD_MYCTU/50-429SAAHT.PTVMGYYTRQDIPIH.YLLADA------------------------------------FTVCDRYFCSVLGPTL
Q9SMN8_ARATH/1-336PGNLS.ETVMKGFRPEAVPVY.AELVKE------------------------------------FAVFDRWFSSIPGPTQ
O53361_MYCTU/50-282.....MAQAFAETHPSEPNYLALFAGNT------------------------------------FGLTKNT.CPVNGGAL
O81020_ARATH/27-389SGNMS.ASVMNGFEPDKVPVY.KSLVSE------------------------------------FAVFDRWFASVPSSTQ
Q9KH04_BURML/84-547AWADSGGLVMGHYRNSAETLRLWNLARG------------------------------------YTLCDNFFMAAFGGSW
PHLN_PSEAE/48-422..PAKTERSLGYYKEQDIAFQ.FAMANA------------------------------------FTICDAYHCSFQGGTN
PHLN_BURPS/47-438..ANKGTTTMAYLERDDIPFH.YQLADA------------------------------------FTICDAYHCSIPSSTD
Q983N8_RHILO/60-507AWADSGAMPMSNWDASKTDM..WAVAQK------------------------------------YVLADHFFMGGFGGSF
PHLA_MYCTU/51-431RAGPYVPLTMGYYTRQDIPIH.YLLADT------------------------------------FTICDGYHCSLLTGTL
Q98ES1_RHILO/58-274...........SLARRTAP.YLNRLARG------------------------------------GALFDRSY.GVAHPSQ
PHLC_MYCTU/52-433RSVANTPVVMGYYARPDIPIH.YLLADT------------------------------------FTICDQYFSSLLGGTM

PF14707

F1QB82_DANRE/433-568----------------------------------------------------------------KNS.............
F1QQ07_DANRE/367-495----------------------------------------------------------------SES.............
ARSA_HUMAN/368-502----------------------------------------------------------------SDT.............
F2UD41_SALS5/491-612----------------------------------------------------------------PND.............
F1QFT2_DANRE/220-353----------------------------------------------------------------EEFNK.........GI
ARSH_HUMAN/418-551----------------------------------------------------------------EGT.............
ARSG_CANFA/402-522----------------------------------------------------------------CDG.............
A8XD87_CAEBR/394-528----------------------------------------------------------------LNTSVDPNLDYFCPNG
ARSG_MOUSE/402-522----------------------------------------------------------------CDG.............
A0YAF7_9GAMM/381-478----------------------------------------------------------------TKE.............
C3YQ76_BRAFL/419-552----------------------------------------------------------------.GT.............
Q5XG10_XENLA/375-508----------------------------------------------------------------EELSQ.........GI
A7V8P9_BACUN/356-447----------------------------------------------------------------TRH.............
ARS_HEMPU/396-526----------------------------------------------------------------QDEYGLE.....CAGG
Q4RYA1_TETNG/304-429----------------------------------------------------------------ENG.............
F2UCT8_SALS5/90-221----------------------------------------------------------------DPA.............
C3YZM0_BRAFL/417-549----------------------------------------------------------------.GT.............
A7SK49_NEMVE/435-563----------------------------------------------------------------................
GALNS_CANFA/377-510----------------------------------------------------------------EEFRQ.........GI
Q6GMA1_XENLA/439-573----------------------------------------------------------------EGT.............
A9VBN0_MONBE/428-544----------------------------------------------------------------CIG.............
C3ZST4_BRAFL/433-562----------------------------------------------------------------.GT.............
A6QLR7_BOVIN/402-522----------------------------------------------------------------CDG.............
STS_HUMAN/437-572----------------------------------------------------------------VGS.............
Q4TCJ7_TETNG/242-385----------------------------------------------------------------PGA.............
F1NFQ0_CHICK/445-579----------------------------------------------------------------LGA.............
E4YGB6_OIKDI/449-582----------------------------------------------------------------.GT.............
D2HFI2_AILME/436-570----------------------------------------------------------------KGA.............
E1FX25_LOALO/406-541----------------------------------------------------------------KNSTDDPQMNKLCPGG
F1R580_DANRE/251-371----------------------------------------------------------------CDG.............
O16138_HELER/402-534----------------------------------------------------------------QGEYGGK.....CQGG
Q32KK0_RAT/450-603----------------------------------------------------------------LGS.............
D2HXW7_AILME/434-569----------------------------------------------------------------EGA.............
D7VQY4_9SPHI/353-442----------------------------------------------------------------SQL.............
Q6DJK3_XENLA/433-566----------------------------------------------------------------EGA.............
Q32KK2_RAT/368-502----------------------------------------------------------------SDT.............
Q32KI1_CANFA/444-578----------------------------------------------------------------EGA.............
E4XNY3_OIKDI/402-533----------------------------------------------------------------ASSI...........W
C3ZQB5_BRAFL/418-551----------------------------------------------------------------MDYTQF......CPSG
E6ZGQ8_DICLA/413-534----------------------------------------------------------------CGG.............
A9UXW0_MONBE/287-431----------------------------------------------------------------DARPSPLCTECCPYGP
Q1YP24_9GAMM/409-501----------------------------------------------------------------MKP.............
ARSE_HUMAN/448-582----------------------------------------------------------------EGA.............
F1KQC6_ASCSU/1702-1837----------------------------------------------------------------RNSSDDPHMDEFCPGG
F0Y2N2_AURAN/404-544----------------------------------------------------------------................
Q4S4L1_TETNG/407-528----------------------------------------------------------------CGG.............
Q7ZWB8_DANRE/433-548----------------------------------------------------------------KNKM...........D
A3XMW9_LEEBM/382-476----------------------------------------------------------------ED..............
C3YBU1_BRAFL/392-524----------------------------------------------------------------.GT.............
Q4RJR3_TETNG/343-474----------------------------------------------------------------SST.............
ARS_STRPU/411-541----------------------------------------------------------------QMKLGER.....CDGG
F2UKF0_SALS5/383-527----------------------------------------------------------------DARPTPLCIECCPYSP
Q0C069_HYPNA/397-504----------------------------------------------------------------GS..............
ARSF_HUMAN/440-574----------------------------------------------------------------PAS.............
A4AN36_MARSH/378-468----------------------------------------------------------------EFG.............
F1NW57_CHICK/376-509----------------------------------------------------------------EDYSK.........GI
C3Y4J9_BRAFL/389-521----------------------------------------------------------------.GT.............
C1BQY6_9MAXI/368-497----------------------------------------------------------------SDG.............
C3ZQC1_BRAFL/339-471----------------------------------------------------------------NYTEHC.......PSG
Q4SI19_TETNG/404-542----------------------------------------------------------------AELKK.........GI
STS_MOUSE/445-581----------------------------------------------------------------AGA.............
A4CMB0_ROBBH/401-491----------------------------------------------------------------MGA.............
STS_RAT/436-573----------------------------------------------------------------PGS.............
ARSD_HUMAN/451-585----------------------------------------------------------------EGA.............
B4DQ74_HUMAN/301-421----------------------------------------------------------------CDG.............
A5D7J7_BOVIN/445-576----------------------------------------------------------------DGA.............
Q32KI0_CANFA/435-568----------------------------------------------------------------PGA.............
F1R2X2_DANRE/342-476----------------------------------------------------------------AGS.............
F2U742_SALS5/410-536----------------------------------------------------------------QPW.............
A9V957_MONBE/437-571----------------------------------------------------------------CKD.............
A9UPM8_MONBE/326-452----------------------------------------------------------------QPW.............
B9QU81_9RHOB/44-158----------------------------------------------------------------AG..............
Q6AX40_XENLA/368-500----------------------------------------------------------------SET.............
F1NWF7_CHICK/360-492----------------------------------------------------------------SDT.............
C3Z258_BRAFL/432-564----------------------------------------------------------------.GT.............
A9V7E7_MONBE/452-571----------------------------------------------------------------NAN.............
ARSA_BOVIN/368-502----------------------------------------------------------------SDT.............
A6CB11_9PLAN/382-473----------------------------------------------------------------RE..............
F0SFZ7_PLABD/380-468----------------------------------------------------------------IGP.............
C3Y4X6_BRAFL/434-568----------------------------------------------------------------.GT.............
C6W2Y6_DYAFD/349-461----------------------------------------------------------------EGS.............
E1BU03_CHICK/378-498----------------------------------------------------------------CDG.............
A7SK50_NEMVE/483-612----------------------------------------------------------------.GT.............
A1L2N0_XENLA/374-506----------------------------------------------------------------SDT.............
C3ZV84_BRAFL/657-790----------------------------------------------------------------DERSK.........GI
A7SQ82_NEMVE/425-557----------------------------------------------------------------PGS.............

PF00884

C3LB12_BACAC/143-439AFNRSFYK-RED.VYK......................------------------------------------------
O06776_MYCTU/43-460KCHEVPVW-QTS.PVGPFDA...............WPS------------------------------------------
O25301_HELPY/294-587GGSGIWNK-LTS.FTK......................------------------------------------------
O34609_NEIME/232-524....TWLE-NDS.GCKG.....................------------------------------------------
LTAS2_BACSU/245-536GNTQTFWN-RNE.MYK......................------------------------------------------
O43113_NEUCS/45-420KLFNAHT.-.............................------------------------------------------
O65931_MYCTU/212-635KWHLTPDN-VQG.AAGPFDN...............WP.------------------------------------------
O82879_STRMU/460-745PSSASNYS-RKY.VYD......................------------------------------------------
O85099_ECOLX/237-530....FWIT-NQQ.T........................------------------------------------------
YEJM_ECOLI/260-505........-.............................------------------------------------------
ARS_HEMPU/52-373KWHLGINE-NSS...TDGAH...............LP.------------------------------------------
ARS_CHLRE/27-385KFLVDYS.-.............................------------------------------------------
ARSA_HUMAN/21-346KWHLGVGP-EGA......................FLP.------------------------------------------
ASLA_ECOLI/86-419KWHMGENK-ESQ........................P.------------------------------------------
EPTA_ECOLI/236-527....LWND-NDG.GCKG.....................------------------------------------------
YIDJ_ECOLI/4-341KWHLDGHD-YFGTGECPP....................------------------------------------------
ARSB_FELCA/47-366KWHLGMYR-KEC.......................LP.------------------------------------------
GALNS_HUMAN/31-355KWHLGHRP-QFH........................P.------------------------------------------
EPTB_ECOLI/248-538MQSEMWFY-SNT..........................------------------------------------------
Y1005_HAEIN/211-475....YWIS-NQG.K........................------------------------------------------
GNS_CAPHI/54-391KYLNEYGA-PD...........................------------------------------------------
STS_MOUSE/35-421KWHLGLSC-RGA..................TDFCHHP.------------------------------------------
ARS_STRPU/67-388KWHLGINE-NSS...SDGAH...............LP.------------------------------------------
SPHM_HUMAN/23-328KKHVG...-...........................PE------------------------------------------
ARS_PSEAE/5-420KWHLGLKP-EQT........................P.------------------------------------------
YHBX_ECO57/223-491....FWLS-SQS.A........................------------------------------------------
CGMA_RHIME/269-561PFQGWFWN-RTA.VYK......................------------------------------------------
YBIP_ECOLI/217-483....WWFS-NQG.Q........................------------------------------------------
YDEN_ECOLI/58-408KWHLSKIS-NVP.VPEDKQTRDYHDNFTTFSAEEWQP.------------------------------------------
P95059_MYCTU/37-466KWHLTPLE-ESN.MASTKRH...............WP.------------------------------------------
P95081_MYCTU/5-389KWHISHAD-LED.PATGAPL..................------------------------------------------
ARS_VOLCA/26-386KFLVDYS.-.............................------------------------------------------
Q45087_9BURK/4-384YTTTTPDP-RTTSARDPRFTVLGDIMDGFRSVGAFEPN------------------------------------------
Q833K3_ENTFA/256-543PYNTSMYK-RKD.VYK......................------------------------------------------
Q840W2_STRMU/270-555PENASNYS-RQA.VYR......................------------------------------------------
Q8DUS0_STRMU/503-788PSSASNYS-RKY.VYD......................------------------------------------------
Q8G592_BIFLO/306-604PYESSMYS-RAT.NYK......................------------------------------------------
Q8K804_STRP3/480-765PASANNFN-RKT.VYS......................------------------------------------------
Q8P1I3_STRP8/480-765PASANNFN-RKT.VYS......................------------------------------------------
Q8XK47_CLOPE/257-551NYEGNFYN-RDT.VYP......................------------------------------------------
Q984T6_RHILO/281-574PGTNWFWN-RGA.VYA......................------------------------------------------
Q98EG2_RHILO/158-441GWPLSFTG-QGT.FYS......................------------------------------------------
Q9A0F9_STRP1/480-765PASANNFN-RKT.VYS......................------------------------------------------
Q9AI31_BURML/214-497PYYADFFG-RDR.VFP......................------------------------------------------
Q9CKD9_PASMU/287-557GGEKHFDN-MAS.FFY......................------------------------------------------
Q9CM05_PASMU/231-523....KWLN-NNS.DCKG.....................------------------------------------------
Q9HVQ5_PSEAE/238-530....FWIT-NQQ.T........................------------------------------------------
Q9HYT4_PSEAE/238-529....LWLE-NNS.DCKG.....................------------------------------------------
Q9I2D3_PSEAE/231-522....LWRD-NQS.GCKG.....................------------------------------------------
Q9I4M0_PSEAE/223-501GAGLRFMA-KDK.VMP......................------------------------------------------
Q9JXJ7_NEIMB/214-487....YFYS-AQA.ENE......................------------------------------------------
Q9KKK2_VIBCH/240-530....LWKE-NDG.GDKN.....................------------------------------------------
Q9PGC7_XYLFA/245-535....LWRD-NQS.GCKG.....................------------------------------------------
Q9RBI1_ACIAD/237-531....TGID-NNS.GCKG.....................------------------------------------------
Q9RMJ0_NEIME/232-495....AWLS-NQG.M........................------------------------------------------
Q9X6R2_PSEAI/20-300NGDFAWDN-QSG.FFS......................------------------------------------------
Q9ZDJ9_RICPR/218-505....TWIG-TQT..........................------------------------------------------
Q9ZJJ5_HELPJ/225-518....FWLE-KQI..........................------------------------------------------
Q9ZN39_HELPJ/222-504....FWYS-AND.GEKNVK...................------------------------------------------

PF01663

ENPP3_MOUSE/161-485.GQPIWLT-AM.--------------------------------------------------------------------
O29992_ARCFU/4-416...DNWID-AST--------------------------------------------------------------------
O50518_STRCO/58-383...PTVFG-LA.--------------------------------------------------------------------
Q73VT6_MYCPA/42-363...PTWFE-RL.--------------------------------------------------------------------
Q6A8W7_PROAC/44-359...PTAFE-SL.--------------------------------------------------------------------
Q6N507_RHOPA/30-497NEESLLKL-AR.--------------------------------------------------------------------
Q7WNM8_BORBR/6-370TGHALRVP-TLA--------------------------------------------------------------------
O58841_PYRHO/4-322RQRGVRIA-SV.--------------------------------------------------------------------
O69954_STRCO/13-378...RLWDA-AR.--------------------------------------------------------------------
Q7AYA7_9RHIZ/4-370...RVWDA-AK.--------------------------------------------------------------------
Q7NU73_CHRVO/4-375...RLWEA-AK.--------------------------------------------------------------------
Q8YZP2_NOSS1/4-370...KVWEI-AK.--------------------------------------------------------------------
Q7UKE3_RHOBA/4-350...VFYDR-YE.--------------------------------------------------------------------
Q71ZQ2_LISMF/5-366...TLYDL-AK.--------------------------------------------------------------------
Q73E52_BACC1/9-380...TLYDE-AH.--------------------------------------------------------------------
Q8XKL9_CLOPE/10-374...TLFGL-AK.--------------------------------------------------------------------
Q97LS7_CLOAB/8-378...TLVDI-AL.--------------------------------------------------------------------
O45359_CAEEL/26-353.IDPIYIS-AL.--------------------------------------------------------------------
Q22129_CAEEL/24-374AKAPLWYT-AG.--------------------------------------------------------------------
Q981Q5_RHILO/5-379..VPTIAT-HAR--------------------------------------------------------------------
O69013_ZYMMB/50-367EGEPLWVT-AE.--------------------------------------------------------------------
Q9A8S4_CAUCR/74-393QAKPFWVS-VE.--------------------------------------------------------------------
Q8PIS1_XANAC/48-366GGEPVWVG-VE.--------------------------------------------------------------------
Q9PAB9_XYLFA/40-358GGEPIWVS-AE.--------------------------------------------------------------------
Q7MXP5_PORGI/37-349GGEPVWNT-AA.--------------------------------------------------------------------
ENPP2_RAT/165-477GGQPLWIT-AT.--------------------------------------------------------------------
Q7ZXN7_XENLA/166-476GGQPIWIT-AS.--------------------------------------------------------------------
Q6PGY9_DANRE/161-472GGQPIWIT-AM.--------------------------------------------------------------------
ENPP1_RAT/194-520KGQPIWVT-AN.--------------------------------------------------------------------
Q6VZU9_CNPV/107-431.GEPIWTT-AM.--------------------------------------------------------------------
Q70HC0_FOWPV/120-443.GEPIWTT-IM.--------------------------------------------------------------------
Q7F5L2_ORYSJ/92-418LGEPLWVT-AA.--------------------------------------------------------------------
Q9FS13_SPIOL/96-418LGEPLWET-VA.--------------------------------------------------------------------
Q9SU83_ARATH/109-435LGEPLWET-VV.--------------------------------------------------------------------
Q9SU81_ARATH/60-394LGEPLWVT-AV.--------------------------------------------------------------------
Q9SU82_ARATH/57-390LGEPLWVT-AV.--------------------------------------------------------------------
YGK5_SCHPO/76-404KGEPIWVN-AE.--------------------------------------------------------------------
Q6BTN4_DEBHA/173-514GGEPIWST-AF.--------------------------------------------------------------------
Q6C6J4_YARLI/277-608GGEPIWQT-LS.--------------------------------------------------------------------
Q7SI20_NEUCR/254-584RGEPFWVS-AQ.--------------------------------------------------------------------
NPP1_YEAST/170-545DTEPIWQT-VQS--------------------------------------------------------------------
Q6FKX1_CANGA/187-587NSEPIWET-VQR--------------------------------------------------------------------
Q757R2_ASHGO/153-497GGDPIWFT-AQK--------------------------------------------------------------------
Q6CX45_KLULA/136-460QSYPLWFF-TN.--------------------------------------------------------------------
ENPP4_XENLA/30-339EATPIWLT-NQ.--------------------------------------------------------------------
ENPP4_HUMAN/28-339EAVPIWVT-NQL--------------------------------------------------------------------
ENPP5_HUMAN/30-342EATPIWIT-NQ.--------------------------------------------------------------------
ENPP7_HUMAN/33-356GSVPIWIT-AQ.--------------------------------------------------------------------
Q6ZM30_DANRE/31-356GSLPIWIT-AQ.--------------------------------------------------------------------
ENPP6_XENLA/26-357GAEPLWVT-ME.--------------------------------------------------------------------
ENPP6_MOUSE/26-357GSEPLWIT-LM.--------------------------------------------------------------------
ENPP1_CAEEL/182-494...PIWSV-YKR--------------------------------------------------------------------
ENPP2_CAEEL/81-386...PIWSA-YKR--------------------------------------------------------------------
Q47910_9FLAO/52-512...VIGIA-IK.--------------------------------------------------------------------
Q9KJX5_FLAME/32-489...VVGVS-LK.--------------------------------------------------------------------
Q55320_SYNE7/42-494...VISVS-IK.--------------------------------------------------------------------
Q89ZL4_BACTN/29-473...VYAIA-PFC--------------------------------------------------------------------
Q7MEK0_VIBVY/30-506...VFSVS-VK.--------------------------------------------------------------------
Q84EY0_9GAMM/27-481...VFGVS-LK.--------------------------------------------------------------------
Q60113_ZYMMB/62-511HSRVISVA-GK.--------------------------------------------------------------------
Q98IY7_RHILO/32-447AKLPMTLI-NG.--------------------------------------------------------------------
Q7NDL2_GLOVI/4-434...MIWSI-AT.--------------------------------------------------------------------
Q9UZH6_PYRAB/14-420...TIWDY-LG.--------------------------------------------------------------------
Q9YCR2_AERPE/4-405...WVWDD-LGL--------------------------------------------------------------------
Q9X5S9_STRLA/7-409...RIWDE-MT.--------------------------------------------------------------------
Q9HSF0_HALSA/15-396...RVWDR-VT.--------------------------------------------------------------------
Q9X5S1_STRLA/5-395...PLWEL-AA.--------------------------------------------------------------------
Q9X5R9_STRLA/7-410...CAWDW-LA.--------------------------------------------------------------------
Q9X5T4_STRLA/7-389...LLWQH-EV.--------------------------------------------------------------------
Q9YCS9_AERPE/3-432...AFWDL-LS.--------------------------------------------------------------------

PF02995

Q9VSJ3_DROME/115-607GWFELAGY-NKVDDNTFPNIMAVLTG...........Y------------------------------------------
Q19148_CAEEL/75-621DYHYLYGY-TKVADNSMVNLAPILVGDMEEALKKPKYD------------------------------------------
Q21671_CAEEL/74-651KGIIFPYM-NKVGDNSRPNGVALWFGKLLEK.VDRFIF------------------------------------------
Q9VGG4_DROME/77-573PHTELWGY-NRVGQNSYPNLIPLLSGQ.........SV------------------------------------------
Q9VQH3_DROME/74-555PHTEFWGY-NRVALNTYPNLIPLVSGL.........SV------------------------------------------
Q9VAU4_DROME/90-580GWFEQQGY-NKIGDNTFPNLLAILTGY..........N------------------------------------------
Q9VKK3_DROME/98-598SHVEFWGY-NKVGDNTFPNLVPLLSG...........L------------------------------------------
Q9VIP6_DROME/62-563GWFEMQGY-NKVGDNTFPNLLAALTG...........D------------------------------------------
Q19486_CAEEL/79-568GFIDMEGH-MKIHDNTYGNLLAILTGK.........RG------------------------------------------
Q9V9Q1_DROME/66-560PHVELKGF-NRLGEDGFDSLMPLLSG...........L------------------------------------------
Q9VF91_DROME/73-581GATVLKGY-NIVGDGTPQALVPLLTG...........F------------------------------------------
Q9VLG3_DROME/84-577GWYEMQGY-NKVADNSFPNILAILSGY..........S------------------------------------------
Q9V9P7_DROME/68-547PHTKFFGY-SRVGLDANANLVPFLGG...........K------------------------------------------
O18062_CAEEL/82-553QMIEFPFV-NKVGENSRPNGLPLWFGKSIE...GGRRV------------------------------------------
O62436_CAEEL/78-581GSVVLNGY-NIVGDGTPQAFIPILTAQ.........TE------------------------------------------
Q9W0F7_DROME/16-518GWFEMQGY-NKVGENTLPNLLAILTGN..........A------------------------------------------
Q8SY05_DROME/180-657HWFELQGY-NKMGDNTFPNLMAVLTG...........F------------------------------------------

PF01676

DEOB_LACLM/6-406...GTAVI-ED...........FGPRQL..ETGELIIY------------------------------------------
DEOB_GEOSE/6-388AS.GTAII-DE...........LGPEHM..ETGALIVY------------------------------------------
DEOB_BACSU/7-389AS.GTAIL-DE...........LGQEHM..ETGALIVY------------------------------------------
DEOB_SHIFL/2-406SS.GTVIL-DQ...........LGEEHM..KTGKPIFY------------------------------------------
DEOB_HELPY/3-406AS.GTEII-KD...........LGEKHL..ETLYPIFY------------------------------------------
YHFW_ECOLI/2-397...AVAIG-DN................L.EADLGQVYN------------------------------------------
APGM2_ARCFU/1-380...FRDDV-KT...........FPPHDI..........------------------------------------------
APGM2_METTH/4-396...GYTSV-RV...........EPPHDI..........------------------------------------------
APGM1_ARCFU/1-399...LSDRV-SD...........TDPKAV........GK------------------------------------------
APGM1_METJA/4-402...LSCRV-SD...........GDPHEE....GVKVSE------------------------------------------
APGM1_METTH/1-400.G.LGDKV-SD...........ADPKVE....GKPPKK------------------------------------------
APGM_PYRHO/5-403...GYKVG-DN............DPHEA....GKPPLK------------------------------------------
APGM_AQUAE/13-398SP.GSDAI-ND...........TDPQQVGKEPLEPKG.------------------------------------------
APGM2_METJA/1-398GW.ISDKI-SD...........SDPFYK.NRYVMKVKA------------------------------------------
GPMI_PORPU/7-514QPLNYNDL-IDHYYNKGISDEFIPPSRI......NTGS------------------------------------------
GPMI_ANTSP/7-506SS.DILSI-IDKYYEQNISDEFLPPTKI......SMHN------------------------------------------
GPMI_SYNY3/7-511RS.AAQVI-KDYYASD.ITDEFIPPTRI......GAGA------------------------------------------
GPMI_PSESM/6-504AT.GVAGL-EAAYARD.ENDEFVKATRI....GEP.AN------------------------------------------
GPMI_ECOLI/6-508DT.AVAGL-QAAYARD.ENDEFVKATVI.RAEGQPDAA------------------------------------------
GPMI_BACSU/4-506RS.ALDVV-DDSYANG.IYDEFVIPSVITKENGEPVAK------------------------------------------
GPMI_MYCGE/3-500ND.PIGYI-ETQYQNQ.ITDEFIYPAIN.ANLNSDQFA------------------------------------------
GPMI_MYCPN/3-501TD.PVAYV-QSAYDQK.VTDEFLYPAVN.GNVDKEQFA------------------------------------------
GPMI_HELPY/3-489LS.PSEYI-QSQYDKN.ITDEFIMPACF.....KNYCG------------------------------------------
PMGI_MAIZE/20-552KS.ALEAV-KTLRAQPKANDQYLPPFVIVDDSGNAVGP------------------------------------------
PMGI_TOBAC/20-552KD.PVEAV-KKLRQEPNANDQYLAPFVIVDDNGKPVAA------------------------------------------
PMGI_MESCR/20-552KN.AVEAV-KTLRQEPKANDQYLPPFVVVDESGKAVGP------------------------------------------
PMGI_RICCO/17-549KS.AVEAI-KKLREEPKANDQYLPPFVIVDENGKPVGP------------------------------------------

PF00245

PPBN_MOUSE/51-486SPAGTYAH-TVNRGWYSDAQM.....PASALQDG....------------------------------------------
PPB4_BACSU/49-459TPAAYGAH-NESRKNMDQIAN.................------------------------------------------
PPB3_BACSU/43-455TPASFGSH-DHSRKNMNSIAD.................------------------------------------------
PPBT_BOVIN/51-490TPSASYAH-SADRDWYSDNEM.....PPEALSQG....------------------------------------------
PPB_BOMMO/74-515SPAGTFAK-VANRNWENDNDV.........KQEGHDVN------------------------------------------
PPB_YEAST/66-527TPASFSSH-VDYRWQEDLIAT.................------------------------------------------
STRK_STRGR/41-448TPAALTAH-VTDRSCKGPADMAA.CPADTRAGGG....------------------------------------------
PPB1_HUMAN/55-490SPAGTYAH-TVNRNWYSDADV.....PASARQEG....------------------------------------------
PPBI_MOUSE/52-486SPSGTYVH-TVNRNWYGDADM.....PASALREG....------------------------------------------
PPB_ECOLI/64-470TPAALVAH-VTSRKCYGPSATSEKCPGNALEKGG....------------------------------------------

PF08665

Q2RKS0_MOOTA/260-429--------------------------------------------------------------------------------
O32495_DICNO/401-579--------------------------------------------------------------------------------
B0K8X1_THEP3/380-556--------------------------------------------------------------------------------
Q72AH5_DESVH/438-616--------------------------------------------------------------------------------
Q4BWC0_CROWT/438-619--------------------------------------------------------------------------------
Q8Q0H3_METMA/497-672--------------------------------------------------------------------------------
Q8TNC5_METAC/496-671--------------------------------------------------------------------------------
Q3A8U0_CARHZ/461-637--------------------------------------------------------------------------------
B1YIB9_EXIS2/462-638--------------------------------------------------------------------------------
Q5P0R1_AROAE/485-661--------------------------------------------------------------------------------
A4JFG3_BURVG/484-660--------------------------------------------------------------------------------
Q2W5M5_MAGSA/475-648--------------------------------------------------------------------------------
Q8RL18_PRORE/500-676--------------------------------------------------------------------------------
Q8ZK15_SALTY/474-650--------------------------------------------------------------------------------
Q7MVV4_PORGI/231-425--------------------------------------------------------------------------------
Q53943_STRCH/527-704--------------------------------------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480QGTTL.RA-QGSP..............ILDLKPGDY.R------------------------------------------
Q7UHL2_RHOBA/84-501QGVTM.RP-GNSP..............ILDLQPQPG.V------------------------------------------
Q7UN58_RHOBA/63-468QATVV.GK-NGQI..........GDGKIAYLDAAEG..------------------------------------------
Q98BS1_RHILO/39-404ESLPAGDR-VATL.............GGLAVGPSTP.L------------------------------------------
Q7UHK7_RHOBA/71-478QGTLF.RS-QGAP..............VLNLNRQPQ.I------------------------------------------
Q7UKW9_RHOBA/100-522QGVQF.RG-GEDP..............VLYLSNPEG.I------------------------------------------
Q8P3X8_XANCP/29-384GVLSGVP.-..................AIAFTDSLP.L------------------------------------------
Q7UZ35_RHOBA/49-467QGVQF.QS-RGDA..............VHYVRPPGG.I------------------------------------------
Q7UFP1_RHOBA/49-464QGVQL.HA-SGNP..............VHYVGNPAG.V------------------------------------------
Q7MLK9_VIBVY/33-420DVLSNGQL-DVSP..............TFSINGYVQ.W------------------------------------------
Q7US09_RHOBA/66-482QGTTM.QR-TGSP..............FTNLDRPEH.V------------------------------------------
Q7VYL6_BORPE/29-381AQLDGKAG-R.................PAAFTEDVP.Q------------------------------------------
Q7UDW2_RHOBA/77-502QGVQC.RS-KGDP..............VLNVANPEG.V------------------------------------------
Q87HJ3_VIBPA/35-425DVLTS.DA-QITP..............LYSVHGDTL.W------------------------------------------
Q7UM62_RHOBA/63-489QGVQC.RS-KGDP..............VLYLSNPEG.V------------------------------------------
Q7UJ64_RHOBA/59-474QGTPL.RA-KGSP..............ILDLQPPAG.I------------------------------------------
Q7UIF5_RHOBA/61-494DGIPL.DI-DSDI.............PLPYAAPPSG.V------------------------------------------
Q7UYJ8_RHOBA/60-484QGTEF..S-ALKP..............LDNLDIPAG.V------------------------------------------
Q7MCK0_VIBVY/38-408EHITKGAL-STPH.............PLFSSNQTLR.V------------------------------------------
Q9A5N3_CAUCR/44-506DLFAASSS-GAASINFTAFTTAGLTGFPVGAQVKAY.R------------------------------------------
Q7ULC1_RHOBA/52-445APFVVPDD-PNRS...........SFRVRDVTIPTG.L------------------------------------------
Q7UQT8_RHOBA/50-438AALET.KS-TPAP.........NKPFSVRGIALPGN.V------------------------------------------
Q7UQ29_RHOBA/54-472QGTYI.DS-SFAT...........VERLLENIRGRS.V------------------------------------------
Q7UGB9_RHOBA/69-492QGIEF.RS-QGDP..............VLFLSNPEG.M------------------------------------------
Q7UPP6_RHOBA/56-434SPVPI.AN-ANSG..............LQNIKLPKY.L------------------------------------------
Q7UI66_RHOBA/46-421SPFSVTSN-GRVR..................NLKMN.L------------------------------------------
Q7UVE3_RHOBA/81-505QGVKL.RS-AKDP..............VLYLNDPDG.F------------------------------------------
Q7UW70_RHOBA/70-497DPYTLYPP-GDDM.....DMDKLQKIRTDDLSLRDE.V------------------------------------------
Q7UKM6_RHOBA/69-495QGVML.RP-GANP..............VLYLKNPNG.V------------------------------------------
Q7UTL9_RHOBA/100-490GYLYL.TD-TSKG..............PSGLSLPHG.I------------------------------------------
Q7UGF5_RHOBA/94-499DPFAL.MA-DPSQ..........PNFKVPDLLPPSS.L------------------------------------------
Q9A6V4_CAUCR/38-393EALAPVRP-IE................GLSVGTTAP.L------------------------------------------
Q7UYC8_RHOBA/101-527QGTSF.QT-SGDP..............VLFLSNPSG.I------------------------------------------
Q7UR29_RHOBA/60-444GGFAL.GA-DPAR..........SDFQVRDLNLAGG.V------------------------------------------
Q7UYM7_RHOBA/45-446GPLFV.GA-TDVPGGMSNGEDGYPNLKVQYLDRAEG.I------------------------------------------
Q7UV65_RHOBA/50-468SGTPI.GN-ASQP..........SDQARVKYVQNAR.L------------------------------------------
Q7UJ54_RHOBA/70-497QGVSF.QP-SGDP..............VLFLSNPEG.V------------------------------------------
Q7UJ36_RHOBA/99-512SGVEF.RS-SGDP..............VLYLSNPPG.M------------------------------------------
Q7NT93_CHRVO/33-383HEQPTPKN-FAAD..............GVVLSSQVL.G------------------------------------------
Q7UEK9_RHOBA/80-501QGTPF..S-TTKP..............IRYLDRPDS.I------------------------------------------
Q7UQW1_RHOBA/70-487QGSVF.QP-HGTA...............VANIKSPE.P------------------------------------------
Q7UPF7_RHOBA/65-448DAFKT.GD-PLEP..............VPDVRPR...V------------------------------------------
Q7UYR5_RHOBA/95-521QGVAL.RS-AGDP..............VLYLSNPDG.I------------------------------------------
Q7UWA1_RHOBA/72-492QGTVF.RT-EGNP..............ILDLNPPSD.F------------------------------------------
Q89DL5_BRAJA/42-392EALPRGER-VSS...............GLAVGPTTP.L------------------------------------------
Q7URV7_RHOBA/77-499QGTDF..N-AKNP..............PNNLHRPSG.L------------------------------------------
Q7MDY0_VIBVY/67-457DALSC.QS-SVTP..............LYSVHGDSL.W------------------------------------------
Q7UH70_RHOBA/75-488QGTHV.DT-QYTN...........PEELVANIDNDY.L------------------------------------------
Q7UVE1_RHOBA/82-507QGVQC.RS-KGDP..............VLNISDPQG.T------------------------------------------
Q7UQ53_RHOBA/45-480QGTTIFPQ-RANP..............IDDLTARADFI------------------------------------------
Q7UP10_RHOBA/69-492QGVQF.RS-GADP..............VLYLSNPQG.I------------------------------------------

PF04185

PHOX_KLULA/65-312PN..YLASVGGDYF.................ALDDD............................................
Q9S816_ARATH/13-380PNRLFIHS.ATS.....................HGTTN..........................................
Q9SRQ6_ARATH/16-381PNRLYVHA.ATS.....................NGAFS..........................................
Q47936_FRANO/55-471PGALNLVA.GANG.................PAMSPSGNLENIENN......................YIIDDPNPYYDDC
Q97V43_SULSO/27-365PNRIAYLT.GFSP..................NFYSDDA..........................................
Q9LML5_ARATH/38-396PNRFYVHS.ATS.....................HGCSS..........................................
PHLB_MYCTU/52-435PNRLYWMS.AWI.....................DPDGT..........................................
Q9A412_CAUCR/40-437TNRLFLWT.GTN.....................DGLGK..........................................
PHLC_PSEAE/51-437PNRLYHMS.GRA...................APSGDGKDVHIGND...................................
PHLD_MYCTU/50-429PNRLYWLS.ATI.....................DPDGQ..........................................
Q9SMN8_ARATH/1-336PNRLFVYS.ATS.....................HGSTS..........................................
O53361_MYCTU/50-282PNLGSELLSAGYTFM.........................GFAEDLPAVG..............................
O81020_ARATH/27-389PNRMFVHS.GTS.....................AG.............................................
Q9KH04_BURML/84-547LNHIFLIS.AQAPLYPDVHQSAAKHLVSVVEGDDPAGTRLKLAADSPASALDGPPKFENDGLFTPDGYAVNTMAPPYQPS
PHLN_PSEAE/48-422PNRLFLWT.GTN.....................DPLGQ..........................................
PHLN_BURPS/47-438PNRYYMWT.GYV.....................GNDGA..........................................
Q983N8_RHILO/60-507FNHQWLIC.ACAPYYADADKSPAKPSISV...TDDSGTALKIADNSPKSARDGIPKFVSDGNLTPDFHAVNTMQPPYQPS
PHLA_MYCTU/51-431PNRLYWLS.ANI.....................DPAGT..........................................
Q98ES1_RHILO/58-274PNYFALFT.GLT..................QGVHDDGM..........................................
PHLC_MYCTU/52-433PNRLYWIS.ATV.....................NPDGD..........................................

PF14707

F1QB82_DANRE/433-568SACFHTH.------------------------------------------------------------------------
F1QQ07_DANRE/367-495.....TP.------------------------------------------------------------------------
ARSA_HUMAN/368-502.....TA.------------------------------------------------------------------------
F2UD41_SALS5/491-612.....YF.------------------------------------------------------------------------
F1QFT2_DANRE/220-353NFCPGQE.------------------------------------------------------------------------
ARSH_HUMAN/418-551GACYGSG.------------------------------------------------------------------------
ARSG_CANFA/402-522........------------------------------------------------------------------------
A8XD87_CAEBR/394-528KPKSDWY.------------------------------------------------------------------------
ARSG_MOUSE/402-522........------------------------------------------------------------------------
A0YAF7_9GAMM/381-478........------------------------------------------------------------------------
C3YQ76_BRAFL/419-552EGCYEIF.------------------------------------------------------------------------
Q5XG10_XENLA/375-508NFCPGQN.------------------------------------------------------------------------
A7V8P9_BACUN/356-447........------------------------------------------------------------------------
ARS_HEMPU/396-526FPLEDYF.------------------------------------------------------------------------
Q4RYA1_TETNG/304-429TACSHTH.------------------------------------------------------------------------
F2UCT8_SALS5/90-221........------------------------------------------------------------------------
C3YZM0_BRAFL/417-549GACYSAF.------------------------------------------------------------------------
A7SK49_NEMVE/435-563PAFFDVLD------------------------------------------------------------------------
GALNS_CANFA/377-510DFCPGQN.------------------------------------------------------------------------
Q6GMA1_XENLA/439-573GGCYDTL.------------------------------------------------------------------------
A9VBN0_MONBE/428-544........------------------------------------------------------------------------
C3ZST4_BRAFL/433-562TGCYSLA.------------------------------------------------------------------------
A6QLR7_BOVIN/402-522........------------------------------------------------------------------------
STS_HUMAN/437-572NGCFATH.------------------------------------------------------------------------
Q4TCJ7_TETNG/242-385GGCYNTR.------------------------------------------------------------------------
F1NFQ0_CHICK/445-579GACYDRG.------------------------------------------------------------------------
E4YGB6_OIKDI/449-582EGCASIL.------------------------------------------------------------------------
D2HFI2_AILME/436-570GACYDRH.------------------------------------------------------------------------
E1FX25_LOALO/406-541KPIDDWY.------------------------------------------------------------------------
F1R580_DANRE/251-371........------------------------------------------------------------------------
O16138_HELER/402-534FPVKDYF.------------------------------------------------------------------------
Q32KK0_RAT/450-603GSCSGAGG------------------------------------------------------------------------
D2HXW7_AILME/434-569NGCFSTH.------------------------------------------------------------------------
D7VQY4_9SPHI/353-442........------------------------------------------------------------------------
Q6DJK3_XENLA/433-566GACYGTK.------------------------------------------------------------------------
Q32KK2_RAT/368-502.....TP.------------------------------------------------------------------------
Q32KI1_CANFA/444-578GACYGRG.------------------------------------------------------------------------
E4XNY3_OIKDI/402-533HFCRGQN.------------------------------------------------------------------------
C3ZQB5_BRAFL/418-551VPIADYY.------------------------------------------------------------------------
E6ZGQ8_DICLA/413-534........------------------------------------------------------------------------
A9UXW0_MONBE/287-431TNFNGTG.------------------------------------------------------------------------
Q1YP24_9GAMM/409-501........------------------------------------------------------------------------
ARSE_HUMAN/448-582GACYGRK.------------------------------------------------------------------------
F1KQC6_ASCSU/1702-1837KPIDDWY.------------------------------------------------------------------------
F0Y2N2_AURAN/404-544........------------------------------------------------------------------------
Q4S4L1_TETNG/407-528........------------------------------------------------------------------------
Q7ZWB8_DANRE/433-548SGCGLMD.------------------------------------------------------------------------
A3XMW9_LEEBM/382-476........------------------------------------------------------------------------
C3YBU1_BRAFL/392-524TGCYTTF.------------------------------------------------------------------------
Q4RJR3_TETNG/343-474.....TP.------------------------------------------------------------------------
ARS_STRPU/411-541FPLDDYF.------------------------------------------------------------------------
F2UKF0_SALS5/383-527LSFNGTG.------------------------------------------------------------------------
Q0C069_HYPNA/397-504........------------------------------------------------------------------------
ARSF_HUMAN/440-574GGCYVTS.------------------------------------------------------------------------
A4AN36_MARSH/378-468........------------------------------------------------------------------------
F1NW57_CHICK/376-509DFCPGQN.------------------------------------------------------------------------
C3Y4J9_BRAFL/389-521MGCFDTL.------------------------------------------------------------------------
C1BQY6_9MAXI/368-497....HNY.------------------------------------------------------------------------
C3ZQC1_BRAFL/339-471VPKVEYY.------------------------------------------------------------------------
Q4SI19_TETNG/404-542NFCPGQE.------------------------------------------------------------------------
STS_MOUSE/445-581NGCFSTH.------------------------------------------------------------------------
A4CMB0_ROBBH/401-491........------------------------------------------------------------------------
STS_RAT/436-573NGCFSTH.------------------------------------------------------------------------
ARSD_HUMAN/451-585GACYGRG.------------------------------------------------------------------------
B4DQ74_HUMAN/301-421........------------------------------------------------------------------------
A5D7J7_BOVIN/445-576GACYGQI.------------------------------------------------------------------------
Q32KI0_CANFA/435-568QACFETL.------------------------------------------------------------------------
F1R2X2_DANRE/342-476SGCFSTG.------------------------------------------------------------------------
F2U742_SALS5/410-536........------------------------------------------------------------------------
A9V957_MONBE/437-571........------------------------------------------------------------------------
A9UPM8_MONBE/326-452........------------------------------------------------------------------------
B9QU81_9RHOB/44-158........------------------------------------------------------------------------
Q6AX40_XENLA/368-500.....TP.------------------------------------------------------------------------
F1NWF7_CHICK/360-492.....TP.------------------------------------------------------------------------
C3Z258_BRAFL/432-564TGCFSLR.------------------------------------------------------------------------
A9V7E7_MONBE/452-571........------------------------------------------------------------------------
ARSA_BOVIN/368-502.....TA.------------------------------------------------------------------------
A6CB11_9PLAN/382-473........------------------------------------------------------------------------
F0SFZ7_PLABD/380-468........------------------------------------------------------------------------
C3Y4X6_BRAFL/434-568THCSVDQ.------------------------------------------------------------------------
C6W2Y6_DYAFD/349-461.....LP.------------------------------------------------------------------------
E1BU03_CHICK/378-498........------------------------------------------------------------------------
A7SK50_NEMVE/483-612EACFGYA.------------------------------------------------------------------------
A1L2N0_XENLA/374-506.....TP.------------------------------------------------------------------------
C3ZV84_BRAFL/657-790DFCRGED.------------------------------------------------------------------------
A7SQ82_NEMVE/425-557EMCLGDG.------------------------------------------------------------------------

PF00884

C3LB12_BACAC/143-439---------.TLGFD----------N.FN------A....EDTMKN-KEVVGDN....-...............------
O06776_MYCTU/43-460---------GGGGFE----------Y.FY------GFIGGEANQWY-PSLYEGTTPVE-VNR............------
O25301_HELPY/294-587---------.KQGFH----------A.LY------FNNHLLEFAQN-KPYPKPIESN.-...............------
O34609_NEIME/232-524---------......----------..VC------GKVPNTDVTSL-NL..PEYCRN.-...............------
LTAS2_BACSU/245-536---------.AEGID----------K.FF------D....SAYYDM-NEENTKNY...-...............------
O43113_NEUCS/45-420---------.VDNYD----------SPYI------AGWNGSDFLLD-PYTYSYLNATF-QRNRD..........------
O65931_MYCTU/212-635---------LGWGFD----------H.FW------GFPSGAAGQYD-PIISQDNSVIG-IPEG...........------
O82879_STRMU/460-745---------.KLKFP----------T.FV------ASSGTSDKITH-SEKVGLN....-...............------
O85099_ECOLX/237-530---------......----------..IT------ARNTMLTVFSR-QTDRQYYMNQQ-R..............------
YEJM_ECOLI/260-505---------.SDGFT----------S.PL------YRQALLSDFSM-PSVRT......-...............------
ARS_HEMPU/52-373---------FNHGFD----------..FV------GHNLPFTNSWS-CDDTGLHKDFP-DSQRCYLYV......------
ARS_CHLRE/27-385---------.VSNYQ----------Q.VP------RAGTISMPXVT-PYTFDYNTRLQ-RNGA...........------
ARSA_HUMAN/21-346---------PHQGFH----------R.FL------G..IPYSHDQG-PCQNLTCFPPA-TPCDGGCDQGLVP..------
ASLA_ECOLI/86-419---------QNVGFD----------D.FR------GFNSVSDMYTE-WRDVHVNPEVA-LSPDRSEYIKQLPFS------
EPTA_ECOLI/236-527---------......----------..AC------DRVPHQNVTAL-NL..PDQCIN.-...............------
YIDJ_ECOLI/4-341---------.EWDAD----------Y.WF------DGANYLSELTE-KEISLWRNGLN-SVEDL..........------
ARSB_FELCA/47-366---------TRRGFD----------T.YF------GYLLGSEDYYS-HERCALIDSLN-VTRCALDFR......------
GALNS_HUMAN/31-355---------LKHGFD----------E.WF------GSPNCHFGPYD-NKARPNIPVYR-DWEMVGRYY......------
EPTB_ECOLI/248-538---------......----------..MA------DNIAYREQIGA-EPRNRGKP...-...............------
Y1005_HAEIN/211-475---------......----------..IG------EFDTIASRIGQ-SADETIFMKPL-G..............------
GNS_CAPHI/54-391---------.AGGLG----------HVPL------GWSYWYALEKN-SKYYNYTLSIN-GKARK..........------
STS_MOUSE/35-421---------LRHGFD----------R.FL------GVPTTNLRDCR-PGAGTVFGPAL-RVFAAGPLAALGASL------
ARS_STRPU/67-388---------ANRGFD----------..FV------GHNLPFGNSWR-CDDTGLHQDFP-DTNACFLYY......------
SPHM_HUMAN/23-328---------TVYPFD----------F.AY------TEENGSVLQVG-...........-...............------
ARS_PSEAE/5-420---------HARGFE----------R.SF------SLLPGAANHYG-..FEPPYDEST-PRILKGTPALY....------
YHBX_ECO57/223-491---------......----------..FR------QNGTAVTSIAM-RAMETVYV...-...............------
CGMA_RHIME/269-561---------.AFGFD----------M.FR------S....EENMPA-MQKRGIF....-...............------
YBIP_ECOLI/217-483---------......----------..IG------EYDTAIASIAK-RADEVYFLKEG-NF.............------
YDEN_ECOLI/58-408---------QNRGFD----------Y.FM------GFHAAGTAYYN-SPSLFKNRERV-...............------
P95059_MYCTU/37-466---------TSRGFE----------R.FY------GFLGGETDQWY-PDLVYDNHPVS-PPG............------
P95081_MYCTU/5-389---------.ATNDN----------EGVV------DSAAVRRYLDA-DPLGPYGFSGW-VGPEPHGA.......------
ARS_VOLCA/26-386---------.VSNYQ----------N.VP------AGWTDIDALVT-PYTFDYNNPGF-SRNGA..........------
Q45087_9BURK/4-384---------MEGYFG----------WVAQ------NGFELPENRED-IWLPEGEHSVP-GATDK..........------
Q833K3_ENTFA/256-543---------.ILGFD----------Q.FI------N....EKTMNY-TDKLENNP...-...............------
Q840W2_STRMU/270-555---------.KLNFN----------K.FI------AREGTEYSVKH-VKREGIN....-...............------
Q8DUS0_STRMU/503-788---------.KLKFP----------T.FV------ASSGTSDKITH-SEKVGLN....-...............------
Q8G592_BIFLO/306-604---------.KFGFS----------H.FY------TLTG.PDVIKY-QDKIDESP...-...............------
Q8K804_STRP3/480-765---------.NLGFS----------K.FL------ALSGSKDKFKN-IENVGLL....-...............------
Q8P1I3_STRP8/480-765---------.NLGFS----------K.FL------ALSGSKDKFKN-IENVGLL....-...............------
Q8XK47_CLOPE/257-551---------.NLGFD----------K.YI------S....MEYMDK-PNNQSWQY...-...............------
Q984T6_RHILO/281-574---------.DFGFD----------D.FK------S....EETLPP-MEKRGPL....-...............------
Q98EG2_RHILO/158-441---------.THGYS----------S.LF------GGPEVVAAVAG-RGNSFG.....-...............------
Q9A0F9_STRP1/480-765---------.NLGFS----------K.FL------ALSGSKDKFKN-IENVGLL....-...............------
Q9AI31_BURML/214-497---------.LLQFD----------R.FF------D....IRAFGD-APRVGPY....-...............------
Q9CKD9_PASMU/287-557---------.GNGFQ----------Y.II------D....ELDYVN-PKFKATWG...-...............------
Q9CM05_PASMU/231-523---------......----------..VC------KHIPYQNVTTL-NL..AEYCRN.-...............------
Q9HVQ5_PSEAE/238-530---------......----------..MT------KRNTMLTTFAQ-QTDAQFYLNNQ-R..............------
Q9HYT4_PSEAE/238-529---------......----------..TC------LRVPNRDIPKT-QP..SPFCDG.-...............------
Q9I2D3_PSEAE/231-522---------......----------..TC------DRVAFQDLSES-KD..PALCAG.-...............------
Q9I4M0_PSEAE/223-501---------.QMGFD----------K.TL------G....RDWFRN-TSYLEFPW...-...............------
Q9JXJ7_NEIMB/214-487---------......----------..MA------ILNLIGKKWID-HLIQPTQLGYG-...............------
Q9KKK2_VIBCH/240-530---------......----------..VA------KNIPLKELARD-NR..EGICDG.-...............------
Q9PGC7_XYLFA/245-535---------......----------..VC------DGLELQQLDDA-KD..PTLCTS.-...............------
Q9RBI1_ACIAD/237-531---------......----------..AC------DRIKNYISPKD-DPRYQAQCKD.-...............------
Q9RMJ0_NEIME/232-495---------......----------..LG------HFANEISTYAL-RSDYPWFTQRG-DY.............------
Q9X6R2_PSEAI/20-300---------.NQGMT----------T.FI------G....RNDYVD-PVFSDPTW...-...............------
Q9ZDJ9_RICPR/218-505---------......----------..LM------RNFANFDLSNI-YNDVNFTIVPG-GS.............------
Q9ZJJ5_HELPJ/225-518---------......----------..VD------EWGITQNLVSN-RSKNRYYILG.-...............------
Q9ZN39_HELPJ/222-504---------......----------..VT------SYLKNYELIQK-CPNCEAIA...-...............------

PF01663

ENPP3_MOUSE/161-485----------YQGLK..........AACY------YWPGSDVAVNG-SF.........-...........PTIY------
O29992_ARCFU/4-416----------NLNDEHLVAKTGFEMAKDL------GLRTFSADLVR-KGADLKMSFIS-PGEDKGVAVASKLMF------
O50518_STRCO/58-383----------...............HA..------..AGVHAAQVS-...........-...........SPTF------
Q73VT6_MYCPA/42-363----------...............AA..------..AGVRARAVL-...........-...........PSSF------
Q6A8W7_PROAC/44-359----------...............VA..------..AGVTVSSIG-...........-...........PARF------
Q6N507_RHOPA/30-497----------DKGLS..........TAAI------GKLGPTLLFDH-TDRADKPGPHS-IVIDDATGSPKGAPL------
Q7WNM8_BORBR/6-370----------QR.............LAAH------GGAAIYSNVSP-GAAYFHDPDGH-GRIYHRAGSYGPGRR------
O58841_PYRHO/4-322----------...............SGYT------MPPFSNVDVRI-FP.........-...........PFFS------
O69954_STRCO/13-378----------RAHPGY........TVANI------CWWYAMGADTD-FTVTPRPVYYA-DGRKEPDCYTRPPAL------
Q7AYA7_9RHIZ/4-370----------ARDPSF........TCANL------FWWYAMAASTD-IAVTPRPIYKA-DGRKLPDCYSDPPEL------
Q7NU73_CHRVO/4-375----------RHDPDF........RCANL------FWWYNMASSHD-FGATPRPIYKA-DGRKLPDCHTKPAAW------
Q8YZP2_NOSS1/4-370----------EIDSDF........TCANL------FWWYNMYSSVD-YSVTPRPMYPA-DGRKLPDIYSQPENL------
Q7UKE3_RHOBA/4-350----------...............TAKM------FWWFNQSTTAK-YGATPKPHYGC-DGSKVFDILDWSGC.------
Q71ZQ2_LISMF/5-366----------EKGMT..........TAAF------LWPVAAKSGID-...........-.......Y.NIAEIF------
Q73E52_BACC1/9-380----------KANLT..........TAAL------LWPVTGRANID-...........-.......Y.NLPEIF------
Q8XKL9_CLOPE/10-374----------KNGLT..........TASV------VWPVTGKMKID-...........-.......Y.NMPEIF------
Q97LS7_CLOAB/8-378----------EHGMK..........VGNV------FWPVMGGAKIH-...........-.......Y.NCPEVW------
O45359_CAEEL/26-353----------RSSAS..........VAMF------FFPECDVDWDV-A..........-...........PQIC------
Q22129_CAEEL/24-374----------KAGVD..........VHCY------WFAHCHRAFYD-MVVQV......-...........PEKR------
Q981Q5_RHILO/5-379----------QAGLD..........VAAI------GQALVNPRDTS-VYVSPWWLRGF-MTGYRFSKMVTPEAL------
O69013_ZYMMB/50-367----------KQGVV..........SATM------FWPGSEADIEG-VR.........-...........PEMW------
Q9A8S4_CAUCR/74-393----------QQGKR..........AAAM------FWPGSEVEIDG-VR.........-...........PSRW------
Q8PIS1_XANAC/48-366----------NTGQH..........AATW------SWPGSEAAIKG-VR.........-...........PSQW------
Q9PAB9_XYLFA/40-358----------HAGIH..........SATF------LWPGSEASIAG-TR.........-...........PSRW------
Q7MXP5_PORGI/37-349----------RQGIR..........TGVY------FWVGSETAVNG-NR.........-...........PWRW------
ENPP2_RAT/165-477----------KQGVR..........AGTF------FWSVS......-...........-...............------
Q7ZXN7_XENLA/166-476----------KQGLK..........AATF------FWPVA......-...........-...............------
Q6PGY9_DANRE/161-472----------KQGVK..........AGSF------FWPVA......-...........-...............------
ENPP1_RAT/194-520----------HQEVR..........SGTY------FWPGSDVEIDG-IL.........-...........PDIY------
Q6VZU9_CNPV/107-431----------KQGVK..........AAAF------FWPGSDKVRSN-KH.........-...........PTMF------
Q70HC0_FOWPV/120-443----------KNGFK..........SATF------FWPGSDKVVPR-KR.........-...........PTMY------
Q7F5L2_ORYSJ/92-418----------DQGIQ..........AATY------FWPGSEVKKGS-WDC........-...........PDKY------
Q9FS13_SPIOL/96-418----------KHGKK..........AATY------FWPGSEVIKPD-WDC........-...........PSNY------
Q9SU83_ARATH/109-435----------NQGLK..........AATY------FWPGSEVHKGS-WNC........-...........PQGL------
Q9SU81_ARATH/60-394----------NQGLK..........AVTY------FWPGSEVLKSS-WTC........-...........PEGY------
Q9SU82_ARATH/57-390----------NQGLM..........AATY------FWPGADVHKGS-WNC........-...........PKGF------
YGK5_SCHPO/76-404----------RNNVR..........SAVH------MWPGNEVENHG-YR.........-...........PTYS------
Q6BTN4_DEBHA/173-514----------KQGVK..........SAIH------MWPGSEVNGVG-IGGG.......-...........PLEV------
Q6C6J4_YARLI/277-608----------YQNVS..........TAVH------MWPGSEANWLP-EDA........-...........PLIV------
Q7SI20_NEUCR/254-584----------KQGLK..........TAIH------MWPGSEAHVLD-IE.........-...........PTYM------
NPP1_YEAST/170-545----------AFDGDIP......FKAATH------MWPGSDVNYTK-YNEEKLQPEHK-NPIARER...TPFYF------
Q6FKX1_CANGA/187-587----------AYNHDDNM....NFKVYAN------MWPGSDVNYTS-LNYIKLERQ..-...........PYYM------
Q757R2_ASHGO/153-497----------AFGISE.......FSAAAH------FWPGSETVYEE-DDPERETRT..-...........PRYV------
Q6CX45_KLULA/136-460----------EIHLN..........THTH------MWPGSEQIHSD-PLRN.......-...........PTIV------
ENPP4_XENLA/30-339----------KQGHR..........SGCA------MWPGSDVSIHN-TT.........-...........PSDF------
ENPP4_HUMAN/28-339----------QENRS..........SAAA------MWPGTDVPIHD-TI.........-...........SSYF------
ENPP5_HUMAN/30-342----------RAGHT..........SGAA------MWPGTDVKIHK-RF.........-...........PTHY------
ENPP7_HUMAN/33-356----------RQGLR..........AGSF------FYPGGNVTYQG-VAVT.......-...........RSRK------
Q6ZM30_DANRE/31-356----------RQGLK..........TGSL------HFPGTAAKYQN-EKIK.......-...........VGEV------
ENPP6_XENLA/26-357----------KAKRK..........VSMY------YWPGCEVEIRA-IK.........-...........PNYC------
ENPP6_MOUSE/26-357----------KARRK..........VYMY------YWPGCEVEILG-VR.........-...........PTYC------
ENPP1_CAEEL/182-494----------KTGKK..........ANCL------FWVGCAYNNSG-YA.........-...........PDVA------
ENPP2_CAEEL/81-386----------LTGNR..........VHCL------FWVGCYYNITG-YM.........-...........PDVS------
Q47910_9FLAO/52-512----------DR.............GGIL------..PAGHFANAA-..YWLDGKTGD-WITSTYYMKDLPKWV------
Q9KJX5_FLAME/32-489----------DR.............ASIL------..PAGHNPTGA-..FWFDDTTGK-FITSTYYTKELPKWV------
Q55320_SYNE7/42-494----------DR.............GAIL------..PGGHTANGA-..YWYDDMTGS-FISSTHYMQQLPTWV------
Q89ZL4_BACTN/29-473----------D..............AAIF------..AAGHAGNGA-..FWINPTTGK-WSGTTYYG.EFPWWA------
Q7MEK0_VIBVY/30-506----------DR.............GAIS------..LGGHAGKA.-..FWFSKATSE-FVTSNYYYDQTPQWV------
Q84EY0_9GAMM/27-481----------DR.............SAIA------..LAGHAGKA.-..FWFDTTNGG-FIASTYYYKQYPQWV------
Q60113_ZYMMB/62-511----------DR.............AAIM------..MGGHMTDQI-....WFWSDNA-YKTLADHKGEMPATV------
Q98IY7_RHILO/32-447----------...............KCSV------VYPHDFVRVNN-VFEIVKAHGGR-TAWSDKH....PAYE------
Q7NDL2_GLOVI/4-434----------RAGKK..........VVAL------NYPFTAPPRPN-.TGSLVPGFTH-WKHLRRST..SPPEL------
Q9UZH6_PYRAB/14-420----------QKGKK..........SIIV------GVPPTYPPKPI-.KGYLVSCFIT-PDASVDYT..YPREL------
Q9YCR2_AERPE/4-405----------RLGLR..........SLVI------GVPPGYPARRV-.RGWFVSCFLT-PGVDGAFA..WPPGL------
Q9X5S9_STRLA/7-409----------AAGRS..........SVVL------GVPGTYPPAPI-.RGAMVSCFLA-PSTQSRYT..SPPGL------
Q9HSF0_HALSA/15-396----------DAGRD..........ATVM------NVPVTFPPQRN-.VQRMSSGFLS-PDIEKAA...HPPEF------
Q9X5S1_STRLA/5-395----------RAGRR..........TVCL------NVPGTYPAPAI-.DGVLVSGFVA-PELERAV...SPPRL------
Q9X5R9_STRLA/7-410----------AQEYS..........LGLI------NIPMSHPPADL-.....PGYQVT-WPLERTLKHCRPDSL------
Q9X5T4_STRLA/7-389----------FQGVR..........FASI------GLFGTHPPEPF-.....DGSLIT-YPMYATLHACHPRSL------
Q9YCS9_AERPE/3-432----------VENKR..........IAVF------FYPLTYPPYPI-.KGVLVSGIGT-PSLKPKS...YPQEV------

PF02995

Q9VSJ3_DROME/115-607---------NLPNAM----------HACS------..PFVVGGLDK-CDYIWKQYQQR.GYVTAYAEDA..VKI------
Q19148_CAEEL/75-621---------KSGDFN----------INWL------LPTEDKMDPTK-LNFLWKIMKEKYGCESLFNEDISTKGL------
Q21671_CAEEL/74-651---------DKPSLE----------ADWT------DDYFCNVFKDN-ETSLFDEFKTH.GYKTLMAEDW..ALG------
Q9VGG4_DROME/77-573---------DEVEAK----------SGCY------G.ASGGTNFDR-CHLLWHDFQAA.GYATIFGEDS..RVA------
Q9VQH3_DROME/74-555---------SEMEAS----------..CY------...HDELNFDK-CNFLWNEFKRA.GYSTIFAEDT..DTA------
Q9VAU4_DROME/90-580---------PESAIK----------KVCN------..WHEDGCLDR-TPFIWHYFRNA.SYLTAYAEDE..AGI------
Q9VKK3_DROME/98-598---------DDQELN----------LACT------..PKTLRSYDR-CSFIWKRYQQL.GYRSIFAEDV..AML------
Q9VIP6_DROME/62-563---------SEKGVG----------DYCD------..VTKPGCLDS-LNFIWKRFKKA.NYTTAFAEDC..SSI------
Q19486_CAEEL/79-568---------VGVKEF----------STEI------N.ESWHIAFDE-FDFIWKTFSDN.GYATLFAEDR..PDI------
Q9V9Q1_DROME/66-560---------SGQELK----------DVSS------....NLSSLDS-CPFIWKVFQKA.GYETGLGEDN..IDK------
Q9VF91_DROME/73-581---------TELELP----------ETRK------R.LSGAGSVDS-YPMIWKDFARL.GYMTSFNEDL..PNV------
Q9VLG3_DROME/84-577---------ASTAKE----------NVCD------..TDKQGCLDE-MPMIWKYFKNA.SYLTGYAEDE..SNS------
Q9V9P7_DROME/68-547---------SSRAAG----------....------....SDILSDE-KAWLWDSFKME.GYSTAYGEDN..AKG------
O18062_CAEEL/82-553---------TGDDVE----------VDWD------WNQYCETYLDN-SSHIFKDFKDH.GYATMLFEDW..EGN------
O62436_CAEEL/78-581---------TELPLT----------RKRY------..KNANYVDDV-YPFIWKNYSDK.GYVTMYAEDA..FSI------
Q9W0F7_DROME/16-518---------EENALF----------NGRF------G...HSGFIDK-LKFIWQLFKKN.GYMTAFGEDC..AKI------
Q8SY05_DROME/180-657---------NKTYAN----------ARCH------..PEKVRGLDA-CPFIWKDFKDK.GYTTAFAEDW..SKF------

PF01676

DEOB_LACLM/6-406---------TSADPVLQIAAHEDVISREE------LYKICEYVRSITLEGSGIMIGRII...ARPYVGE.AGNF------
DEOB_GEOSE/6-388---------TSADSVLQIAAHEEVIPLEE------LYRICKIAREL.TLDEKYMVGRVI...ARPFIGT.PGNF------
DEOB_BACSU/7-389---------TSADSVLQIAAHEEVVPLEE------LYRICETAREL.TLDPKYMVGRII...ARPFVGE.PGQF------
DEOB_SHIFL/2-406---------TSADSVFQIACHEETFGLDK------LYELCEIAREE.LTNGGYNIGRVI...ARPFIGDKAGNF------
DEOB_HELPY/3-406---------TSADSVFQIAAHEERFGLDN------LYALCEEAFQI.LEP.....LKIARVIARPFIGTNRESF------
YHFW_ECOLI/2-397---------ITANLSVISFDDAIKIGRIV------REQVQVGRVIT.FGGLLTDSQRIL.....DAAESKEGRF------
APGM2_ARCFU/1-380---------..TGKEIDKHLPSGGELAEL------LKELMGWSAEI.LPEITD.................KANM------
APGM2_METTH/4-396---------..VGESVAAHLPSGSEEADH------IRELMLESAGV.LRSHEVNLKRES.......MGKRPATM------
APGM1_ARCFU/1-399---------KVKRCVPLADDAKAKKTAEI------VNEFMQKAHEV.LENHPLNRERAE.......KGLLKANA------
APGM1_METJA/4-402---------IKPLDD....SEEAKRTAEI------LNKLLKIVYEK.LNNHPINEERRK.......KGLPPANI------
APGM1_METTH/1-400---------IKALDG....SPESRKTAEV------LNRIVKESYEI.LRDHPVNTGRIE.......RGEAPANI------
APGM_PYRHO/5-403---------FSYEDE......DSKKVAEI------LEEFVKKAQEV.LEKHPINERRRK.......EGKPIANY------
APGM_AQUAE/13-398---------.........ENPNAEKVAEV------VRKFIQRATEI.LRNEP..................KANY------
APGM2_METJA/1-398---------IRELCKSEVEYSKAKDTARA------LNKYLLNVYKI.LQNHKINRKRRK.......LEKMPANF------
GPMI_PORPU/7-514---------IKDGDAIIFFNFRPDRMRQL------VQALVQKPFNC.FLTKSL..SHLHVLTFTNYDSSLNTAL------
GPMI_ANTSP/7-506---------IVHNDSLIFFNFRPDRIRQL------LHSFAKPNFKG.FQRKTI..KNLMLTTFTEYDSTLSIPT------
GPMI_SYNY3/7-511---------IASGDGVIFYNFRPDRARQL------CYALVNPSFDG.FPRERI..QPLDFVTFTQYDPALPVVV------
GPMI_PSESM/6-504---------VEDGDAVVFMNFRADRAREL------TRVFVEDDFKD.FERARQ..PKVNYVMLTQYAASIPAPS------
GPMI_ECOLI/6-508---------MEDGDALIFMNFRADRAREI------TRAFVNADFDG.FARKKV..VNVDFVMLTEYAADIKTAV------
GPMI_BACSU/4-506---------IQDGDSVIFYNFRPDRAIQI------SNTFTNKDFRD.FDRGENYPKNLYFVCLTHFSETVDGYV------
GPMI_MYCGE/3-500---------LNNNDGVISFNFRPDRARQM------SHLIFNSNYYN.YQPELKRKENLFFVTMMNYEGIVPSEF------
GPMI_MYCPN/3-501---------LKDHDSVIFFNFRPDRARQM------SHMLFQTDYYD.YTPKAGRKYNLFFVTMMNYEGIKPSAV------
GPMI_HELPY/3-489---------MQDDESFIFINFRNDRAREI------VSALGQKQFSG.FKRQVF..KKLHIATMTPYDNTFPYPV------
PMGI_MAIZE/20-552---------VLDGDAVVTINFRADRMVML------AKALEYADFDN.FDRVRV..PKIRYAGMLQYDGELKLPS------
PMGI_TOBAC/20-552---------ILDGDAVVTFNFRADRMVML------AKALEYENFDK.FDRVRV..PKIRYAGMLQYHGELQLPS------
PMGI_MESCR/20-552---------IVDGDAVVTLNFRADRMVML------AKALEYEDFDK.FDRVRF..PKIRYAGMLQYDGELKLPN------
PMGI_RICCO/17-549---------IVDGDAVVTINFRADRMVML------AKALEYENFDT.FDRVRF..PKIHYAGMLQYDGELKLPS------

PF00245

PPBN_MOUSE/51-486---------.CKDISTQLISNM...DIDV------ILGGGRKFMFPKGTPDQEYPTDTKQAGTRLDGRNLVQEWL....A
PPB4_BACSU/49-459---------...SYMDDKIKGK..HKIDV------LLGGGKSYF...................NRKDRNLTKEF......
PPB3_BACSU/43-455---------...DYFDEMVNGK..HKIDV------LLGGGKSNF...................DRKDRNLIKEF......
PPBT_BOVIN/51-490---------.CKDIAYQLMHNI..KDIEV------IMGGGRKYMFPKNRTDVEYELDEKARGTRLDGLNLIDIWKS.FKP
PPB_BOMMO/74-515---------RCPDIAHQLIKMAPGNKFKV------IFGGGRREFLPTTQVDE.....EGTRGLRTDGRNLIEEWQNDKES
PPB_YEAST/66-527---------......HQLGEYPLGRVVDL------LMGGGRSHFYPQGEKAS....PYGHHGARKDGRDLIDEA......
STRK_STRGR/41-448---------.EGSIAEQTVAAR....PDV------LLGGGADHFAQTVTDG............PFRGRTVTQQA......
PPB1_HUMAN/55-490---------.CQDIATQLISNM...DIDV------ILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWL....A
PPBI_MOUSE/52-486---------.CKDIATQLISNM...DINV------ILGGGRKYMFPAGTPDPEYPNDANETGTRLDGRNLVQEWL....S
PPB_ECOLI/64-470---------.KGSITEQLLNAR....ADV------TLGGGAKTFAETATAG............EWQGKTLREQA......

PF08665

Q2RKS0_MOOTA/260-429-------------------------FLQF------VREKWLE....----------------------------------
O32495_DICNO/401-579-------------------------KQFW------EGHGLSR....----------------------------------
B0K8X1_THEP3/380-556-------------------------KKFW------MNQGYKG....----------------------------------
Q72AH5_DESVH/438-616-------------------------QGTA------NRIKILGQAIS----------------------------------
Q4BWC0_CROWT/438-619-------------------------QGTE------NRRKILEKAFE----------------------------------
Q8Q0H3_METMA/497-672-------------------------EGLE------NRKKILQNNCL----------------------------------
Q8TNC5_METAC/496-671-------------------------EGLE------KRNKILQSKYE----------------------------------
Q3A8U0_CARHZ/461-637-------------------------EGTD------NRNMILQNHVN----------------------------------
B1YIB9_EXIS2/462-638-------------------------AGLE------NRKKIIESYVE----------------------------------
Q5P0R1_AROAE/485-661-------------------------STLE------QRNAHLAKYE.----------------------------------
A4JFG3_BURVG/484-660-------------------------ATLE------QRSAILAQHG.----------------------------------
Q2W5M5_MAGSA/475-648-------------------------AA.G------NRSNILATKK.----------------------------------
Q8RL18_PRORE/500-676-------------------------QGLD------NRNAILQKVG.----------------------------------
Q8ZK15_SALTY/474-650-------------------------SGTP------NRDTILKKYK.----------------------------------
Q7MVV4_PORGI/231-425-------------------------EGKN------LNEEPMIRTLI----------------------------------
Q53943_STRCH/527-704-------------------------FPAL------KLWGGAP....----------------------------------

PF07394

Q7UT83_RHOBA/61-480---------TRQHQRRMLDELAALNKDHLNASSLEQHPNAGELAARMESYELAFR....MQTSVPNLIDLKTEP------
Q7UHL2_RHOBA/84-501---------TETQQRLDLSLIQKLNQRHLQ.....QRDFDDRLNARVKAYELAFR....MQSEAPELVDIQQET------
Q7UN58_RHOBA/63-468---------......HQFDLVNQLNRGHVQ.....SAGRDRATDGAIEAVDLANR....MRGTAPEVMDLSKET------
Q98BS1_RHILO/39-404---------VIRGAAPVLGWAP.............QSLPAPAGDLAARVLDLYQHRDPVLAAALQKGLDAERMA------
Q7UHK7_RHOBA/71-478---------TKQDQVAQLDLMAKLNDEHMR.....RHTRDAEFANRMQSFELAFR....MQKEATEVVDLSRET------
Q7UKW9_RHOBA/100-522---------SRDHRRQQLDSINRLNSHQY......QREFDPEIQSRIAQYEMAFK....MQTSVPDATDFSDEP------
Q8P3X8_XANCP/29-384---------TFQGAGDLPNVSLKG...........IGKRGLDDRQAQILAQMYGATP..LAAAARDGLALRQQV------
Q7UZ35_RHOBA/49-467---------TDTTQRATIEAVNAFNQDLL......ADRGDSEIATRISQYEMAFR....MQTSVPELADMSDES------
Q7UFP1_RHOBA/49-464---------NHSQQRDIVDAVARINMHRN......ETLQDPEIATRISAYEMAFR....MQTSVPELTDMTDEP------
Q7MLK9_VIBVY/33-420---------LNGEKQRANLINPDGMPT........LWANNNTLRRQSFDQVLALQPDSLFAQAFD...QVKSDS------
Q7US09_RHOBA/66-482---------AGPQQRAALDFLADLNQAHAA.....ERSDNSELEARIRSFELAYQ....MQSHAPDAVDLSQET------
Q7VYL6_BORPE/29-381---------IFRGQARVPNIDLGGA..........KRKSRLTADSSSAIAQMYQGTG..LDASVNEGLAAMGQA------
Q7UDW2_RHOBA/77-502---------SRQERRQVLDALAALNQESL......QQYGDPETVTRIAQYEMAYR....MQVAAPEAMDLSQET------
Q87HJ3_VIBPA/35-425---------LKAMEHRQTVLKKDKAVQ........LTAVGNPLYEEVYQKLLSQSADNPFSGHFN...LMVDES------
Q7UM62_RHOBA/63-489---------SRIQRRRALDTLAKLNREMF......EQTGDAEVLTRISQYEMAFR....MQTSATEAFDLTQET------
Q7UJ64_RHOBA/59-474---------SRARQRLNLDLLSRMNQRHAA.....KHPGHDELSARLVSYELAFR....MQTEVPEAMDLSGET------
Q7UIF5_RHOBA/61-494---------FQEEQAGEFELLRQLNQISSE.....QFPNDEALRARVRSYELAFR....MQTAVPDVVRLEDET------
Q7UYJ8_RHOBA/60-484---------SPETDRATRGFLERMNQRHLK.....QFPGDTELAARISSYQLAAR....MQLSVPEVTDLSSES------
Q7MCK0_VIBVY/38-408---------TQSENYRQEVITPNGIASGF......LSAWSEGPRLRAMQYDVANPRENLFMRHNQ...NMLAEF------
Q9A5N3_CAUCR/44-506---------ISVGPTGGSAVRVDLLQKTG......SYNNSPTFLSALSATLLGNDAEGSVLGQAYADAMVTSNN------
Q7ULC1_RHOBA/52-445---------TDGRFSSRQQIRQRIDTMMRFN....DASVADPTLAVDEFYQQSLQI..ISSKEAQAAFDIHQES------
Q7UQT8_RHOBA/50-438---------SIDEVTRRQSLLKKLDRRFAS.....IEKNESLLQGLDRFGEQAYAM..ITSSRAREAFDISREP------
Q7UQ29_RHOBA/54-472---------HPINQREQLDLLAKMNQQHAA.....QRGNDPRLESRIESFELAYR....MQSEASEAFDISRET------
Q7UGB9_RHOBA/69-492---------RPSDRRKVVDAVKDLNALRL......DDVGDPEISTRISQYEMAYR....MQTSVPELMNIDNET------
Q7UPP6_RHOBA/56-434---------DEKLFYRRLALANRFDKSFQ......SQRDNNDVEAYNQLYLETRK...LMGSEHLKVFDLNEED------
Q7UI66_RHOBA/46-421---------DDQRLLQRMAALNMIESGFA......KRTRDTPAAEHAKVLGKTLD...LMTSEQMEAFRVEKEP------
Q7UVE3_RHOBA/81-505---------PRELRREMLDGLAGMNRLHH......TETLDPEIETRIAQYEMAFR....MQTSIPDLTDLSDES------
Q7UW70_RHOBA/70-497---------FDVRLQRRANLRQALNEQMP......VINEAVEKFELDQNYDRALSL..ILSGRARDAFQLSAED------
Q7UKM6_RHOBA/69-495---------SRDSRRELLNTLGRMNQMHS......EATGDPETLARIEAYEMAYR....MQTSVPELTDVSDEP------
Q7UTL9_RHOBA/100-490---------DAERQSRREQLLSATRASARR.....RFDNDSAVANYDSVIEQSLR...LSGPEFGEVFELENES------
Q7UGF5_RHOBA/94-499---------PDVRIDRRRRMRDSIESHMA......RFESTESAKLFDANFEAAYRM..MNSPEARMAFDLSKEP------
Q9A6V4_CAUCR/38-393---------ILRGKVQAASWS..............PGKGVDETARLPMLLQDLYRSDPLLGPAFARGLETEAMA------
Q7UYC8_RHOBA/101-527---------DPTIRRRMLDSLGDLNRKHF......GEIGDPEIETTIAQQEMAFR....MQTSVPELTDISDES------
Q7UR29_RHOBA/60-444---------DEARFMRRKRALEMVNQRFV......TGTSADNVGAMNTFYERAYDL..LDTPEAKAAFDLSKED------
Q7UYM7_RHOBA/45-446---------DAERMDKRLKIWRRLQSHFV......TSRQAGAAGMHNEVYEGAVR...LMNSDDAKAFDLSDEP------
Q7UV65_RHOBA/50-468---------SLDAQRMQLDLTQSMNREFLE.....TTGPDSELEARIQSFELAFR....MQTEMPEALDLESET------
Q7UJ54_RHOBA/70-497---------NRESRQKMLDLVTDLNRQHM......QQIGDPEILTTIAQQEMAFR....MQASVPELTDLSQET------
Q7UJ36_RHOBA/99-512---------SDWSQRQSLQTVNELNRRRL......DVVGDPEIATRINGYEMAYR....MQSSAPEAMALSDEP------
Q7NT93_CHRVO/33-383---------PLDGGARAVVL...............SNPQDFARQAKLVADQQPGRAGAALEHILKVEGDIRQAA------
Q7UEK9_RHOBA/80-501---------SASTELASCEALRFLEQQYQD.....RFPGDQQLAARMASYELAAR....MQLQVPDVVDLSGEP------
Q7UQW1_RHOBA/70-487---------DIGRQRAHLDLISKLDSEAMR.....HGLRHDAVESAIANYELAFQ....MQAAVPDLMSIKDEP------
Q7UPF7_RHOBA/65-448---------DESRYQRRLDALNNVLEPQFT.....RGRIRNLQENRTLHLAGTQAARKMMSSDQLTAFDVKEEP------
Q7UYR5_RHOBA/95-521---------DSGVRRRMLDTLAELNRNTL......DRWHDPETEARIAQYEMAFK....MQTSVPELTDLSDEP------
Q7UWA1_RHOBA/72-492---------PPGLQRRLIDSIQDANRRHLV.....QHVGEEPLASRISSYELAYR....MQSAAPEAVDLSDET------
Q89DL5_BRAJA/42-392---------VLRGNAPTVGWAP.............VALPQADDDTAMRLVDLYRHRDPALAMALSQGLQLEKAA------
Q7URV7_RHOBA/77-499---------TPDADAATVDLLQRLNAKHLE.....LYPGDANLAGRIASYELAGK....MQTSVPDVMDLSGET------
Q7MDY0_VIBVY/67-457---------LRASEYQQVVLRKDRAVE........LNGLADSGLSDLYDEMLAFESESPFQRQFR...RMVNHS------
Q7UH70_RHOBA/75-488---------VPSQQKRQMDLIQNLNRMHLA.....DRSDDAQLSGRIESLELAFR....MQGEARDAFDISSET------
Q7UVE1_RHOBA/82-507---------TREARRAMLDSLNRLNQTSH......ETFGDPETITRIAQYEMAFR....MQSAVPDAMDISKEP------
Q7UQ53_RHOBA/45-480---------SARGDREGLAMLNRMNDRYLQ.....ERPGDSRLEARIRSYELAAA....MQLHAPEALDISGET------
Q7UP10_RHOBA/69-492---------DSQSRRSAMDALSKLHQMQL......ATQADPLVEARIAQYEMAFA....MQSSIPEATDFADEP------

PF04185

PHOX_KLULA/65-312.........RFISMPS.............------NVSNIVDLLDT-KGISWAEYQEHSPYAGFQGMNFSNQET------
Q9S816_ARATH/13-380......NERKLLI.............EGF------PQKTIFESLDE-AGFTFGIYYQCFPTTL......F....------
Q9SRQ6_ARATH/16-381......NDTNTLV.............RGF------PQRTVFESLEE-SGFTFGIYYQSFPNCL......F....------
Q47936_FRANO/55-471SYGTSKSGDTNTAVAKIT........DGY------...NIGHYLTQ-KGITWGWFQGGFKPTSYSGKTAICDAM------
Q97V43_SULSO/27-365........TNVIP...............F------NYSIMYQ.LQL-NNVSWGYFVYKLNGIPWP.........------
Q9LML5_ARATH/38-396......NVKKDLV.............KGF------PQKTIFDSLDE-NGLSFGIYYQNIPATFF..........------
PHLB_MYCTU/52-435......DGGPVLIEPNIQ......PLQHY------SWRIMPENLED-AGVSWKVYQNKLLGALNNTVVGYNGLV------
Q9A412_CAUCR/40-437......AGGPSISNSHDNFAEKGGAKESY------TWTTYPERLLQ-AGVSWRIYQDMADNFTDNPLAGFKAYR------
PHLC_PSEAE/51-437......MGDGTIGAS...........GTV------DWTTYPERLSA-AGVDWRVYQEGGYRSSSLWYLYVDAYW------
PHLD_MYCTU/50-429......NGGPELQSPTFQ......PVRRF------GWRIMPQNLSD-AGVSWKVYRNKTLGPISS.VLTYGSLV------
Q9SMN8_ARATH/1-336......HVKKQLAQ.............GY------PQKTIFDSLHS-NDIDFGIYFQNIPTTL...........------
O53361_MYCTU/50-282.............................------STVCSAGKYAR-KHVPWVNFSNVPTTL............------
O81020_ARATH/27-389.....ATSNNPISLAK...........GY------PQRTIFDNLDD-EEFSFGIYYQNIPAV......LF....------
Q9KH04_BURML/84-547SVRPPVEGNPAYADPS.....NPRVLPPQ------HYATIGDRLSE-KGVDWAWYGGAWQYALEHRDTGSVPDF------
PHLN_PSEAE/48-422......HGGPVTTNDHDS...NGPVEQGY------TWTTYPERLQA-AGITWRVYQDMADNFSDNPLIGFRQY.------
PHLN_BURPS/47-438......GGGPVLGNEE..........AGY------GWSTYPETLEQ-AGVSWKIYQDIGTGLDAAGSWGWTQNP------
Q983N8_RHILO/60-507GTDPAPGGDPLLADPA.....KPTTLPPQ------TEPTIGDMLSL-KHISWAWYSGAWQYTLDHGNKSPIPNF------
PHLA_MYCTU/51-431......DGGPQLVEPGFL......PLQQF------SWRIMPENLED-AGVSWKVYQNKGLGRFINTPISNNGLV------
Q98ES1_RHILO/58-274..........................HSF------AAPNLAARLRA-HGKTFAGYVEARSPRK...........------
PHLC_MYCTU/52-433......QGGPQIVEPAIQ......PKLTF------TWRIMPQNLSD-AGISWKVYNSKLLGGLNDTSLSRNGYV------

PF14707

F1QB82_DANRE/433-568-----------------------------------...V.CFCIKP----------------------------------
F1QQ07_DANRE/367-495-----------------------------------...DNSCSLLA----------------------------------
ARSA_HUMAN/368-502-----------------------------------...DPACHASS----------------------------------
F2UD41_SALS5/491-612-----------------------------------...VPSCRSNT----------------------------------
F1QFT2_DANRE/220-353-----------------------------------...VPGVTTHT----------------------------------
ARSH_HUMAN/418-551-----------------------------------...I.CSCSGD----------------------------------
ARSG_CANFA/402-522-----------------------------------........DVG----------------------------------
A8XD87_CAEBR/394-528-----------------------------------...VSQVCPDE----------------------------------
ARSG_MOUSE/402-522-----------------------------------........SVG----------------------------------
A0YAF7_9GAMM/381-478-----------------------------------.........QK----------------------------------
C3YQ76_BRAFL/419-552-----------------------------------...L.CQCRGD----------------------------------
Q5XG10_XENLA/375-508-----------------------------------...ITGVTTHM----------------------------------
A7V8P9_BACUN/356-447-----------------------------------...........----------------------------------
ARS_HEMPU/396-526-----------------------------------...DCNDCEGD----------------------------------
Q4RYA1_TETNG/304-429-----------------------------------...V.CFCTAG----------------------------------
F2UCT8_SALS5/90-221-----------------------------------...........----------------------------------
C3YZM0_BRAFL/417-549-----------------------------------...G.CSCDDR----------------------------------
A7SK49_NEMVE/435-563-----------------------------------EYKL.YGCYGD----------------------------------
GALNS_CANFA/377-510-----------------------------------...VSGVTTHT----------------------------------
Q6GMA1_XENLA/439-573-----------------------------------...V.CPCDGD----------------------------------
A9VBN0_MONBE/428-544-----------------------------------...SPEPRTAG----------------------------------
C3ZST4_BRAFL/433-562-----------------------------------...I.CQCTGQ----------------------------------
A6QLR7_BOVIN/402-522-----------------------------------........SVG----------------------------------
STS_HUMAN/437-572-----------------------------------...V.CFCFGS----------------------------------
Q4TCJ7_TETNG/242-385-----------------------------------...I.CQCFGK----------------------------------
F1NFQ0_CHICK/445-579-----------------------------------...F.CPCFGE----------------------------------
E4YGB6_OIKDI/449-582-----------------------------------...I.CGCYGP----------------------------------
D2HFI2_AILME/436-570-----------------------------------...L.CPCSGD----------------------------------
E1FX25_LOALO/406-541-----------------------------------...VSQRCPED----------------------------------
F1R580_DANRE/251-371-----------------------------------........ESG----------------------------------
O16138_HELER/402-534-----------------------------------...DCNDCEGD----------------------------------
Q32KK0_RAT/450-603-----------------------------------AAAV.CPCVGK----------------------------------
D2HXW7_AILME/434-569-----------------------------------...V.CFCHGQ----------------------------------
D7VQY4_9SPHI/353-442-----------------------------------.........GL----------------------------------
Q6DJK3_XENLA/433-566-----------------------------------...F.CSCSGN----------------------------------
Q32KK2_RAT/368-502-----------------------------------...DPACHAAN----------------------------------
Q32KI1_CANFA/444-578-----------------------------------...V.CPCSGD----------------------------------
E4XNY3_OIKDI/402-533-----------------------------------...VPNVTTEV----------------------------------
C3ZQB5_BRAFL/418-551-----------------------------------...TSFDCYGP----------------------------------
E6ZGQ8_DICLA/413-534-----------------------------------........ATG----------------------------------
A9UXW0_MONBE/287-431-----------------------------------..GSLCDCAEE----------------------------------
Q1YP24_9GAMM/409-501-----------------------------------...........----------------------------------
ARSE_HUMAN/448-582-----------------------------------...V.CPCFGE----------------------------------
F1KQC6_ASCSU/1702-1837-----------------------------------...VSQKCPEE----------------------------------
F0Y2N2_AURAN/404-544-----------------------------------...GLAGCDGC----------------------------------
Q4S4L1_TETNG/407-528-----------------------------------........ATG----------------------------------
Q7ZWB8_DANRE/433-548-----------------------------------...L.CMVTPT----------------------------------
A3XMW9_LEEBM/382-476-----------------------------------...........----------------------------------
C3YBU1_BRAFL/392-524-----------------------------------...I.CRCGGP----------------------------------
Q4RJR3_TETNG/343-474-----------------------------------...DQDCSIFA----------------------------------
ARS_STRPU/411-541-----------------------------------...LCSDCEGD----------------------------------
F2UKF0_SALS5/383-527-----------------------------------..GSLCPCDAE----------------------------------
Q0C069_HYPNA/397-504-----------------------------------...........----------------------------------
ARSF_HUMAN/440-574-----------------------------------...L.CRCFGE----------------------------------
A4AN36_MARSH/378-468-----------------------------------...........----------------------------------
F1NW57_CHICK/376-509-----------------------------------...VSGVTTHL----------------------------------
C3Y4J9_BRAFL/389-521-----------------------------------...V.CYCYDG----------------------------------
C1BQY6_9MAXI/368-497-----------------------------------...DVSCGLRA----------------------------------
C3ZQC1_BRAFL/339-471-----------------------------------...TSFDCYGP----------------------------------
Q4SI19_TETNG/404-542-----------------------------------...VPGVTTHE----------------------------------
STS_MOUSE/445-581-----------------------------------...V.CLCAGP----------------------------------
A4CMB0_ROBBH/401-491-----------------------------------...........----------------------------------
STS_RAT/436-573-----------------------------------...V.CMCHGH----------------------------------
ARSD_HUMAN/451-585-----------------------------------...V.CPCSGE----------------------------------
B4DQ74_HUMAN/301-421-----------------------------------........STG----------------------------------
A5D7J7_BOVIN/445-576-----------------------------------...V.CPCSGN----------------------------------
Q32KI0_CANFA/435-568-----------------------------------...F.CRCSGK----------------------------------
F1R2X2_DANRE/342-476-----------------------------------...S.CMCHKP----------------------------------
F2U742_SALS5/410-536-----------------------------------...........----------------------------------
A9V957_MONBE/437-571-----------------------------------...WPDSQIGH----------------------------------
A9UPM8_MONBE/326-452-----------------------------------...........----------------------------------
B9QU81_9RHOB/44-158-----------------------------------...........----------------------------------
Q6AX40_XENLA/368-500-----------------------------------...DPDCHVTA----------------------------------
F1NWF7_CHICK/360-492-----------------------------------...DQACHGLT----------------------------------
C3Z258_BRAFL/432-564-----------------------------------...I.CRCAGQ----------------------------------
A9V7E7_MONBE/452-571-----------------------------------...........----------------------------------
ARSA_BOVIN/368-502-----------------------------------...DPACHASN----------------------------------
A6CB11_9PLAN/382-473-----------------------------------...........----------------------------------
F0SFZ7_PLABD/380-468-----------------------------------...........----------------------------------
C3Y4X6_BRAFL/434-568-----------------------------------...LACFCGTR----------------------------------
C6W2Y6_DYAFD/349-461-----------------------------------...GKNGQPGP----------------------------------
E1BU03_CHICK/378-498-----------------------------------........SIG----------------------------------
A7SK50_NEMVE/483-612-----------------------------------...V.CGCYES----------------------------------
A1L2N0_XENLA/374-506-----------------------------------...DADCHVTA----------------------------------
C3ZV84_BRAFL/657-790-----------------------------------...IPGVTTMQ----------------------------------
A7SQ82_NEMVE/425-557-----------------------------------...V.CRCYGE----------------------------------

PF00884

C3LB12_BACAC/143-439........-----.....................................................IGDLSMSKEIID--
O06776_MYCTU/43-460........-----...............................................TPEEGYHFMADMTDKALG--
O25301_HELPY/294-587........-----...................................................WGVHDNILFDYILE--
O34609_NEIME/232-524........-----...................................................GECLDNILLTKFDE--
LTAS2_BACSU/245-536........-----....................................................GMKDKPFFKESMP--
O43113_NEUCS/45-420........-----.............................................PPISYEGQYSVDVLAEKAYG--
O65931_MYCTU/212-635........-----.............................................SGEDGRPYYFPDDLTDKAIE--
O82879_STRMU/460-745........-----.....................................................VSDKTTYQNILD--
O85099_ECOLX/237-530........-----................................................TQSAREYDTNVLKPFRE--
YEJM_ECOLI/260-505........-----.....................................................QSDEQTATQWIN--
ARS_HEMPU/52-373........-----.........................................NATLVSQPYQHKGLTQLFTDDALG--
ARS_CHLRE/27-385........-----.............................................TPNIYPGEYSTDVIRDKGVA--
ARSA_HUMAN/21-346........-----....................................IPLLANLSVEAQPPWLPGLEARYMAFAHD--
ASLA_ECOLI/86-419KDD.....-----................................VHAVRGGEQQAIADITPKYMEDLDQRWMDYGVK--
EPTA_ECOLI/236-527........-----...................................................GECYDEVLFHGLEE--
YIDJ_ECOLI/4-341........-----............................................QANHIDETFTWAHRISNRAVD--
ARSB_FELCA/47-366........-----.........................................DGEQVATGYKNMYSTNIFTERATA--
GALNS_HUMAN/31-355........-----.........................................EEFPINLKTGEANLTQIYLQEALD--
EPTB_ECOLI/248-538........-----.....................................................VDDMLLVDEMQQ--
Y1005_HAEIN/211-475........-----................................................YNSKKVYDDEMLPVLDK--
GNS_CAPHI/54-391........-----.............................................HGENYSVDYLTDVLANVSLD--
STS_MOUSE/35-421AAMAAARW-----AGLARVPGWALAGTAAAMLAVGGPRSASCLGFRPANCFLMDDLAVAQRPTDYGGLTRRLADEAAL--
ARS_STRPU/67-388........-----.........................................NSTSVAQPFQHKGLTQLLRDDTVG--
SPHM_HUMAN/23-328........-----.....................................................RNITRIKLLVRK--
ARS_PSEAE/5-420........-----.......................................VEDERYLDTLPEGFYSSDAFGDKLLQ--
YHBX_ECO57/223-491........-----....................................................RGFDELLLPHLSQ--
CGMA_RHIME/269-561........-----.....................................................ASDESLTKEIIR--
YBIP_ECOLI/217-483........-----................................................EADKNTKDEALLDMTAQ--
YDEN_ECOLI/58-408........-----.................................................PAKGYISDQLTDEAIG--
P95059_MYCTU/37-466........-----...............................................TPEGGYHLSKDIADKTIE--
P95081_MYCTU/5-389........-----.........................................GLANSGFRRDPLVADRVVAWLTER--
ARS_VOLCA/26-386........-----.............................................TPNIYPGFYSTDVIADKAVA--
Q45087_9BURK/4-384........-----.............................................PSRIPKEFSDSTFFTERALT--
Q833K3_ENTFA/256-543........-----....................................................YISDQAAYQEVTT--
Q840W2_STRMU/270-555........-----.....................................................VSDQTTYENILD--
Q8DUS0_STRMU/503-788........-----.....................................................VSDKTTYQNILD--
Q8G592_BIFLO/306-604........-----....................................................YVSDKSSYDSALE--
Q8K804_STRP3/480-765........-----.....................................................TSDKTVYNNILS--
Q8P1I3_STRP8/480-765........-----.....................................................TSDKTVYNNILS--
Q8XK47_CLOPE/257-551........-----.....................................................PEDVLNIEPIED--
Q984T6_RHILO/281-574........-----.....................................................ASDAAMTDEIIR--
Q98EG2_RHILO/158-441........-----.....................................................ADDAEVLDLSFD--
Q9A0F9_STRP1/480-765........-----.....................................................TSDKTVYNNILS--
Q9AI31_BURML/214-497........-----.....................................................ISDAAVLDQIVA--
Q9CKD9_PASMU/287-557........-----.....................................................VSDEDLFDKAHE--
Q9CM05_PASMU/231-523........-----...................................................GECLDNILLTQVDQ--
Q9HVQ5_PSEAE/238-530........-----................................................SQNASQLDGAVLAPFAK--
Q9HYT4_PSEAE/238-529........-----...................................................KNCLDESLLVGLQE--
Q9I2D3_PSEAE/231-522........-----...................................................GECHDEILLRDLQA--
Q9I4M0_PSEAE/223-501........-----....................................................GMDDKAFFEGAAT--
Q9JXJ7_NEIMB/214-487........-----.................................................NGDNMPDEKLLPLFDK--
Q9KKK2_VIBCH/240-530........-----...................................................DTCYDIAMLENLDQ--
Q9PGC7_XYLFA/245-535........-----..................................................SGRCMDEILLKDFVS--
Q9RBI1_ACIAD/237-531........-----...................................................GECYDEVLIEALND--
Q9RMJ0_NEIME/232-495........-----................................................GKSAGLSDRLLLPAFKR--
Q9X6R2_PSEAI/20-300........-----....................................................GVSDQDMFARGNE--
Q9ZDJ9_RICPR/218-505........-----...............................................ALLSLNDYDEKILPFIKE--
Q9ZJJ5_HELPJ/225-518........-----..................................................NYGAYDEELVKFYSK--
Q9ZN39_HELPJ/222-504........-----.....................................................PYDESLLYNLPN--

PF01663

ENPP3_MOUSE/161-485..RNYSNS...VPY......................................................ERRITTLLQ.--
O29992_ARCFU/4-416LRRFARHR.GRKKSS..................................................FLKKLILKLFPLH--
O50518_STRCO/58-383ANTPLTKV.ALSGGE..................................................FHGRLSGEDRMDC--
Q73VT6_MYCPA/42-363LGSGLTEA.AYRGAR..................................................LVPAEPADDYPRL--
Q6A8W7_PROAC/44-359QRSGLTRA.SLRGPR..................................................FIPIRDEDDVDER--
Q6N507_RHOPA/30-497PDDFKAEL.DKLGLPLKPPARGENAKAG.........................DAKTPGTLVANVVQQAYFADVAAKA--
Q7WNM8_BORBR/6-370PYSGAEAL.........E...............................................IASGAAGDAEMTR--
O58841_PYRHO/4-322SDELYRR..........................................................HGRDWKKDVWVLN--
O69954_STRCO/13-378HDELTDKL.GTFPLFHFW..............................................GPGADLVSSQWIID--
Q7AYA7_9RHIZ/4-370RDELTRKL.GAFPLFHFW..............................................GPATSIASSRWIAD--
Q7NU73_CHRVO/4-375RDRLTAEL.GTFPLFHFW..............................................GPATSIASSRWIAE--
Q8YZP2_NOSS1/4-370RSRLQIDL.GQFPLFNFW..............................................GPNTSIRSTQWIAD--
Q7UKE3_RHOBA/4-350..NLTEKL.GPFPFFGFW..............................................GPAAGIASSDWIAK--
Q71ZQ2_LISMF/5-366PNRFWLTQ.MMVSLHASSPLFLIDM...............................DRKFGHLRKGINQPDLDIFLTA--
Q73E52_BACC1/9-380PNRPWQNQ.VLVSLFSGSPLYQLDL...............................NRRFGHIRNGLSQPELDDFVLA--
Q8XKL9_CLOPE/10-374ETKPWHNQ.IIMSALAGSKVYQFSM...............................NKKFGSLRKGTKEPYLDNFVTA--
Q97LS7_CLOAB/8-378SVKPYTNQ.VIASLVNGTPLFLLKL...............................ILKFGTTLKGAEQPNLDDFLCK--
O45359_CAEEL/26-353VPPRTDGK.........T...............................................FADESQAKRVIQ.--
Q22129_CAEEL/24-374WANLDDQH...........................................................QTDNLRDIFPE--
Q981Q5_RHILO/5-379AASRAIHD.PEDRLAKAGLTEMDAFR..............................DAADGGAPHLISGLALDQFLNR--
O69013_ZYMMB/50-367..RQFDSH...VPF......................................................SERVDQVFS.--
Q9A8S4_CAUCR/74-393..VKFDQT...MPG......................................................DARVDQVLN.--
Q8PIS1_XANAC/48-366..RHYQKG...VRL......................................................DTRVDAVRG.--
Q9PAB9_XYLFA/40-358..YAYNKH...ISA......................................................DTQITQALR.--
Q7MXP5_PORGI/37-349..KKFSST...VPF......................................................RDRADSVIA.--
ENPP2_RAT/165-477...........IPH......................................................ERRILTILQ.--
Q7ZXN7_XENLA/166-476...........ISQ......................................................ERRIFTVLQ.--
Q6PGY9_DANRE/161-472...........IPM......................................................ERRVLTMLQ.--
ENPP1_RAT/194-520..KVYNGS...VPF......................................................EERILAVLE.--
Q6VZU9_CNPV/107-431..RAYNRS...VSF......................................................DDRVEAVLK.--
Q70HC0_FOWPV/120-443..RSYNKS...VPY......................................................EERINTVLR.--
Q7F5L2_ORYSJ/92-418C.RHYNGS...VPF......................................................EERVDAILG.--
Q9FS13_SPIOL/96-418C.IHYNGS...IPF......................................................EERVDTVIS.--
Q9SU83_ARATH/109-435C.QNYNGS...VPF......................................................DDRVDTILS.--
Q9SU81_ARATH/60-394C.PHFNLS...VPL......................................................EERVDSVLS.--
Q9SU82_ARATH/57-390CKAPYNVS...VPL......................................................EERVDTILN.--
YGK5_SCHPO/76-404..DGFNFD...TTL......................................................REKKDRILE.--
Q6BTN4_DEBHA/173-514..DRYNGS...EVL......................................................SSKVYRVMN.--
Q6C6J4_YARLI/277-608..DPFNQT...EAL......................................................YKKLDRLTE.--
Q7SI20_NEUCR/254-584..DRYNGK...EKL......................................................GNKVDRILG.--
NPP1_YEAST/170-545..DEFNAK...EPL......................................................SQKLSKIIE.--
Q6FKX1_CANGA/187-587..DVFDAQ...ETM......................................................ETKKSKIFN.--
Q757R2_ASHGO/153-497..DKYDGL...ESM......................................................DHKLDRIFE.--
Q6CX45_KLULA/136-460..DSFNID...EPL......................................................NDKLNTIRT.--
ENPP4_XENLA/30-339..LYYNHT...VSF......................................................AQRVNHITT.--
ENPP4_HUMAN/28-339..MNYNSS...VSF......................................................EERLNNITM.--
ENPP5_HUMAN/30-342..MPYNES...VSF......................................................EDRVAKIIE.--
ENPP7_HUMAN/33-356EGIAHNYK.NETEW......................................................RANIDTVMA.--
Q6ZM30_DANRE/31-356EPRFYDHT.NETLW......................................................MEKVDKVMKD--
ENPP6_XENLA/26-357REYFYYPS............................................................EAEFGKSVTD--
ENPP6_MOUSE/26-357LEYKTVPT............................................................DINFANAVSD--
ENPP1_CAEEL/182-494..PAYNQE...LPF......................................................RNRIDTVVE.--
ENPP2_CAEEL/81-386..PDYNQE...LPL......................................................KERIDTLIG.--
Q47910_9FLAO/52-512KGFN.KEK.VVDQYYKQGWKTLYPIDTYVLSTADDNLYEETFKGEKTPTFPRDLVKLKKENGYELIKSTPQGNTLTLD--
Q9KJX5_FLAME/32-489NDFN.NKN.VPAQLVANGWNTLLPINQYTESSEDNVEWEGLLGSKKTPTFPYTDLAKDYEAKKGLIRTTPFGNTLTLQ--
Q55320_SYNE7/42-494NDFNAQR..LPNKYFEQDWNTLYPIETYTESTADAKPYER.TFKGAKTSSFPHLFKQYANKNYSMMASMPQGNSFTLE--
Q89ZL4_BACTN/29-473SQYNDRQA.IDSRISSVTWEPVFPRGMYTFLPDWR............DVVFKYKFDDDRNNKFRRFITSPFVNDEVNA--
Q7MEK0_VIBVY/30-506TQWNAEK..IPAQYSGQKWSLTLPQDRYTLQEISQEHKVD..LAGFARTFPHPYGPASFKYFSTMLTLSPAGDEITAN--
Q84EY0_9GAMM/27-481KNWNKNYH.PQDYDWHLSRSKSEYQNANSPVFHHEDE.......LFGQTFPHHITQAPSPEYFKSLSRTPKADQLTAD--
Q60113_ZYMMB/62-511KTVNEQVTRLMQQDEAPVMPSVCADHASALKIGN.............NRIIGLAPASRKTGDFKTFRVTPDYDRTTTD--
Q98IY7_RHILO/32-447WLNGPSGK.GVDDLYALEQ............................................DSLIPGTKVKTTGSF--
Q7NDL2_GLOVI/4-434YERLKELP.DFSPKNLAWDFEHEKQIM...........................EALNQGDLADWIRYHIRRDENWFA--
Q9UZH6_PYRAB/14-420KGEIERLV.GEYIFDVPFRKE.......................................AKDEVKEGLWEMTEKRFE--
Q9YCR2_AERPE/4-405KREILKASGGDYVFDVKYRVE.......................................DKESVRKSLWRLAKTQFK--
Q9X5S9_STRLA/7-409ADELEKLT.GGYALDVEDFRST......................................DLERVSQRVFDMSEQRFE--
Q9HSF0_HALSA/15-396ADALEATD.YRIDVNAKLGHDD......................................DKAAFIEDAHETIDARQE--
Q9X5S1_STRLA/5-395LPLLRGLD.YELDVEVGDVAA.......................................DPAAFLGRAVRALRARTR--
Q9X5R9_STRLA/7-410LRELAAAK.AHFQSDLATMFR.......................................GDMAYLEEAERNVAARVR--
Q9X5T4_STRLA/7-389QRTLAKKG.IRPVHDVSI...............................................FWTGQDRDELLPS--
Q9YCS9_AERPE/3-432TDEILSSF.PDFRVYVDY..............................................HDEKYNDVDLFISD--

PF02995

Q9VSJ3_DROME/115-607NTFNYL....KKGF--------------------------------------------KNPPADYYLRPYLSAAESQL--
Q19148_CAEEL/75-621GLFNYPPTEFQPGF--------------------------------------------TENPADHYYRAYYLAVYENW--
Q21671_CAEEL/74-651TLIWPN....CLGY--------------------------------------------RNQSIDHYMRPFQLAHEKYG--
Q9VGG4_DROME/77-573GTFTYV....RPGF--------------------------------------------KKRPTDFYLRSVINEIHMRS--
Q9VQH3_DROME/74-555GLFIYR....KRGF--------------------------------------------QKQPTDIYMRPLMTEIESHS--
Q9VAU4_DROME/90-580NTFNYW....KPGF--------------------------------------------LEQPTDFYLRPLQKAIESGL--
Q9VKK3_DROME/98-598SAFNYN....QNGF--------------------------------------------RKQPTDYYLRPMIMEMEKTV--
Q9VIP6_DROME/62-563STFNYL....KPGF--------------------------------------------VKQPTDYYLRPLLFAIEKQF--
Q19486_CAEEL/79-568GTFTYKN..MLEGF--------------------------------------------LKQPTDHYIRPFWISAFWSL--
Q9V9Q1_DROME/66-560SLFVKG.......F--------------------------------------------RKPPTDFYLRPALLEMWLKT--
Q9VF91_DROME/73-581GTFTYR....MTGF--------------------------------------------EAQPVDHYLRTYYVQAEHMA--
Q9VLG3_DROME/84-577NHFNYL....KPGF--------------------------------------------SKKPMDYYFRPLLRALESEM--
Q9V9P7_DROME/68-547ILSNRN...GDKEL--------------------------------------------PKSPVDFDLTPVIVEMNNHT--
O18062_CAEEL/82-553VVDSWP...TCVGF--------------------------------------------EEPPTDHTFRPFASVSETHG--
O62436_CAEEL/78-581GTFTYR....LKGF--------------------------------------------RQQPTDHYTRTLFEEVEKLN--
Q9W0F7_DROME/16-518NTFNYQ....KPGF--------------------------------------------KQQPVDFYLRNFIVALETIL--
Q8SY05_DROME/180-657STFDYS....SRGF--------------------------------------------FNPPTDVYGRPLVLAVEKEL--

PF01676

DEOB_LACLM/6-406ERTDGRRDYALSPFAETVLEKLYKAGI.DTYSVGKISDIFN...................TVGVKYDMGHNHNDMDGV--
DEOB_GEOSE/6-388QRTANRHDYALKPFGRTVMNELQDAGY.DVIAIGKIADIYD...................NEGVTKTLRTK.SNMDGM--
DEOB_BACSU/7-389KRTPNRHDYALKPFDRTVMNELKDCGL.DVISIGKISDIYDG...................EGITSSRRT.VSNMDGM--
DEOB_SHIFL/2-406QRTGNRHDLAVEPPAPTVLQKLVDEKHGQVVSVGKIADIYA...................NCGITKKVKATGLDALFD--
DEOB_HELPY/3-406KRTANRKDYAIKPHKKLLFETFIEEKRGEVISIGKIADIYA...................HVGITQKFKAG.SLMELC--
YHFW_ECOLI/2-397IGINAPRS.....GAYDNGFQVVHMGYGVDEKVQVPQKLYEAGVPTV..LVGKVADIVNNPYGVSWQNLVD..SQRIM--
APGM2_ARCFU/1-380IWPWGGGRMPSFP.NFGQRYGLRGAMITEVDLLEGIARGMG..............MEVVQVEGITGYIDTNY..RGLV--
APGM2_METTH/4-396IWLWGQGLRPSME.PFSERYGIRGATITAVDLIKGLGVYAG..............LENIHVPGATGYLDTDYRAKG..--
APGM1_ARCFU/1-399LLLRGAGEMPHVP.SFKDKTGLRLCVIAATALIKGVGRVVG..............ADVITPEGATGNKNTNLEAK..V--
APGM1_METJA/4-402ILPRGAGVVPKIE.KFSEKYNMKGACICGTGLIKGMAKMIG..............LDVIEVEGATGTPKTNFMGK..A--
APGM1_METTH/1-400ILPRGAGAVPHVE.KFQERYDLKAACIAETGLIKGIGHLTG..............MDVIDVEGATGGIDTDLESI...--
APGM_PYRHO/5-403LLIRGAGTYPNIPMKFTEQWKVKAAGVIAVALVKGVARAVG..............FDVYTPEGATGEYNTNEMAK..A--
APGM_AQUAE/13-398ILLRGFSQKPDIP.TMEERFGVKPCCIAVYPMYKGLASLVG..............MDVIEFEGSTIQDEIDTLKKVW.--
APGM2_METJA/1-398LLTKWASRYKRVE.SFKEKWGMNAVILAESSLFKGLAKFLG............................MDFIKIESF--
GPMI_PORPU/7-514AF..PPNTLNNFLGETISKYGLKQFRVAETEKYAHVTYFFNGGAEEP..FSGEDRELVSSPSVTTYDLSPDMSAELVT--
GPMI_ANTSP/7-506VF..PNEPKKNFLGQIISNSGLKQLRLAETEKYAHVTYFFNGGIEEP..FPGENRELIASPKVETYDLPPEMSAYQLT--
GPMI_SYNY3/7-511AF..EPQNLNNILGEIISRQGMKQFRTAETEKYPHVTYFFNGGLEQP..FAGEDRELIQSPMVSTYDKAPQMSAKAVT--
GPMI_PSESM/6-504AF..AAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGGREEP..FPGEERILIPSPKVATYDLQPEMSAPEVT--
GPMI_ECOLI/6-508AY..PPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEES..FKGEDRILINSPKVATYDLQPEMSSAELT--
GPMI_BACSU/4-506AF..KPINLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGGREAE..FPGEERILINSPKVATYDLKPEMSAYEVK--
GPMI_MYCGE/3-500AF..PPQTIKNSLGEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVN..LSNETKTLIPSLKVATYDLAPEMSCKAIT--
GPMI_MYCPN/3-501VF..PPETIPNTFGEVIAHNKLKQLRIAETEKYAHVTFFFDGGVEVD..LPNETKCMVPSLKVATYDLAPEMACKGIT--
GPMI_HELPY/3-489LF..PKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGGVETP..FKNENRVLIQSPKVTTYDLKPEMSAKEVT--
PMGI_MAIZE/20-552RYLVSPPEIDRTSGEYLVKNGIRTFACSETVKFGHVTFFWNGNRSGYFDATKEEYVEVPSDSGITFNVAPNMKALEIA--
PMGI_TOBAC/20-552HYLVSPPEIARHSGEYLVRNGVRTFACSETVKFGHVTFFWNGNRSGYFNEKLEEYVEIPSDSGITFNVKPKMKALEIA--
PMGI_MESCR/20-552RYLVSPPEIERTSGEYLVHNGVRTFACSETVKFGHVTFFWNGNRSGYFKPEMEEYVEIPSDSGITFNVQPKMKALEIA--
PMGI_RICCO/17-549HYLVSPPEIERTSGEYLVHNGVHTFACSETVKFGHVTFFWNGNRSGYFNPEMEEYVEIPSDVGITFNVQPKMKAIEIA--

PF00245

PPBN_MOUSE/51-486KHQGARYVWNRS...ELIQASLNRSVTHLMGLFEPNDMKYEI.....................HRDPAQDPSLAEMTE--
PPB4_BACSU/49-459KQAGYSYVTTKQ...ALKKNKDQQ....VLGLFADGGLAKAL......................DRDSKTPSLKDMTV--
PPB3_BACSU/43-455KKAGYSYVDDRK...DMLKNKDSQ....VLGLFADGGLPKKI......................DRTKDIPSLKDMTN--
PPBT_BOVIN/51-490KHKHSHYVWNRT...DLLAL.DPHSVDYLLGLFEPGDMQYEL.....................NRNNATDPSLSEMVE--
PPB_BOMMO/74-515QKVSYKYLWNRQ...ELLKLGSSP.PDYLLGLFEGSHLQYHL.....................EGDESTEPTLAELTD--
PPB_YEAST/66-527QSNGWQYVGDRKNFDSLLKSHGENVTLPFLGLFADNDIPFEI.....................DRDEKEYPSLKEQVK--
STRK_STRGR/41-448RAAGYQVVRDRT...QLAAARPGR...PVLGLFAPEYVPVEWTGPPAAPGG..TAPQRCATRNPGRPAGTPDLAESTR--
PPB1_HUMAN/55-490KRQGARYVWNRT...ELMQASLDPSVTHLMGLFEPGDMKYEI.....................HRDSTLDPSLMEMTE--
PPBI_MOUSE/52-486KHQGSQYVWNRE...QLIQKAQDPSVTYLMGLFEPVDTKFDI.....................QRDPLMDPSLKDMTE--
PPB_ECOLI/64-470QARGYQLVSDAA...SLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTD--

PF08665

Q2RKS0_MOOTA/260-429--------------------------------------------------------------.....GERRQAGVFMN--
O32495_DICNO/401-579--------------------------------------------------------------.....LDVAYQRGLGD--
B0K8X1_THEP3/380-556--------------------------------------------------------------.....DDVFYIKNVME--
Q72AH5_DESVH/438-616--------------------------------------------------------------HR...ATACKADELMA--
Q4BWC0_CROWT/438-619--------------------------------------------------------------KRQKKATVIQAKDLIN--
Q8Q0H3_METMA/497-672--------------------------------------------------------------E....SFAIRYEDFMK--
Q8TNC5_METAC/496-671--------------------------------------------------------------D....SLAFNYEDFMR--
Q3A8U0_CARHZ/461-637--------------------------------------------------------------K....SIAVQYKDIID--
B1YIB9_EXIS2/462-638--------------------------------------------------------------D....SLAIHFQDMLA--
Q5P0R1_AROAE/485-661--------------------------------------------------------------.....GLAIKADELLT--
A4JFG3_BURVG/484-660--------------------------------------------------------------.....GVAIGRDELME--
Q2W5M5_MAGSA/475-648--------------------------------------------------------------.....GVAVKADDLKD--
Q8RL18_PRORE/500-676--------------------------------------------------------------.....GMAVSSKELMS--
Q8ZK15_SALTY/474-650--------------------------------------------------------------.....GMAVKSDDLLK--
Q7MVV4_PORGI/231-425--------------------------------------------------------------ERYRKHYSFSYNKVYE--
Q53943_STRCH/527-704--------------------------------------------------------------.....AAVFHKDDLRT--

PF07394

Q7UT83_RHOBA/61-480-----------------------------------------------------------QHVLDSYGVDD..PE.TAA..
Q7UHL2_RHOBA/84-501-----------------------------------------------------------HQTKQMYGIDQ..KE.TRE..
Q7UN58_RHOBA/63-468-----------------------------------------------------------DATKKLYGIGE..KT.TDS..
Q98BS1_RHILO/39-404-----------------------------------------------------------LDDQIGGNVMKPNVGAMKPKG
Q7UHK7_RHOBA/71-478-----------------------------------------------------------KETQQLYGIDQ..PR.SKS..
Q7UKW9_RHOBA/100-522-----------------------------------------------------------ESTFDLYGEDA..KQ.PGT..
Q8P3X8_XANCP/29-384-----------------------------------------------------------TTQLREEMEQAGRGAASARTF
Q7UZ35_RHOBA/49-467-----------------------------------------------------------QETLDLYGVTK..PG.DGS..
Q7UFP1_RHOBA/49-464-----------------------------------------------------------DHIVKMYGCT...PG.DGT..
Q7MLK9_VIBVY/33-420-----------------------------------------------------------ITIRDQLSAALESSPEEPHFP
Q7US09_RHOBA/66-482-----------------------------------------------------------EQTKSMYGLDQ..KE.TAD..
Q7VYL6_BORPE/29-381-----------------------------------------------------------RAALEAEMREANGGAGNTEKL
Q7UDW2_RHOBA/77-502-----------------------------------------------------------AETLENYGAEP..GK..ES..
Q87HJ3_VIBPA/35-425-----------------------------------------------------------MMMSNILAEQLKLIDDAPLFS
Q7UM62_RHOBA/63-489-----------------------------------------------------------ADVHAMYGTNP..GE..ES..
Q7UJ64_RHOBA/59-474-----------------------------------------------------------KETFALYGIGN..DA.TDA..
Q7UIF5_RHOBA/61-494-----------------------------------------------------------ALTQREYGLDQ..PE.TKV..
Q7UYJ8_RHOBA/60-484-----------------------------------------------------------KSTLREYGADDSQNILKAQ..
Q7MCK0_VIBVY/38-408-----------------------------------------------------------TAPKEEFIPIFEQPVLDGFPN
Q9A5N3_CAUCR/44-506-----------------------------------------------------------TAAAFSTALASSPVSAPPAFT
Q7ULC1_RHOBA/52-445-----------------------------------------------------------DAIRDAYGRNP..........
Q7UQT8_RHOBA/50-438-----------------------------------------------------------ESMRKQFADDA..........
Q7UQ29_RHOBA/54-472-----------------------------------------------------------EETRTMYGDGD..........
Q7UGB9_RHOBA/69-492-----------------------------------------------------------ADVHQMYGTEP..GK..TS..
Q7UPP6_RHOBA/56-434-----------------------------------------------------------AKIRDAYGRNS..........
Q7UI66_RHOBA/46-421-----------------------------------------------------------DEVKERYGTDN..........
Q7UVE3_RHOBA/81-505-----------------------------------------------------------DETFEMYGPDS..RR.PGS..
Q7UW70_RHOBA/70-497-----------------------------------------------------------DVLRDAYGRNS..........
Q7UKM6_RHOBA/69-495-----------------------------------------------------------ESTFELYGEDA..RR.PGS..
Q7UTL9_RHOBA/100-490-----------------------------------------------------------GQLRNQYGSE...........
Q7UGF5_RHOBA/94-499-----------------------------------------------------------TSVRERYGMNR..........
Q9A6V4_CAUCR/38-393-----------------------------------------------------------EAAMAGQARAAMAPAMAAGGQ
Q7UYC8_RHOBA/101-527-----------------------------------------------------------PETLAMYGEEV..NN.PGS..
Q7UR29_RHOBA/60-444-----------------------------------------------------------DKTRDRYGRNT..........
Q7UYM7_RHOBA/45-446-----------------------------------------------------------EKLREAYGNNV..........
Q7UV65_RHOBA/50-468-----------------------------------------------------------EATHKLYGIDN..ET.TAD..
Q7UJ54_RHOBA/70-497-----------------------------------------------------------EDTLAMYGPEV..HK.SGS..
Q7UJ36_RHOBA/99-512-----------------------------------------------------------EHMLKLYGAEP..GK..MS..
Q7NT93_CHRVO/33-383-----------------------------------------------------------ASLAPLPRTAASEAPTAGPKP
Q7UEK9_RHOBA/80-501-----------------------------------------------------------KHVLELYGADSSNKT.KAD..
Q7UQW1_RHOBA/70-487-----------------------------------------------------------EHIRKLYGLDAKYKP.TQI..
Q7UPF7_RHOBA/65-448-----------------------------------------------------------QAELDAFGDHP..........
Q7UYR5_RHOBA/95-521-----------------------------------------------------------QHVLDLYGPDV..TN.PGT..
Q7UWA1_RHOBA/72-492-----------------------------------------------------------EETLSMYGVNN..PK.TQA..
Q89DL5_BRAJA/42-392-----------------------------------------------------------SGDD............MKPKG
Q7URV7_RHOBA/77-499-----------------------------------------------------------AATLKAYGVEGGSEL.RGE..
Q7MDY0_VIBVY/67-457-----------------------------------------------------------RAVSHTLSQTLDSVPDNPMFT
Q7UH70_RHOBA/75-488-----------------------------------------------------------KETQEMYGDSL..........
Q7UVE1_RHOBA/82-507-----------------------------------------------------------QHVLDSYGAEP..GK..ES..
Q7UQ53_RHOBA/45-480-----------------------------------------------------------AETMKMYGLDRMGATYPDQIN
Q7UP10_RHOBA/69-492-----------------------------------------------------------EEVFELYGKDS..KN.PGS..

PF04185

PHOX_KLULA/65-312--------------------YASDYVRK....................HNP.....LILFDNVVNNDTRLANIKNFED--
Q9S816_ARATH/13-380--------------------...YRNL...................................RKLKYLTRFHDYGL.Q--
Q9SRQ6_ARATH/16-381--------------------...YRNMR...................................KLKYVDNFHQYHL.S--
Q47936_FRANO/55-471--------------------STNKFGVKSRDYIPHHEPFNYWKETSNPHHL.....APSDDKYIGSNDQANHQYDISE--
Q97V43_SULSO/27-365--------------------.........................................LDAFNQINMSHIYDLKN--
Q9LML5_ARATH/38-396--------------------......................................FKSLRRLKHLVKFHSY.ALK--
PHLB_MYCTU/52-435--------------------NDFKQAAD............................PRSNLARFGISPTYP.....LD--
Q9A412_CAUCR/40-437--------------------DAYK.................................DLPGSNPRLKQLGLSTWHLDK--
PHLC_PSEAE/51-437--------------------KYRLQEQN...........NYDCNALAWFRN.....FKNAPRDSDLWQRAMLARGVDQ--
PHLD_MYCTU/50-429--------------------TSFKQSAD............................PRSDLVRFGVAPSY.....PAS--
Q9SMN8_ARATH/1-336--------------------..FYRNL...................................RQLKYIFNLHQYDL.K--
O53361_MYCTU/50-282--------------------....................................................SVPFSA--
O81020_ARATH/27-389--------------------...YQSL...................................RKLKYVFKFHSYG.NS--
Q9KH04_BURML/84-547--------------------QYHHQPFN................YFASHAP.....GTEARRRHLRDAGLGDDPSTNH--
PHLN_PSEAE/48-422--------------------.....................................RAAAPDSPLIVNGLSTWKLDA--
PHLN_BURPS/47-438--------------------YIGNYGDN.............SLLYFNQYRNAQPGSPLYDKARTGTNVSAGGTL.FDV--
Q983N8_RHILO/60-507--------------------QYHHQPFN....................YYA.....NYAPGTEARREHLRDGGLGGVS--
PHLA_MYCTU/51-431--------------------QAFRQAAD............................PRSNLARYGIAPTYP.....GD--
Q98ES1_RHILO/58-274--------------------.......................................HNPWESFADAKGFEKPLAQ--
PHLC_MYCTU/52-433--------------------GSFKQAAD............................PRSDLARYGIAPAYP.....WD--

PF14707

F1QB82_DANRE/433-568--------------------------------------------------------------------------------
F1QQ07_DANRE/367-495--------------------------------------------------------------------------------
ARSA_HUMAN/368-502--------------------------------------------------------------------------------
F2UD41_SALS5/491-612--------------------------------------------------------------------------------
F1QFT2_DANRE/220-353--------------------------------------------------------------------------------
ARSH_HUMAN/418-551--------------------------------------------------------------------------------
ARSG_CANFA/402-522--------------------------------------------------------------------------------
A8XD87_CAEBR/394-528--------------------------------------------------------------------------------
ARSG_MOUSE/402-522--------------------------------------------------------------------------------
A0YAF7_9GAMM/381-478--------------------------------------------------------------------------------
C3YQ76_BRAFL/419-552--------------------------------------------------------------------------------
Q5XG10_XENLA/375-508--------------------------------------------------------------------------------
A7V8P9_BACUN/356-447--------------------------------------------------------------------------------
ARS_HEMPU/396-526--------------------------------------------------------------------------------
Q4RYA1_TETNG/304-429--------------------------------------------------------------------------------
F2UCT8_SALS5/90-221--------------------------------------------------------------------------------
C3YZM0_BRAFL/417-549--------------------------------------------------------------------------------
A7SK49_NEMVE/435-563--------------------------------------------------------------------------------
GALNS_CANFA/377-510--------------------------------------------------------------------------------
Q6GMA1_XENLA/439-573--------------------------------------------------------------------------------
A9VBN0_MONBE/428-544--------------------------------------------------------------------------------
C3ZST4_BRAFL/433-562--------------------------------------------------------------------------------
A6QLR7_BOVIN/402-522--------------------------------------------------------------------------------
STS_HUMAN/437-572--------------------------------------------------------------------------------
Q4TCJ7_TETNG/242-385--------------------------------------------------------------------------------
F1NFQ0_CHICK/445-579--------------------------------------------------------------------------------
E4YGB6_OIKDI/449-582--------------------------------------------------------------------------------
D2HFI2_AILME/436-570--------------------------------------------------------------------------------
E1FX25_LOALO/406-541--------------------------------------------------------------------------------
F1R580_DANRE/251-371--------------------------------------------------------------------------------
O16138_HELER/402-534--------------------------------------------------------------------------------
Q32KK0_RAT/450-603--------------------------------------------------------------------------------
D2HXW7_AILME/434-569--------------------------------------------------------------------------------
D7VQY4_9SPHI/353-442--------------------------------------------------------------------------------
Q6DJK3_XENLA/433-566--------------------------------------------------------------------------------
Q32KK2_RAT/368-502--------------------------------------------------------------------------------
Q32KI1_CANFA/444-578--------------------------------------------------------------------------------
E4XNY3_OIKDI/402-533--------------------------------------------------------------------------------
C3ZQB5_BRAFL/418-551--------------------------------------------------------------------------------
E6ZGQ8_DICLA/413-534--------------------------------------------------------------------------------
A9UXW0_MONBE/287-431--------------------------------------------------------------------------------
Q1YP24_9GAMM/409-501--------------------------------------------------------------------------------
ARSE_HUMAN/448-582--------------------------------------------------------------------------------
F1KQC6_ASCSU/1702-1837--------------------------------------------------------------------------------
F0Y2N2_AURAN/404-544--------------------------------------------------------------------------------
Q4S4L1_TETNG/407-528--------------------------------------------------------------------------------
Q7ZWB8_DANRE/433-548--------------------------------------------------------------------------------
A3XMW9_LEEBM/382-476--------------------------------------------------------------------------------
C3YBU1_BRAFL/392-524--------------------------------------------------------------------------------
Q4RJR3_TETNG/343-474--------------------------------------------------------------------------------
ARS_STRPU/411-541--------------------------------------------------------------------------------
F2UKF0_SALS5/383-527--------------------------------------------------------------------------------
Q0C069_HYPNA/397-504--------------------------------------------------------------------------------
ARSF_HUMAN/440-574--------------------------------------------------------------------------------
A4AN36_MARSH/378-468--------------------------------------------------------------------------------
F1NW57_CHICK/376-509--------------------------------------------------------------------------------
C3Y4J9_BRAFL/389-521--------------------------------------------------------------------------------
C1BQY6_9MAXI/368-497--------------------------------------------------------------------------------
C3ZQC1_BRAFL/339-471--------------------------------------------------------------------------------
Q4SI19_TETNG/404-542--------------------------------------------------------------------------------
STS_MOUSE/445-581--------------------------------------------------------------------------------
A4CMB0_ROBBH/401-491--------------------------------------------------------------------------------
STS_RAT/436-573--------------------------------------------------------------------------------
ARSD_HUMAN/451-585--------------------------------------------------------------------------------
B4DQ74_HUMAN/301-421--------------------------------------------------------------------------------
A5D7J7_BOVIN/445-576--------------------------------------------------------------------------------
Q32KI0_CANFA/435-568--------------------------------------------------------------------------------
F1R2X2_DANRE/342-476--------------------------------------------------------------------------------
F2U742_SALS5/410-536--------------------------------------------------------------------------------
A9V957_MONBE/437-571--------------------------------------------------------------------------------
A9UPM8_MONBE/326-452--------------------------------------------------------------------------------
B9QU81_9RHOB/44-158--------------------------------------------------------------------------------
Q6AX40_XENLA/368-500--------------------------------------------------------------------------------
F1NWF7_CHICK/360-492--------------------------------------------------------------------------------
C3Z258_BRAFL/432-564--------------------------------------------------------------------------------
A9V7E7_MONBE/452-571--------------------------------------------------------------------------------
ARSA_BOVIN/368-502--------------------------------------------------------------------------------
A6CB11_9PLAN/382-473--------------------------------------------------------------------------------
F0SFZ7_PLABD/380-468--------------------------------------------------------------------------------
C3Y4X6_BRAFL/434-568--------------------------------------------------------------------------------
C6W2Y6_DYAFD/349-461--------------------------------------------------------------------------------
E1BU03_CHICK/378-498--------------------------------------------------------------------------------
A7SK50_NEMVE/483-612--------------------------------------------------------------------------------
A1L2N0_XENLA/374-506--------------------------------------------------------------------------------
C3ZV84_BRAFL/657-790--------------------------------------------------------------------------------
A7SQ82_NEMVE/425-557--------------------------------------------------------------------------------

PF00884

C3LB12_BACAC/143-439-----------------E.....LKKR-----.KQPT---FIHAVT----M-------Q----------NH-........
O06776_MYCTU/43-460-----------------WIGQQKALAP-----.DRPF---FVYFAP----G-------A----------TH-A.......
O25301_HELPY/294-587-----------------N.......TN-----PHEKT---FSMVMT----L-------S----------NH-AIKNVNLK
O34609_NEIME/232-524-----------------V.....LNKN-----.DKDA---VLILHT----I-------G----------SH-G.......
LTAS2_BACSU/245-536-----------------L.....LESL-----.PQPF---YTKFIT----L-------S----------NH-F.......
O43113_NEUCS/45-420-----------------FLDEAAKNVH-----.NRPF---FLGIAP----I-------A----------PH-S.......
O65931_MYCTU/212-635-----------------WLHTVRAQNA-----.TKPW---MLYYAT----G-------A----------TH-A.......
O82879_STRMU/460-745-----------------K.....INP.-----.SQSQ---FFSVMT----M-------Q----------NH-........
O85099_ECOLX/237-530-----------------V.....LNDP-----.APKK---LIIVHL----L-------G----------TH-I.......
YEJM_ECOLI/260-505-----------------WLGRYAQE..-----.DNRW---FSWVSF----N-------G----------TN-I.......
ARS_HEMPU/52-373-----------------FI....EDNH-----.ADPF---FLYVAF----A-------H----------MH-T.......
ARS_CHLRE/27-385-----------------QI...KSAVA-----AGKPF---YAQISP----I-------A----------PH-........
ARSA_HUMAN/21-346-----------------LM...ADAQR-----QDRPF---FLYYAS----H-------H----------TH-Y.......
ASLA_ECOLI/86-419-----------------FL...DKMAK-----SDKPF---FLYYGT----R-------G----------CH-F.......
EPTA_ECOLI/236-527-----------------Y.....INNL-----.QGDG---VIVLHT----I-------G----------SH-G.......
YIDJ_ECOLI/4-341-----------------FL...QQPAR-----ADEPF---LMVVSY----D-------E----------PH-H.......
ARSB_FELCA/47-366-----------------LI....TSHP-----PEKPL---FLYLAL----Q-------S----------VH-E.......
GALNS_HUMAN/31-355-----------------FI....KRQA-----RHHPF---FLYWAV----D-------A----------TH-A.......
EPTB_ECOLI/248-538-----------------S.....LGRN-----PDGKH---LIILHT----K-------G----------SH-F.......
Y1005_HAEIN/211-475-----------------A.....LKEN-----ISNSK---LIVIHL----I-------G----------SH-P.......
GNS_CAPHI/54-391-----------------FL....DYKS-----NSEPF---FMMIST----P-------A----------PH-S.......
STS_MOUSE/35-421-----------------FL.....RRN-----RARPF---LLFLSF----L-------H----------VH-T.......
ARS_STRPU/67-388-----------------FI....EDNV-----.NKPF---FMYVSF----A-------H----------MH-T.......
SPHM_HUMAN/23-328-----------------FL....QTQD-----.DRPF---FLYVAF----H-------D----------PH-R.......
ARS_PSEAE/5-420-----------------YL....KERD-----QSRPF---FAYLPF----S-------A----------PH-W.......
YHBX_ECO57/223-491-----------------A.....LQQN-----TQQKK---LIVLHL----N-------G----------SH-E.......
CGMA_RHIME/269-561-----------------Q.....ADEV-----.EDPF---FFFAVT----L-------Q----------GH-........
YBIP_ECOLI/217-483-----------------V.....LAQE-----HSQPQ---LIVLHL----M-------G----------SH-P.......
YDEN_ECOLI/58-408-----------------VV...DRAKT-----LDQPF---MLYLAY----N-------A----------PH-L.......
P95059_MYCTU/37-466-----------------FIRDAKVIAP-----.DKPW---FSYVCP----G-------A----------GH-A.......
P95081_MYCTU/5-389-----------------YARRRAGDTA-----AMRPF---LLVASF----V-------N----------PH-DIVLFPAW
ARS_VOLCA/26-386-----------------QI...KTAVA-----AGKPF---YAQISP----I-------A----------PH-........
Q45087_9BURK/4-384-----------------YL....KGRD-----.GKPF---FLHLGY----Y-------R----------PH-P.......
Q833K3_ENTFA/256-543-----------------L.....LKEK-----.EQPQ---FIHLVT----M-------Q----------TH-........
Q840W2_STRMU/270-555-----------------Q.....LNP.-----.SQSQ---FFSVIT----M-------Q----------NH-........
Q8DUS0_STRMU/503-788-----------------K.....INP.-----.SQSQ---FFSVMT----M-------Q----------NH-........
Q8G592_BIFLO/306-604-----------------G.....IKSG-----.KTNK---FIQIIT----M-------Q----------NH-........
Q8K804_STRP3/480-765-----------------L.....INP.-----.SESQ---FFSVIT----M-------Q----------NH-........
Q8P1I3_STRP8/480-765-----------------L.....INP.-----.SESQ---FFSVIT----M-------Q----------NH-........
Q8XK47_CLOPE/257-551-----------------I.....ISNN-----.EKPQ---FIYNVT----V-------E----------SH-........
Q984T6_RHILO/281-574-----------------E.....AGAS-----.DDPV---FFFAVS----L-------Q----------NH-........
Q98EG2_RHILO/158-441-----------------IL..RHAQRD-----.GKPF---SLTIAV----S-------G----------GH-AMDG....
Q9A0F9_STRP1/480-765-----------------L.....INP.-----.SESQ---FFSVIT----M-------Q----------NH-........
Q9AI31_BURML/214-497-----------------V.....LDEK-----RTQPA---FLFAMT----M-------E----------NH-........
Q9CKD9_PASMU/287-557-----------------TF..TALHKE-----.GKPF---FSLVFS----S-------S----------NH-D.......
Q9CM05_PASMU/231-523-----------------I.....LDST-----.DKDT---VLVLHT----I-------G----------NH-G.......
Q9HVQ5_PSEAE/238-530-----------------V.....LDDP-----.APKK---FIVVHL----L-------G----------TH-M.......
Q9HYT4_PSEAE/238-529-----------------Y.....IDGL-----.QDDA---IIVLHS----D-------G----------SH-G.......
Q9I2D3_PSEAE/231-522-----------------F.....IDGL-----.QQDT---VLVLHQ----M-------G----------SH-G.......
Q9I4M0_PSEAE/223-501-----------------YV..KQLRQQ-----.KKPW---MLTLLT----V-------G----------TH-Q.......
Q9JXJ7_NEIMB/214-487-----------------I.......NL-----QQGKH---FIVLHQ----R-------G----------SH-A.......
Q9KKK2_VIBCH/240-530-----------------E.....IATQ-----.QGNR---MIFMHF----I-------G----------SH-G.......
Q9PGC7_XYLFA/245-535-----------------Q.....VRSK-----.LGDR---VVVLHQ----L-------G----------SH-G.......
Q9RBI1_ACIAD/237-531-----------------YLKTLDLKKL-----.KKSQ---LIVLHQ----V-------G----------SH-G.......
Q9RMJ0_NEIME/232-495-----------------VL....IGNA-----GTKPR---LIVMHL----M-------G----------SH-S.......
Q9X6R2_PSEAI/20-300-----------------EL..DKLAST-----.GKPF---YALLQS----L-------S----------NH-V.......
Q9ZDJ9_RICPR/218-505-----------------I.....ITK.-----.SEKQ---FLVLHT----S-------G----------SH-W.......
Q9ZJJ5_HELPJ/225-518-----------------N.....VQPQ-----LKSKN---FIVFHL----L-------G----------SH-S.......
Q9ZN39_HELPJ/222-504-----------------L.....LKER-----SNENI---LLILHL----A-------G----------SH-G.......

PF01663

ENPP3_MOUSE/161-485-----------------WLDL.PKADR........PS---FYTIYV....E-------E----------PD-S-------
O29992_ARCFU/4-416-----------------VLQHEIAVRNTLKAVRAGYR---FGVTWF....M-------E----------TD-A-------
O50518_STRCO/58-383-----------------AAEQLARADR.........A---LVYTYY....A-------E----------VD-G-------
Q73VT6_MYCPA/42-363-----------------VGEELRAG..........PG---LVYGYT....A-------E----------LD-T-------
Q6A8W7_PROAC/44-359-----------------VYKTLKASRSG......DAS---LTYVYE....R-------S----------LD-H-------
Q6N507_RHOPA/30-497-----------------VLPLFKQRGK........PF---VLVFWS....R-------D----------PD-G-------
Q7WNM8_BORBR/6-370-----------------RFCAMLQAPG.......APA---MATLWL....S-------E----------PD-H-------
O58841_PYRHO/4-322-----------------SALYLYEECK........PD---LLLVHF....A-------S----------ID-G-------
O69954_STRCO/13-378-----------------ATRHIMATRH........PD---LTLCYL....P-------H----------LD-Y-------
Q7AYA7_9RHIZ/4-370-----------------SAKYVLAAND........PT---LTLVYL....P-------H----------LD-Y-------
Q7NU73_CHRVO/4-375-----------------ASKLAIADFR........PS---LLLSYL....P-------H----------LD-Y-------
Q8YZP2_NOSS1/4-370-----------------SAKFLDGRCD........PT---LTLVYL....P-------H----------LD-Y-------
Q7UKE3_RHOBA/4-350-----------------ATALVMREKQ........PQ---LTLCYL....P-------H----------LD-Y-------
Q71ZQ2_LISMF/5-366-----------------SVVDTIKAKR........PR---LLLTHL....V-------D----------MD-S-------
Q73E52_BACC1/9-380-----------------SAVHTIQTKK........PN---VMFVHF....T-------D----------LD-T-------
Q8XKL9_CLOPE/10-374-----------------CAKETIKKYK........PN---LTMVHL....I-------D----------VD-S-------
Q97LS7_CLOAB/8-378-----------------SVCYMVENKK........PN---LTLLHL....N-------E----------ID-H-------
O45359_CAEEL/26-353-----------------.....ATREH.........D---LTLIYHPWIGE-------E----------IR-R-------
Q22129_CAEEL/24-374-----------------IANRISKYQVY......KQQ---MFLIRY....A-------N----------IG-N-------
Q981Q5_RHILO/5-379-----------------AVVALLGSDR.......PPD---LLLTEI....E-------M----------PD-A-------
O69013_ZYMMB/50-367-----------------WLAY.PKKKR........PQ---FITLYF....E-------N----------VD-H-------
Q9A8S4_CAUCR/74-393-----------------WLDS.ADGPP........IA---FSTLYF....D-------I----------VD-T-------
Q8PIS1_XANAC/48-366-----------------WLAT.DGAQR........NR---LVTLYF....E-------H----------VD-E-------
Q9PAB9_XYLFA/40-358-----------------WLNE.RGPDA........PR---LVILRF....E-------Q----------VN-T-------
Q7MXP5_PORGI/37-349-----------------WLGL.PEKER........PR---LLMWYI....E-------E----------PD-M-------
ENPP2_RAT/165-477-----------------WLSL.PDNER........PS---VYAFYS....E-------Q----------PD-F-------
Q7ZXN7_XENLA/166-476-----------------WLHL.PDNER........PY---VYALYS....E-------Q----------PD-Q-------
Q6PGY9_DANRE/161-472-----------------WLHL.PDAER........PY---LYAMHS....E-------Q----------LD-S-------
ENPP1_RAT/194-520-----------------WLQL.PSYER........PH---FYTLYL....E-------E----------PD-S-------
Q6VZU9_CNPV/107-431-----------------WLKM.DTGYR........PY---LYTLYF....E-------E----------PG-A-------
Q70HC0_FOWPV/120-443-----------------WLKM.DTGYR........PY---FYALYL....E-------E----------PG-S-------
Q7F5L2_ORYSJ/92-418-----------------YFDL.PSDEM........PQ---FLTLYF....E-------D----------PD-H-------
Q9FS13_SPIOL/96-418-----------------YFDL.PINEI........PV---FMTLYF....E-------D----------PD-H-------
Q9SU83_ARATH/109-435-----------------YFDL.PSNEI........PS---FMTLYF....E-------D----------PD-H-------
Q9SU81_ARATH/60-394-----------------HFDH.LEDEV........PD---LLMLYF....D-------E----------PD-Q-------
Q9SU82_ARATH/57-390-----------------YFDL.PEREI........PD---FMALYF....D-------E----------PD-I-------
YGK5_SCHPO/76-404-----------------WLDL.PDKDR........PQ---LLLAYA....P-------H----------VD-M-------
Q6BTN4_DEBHA/173-514-----------------WLDKEDIELR........PE---LILTYV....P-------T----------ID-Q-------
Q6C6J4_YARLI/277-608-----------------WLDR.PIQTR........PE---LMLTYV....P-------T----------VD-T-------
Q7SI20_NEUCR/254-584-----------------FLDM.PDDER........PQ---VIAAYV....P-------N----------VD-S-------
NPP1_YEAST/170-545-----------------YVDMSTLNER........PQ---LILGYV....P-------N----------VD-A-------
Q6FKX1_CANGA/187-587-----------------YIDTEDITQR........PQ---MILSVV....N-------D----------LD-T-------
Q757R2_ASHGO/153-497-----------------FIDM.PLGER........PG---LILSYI....P-------E----------VD-S-------
Q6CX45_KLULA/136-460-----------------....ALQNES........TT---LTFAYV....P-------V----------VD-T-------
ENPP4_XENLA/30-339-----------------WLTR.PNDSI.........N---FAAIYW....E-------E----------PD-A-------
ENPP4_HUMAN/28-339-----------------WLNN..SNPP........VT---FATLYW....E-------E----------PD-A-------
ENPP5_HUMAN/30-342-----------------WFTS...KEP........IN---LGLLYW....E-------D----------PD-D-------
ENPP7_HUMAN/33-356-----------------WFTE....ED........LD---LVTLYF....G-------E----------PD-S-------
Q6ZM30_DANRE/31-356-----------------WFKD....QD........LD---FVTLYF....G-------D----------PD-S-------
ENPP6_XENLA/26-357-----------------ALQS.LTRGN........AE---MAAVYY....E-------R----------ID-V-------
ENPP6_MOUSE/26-357-----------------ALDS.LKSGR........AD---LAAIYH....E-------R----------ID-V-------
ENPP1_CAEEL/182-494-----------------WLKL.PVDER........PG---LITAYL....H-------E----------PD-N-------
ENPP2_CAEEL/81-386-----------------WLKL.PETER........PA---LITAYL....H-------E----------PD-Q-------
Q47910_9FLAO/52-512-----------------FAKRAIENEQLGNNPLQVTD---FLAVSL....S-------S----------TD-Y-------
Q9KJX5_FLAME/32-489-----------------MADAAIDGNQMGV..DDITD---FLTVNL....A-------S----------TD-Y-------
Q55320_SYNE7/42-494-----------------FAKAAIPAEKLGQ..TGNTD---FLAVSL....S-------S----------TD-Y-------
Q89ZL4_BACTN/29-473-----------------LAEEAIGKGSVGM..DDITD---LLALTY....Y-------A----------GN-Y-------
Q7MEK0_VIBVY/30-506-----------------FAQRVLEKEQLGK..GDTTD---YLAVSF....S-------S----------ND-Y-------
Q84EY0_9GAMM/27-481-----------------FAEQLLTKERLGQ.SSGKTD---YLGISF....S-------G----------VD-A-------
Q60113_ZYMMB/62-511-----------------IAIGLIDELKLGH..GNAPD---LLTVSL....S-------A----------TD-A-------
Q98IY7_RHILO/32-447-----------------KAERDFDEAR........VQ---AVINEI....K-------G----------LD-S-------
Q7NDL2_GLOVI/4-434-----------------VAKKLLVEDK........PD---LMAVLF....D-------G----------TD-K-------
Q9UZH6_PYRAB/14-420-----------------VIRYLLQEKE........WD---YFHFVE....I-------G----------LD-R-------
Q9YCR2_AERPE/4-405-----------------VVKYLLSSKP........WD---FAMYMH....I-------G----------TD-R-------
Q9X5S9_STRLA/7-409-----------------VARHLATTQE........WD---FLSFVD....M-------G----------PD-R-------
Q9HSF0_HALSA/15-396-----------------AFLEYIDADD........WD---LFFGVF....M-------S----------TD-R-------
Q9X5S1_STRLA/5-395-----------------AMEHLLRQET........WD---LAVAVL....T-------E----------TD-R-------
Q9X5R9_STRLA/7-410-----------------SVRHLMSTRP........TD---VVMVVL....T-------E----------AD-R-------
Q9X5T4_STRLA/7-389-----------------LLEADVQRGRAALALLEESD---VVIVNL....T-------S----------ID-R-------
Q9YCS9_AERPE/3-432-----------------VMRHLEITKRMVKSYVLGKY---GLYDNITFIVS-------A----------TD-W-------

PF02995

Q9VSJ3_DROME/115-607-----------------DHTTVNGLV...HCLGYLTA---AEHVYD----Y-------G----------LE-F-------
Q19148_CAEEL/75-621-----------------KYEA.........CRDGEQL---QNEFVN----I-------W----------RR-F-------
Q21671_CAEEL/74-651-----------------TPVTREHLN....GSLCRED---HNTLLD----Y-------L----------AQ-F-------
Q9VGG4_DROME/77-573-----------------TYFARGPLEI..KCSGDRVY---HHVLYD----F-------I----------YR-L-------
Q9VQH3_DROME/74-555-----------------LY..RTTFDL..KCTGHRLY---GEFYYD----F-------V----------SK-L-------
Q9VAU4_DROME/90-580-----------------NTWKCSDCSM.KYCIGRRIT---SSYAYD----M-------A----------RN-F-------
Q9VKK3_DROME/98-598-----------------AFKKDLNMH...LCMGSRRT---ADVLLE----Y-------M----------KK-L-------
Q9VIP6_DROME/62-563-----------------KVTNDFGFA...YCVGRHLS---FSYVWD----F-------G----------QQ-F-------
Q19486_CAEEL/79-568-----------------ISRRSVAS.....CYDSTPQ---HKIQLK----Y-------L----------EE-F-------
Q9V9Q1_DROME/66-560-----------------RTDGLFGTH....CNEKDNY---AMVLRE----F-------L----------FK-M-------
Q9VF91_DROME/73-581-----------------AE...SKPN....CIGHQPD---HITMLE----Y-------T----------KN-F-------
Q9VLG3_DROME/84-577-----------------DVYRLPEHDYMRYCLGRRIA---NRYIYD----Y-------G----------LQ-F-------
Q9V9P7_DROME/68-547-----------------RY..SIDLKEMIHCTAGRKF---QDVLRD----F-------V----------LQ-L-------
O18062_CAEEL/82-553-----------------MEITKRHLS....GKFCRET---HHAIME----L-------L----------EQ-G-------
O62436_CAEEL/78-581-----------------DR......N....CIGSIPL---HRMWLQ----N-------G----------RQ-F-------
Q9W0F7_DROME/16-518-----------------KTRREFGNV...FCLGRKLG---FQYVFD----F-------A----------RQ-F-------
Q8SY05_DROME/180-657-----------------TILQRGQMP...YCLGRKPA---SEYIYD----M-------G----------VQ-F-------

PF01676

DEOB_LACLM/6-406-----------------DRLLKAMTKT--------EFTEGFSFTNL----V-------D----------FDAK-------
DEOB_GEOSE/6-388-----------------DKLVNTLQMN--------FT.G.LSFLNL----V-------D----------FDAL-------
DEOB_BACSU/7-389-----------------DKVIDTLGED--------FT.G.LSFANL----V-------D----------FDAL-------
DEOB_SHIFL/2-406-----------------ATIKEMKEAG--------DN.T.IVFTNF----V-------D----------FDSS-------
DEOB_HELPY/3-406-----------------DVTLEQVKNA--------KN.NSLIFTNF----V-------H----------FDSD-------
YHFW_ECOLI/2-397-----------------DITLNEFNTH--------PT.A.FICTNI----Q-------E----------TD.L-------
APGM2_ARCFU/1-380-----------------RETARAL..E--------EH.D.FVVLHT----E-------G----------ID.E-------
APGM2_METTH/4-396-----------------RYAAGAL..E--------EY.D.FLYVHV----E-------A----------PD.E-------
APGM1_ARCFU/1-399-----------------KAAINAL..E--------SY.D.VVLLHI----K-------A----------TD.E-------
APGM1_METJA/4-402-----------------KALVEAL..K--------EY.D.FVLVNV----K-------G----------AD.E-------
APGM1_METTH/1-400-----------------KNAISSAIAA--------DY.D.FLLINI----D-------G----------AD.E-------
APGM_PYRHO/5-403-----------------KKAVELL..K--------DY.D.FVFLHF----K-------P----------TD.A-------
APGM_AQUAE/13-398-----------------.........N--------EY.D.YFFVHI----K-------K----------TD.S-------
APGM2_METJA/1-398-----------------EEGIDLIPEL--------DY.D.FIHLHT----K-------E----------TD.E-------
GPMI_PORPU/7-514-----------------QKSISAINKG--------IY.S.CIVINY----A-------N----------AD.M-------
GPMI_ANTSP/7-506-----------------NSLIEAINKQ--------LY.Q.FIVINY----A-------N----------PD.M-------
GPMI_SYNY3/7-511-----------------DAVCRAMEKG--------IY.S.LVVVNY----A-------N----------PD.M-------<