Sequence alignment for CL0088

PF01663

Q7NDL2_GLOVI/4-434---T----LAIG--LDGAT....-----------------FTVLDQMVEELPGLGLA-----------------------
Q9X5T4_STRLA/7-389---V----VVVI--TEGAA....-----------------PELLDRWCAQ.....GL-----------------------
B0R301_HALS3/15-396---V----AFVG--IDGVP....-----------------FSLIRDHPD.......T-----------------------
Q9X5S1_STRLA/5-395---A----LVIG--LDGMP....-----------------RTLLTRLAGD.....GT-----------------------
Q9X5R9_STRLA/7-410---A----LVIG--IDGGT....-----------------FDTVDPLIEC.....GL-----------------------
Q9YCS9_AERPE/3-432---T----VLLG--LDGCT....-----------------WSILRPLAEK.....GV-----------------------
Q9X5S9_STRLA/7-409---V----AVIG--LDSAT....-----------------PQYMFDRFAE......D-----------------------
Q9UZH6_PYRAB/14-420---V----FVIG--LDSAP....-----------------PELLFNRFIN......D-----------------------
Q9YCR2_AERPE/4-405---L----LVIG--LDSVP....-----------------PLLIEKFR.D......L-----------------------
V5Q348_ZYMMB/62-511---I----VAIS--VDQFS....-----------------SDLFSEYRGR......F-----------------------
C6IK84_9BACE/29-473---V----VGLT--IDQLR....-----------------TDYLEAFSSL.....YG-----------------------
ALPH_SYNE7/42-494---V----VGMV--IDQMR....-----------------WDYLYRFYAR.....YG-----------------------
ALPH_ELIME/32-489---V----VGLV--VDQMR....-----------------WDYLYRYYSK.....YG-----------------------
CDA_MYROD/31-491---V----VGLV--VDQMR....-----------------WDYLYRYYDR.....YS-----------------------
Q7MEK0_VIBVY/30-506---V----LQIT--VDGLR....-----------------GDLLDRYKHN.....FA-----------------------
Q84EY0_9GAMM/27-481---V----VQLV--IDQLR....-----------------GDLIFQHQQQ.....FG-----------------------
O29992_ARCFU/4-416---A----VIVV--VDGVSHGVF-----------------WRLFKA...G......K-----------------------
Q981Q5_RHILO/5-379---L----ISIL--VDGVS....-----------------ADTFEKHA.H......R-----------------------
Q98IY7_RHILO/32-447---V----LLIS--VDGLHALDL-----------------ANYVAA...N......P-----------------------
Q7UKE3_RHOBA/4-350---L----CILN--VVGLT....-----------------PKLL.....R......H-----------------------
O69954_STRCO/13-378---L----LVLD--VVGLT....-----------------PRLLD...........H-----------------------
Q8YZP2_NOSS1/4-370---T----VILN--VVGLT....-----------------PKLICE..........H-----------------------
Q7AYA7_9RHIZ/4-370---T----VVIN--VVGLT....-----------------PALLGP..........R-----------------------
Q7NU73_CHRVO/4-375---L----LLLN--VVGLT....-----------------SRLIGE..........F-----------------------
D3MCQ1_PROAA/44-359---Y----VFLL--VDGMG....-----------------QENLEHFR.H......L-----------------------
F7PA94_MYCPC/42-363---V----LVLL--VDGLG....-----------------WQLLAQLA.G......D-----------------------
O50518_STRCO/58-383---N----CVFL--IDGLG....-----------------WEQLRAHP.E......D-----------------------
Q6N507_RHOPA/30-497---L----ILFI--PDGLR....-----------------AKSVSP...E......T-----------------------
Q7WNM8_BORBR/6-370---A----ILII--CDSLR....-----------------RDLVTA...R......T-----------------------
F0K5R6_CLOAE/8-378---L----IVIS--IDALN....-----------------AKDFDFI..K......E-----------------------
Q8XKL9_CLOPE/10-374---M----VVIS--LDAVS....-----------------SKDIEIM..K......E-----------------------
C8K1F1_LISMN/5-366---L----FVIS--LDALG....-----------------ALDLKDT..T......D-----------------------
Q73E52_BACC1/9-380---V----IILS--FDCLS....-----------------ALDFPIL..Q......K-----------------------
O45359_CAEEL/26-353---L----AVVV--IDGLA....-----------------ANTFYKF..S......H-----------------------
Q22129_CAEEL/24-374---L----IVIL--ADGYG....-----------------ATLLNNTKPD......A-----------------------
O58841_PYRHO/4-322---L----ALIS--LDGNG....-----------------IYNLK...........Y-----------------------
ENPP6_XENLA/26-357---L----LLFL--IDGFR....-----------------FDYISDGELQ......H-----------------------
ENPP6_MOUSE/26-357---L----LVLL--LDGFR....-----------------SDYISEDALA......S-----------------------
ENPP1_CAEEL/182-494---L----VILS--LDGFA....-----------------REYVDR...N......I-----------------------
ENPP2_CAEEL/81-386---L----VILS--FDGFA....-----------------KEYLER...R......I-----------------------
Q7MXP5_PORGI/37-349---V----VVLS--LDGFR....-----------------PDYTDR...A......R-----------------------
ENPP7_HUMAN/33-356---L----LLVS--FDGFR....-----------------WNYDQD...V......D-----------------------
Q6ZM30_DANRE/31-356---L----LLIS--FDGFR....-----------------WDYDRD...V......D-----------------------
Q6CX45_KLULA/136-460---T----LVIS--LDGFH....-----------------PGYISE...L......R-----------------------
ENPP5_HUMAN/30-342---V----LLVS--FDGFR....-----------------WDYLYK...V......P-----------------------
ENPP4_XENLA/30-339---L----ILLS--FDGFR....-----------------ADYLTR...F......P-----------------------
K7BSV5_PANTR/28-339---L----LLVS--FDGFR....-----------------ADYLKN...Y......E-----------------------
Q6VZU9_CNPV/107-431---L----ILVA--LDGFR....-----------------YDYLKKWS.N......Y-----------------------
O90761_FOWPV/120-443---L----ILIA--MNGFR....-----------------YDYLNKWE.K......Y-----------------------
Q6PGY9_DANRE/161-472---V----IMLS--VDGFR....-----------------ASYMKRGG.T......V-----------------------
ENPP2_RAT/165-477---L----IIFS--VDGFR....-----------------ASYMKKGS.K......V-----------------------
Q7ZXN7_XENLA/166-476---L----IIFS--VDGFR....-----------------ASYMKKGH.K......V-----------------------
ENPP3_MOUSE/161-485---V----ILFS--MDGFR....-----------------AEYLQTWS.T......L-----------------------
ENPP1_RAT/194-520---T----LLFS--LDGFR....-----------------AEYLHTWG.G......L-----------------------
Q9SU81_ARATH/60-394---V----LMIS--CDGFR....-----------------FGYQFK...T......D-----------------------
Q9SU82_ARATH/57-390---V----LLIS--CDGFR....-----------------FGYQFK...T......E-----------------------
Q42974_ORYSA/92-418---V----ILIS--SDGFR....-----------------FGYQHK...A......A-----------------------
Q9FS13_SPIOL/96-418---V----ILIS--SDGFR....-----------------FGYQFK...A......P-----------------------
Q9SU83_ARATH/109-435---V----LLIS--SDGFR....-----------------FGYQFK...T......K-----------------------
M9N2F7_ASHG1/153-497---T----LLVS--IDGFH....-----------------PSYINN...E......S-----------------------
Q6FKX1_CANGA/187-587---N----IVIS--LSGFY....-----------------PGLISD...E......R-----------------------
N1P7V5_YEASC/170-545---T----IVIS--LDGFH....-----------------PSLISK...R......N-----------------------
M4TY79_9XANT/48-366---L----LLIS--IDGLR....-----------------ADMLDR...G......I-----------------------
Q9PAB9_XYLFA/40-358---L----LLIL--IDGLR....-----------------ADALEH...G......Q-----------------------
H2VFP5_ZYMMO/50-367---L----ILIS--IDGFR....-----------------ADYIKR...G......L-----------------------
Q9A8S4_CAUCR/74-393---T----ILVS--IDGFR....-----------------ADYLDR...G......D-----------------------
Q7SI20_NEUCR/254-584---T----IIFS--LDGFR....-----------------ADFLNR...G......L-----------------------
YGK5_SCHPO/76-404---V----IVIS--LDGFR....-----------------ADYLYR...G......F-----------------------
Q6BTN4_DEBHA/173-514---T----VVIS--LDGFH....-----------------PHYINP...L......L-----------------------
Q6C6J4_YARLI/277-608---T----LVIS--LDGFH....-----------------PHYISP...E......L-----------------------

PF00884

C3LB12_BACAC/143-439-PNI----IFIM--SEAFWDPTK-----------------LTNLSFSEDP------V..................-----
A0A038KMS4_MYCTX/43-460-PNV----LLIL--LDDVGFG..-----------------..ASSAFGGP------C..................-----
K4NNF3_HELPX/294-587-QHV----FYIV--SESLSSWHF-----------------DPKFDAIGLT------S..................-----
A1IT97_NEIMA/232-524-RFV----VLVV--GETTRAA..-----------------..NWGLNGYS------R..................-----
E8VE61_BACST/245-536-KNV----IYVS--LESLQSF..-----------------..IIDYKIDG------K..................-----
O43113_NEUCS/45-420-PNI----VFIL--TDDQ.....-----------------..DLHLQSLD------Y..................-----
A0A038F731_MYCTX/212-635-PNV----LIVL--IDDAGFG..-----------------..GPDTFGGA------I..................-----
O82879_STRMG/460-745-QTV----IYIL--SESFSDPDR-----------------VQGVNLSRDV------I..................-----
O85099_ECOLX/237-530-RTL----VLVI--GESTQRE..-----------------..RMSLYGYL------R..................-----
A0A017IKP4_ECOLX/260-505-QNV----LLIT--VDGLNYSRF-----------------EKQ.......------...................-----
ARS_HEMPU/52-373-PNV----VLLV--ADHMGSG..-----------------..DLTSYGHP------T..................-----
ARS_CHLRE/27-385-PNF----VVIF--TDDQ.....-----------------..DAIQNSTH------P..................-----
ARSA_HUMAN/21-346-PNI----VLIF--ADDLGYG..-----------------..DLGCYGHP------S..................-----
A0A017J6J3_ECOLX/86-419-PNV----VVFL--LDDVGWM..-----------------..DVGFNGGG------V..................-----
A0A017J597_ECOLX/236-527-NLT----ILIV--GETSRAE..-----------------..NFSLNGYP------R..................-----
A0A017HZX0_ECOLX/4-341-PNF----LFVM--TDTQATN..-----------------..MVGCYSGK------P..................-----
ARSB_FELCA/47-366-PHL----VFVL--ADDLGWN..-----------------..DVSFHGSN------I..................-----
GALNS_HUMAN/31-355-PNI----LLLL--MDDMGWG..-----------------..DLGVYGEP------S..................-----
A0A017I1Q5_ECOLX/248-538-TYV----VFII--GETTRWD..-----------------..HMGIFGYE------R..................-----
C9MG45_HAEIF/211-475-KNY----ILII--GESMRKD..-----------------..YMSLYGFP------L..................-----
GNS_CAPHI/54-391-PNV----VLVL--ADDQ.....-----------------..DEVLGGM.------...................-----
STS_MOUSE/35-421-PNF----LLIM--ADDLGIG..-----------------..DLGCYGNK------T..................-----
ARS_STRPU/67-388-PNV----ILLL--ADDMGVG..-----------------..DLSVYGHP------T..................-----
SPHM_HUMAN/23-328-RNA----LLLL--ADDGGF...-----------------..ESGAYNNS------A..................-----
A0A022NJX0_PSEAI/5-420-PNF----LVIV--ADDLGFS..-----------------..DIGAFGGE------I..................-----
E8H705_ECO57/223-491-DTY----VLIV--GESVRVD..-----------------..NMSLYGYT------R..................-----
F6BMG6_SINMB/269-561-PDV----IVLM--SESFWDPTR-----------------LPKVKLTPDP------M..................-----
A0A017IT13_ECOLX/217-483-QTY----VVVI--GESARRD..-----------------..ALGAFGGH------W..................-----
A0A024LN14_ECOLX/58-408-PNI----IVLT--MDDLGYGQL-----------------PFDKGSFDPK------TMENREVVDTYKIGIDKAI-----
A0A038FFI8_MYCTX/37-466-PNI----LYLV--WDDVGIA..-----------------..TWDCFGGL------V..................-----
A0A038VAH2_MYCTX/5-389-PDI----IIVM--TDEERAVPP-----------------YESAEVLAWR------Q..................-----
Q0Z8S6_VOLCA/26-386-PNF----VVIF--TDDQ.....-----------------..DGIQNSTH------P..................-----
Q45087_9BURK/4-384-KNV----LLIV--VDQWRADFI-----------------PHLMRAEGRE------P..................-----
A0A059MXH6_ENTFL/256-543-PNI----VFVM--SESFSNPDH-----------------LKGLSIIGNP------L..................-----
Q840W2_STRMG/270-555-RTV----IYIL--SESFSDPWN-----------------VPSVTLSQDV------M..................-----
M2E9Z0_STRMG/503-788-QTV----IYIL--SESFSDPDR-----------------VKGVNLSRDV------I..................-----
Q8G592_BIFLO/306-604-STV----VYVL--SESFSDPSR-----------------VPGLKTNKDS------M..................-----
A0A029SCQ9_STRPY/480-765-QTV----IYLL--SESLSDPDR-----------------VSNVTVSHDV------L..................-----
Q8P1I3_STRP8/480-765-QTV----IYLL--SESLSDPDR-----------------VSNVTVSHDV------L..................-----
Q8XK47_CLOPE/257-551-PNI----IIVQ--LESFMDLHR-----------------INGLTFKEDP------I..................-----
Q984T6_RHILO/281-574-PDI----IIVM--SESFWDPTK-----------------LPGVTITPDP------I..................-----
Q98EG2_RHILO/158-441-KNL----VHIF--IESAERT..-----------------..YMNEVEFG------D..................-----
Q9A0F9_STRP1/480-765-QTV----IYLL--SESLSDPDR-----------------VSNVTVSHDV------L..................-----
Q9AI31_BURML/214-497-PDV----IVIQ--SESFFDPRP-----------------L.SAAIDSSI------L..................-----
H8ID57_PASMH/287-557-KNI----VIIL--EESLGAQ..-----------------..FIGSLGGL------P..................-----
Q9CM05_PASMU/231-523-HVT----VLII--GETTRAK..-----------------..NWGLNHYE------R..................-----
A0A030RTZ7_PSEAI/238-530-RTL----VLVI--GESTSRK..-----------------..HMSLYGYP------R..................-----
A0A022NH93_PSEAI/238-529-SLL----VFVV--GETARAD..-----------------..HFSLNGYA------R..................-----
A0A030XY34_PSEAI/231-522-SLT----VLVV--GESARAQ..-----------------..NFGLNGYA------R..................-----
A0A030YI64_PSEAI/223-501-RNV----LIVA--MEGIPGAYI-----------------AANRAAINSS------Y..................-----
F0ADR9_NEIME/214-487-QNI----VLIM--GESESAA..-----------------..HLKLFGYG------R..................-----
A0A016X8V3_VIBCL/240-530-TLV----FFVL--GETARVQ..-----------------..NYQYLGYP------R..................-----
Q9PGC7_XYLFA/245-535-RLL----VIVV--GETARAQ..-----------------..NWGLNGYV------R..................-----
Q9RBI1_ACIAD/237-531-QVM----VLVI--GETGRAQ..-----------------..SFGLNGYA------R..................-----
Q9RMJ0_NEIME/232-495-KNY----VVVI--GESARSD..-----------------..YMNVYGFP------L..................-----
Q9X6R2_PSEAI/20-300-ATW----WWSC--WKAFAGH..-----------------..YVGALGAP------G..................-----
D5AWR1_RICPP/218-505-IIG----VLVI--GESARFD..-----------------..HFGINGYK------R..................-----
Q9ZJJ5_HELPJ/225-518-SNV----VLVI--GESASRN..-----------------..FMQLYGYS------V..................-----
Q9ZN39_HELPJ/222-504-SFV----VLVI--GESARKS..-----------------..NYALYGYE------K..................-----

PF02995

Q19148_CAEEL/61-607-DDN----IKTE--IERDPLLTH-----------------HPFDNTCKFPLPNSYAEDIIPFHLSERMRQLKCEVKQKDY
O18062_CAEEL/67-538-EYN----PARN--CYKNYVQWT-----------------ELVN...STWRIVKDG..............ANCLA.RCFS
Q9VSJ3_DROME/115-607-KRI----KYKS--CQKLTPLTQ-----------------VKFEAKSQKYLLSIDG.AAFGRYP..VGKQLHCCY.MSVQ
Q21671_CAEEL/74-651-NEN----PLKK--CDTSFKPLT-----------------KLENSKWGVTFA.........H.......NLTCRA.RCHT
Q9VGG4_DROME/77-573-TPM----PSSA--CPMIKLMKP-----------------QSID.GMNYLYLIASAKELWKKLGVRRLSDIFCAY.KRFV
Q9VQH3_DROME/74-555-EPI----EPVL--CRMEQLMVA-----------------ETIG.DRNYLVRNIS......RHGILSWRQVSCIY.REFV
Q9VAU4_DROME/90-580-HPE----HFET--CSNETALVT-----------------PIYDISRQRYVLFINESLASIILN.SNGGEYNCYY.QEIT
Q9VKK3_DROME/98-598-KPR----PYS.--CNRALIRTS-----------------DTIP...GQLHLNLEASELLAYYNISDLSSVNCNY.TEVK
Q19486_CAEEL/79-568-SKP----SPLV--CSTMQVQAV-----------------KSFNNGILTFEPQVIK.............NARCYK..TGI
Q9V9Q1_DROME/66-560-RGL----RRDF--CASNLNLTS-----------------FS.NCTYNYLRTEVNMELAKARFGVETLESFKCMY.YAME
Q9VF91_DROME/73-581-KPV----ERIN--CGEGMDWVM-----------------CEKSICFVRPEIASS............HEDVICSY.TDII
Q9VLG3_DROME/84-577-KPQ----TLIT--CSNETDLIS-----------------TTYNEIIKRHILHIDDEVAQKLLN.FTDKDYNCFY.REIK
Q9V9P7_DROME/68-547-EPV----NKLR--CRMTQLLTA-----------------ITQD...GSNFLEAK......RIS....EDLSCRYWLKSG
O62436_CAEEL/78-581-TAL----QSQK--CNIPKLEIN-----------------GSEVINFFKTHAPLECQKKNSIEDNWVFINDEAIIRFTEK
Q9W0F7_DROME/16-518-KRR----QFRE--CSSDKDLLI-----------------SEFDSHLRQYRIKIDENSAQQHLKKFGNATLKCEY.QVIG
Q8SY05_DROME/180-657-KKH----SYIV--CDKSRDMIT-----------------VNYNVTDSTYRLHKNE.............NSTCCF.KQIL
Q9VIP6_DROME/56-555-.RK----TLRH--CHNDSDMVT-----------------SEFDFETHQYRLHVHEHLAKPIMNRKGNATLECEY.QEIS

PF01676

APGM2_ARCFU/1-380-MKY----LLLI--PDGMADWEV.................EELDGRTPLEVAE....-----------------------
DEOB_GEOSE/6-381-KRV----FLIV--MDSVGIGEAPDA...........EKYNDKGADTLGHIAEHRG.-----------------------
E8VA73_BACST/4-499-KPA----ALII--LDGFGLRNE.................TVGNA...VALAK....-----------------------
APGM_AQUAE/13-398-SKI----LLIV--LDGLGGLPV.................KE..GKTELELAK....-----------------------
A0A017I0E2_ECOLX/6-501-KPM----VLVI--LDGYGYREE.................QQDNA...IFSAK....-----------------------
I0ZIS4_HELPX/3-399-KRV----VILL--LDSFGIGASEDA...........KDFGDLGANTLGNIAKACFN-----------------------
PMGI_MESCR/20-545-KTL----AMVV--LDGWGEASA.................NQYNC...IHVAE....-----------------------
GPMI_PORPU/7-507-HPI----VLAI--LDGWGHSNS.................HQGNA...IKIAK....-----------------------
F7URM6_SYNYG/7-504-APV----VLVI--LDGWGYRPD.................TRANA...IAQAN....-----------------------
APGM_PYRHO/5-403-RKG----LLII--LDGLGDRPI.................KELNGLTPLEYAN....-----------------------
PMGI_MAIZE/20-545-KSV----AVVV--LDGWGEANP.................DQYNC...IHVAQ....-----------------------
PMGI_RICCO/17-542-KTI----AMVV--LDGWGEAKP.................DQYNC...IHVAE....-----------------------
G4EU83_BACIU/7-382-NRV----FLIV--MDSVGIGEAPDA...........ADFNDEGAHTLGHIAEHMN.-----------------------
APGM1_ARCFU/1-399-MPV----LLIV--VDGLSDRPI.................D...GKTPLSVAR....-----------------------
APGM1_METJA/4-402-GKC----VIFI--IDGLGDRPN.................EK..GLTPLKEAK....-----------------------
D8KJJ3_LACLN/6-399-GRI----HLVV--MDSVGIGAAPDADKFFNHDVETHEAINDVKSDTIGHISEIR..-----------------------
B1X727_ECODH/2-390-ARF----VVLV--IDSFGVGAMKDVT.........LVRPQDAGANTCGHILSQLP.-----------------------
GPMI_PSESM/6-497-KPL----VLII--LDGFGHSES.................HEGNA...ILAAK....-----------------------
GPMI_ANTSP/7-499-SPI----ILMI--LDGWGHSTN.................AKGNA...IHEAN....-----------------------
I0ZG59_HELPX/3-482-QKT----LLII--TDGIGYRKD.................SDHNA...FFHAK....-----------------------
PMGI_TOBAC/20-545-KTV----AVIV--LDGWGEAKP.................NEFNA...IHVAE....-----------------------
M7ZXD7_TRIUA/25-880-KVV----GVVV--LDGWGEAPP.................DPFNC...IHVAD....-----------------------
A0A009END8_ECOLX/2-399-KRA----FIMV--LDSFGIGATEDA...........ERFGDVGADTLGHIAEACAK-----------------------
APGM2_METTH/4-396-MKH----VILV--GDGMADYPL.................DELDGKTPLQVAD....-----------------------
GPMI_MYCGE/3-493-KKV----LLAI--LDGYGISNA.................IYGNA...VQNAN....-----------------------
M1GCD6_MYCPM/3-494-KKV----LLAI--LDGYGISNK.................QHGNA...VYHAK....-----------------------
GPMI_HELPY/3-482-QKT----LLII--TDGIGYRKD.................SDHNA...FFHAK....-----------------------
APGM1_METTH/1-400-MKG----VIMI--IDGMADRPL.................EKLSGRTPLEAAS....-----------------------
APGM2_METJA/1-398-MRA----ILIL--LDGLGDRAS.................EILNNKTPLQFAK....-----------------------

PF00245

PPB_BOMMO/74-515AKNV----VMFL--GDGMS---------------------VPTLAAARTLLGQRRGQ-----------------------
PPBT_BOVIN/51-490AKNV----IMFL--GDGMG---------------------VSTVTAARILKGQLHHS-----------------------
PPBI_MOUSE/52-486AKNL----IIFL--GDGMG---------------------VPTVTATRILKGQLEGH-----------------------
PPBN_MOUSE/51-486AKNL----VILM--GDGMG---------------------VSTVTATRILKGQQQGH-----------------------
PPB1_HUMAN/55-490AKNL----IIFL--GDGMG---------------------VSTVTAARILKGQKKDK-----------------------
B1W385_STRGG/41-448ARSV----ILLI--GDGMG---------------------DAEITAARNYSVGAAGR-----------------------
A0A017K3Y5_ECOLX/64-470AKNI----ILLI--GDGMG---------------------DSEITAARNYAEGAGGF-----------------------
A0A023ZB72_YEASX/66-527KKNV----IFFV--TDGMG---------------------PASLSMARSFNQHVNDL-----------------------
J7JQ01_BACIU/49-459IRNV----IVMI--GDGMG---------------------TPYIRAYRSMKNN.GDT-----------------------
G4EZI5_BACIU/43-455IKNV----IVLI--GDGMG---------------------VSYTSAYRYLKDNKKTK-----------------------

PF08665

Q2RKS0_MOOTA/260-429-AKK----VLIC--MDGMG---------------------FQEWCCLKQY------------------------------
Q72AH5_DESVH/438-616-NKV----CVII--SDAMR---------------------YEIGDELLSL------------------------------
Q8TNC5_METAC/496-671-SKV----AVIV--SDALR---------------------YEAAAELFET------------------------------
Q3A8U0_CARHZ/461-637-ERV----FVII--SDALR---------------------FEAGRELAEM------------------------------
B1YIB9_EXIS2/462-638-ERV----FVIV--SDAMR---------------------YEVGLELIDL------------------------------
Q5P0R1_AROAE/485-661-KRV----FVVI--SDAFR---------------------FEAAEELVQQ------------------------------
Q2W5M5_MAGSA/475-648-RRV----FVII--SDALR---------------------YEAAKELVDV------------------------------
Q8ZK15_SALTY/474-650-KRV----FVII--SDALR---------------------YEVAEELGNQ------------------------------
Q7MVV4_PORGI/231-425-EKV----FFIL--IDNFR---------------------QDQWESVKSM------------------------------
A5EWI8_DICNV/401-578-SRA----ALIV--VDGLA---------------------LDQWVTIRQL------------------------------

PF07394

Q7UT83_RHOBA/61-480AKAV----IMLF--MEGGPGQ-------------------MDTFDPKPELDRLHVTE.......SKRTEGLATGKRFYVG
Q7UHL2_RHOBA/84-501AKRV----IWLF--MHGGPSH-------------------VDLFDPKPALTKYSGQP..LPESFGNVMTRRDVKKNPLLA
Q7UN58_RHOBA/63-468AKRV----IFLF--MHGGPSH-------------------VDTFDYKPMLIRDNGKDLPFE......LPPQISAKPTLLA
Q98BS1_RHILO/39-404DPRL----IVIV--LRGALDG-------------------LSAVGPVGDPDYAGLHGDI.....................
Q7UHK7_RHOBA/71-478VKSV----IWLF--MEGAPSA-------------------VDMFDRKPELDKRDGDTTDIQAFFGNP........GPLMK
Q7UKW9_RHOBA/100-522AKRI----IYLF--QSGGPAQ-------------------QDLFDHKPMLEQMHGRELPPEVRGEQRLTGMSVNQSSLPV
Q8P3X8_XANCP/29-384SARM----LVVF--LRGGYDS-------------------NNLLVPHGSDFYYQARPTL.....................
Q7UZ35_RHOBA/49-467AKTV----IHLC--MAGGPSH-------------------VESLDPKPELDKINDQPFPASMTDGQQLAQLQGSKLVARG
Q7UFP1_RHOBA/49-464IKRV----IHLC--MAGGPSH-------------------LETFDYKPELARLDGQPMPESLTKGQPIAQLQN..KALRV
Q7MLK9_VIBVY/33-420YKAL----VCVF--LFGGNDG-------------------FNMLVPTSDAHYDEYARAR.....................
Q7US09_RHOBA/66-482AKSV----IFLF--MDGGPSH-------------------LDTFDPKPELERLAGKP..IPESFGRVLTAMGEFDSPILP
Q7VYL6_BORPE/29-381DTRL----LVVF--MRGAYDA-------------------ASLLVPTTSEFYYESRPHI.....................
Q7UDW2_RHOBA/77-502VKRV----IYLH--MVGAPSQ-------------------LELFDYKPDLKELDGKECPQSFLEGKRFAFINGTPRMLGP
Q87HJ3_VIBPA/35-425FRAL----ICVY--LAGGNDA-------------------INTILPLSDFHYNQYANVR.....................
Q7UM62_RHOBA/63-489AKRV----IFLH--MAGGPSQ-------------------LELFDYKPDLQQLDGKDTPASFLEGKRFAFIQGVPKMLGP
Q7UJ64_RHOBA/59-474AKNC----IFLM--MEGGPSH-------------------IDTFDPKPKLNQLHLQEFVRQ...GQQKSAMESGKRYFVR
Q7UIF5_RHOBA/61-494AKSV----IWLF--MIGGASH-------------------METFDPKPQLNKLAGKTIKETPYAKVLESPYLANERVVAF
Q7UYJ8_RHOBA/60-484AKNV----LVIF--CAGACSQ-------------------LDTFDYKPELIKRHGQPMPGA....ESLVTFQGEQGMLTK
Q7MCK0_VIBVY/38-408YKAI----VVIS--LGGGNDG-------------------FNTIVATEQYDL............................
Q9A5N3_CAUCR/44-506YKAI----VCLF--LVGGNDA-------------------NNLLVATDDASWQRYWSARFRGATPIALMPPGTAPTPIGS
Q7ULC1_RHOBA/52-445ADAC----ILVW--MDGGPSH-------------------YETFDPKPDAPVEIRGSY......................
Q7UQT8_RHOBA/50-438AKRA----IFIE--LNGGPSH-------------------IDTFDPKPDASDEVRGPF......................
Q7UQ29_RHOBA/54-472AKRV----IHLF--MNGGPSQ-------------------VDSFDRKPALEEFDGKSAPMANLKTERPT......GNVMR
Q7UGB9_RHOBA/69-492AKSV----IYIH--MVGAPSH-------------------LDLFDYKPVLQERSGQLCPDEFFNGKQLAFIREQPKLFGT
Q7UPP6_RHOBA/56-434AKHI----IYLF--MDGAMSH-------------------LDTFDPKEGVEEAGET........................
Q7UI66_RHOBA/46-421RKSA----ILLW--MGGGPAT-------------------IDIWDLKPGAPTGGP.........................
Q7UVE3_RHOBA/81-505AKRV----IFLT--QSGGPSQ-------------------IELFDHKPELPKLAGTELPDSVRQGQRLTGMTKNQKQLIL
Q7UW70_RHOBA/70-497AKSI----IMVY--LQGGPSH-------------------LDLWDPKENVPDNVKSQF......................
Q7UKM6_RHOBA/69-495AKRV----IYLF--QSGGPSH-------------------IDLFDHKEELEQLHGTNLPDSIRGGQRLTGMTSRQSQFPV
Q7UTL9_RHOBA/100-490AEHV----ISIW--LGGGMGQ-------------------IDTFDPKRMGDQKARKPGSLY...................
Q7UGF5_RHOBA/94-499RKSC----IMIF--NLGAPSQ-------------------MDTFDPKPNAPVEVRGP.......................
Q9A6V4_CAUCR/38-393RKKL----VIVI--CRGGMDG-------------------LSVSPPVGDANYAALRGSI.....................
Q7UYC8_RHOBA/101-527AKRV----IFLF--MAGAPSQ-------------------IDLFDYKPELVKQFNQPLPPSVSQGQRVTAMTRGKEQLIV
Q7UR29_RHOBA/60-444AKSV----IHIY--LPGGMAQ-------------------QESWDPKPYSPMEYRGD.......................
Q7UYM7_RHOBA/45-446RRHC----ILLW--MSGGPTQ-------------------TDTFDMKPNHENGGEF........................
Q7UV65_RHOBA/50-468AKRV----IFLF--MKGGPSH-------------------MDTFDYKPQLQKDDGKP..LP..FEKPRVQFAPT.SNLLA
Q7UJ54_RHOBA/70-497AKRV----IFLF--MAGAPSQ-------------------MDLFDYKPELAKQFKQPLPPSVSNGQRVTAMTRGTKQIIA
Q7UJ36_RHOBA/99-512IKNV----ILLF--MGGGPSQ-------------------FEMFDYKPELERLDGTLPPAELLDGYRAAFINPNSKLLGP
Q7NT93_CHRVO/33-383KRLL----VLVE--LKGGNDG-------------------LNTVVPYASADYYRLRPGI.....................
Q7UEK9_RHOBA/80-501AKSV----IVVF--CSGALSH-------------------VDTFDFKPELERRHGQPMPGN....ENLVSFQGPNGNLTR
Q7UQW1_RHOBA/70-487AKNV----IFLY--MDGGPSQ-------------------IDTFDPKPLLTKMDGRE..PGDLFRVEPTQFNNN.GKVLG
Q7UPF7_RHOBA/65-448PKSV----ILLW--MEGGPSQ-------------------LETFDPHPGTKFGGDV........................
Q7UYR5_RHOBA/95-521AKRA----IYLF--MSGAPSQ-------------------MDMWDHKPQMADWFDKDLPESIRQGQRLTTMTSGQSRFPI
Q7UWA1_RHOBA/72-492AKTV----IFLF--MYGGPSH-------------------IDTFDHKPAMKGMDGKTVDVK.TFGRGGHKAG...GRIVE
Q89DL5_BRADU/42-392DPRL----IVVI--LRGALDG-------------------LSTVAPVGDPDYAGLHGSI.....................
Q7URV7_RHOBA/77-499AKQV----LVIF--CPGAVSH-------------------VDTFDYKPALTKLHGQKPPGI.....PAVTFEGPTGNIAK
Q7MDY0_VIBVY/67-457FKAL----VCIY--LAGGNDA-------------------INTVLAKDNEHYLQYKNVR.....................
Q7UH70_RHOBA/75-488AKRV----IHLF--ANGGPSQ-------------------IDTFDPKPMLAKMHGKTLDDKLKNNRRLGGVAHQSP....
Q7UVE1_RHOBA/82-507VKRV----IFLH--MIGAPSQ-------------------LELFDYKPELKRLDGKDCPQSFLEGKRFAFIQGTPKMLGP
Q7UQ53_RHOBA/45-480AKRV----VQLF--MAGAASH-------------------IDLWDHKPLLEKLHGQQ....SDFGEPVETFQDGLGPWMK
Q7UP10_RHOBA/69-492AKRV----IFLF--QSGAPSQ-------------------LDLFDYKPLLNQKHGTELPDEIRGGQRLTGMSGNQSSLPL

PF04185

Q47936_FRANO/55-471IKHV----VIIF--QENNSF--------------------DRYFGMYPNAKNPEGEPKFVAKENTPNVNG..........
PHOX_KLULA/65-312FKRF----FIIF--LENTDY--------------------DKAAGDES................................
Q98ES1_RHILO/58-274YDHV----VVVI--MENHTF--------------------EQI.....................................
A0A038F821_MYCTX/50-282FAHV----VIVV--EENRSQ--------------------AAIIGNKS................................
D0KPN6_SULS9/27-365IRHV----IIII--EENHSF--------------------DNLFGTYPFGYPPILNNITLSLMYPY...G..........
NPC6_ARATH/59-394MKNS----V...--..NPTI--------------------NGVTGQEC................................
NPC5_ARATH/13-380IKTI----VVLV--QENRSF--------------------DHTLGWFK.ELNREID.............G..........
NPC3_ARATH/16-381IKTI----VVLV--QENRSF--------------------DHMLGWFK.ELNPEID.............G..........
NPC1_ARATH/38-396IKTI----VVVV--MENRSF--------------------DHILGWLK.STRPEID.............G..........
NPC2_ARATH/27-389IKTI----VVVV--MENRSF--------------------DHMLGWMK.KLNPEIN.............G..........
Q9KH04_BURML/84-547VRTI----VVIY--AENRSF--------------------ANLFGDFP.GVQQPLGAVSPERYAQLDRDGKTPLATLPKI
Q983N8_RHILO/60-507IETV----VVIF--AENRAF--------------------DNLYGHFP.GAEG.IDKASQESLQQRDRDGSV.LSELPPV
E2TNP6_MYCTX/52-433IEHI----VLCL--QENRSF--------------------DHYFGTLS.AVDG.FDTPTP..LFQQK..G..........
A1KJH2_MYCBP/50-429IEHF----VFFM--QENRSF--------------------DHYFGTLS.GTDG.FNTVSP..LFQQK..G..........
A4KJA2_MYCTX/52-435IEHI----VLLM--QENRSF--------------------DHYFGTLS.DTRG.FDDTTPPVVFAQS..G..........
A5WPW5_MYCTF/51-431IEHI----VLLM--QENRSF--------------------DHYFGTLS.STNG.FNAASP..AFQQM..G..........
A0A030U552_PSEAI/51-437VQHV----VILM--QENRSF--------------------DHYFGHLN.GVRG.FNDPRA..LKRQD..G..........
A3NXI4_BURP0/47-438VEHI----VILM--QENRSF--------------------DHYFGKLR.GVRG.FGDPRP..LALQN..G..........
B8H354_CAUCN/40-437VEHV----VILM--QENRSF--------------------DHYFGTLN.GVRG.FGDRFP..IPVRDAAG..........
A0A022NDQ0_PSEAI/48-422VEHV----VILM--QENRSF--------------------DHYFGTLK.GVRG.FGDRMA..IPLPD..G..........

PF16347

G2PRM5_MURRD/414-516IPEDMQGKSILP--VLEG-------------------------------N------------------------------
G7USR5_PSEUP/397-499PPDWMQGRSWQK--IALD-------------------------------Q------------------------------
D5BJX1_ZUNPS/413-515IPKDMQGISFKE--VVYG-------------------------------N------------------------------
G0J719_CYCMS/407-508IPEEIQGESFRD--VVS.-------------------------------G------------------------------
D2R402_PIRSD/397-498QPADMQGRSLKP--LLTG-------------------------------N------------------------------
G8NQI2_GRAMM/379-480KPANMQGKSVLP--LAE.-------------------------------K------------------------------
D2QMZ8_SPILD/410-511IPRGVQGESFLP--LLT.-------------------------------G------------------------------
A4AWR6_MARSH/414-516APQDMQGESLVP--LLKG-------------------------------Q------------------------------
A6LDP5_PARD8/412-514IPSDMHGISFLP--LLRG-------------------------------E------------------------------
A4CJM0_ROBBH/381-483QPSDMQGESLVP--VLTG-------------------------------N------------------------------
A2TWV5_9FLAO/422-523IPKEMQGKSLVP--LFK.-------------------------------N------------------------------
G8UMU5_TANFA/417-519VPNDIQGDSYLP--LLKG-------------------------------E------------------------------
D5BJT8_ZUNPS/386-488EDHKMQGRSFAQ--LLKG-------------------------------E------------------------------
F9YSE0_CAPCC/401-501VPKDMHGNSFKA--LVD.-------------------------------G------------------------------
D3IBE7_9BACT/417-519VPNDIQGVSLLP--LLKG-------------------------------Q------------------------------
C7M893_CAPOD/396-496IPADIQGKSFLP--LFA.-------------------------------K------------------------------
G0J436_CYCMS/421-522APKDMQGESLLP--LLTG-------------------------------.------------------------------
A3HWF8_9BACT/418-520APADMQGESMMP--LLTG-------------------------------N------------------------------
E8V2R6_TERSS/392-493IPAHMQGKSILP--LTK.-------------------------------K------------------------------
G8TRD3_NIAKG/412-512IPTDMQGKSFVP--LLKG-------------------------------K------------------------------
H8KTX9_SOLCM/409-510APADMQGVTFKP--LVTG-------------------------------K------------------------------
F4L7F1_HALH1/402-503IPAEMQGKSIVP--LLRK-------------------------------K------------------------------
F3ZRQ1_9BACE/413-515IPEDIQGVSLLP--LLKG-------------------------------E------------------------------
E6SVH3_BACT6/418-520TPQDMHGVSFLP--LLKG-------------------------------K------------------------------
D2QEZ9_SPILD/447-548VPDYVQGESFLP--LLT.-------------------------------G------------------------------
G0IUX7_CYCMS/423-524APQEMQGESFRK--LVS.-------------------------------G------------------------------
G0L151_ZOBGA/413-515IPADMQGKSLLP--LVGE-------------------------------N------------------------------
A6KZU2_BACV8/416-518VPADMHGVSFLP--LLKG-------------------------------E------------------------------
A6L8Y1_PARD8/413-515IPADIQGESLLP--LLKG-------------------------------E------------------------------
I3YHK1_ALIFI/406-508VPDDIQGVSLLP--LLRG-------------------------------E------------------------------
Q5LAU2_BACFN/415-517VPADIQGVSLLP--LLKG-------------------------------E------------------------------
R5M554_9BACE/414-516VPEDIQGISLVP--LLKG-------------------------------E------------------------------
R5UAM5_9BACE/410-512IPEDIQGVSLLP--LLKG-------------------------------E------------------------------
R7DGX3_9PORP/412-514VPEDMQGISLLP--LLKG-------------------------------E------------------------------
W0EZJ7_9SPHI/397-497VPERMQGISFLP--LLQ.-------------------------------N------------------------------

PF14707

A9VBN0_MONBE/428-544DERI....LFFP..EDGN.....-----------------.........M------------------------------
E6ZGQ8_DICLA/413-534.GHE....FLFHP.NSGA.....-----------------...AGKFGDL------------------------------
Q4S4L1_TETNG/407-528.GHE....FLFHP.NSGA.....-----------------...AGTFGYL------------------------------
E1BU03_CHICK/390-510.GHK....VLLHP.NSGA.....-----------------...AGKDGAV------------------------------
ARSG_MOUSE/402-522.GHR....VLFHP.NSGA.....-----------------...AGEYGAL------------------------------
A6QLR7_BOVIN/402-522.GHR....VLFHP.NSGA.....-----------------...AGEDGAL------------------------------
ARSG_CANFA/402-522.GHR....VLFHP.NSGA.....-----------------...AGEFGAL------------------------------
B4DQ74_HUMAN/301-421.GHR....VLFHP.NSGA.....-----------------...AGEFGAL------------------------------
A9V957_MONBE/437-571RGHT....SMFHPSYGEG.....-----------------...SPHFGAI------------------------------
F0Y2N2_AURAN/404-544SARDEAGDCLFF..FGGP.....-----------------...HGADA.P------------------------------
Q1YP24_9GAMM/409-501SPRT....SIPF..YSGS.....-----------------...E.....L------------------------------
C6W2Y6_DYAFD/349-461TPRES...FLYY..YRKN.....-----------------...N.....L------------------------------
D7VQY4_9SPHI/353-442KGRD....EFFY..FGLD.....-----------------...H....QL------------------------------
F2UD41_SALR5/491-612GARD....YYFY..WAAN.....-----------------...VANMSDL------------------------------
A9UXW0_MONBE/287-431VRNR....TMWH..YCGH.....-----------------...N.....V------------------------------
F2UKF0_SALR5/383-527RPDP....IIWH..YCGH.....-----------------...N.....V------------------------------
B9QU81_9RHOB/44-158SSRD....EIIY..YEGT.....-----------------...D.....L------------------------------
E4YGB6_OIKDI/449-582SPHE....FMFH..YCGD.....-----------------...N.....L------------------------------
F2U742_SALR5/410-535QGHD....CIMF..YHNAAA...-----------------...VNASGEL------------------------------
A9UPM8_MONBE/326-451KGHE....CIMF..YHNAVA...-----------------...ANASGEL------------------------------
A8XD87_CAEBR/394-528GKAR....PIIY..YCNT.....-----------------...H.....L------------------------------
E1FX25_LOALO/406-541ALER....PIFY..YCNT.....-----------------...H.....L------------------------------
F1KQC6_ASCSU/1702-1837GVRR....PIFY..YCNE.....-----------------...H.....L------------------------------
F2UCT8_SALR5/90-221SQHD....CLFI..YKGTTGAAC-----------------PRQHPNCPGL------------------------------
A9V7E7_MONBE/452-571SQHD....CIFI..YKGT.....-----------------...P....GL------------------------------
C1BQY6_9MAXI/368-496NPRE....TLMY..FPGN.....-----------------...AQRRLGP------------------------------
Q4RJR3_TETNG/343-473SKRE....AMMF..YPTD.....-----------------...PSEKNGL------------------------------
Q6AX40_XENLA/368-499SPRN....TFHY..YPSS.....-----------------...IDRNKGI------------------------------
A1L2N0_XENLA/374-505SPRK....MFYY..YPPS.....-----------------...IDPSRGI------------------------------
F1NWF7_CHICK/373-504SPRQ....TMFF..YPPS.....-----------------...PDPLHGP------------------------------
Q32KK2_RAT/368-501SPRN....SVFF..YPPF.....-----------------...PDEIHGV------------------------------
ARSA_BOVIN/368-501SPRH....TLFF..YSAY.....-----------------...PDEVRGV------------------------------
ARSA_HUMAN/368-501SPRQ....SLFF..YPSY.....-----------------...PDEVRGV------------------------------
E4XNY3_OIKDI/402-532SPSG....THFF..YRGD.....-----------------...T.....L------------------------------
C3ZV84_BRAFL/657-789EVDR....PVFY..YRGD.....-----------------...E.....L------------------------------
Q4SI19_TETNG/405-541LDRRVHVWPIFY..YRGN.....-----------------...E.....L------------------------------
F1QFT2_DANRE/220-352LIDR....PIFY..YRGN.....-----------------...Q.....M------------------------------
Q5XG10_XENLA/375-507ETER....PIFY..YRGN.....-----------------...E.....L------------------------------
GALNS_CANFA/377-509LTDR....PIFY..YRGD.....-----------------...T.....L------------------------------
F1NW57_CHICK/376-508LIDR....PIFY..YRGN.....-----------------...E.....M------------------------------
A0YAF7_9GAMM/381-478NERK....NIFY..YHGD.....-----------------...K.....I------------------------------
Q0C069_HYPNA/397-504SPRE....TLYY..YRFT.....-----------------...D.....V------------------------------
ARS_STRPU/411-541SPHD....DFFY..YCKD.....-----------------...T.....L------------------------------
ARS_HEMPU/396-526SPHS....SFFY..YCKD.....-----------------...N.....L------------------------------
O16138_HELER/402-534SPHD....SFFY..YCKD.....-----------------...N.....L------------------------------
A4AN36_MARSH/378-468SPRQ....HILY..YRGT.....-----------------...E.....L------------------------------
A4CMB0_ROBBH/401-491SPRK....EMFY..YQGA.....-----------------...D.....L------------------------------
A3XMW9_LEEBM/382-476SPRE....TMFY..YRGD.....-----------------...E.....L------------------------------
A7V8P9_BACUN/356-447SSRD....EMYY..WRGS.....-----------------...H.....L------------------------------
A6CB11_9PLAN/382-473SPRE....ELAY..YRGT.....-----------------...K.....L------------------------------
F0SFZ7_PLABD/380-468SPRQ....DVFY..WRSE.....-----------------...Q.....L------------------------------
C3ZQB5_BRAFL/423-551PSPR....TLFH..YCSN.....-----------------...R.....L------------------------------
C3ZQC1_BRAFL/344-471PSPR....TLFH..YCSD.....-----------------...R.....L------------------------------
A7SK49_NEMVE/435-563SAHE....FMYH..YCGK.....-----------------...D.....I------------------------------
A7SQ82_NEMVE/425-557SPHE....FLFH..YCAK.....-----------------...S.....I------------------------------
A7SK50_NEMVE/483-612SPHK....FMYH..YCAK.....-----------------...A.....V------------------------------
Q7ZWB8_DANRE/433-548SEHE....FLFH..YCNA.....-----------------...E.....L------------------------------
Q6DJK3_XENLA/433-566SSHD....FMFH..YCTD.....-----------------...Q.....L------------------------------
Q32KK0_RAT/450-603SAHE....VLLH..YCEV.....-----------------...F.....L------------------------------
F1QB82_DANRE/433-568SEHE....LLFH..YCNA.....-----------------...E.....L------------------------------
Q4RYA1_TETNG/304-429SEHE....FLFH..YCNS.....-----------------...Y.....L------------------------------
STS_MOUSE/445-581SEHE....FLFH..YCNA.....-----------------...Y.....L------------------------------
STS_RAT/436-573SEHE....FLFH..YCNA.....-----------------...Y.....L------------------------------
STS_HUMAN/437-572SDHE....FLFH..YCNA.....-----------------...Y.....L------------------------------
D2HXW7_AILME/434-569SDHE....FLFH..YCNF.....-----------------...Y.....L------------------------------
Q4TCJ7_TETNG/242-385SEHE....FMFH..YCGI.....-----------------...Y.....L------------------------------
Q6GMA1_XENLA/439-573SEHE....FLYH..YCGP.....-----------------...H.....L------------------------------
ARSF_HUMAN/440-574SEHE....FLFH..YCGS.....-----------------...Y.....L------------------------------
Q32KI0_CANFA/435-568SEHE....FLYH..YCGA.....-----------------...F.....L------------------------------
ARSE_HUMAN/448-582SDHE....FLMH..YCER.....-----------------...F.....L------------------------------
Q32KI1_CANFA/444-578SDHE....FLLH..YCEN.....-----------------...F.....L------------------------------
A5D7J7_BOVIN/445-576SDHE....FLMH..YCES.....-----------------...F.....L------------------------------
ARSH_HUMAN/418-551SDHE....FLFH..YCGV.....-----------------...Y.....L------------------------------
F1NFQ0_CHICK/445-579SEHK....FLFH..YCGT.....-----------------...H.....L------------------------------
D2HFI2_AILME/436-570SAHE....FLFH..YCGK.....-----------------...Y.....L------------------------------
ARSD_HUMAN/451-585SAHE....FLFH..YCGQ.....-----------------...H.....L------------------------------
C3Y4J9_BRAFL/389-521SPHE....FLFH..YCGT.....-----------------...W.....I------------------------------
C3Y4X6_BRAFL/434-568SPHD....FLFH..YCGN.....-----------------...I.....L------------------------------
C3YBU1_BRAFL/392-524SPHD....FLFH..YCDE.....-----------------...Y.....V------------------------------
C3ZST4_BRAFL/433-562SPHD....FLFH..YCAD.....-----------------...Y.....L------------------------------
C3Z258_BRAFL/432-564SPHE....FLFH..YCGG.....-----------------...H.....L------------------------------
C3YQ76_BRAFL/419-552TDHR....FLIH..YCGS.....-----------------...T.....I------------------------------
C3YZM0_BRAFL/417-549TEHE....FLIH..YCGQ.....-----------------...S.....L------------------------------

PF01663

Q7NDL2_GLOVI/4-434--------------MPFM---------KKI---------------F----------------------------------
Q9X5T4_STRLA/7-389--------------LPGF---------AAL---------------R----------------------------------
B0R301_HALS3/15-396--------------FPNL---------HDA---------------M----------------------------------
Q9X5S1_STRLA/5-395--------------MPHT---------AAL---------------L----------------------------------
Q9X5R9_STRLA/7-410--------------LPHM---------AKL---------------L----------------------------------
Q9YCS9_AERPE/3-432--------------MHNL---------AKL---------------M----------------------------------
Q9X5S9_STRLA/7-409--------------MPVF---------TAL---------------R----------------------------------
Q9UZH6_PYRAB/14-420--------------LPHI---------KKL---------------L----------------------------------
Q9YCR2_AERPE/4-405--------------IPNL---------QSL---------------L----------------------------------
V5Q348_ZYMMB/62-511--------------RSGM---------KQL---------------Q----------------------------------
C6IK84_9BACE/29-473--------------ERGF---------KRL---------------W----------------------------------
ALPH_SYNE7/42-494--------------NGGF---------KRL---------------I----------------------------------
ALPH_ELIME/32-489--------------EGGF---------KRM---------------L----------------------------------
CDA_MYROD/31-491--------------ENGF---------KRL---------------L----------------------------------
Q7MEK0_VIBVY/30-506--------------EKGF---------RYL---------------M----------------------------------
Q84EY0_9GAMM/27-481--------------NGGF---------NYL---------------L----------------------------------
O29992_ARCFU/4-416--------------LPFL---------EEI---------------S----------------------------------
Q981Q5_RHILO/5-379--------------LPNM---------RHL---------------A----------------------------------
Q98IY7_RHILO/32-447--------------KSSL---------AAL---------------A----------------------------------
Q7UKE3_RHOBA/4-350--------------APNL---------AAM---------------.----------------------------------
O69954_STRCO/13-378--------------MPHL---------KQL---------------G----------------------------------
Q8YZP2_NOSS1/4-370--------------TPFL---------SRW---------------S----------------------------------
Q7AYA7_9RHIZ/4-370--------------TPNL---------SRL---------------A----------------------------------
Q7NU73_CHRVO/4-375--------------TPRL---------AEF---------------A----------------------------------
D3MCQ1_PROAA/44-359--------------APTL---------SEM---------------K----------------------------------
F7PA94_MYCPC/42-363--------------APLL---------AAV---------------R----------------------------------
O50518_STRCO/58-383--------------APFL---------SSL---------------L----------------------------------
Q6N507_RHOPA/30-497--------------APAM---------AAL---------------R----------------------------------
Q7WNM8_BORBR/6-370--------------CPTL---------TGL---------------A----------------------------------
F0K5R6_CLOAE/8-378--------------LPNF---------SNI---------------I----------------------------------
Q8XKL9_CLOPE/10-374--------------LPNI---------SKL---------------M----------------------------------
C8K1F1_LISMN/5-366--------------LPVL---------REL---------------I----------------------------------
Q73E52_BACC1/9-380--------------LPHF---------QSL---------------I----------------------------------
O45359_CAEEL/26-353--------------LSVF---------RTF---------------E----------------------------------
Q22129_CAEEL/24-374--------------TFGI---------RHL---------------A----------------------------------
O58841_PYRHO/4-322--------------MPFL---------SEL---------------A----------------------------------
ENPP6_XENLA/26-357--------------LPGF---------RHM---------------V----------------------------------
ENPP6_MOUSE/26-357--------------LPGF---------REI---------------V----------------------------------
ENPP1_CAEEL/182-494--------------VQTL---------NHI---------------A----------------------------------
ENPP2_CAEEL/81-386--------------VKSL---------ELI---------------A----------------------------------
Q7MXP5_PORGI/37-349--------------TPAL---------DRM---------------A----------------------------------
ENPP7_HUMAN/33-356--------------TPNL---------DAM---------------A----------------------------------
Q6ZM30_DANRE/31-356--------------TPNL---------DKM---------------A----------------------------------
Q6CX45_KLULA/136-460--------------TPFL---------NQL---------------F----------------------------------
ENPP5_HUMAN/30-342--------------TPHF---------HYI---------------M----------------------------------
ENPP4_XENLA/30-339--------------MPNL---------QEF---------------M----------------------------------
K7BSV5_PANTR/28-339--------------FPHL---------QNF---------------I----------------------------------
Q6VZU9_CNPV/107-431--------------TPAI---------NEL---------------V----------------------------------
O90761_FOWPV/120-443--------------IPTI---------KDL---------------M----------------------------------
Q6PGY9_DANRE/161-472--------------IPNI---------EKL---------------R----------------------------------
ENPP2_RAT/165-477--------------MPNI---------EKL---------------R----------------------------------
Q7ZXN7_XENLA/166-476--------------MPNI---------DKL---------------R----------------------------------
ENPP3_MOUSE/161-485--------------LPNI---------NKL---------------K----------------------------------
ENPP1_RAT/194-520--------------LPVI---------SKL---------------K----------------------------------
Q9SU81_ARATH/60-394--------------TPNI---------DLL---------------I----------------------------------
Q9SU82_ARATH/57-390--------------TPNI---------DLL---------------I----------------------------------
Q42974_ORYSA/92-418--------------TPHI---------HRL---------------I----------------------------------
Q9FS13_SPIOL/96-418--------------TPNI---------HRL---------------I----------------------------------
Q9SU83_ARATH/109-435--------------LPSI---------HRL---------------I----------------------------------
M9N2F7_ASHG1/153-497--------------TPFI---------NEL---------------Y----------------------------------
Q6FKX1_CANGA/187-587--------------TPFI---------SAL---------------F----------------------------------
N1P7V5_YEASC/170-545--------------TPFL---------HDL---------------Y----------------------------------
M4TY79_9XANT/48-366--------------TPNL---------SHL---------------A----------------------------------
Q9PAB9_XYLFA/40-358--------------APQL---------ARL---------------A----------------------------------
H2VFP5_ZYMMO/50-367--------------TPNL---------VSL---------------A----------------------------------
Q9A8S4_CAUCR/74-393--------------TPVM---------KAL---------------A----------------------------------
Q7SI20_NEUCR/254-584--------------TPRL---------SSF---------------I----------------------------------
YGK5_SCHPO/76-404--------------TPNL---------LSL---------------A----------------------------------
Q6BTN4_DEBHA/173-514--------------TPTL---------HEM---------------M----------------------------------
Q6C6J4_YARLI/277-608--------------TPHL---------DNL---------------M----------------------------------

PF00884

C3LB12_BACAC/143-439--------.PN...LHRY.........TEN---------------F..--------------------------------
A0A038KMS4_MYCTX/43-460--------.R....TSTA.........ELL---------------A..--------------------------------
K4NNF3_HELPX/294-587--------.AL................QDL---------------VKK--------------------------------
A1IT97_NEIMA/232-524--------.QT...TPLLA...........---------------ARG--------------------------------
E8VE61_BACST/245-536--------.EV...TPFL.........NKL---------------AHD--------------------------------
O43113_NEUCS/45-420--------......LPLLK........KYL---------------A..--------------------------------
A0A038F731_MYCTX/212-635--------.R....TPTL.........SRL---------------A..--------------------------------
O82879_STRMG/460-745--------.PN...IKQI.........KEK---------------T..--------------------------------
O85099_ECOLX/237-530--------.ET...TPELD........ALR---------------KTD--------------------------------
A0A017IKP4_ECOLX/260-505--------......MPAL.........AGF---------------A..--------------------------------
ARS_HEMPU/52-373--------.QE...AGFI.........DKM---------------A..--------------------------------
ARS_CHLRE/27-385--------.HY...MPSLH........KYI---------------R..--------------------------------
ARSA_HUMAN/21-346--------.ST...TPNL.........DQL---------------A..--------------------------------
A0A017J6J3_ECOLX/86-419--------.AVGNPTPDI.........DAV---------------A..--------------------------------
A0A017J597_ECOLX/236-527--------.ET...NPRLA...........---------------K..--------------------------------
A0A017HZX0_ECOLX/4-341--------.LN...TQNI.........DSL---------------A..--------------------------------
ARSB_FELCA/47-366--------.R....TPHL.........DEL---------------A..--------------------------------
GALNS_HUMAN/31-355--------.RE...TPNL.........DRM---------------A..--------------------------------
A0A017I1Q5_ECOLX/248-538--------.NT...TPKLA...........---------------.QE--------------------------------
C9MG45_HAEIF/211-475--------.KT...TPFLE...........---------------..R--------------------------------
GNS_CAPHI/54-391--------......TPLKK........TKA---------------LIG--------------------------------
STS_MOUSE/35-421--------.LR...TPHL.........DRL---------------A..--------------------------------
ARS_STRPU/67-388--------.QE...PGFI.........DQM---------------A..--------------------------------
SPHM_HUMAN/23-328--------.IA...TPHL.........DAL---------------A..--------------------------------
A0A022NJX0_PSEAI/5-420--------.A....TPNL.........DAL---------------A..--------------------------------
E8H705_ECO57/223-491--------.ST...TPQVE...........---------------AQR--------------------------------
F6BMG6_SINMB/269-561--------.PT...IREL............---------------...--------------------------------
A0A017IT13_ECOLX/217-483--------.DN...TPFAS...........---------------..S--------------------------------
A0A024LN14_ECOLX/58-408--------EAAQKSTPTL.........LSL---------------M..--------------------------------
A0A038FFI8_MYCTX/37-466--------.E....MPAM.........TRV---------------A..--------------------------------
A0A038VAH2_MYCTX/5-389--------.RS......LT........GRR---------------WFD--------------------------------
Q0Z8S6_VOLCA/26-386--------.RY...QPKLH........EHI---------------R..--------------------------------
Q45087_9BURK/4-384--------.FL..KTPNL.........DRL---------------C..--------------------------------
A0A059MXH6_ENTFL/256-543--------.AD...YQQI.........ADK---------------T..--------------------------------
Q840W2_STRMG/270-555--------.PN...IRQI.........GRT---------------T..--------------------------------
M2E9Z0_STRMG/503-788--------.PN...IKQI.........KEK---------------T..--------------------------------
Q8G592_BIFLO/306-604--------.PN...IRKI.........KAG---------------T..--------------------------------
A0A029SCQ9_STRPY/480-765--------.PN...IKAI.........KNS---------------T..--------------------------------
Q8P1I3_STRP8/480-765--------.PN...IKAI.........KNS---------------T..--------------------------------
Q8XK47_CLOPE/257-551--------.PT...FRKI.........SSE---------------S..--------------------------------
Q984T6_RHILO/281-574--------.PT...VRAL............---------------...--------------------------------
Q98EG2_RHILO/158-441--------.VM...APLLEFDRRGVSASNM---------------V..--------------------------------
Q9A0F9_STRP1/480-765--------.PN...IKAI.........KNS---------------T..--------------------------------
Q9AI31_BURML/214-497--------.GH...FDRVC........RES---------------V..--------------------------------
H8ID57_PASMH/287-557--------.L....SPEF.........DKL---------------A..--------------------------------
Q9CM05_PASMU/231-523--------.QT...TPLLA...........---------------NRG--------------------------------
A0A030RTZ7_PSEAI/238-530--------.ET...TPQLD........ALK---------------AAN--------------------------------
A0A022NH93_PSEAI/238-529--------.ET...NPELS...........---------------K..--------------------------------
A0A030XY34_PSEAI/231-522--------.ET...NPRLK...........---------------AE.--------------------------------
A0A030YI64_PSEAI/223-501--------.HEA.PMPRL.........SGW---------------A..--------------------------------
F0ADR9_NEIME/214-487--------.ET...SPFLT.........RL---------------SQA--------------------------------
A0A016X8V3_VIBCL/240-530--------.DT...NAYTA...........---------------P..--------------------------------
Q9PGC7_XYLFA/245-535--------.QT...TPQLA...........---------------Q..--------------------------------
Q9RBI1_ACIAD/237-531--------.QT...TPALS...........---------------K..--------------------------------
Q9RMJ0_NEIME/232-495--------.PD...TPFLS...........---------------..Q--------------------------------
Q9X6R2_PSEAI/20-300--------.NI...TPYF.........DKL---------------S..--------------------------------
D5AWR1_RICPP/218-505--------.NT...TPYLK...........---------------.TA--------------------------------
Q9ZJJ5_HELPJ/225-518--------.PN...NPLSSELA..NERERE---------------RES--------------------------------
Q9ZN39_HELPJ/222-504--------.PT...TPRLS.........KR---------------LEN--------------------------------

PF02995

Q19148_CAEEL/61-607ATMDS...EGYIYVHPHFVDWPRLERDVQC---------------KVDIIEGGLRKPERNMTKNSMFIKKTLEIPSNERL
O18062_CAEEL/67-538GIGGS...KNVKIGPWMKPG..........---------------HVD................................
Q9VSJ3_DROME/115-607RVD........EMKVKYTKC.QTFKGSILL---------------PDS................................
Q21671_CAEEL/74-651RKRDK...ENLVGNWTYTPG..........---------------KIN................................
Q9VGG4_DROME/77-573RFNDF...VNIYFESTLFRF.SKLRNFTKV---------------DSG................................
Q9VQH3_DROME/74-555RVDDA...HNKYISLKFFKL.TDRTRYLEV---------------GTG................................
Q9VAU4_DROME/90-580RDR......KHDSYDKMER..KYFSQNYEV---------------PLH................................
Q9VKK3_DROME/98-598RKTDS...SNTHSPAVSFK....LDKVMKL---------------PLS................................
Q19486_CAEEL/79-568RHDEN...VTDLDVIYEKPVPLNLTHTSSI---------------KIS................................
Q9V9Q1_DROME/66-560RHTDF...DNRYLYSREFEL..LTDGNNTI---------------EPH................................
Q9VF91_DROME/73-581RKSDY...KVRFGQSLRMKEPYVLQASDFV---------------KVV................................
Q9VLG3_DROME/84-577YGK......IADTYDNLKAK.KYFTSGYEV---------------PVH................................
Q9V9P7_DROME/68-547HTRNH...SGHYTAYGHFDLKRGATRKIKI---------------GTG................................
O62436_CAEEL/78-581RAKAK...CKIQYFSRVDDNNNKYEEPVEV---------------LDGDR..............................
Q9W0F7_DROME/16-518RNKKDSFPDNHFSFSKLQP....LSQSFLV---------------PKT................................
Q8SY05_DROME/180-657RAGTS...ANADHKYKLGPC.VEFHQDFLV---------------PTE................................
Q9VIP6_DROME/56-555RDNSD...QKPDNAYNQLRR.RPIEQHQFV---------------PNN................................

PF01676

APGM2_ARCFU/1-380-.............TENM---------DFL...............A----------------------------------
DEOB_GEOSE/6-381-..........GLNMPNM---------AKLGLSNIR...EIEGIPK----------------------------------
E8VA73_BACST/4-499-.............KPNF---------DRY...............W----------------------------------
APGM_AQUAE/13-398-.............TPNL---------DKL...............V----------------------------------
A0A017I0E2_ECOLX/6-501-.............TPVM---------DAL...............W----------------------------------
I0ZIS4_HELPX/3-399-NLADSNDRSGALKLPYL---------ESLGLGL......SALKAA----------------------------------
PMGI_MESCR/20-545-.............TPTM---------DSL...............K----------------------------------
GPMI_PORPU/7-507-.............TPTI---------DSL...............L----------------------------------
F7URM6_SYNYG/7-504-.............TPIM---------DSL...............I----------------------------------
APGM_PYRHO/5-403-.............TPNM---------DKL...............A----------------------------------
PMGI_MAIZE/20-545-.............TPVM---------DSL...............K----------------------------------
PMGI_RICCO/17-542-.............TPTM---------DSF...............K----------------------------------
G4EU83_BACIU/7-382-..........GLHMPNM---------AKLGLGLIE...DIKGVEK----------------------------------
APGM1_ARCFU/1-399-.............KPNL---------DRL...............A----------------------------------
APGM1_METJA/4-402-.............TPTM---------DKI...............A----------------------------------
D8KJJ3_LACLN/6-399-..........GLDVPNL---------QKLGWGNIPRESPLKTIPA----------------------------------
B1X727_ECODH/2-390-..........HLQLPTL---------ETLGL..........INAL----------------------------------
GPMI_PSESM/6-497-.............MPVM---------DRL...............Y----------------------------------
GPMI_ANTSP/7-499-.............TPII---------DKL...............W----------------------------------
I0ZG59_HELPX/3-482-.............KPTY---------DLM...............F----------------------------------
PMGI_TOBAC/20-545-.............TPVM---------YSL...............K----------------------------------
M7ZXD7_TRIUA/25-880-.............TPTL---------DAL...............K----------------------------------
A0A009END8_ECOLX/2-399-GEAD.NGRKGPLNLPNL---------TRLGLAK......AHEGST----------------------------------
APGM2_METTH/4-396-.............KPNM---------DQL...............A----------------------------------
GPMI_MYCGE/3-493-.............TPML---------DEL...............I----------------------------------
M1GCD6_MYCPM/3-494-.............TPAL---------DSL...............I----------------------------------
GPMI_HELPY/3-482-.............KPTY---------DLM...............F----------------------------------
APGM1_METTH/1-400-.............TPNM---------DRI...............A----------------------------------
APGM2_METJA/1-398-.............TPNL---------DRL...............A----------------------------------

PF00245

PPB_BOMMO/74-515---------TGEEASLHF---------EQF---------------P----------------------------------
PPBT_BOVIN/51-490---------PGEETKLEM---------DKF---------------P----------------------------------
PPBI_MOUSE/52-486---------LGPETPLAM---------DRF---------------P----------------------------------
PPBN_MOUSE/51-486---------LGPETQLAM---------DRF---------------P----------------------------------
PPB1_HUMAN/55-490---------LGPEIPLAM---------DRF---------------P----------------------------------
B1W385_STRGG/41-448---------......LAM---------DTL---------------D----------------------------------
A0A017K3Y5_ECOLX/64-470---------F.....KGI---------DAL---------------P----------------------------------
A0A023ZB72_YEASX/66-527---------PIDDILTLD---------EHF---------------.----------------------------------
J7JQ01_BACIU/49-459---------PNNPKLTEF---------DR.---------------N----------------------------------
G4EZI5_BACIU/43-455---------V..VEPTAF---------DQY---------------.----------------------------------

PF08665

Q2RKS0_MOOTA/260-429--------------LAGR---------GID--------------------------------------------------
Q72AH5_DESVH/438-616--------------IRQE---------DRY--------------------------------------------------
Q8TNC5_METAC/496-671--------------LNKD---------TWG--------------------------------------------------
Q3A8U0_CARHZ/461-637--------------LNTE---------RRG--------------------------------------------------
B1YIB9_EXIS2/462-638--------------LNFE---------TTG--------------------------------------------------
Q5P0R1_AROAE/485-661--------------LNSK---------SRF--------------------------------------------------
Q2W5M5_MAGSA/475-648--------------LNGT---------YRI--------------------------------------------------
Q8ZK15_SALTY/474-650--------------INTE---------KRF--------------------------------------------------
Q7MVV4_PORGI/231-425--------------LSEF---------YTF--------------------------------------------------
A5EWI8_DICNV/401-578--------------LQKQ---------DA.--------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480SP...F..........KT---------RKV---------------G----------------------------------
Q7UHL2_RHOBA/84-501PI...R..........RF---------RPR---------------G----------------------------------
Q7UN58_RHOBA/63-468SP...W..........KW---------SQH---------------G----------------------------------
Q98BS1_RHILO/39-404..................---------...---------------.----------------------------------
Q7UHK7_RHOBA/71-478SP...F..........SF---------KQY---------------G----------------------------------
Q7UKW9_RHOBA/100-522AASK.F..........KF---------AQH---------------G----------------------------------
Q8P3X8_XANCP/29-384..................---------...---------------.----------------------------------
Q7UZ35_RHOBA/49-467SF...C..........KF---------KKW---------------G----------------------------------
Q7UFP1_RHOBA/49-464MGPQ.H..........AF---------AKH---------------G----------------------------------
Q7MLK9_VIBVY/33-420..................---------...---------------P----------------------------------
Q7US09_RHOBA/66-482TQ...R..........KW---------AQH---------------G----------------------------------
Q7VYL6_BORPE/29-381..................---------...---------------.----------------------------------
Q7UDW2_RHOBA/77-502Q....Y..........DF---------QQH---------------G----------------------------------
Q87HJ3_VIBPA/35-425..................---------...---------------G----------------------------------
Q7UM62_RHOBA/63-489Q....F..........PF---------AQH---------------G----------------------------------
Q7UJ64_RHOBA/59-474SP...F..........SF---------SRH---------------G----------------------------------
Q7UIF5_RHOBA/61-494DPNNGFIRNEIYPLQVGF---------APR---------------G----------------------------------
Q7UYJ8_RHOBA/60-484SP...W..........AF---------KPR---------------G----------------------------------
Q7MCK0_VIBVY/38-408................YY---------QAR---------------Q----------------------------------
Q9A5N3_CAUCR/44-506VNAVSKRTVSATNFPEYW---------GGV---------------L----------------------------------
Q7ULC1_RHOBA/52-445................QP---------IAT---------------Q----------------------------------
Q7UQT8_RHOBA/50-438................NP---------IST---------------N----------------------------------
Q7UQ29_RHOBA/54-472SP...Y..........KW---------DKY---------------G----------------------------------
Q7UGB9_RHOBA/69-492PTDQAF..........QF---------QRC---------------G----------------------------------
Q7UPP6_RHOBA/56-434................KP---------IST---------------R----------------------------------
Q7UI66_RHOBA/46-421................FR---------PIS---------------T----------------------------------
Q7UVE3_RHOBA/81-505PAIT............KF---------HRH---------------G----------------------------------
Q7UW70_RHOBA/70-497................NP---------IST---------------K----------------------------------
Q7UKM6_RHOBA/69-495VKPL.W..........GG---------KRC---------------G----------------------------------
Q7UTL9_RHOBA/100-490................KS---------IDT---------------A----------------------------------
Q7UGF5_RHOBA/94-499................FK---------TIA---------------T----------------------------------
Q9A6V4_CAUCR/38-393..................---------...---------------.----------------------------------
Q7UYC8_RHOBA/101-527PSR..F..........GF---------SQQ---------------G----------------------------------
Q7UR29_RHOBA/60-444................LG---------TIK---------------T----------------------------------
Q7UYM7_RHOBA/45-446................KE---------VQT---------------S----------------------------------
Q7UV65_RHOBA/50-468SP...W..........KF---------KQY---------------G----------------------------------
Q7UJ54_RHOBA/70-497PSM..F..........EF---------SRH---------------G----------------------------------
Q7UJ36_RHOBA/99-512K....F..........KF---------EKK---------------G----------------------------------
Q7NT93_CHRVO/33-383..................---------...---------------.----------------------------------
Q7UEK9_RHOBA/80-501PL...W..........KF---------QPR---------------G----------------------------------
Q7UQW1_RHOBA/70-487SP...W..........KF---------KQH---------------G----------------------------------
Q7UPF7_RHOBA/65-448................GD---------VAT---------------T----------------------------------
Q7UYR5_RHOBA/95-521APSI.Y..........KF---------SPH---------------G----------------------------------
Q7UWA1_RHOBA/72-492PR...W..........DF---------APH---------------G----------------------------------
Q89DL5_BRADU/42-392..................---------...---------------.----------------------------------
Q7URV7_RHOBA/77-499PF...W..........DF---------KPR---------------G----------------------------------
Q7MDY0_VIBVY/67-457..................---------...---------------G----------------------------------
Q7UH70_RHOBA/75-488.....F..........KF---------QKH---------------G----------------------------------
Q7UVE1_RHOBA/82-507Q....Y..........PF---------EQH---------------G----------------------------------
Q7UQ53_RHOBA/45-480SP...F..........RF---------SPY---------------G----------------------------------
Q7UP10_RHOBA/69-492VGSP.F..........EF---------KQH---------------G----------------------------------

PF04185

Q47936_FRANO/55-471.....LTKQLLENNPNT..........KNP--------------------------------------------------
PHOX_KLULA/65-312..............................--------------------------------------------------
Q98ES1_RHILO/58-274..............................--------------------------------------------------
A0A038F821_MYCTX/50-282..............................--------------------------------------------------
D0KPN6_SULS9/27-365.....LYENYTQLQGAKNGVLYWISVPDIP--------------------------------------------------
NPC6_ARATH/59-394...........................NPV--------------------------------------------------
NPC5_ARATH/13-380.....VMKSDQKFNPGFS.........SDL--------------------------------------------------
NPC3_ARATH/16-381.....VSESEPRSNPLST.........SDP--------------------------------------------------
NPC1_ARATH/38-396.....LTGKE..SNPLNV.........SDP--------------------------------------------------
NPC2_ARATH/27-389.....VDGSE..SNPVSV.........SDP--------------------------------------------------
Q9KH04_BURML/84-547WGGLVPQAQVVDGKRYMIGEHDIVGLPNAP--------------------------------------------------
Q983N8_RHILO/60-507WDGLTAKGVTPPVTQAMT.....EHLPNAP--------------------------------------------------
E2TNP6_MYCTX/52-433WN...PETQA..LDPTGI.........TLP--------------------------------------------------
A1KJH2_MYCBP/50-429WN...PMTQA..LDATGV.........TMP--------------------------------------------------
A4KJA2_MYCTX/52-435WN...PMTQA..VDPAGV.........TLP--------------------------------------------------
A5WPW5_MYCTF/51-431WN...PMTQA..LDPAGV.........TIP--------------------------------------------------
A0A030U552_PSEAI/51-437KP...VWYQN...YKYEF.........S.P--------------------------------------------------
A3NXI4_BURP0/47-438KS...VFHQPVLLGPAEL.........L.P--------------------------------------------------
B8H354_CAUCN/40-437RKESSVFVQA..WSKDKL.........LAP--------------------------------------------------
A0A022NDQ0_PSEAI/48-422QR...VWHQK..GSKGEI.........L.P--------------------------------------------------

PF16347

G2PRM5_MURRD/414-516--------------------------------------------------------------------------------
G7USR5_PSEUP/397-499--------------------------------------------------------------------------------
D5BJX1_ZUNPS/413-515--------------------------------------------------------------------------------
G0J719_CYCMS/407-508--------------------------------------------------------------------------------
D2R402_PIRSD/397-498--------------------------------------------------------------------------------
G8NQI2_GRAMM/379-480--------------------------------------------------------------------------------
D2QMZ8_SPILD/410-511--------------------------------------------------------------------------------
A4AWR6_MARSH/414-516--------------------------------------------------------------------------------
A6LDP5_PARD8/412-514--------------------------------------------------------------------------------
A4CJM0_ROBBH/381-483--------------------------------------------------------------------------------
A2TWV5_9FLAO/422-523--------------------------------------------------------------------------------
G8UMU5_TANFA/417-519--------------------------------------------------------------------------------
D5BJT8_ZUNPS/386-488--------------------------------------------------------------------------------
F9YSE0_CAPCC/401-501--------------------------------------------------------------------------------
D3IBE7_9BACT/417-519--------------------------------------------------------------------------------
C7M893_CAPOD/396-496--------------------------------------------------------------------------------
G0J436_CYCMS/421-522--------------------------------------------------------------------------------
A3HWF8_9BACT/418-520--------------------------------------------------------------------------------
E8V2R6_TERSS/392-493--------------------------------------------------------------------------------
G8TRD3_NIAKG/412-512--------------------------------------------------------------------------------
H8KTX9_SOLCM/409-510--------------------------------------------------------------------------------
F4L7F1_HALH1/402-503--------------------------------------------------------------------------------
F3ZRQ1_9BACE/413-515--------------------------------------------------------------------------------
E6SVH3_BACT6/418-520--------------------------------------------------------------------------------
D2QEZ9_SPILD/447-548--------------------------------------------------------------------------------
G0IUX7_CYCMS/423-524--------------------------------------------------------------------------------
G0L151_ZOBGA/413-515--------------------------------------------------------------------------------
A6KZU2_BACV8/416-518--------------------------------------------------------------------------------
A6L8Y1_PARD8/413-515--------------------------------------------------------------------------------
I3YHK1_ALIFI/406-508--------------------------------------------------------------------------------
Q5LAU2_BACFN/415-517--------------------------------------------------------------------------------
R5M554_9BACE/414-516--------------------------------------------------------------------------------
R5UAM5_9BACE/410-512--------------------------------------------------------------------------------
R7DGX3_9PORP/412-514--------------------------------------------------------------------------------
W0EZJ7_9SPHI/397-497--------------------------------------------------------------------------------

PF14707

A9VBN0_MONBE/428-544--------------------------------------------------------------------------------
E6ZGQ8_DICLA/413-534--------------------------------------------------------------------------------
Q4S4L1_TETNG/407-528--------------------------------------------------------------------------------
E1BU03_CHICK/390-510--------------------------------------------------------------------------------
ARSG_MOUSE/402-522--------------------------------------------------------------------------------
A6QLR7_BOVIN/402-522--------------------------------------------------------------------------------
ARSG_CANFA/402-522--------------------------------------------------------------------------------
B4DQ74_HUMAN/301-421--------------------------------------------------------------------------------
A9V957_MONBE/437-571--------------------------------------------------------------------------------
F0Y2N2_AURAN/404-544--------------------------------------------------------------------------------
Q1YP24_9GAMM/409-501--------------------------------------------------------------------------------
C6W2Y6_DYAFD/349-461--------------------------------------------------------------------------------
D7VQY4_9SPHI/353-442--------------------------------------------------------------------------------
F2UD41_SALR5/491-612--------------------------------------------------------------------------------
A9UXW0_MONBE/287-431--------------------------------------------------------------------------------
F2UKF0_SALR5/383-527--------------------------------------------------------------------------------
B9QU81_9RHOB/44-158--------------------------------------------------------------------------------
E4YGB6_OIKDI/449-582--------------------------------------------------------------------------------
F2U742_SALR5/410-535--------------------------------------------------------------------------------
A9UPM8_MONBE/326-451--------------------------------------------------------------------------------
A8XD87_CAEBR/394-528--------------------------------------------------------------------------------
E1FX25_LOALO/406-541--------------------------------------------------------------------------------
F1KQC6_ASCSU/1702-1837--------------------------------------------------------------------------------
F2UCT8_SALR5/90-221--------------------------------------------------------------------------------
A9V7E7_MONBE/452-571--------------------------------------------------------------------------------
C1BQY6_9MAXI/368-496--------------------------------------------------------------------------------
Q4RJR3_TETNG/343-473--------------------------------------------------------------------------------
Q6AX40_XENLA/368-499--------------------------------------------------------------------------------
A1L2N0_XENLA/374-505--------------------------------------------------------------------------------
F1NWF7_CHICK/373-504--------------------------------------------------------------------------------
Q32KK2_RAT/368-501--------------------------------------------------------------------------------
ARSA_BOVIN/368-501--------------------------------------------------------------------------------
ARSA_HUMAN/368-501--------------------------------------------------------------------------------
E4XNY3_OIKDI/402-532--------------------------------------------------------------------------------
C3ZV84_BRAFL/657-789--------------------------------------------------------------------------------
Q4SI19_TETNG/405-541--------------------------------------------------------------------------------
F1QFT2_DANRE/220-352--------------------------------------------------------------------------------
Q5XG10_XENLA/375-507--------------------------------------------------------------------------------
GALNS_CANFA/377-509--------------------------------------------------------------------------------
F1NW57_CHICK/376-508--------------------------------------------------------------------------------
A0YAF7_9GAMM/381-478--------------------------------------------------------------------------------
Q0C069_HYPNA/397-504--------------------------------------------------------------------------------
ARS_STRPU/411-541--------------------------------------------------------------------------------
ARS_HEMPU/396-526--------------------------------------------------------------------------------
O16138_HELER/402-534--------------------------------------------------------------------------------
A4AN36_MARSH/378-468--------------------------------------------------------------------------------
A4CMB0_ROBBH/401-491--------------------------------------------------------------------------------
A3XMW9_LEEBM/382-476--------------------------------------------------------------------------------
A7V8P9_BACUN/356-447--------------------------------------------------------------------------------
A6CB11_9PLAN/382-473--------------------------------------------------------------------------------
F0SFZ7_PLABD/380-468--------------------------------------------------------------------------------
C3ZQB5_BRAFL/423-551--------------------------------------------------------------------------------
C3ZQC1_BRAFL/344-471--------------------------------------------------------------------------------
A7SK49_NEMVE/435-563--------------------------------------------------------------------------------
A7SQ82_NEMVE/425-557--------------------------------------------------------------------------------
A7SK50_NEMVE/483-612--------------------------------------------------------------------------------
Q7ZWB8_DANRE/433-548--------------------------------------------------------------------------------
Q6DJK3_XENLA/433-566--------------------------------------------------------------------------------
Q32KK0_RAT/450-603--------------------------------------------------------------------------------
F1QB82_DANRE/433-568--------------------------------------------------------------------------------
Q4RYA1_TETNG/304-429--------------------------------------------------------------------------------
STS_MOUSE/445-581--------------------------------------------------------------------------------
STS_RAT/436-573--------------------------------------------------------------------------------
STS_HUMAN/437-572--------------------------------------------------------------------------------
D2HXW7_AILME/434-569--------------------------------------------------------------------------------
Q4TCJ7_TETNG/242-385--------------------------------------------------------------------------------
Q6GMA1_XENLA/439-573--------------------------------------------------------------------------------
ARSF_HUMAN/440-574--------------------------------------------------------------------------------
Q32KI0_CANFA/435-568--------------------------------------------------------------------------------
ARSE_HUMAN/448-582--------------------------------------------------------------------------------
Q32KI1_CANFA/444-578--------------------------------------------------------------------------------
A5D7J7_BOVIN/445-576--------------------------------------------------------------------------------
ARSH_HUMAN/418-551--------------------------------------------------------------------------------
F1NFQ0_CHICK/445-579--------------------------------------------------------------------------------
D2HFI2_AILME/436-570--------------------------------------------------------------------------------
ARSD_HUMAN/451-585--------------------------------------------------------------------------------
C3Y4J9_BRAFL/389-521--------------------------------------------------------------------------------
C3Y4X6_BRAFL/434-568--------------------------------------------------------------------------------
C3YBU1_BRAFL/392-524--------------------------------------------------------------------------------
C3ZST4_BRAFL/433-562--------------------------------------------------------------------------------
C3Z258_BRAFL/432-564--------------------------------------------------------------------------------
C3YQ76_BRAFL/419-552--------------------------------------------------------------------------------
C3YZM0_BRAFL/417-549--------------------------------------------------------------------------------

PF01663

Q7NDL2_GLOVI/4-434---E.........QGSRSK..L---------------------------------------------------L-STP--
Q9X5T4_STRLA/7-389---S.........QGASGP..L---------------------------------------------------H-AEG--
B0R301_HALS3/15-396---A.........AGSGGA..I---------------------------------------------------E-SIV--
Q9X5S1_STRLA/5-395---A.........EGHCAE..L---------------------------------------------------L-APV--
Q9X5R9_STRLA/7-410---R.........ESASAA..T---------------------------------------------------D-CTW--
Q9YCS9_AERPE/3-432---K.........QCSWGI..L---------------------------------------------------R-STI--
Q9X5S9_STRLA/7-409---R.........KSLWGP..M---------------------------------------------------R-SID--
Q9UZH6_PYRAB/14-420---K.........KSVYGP..M---------------------------------------------------K-TGI--
Q9YCR2_AERPE/4-405---N...........VKGK..L---------------------------------------------------L-SGH--
V5Q348_ZYMMB/62-511---N..........GVVYPMAY---------------------------------------------------H-SHA--
C6IK84_9BACE/29-473---K.........EGRVFHNAE---------------------------------------------------Y-TFS--
ALPH_SYNE7/42-494---N.........EGFSAENTL---------------------------------------------------I-PYT--
ALPH_ELIME/32-489---N.........TGYSLNNVH---------------------------------------------------I-DYV--
CDA_MYROD/31-491---N.........EGFSSENTL---------------------------------------------------I-DYV--
Q7MEK0_VIBVY/30-506---D.........EGVYYTNAH---------------------------------------------------Y-QHG--
Q84EY0_9GAMM/27-481---S.........HAIDYHNTH---------------------------------------------------H-PHA--
O29992_ARCFU/4-416---K.........ESLLIDE.C---------------------------------------------------I-SVF--
Q981Q5_RHILO/5-379---E.........RGLRVRR.L---------------------------------------------------K-SAV--
Q98IY7_RHILO/32-447---D.........TGIFYPN.A---------------------------------------------------L-ASA--
Q7UKE3_RHOBA/4-350---...........GNHRA..W---------------------------------------------------T-SPV--
O69954_STRCO/13-378---Q.........SGSRAP..L---------------------------------------------------G-TVL--
Q8YZP2_NOSS1/4-370---S.........TGKIAT..V---------------------------------------------------T-PVL--
Q7AYA7_9RHIZ/4-370---A.........NGCQRP..L---------------------------------------------------R-TVT--
Q7NU73_CHRVO/4-375---R.........QGFVQP..L---------------------------------------------------R-NIV--
D3MCQ1_PROAA/44-359---N.........CHD.....L---------------------------------------------------T-CYV--
F7PA94_MYCPC/42-363---A.........GEVGRLTRL---------------------------------------------------D-CTF--
O50518_STRCO/58-383---GSSR......GGTGRP..I---------------------------------------------------T-AGY--
Q6N507_RHOPA/30-497---D.........QGVNFKN.P---------------------------------------------------H-SLF--
Q7WNM8_BORBR/6-370---Q.........ASTWFSR.A---------------------------------------------------G-SVF--
F0K5R6_CLOAE/8-378---N.........NGSYVRE.V---------------------------------------------------T-GVY--
Q8XKL9_CLOPE/10-374---K.........EGSLIKN.V---------------------------------------------------E-TIY--
C8K1F1_LISMN/5-366---K.........TGTHIQE.V---------------------------------------------------E-TIY--
Q73E52_BACC1/9-380---K.........KGTVVEK.V---------------------------------------------------E-PIY--
O45359_CAEEL/26-353---E.........EGVWSTK.V---------------------------------------------------F-PVF--
Q22129_CAEEL/24-374---T.........NGVQVDY.V---------------------------------------------------T-PSF--
O58841_PYRHO/4-322---E.........KGDIFT..V---------------------------------------------------D-SIF--
ENPP6_XENLA/26-357---E.........RGVKVDY.M---------------------------------------------------T-PAF--
ENPP6_MOUSE/26-357---N.........RGVKVDY.L---------------------------------------------------T-PDF--
ENPP1_CAEEL/182-494---D.........CGVKADK.V---------------------------------------------------Y-PSY--
ENPP2_CAEEL/81-386---E.........CGVKADR.V---------------------------------------------------Y-PSF--
Q7MXP5_PORGI/37-349---Q.........EGLSGS..L---------------------------------------------------Q-PCF--
ENPP7_HUMAN/33-356---R.........DGVKARY.M---------------------------------------------------T-PAF--
Q6ZM30_DANRE/31-356---V.........DGVKAAY.V---------------------------------------------------T-PPF--
Q6CX45_KLULA/136-460---TPSNQIN...DTLVAPY.M---------------------------------------------------I-PSF--
ENPP5_HUMAN/30-342---K.........YGVHVKQ.V---------------------------------------------------T-NVF--
ENPP4_XENLA/30-339---K.........EGVEVEE.V---------------------------------------------------K-NVF--
K7BSV5_PANTR/28-339---K.........EGVLVEH.V---------------------------------------------------K-NVF--
Q6VZU9_CNPV/107-431---L.........HGVSAP..M---------------------------------------------------R-PVF--
O90761_FOWPV/120-443---E.........HGVTAP..M---------------------------------------------------R-PVY--
Q6PGY9_DANRE/161-472---S.........CGTHAPY.M---------------------------------------------------R-PMY--
ENPP2_RAT/165-477---S.........CGTHAPY.M---------------------------------------------------R-PVY--
Q7ZXN7_XENLA/166-476---S.........CGTHSPY.M---------------------------------------------------R-PVY--
ENPP3_MOUSE/161-485---T.........CGIHSKY.M---------------------------------------------------R-AMY--
ENPP1_RAT/194-520---N.........CGTYTKN.M---------------------------------------------------R-PVY--
Q9SU81_ARATH/60-394---S.........GGTEAKHGL---------------------------------------------------I-PVF--
Q9SU82_ARATH/57-390---S.........RGTEAKTGL---------------------------------------------------I-PVF--
Q42974_ORYSA/92-418---G.........NGTSAATGL---------------------------------------------------V-PIF--
Q9FS13_SPIOL/96-418---N.........NGTSAELGL---------------------------------------------------I-PVF--
Q9SU83_ARATH/109-435---A.........NGTEAETGL---------------------------------------------------I-PVF--
M9N2F7_ASHG1/153-497---SGTYAK....SGVLTTPYM---------------------------------------------------R-PSF--
Q6FKX1_CANGA/187-587---KREHNEILKQNITTSPY.M---------------------------------------------------R-PQF--
N1P7V5_YEASC/170-545---ELKYDGGM..NITSTPF.M---------------------------------------------------V-PSF--
M4TY79_9XANT/48-366---R.........EGVRARW.M---------------------------------------------------A-PSY--
Q9PAB9_XYLFA/40-358---S.........DGVHALW.M---------------------------------------------------T-PSY--
H2VFP5_ZYMMO/50-367---E.........NGSYAKV.M---------------------------------------------------H-PSF--
Q9A8S4_CAUCR/74-393---E.........NGARAA..M---------------------------------------------------R-PSF--
Q7SI20_NEUCR/254-584---K.........EGVSPLY.M---------------------------------------------------L-PSF--
YGK5_SCHPO/76-404---E.........RNVHVPF.L---------------------------------------------------I-PSF--
Q6BTN4_DEBHA/173-514---L.........NDYGAPY.M---------------------------------------------------I-PSF--
Q6C6J4_YARLI/277-608---R.........KESGAPY.M---------------------------------------------------L-PSF--

PF00884

C3LB12_BACAC/143-439---P---------GGQTIAPTF---------------------------------------------------.-.GG--
A0A038KMS4_MYCTX/43-460---G---------NGLRYNRFH---------------------------------------------------.-.TT--
K4NNF3_HELPX/294-587---E---------HAHMLSAFI---------------------------------------------------.-.ES--
A1IT97_NEIMA/232-524---D---------EIVNFPQVR---------------------------------------------------.-.SC--
E8VE61_BACST/245-536---N---------ETFYFDNFF---------------------------------------------------H-QTG--
O43113_NEUCS/45-420---D---------EGTTYKRHY---------------------------------------------------.-.CT--
A0A038F731_MYCTX/212-635---Q---------NGLIYNRFH---------------------------------------------------.-.VT--
O82879_STRMG/460-745---T---------SGLMHSDGY---------------------------------------------------.-.GG--
O85099_ECOLX/237-530---P---------GLTVFNNVV---------------------------------------------------.-.AS--
A0A017IKP4_ECOLX/260-505---E---------QNISFTRHM---------------------------------------------------.-.SS--
ARS_HEMPU/52-373---A---------EGLRFTNGY---------------------------------------------------.-.VG--
ARS_CHLRE/27-385---Y---------PGVELSQYF---------------------------------------------------.-.VT--
ARSA_HUMAN/21-346---A---------GGLRFTDFY---------------------------------------------------.-.VP--
A0A017J6J3_ECOLX/86-419---S---------QGLILTSAY---------------------------------------------------.-..S--
A0A017J597_ECOLX/236-527---D---------NVVYFPNTA---------------------------------------------------.-.SC--
A0A017HZX0_ECOLX/4-341---A---------EGIRFNSAY---------------------------------------------------.-.TC--
ARSB_FELCA/47-366---A---------GGVLLDNYY---------------------------------------------------.-..T--
GALNS_HUMAN/31-355---A---------EGLLFPNFY---------------------------------------------------.-.SA--
A0A017I1Q5_ECOLX/248-538---K---------NLAAFRGY.---------------------------------------------------.-.SC--
C9MG45_HAEIF/211-475---V---------KGTVFENYY---------------------------------------------------.-.SA--
GNS_CAPHI/54-391---E---------MGMTFSSAY---------------------------------------------------.-.VP--
STS_MOUSE/35-421---R---------EGVKLTQHL---------------------------------------------------.-.AA--
ARS_STRPU/67-388---N---------QGLRFTQGY---------------------------------------------------.-.SG--
SPHM_HUMAN/23-328---R---------RSLLFRNAF---------------------------------------------------.-.TS--
A0A022NJX0_PSEAI/5-420---I---------AGLRLTDFH---------------------------------------------------.-.TA--
E8H705_ECO57/223-491---K---------QIKLFNQAI---------------------------------------------------.-.SG--
F6BMG6_SINMB/269-561---Q---------GGNVFSPEF---------------------------------------------------.-.GG--
A0A017IT13_ECOLX/217-483---V---------NGLIFADYI---------------------------------------------------.-.AA--
A0A024LN14_ECOLX/58-408---D---------EGVRFTNGY---------------------------------------------------.-.VA--
A0A038FFI8_MYCTX/37-466---E---------RGVRLSQFH---------------------------------------------------.-.TT--
A0A038VAH2_MYCTX/5-389---E---------HGISFTRHY---------------------------------------------------.-.TG--
Q0Z8S6_VOLCA/26-386---Y---------PGIELKNYF---------------------------------------------------.-.VT--
Q45087_9BURK/4-384---R---------EGLTFRNHV---------------------------------------------------.-.TT--
A0A059MXH6_ENTFL/256-543---Y---------SGQMLSQNY---------------------------------------------------.-.GG--
Q840W2_STRMG/270-555---T---------SGLMKSDGF---------------------------------------------------.-.GG--
M2E9Z0_STRMG/503-788---T---------SGLMHSDGY---------------------------------------------------.-.GG--
Q8G592_BIFLO/306-604---T---------SGLMLSSGY---------------------------------------------------.-.GG--
A0A029SCQ9_STRPY/480-765---T---------AGLMQSDSY---------------------------------------------------.-.GG--
Q8P1I3_STRP8/480-765---T---------AGLMQSDSY---------------------------------------------------.-.GG--
Q8XK47_CLOPE/257-551---T---------KGFLKVPTY---------------------------------------------------.-.GG--
Q984T6_RHILO/281-574---R---------SGSMFSPEF---------------------------------------------------.-.GG--
Q98EG2_RHILO/158-441---Q---------LAYTNNSIS---------------------------------------------------G-MVA--
Q9A0F9_STRP1/480-765---T---------AGLMQSDSY---------------------------------------------------.-.GG--
Q9AI31_BURML/214-497---E---------HGQLAVPAW---------------------------------------------------.-.GA--
H8ID57_PASMH/287-557---Q---------EGWLFENLY---------------------------------------------------.-.AT--
Q9CM05_PASMU/231-523---E---------DVINFQHMT---------------------------------------------------.-.SC--
A0A030RTZ7_PSEAI/238-530---R---------NLTVFNNVV---------------------------------------------------.-.AS--
A0A022NH93_PSEAI/238-529---Q---------DIVNFTQVR---------------------------------------------------.-.SC--
A0A030XY34_PSEAI/231-522---E---------GLINFSNVH---------------------------------------------------.-.SC--
A0A030YI64_PSEAI/223-501---E---------RAMTTPDYV---------------------------------------------------.-.LH--
F0ADR9_NEIME/214-487---D---------FKPIVKQSY---------------------------------------------------.-.SA--
A0A016X8V3_VIBCL/240-530---F---------QPIFFKDVA---------------------------------------------------.-.SC--
Q9PGC7_XYLFA/245-535---N---------DVINFPDMH---------------------------------------------------.-.SC--
Q9RBI1_ACIAD/237-531---L---------DIINFSQAS---------------------------------------------------.-.SC--
Q9RMJ0_NEIME/232-495---T---------KGLLINGYQ---------------------------------------------------.-.ST--
Q9X6R2_PSEAI/20-300---K---------EGLLFTQFF---------------------------------------------------.-.SN--
D5AWR1_RICPP/218-505---Q---------NIISFKAK.---------------------------------------------------.-.SS--
Q9ZJJ5_HELPJ/225-518---N---------NLFVFSDTI---------------------------------------------------.-.SK--
Q9ZN39_HELPJ/222-504---H---------ELTLFNAT.---------------------------------------------------.-.SC--

PF02995

Q19148_CAEEL/61-607FVNA---------DAFVINCYN.HSKKAVKPEVPIWKKPFPGMKDKNLPED.....EILRVKDLYSYGDYGNKI-REQ--
O18062_CAEEL/67-538...C---------EFLETVCWE.DNIEVY.................GHIHT.....QIIPR.............-KAS--
Q9VSJ3_DROME/115-607...A---------EGIIVKCDS.GGRQIYIN.......GHATVPVKEAVQQ.....RLRMA............S-EAD--
Q21671_CAEEL/74-651...C---------EILETVCAE.KGGEQR..............DVYGYLHS.....QIIPTKP..........K-LSR--
Q9VGG4_DROME/77-573...N---------ITLRVWCWM.DYGRLV............YHDVFIFLPF.....PNPQK............V-NNS--
Q9VQH3_DROME/74-555...L---------QHIRTWCWV.DFGRII............FHDVMYFLP......PLPQA............T-NRS--
Q9VAU4_DROME/90-580...V---------EGLILTCHR.LGNESDI..........LQSDAYNLIQY.....RPPPKG............-LSL--
Q9VKK3_DROME/98-598...S---------EFICMWCYD.SLDKLF............YKDCHFFAVDKP.RIRPPLKTGTD.....RVSF-NKS--
Q19486_CAEEL/79-568...D---------EVFQITCES.DNLLKS..............EIFKYHYT.....QIVPKSSN.......IKN-KVI--
Q9V9Q1_DROME/66-560...A---------DIIRAECFI.NATSIY.............NGVHFYVHPTDEWLRTAQGLP..........P-LKL--
Q9VF91_DROME/73-581...C---------RSSSGESWF.GMAHGIRD.......TVPRPPASNFSPN....LAVLPPEAVA.....QAQQ-QMQ--
Q9VLG3_DROME/84-577...V---------EGMIVECQT.ADDPIVV..........LQKDAFAFIQH.....RPLPK.............-DSI--
Q9V9P7_DROME/68-547...E---------QIVRIRCSD.KFKASK............YHDVLYFLS......PPDPK.............-LMS--
O62436_CAEEL/78-581MNGS---------DYATISCIQ.GFQKWKSI.......LWDVNDEPEIHER....ARKMRK.............-EQA--
Q9W0F7_DROME/16-518...I---------DFISTQCHA.VHGNIDLK........LLQKDAFLFVQD.....RLNHEHK.........NT-EHH--
Q8SY05_DROME/180-657...V---------SAMITYCRRPPFDKVS............QKDAFSFVHP.....RKDQIE............-NPT--
Q9VIP6_DROME/56-555...T---------DYMITSCYV.RDVTKHRE........LLQQDAISFIED.....RLPKEKV.........KD-FVK--

PF01676

APGM2_ARCFU/1-380---KE........GACGIAKTV---------------------------------------------------P.DGF--
DEOB_GEOSE/6-381---AEKPLAY.........YTK---------------------------------------------------M.QEA--
E8VA73_BACST/4-499---NQYPHQ..TLTASGEAVGL---------------------------------------------------P.EGQ--
APGM_AQUAE/13-398---KN........SATGLHIPV---------------------------------------------------D.WGI--
A0A017I0E2_ECOLX/6-501---ANRPHT..LIDASGLEVGL---------------------------------------------------P.DRQ--
I0ZIS4_HELPX/3-399---NELPLGFQSQPNLIGAYAY---------------------------------------------------A.QEL--
PMGI_MESCR/20-545---QGAPEKWRLIRAHGKAVGL---------------------------------------------------PTEDD--
GPMI_PORPU/7-507---ETYPNT..LLVASGEEVGL---------------------------------------------------P.KGQ--
F7URM6_SYNYG/7-504---AAYPNT..LVNTSGKDVGL---------------------------------------------------P.KGQ--
APGM_PYRHO/5-403---EI........GILGQQDPI---------------------------------------------------K.PGQ--
PMGI_MAIZE/20-545---NGAPEKWRLVKAHGTAVGL---------------------------------------------------PSDDD--
PMGI_RICCO/17-542---KTAPERWRLIKAHGTAVGL---------------------------------------------------PTEDD--
G4EU83_BACIU/7-382---TEHPLAY.........YGK---------------------------------------------------M.QEA--
APGM1_ARCFU/1-399---EM........GINGIMDTI---------------------------------------------------A.PGI--
APGM1_METJA/4-402---KE........GICGLMNAI---------------------------------------------------D.IGI--
D8KJJ3_LACLN/6-399---AQKPAAY.........VTK---------------------------------------------------L.EEI--
B1X727_ECODH/2-390---GYAPGDMQPSDSATWGVAE---------------------------------------------------L.QH.--
GPMI_PSESM/6-497---KTMPNG..LISGSGMDVGL---------------------------------------------------P.DGQ--
GPMI_ANTSP/7-499---DNYPKT..LLSASGEHVGL---------------------------------------------------P.HKQ--
I0ZG59_HELPX/3-482---KTLPYS..LIDTHGLSVGL---------------------------------------------------P.KGQ--
PMGI_TOBAC/20-545---NGAPEKWRLIKAHGNAVGL---------------------------------------------------PTEDD--
M7ZXD7_TRIUA/25-880---KGAPERWRLIKAHGTAVGL---------------------------------------------------PTDDD--
A0A009END8_ECOLX/2-399---GFIPAGMDGNAEVIGAYAW---------------------------------------------------A.HEM--
APGM2_METTH/4-396---GM........GACGLLRTV---------------------------------------------------P.EGM--
GPMI_MYCGE/3-493---NSYPCV..LLDASGEAVGL---------------------------------------------------P.MGQ--
M1GCD6_MYCPM/3-494---KDYPCV..MLEASGEAVGL---------------------------------------------------P.QGQ--
GPMI_HELPY/3-482---KTLPYS..LIDTHGLSVGL---------------------------------------------------P.KGQ--
APGM1_METTH/1-400---ES........GINGIMDPI---------------------------------------------------K.PGV--
APGM2_METJA/1-398---EN........GMCGLMTTY---------------------------------------------------K.EGI--

PF00245

PPB_BOMMO/74-515---T---------LGLAKTYCV-----------------------------------------------------NAQ..
PPBT_BOVIN/51-490---Y---------VALSKTYNT-----------------------------------------------------NAQ..
PPBI_MOUSE/52-486---Y---------MALSKTYSV-----------------------------------------------------DRQ..
PPBN_MOUSE/51-486---H---------MALSKTYNT-----------------------------------------------------DKQ..
PPB1_HUMAN/55-490---Y---------VALSKTYNV-----------------------------------------------------DKH..
B1W385_STRGG/41-448---A---------SGRRTTYAV-----------------------------------------------------DER.G
A0A017K3Y5_ECOLX/64-470---L---------TGQYTHYAL-----------------------------------------------------NKKTG
A0A023ZB72_YEASX/66-527---.---------IGSSRTRSS-----------------------------------------------------DSL..
J7JQ01_BACIU/49-459---L---------TGMMMTHPD-----------------------------------------------------DPD..
G4EZI5_BACIU/43-455---L---------VGQQTTYPD-----------------------------------------------------DPE..

PF08665

Q2RKS0_MOOTA/260-429---S---------FSV..TAVF-----------------------------------------------------TLL--
Q72AH5_DESVH/438-616---S---------AEL..EPAL-----------------------------------------------------SML--
Q8TNC5_METAC/496-671---I---------PEL..SYMA-----------------------------------------------------GVL--
Q3A8U0_CARHZ/461-637---T---------TEI..SAMQ-----------------------------------------------------GVL--
B1YIB9_EXIS2/462-638---I---------CEM..QSML-----------------------------------------------------GVV--
Q5P0R1_AROAE/485-661---K---------AAL..SSQL-----------------------------------------------------GVL--
Q2W5M5_MAGSA/475-648---Q---------AEI..QPML-----------------------------------------------------GVL--
Q8ZK15_SALTY/474-650---T---------AEL..RSQL-----------------------------------------------------GVL--
Q7MVV4_PORGI/231-425---E---------EDM....YL-----------------------------------------------------SIL--
A5EWI8_DICNV/401-578---N---------LVMRESATF-----------------------------------------------------AWI--

PF07394

Q7UT83_RHOBA/61-480---Q---------SGLDMCDQF-----------------------------------------------------VHL--
Q7UHL2_RHOBA/84-501---Q---------SGLEISDFL-----------------------------------------------------PHM--
Q7UN58_RHOBA/63-468---E---------AGLWATDLL-----------------------------------------------------QEM--
Q98BS1_RHILO/39-404---.---------....ALSLA-----------------------------------------------------GPH--
Q7UHK7_RHOBA/71-478---E---------SGQWVCDRY-----------------------------------------------------TNV--
Q7UKW9_RHOBA/100-522---Q---------SGAWLSELL-----------------------------------------------------PYH--
Q8P3X8_XANCP/29-384---.---------.AIARPDTN-----------------------------------------------------NPR--
Q7UZ35_RHOBA/49-467---Q---------SGLEISELF-----------------------------------------------------PNI--
Q7UFP1_RHOBA/49-464---K---------SGLEISSVL-----------------------------------------------------PHL--
Q7MLK9_VIBVY/33-420---D---------IALAKESLL-----------------------------------------------------PLT--
Q7US09_RHOBA/66-482---E---------GGLWISDWL-----------------------------------------------------PHT--
Q7VYL6_BORPE/29-381---.---------.......AI-----------------------------------------------------ARD--
Q7UDW2_RHOBA/77-502---E---------SGAWVSELM-----------------------------------------------------PNL--
Q87HJ3_VIBPA/35-425---S---------LSVAKNTII-----------------------------------------------------PIR--
Q7UM62_RHOBA/63-489---E---------SGAWVSDRL-----------------------------------------------------PHF--
Q7UJ64_RHOBA/59-474---E---------SGAPMADNW-----------------------------------------------------THL--
Q7UIF5_RHOBA/61-494---E---------SGIEISDWF-----------------------------------------------------PHV--
Q7UYJ8_RHOBA/60-484---Q---------SGKMISELV-----------------------------------------------------PQL--
Q7MCK0_VIBVY/38-408---K---------LAIPLNDLL-----------------------------------------------------PIN--
Q9A5N3_CAUCR/44-506---P---------ITPKTPQRA-----------------------------------------------------AGA--
Q7ULC1_RHOBA/52-445---T---------PGIQFAQPM-----------------------------------------------------QKM--
Q7UQT8_RHOBA/50-438---V---------PGVQISEHL-----------------------------------------------------PKL--
Q7UQ29_RHOBA/54-472---E---------CGLEVSELF-----------------------------------------------------EHT--
Q7UGB9_RHOBA/69-492---E---------SGAQISNLM-----------------------------------------------------PNL--
Q7UPP6_RHOBA/56-434---V---------PGIQFGDRF-----------------------------------------------------PKL--
Q7UI66_RHOBA/46-421---T---------GNAQICEHM-----------------------------------------------------PMV--
Q7UVE3_RHOBA/81-505---D---------CGRLVGEWL-----------------------------------------------------PHI--
Q7UW70_RHOBA/70-497---I---------PGVKFTENL-----------------------------------------------------PRL--
Q7UKM6_RHOBA/69-495---Q---------HGTWVGNLL-----------------------------------------------------PHL--
Q7UTL9_RHOBA/100-490---V---------AGVSVCEHL-----------------------------------------------------PRL--
Q7UGF5_RHOBA/94-499---R---------GDFELTEIL-----------------------------------------------------PKH--
Q9A6V4_CAUCR/38-393---.---------.......AL-----------------------------------------------------QRD--
Q7UYC8_RHOBA/101-527---E---------SGMWMSDLL-----------------------------------------------------PHL--
Q7UR29_RHOBA/60-444---N---------TGEVIGSAM-----------------------------------------------------PQL--
Q7UYM7_RHOBA/45-446---A---------PGLRFSEHL-----------------------------------------------------PKL--
Q7UV65_RHOBA/50-468---E---------SGISVSELF-----------------------------------------------------PHV--
Q7UJ54_RHOBA/70-497---E---------NGIHLSELL-----------------------------------------------------PHL--
Q7UJ36_RHOBA/99-512---S---------AGTHISELL-----------------------------------------------------PHT--
Q7NT93_CHRVO/33-383---.---------.......AI-----------------------------------------------------ARE--
Q7UEK9_RHOBA/80-501---E---------SGKMISDLV-----------------------------------------------------PHI--
Q7UQW1_RHOBA/70-487---E---------SGIPVSSLF-----------------------------------------------------PHV--
Q7UPF7_RHOBA/65-448---L---------KDVRIADTM-----------------------------------------------------PRL--
Q7UYR5_RHOBA/95-521---A---------NGTMASELI-----------------------------------------------------PHM--
Q7UWA1_RHOBA/72-492---E---------CGKMVSTLF-----------------------------------------------------PNV--
Q89DL5_BRADU/42-392---.---------....ALAAD-----------------------------------------------------GAH--
Q7URV7_RHOBA/77-499---E---------SGKMVSDLL-----------------------------------------------------PHL--
Q7MDY0_VIBVY/67-457---N---------LALSQSQII-----------------------------------------------------PLS--
Q7UH70_RHOBA/75-488---K---------SGIEISELF-----------------------------------------------------PEL--
Q7UVE1_RHOBA/82-507---E---------SGAWVSDRM-----------------------------------------------------PHL--
Q7UQ53_RHOBA/45-480---E---------SSKMLSEVV-----------------------------------------------------APL--
Q7UP10_RHOBA/69-492---E---------SGTWMSDQL-----------------------------------------------------PYT--

PF04185

Q47936_FRANO/55-471-------------YRLDRNFQ.-----------------------------------------------------...--
PHOX_KLULA/65-312-------------.........-----------------------------------------------------...--
Q98ES1_RHILO/58-274-------------.........-----------------------------------------------------...--
A0A038F821_MYCTX/50-282-------------.........-----------------------------------------------------...--
D0KPN6_SULS9/27-365-------------WLPIAYSHP-----------------------------------------------------YYS--
NPC6_ARATH/59-394-------------PNSTQTICF-----------------------------------------------------TSD--
NPC5_ARATH/13-380-------------NSHNVVFG.-----------------------------------------------------.DQ--
NPC3_ARATH/16-381-------------NSAQIFFG.-----------------------------------------------------.KE--
NPC1_ARATH/38-396-------------NSKKIFVS.-----------------------------------------------------.DD--
NPC2_ARATH/27-389-------------SSRKIKFG.-----------------------------------------------------.SG--
Q9KH04_BURML/84-547-------------FVIPDAQGK-----------------------------------------------------PLP--
Q983N8_RHILO/60-507-------------FTVNDAKGF-----------------------------------------------------NVP--
E2TNP6_MYCTX/52-433-------------YRINTTGG.-----------------------------------------------------PNG--
A1KJH2_MYCBP/50-429-------------YRFDTTRG.-----------------------------------------------------PFL--
A4KJA2_MYCTX/52-435-------------YRFDTTRG.-----------------------------------------------------PLV--
A5WPW5_MYCTF/51-431-------------FRLDTTRG.-----------------------------------------------------PFL--
A0A030U552_PSEAI/51-437-------------YHWDTKV..-----------------------------------------------------.TS--
A3NXI4_BURP0/47-438-------------FHPDASN..-----------------------------------------------------.LG--
B8H354_CAUCN/40-437-------------FPLNSAQ..-----------------------------------------------------.TF--
A0A022NDQ0_PSEAI/48-422-------------YHFDTST..-----------------------------------------------------.TS--

PF16347

G2PRM5_MURRD/414-516-------------TPSDWRNA-----------------------------------------------------------
G7USR5_PSEUP/397-499-------------GNAGWRQD-----------------------------------------------------------
D5BJX1_ZUNPS/413-515-------------KKELDRDA-----------------------------------------------------------
G0J719_CYCMS/407-508-------------KTDEFRDA-----------------------------------------------------------
D2R402_PIRSD/397-498-------------TPADWRKS-----------------------------------------------------------
G8NQI2_GRAMM/379-480-------------ADPAFRTE-----------------------------------------------------------
D2QMZ8_SPILD/410-511-------------KKVAWRKE-----------------------------------------------------------
A4AWR6_MARSH/414-516-------------KEKWDRDA-----------------------------------------------------------
A6LDP5_PARD8/412-514-------------KVENWRKS-----------------------------------------------------------
A4CJM0_ROBBH/381-483-------------MEDWDREA-----------------------------------------------------------
A2TWV5_9FLAO/422-523-------------NNSNWRDA-----------------------------------------------------------
G8UMU5_TANFA/417-519-------------HPDNWRTS-----------------------------------------------------------
D5BJT8_ZUNPS/386-488-------------NPKSWKNE-----------------------------------------------------------
F9YSE0_CAPCC/401-501-------------KKYKKQKT-----------------------------------------------------------
D3IBE7_9BACT/417-519-------------KQKHWRDA-----------------------------------------------------------
C7M893_CAPOD/396-496-------------KAKPIRNQ-----------------------------------------------------------
G0J436_CYCMS/421-522-------------EGEWTRDA-----------------------------------------------------------
A3HWF8_9BACT/418-520-------------EDQWTRDE-----------------------------------------------------------
E8V2R6_TERSS/392-493-------------NDPEFRKE-----------------------------------------------------------
G8TRD3_NIAKG/412-512-------------QKGNVHDA-----------------------------------------------------------
H8KTX9_SOLCM/409-510-------------KPKQWRDA-----------------------------------------------------------
F4L7F1_HALH1/402-503-------------SSKNWRQQ-----------------------------------------------------------
F3ZRQ1_9BACE/413-515-------------TPQSWRTS-----------------------------------------------------------
E6SVH3_BACT6/418-520-------------KVKNWRKA-----------------------------------------------------------
D2QEZ9_SPILD/447-548-------------GKNDWRNQ-----------------------------------------------------------
G0IUX7_CYCMS/423-524-------------ESGEWRDA-----------------------------------------------------------
G0L151_ZOBGA/413-515-------------GNGEWRDA-----------------------------------------------------------
A6KZU2_BACV8/416-518-------------KVPDWRKS-----------------------------------------------------------
A6L8Y1_PARD8/413-515-------------RPENWRNS-----------------------------------------------------------
I3YHK1_ALIFI/406-508-------------HPAGWRRS-----------------------------------------------------------
Q5LAU2_BACFN/415-517-------------QPKDWRNA-----------------------------------------------------------
R5M554_9BACE/414-516-------------KPSDWRKA-----------------------------------------------------------
R5UAM5_9BACE/410-512-------------RPKDWRKS-----------------------------------------------------------
R7DGX3_9PORP/412-514-------------NPKNWRKS-----------------------------------------------------------
W0EZJ7_9SPHI/397-497-------------KKYASRNA-----------------------------------------------------------

PF14707

A9VBN0_MONBE/428-544-------------AAMRFNE..----------------------------------------------------------
E6ZGQ8_DICLA/413-534-------------QTVRTRK..----------------------------------------------------------
Q4S4L1_TETNG/407-528-------------QTVRMGR..----------------------------------------------------------
E1BU03_CHICK/390-510-------------EALRLAQ..----------------------------------------------------------
ARSG_MOUSE/402-522-------------QTVRLNH..----------------------------------------------------------
A6QLR7_BOVIN/402-522-------------QTVRLEQ..----------------------------------------------------------
ARSG_CANFA/402-522-------------QTVRLGS..----------------------------------------------------------
B4DQ74_HUMAN/301-421-------------QTVRLER..----------------------------------------------------------
A9V957_MONBE/437-571-------------ETIRVGD..----------------------------------------------------------
F0Y2N2_AURAN/404-544-------------SAARCGP..----------------------------------------------------------
Q1YP24_9GAMM/409-501-------------RAFRYQD..----------------------------------------------------------
C6W2Y6_DYAFD/349-461-------------EAVRKGN..----------------------------------------------------------
D7VQY4_9SPHI/353-442-------------MAVRKGP..----------------------------------------------------------
F2UD41_SALR5/491-612-------------QAVRWRE..----------------------------------------------------------
A9UXW0_MONBE/287-431-------------TAARFGR..----------------------------------------------------------
F2UKF0_SALR5/383-527-------------TAARNGR..----------------------------------------------------------
B9QU81_9RHOB/44-158-------------QAVRYRD..----------------------------------------------------------
E4YGB6_OIKDI/449-582-------------NAIRWTEP.----------------------------------------------------------
F2U742_SALR5/410-535-------------YAMRCGD..----------------------------------------------------------
A9UPM8_MONBE/326-451-------------YAVRCGD..----------------------------------------------------------
A8XD87_CAEBR/394-528-------------MAIRIGD..----------------------------------------------------------
E1FX25_LOALO/406-541-------------MAIRYGN..----------------------------------------------------------
F1KQC6_ASCSU/1702-1837-------------MAIRYGN..----------------------------------------------------------
F2UCT8_SALR5/90-221-------------WAVRCGA..----------------------------------------------------------
A9V7E7_MONBE/452-571-------------WAVRCGP..----------------------------------------------------------
C1BQY6_9MAXI/368-496-------------FAMRYHQ..----------------------------------------------------------
Q4RJR3_TETNG/343-473-------------FAIRLEK..----------------------------------------------------------
Q6AX40_XENLA/368-499-------------FAVRLGK..----------------------------------------------------------
A1L2N0_XENLA/374-505-------------FALRMGN..----------------------------------------------------------
F1NWF7_CHICK/373-504-------------FAVRLGK..----------------------------------------------------------
Q32KK2_RAT/368-501-------------FAVRNGK..----------------------------------------------------------
ARSA_BOVIN/368-501-------------FAVRSGK..----------------------------------------------------------
ARSA_HUMAN/368-501-------------FAVRTGK..----------------------------------------------------------
E4XNY3_OIKDI/402-532-------------GAVRRGD..----------------------------------------------------------
C3ZV84_BRAFL/657-789-------------MAVRYGL..----------------------------------------------------------
Q4SI19_TETNG/405-541-------------MAVRRGQ..----------------------------------------------------------
F1QFT2_DANRE/220-352-------------MAVRIGQ..----------------------------------------------------------
Q5XG10_XENLA/375-507-------------MAVRLGQ..----------------------------------------------------------
GALNS_CANFA/377-509-------------MAVTLGQ..----------------------------------------------------------
F1NW57_CHICK/376-508-------------MAVRVGL..----------------------------------------------------------
A0YAF7_9GAMM/381-478-------------FAVRQGD..----------------------------------------------------------
Q0C069_HYPNA/397-504-------------FAVRKGK..----------------------------------------------------------
ARS_STRPU/411-541-------------MAVRVGK..----------------------------------------------------------
ARS_HEMPU/396-526-------------MAVRVGK..----------------------------------------------------------
O16138_HELER/402-534-------------MAVRVGK..----------------------------------------------------------
A4AN36_MARSH/378-468-------------YAARLGE..----------------------------------------------------------
A4CMB0_ROBBH/401-491-------------YAVRLGA..----------------------------------------------------------
A3XMW9_LEEBM/382-476-------------YAVRYGS..----------------------------------------------------------
A7V8P9_BACUN/356-447-------------LAVRKGP..----------------------------------------------------------
A6CB11_9PLAN/382-473-------------MAFRKGP..----------------------------------------------------------
F0SFZ7_PLABD/380-468-------------YAVRSGP..----------------------------------------------------------
C3ZQB5_BRAFL/423-551-------------MAVRYGE..----------------------------------------------------------
C3ZQC1_BRAFL/344-471-------------MAVRYGE..----------------------------------------------------------
A7SK49_NEMVE/435-563-------------HAVRYRPK.----------------------------------------------------------
A7SQ82_NEMVE/425-557-------------HATRYRPR.----------------------------------------------------------
A7SK50_NEMVE/483-612-------------HAVRYRPR.----------------------------------------------------------
Q7ZWB8_DANRE/433-548-------------NAVRWRPP.----------------------------------------------------------
Q6DJK3_XENLA/433-566-------------HSVRWYQK.----------------------------------------------------------
Q32KK0_RAT/450-603-------------HAVRWVQR.----------------------------------------------------------
F1QB82_DANRE/433-568-------------NAVRWRPP.----------------------------------------------------------
Q4RYA1_TETNG/304-429-------------NAVRWHPR.----------------------------------------------------------
STS_MOUSE/445-581-------------QAVRWHN..----------------------------------------------------------
STS_RAT/436-573-------------SAVAWRPH.----------------------------------------------------------
STS_HUMAN/437-572-------------NAVRWHPQ.----------------------------------------------------------
D2HXW7_AILME/434-569-------------NAVRWRPR.----------------------------------------------------------
Q4TCJ7_TETNG/242-385-------------HAVRWHPP.----------------------------------------------------------
Q6GMA1_XENLA/439-573-------------HAARWHEK.----------------------------------------------------------
ARSF_HUMAN/440-574-------------HAVRWIPKD----------------------------------------------------------
Q32KI0_CANFA/435-568-------------HAVRWHPK.----------------------------------------------------------
ARSE_HUMAN/448-582-------------HAARWHQR.----------------------------------------------------------
Q32KI1_CANFA/444-578-------------HAARWRQR.----------------------------------------------------------
A5D7J7_BOVIN/445-576-------------HAARWHQR.----------------------------------------------------------
ARSH_HUMAN/418-551-------------HTVRWHQK.----------------------------------------------------------
F1NFQ0_CHICK/445-579-------------HAVRWHQK.----------------------------------------------------------
D2HFI2_AILME/436-570-------------HAARWHEK.----------------------------------------------------------
ARSD_HUMAN/451-585-------------HAARWHQK.----------------------------------------------------------
C3Y4J9_BRAFL/389-521-------------HAARYRPR.----------------------------------------------------------
C3Y4X6_BRAFL/434-568-------------HAVRYRPR.----------------------------------------------------------
C3YBU1_BRAFL/392-524-------------HAVRYRPK.----------------------------------------------------------
C3ZST4_BRAFL/433-562-------------HAVRYRPR.----------------------------------------------------------
C3Z258_BRAFL/432-564-------------HAVRYMPS.----------------------------------------------------------
C3YQ76_BRAFL/419-552-------------HAARYRPP.----------------------------------------------------------
C3YZM0_BRAFL/417-549-------------AAARYRPL.----------------------------------------------------------

PF01663

Q7NDL2_GLOVI/4-434----NPLTP---------------PAW----VSFMT--------------------------------------------
Q9X5T4_STRLA/7-389----TPYEP---------------PGL----LSVLT--------------------------------------------
B0R301_HALS3/15-396----PPESS---------------ACW----PSLTT--------------------------------------------
Q9X5S1_STRLA/5-395----PEISS---------------TSW----ATFLT--------------------------------------------
Q9X5R9_STRLA/7-410----PAHTA---------------PGW----STFVS--------------------------------------------
Q9YCS9_AERPE/3-432----PPITG---------------AAW----PSLAT--------------------------------------------
Q9X5S9_STRLA/7-409----PPITM---------------PAW----SCMMS--------------------------------------------
Q9UZH6_PYRAB/14-420----PAITI---------------PMW----MVMVT--------------------------------------------
Q9YCR2_AERPE/4-405----PPITV---------------PMW----GVMLA--------------------------------------------
V5Q348_ZYMMB/62-511----ATETC---------------PGH----SVLLT--------------------------------------------
C6IK84_9BACE/29-473----GVDRA---------------SAM----AAIYS--------------------------------------------
ALPH_SYNE7/42-494----PTLTA---------------CGH----SSIYT--------------------------------------------
ALPH_ELIME/32-489----PTVTA---------------IGH----TSIFT--------------------------------------------
CDA_MYROD/31-491----PTYTA---------------IGH----STIYT--------------------------------------------
Q7MEK0_VIBVY/30-506----NTETI---------------VGH----VSLAT--------------------------------------------
Q84EY0_9GAMM/27-481----NTTTC---------------AGH----ATVAT--------------------------------------------
O29992_ARCFU/4-416----PSATV---------------SGH----ASIST--------------------------------------------
Q981Q5_RHILO/5-379----PATSV---------------PGR----ATMLT--------------------------------------------
Q98IY7_RHILO/32-447----PSDSF---------------PGL----VAQVT--------------------------------------------
Q7UKE3_RHOBA/4-350----PAVTC---------------TSQ----ATMLT--------------------------------------------
O69954_STRCO/13-378----PAVTC---------------AAQ----STFLT--------------------------------------------
Q8YZP2_NOSS1/4-370----PAVTC---------------TAQ----ATYLT--------------------------------------------
Q7AYA7_9RHIZ/4-370----PAVTC---------------SAQ----ATFVT--------------------------------------------
Q7NU73_CHRVO/4-375----PAVTC---------------SVQ----ASMLT--------------------------------------------
D3MCQ1_PROAA/44-359----PSTTA---------------TSL----SCIGT--------------------------------------------
F7PA94_MYCPC/42-363----PSTTP---------------TSL----VSLAT--------------------------------------------
O50518_STRCO/58-383----PATTA---------------TSL----ASVGT--------------------------------------------
Q6N507_RHOPA/30-497----PTFTM---------------ANG----SAMAT--------------------------------------------
Q7WNM8_BORBR/6-370----PSTTR---------------VSS----ASIAT--------------------------------------------
F0K5R6_CLOAE/8-378----PSVTY---------------PSH----TSIIT--------------------------------------------
Q8XKL9_CLOPE/10-374----PSLTY---------------PAH----VSIIT--------------------------------------------
C8K1F1_LISMN/5-366----PSLTY---------------PAH----TSIIT--------------------------------------------
Q73E52_BACC1/9-380----PSVTY---------------PSH----STIVT--------------------------------------------
O45359_CAEEL/26-353----PTFSI---------------SNR----HSLLT--------------------------------------------
Q22129_CAEEL/24-374----PTHTW---------------PQW----MSLST--------------------------------------------
O58841_PYRHO/4-322----PTLTD---------------LVH----TTVMT--------------------------------------------
ENPP6_XENLA/26-357----PSLSY---------------PNY----YTLMT--------------------------------------------
ENPP6_MOUSE/26-357----PSLSY---------------PNY----YTLMT--------------------------------------------
ENPP1_CAEEL/182-494----PSKTF---------------PNH----YSIVT--------------------------------------------
ENPP2_CAEEL/81-386----PSKTF---------------PNH----YTMVT--------------------------------------------
Q7MXP5_PORGI/37-349----PSLTF---------------PNH----YSMAT--------------------------------------------
ENPP7_HUMAN/33-356----VTMTS---------------PCH----FTLVT--------------------------------------------
Q6ZM30_DANRE/31-356----LTITS---------------PTH----FTLLS--------------------------------------------
Q6CX45_KLULA/136-460----PSQTF---------------PNH----WTMIT--------------------------------------------
ENPP5_HUMAN/30-342----ITKTY---------------PNH----YTLVT--------------------------------------------
ENPP4_XENLA/30-339----ITKTF---------------PNH----YSLVT--------------------------------------------
K7BSV5_PANTR/28-339----ITKTF---------------PNH----YSIVT--------------------------------------------
Q6VZU9_CNPV/107-431----PTNTF---------------PNL----YSIVT--------------------------------------------
O90761_FOWPV/120-443----PTNTF---------------PNL----YSIVT--------------------------------------------
Q6PGY9_DANRE/161-472----PTKTY---------------PNL----YTITT--------------------------------------------
ENPP2_RAT/165-477----PTKTF---------------PNL----YTLAT--------------------------------------------
Q7ZXN7_XENLA/166-476----PTKTF---------------PNL----YTLAT--------------------------------------------
ENPP3_MOUSE/161-485----PTKTF---------------PNH----YTIVT--------------------------------------------
ENPP1_RAT/194-520----PTKTF---------------PNH----YSIVT--------------------------------------------
Q9SU81_ARATH/60-394----PTMTF---------------PNH----YSIAT--------------------------------------------
Q9SU82_ARATH/57-390----PTMTF---------------PNH----YSIAT--------------------------------------------
Q42974_ORYSA/92-418----PTLTF---------------PNH----YSIAT--------------------------------------------
Q9FS13_SPIOL/96-418----PTLTF---------------PNH----YSIVT--------------------------------------------
Q9SU83_ARATH/109-435----PTLTF---------------PNH----YSIVT--------------------------------------------
M9N2F7_ASHG1/153-497----PSETF---------------PNH----WTLVT--------------------------------------------
Q6FKX1_CANGA/187-587----PLQSI---------------PNM----WTMVT--------------------------------------------
N1P7V5_YEASC/170-545----PTETF---------------PNH----WTLVT--------------------------------------------
M4TY79_9XANT/48-366----PSLTF---------------PNH----YTLVT--------------------------------------------
Q9PAB9_XYLFA/40-358----PALTL---------------PNA----YTLIT--------------------------------------------
H2VFP5_ZYMMO/50-367----PSITF---------------PNH----YTLVT--------------------------------------------
Q9A8S4_CAUCR/74-393----PSVTF---------------PNH----YTLIT--------------------------------------------
Q7SI20_NEUCR/254-584----PSVTF---------------PNH----YTLAT--------------------------------------------
YGK5_SCHPO/76-404----PSITF---------------PNH----YTIVT--------------------------------------------
Q6BTN4_DEBHA/173-514----PSSTF---------------PNH----WTLVT--------------------------------------------
Q6C6J4_YARLI/277-608----PTSTF---------------PNH----WTLIT--------------------------------------------

PF00884

C3LB12_BACAC/143-439----..NTA---------------NTE----FEALT--------------------------------------------
A0A038KMS4_MYCTX/43-460----A.LCS---------------PTR----QALLT--------------------------------------------
K4NNF3_HELPX/294-587----APRTV---------------KSL----DVQIT--------------------------------------------
A1IT97_NEIMA/232-524----GTSTA---------------HSL----PCMFS--------------------------------------------
E8VE61_BACST/245-536----QGKTS---------------DAE----FMMEN--------------------------------------------
O43113_NEUCS/45-420----TAICC---------------PAR----VSLWT--------------------------------------------
A0A038F731_MYCTX/212-635----A.VCS---------------PTR----AALLT--------------------------------------------
O82879_STRMG/460-745----..GTA---------------NME----FQSLT--------------------------------------------
O85099_ECOLX/237-530----RPYTI---------------EAL----QQALT--------------------------------------------
A0A017IKP4_ECOLX/260-505----GNTTD---------------NGI----FGLFY--------------------------------------------
ARS_HEMPU/52-373----DAVCT---------------PSR----SAIMT--------------------------------------------
ARS_CHLRE/27-385----TPVCC---------------PSR----TNLXR--------------------------------------------
ARSA_HUMAN/21-346----VSLCT---------------PSR----AALLT--------------------------------------------
A0A017J6J3_ECOLX/86-419----QPSSS---------------PTR----ATILT--------------------------------------------
A0A017J597_ECOLX/236-527----GTATA---------------VSV----PCMFS--------------------------------------------
A0A017HZX0_ECOLX/4-341----SPVCT---------------PAR----AGLFT--------------------------------------------
ARSB_FELCA/47-366----QPLCT---------------PSR----SQLLT--------------------------------------------
GALNS_HUMAN/31-355----NPLCS---------------PSR----AALLT--------------------------------------------
A0A017I1Q5_ECOLX/248-538----DTATK---------------LSL----RCMFV--------------------------------------------
C9MG45_HAEIF/211-475----APNTQ---------------PSL----QLTLY--------------------------------------------
GNS_CAPHI/54-391----SALCC---------------PSR----ASILT--------------------------------------------
STS_MOUSE/35-421----APLCT---------------PSR----AAFLT--------------------------------------------
ARS_STRPU/67-388----DSVCT---------------PSR----SAIVT--------------------------------------------
SPHM_HUMAN/23-328----VSSCS---------------PSR----ASLLT--------------------------------------------
A0A022NJX0_PSEAI/5-420----S.TCS---------------PTR----SMLLT--------------------------------------------
E8H705_ECO57/223-491----APYTA---------------LSV----PLSLT--------------------------------------------
F6BMG6_SINMB/269-561----..MTA---------------NVE----FEALT--------------------------------------------
A0A017IT13_ECOLX/217-483----SGSTQ---------------KSL----GLTLN--------------------------------------------
A0A024LN14_ECOLX/58-408----HGVSG---------------PSR----AAIMT--------------------------------------------
A0A038FFI8_MYCTX/37-466----A.LCS---------------PTR----ASLLT--------------------------------------------
A0A038VAH2_MYCTX/5-389----SLACV---------------PSR----PTIFT--------------------------------------------
Q0Z8S6_VOLCA/26-386----TPVCC---------------PSR----TNLWR--------------------------------------------
Q45087_9BURK/4-384----CVPCG---------------PAR----ASLLT--------------------------------------------
A0A059MXH6_ENTFL/256-543----..GTA---------------NIE----FEALT--------------------------------------------
Q840W2_STRMG/270-555----..GTA---------------NME----FQTLT--------------------------------------------
M2E9Z0_STRMG/503-788----..GTA---------------NME----FQSLT--------------------------------------------
Q8G592_BIFLO/306-604----..GTA---------------NLE----YMGLS--------------------------------------------
A0A029SCQ9_STRPY/480-765----..GTA---------------NME----FQTLT--------------------------------------------
Q8P1I3_STRP8/480-765----..GTA---------------NME----FQTLT--------------------------------------------
Q8XK47_CLOPE/257-551----..GTV---------------RSE----FEVLT--------------------------------------------
Q984T6_RHILO/281-574----..MTA---------------NIE----FEALT--------------------------------------------
Q98EG2_RHILO/158-441----ANCGT---------------PLL----ITFFT--------------------------------------------
Q9A0F9_STRP1/480-765----..GTA---------------NME----FQTLT--------------------------------------------
Q9AI31_BURML/214-497----..NTM---------------RSE----FAFLT--------------------------------------------
H8ID57_PASMH/287-557----GTRSV---------------RGI----EAVTA--------------------------------------------
Q9CM05_PASMU/231-523----GTSTA---------------VSV----PCMFS--------------------------------------------
A0A030RTZ7_PSEAI/238-530----RPYTI---------------EVL----QQVLT--------------------------------------------
A0A022NH93_PSEAI/238-529----GTSTA---------------VSV----PCMFS--------------------------------------------
A0A030XY34_PSEAI/231-522----GTETA---------------VSV----PCMFS--------------------------------------------
A0A030YI64_PSEAI/223-501----SHQTI---------------RGL----YAMLC--------------------------------------------
F0ADR9_NEIME/214-487----GFMTA---------------VSL----PSFFN--------------------------------------------
A0A016X8V3_VIBCL/240-530----GTATA---------------VSV----PCMFS--------------------------------------------
Q9PGC7_XYLFA/245-535----GTNTE---------------VSV----PCMFS--------------------------------------------
Q9RBI1_ACIAD/237-531----GTQTS---------------VSV----PCMFS--------------------------------------------
Q9RMJ0_NEIME/232-495----AHATN---------------LSL----PQTL.--------------------------------------------
Q9X6R2_PSEAI/20-300----GTHTH---------------QGM----FATMA--------------------------------------------
D5AWR1_RICPP/218-505----YNLTY---------------LSV----PSLLS--------------------------------------------
Q9ZJJ5_HELPJ/225-518----EAHTS---------------DVF----ESLLN--------------------------------------------
Q9ZN39_HELPJ/222-504----ATYTT---------------ASL----ECILD--------------------------------------------

PF02995

Q19148_CAEEL/61-607----VSKAV---------------DRY----SIDIL--------------------------------------------
O18062_CAEEL/67-538----PTKFK---------------DAP----NVFIF--------------------------------------------
Q9VSJ3_DROME/115-607----AKGYQ---------------RPP----SVLML--------------------------------------------
Q21671_CAEEL/74-651----TNADL---------------KEY----DVFVI--------------------------------------------
Q9VGG4_DROME/77-573----AP..V---------------KRL----SVLIL--------------------------------------------
Q9VQH3_DROME/74-555----TEHQK---------------RKL----SVMIL--------------------------------------------
Q9VAU4_DROME/90-580----KP.SK---------------RKP----SVLMF--------------------------------------------
Q9VKK3_DROME/98-598----KE.EQ---------------ERL----SVMIL--------------------------------------------
Q19486_CAEEL/79-568----EQSTS---------------DFP----SVIMI--------------------------------------------
Q9V9Q1_DROME/66-560----AS.DV---------------GSL----SVLIV--------------------------------------------
Q9VF91_DROME/73-581----DGATA---------------PIY----NVLMF--------------------------------------------
Q9VLG3_DROME/84-577----RPRAA---------------RKP----SVIMY--------------------------------------------
Q9V9P7_DROME/68-547----TE.SS---------------EKL----SVMVL--------------------------------------------
O62436_CAEEL/78-581----DP.EK---------------KPY----NVYFL--------------------------------------------
Q9W0F7_DROME/16-518----RPDLQ---------------SKP----NVIIL--------------------------------------------
Q8SY05_DROME/180-657----TP.HR---------------RRP----SVLLW--------------------------------------------
Q9VIP6_DROME/56-555----DESEV---------------HKP----SVLIM--------------------------------------------

PF01676

APGM2_ARCFU/1-380----EPGSD...............VAN----LTILGVDVRKHYT....................................
DEOB_GEOSE/6-381----SAGKDT.............MTGH----WELMGLRIDTPFQVFPDGFPKELIDEL..........EKQTGRKVIGNK
E8VA73_BACST/4-499----MGNSE...............VGH----LNIGA............................................
APGM_AQUAE/13-398----TPGSG...............PGH----LGLFGYDPIKYQI....................................
A0A017I0E2_ECOLX/6-501----MGNSE...............VGH----VNLGA............................................
I0ZIS4_HELPX/3-399----SSAKDT.............ISGH----WEMMGAPVLFEWGYFKDKTHSFPKEILDE......IVRKTKIKGYLGNC
PMGI_MESCR/20-545----MGNSE...............VGH----NALGA............................................
GPMI_PORPU/7-507----MGNSE...............VGH----TTIGG............................................
F7URM6_SYNYG/7-504----MGNSE...............VGH----LNLGA............................................
APGM_PYRHO/5-403----PAGSD...............TAH----LSIFGYDPYETYR....................................
PMGI_MAIZE/20-545----MGNSE...............VGH----NALGA............................................
PMGI_RICCO/17-542----MGNSE...............VGH----NALGA............................................
G4EU83_BACIU/7-382----SNGKDT.............MTGH----WEIMGLYIDKPFKVFPEGFPDELLQEL..........EKRSGRKIIGNK
APGM1_ARCFU/1-399----RPGSD...............TSH----LALLGYDPYKYYS....................................
APGM1_METJA/4-402----RPGSD...............TAH----LAILGYNPYEVYT....................................
D8KJJ3_LACLN/6-399----SKGKDT.............MTGH----WEIMGLNIQTPFPTYPEGYPEDLLEKIE........EFSGRKIIREANK
B1X727_ECODH/2-390----.EGGDT.............FMGH----QEILGTRPLPPLRMPFRDVIDRVEQALVSAGWQVERRGDDLQFLWVNQA
GPMI_PSESM/6-497----MGNSE...............VGH----MNLGA............................................
GPMI_ANTSP/7-499----MGNSE...............VGH----TTIGA............................................
I0ZG59_HELPX/3-482----MGNSE...............VGH----MCIGA............................................
PMGI_TOBAC/20-545----MGNSE...............VGH----NALGA............................................
M7ZXD7_TRIUA/25-880----MGNSEGRRIRWEGLGGAAPTVPH----LQLAAASSEAEHPLLDSLLQQHS..................NLFDKPQG
A0A009END8_ECOLX/2-399----SSGKDT.............PSGH----WEIAGVPVLFEWGYFSDHENSFPQELLDK......LVERANLPGYLGNC
APGM2_METTH/4-396----EAGSD...............VAN----LSIMGYDPRRYYT....................................
GPMI_MYCGE/3-493----IGNSE...............VGH----LNIGA............................................
M1GCD6_MYCPM/3-494----IGNSE...............VGH----LNIGA............................................
GPMI_HELPY/3-482----MGNSE...............VGH----MCIGA............................................
APGM1_METTH/1-400----RAGSD...............TSH----LSILGYDPYRVYT....................................
APGM2_METJA/1-398----PLGTE...............VAH----FLLWGYS.LEEFP....................................

PF00245

PPB_BOMMO/74-515....VPDSS---------------CTA----TAYLC--------------------------------------------
PPBT_BOVIN/51-490....VPDSA---------------GTA----TAYLC--------------------------------------------
PPBI_MOUSE/52-486....VPDSA---------------STA----TAYLC--------------------------------------------
PPBN_MOUSE/51-486....IPDSA---------------GTG----TAFLC--------------------------------------------
PPB1_HUMAN/55-490....VPDSG---------------ATA----TAYLC--------------------------------------------
B1W385_STRGG/41-448RPVYVTDSA---------------AGA----TAWAT--------------------------------------------
A0A017K3Y5_ECOLX/64-470KPDYVTDSA---------------ASA----TAWST--------------------------------------------
A0A023ZB72_YEASX/66-527....VTDSA---------------AGA----TAFAC--------------------------------------------
J7JQ01_BACIU/49-459..YNITDSA---------------AAG----TALAT--------------------------------------------
G4EZI5_BACIU/43-455..QNVTDSA---------------AAA----TAMSA--------------------------------------------

PF08665

Q2RKS0_MOOTA/260-429----PTLTR---------------VSR----RALFC--------------------------------------------
Q72AH5_DESVH/438-616----PSYTQ---------------LGM----AALLP--------------------------------------------
Q8TNC5_METAC/496-671----PSYTK---------------LGM----ASLLP--------------------------------------------
Q3A8U0_CARHZ/461-637----PSYTK---------------LGM----AALLP--------------------------------------------
B1YIB9_EXIS2/462-638----PSVTK---------------LGM----AALLP--------------------------------------------
Q5P0R1_AROAE/485-661----PSYTT---------------LGM----AALLP--------------------------------------------
Q2W5M5_MAGSA/475-648----PSYTA---------------LGM----AALLP--------------------------------------------
Q8ZK15_SALTY/474-650----PSYTQ---------------LGM----AALLP--------------------------------------------
Q7MVV4_PORGI/231-425----PTATQ---------------YAR----NAIFS--------------------------------------------
A5EWI8_DICNV/401-578----PTLTS---------------VSR----QSIFS--------------------------------------------

PF07394

Q7UT83_RHOBA/61-480----AQPEV---------------ADE....LCVYR--------------------------------------------
Q7UHL2_RHOBA/84-501----..SEH---------------ADD....LCVIR--------------------------------------------
Q7UN58_RHOBA/63-468----..NKH---------------LDS....LCVVR--------------------------------------------
Q98BS1_RHILO/39-404----AALPL---------------DGF....FAVNP--------------------------------------------
Q7UHK7_RHOBA/71-478----..AKH---------------VDK....MAFIK--------------------------------------------
Q7UKW9_RHOBA/100-522----..RDI---------------VDD....VCFIK--------------------------------------------
Q8P3X8_XANCP/29-384----SALAL---------------DAQ....WGLNP--------------------------------------------
Q7UZ35_RHOBA/49-467----..GSV---------------ADD....LCIIR--------------------------------------------
Q7UFP1_RHOBA/49-464----..SKM---------------ADD....LCVVK--------------------------------------------
Q7MLK9_VIBVY/33-420----LATGS---------------TLS....LGLHP--------------------------------------------
Q7US09_RHOBA/66-482----..AKM---------------ADE....LAVIR--------------------------------------------
Q7VYL6_BORPE/29-381----AAAAL---------------SDG....WALHP--------------------------------------------
Q7UDW2_RHOBA/77-502----..AKQ---------------VDD....LCFLK--------------------------------------------
Q87HJ3_VIBPA/35-425----LNAHD---------------ANNNAVPLGLHP--------------------------------------------
Q7UM62_RHOBA/63-489----..QSV---------------VDK....VCFVK--------------------------------------------
Q7UJ64_RHOBA/59-474----..PKV---------------ADE....LCFYR--------------------------------------------
Q7UIF5_RHOBA/61-494----..GEC---------------ADD....LCVIR--------------------------------------------
Q7UYJ8_RHOBA/60-484----..GEL---------------ADD....MCFLH--------------------------------------------
Q7MCK0_VIBVY/38-408----..TQG---------------ENT....LALHP--------------------------------------------
Q9A5N3_CAUCR/44-506----APGAP---------------ART....FGLHP--------------------------------------------
Q7ULC1_RHOBA/52-445----..AAI---------------SDD....LAIVR--------------------------------------------
Q7UQT8_RHOBA/50-438----..AQV---------------ADK....FAILR--------------------------------------------
Q7UQ29_RHOBA/54-472----..ATH---------------ADD....LCVIN--------------------------------------------
Q7UGB9_RHOBA/69-492----..QTV---------------ADE....LCFIK--------------------------------------------
Q7UPP6_RHOBA/56-434----..SYL---------------AGA....IATVR--------------------------------------------
Q7UI66_RHOBA/46-421----..AQQ---------------MKH....LSVVR--------------------------------------------
Q7UVE3_RHOBA/81-505----..GAI---------------SDD....LCFVK--------------------------------------------
Q7UW70_RHOBA/70-497----..SQV---------------NDK....FTMIR--------------------------------------------
Q7UKM6_RHOBA/69-495----..QEI---------------TDD....ISIVR--------------------------------------------
Q7UTL9_RHOBA/100-490----..AER---------------MDR....VTAVR--------------------------------------------
Q7UGF5_RHOBA/94-499----..AEI---------------ADM....FSIVR--------------------------------------------
Q9A6V4_CAUCR/38-393----QVRML---------------DDT....FGLHP--------------------------------------------
Q7UYC8_RHOBA/101-527----..STQ---------------VDK....LCFID--------------------------------------------
Q7UR29_RHOBA/60-444----..AKR---------------ADK....YCVIR--------------------------------------------
Q7UYM7_RHOBA/45-446----..GSM---------------ADK....LAVLR--------------------------------------------
Q7UV65_RHOBA/50-468----..AEC---------------VDD....LCIIN--------------------------------------------
Q7UJ54_RHOBA/70-497----..GTV---------------IDD....ICLIR--------------------------------------------
Q7UJ36_RHOBA/99-512----..AGV---------------LDD....ICLIR--------------------------------------------
Q7NT93_CHRVO/33-383----QVLQI---------------NGD....IGLHP--------------------------------------------
Q7UEK9_RHOBA/80-501----..GEM---------------ADD....LCFFH--------------------------------------------
Q7UQW1_RHOBA/70-487----..AGC---------------VDE....LAVVR--------------------------------------------
Q7UPF7_RHOBA/65-448----..AEQ---------------MHL....CSLVR--------------------------------------------
Q7UYR5_RHOBA/95-521----..AKK---------------VDE....IALVK--------------------------------------------
Q7UWA1_RHOBA/72-492----..AKH---------------VDD....IAFLH--------------------------------------------
Q89DL5_BRADU/42-392----PAIML---------------DSF....FALHP--------------------------------------------
Q7URV7_RHOBA/77-499----..AEQ---------------VDD....FCFLH--------------------------------------------
Q7MDY0_VIBVY/67-457----LKAQD---------------NQGKPVTLGLHP--------------------------------------------
Q7UH70_RHOBA/75-488----..SKH---------------ADK....LCVIR--------------------------------------------
Q7UVE1_RHOBA/82-507----..AKQ---------------VDD....ICFIK--------------------------------------------
Q7UQ53_RHOBA/45-480----..GDC---------------VDD....IAFVH--------------------------------------------
Q7UP10_RHOBA/69-492----..SKI---------------ADD....ICVVR--------------------------------------------

PF04185

Q47936_FRANO/55-471----....P---------------CSQ----NHEYH--------------------------------------------
PHOX_KLULA/65-312----.....---------------...----.....--------------------------------------------
Q98ES1_RHILO/58-274----.....---------------...----.....--------------------------------------------
A0A038F821_MYCTX/50-282----.....---------------...----.....--------------------------------------------
D0KPN6_SULS9/27-365----NAYST---------------RDP----YEGWD--------------------------------------------
NPC6_ARATH/59-394----AEFVD---------------PDP----GHSFE--------------------------------------------
NPC5_ARATH/13-380----SQYVD---------------PNP----GHSIR--------------------------------------------
NPC3_ARATH/16-381----SQNID---------------PDP----GHSFQ--------------------------------------------
NPC1_ARATH/38-396----AVFVD---------------MDP----GHSFQ--------------------------------------------
NPC2_ARATH/27-389----SHYVD---------------PDP----GHSFQ--------------------------------------------
Q9KH04_BURML/84-547----NGVIT---------------RDL----WHRFY--------------------------------------------
Q983N8_RHILO/60-507----LSVTT---------------HDL----WHRYY--------------------------------------------
E2TNP6_MYCTX/52-433----VGECV---------------NDP----DHQWI--------------------------------------------
A1KJH2_MYCBP/50-429----DGACV---------------NDP----DHSWV--------------------------------------------
A4KJA2_MYCTX/52-435----AGECV---------------NDP----DHSWI--------------------------------------------
A5WPW5_MYCTF/51-431----DGECV---------------NDP----EHQWV--------------------------------------------
A0A030U552_PSEAI/51-437----AQ.WV---------------SSQ----NHEWS--------------------------------------------
A3NXI4_BURP0/47-438----MQ.FL---------------QDL----PHGWQ--------------------------------------------
B8H354_CAUCN/40-437----AHMRV---------------EGT----PHSWT--------------------------------------------
A0A022NDQ0_PSEAI/48-422----AQ.RV---------------DGT----PHTWP--------------------------------------------

PF16347

G2PRM5_MURRD/414-516-----------------------------HYYHYYE--------------------------------------------
G7USR5_PSEUP/397-499-----------------------------FLYEWFK--------------------------------------------
D5BJX1_ZUNPS/413-515-----------------------------IYYHYYD--------------------------------------------
G0J719_CYCMS/407-508-----------------------------VYYTYYE--------------------------------------------
D2R402_PIRSD/397-498-----------------------------VYYHYYE--------------------------------------------
G8NQI2_GRAMM/379-480-----------------------------WYYEYFE--------------------------------------------
D2QMZ8_SPILD/410-511-----------------------------AYYHYYE--------------------------------------------
A4AWR6_MARSH/414-516-----------------------------VYYHYYE--------------------------------------------
A6LDP5_PARD8/412-514-----------------------------LYYHFYE--------------------------------------------
A4CJM0_ROBBH/381-483-----------------------------VYYHYYE--------------------------------------------
A2TWV5_9FLAO/422-523-----------------------------LYYHYYE--------------------------------------------
G8UMU5_TANFA/417-519-----------------------------LYYHFYE--------------------------------------------
D5BJT8_ZUNPS/386-488-----------------------------HYYHYYE--------------------------------------------
F9YSE0_CAPCC/401-501-----------------------------IYYHYYE--------------------------------------------
D3IBE7_9BACT/417-519-----------------------------LYYHFHE--------------------------------------------
C7M893_CAPOD/396-496-----------------------------IFYHYYE--------------------------------------------
G0J436_CYCMS/421-522-----------------------------VYYHYYE--------------------------------------------
A3HWF8_9BACT/418-520-----------------------------VYYHYYE--------------------------------------------
E8V2R6_TERSS/392-493-----------------------------WYYEYYE--------------------------------------------
G8TRD3_NIAKG/412-512-----------------------------LYYHFYE--------------------------------------------
H8KTX9_SOLCM/409-510-----------------------------LYYHYYE--------------------------------------------
F4L7F1_HALH1/402-503-----------------------------VYYHYYE--------------------------------------------
F3ZRQ1_9BACE/413-515-----------------------------LYYHFYE--------------------------------------------
E6SVH3_BACT6/418-520-----------------------------LYYHFYE--------------------------------------------
D2QEZ9_SPILD/447-548-----------------------------AYYHYYE--------------------------------------------
G0IUX7_CYCMS/423-524-----------------------------VYYTYYE--------------------------------------------
G0L151_ZOBGA/413-515-----------------------------LYYHYYE--------------------------------------------
A6KZU2_BACV8/416-518-----------------------------LYYHFYE--------------------------------------------
A6L8Y1_PARD8/413-515-----------------------------LYYHYYE--------------------------------------------
I3YHK1_ALIFI/406-508-----------------------------LYYHFYE--------------------------------------------
Q5LAU2_BACFN/415-517-----------------------------LYYHFYE--------------------------------------------
R5M554_9BACE/414-516-----------------------------LYYHFYE--------------------------------------------
R5UAM5_9BACE/410-512-----------------------------LYYHFYE--------------------------------------------
R7DGX3_9PORP/412-514-----------------------------LYYHFYE--------------------------------------------
W0EZJ7_9SPHI/397-497-----------------------------LYYHYYE--------------------------------------------

PF14707

A9VBN0_MONBE/428-544------------------------.....YKLFYKT--------------------------------------------
E6ZGQ8_DICLA/413-534------------------------.....HKAFYIT--------------------------------------------
Q4S4L1_TETNG/407-528------------------------.....YKAFYLT--------------------------------------------
E1BU03_CHICK/390-510------------------------.....YKAFYTT--------------------------------------------
ARSG_MOUSE/402-522------------------------.....YKAFYIT--------------------------------------------
A6QLR7_BOVIN/402-522------------------------.....YKAFYVT--------------------------------------------
ARSG_CANFA/402-522------------------------.....YKAFYVS--------------------------------------------
B4DQ74_HUMAN/301-421------------------------.....YKAFYIT--------------------------------------------
A9V957_MONBE/437-571------------------------.....YKAKYRI--------------------------------------------
F0Y2N2_AURAN/404-544------------------------.....YKLHYAT--------------------------------------------
Q1YP24_9GAMM/409-501------------------------.....HKVHFVT--------------------------------------------
C6W2Y6_DYAFD/349-461------------------------.....WKLVFAH--------------------------------------------
D7VQY4_9SPHI/353-442------------------------.....WKLHVKT--------------------------------------------
F2UD41_SALR5/491-612------------------------.....WKMHFKT--------------------------------------------
A9UXW0_MONBE/287-431------------------------.....YKLHFAT--------------------------------------------
F2UKF0_SALR5/383-527------------------------.....YKLHFAT--------------------------------------------
B9QU81_9RHOB/44-158------------------------.....WKAHFVI--------------------------------------------
E4YGB6_OIKDI/449-582------------------------QTGRVWKLHYFQ--------------------------------------------
F2U742_SALR5/410-535------------------------.....HKIYWAT--------------------------------------------
A9UPM8_MONBE/326-451------------------------.....MKVYWAT--------------------------------------------
A8XD87_CAEBR/394-528------------------------.....YKVHYKT--------------------------------------------
E1FX25_LOALO/406-541------------------------.....HKVHFKT--------------------------------------------
F1KQC6_ASCSU/1702-1837------------------------.....FKVHFKT--------------------------------------------
F2UCT8_SALR5/90-221------------------------.....YKMHYVT--------------------------------------------
A9V7E7_MONBE/452-571------------------------.....YKAHYVT--------------------------------------------
C1BQY6_9MAXI/368-496------------------------.....YKAHFYT--------------------------------------------
Q4RJR3_TETNG/343-473------------------------.....YKAHFYT--------------------------------------------
Q6AX40_XENLA/368-499------------------------.....YKAHFYT--------------------------------------------
A1L2N0_XENLA/374-505------------------------.....YKAHFYT--------------------------------------------
F1NWF7_CHICK/373-504------------------------.....YKAHYFT--------------------------------------------
Q32KK2_RAT/368-501------------------------.....YKAHFFT--------------------------------------------
ARSA_BOVIN/368-501------------------------.....YKAHFFT--------------------------------------------
ARSA_HUMAN/368-501------------------------.....YKAHFFT--------------------------------------------
E4XNY3_OIKDI/402-532------------------------.....YKMHVYT--------------------------------------------
C3ZV84_BRAFL/657-789------------------------.....YKAHFWT--------------------------------------------
Q4SI19_TETNG/405-541------------------------.....YKAHYWT--------------------------------------------
F1QFT2_DANRE/220-352------------------------.....YKAHYWT--------------------------------------------
Q5XG10_XENLA/375-507------------------------.....HKAHYWT--------------------------------------------
GALNS_CANFA/377-509------------------------.....YKAHFWT--------------------------------------------
F1NW57_CHICK/376-508------------------------.....YKAHYWT--------------------------------------------
A0YAF7_9GAMM/381-478------------------------.....WKVHFKT--------------------------------------------
Q0C069_HYPNA/397-504------------------------.....YKAHFST--------------------------------------------
ARS_STRPU/411-541------------------------.....YKAHFKT--------------------------------------------
ARS_HEMPU/396-526------------------------.....YKAHFRT--------------------------------------------
O16138_HELER/402-534------------------------.....YKAHFKT--------------------------------------------
A4AN36_MARSH/378-468------------------------.....YKAHYIT--------------------------------------------
A4CMB0_ROBBH/401-491------------------------.....YKAHFYT--------------------------------------------
A3XMW9_LEEBM/382-476------------------------.....YKAHYVT--------------------------------------------
A7V8P9_BACUN/356-447------------------------.....WKIHFST--------------------------------------------
A6CB11_9PLAN/382-473------------------------.....WKAHFIT--------------------------------------------
F0SFZ7_PLABD/380-468------------------------.....WKAHFIT--------------------------------------------
C3ZQB5_BRAFL/423-551------------------------.....YKAHFYS--------------------------------------------
C3ZQC1_BRAFL/344-471------------------------.....YKAHFYS--------------------------------------------
A7SK49_NEMVE/435-563------------------------RGKSIWKAVFKT--------------------------------------------
A7SQ82_NEMVE/425-557------------------------EGKTTWKAFFFT--------------------------------------------
A7SK50_NEMVE/483-612------------------------SGHTTWKAHFMT--------------------------------------------
Q7ZWB8_DANRE/433-548------------------------NSSAIWKAFFFT--------------------------------------------
Q6DJK3_XENLA/433-566------------------------SNQTVWKVHYMS--------------------------------------------
Q32KK0_RAT/450-603------------------------DSGQVWKAHFVT--------------------------------------------
F1QB82_DANRE/433-568------------------------NSSAIWKAFFFT--------------------------------------------
Q4RYA1_TETNG/304-429------------------------NSSSVWKAFYFT--------------------------------------------
STS_MOUSE/445-581------------------------.GSAVWKAFYFT--------------------------------------------
STS_RAT/436-573------------------------NSSSVWKAFYFT--------------------------------------------
STS_HUMAN/437-572------------------------NSTSIWKAFFFT--------------------------------------------
D2HXW7_AILME/434-569------------------------NSTSVWKAFFFT--------------------------------------------
Q4TCJ7_TETNG/242-385------------------------GSDSVFKVHFFT--------------------------------------------
Q6GMA1_XENLA/439-573------------------------ESGAVWKAHFIT--------------------------------------------
ARSF_HUMAN/440-574------------------------DSGSVWKAHYVT--------------------------------------------
Q32KI0_CANFA/435-568------------------------DSDAVWKVHYVT--------------------------------------------
ARSE_HUMAN/448-582------------------------DRGTMWKVHFVT--------------------------------------------
Q32KI1_CANFA/444-578------------------------DGGRLWKVHYMT--------------------------------------------
A5D7J7_BOVIN/445-576------------------------D...LWKVHFTT--------------------------------------------
ARSH_HUMAN/418-551------------------------DCATVWKAHYVT--------------------------------------------
F1NFQ0_CHICK/445-579------------------------DSGAIWKAHYVT--------------------------------------------
D2HFI2_AILME/436-570------------------------DSGRLWKVHYMT--------------------------------------------
ARSD_HUMAN/451-585------------------------DSGSVWKVHYTT--------------------------------------------
C3Y4J9_BRAFL/389-521------------------------QGNSTWKVHFTT--------------------------------------------
C3Y4X6_BRAFL/434-568------------------------KGKVTWKAQFAT--------------------------------------------
C3YBU1_BRAFL/392-524------------------------EGNVTWKAHFVS--------------------------------------------
C3ZST4_BRAFL/433-562------------------------EGNVTWKAHFVS--------------------------------------------
C3Z258_BRAFL/432-564------------------------KGNVTWKAHFVS--------------------------------------------
C3YQ76_BRAFL/419-552------------------------TGGSIWKAHYAT--------------------------------------------
C3YZM0_BRAFL/417-549------------------------TGNSVYKAHYIT--------------------------------------------

PF01663

Q7NDL2_GLOVI/4-434---GRTP-------------------------------------------------------------------------
Q9X5T4_STRLA/7-389---GRRA-------------------------------------------------------------------------
B0R301_HALS3/15-396---GVNP-------------------------------------------------------------------------
Q9X5S1_STRLA/5-395---GTNP-------------------------------------------------------------------------
Q9X5R9_STRLA/7-410---ASDP-------------------------------------------------------------------------
Q9YCS9_AERPE/3-432---GLNP-------------------------------------------------------------------------
Q9X5S9_STRLA/7-409---GRSP-------------------------------------------------------------------------
Q9UZH6_PYRAB/14-420---SKTP-------------------------------------------------------------------------
Q9YCR2_AERPE/4-405---GRSA-------------------------------------------------------------------------
V5Q348_ZYMMB/62-511---GDHP-------------------------------------------------------------------------
C6IK84_9BACE/29-473---GSTP-------------------------------------------------------------------------
ALPH_SYNE7/42-494---GSVP-------------------------------------------------------------------------
ALPH_ELIME/32-489---GSVP-------------------------------------------------------------------------
CDA_MYROD/31-491---GSVP-------------------------------------------------------------------------
Q7MEK0_VIBVY/30-506---GAPP-------------------------------------------------------------------------
Q84EY0_9GAMM/27-481---GSFP-------------------------------------------------------------------------
O29992_ARCFU/4-416---AAFP-------------------------------------------------------------------------
Q981Q5_RHILO/5-379---GVGP-------------------------------------------------------------------------
Q98IY7_RHILO/32-447---GGTP-------------------------------------------------------------------------
Q7UKE3_RHOBA/4-350---GLSP-------------------------------------------------------------------------
O69954_STRCO/13-378---GTMP-------------------------------------------------------------------------
Q8YZP2_NOSS1/4-370---GKSP-------------------------------------------------------------------------
Q7AYA7_9RHIZ/4-370---GLPP-------------------------------------------------------------------------
Q7NU73_CHRVO/4-375---GLTP-------------------------------------------------------------------------
D3MCQ1_PROAA/44-359---GAVP-------------------------------------------------------------------------
F7PA94_MYCPC/42-363---GAAP-------------------------------------------------------------------------
O50518_STRCO/58-383---GLPP-------------------------------------------------------------------------
Q6N507_RHOPA/30-497---GHYL-------------------------------------------------------------------------
Q7WNM8_BORBR/6-370---GCRP-------------------------------------------------------------------------
F0K5R6_CLOAE/8-378---GTYP-------------------------------------------------------------------------
Q8XKL9_CLOPE/10-374---GKYP-------------------------------------------------------------------------
C8K1F1_LISMN/5-366---GHYP-------------------------------------------------------------------------
Q73E52_BACC1/9-380---GNYP-------------------------------------------------------------------------
O45359_CAEEL/26-353---GTLP-------------------------------------------------------------------------
Q22129_CAEEL/24-374---GLYT-------------------------------------------------------------------------
O58841_PYRHO/4-322---GVEP-------------------------------------------------------------------------
ENPP6_XENLA/26-357---GRHC-------------------------------------------------------------------------
ENPP6_MOUSE/26-357---GRHC-------------------------------------------------------------------------
ENPP1_CAEEL/182-494---GLWP-------------------------------------------------------------------------
ENPP2_CAEEL/81-386---GLYP-------------------------------------------------------------------------
Q7MXP5_PORGI/37-349---GLYP-------------------------------------------------------------------------
ENPP7_HUMAN/33-356---GKYI-------------------------------------------------------------------------
Q6ZM30_DANRE/31-356---GRYI-------------------------------------------------------------------------
Q6CX45_KLULA/136-460---GQFP-------------------------------------------------------------------------
ENPP5_HUMAN/30-342---GLFA-------------------------------------------------------------------------
ENPP4_XENLA/30-339---GLYA-------------------------------------------------------------------------
K7BSV5_PANTR/28-339---GLYE-------------------------------------------------------------------------
Q6VZU9_CNPV/107-431---GLYP-------------------------------------------------------------------------
O90761_FOWPV/120-443---GLYP-------------------------------------------------------------------------
Q6PGY9_DANRE/161-472---GLYP-------------------------------------------------------------------------
ENPP2_RAT/165-477---GLYP-------------------------------------------------------------------------
Q7ZXN7_XENLA/166-476---GLYP-------------------------------------------------------------------------
ENPP3_MOUSE/161-485---GLYP-------------------------------------------------------------------------
ENPP1_RAT/194-520---GLYP-------------------------------------------------------------------------
Q9SU81_ARATH/60-394---GLYP-------------------------------------------------------------------------
Q9SU82_ARATH/57-390---GLYP-------------------------------------------------------------------------
Q42974_ORYSA/92-418---GLYP-------------------------------------------------------------------------
Q9FS13_SPIOL/96-418---GLYP-------------------------------------------------------------------------
Q9SU83_ARATH/109-435---GLYP-------------------------------------------------------------------------
M9N2F7_ASHG1/153-497---GRRP-------------------------------------------------------------------------
Q6FKX1_CANGA/187-587---GLYP-------------------------------------------------------------------------
N1P7V5_YEASC/170-545---GQYP-------------------------------------------------------------------------
M4TY79_9XANT/48-366---GLRP-------------------------------------------------------------------------
Q9PAB9_XYLFA/40-358---GLRP-------------------------------------------------------------------------
H2VFP5_ZYMMO/50-367---GLYP-------------------------------------------------------------------------
Q9A8S4_CAUCR/74-393---GKRP-------------------------------------------------------------------------
Q7SI20_NEUCR/254-584---GLYP-------------------------------------------------------------------------
YGK5_SCHPO/76-404---GLYP-------------------------------------------------------------------------
Q6BTN4_DEBHA/173-514---GLYP-------------------------------------------------------------------------
Q6C6J4_YARLI/277-608---GLYP-------------------------------------------------------------------------

PF00884

C3LB12_BACAC/143-439---SYSM-------------------------------------------------------------------------
A0A038KMS4_MYCTX/43-460---GRNH-------------------------------------------------------------------------
K4NNF3_HELPX/294-587---GLPY-------------------------------------------------------------------------
A1IT97_NEIMA/232-524---TFDR-------------------------------------------------------------------------
E8VE61_BACST/245-536---SLYP-------------------------------------------------------------------------
O43113_NEUCS/45-420---GKQA-------------------------------------------------------------------------
A0A038F731_MYCTX/212-635---GRNH-------------------------------------------------------------------------
O82879_STRMG/460-745---GLPY-------------------------------------------------------------------------
O85099_ECOLX/237-530---FANE-------------------------------------------------------------------------
A0A017IKP4_ECOLX/260-505---GISP-------------------------------------------------------------------------
ARS_HEMPU/52-373---GRLP-------------------------------------------------------------------------
ARS_CHLRE/27-385---GQFA-------------------------------------------------------------------------
ARSA_HUMAN/21-346---GRLP-------------------------------------------------------------------------
A0A017J6J3_ECOLX/86-419---GQYS-------------------------------------------------------------------------
A0A017J597_ECOLX/236-527---DMPR-------------------------------------------------------------------------
A0A017HZX0_ECOLX/4-341---GIYA-------------------------------------------------------------------------
ARSB_FELCA/47-366---GRYQ-------------------------------------------------------------------------
GALNS_HUMAN/31-355---GRLP-------------------------------------------------------------------------
A0A017I1Q5_ECOLX/248-538---RQGG-------------------------------------------------------------------------
C9MG45_HAEIF/211-475---RAE.-------------------------------------------------------------------------
GNS_CAPHI/54-391---GKYP-------------------------------------------------------------------------
STS_MOUSE/35-421---GRYP-------------------------------------------------------------------------
ARS_STRPU/67-388---GRQP-------------------------------------------------------------------------
SPHM_HUMAN/23-328---GLPQ-------------------------------------------------------------------------
A0A022NJX0_PSEAI/5-420---GTDH-------------------------------------------------------------------------
E8H705_ECO57/223-491---ADSV-------------------------------------------------------------------------
F6BMG6_SINMB/269-561---GFSN-------------------------------------------------------------------------
A0A017IT13_ECOLX/217-483---RVV.-------------------------------------------------------------------------
A0A024LN14_ECOLX/58-408---GRAP-------------------------------------------------------------------------
A0A038FFI8_MYCTX/37-466---GRNA-------------------------------------------------------------------------
A0A038VAH2_MYCTX/5-389---GQYP-------------------------------------------------------------------------
Q0Z8S6_VOLCA/26-386---GQFS-------------------------------------------------------------------------
Q45087_9BURK/4-384---GLYL-------------------------------------------------------------------------
A0A059MXH6_ENTFL/256-543---SFSM-------------------------------------------------------------------------
Q840W2_STRMG/270-555---GLPF-------------------------------------------------------------------------
M2E9Z0_STRMG/503-788---GLPY-------------------------------------------------------------------------
Q8G592_BIFLO/306-604---GLSM-------------------------------------------------------------------------
A0A029SCQ9_STRPY/480-765---SLPF-------------------------------------------------------------------------
Q8P1I3_STRP8/480-765---SLPF-------------------------------------------------------------------------
Q8XK47_CLOPE/257-551---GLST-------------------------------------------------------------------------
Q984T6_RHILO/281-574---GFSN-------------------------------------------------------------------------
Q98EG2_RHILO/158-441---SRQY-------------------------------------------------------------------------
Q9A0F9_STRP1/480-765---SLPF-------------------------------------------------------------------------
Q9AI31_BURML/214-497---GLPS-------------------------------------------------------------------------
H8ID57_PASMH/287-557---GFTP-------------------------------------------------------------------------
Q9CM05_PASMU/231-523---SLDR-------------------------------------------------------------------------
A0A030RTZ7_PSEAI/238-530---FADQ-------------------------------------------------------------------------
A0A022NH93_PSEAI/238-529---QYPR-------------------------------------------------------------------------
A0A030XY34_PSEAI/231-522---NLGR-------------------------------------------------------------------------
A0A030YI64_PSEAI/223-501---GDYS-------------------------------------------------------------------------
F0ADR9_NEIME/214-487---AIPH-------------------------------------------------------------------------
A0A016X8V3_VIBCL/240-530---NMNR-------------------------------------------------------------------------
Q9PGC7_XYLFA/245-535---PYGR-------------------------------------------------------------------------
Q9RBI1_ACIAD/237-531---GMPR-------------------------------------------------------------------------
Q9RMJ0_NEIME/232-495---....-------------------------------------------------------------------------
Q9X6R2_PSEAI/20-300---CFPN-------------------------------------------------------------------------
D5AWR1_RICPP/218-505---RYPA-------------------------------------------------------------------------
Q9ZJJ5_HELPJ/225-518---YSDA-------------------------------------------------------------------------
Q9ZN39_HELPJ/222-504---SSFK-------------------------------------------------------------------------

PF02995

Q19148_CAEEL/61-607---GFDS-------------------------------------------------------------------------
O18062_CAEEL/67-538---TIDA-------------------------------------------------------------------------
Q9VSJ3_DROME/115-607---GIDS-------------------------------------------------------------------------
Q21671_CAEEL/74-651---LLDS-------------------------------------------------------------------------
Q9VGG4_DROME/77-573---GIDS-------------------------------------------------------------------------
Q9VQH3_DROME/74-555---GVDS-------------------------------------------------------------------------
Q9VAU4_DROME/90-580---GIDS-------------------------------------------------------------------------
Q9VKK3_DROME/98-598---GMDS-------------------------------------------------------------------------
Q19486_CAEEL/79-568---GLDS-------------------------------------------------------------------------
Q9V9Q1_DROME/66-560---GLDS-------------------------------------------------------------------------
Q9VF91_DROME/73-581---GFDS-------------------------------------------------------------------------
Q9VLG3_DROME/84-577---GIDS-------------------------------------------------------------------------
Q9V9P7_DROME/68-547---GIDS-------------------------------------------------------------------------
O62436_CAEEL/78-581---GFDS-------------------------------------------------------------------------
Q9W0F7_DROME/16-518---GIDS-------------------------------------------------------------------------
Q8SY05_DROME/180-657---GIDS-------------------------------------------------------------------------
Q9VIP6_DROME/56-555---GLDS-------------------------------------------------------------------------

PF01676

APGM2_ARCFU/1-380...GRGP.........................................................................
DEOB_GEOSE/6-381PASGTAI.........................................................................
E8VA73_BACST/4-499...GRIVYQS......................................................................
APGM_AQUAE/13-398...GRGI.........................................................................
A0A017I0E2_ECOLX/6-501...GRIVYQD......................................................................
I0ZIS4_HELPX/3-399HASGTEI.........................................................................
PMGI_MESCR/20-545...GRIYAQG......................................................................
GPMI_PORPU/7-507...GRVVEQE......................................................................
F7URM6_SYNYG/7-504...GRVVPQE......................................................................
APGM_PYRHO/5-403...GRGF.........................................................................
PMGI_MAIZE/20-545...GRIFAQG......................................................................
PMGI_RICCO/17-542...GRIYAQG......................................................................
G4EU83_BACIU/7-382PASGTAI.........................................................................
APGM1_ARCFU/1-399...GRGP.........................................................................
APGM1_METJA/4-402...GRGP.........................................................................
D8KJJ3_LACLN/6-399PYSGTAV.........................................................................
B1X727_ECODH/2-390VAIGDNL.........................................................................
GPMI_PSESM/6-497...GRVVYQD......................................................................
GPMI_ANTSP/7-499...GRIINQD......................................................................
I0ZG59_HELPX/3-482...GRVLYQD......................................................................
PMGI_TOBAC/20-545...GRIFAQG......................................................................
M7ZXD7_TRIUA/25-880LPPSRVYDHHIHLVPGSTPVAVRPYRYPQLQKDELERQCALMLAAGIIRTSTSPFTAPALLVRKSDGTWRFCIDYRALNA
A0A009END8_ECOLX/2-399HSSGTVI.........................................................................
APGM2_METTH/4-396...GRGP.........................................................................
GPMI_MYCGE/3-493...GRVVYTG......................................................................
M1GCD6_MYCPM/3-494...GRIVYTG......................................................................
GPMI_HELPY/3-482...GRVLYQD......................................................................
APGM1_METTH/1-400...GRGP.........................................................................
APGM2_METJA/1-398...GRGV.........................................................................

PF00245

PPB_BOMMO/74-515---GVKA-------------------------------------------------------------------------
PPBT_BOVIN/51-490---GVKA-------------------------------------------------------------------------
PPBI_MOUSE/52-486---GVKT-------------------------------------------------------------------------
PPBN_MOUSE/51-486---GVKT-------------------------------------------------------------------------
PPB1_HUMAN/55-490---GVKG-------------------------------------------------------------------------
B1W385_STRGG/41-448---GRRT-------------------------------------------------------------------------
A0A017K3Y5_ECOLX/64-470---GVKT-------------------------------------------------------------------------
A0A023ZB72_YEASX/66-527---ALKS-------------------------------------------------------------------------
J7JQ01_BACIU/49-459---GVKT-------------------------------------------------------------------------
G4EZI5_BACIU/43-455---GIKT-------------------------------------------------------------------------

PF08665

Q2RKS0_MOOTA/260-429---GRP.-------------------------------------------------------------------------
Q72AH5_DESVH/438-616---NKAL-------------------------------------------------------------------------
Q8TNC5_METAC/496-671---HNAL-------------------------------------------------------------------------
Q3A8U0_CARHZ/461-637---HKKI-------------------------------------------------------------------------
B1YIB9_EXIS2/462-638---HRKL-------------------------------------------------------------------------
Q5P0R1_AROAE/485-661---HHSL-------------------------------------------------------------------------
Q2W5M5_MAGSA/475-648---HSKI-------------------------------------------------------------------------
Q8ZK15_SALTY/474-650---HDEI-------------------------------------------------------------------------
Q7MVV4_PORGI/231-425---GLMP-------------------------------------------------------------------------
A5EWI8_DICNV/401-578---GKPP-------------------------------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480---GCQA-------------------------------------------------------------------------
Q7UHL2_RHOBA/84-501---SMHG-------------------------------------------------------------------------
Q7UN58_RHOBA/63-468---SMHT-------------------------------------------------------------------------
Q98BS1_RHILO/39-404---AM.P-------------------------------------------------------------------------
Q7UHK7_RHOBA/71-478---SCYS-------------------------------------------------------------------------
Q7UKW9_RHOBA/100-522---SMHT-------------------------------------------------------------------------
Q8P3X8_XANCP/29-384---VVGE-------------------------------------------------------------------------
Q7UZ35_RHOBA/49-467---SMHT-------------------------------------------------------------------------
Q7UFP1_RHOBA/49-464---SMHT-------------------------------------------------------------------------
Q7MLK9_VIBVY/33-420---AM.S-------------------------------------------------------------------------
Q7US09_RHOBA/66-482---SCWT-------------------------------------------------------------------------
Q7VYL6_BORPE/29-381---AVKD-------------------------------------------------------------------------
Q7UDW2_RHOBA/77-502---TVKT-------------------------------------------------------------------------
Q87HJ3_VIBPA/35-425---KL.S-------------------------------------------------------------------------
Q7UM62_RHOBA/63-489---SMHT-------------------------------------------------------------------------
Q7UJ64_RHOBA/59-474---GCQV-------------------------------------------------------------------------
Q7UIF5_RHOBA/61-494---SMWT-------------------------------------------------------------------------
Q7UYJ8_RHOBA/60-484---SLTG-------------------------------------------------------------------------
Q7MCK0_VIBVY/38-408---AL.D-------------------------------------------------------------------------
Q9A5N3_CAUCR/44-506---LM.P-------------------------------------------------------------------------
Q7ULC1_RHOBA/52-445---SIRH-------------------------------------------------------------------------
Q7UQT8_RHOBA/50-438---GVSH-------------------------------------------------------------------------
Q7UQ29_RHOBA/54-472---SMYA-------------------------------------------------------------------------
Q7UGB9_RHOBA/69-492---TLHT-------------------------------------------------------------------------
Q7UPP6_RHOBA/56-434---SLST-------------------------------------------------------------------------
Q7UI66_RHOBA/46-421---SMST-------------------------------------------------------------------------
Q7UVE3_RHOBA/81-505---SMVT-------------------------------------------------------------------------
Q7UW70_RHOBA/70-497---SMSY-------------------------------------------------------------------------
Q7UKM6_RHOBA/69-495---SMWT-------------------------------------------------------------------------
Q7UTL9_RHOBA/100-490---TVHH-------------------------------------------------------------------------
Q7UGF5_RHOBA/94-499---SCYH-------------------------------------------------------------------------
Q9A6V4_CAUCR/38-393---DL.K-------------------------------------------------------------------------
Q7UYC8_RHOBA/101-527---SMHT-------------------------------------------------------------------------
Q7UR29_RHOBA/60-444---SMSH-------------------------------------------------------------------------
Q7UYM7_RHOBA/45-446---GLST-------------------------------------------------------------------------
Q7UV65_RHOBA/50-468---SLHG-------------------------------------------------------------------------
Q7UJ54_RHOBA/70-497---STHT-------------------------------------------------------------------------
Q7UJ36_RHOBA/99-512---SMKT-------------------------------------------------------------------------
Q7NT93_CHRVO/33-383---SL.A-------------------------------------------------------------------------
Q7UEK9_RHOBA/80-501---SLTN-------------------------------------------------------------------------
Q7UQW1_RHOBA/70-487---SMVS-------------------------------------------------------------------------
Q7UPF7_RHOBA/65-448---SVVG-------------------------------------------------------------------------
Q7UYR5_RHOBA/95-521---SMYT-------------------------------------------------------------------------
Q7UWA1_RHOBA/72-492---SLTA-------------------------------------------------------------------------
Q89DL5_BRADU/42-392---AM.P-------------------------------------------------------------------------
Q7URV7_RHOBA/77-499---SLNT-------------------------------------------------------------------------
Q7MDY0_VIBVY/67-457---AM.S-------------------------------------------------------------------------
Q7UH70_RHOBA/75-488---SMVT-------------------------------------------------------------------------
Q7UVE1_RHOBA/82-507---SMQT-------------------------------------------------------------------------
Q7UQ53_RHOBA/45-480---NMVG-------------------------------------------------------------------------
Q7UP10_RHOBA/69-492---SMYT-------------------------------------------------------------------------

PF04185

Q47936_FRANO/55-471---QEIS-------------------------------------------------------------------------
PHOX_KLULA/65-312---....-------------------------------------------------------------------------
Q98ES1_RHILO/58-274---....-------------------------------------------------------------------------
A0A038F821_MYCTX/50-282---....-------------------------------------------------------------------------
D0KPN6_SULS9/27-365---SYHG-------------------------------------------------------------------------
NPC6_ARATH/59-394---AVEQ-------------------------------------------------------------------------
NPC5_ARATH/13-380---DIYE-------------------------------------------------------------------------
NPC3_ARATH/16-381---AIYE-------------------------------------------------------------------------
NPC1_ARATH/38-396---AIRE-------------------------------------------------------------------------
NPC2_ARATH/27-389---AIRE-------------------------------------------------------------------------
Q9KH04_BURML/84-547---QNQM-------------------------------------------------------------------------
Q983N8_RHILO/60-507---QNQM-------------------------------------------------------------------------
E2TNP6_MYCTX/52-433---AAHL-------------------------------------------------------------------------
A1KJH2_MYCBP/50-429---AMHE-------------------------------------------------------------------------
A4KJA2_MYCTX/52-435---GMHN-------------------------------------------------------------------------
A5WPW5_MYCTF/51-431---GMHL-------------------------------------------------------------------------
A0A030U552_PSEAI/51-437---AFHA-------------------------------------------------------------------------
A3NXI4_BURP0/47-438---DMHG-------------------------------------------------------------------------
B8H354_CAUCN/40-437---DAQD-------------------------------------------------------------------------
A0A022NDQ0_PSEAI/48-422---DAQQ-------------------------------------------------------------------------

PF16347

G2PRM5_MURRD/414-516--------------------------------------------------------------------------------
G7USR5_PSEUP/397-499--------------------------------------------------------------------------------
D5BJX1_ZUNPS/413-515--------------------------------------------------------------------------------
G0J719_CYCMS/407-508--------------------------------------------------------------------------------
D2R402_PIRSD/397-498--------------------------------------------------------------------------------
G8NQI2_GRAMM/379-480--------------------------------------------------------------------------------
D2QMZ8_SPILD/410-511--------------------------------------------------------------------------------
A4AWR6_MARSH/414-516--------------------------------------------------------------------------------
A6LDP5_PARD8/412-514--------------------------------------------------------------------------------
A4CJM0_ROBBH/381-483--------------------------------------------------------------------------------
A2TWV5_9FLAO/422-523--------------------------------------------------------------------------------
G8UMU5_TANFA/417-519--------------------------------------------------------------------------------
D5BJT8_ZUNPS/386-488--------------------------------------------------------------------------------
F9YSE0_CAPCC/401-501--------------------------------------------------------------------------------
D3IBE7_9BACT/417-519--------------------------------------------------------------------------------
C7M893_CAPOD/396-496--------------------------------------------------------------------------------
G0J436_CYCMS/421-522--------------------------------------------------------------------------------
A3HWF8_9BACT/418-520--------------------------------------------------------------------------------
E8V2R6_TERSS/392-493--------------------------------------------------------------------------------
G8TRD3_NIAKG/412-512--------------------------------------------------------------------------------
H8KTX9_SOLCM/409-510--------------------------------------------------------------------------------
F4L7F1_HALH1/402-503--------------------------------------------------------------------------------
F3ZRQ1_9BACE/413-515--------------------------------------------------------------------------------
E6SVH3_BACT6/418-520--------------------------------------------------------------------------------
D2QEZ9_SPILD/447-548--------------------------------------------------------------------------------
G0IUX7_CYCMS/423-524--------------------------------------------------------------------------------
G0L151_ZOBGA/413-515--------------------------------------------------------------------------------
A6KZU2_BACV8/416-518--------------------------------------------------------------------------------
A6L8Y1_PARD8/413-515--------------------------------------------------------------------------------
I3YHK1_ALIFI/406-508--------------------------------------------------------------------------------
Q5LAU2_BACFN/415-517--------------------------------------------------------------------------------
R5M554_9BACE/414-516--------------------------------------------------------------------------------
R5UAM5_9BACE/410-512--------------------------------------------------------------------------------
R7DGX3_9PORP/412-514--------------------------------------------------------------------------------
W0EZJ7_9SPHI/397-497--------------------------------------------------------------------------------

PF14707

A9VBN0_MONBE/428-544---....-------------------------------------------------------------------------
E6ZGQ8_DICLA/413-534---....-------------------------------------------------------------------------
Q4S4L1_TETNG/407-528---....-------------------------------------------------------------------------
E1BU03_CHICK/390-510---....-------------------------------------------------------------------------
ARSG_MOUSE/402-522---....-------------------------------------------------------------------------
A6QLR7_BOVIN/402-522---....-------------------------------------------------------------------------
ARSG_CANFA/402-522---....-------------------------------------------------------------------------
B4DQ74_HUMAN/301-421---....-------------------------------------------------------------------------
A9V957_MONBE/437-571---....-------------------------------------------------------------------------
F0Y2N2_AURAN/404-544---....-------------------------------------------------------------------------
Q1YP24_9GAMM/409-501---....-------------------------------------------------------------------------
C6W2Y6_DYAFD/349-461---....-------------------------------------------------------------------------
D7VQY4_9SPHI/353-442---....-------------------------------------------------------------------------
F2UD41_SALR5/491-612---....-------------------------------------------------------------------------
A9UXW0_MONBE/287-431---....-------------------------------------------------------------------------
F2UKF0_SALR5/383-527---....-------------------------------------------------------------------------
B9QU81_9RHOB/44-158---....-------------------------------------------------------------------------
E4YGB6_OIKDI/449-582---....-------------------------------------------------------------------------
F2U742_SALR5/410-535---....-------------------------------------------------------------------------
A9UPM8_MONBE/326-451---....-------------------------------------------------------------------------
A8XD87_CAEBR/394-528---....-------------------------------------------------------------------------
E1FX25_LOALO/406-541---....-------------------------------------------------------------------------
F1KQC6_ASCSU/1702-1837---....-------------------------------------------------------------------------
F2UCT8_SALR5/90-221---....-------------------------------------------------------------------------
A9V7E7_MONBE/452-571---....-------------------------------------------------------------------------
C1BQY6_9MAXI/368-496---....-------------------------------------------------------------------------
Q4RJR3_TETNG/343-473---....-------------------------------------------------------------------------
Q6AX40_XENLA/368-499---....-------------------------------------------------------------------------
A1L2N0_XENLA/374-505---....-------------------------------------------------------------------------
F1NWF7_CHICK/373-504---....-------------------------------------------------------------------------
Q32KK2_RAT/368-501---....-------------------------------------------------------------------------
ARSA_BOVIN/368-501---....-------------------------------------------------------------------------
ARSA_HUMAN/368-501---....-------------------------------------------------------------------------
E4XNY3_OIKDI/402-532---....-------------------------------------------------------------------------
C3ZV84_BRAFL/657-789---....-------------------------------------------------------------------------
Q4SI19_TETNG/405-541---....-------------------------------------------------------------------------
F1QFT2_DANRE/220-352---....-------------------------------------------------------------------------
Q5XG10_XENLA/375-507---....-------------------------------------------------------------------------
GALNS_CANFA/377-509---....-------------------------------------------------------------------------
F1NW57_CHICK/376-508---....-------------------------------------------------------------------------
A0YAF7_9GAMM/381-478---....-------------------------------------------------------------------------
Q0C069_HYPNA/397-504---....-------------------------------------------------------------------------
ARS_STRPU/411-541---....-------------------------------------------------------------------------
ARS_HEMPU/396-526---....-------------------------------------------------------------------------
O16138_HELER/402-534---....-------------------------------------------------------------------------
A4AN36_MARSH/378-468---....-------------------------------------------------------------------------
A4CMB0_ROBBH/401-491---....-------------------------------------------------------------------------
A3XMW9_LEEBM/382-476---....-------------------------------------------------------------------------
A7V8P9_BACUN/356-447---....-------------------------------------------------------------------------
A6CB11_9PLAN/382-473---....-------------------------------------------------------------------------
F0SFZ7_PLABD/380-468---....-------------------------------------------------------------------------
C3ZQB5_BRAFL/423-551---MELP-------------------------------------------------------------------------
C3ZQC1_BRAFL/344-471---MELP-------------------------------------------------------------------------
A7SK49_NEMVE/435-563---....-------------------------------------------------------------------------
A7SQ82_NEMVE/425-557---....-------------------------------------------------------------------------
A7SK50_NEMVE/483-612---....-------------------------------------------------------------------------
Q7ZWB8_DANRE/433-548---....-------------------------------------------------------------------------
Q6DJK3_XENLA/433-566---....-------------------------------------------------------------------------
Q32KK0_RAT/450-603---....-------------------------------------------------------------------------
F1QB82_DANRE/433-568---....-------------------------------------------------------------------------
Q4RYA1_TETNG/304-429---....-------------------------------------------------------------------------
STS_MOUSE/445-581---....-------------------------------------------------------------------------
STS_RAT/436-573---....-------------------------------------------------------------------------
STS_HUMAN/437-572---....-------------------------------------------------------------------------
D2HXW7_AILME/434-569---....-------------------------------------------------------------------------
Q4TCJ7_TETNG/242-385---....-------------------------------------------------------------------------
Q6GMA1_XENLA/439-573---....-------------------------------------------------------------------------
ARSF_HUMAN/440-574---....-------------------------------------------------------------------------
Q32KI0_CANFA/435-568---....-------------------------------------------------------------------------
ARSE_HUMAN/448-582---....-------------------------------------------------------------------------
Q32KI1_CANFA/444-578---....-------------------------------------------------------------------------
A5D7J7_BOVIN/445-576---....-------------------------------------------------------------------------
ARSH_HUMAN/418-551---....-------------------------------------------------------------------------
F1NFQ0_CHICK/445-579---....-------------------------------------------------------------------------
D2HFI2_AILME/436-570---....-------------------------------------------------------------------------
ARSD_HUMAN/451-585---....-------------------------------------------------------------------------
C3Y4J9_BRAFL/389-521---....-------------------------------------------------------------------------
C3Y4X6_BRAFL/434-568---....-------------------------------------------------------------------------
C3YBU1_BRAFL/392-524---....-------------------------------------------------------------------------
C3ZST4_BRAFL/433-562---....-------------------------------------------------------------------------
C3Z258_BRAFL/432-564---....-------------------------------------------------------------------------
C3YQ76_BRAFL/419-552---....-------------------------------------------------------------------------
C3YZM0_BRAFL/417-549---....-------------------------------------------------------------------------

PF01663

Q7NDL2_GLOVI/4-434--------------------------------------------------------------------------------
Q9X5T4_STRLA/7-389--------------------------------------------------------------------------------
B0R301_HALS3/15-396--------------------------------------------------------------------------------
Q9X5S1_STRLA/5-395--------------------------------------------------------------------------------
Q9X5R9_STRLA/7-410--------------------------------------------------------------------------------
Q9YCS9_AERPE/3-432--------------------------------------------------------------------------------
Q9X5S9_STRLA/7-409--------------------------------------------------------------------------------
Q9UZH6_PYRAB/14-420--------------------------------------------------------------------------------
Q9YCR2_AERPE/4-405--------------------------------------------------------------------------------
V5Q348_ZYMMB/62-511--------------------------------------------------------------------------------
C6IK84_9BACE/29-473--------------------------------------------------------------------------------
ALPH_SYNE7/42-494--------------------------------------------------------------------------------
ALPH_ELIME/32-489--------------------------------------------------------------------------------
CDA_MYROD/31-491--------------------------------------------------------------------------------
Q7MEK0_VIBVY/30-506--------------------------------------------------------------------------------
Q84EY0_9GAMM/27-481--------------------------------------------------------------------------------
O29992_ARCFU/4-416--------------------------------------------------------------------------------
Q981Q5_RHILO/5-379--------------------------------------------------------------------------------
Q98IY7_RHILO/32-447--------------------------------------------------------------------------------
Q7UKE3_RHOBA/4-350--------------------------------------------------------------------------------
O69954_STRCO/13-378--------------------------------------------------------------------------------
Q8YZP2_NOSS1/4-370--------------------------------------------------------------------------------
Q7AYA7_9RHIZ/4-370--------------------------------------------------------------------------------
Q7NU73_CHRVO/4-375--------------------------------------------------------------------------------
D3MCQ1_PROAA/44-359--------------------------------------------------------------------------------
F7PA94_MYCPC/42-363--------------------------------------------------------------------------------
O50518_STRCO/58-383--------------------------------------------------------------------------------
Q6N507_RHOPA/30-497--------------------------------------------------------------------------------
Q7WNM8_BORBR/6-370--------------------------------------------------------------------------------
F0K5R6_CLOAE/8-378--------------------------------------------------------------------------------
Q8XKL9_CLOPE/10-374--------------------------------------------------------------------------------
C8K1F1_LISMN/5-366--------------------------------------------------------------------------------
Q73E52_BACC1/9-380--------------------------------------------------------------------------------
O45359_CAEEL/26-353--------------------------------------------------------------------------------
Q22129_CAEEL/24-374--------------------------------------------------------------------------------
O58841_PYRHO/4-322--------------------------------------------------------------------------------
ENPP6_XENLA/26-357--------------------------------------------------------------------------------
ENPP6_MOUSE/26-357--------------------------------------------------------------------------------
ENPP1_CAEEL/182-494--------------------------------------------------------------------------------
ENPP2_CAEEL/81-386--------------------------------------------------------------------------------
Q7MXP5_PORGI/37-349--------------------------------------------------------------------------------
ENPP7_HUMAN/33-356--------------------------------------------------------------------------------
Q6ZM30_DANRE/31-356--------------------------------------------------------------------------------
Q6CX45_KLULA/136-460--------------------------------------------------------------------------------
ENPP5_HUMAN/30-342--------------------------------------------------------------------------------
ENPP4_XENLA/30-339--------------------------------------------------------------------------------
K7BSV5_PANTR/28-339--------------------------------------------------------------------------------
Q6VZU9_CNPV/107-431--------------------------------------------------------------------------------
O90761_FOWPV/120-443--------------------------------------------------------------------------------
Q6PGY9_DANRE/161-472--------------------------------------------------------------------------------
ENPP2_RAT/165-477--------------------------------------------------------------------------------
Q7ZXN7_XENLA/166-476--------------------------------------------------------------------------------
ENPP3_MOUSE/161-485--------------------------------------------------------------------------------
ENPP1_RAT/194-520--------------------------------------------------------------------------------
Q9SU81_ARATH/60-394--------------------------------------------------------------------------------
Q9SU82_ARATH/57-390--------------------------------------------------------------------------------
Q42974_ORYSA/92-418--------------------------------------------------------------------------------
Q9FS13_SPIOL/96-418--------------------------------------------------------------------------------
Q9SU83_ARATH/109-435--------------------------------------------------------------------------------
M9N2F7_ASHG1/153-497--------------------------------------------------------------------------------
Q6FKX1_CANGA/187-587--------------------------------------------------------------------------------
N1P7V5_YEASC/170-545--------------------------------------------------------------------------------
M4TY79_9XANT/48-366--------------------------------------------------------------------------------
Q9PAB9_XYLFA/40-358--------------------------------------------------------------------------------
H2VFP5_ZYMMO/50-367--------------------------------------------------------------------------------
Q9A8S4_CAUCR/74-393--------------------------------------------------------------------------------
Q7SI20_NEUCR/254-584--------------------------------------------------------------------------------
YGK5_SCHPO/76-404--------------------------------------------------------------------------------
Q6BTN4_DEBHA/173-514--------------------------------------------------------------------------------
Q6C6J4_YARLI/277-608--------------------------------------------------------------------------------

PF00884

C3LB12_BACAC/143-439--------------------------------------------------------------------------------
A0A038KMS4_MYCTX/43-460--------------------------------------------------------------------------------
K4NNF3_HELPX/294-587--------------------------------------------------------------------------------
A1IT97_NEIMA/232-524--------------------------------------------------------------------------------
E8VE61_BACST/245-536--------------------------------------------------------------------------------
O43113_NEUCS/45-420--------------------------------------------------------------------------------
A0A038F731_MYCTX/212-635--------------------------------------------------------------------------------
O82879_STRMG/460-745--------------------------------------------------------------------------------
O85099_ECOLX/237-530--------------------------------------------------------------------------------
A0A017IKP4_ECOLX/260-505--------------------------------------------------------------------------------
ARS_HEMPU/52-373--------------------------------------------------------------------------------
ARS_CHLRE/27-385--------------------------------------------------------------------------------
ARSA_HUMAN/21-346--------------------------------------------------------------------------------
A0A017J6J3_ECOLX/86-419--------------------------------------------------------------------------------
A0A017J597_ECOLX/236-527--------------------------------------------------------------------------------
A0A017HZX0_ECOLX/4-341--------------------------------------------------------------------------------
ARSB_FELCA/47-366--------------------------------------------------------------------------------
GALNS_HUMAN/31-355--------------------------------------------------------------------------------
A0A017I1Q5_ECOLX/248-538--------------------------------------------------------------------------------
C9MG45_HAEIF/211-475--------------------------------------------------------------------------------
GNS_CAPHI/54-391--------------------------------------------------------------------------------
STS_MOUSE/35-421--------------------------------------------------------------------------------
ARS_STRPU/67-388--------------------------------------------------------------------------------
SPHM_HUMAN/23-328--------------------------------------------------------------------------------
A0A022NJX0_PSEAI/5-420--------------------------------------------------------------------------------
E8H705_ECO57/223-491--------------------------------------------------------------------------------
F6BMG6_SINMB/269-561--------------------------------------------------------------------------------
A0A017IT13_ECOLX/217-483--------------------------------------------------------------------------------
A0A024LN14_ECOLX/58-408--------------------------------------------------------------------------------
A0A038FFI8_MYCTX/37-466--------------------------------------------------------------------------------
A0A038VAH2_MYCTX/5-389--------------------------------------------------------------------------------
Q0Z8S6_VOLCA/26-386--------------------------------------------------------------------------------
Q45087_9BURK/4-384--------------------------------------------------------------------------------
A0A059MXH6_ENTFL/256-543--------------------------------------------------------------------------------
Q840W2_STRMG/270-555--------------------------------------------------------------------------------
M2E9Z0_STRMG/503-788--------------------------------------------------------------------------------
Q8G592_BIFLO/306-604--------------------------------------------------------------------------------
A0A029SCQ9_STRPY/480-765--------------------------------------------------------------------------------
Q8P1I3_STRP8/480-765--------------------------------------------------------------------------------
Q8XK47_CLOPE/257-551--------------------------------------------------------------------------------
Q984T6_RHILO/281-574--------------------------------------------------------------------------------
Q98EG2_RHILO/158-441--------------------------------------------------------------------------------
Q9A0F9_STRP1/480-765--------------------------------------------------------------------------------
Q9AI31_BURML/214-497--------------------------------------------------------------------------------
H8ID57_PASMH/287-557--------------------------------------------------------------------------------
Q9CM05_PASMU/231-523--------------------------------------------------------------------------------
A0A030RTZ7_PSEAI/238-530--------------------------------------------------------------------------------
A0A022NH93_PSEAI/238-529--------------------------------------------------------------------------------
A0A030XY34_PSEAI/231-522--------------------------------------------------------------------------------
A0A030YI64_PSEAI/223-501--------------------------------------------------------------------------------
F0ADR9_NEIME/214-487--------------------------------------------------------------------------------
A0A016X8V3_VIBCL/240-530--------------------------------------------------------------------------------
Q9PGC7_XYLFA/245-535--------------------------------------------------------------------------------
Q9RBI1_ACIAD/237-531--------------------------------------------------------------------------------
Q9RMJ0_NEIME/232-495--------------------------------------------------------------------------------
Q9X6R2_PSEAI/20-300--------------------------------------------------------------------------------
D5AWR1_RICPP/218-505--------------------------------------------------------------------------------
Q9ZJJ5_HELPJ/225-518--------------------------------------------------------------------------------
Q9ZN39_HELPJ/222-504--------------------------------------------------------------------------------

PF02995

Q19148_CAEEL/61-607--------------------------------------------------------------------------------
O18062_CAEEL/67-538--------------------------------------------------------------------------------
Q9VSJ3_DROME/115-607--------------------------------------------------------------------------------
Q21671_CAEEL/74-651--------------------------------------------------------------------------------
Q9VGG4_DROME/77-573--------------------------------------------------------------------------------
Q9VQH3_DROME/74-555--------------------------------------------------------------------------------
Q9VAU4_DROME/90-580--------------------------------------------------------------------------------
Q9VKK3_DROME/98-598--------------------------------------------------------------------------------
Q19486_CAEEL/79-568--------------------------------------------------------------------------------
Q9V9Q1_DROME/66-560--------------------------------------------------------------------------------
Q9VF91_DROME/73-581--------------------------------------------------------------------------------
Q9VLG3_DROME/84-577--------------------------------------------------------------------------------
Q9V9P7_DROME/68-547--------------------------------------------------------------------------------
O62436_CAEEL/78-581--------------------------------------------------------------------------------
Q9W0F7_DROME/16-518--------------------------------------------------------------------------------
Q8SY05_DROME/180-657--------------------------------------------------------------------------------
Q9VIP6_DROME/56-555--------------------------------------------------------------------------------

PF01676

APGM2_ARCFU/1-380................................................................................
DEOB_GEOSE/6-381................................................................................
E8VA73_BACST/4-499................................................................................
APGM_AQUAE/13-398................................................................................
A0A017I0E2_ECOLX/6-501................................................................................
I0ZIS4_HELPX/3-399................................................................................
PMGI_MESCR/20-545................................................................................
GPMI_PORPU/7-507................................................................................
F7URM6_SYNYG/7-504................................................................................
APGM_PYRHO/5-403................................................................................
PMGI_MAIZE/20-545................................................................................
PMGI_RICCO/17-542................................................................................
G4EU83_BACIU/7-382................................................................................
APGM1_ARCFU/1-399................................................................................
APGM1_METJA/4-402................................................................................
D8KJJ3_LACLN/6-399................................................................................
B1X727_ECODH/2-390................................................................................
GPMI_PSESM/6-497................................................................................
GPMI_ANTSP/7-499................................................................................
I0ZG59_HELPX/3-482................................................................................
PMGI_TOBAC/20-545................................................................................
M7ZXD7_TRIUA/25-880LTLKDKFPIPVVDELLDELHGARFFTKLDLRSGYHQVRMHPDDIAKTAFRTHHGHFEFLVMPFGLANAPATFQALMNDVL
A0A009END8_ECOLX/2-399................................................................................
APGM2_METTH/4-396................................................................................
GPMI_MYCGE/3-493................................................................................
M1GCD6_MYCPM/3-494................................................................................
GPMI_HELPY/3-482................................................................................
APGM1_METTH/1-400................................................................................
APGM2_METJA/1-398................................................................................

PF00245

PPB_BOMMO/74-515--------------------------------------------------------------------------------
PPBT_BOVIN/51-490--------------------------------------------------------------------------------
PPBI_MOUSE/52-486--------------------------------------------------------------------------------
PPBN_MOUSE/51-486--------------------------------------------------------------------------------
PPB1_HUMAN/55-490--------------------------------------------------------------------------------
B1W385_STRGG/41-448--------------------------------------------------------------------------------
A0A017K3Y5_ECOLX/64-470--------------------------------------------------------------------------------
A0A023ZB72_YEASX/66-527--------------------------------------------------------------------------------
J7JQ01_BACIU/49-459--------------------------------------------------------------------------------
G4EZI5_BACIU/43-455--------------------------------------------------------------------------------

PF08665

Q2RKS0_MOOTA/260-429--------------------------------------------------------------------------------
Q72AH5_DESVH/438-616--------------------------------------------------------------------------------
Q8TNC5_METAC/496-671--------------------------------------------------------------------------------
Q3A8U0_CARHZ/461-637--------------------------------------------------------------------------------
B1YIB9_EXIS2/462-638--------------------------------------------------------------------------------
Q5P0R1_AROAE/485-661--------------------------------------------------------------------------------
Q2W5M5_MAGSA/475-648--------------------------------------------------------------------------------
Q8ZK15_SALTY/474-650--------------------------------------------------------------------------------
Q7MVV4_PORGI/231-425--------------------------------------------------------------------------------
A5EWI8_DICNV/401-578--------------------------------------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480--------------------------------------------------------------------------------
Q7UHL2_RHOBA/84-501--------------------------------------------------------------------------------
Q7UN58_RHOBA/63-468--------------------------------------------------------------------------------
Q98BS1_RHILO/39-404--------------------------------------------------------------------------------
Q7UHK7_RHOBA/71-478--------------------------------------------------------------------------------
Q7UKW9_RHOBA/100-522--------------------------------------------------------------------------------
Q8P3X8_XANCP/29-384--------------------------------------------------------------------------------
Q7UZ35_RHOBA/49-467--------------------------------------------------------------------------------
Q7UFP1_RHOBA/49-464--------------------------------------------------------------------------------
Q7MLK9_VIBVY/33-420--------------------------------------------------------------------------------
Q7US09_RHOBA/66-482--------------------------------------------------------------------------------
Q7VYL6_BORPE/29-381--------------------------------------------------------------------------------
Q7UDW2_RHOBA/77-502--------------------------------------------------------------------------------
Q87HJ3_VIBPA/35-425--------------------------------------------------------------------------------
Q7UM62_RHOBA/63-489--------------------------------------------------------------------------------
Q7UJ64_RHOBA/59-474--------------------------------------------------------------------------------
Q7UIF5_RHOBA/61-494--------------------------------------------------------------------------------
Q7UYJ8_RHOBA/60-484--------------------------------------------------------------------------------
Q7MCK0_VIBVY/38-408--------------------------------------------------------------------------------
Q9A5N3_CAUCR/44-506--------------------------------------------------------------------------------
Q7ULC1_RHOBA/52-445--------------------------------------------------------------------------------
Q7UQT8_RHOBA/50-438--------------------------------------------------------------------------------
Q7UQ29_RHOBA/54-472--------------------------------------------------------------------------------
Q7UGB9_RHOBA/69-492--------------------------------------------------------------------------------
Q7UPP6_RHOBA/56-434--------------------------------------------------------------------------------
Q7UI66_RHOBA/46-421--------------------------------------------------------------------------------
Q7UVE3_RHOBA/81-505--------------------------------------------------------------------------------
Q7UW70_RHOBA/70-497--------------------------------------------------------------------------------
Q7UKM6_RHOBA/69-495--------------------------------------------------------------------------------
Q7UTL9_RHOBA/100-490--------------------------------------------------------------------------------
Q7UGF5_RHOBA/94-499--------------------------------------------------------------------------------
Q9A6V4_CAUCR/38-393--------------------------------------------------------------------------------
Q7UYC8_RHOBA/101-527--------------------------------------------------------------------------------
Q7UR29_RHOBA/60-444--------------------------------------------------------------------------------
Q7UYM7_RHOBA/45-446--------------------------------------------------------------------------------
Q7UV65_RHOBA/50-468--------------------------------------------------------------------------------
Q7UJ54_RHOBA/70-497--------------------------------------------------------------------------------
Q7UJ36_RHOBA/99-512--------------------------------------------------------------------------------
Q7NT93_CHRVO/33-383--------------------------------------------------------------------------------
Q7UEK9_RHOBA/80-501--------------------------------------------------------------------------------
Q7UQW1_RHOBA/70-487--------------------------------------------------------------------------------
Q7UPF7_RHOBA/65-448--------------------------------------------------------------------------------
Q7UYR5_RHOBA/95-521--------------------------------------------------------------------------------
Q7UWA1_RHOBA/72-492--------------------------------------------------------------------------------
Q89DL5_BRADU/42-392--------------------------------------------------------------------------------
Q7URV7_RHOBA/77-499--------------------------------------------------------------------------------
Q7MDY0_VIBVY/67-457--------------------------------------------------------------------------------
Q7UH70_RHOBA/75-488--------------------------------------------------------------------------------
Q7UVE1_RHOBA/82-507--------------------------------------------------------------------------------
Q7UQ53_RHOBA/45-480--------------------------------------------------------------------------------
Q7UP10_RHOBA/69-492--------------------------------------------------------------------------------

PF04185

Q47936_FRANO/55-471--------------------------------------------------------------------------------
PHOX_KLULA/65-312--------------------------------------------------------------------------------
Q98ES1_RHILO/58-274--------------------------------------------------------------------------------
A0A038F821_MYCTX/50-282--------------------------------------------------------------------------------
D0KPN6_SULS9/27-365--------------------------------------------------------------------------------
NPC6_ARATH/59-394--------------------------------------------------------------------------------
NPC5_ARATH/13-380--------------------------------------------------------------------------------
NPC3_ARATH/16-381--------------------------------------------------------------------------------
NPC1_ARATH/38-396--------------------------------------------------------------------------------
NPC2_ARATH/27-389--------------------------------------------------------------------------------
Q9KH04_BURML/84-547--------------------------------------------------------------------------------
Q983N8_RHILO/60-507--------------------------------------------------------------------------------
E2TNP6_MYCTX/52-433--------------------------------------------------------------------------------
A1KJH2_MYCBP/50-429--------------------------------------------------------------------------------
A4KJA2_MYCTX/52-435--------------------------------------------------------------------------------
A5WPW5_MYCTF/51-431--------------------------------------------------------------------------------
A0A030U552_PSEAI/51-437--------------------------------------------------------------------------------
A3NXI4_BURP0/47-438--------------------------------------------------------------------------------
B8H354_CAUCN/40-437--------------------------------------------------------------------------------
A0A022NDQ0_PSEAI/48-422--------------------------------------------------------------------------------

PF16347

G2PRM5_MURRD/414-516--------------------------------------------------------------------------------
G7USR5_PSEUP/397-499--------------------------------------------------------------------------------
D5BJX1_ZUNPS/413-515--------------------------------------------------------------------------------
G0J719_CYCMS/407-508--------------------------------------------------------------------------------
D2R402_PIRSD/397-498--------------------------------------------------------------------------------
G8NQI2_GRAMM/379-480--------------------------------------------------------------------------------
D2QMZ8_SPILD/410-511--------------------------------------------------------------------------------
A4AWR6_MARSH/414-516--------------------------------------------------------------------------------
A6LDP5_PARD8/412-514--------------------------------------------------------------------------------
A4CJM0_ROBBH/381-483--------------------------------------------------------------------------------
A2TWV5_9FLAO/422-523--------------------------------------------------------------------------------
G8UMU5_TANFA/417-519--------------------------------------------------------------------------------
D5BJT8_ZUNPS/386-488--------------------------------------------------------------------------------
F9YSE0_CAPCC/401-501--------------------------------------------------------------------------------
D3IBE7_9BACT/417-519--------------------------------------------------------------------------------
C7M893_CAPOD/396-496--------------------------------------------------------------------------------
G0J436_CYCMS/421-522--------------------------------------------------------------------------------
A3HWF8_9BACT/418-520--------------------------------------------------------------------------------
E8V2R6_TERSS/392-493--------------------------------------------------------------------------------
G8TRD3_NIAKG/412-512--------------------------------------------------------------------------------
H8KTX9_SOLCM/409-510--------------------------------------------------------------------------------
F4L7F1_HALH1/402-503--------------------------------------------------------------------------------
F3ZRQ1_9BACE/413-515--------------------------------------------------------------------------------
E6SVH3_BACT6/418-520--------------------------------------------------------------------------------
D2QEZ9_SPILD/447-548--------------------------------------------------------------------------------
G0IUX7_CYCMS/423-524--------------------------------------------------------------------------------
G0L151_ZOBGA/413-515--------------------------------------------------------------------------------
A6KZU2_BACV8/416-518--------------------------------------------------------------------------------
A6L8Y1_PARD8/413-515--------------------------------------------------------------------------------
I3YHK1_ALIFI/406-508--------------------------------------------------------------------------------
Q5LAU2_BACFN/415-517--------------------------------------------------------------------------------
R5M554_9BACE/414-516--------------------------------------------------------------------------------
R5UAM5_9BACE/410-512--------------------------------------------------------------------------------
R7DGX3_9PORP/412-514--------------------------------------------------------------------------------
W0EZJ7_9SPHI/397-497--------------------------------------------------------------------------------

PF14707

A9VBN0_MONBE/428-544--------------------------------------------------------------------------------
E6ZGQ8_DICLA/413-534--------------------------------------------------------------------------------
Q4S4L1_TETNG/407-528--------------------------------------------------------------------------------
E1BU03_CHICK/390-510--------------------------------------------------------------------------------
ARSG_MOUSE/402-522--------------------------------------------------------------------------------
A6QLR7_BOVIN/402-522--------------------------------------------------------------------------------
ARSG_CANFA/402-522--------------------------------------------------------------------------------
B4DQ74_HUMAN/301-421--------------------------------------------------------------------------------
A9V957_MONBE/437-571--------------------------------------------------------------------------------
F0Y2N2_AURAN/404-544--------------------------------------------------------------------------------
Q1YP24_9GAMM/409-501--------------------------------------------------------------------------------
C6W2Y6_DYAFD/349-461--------------------------------------------------------------------------------
D7VQY4_9SPHI/353-442--------------------------------------------------------------------------------
F2UD41_SALR5/491-612--------------------------------------------------------------------------------
A9UXW0_MONBE/287-431--------------------------------------------------------------------------------
F2UKF0_SALR5/383-527--------------------------------------------------------------------------------
B9QU81_9RHOB/44-158--------------------------------------------------------------------------------
E4YGB6_OIKDI/449-582--------------------------------------------------------------------------------
F2U742_SALR5/410-535--------------------------------------------------------------------------------
A9UPM8_MONBE/326-451--------------------------------------------------------------------------------
A8XD87_CAEBR/394-528--------------------------------------------------------------------------------
E1FX25_LOALO/406-541--------------------------------------------------------------------------------
F1KQC6_ASCSU/1702-1837--------------------------------------------------------------------------------
F2UCT8_SALR5/90-221--------------------------------------------------------------------------------
A9V7E7_MONBE/452-571--------------------------------------------------------------------------------
C1BQY6_9MAXI/368-496--------------------------------------------------------------------------------
Q4RJR3_TETNG/343-473--------------------------------------------------------------------------------
Q6AX40_XENLA/368-499--------------------------------------------------------------------------------
A1L2N0_XENLA/374-505--------------------------------------------------------------------------------
F1NWF7_CHICK/373-504--------------------------------------------------------------------------------
Q32KK2_RAT/368-501--------------------------------------------------------------------------------
ARSA_BOVIN/368-501--------------------------------------------------------------------------------
ARSA_HUMAN/368-501--------------------------------------------------------------------------------
E4XNY3_OIKDI/402-532--------------------------------------------------------------------------------
C3ZV84_BRAFL/657-789--------------------------------------------------------------------------------
Q4SI19_TETNG/405-541--------------------------------------------------------------------------------
F1QFT2_DANRE/220-352--------------------------------------------------------------------------------
Q5XG10_XENLA/375-507--------------------------------------------------------------------------------
GALNS_CANFA/377-509--------------------------------------------------------------------------------
F1NW57_CHICK/376-508--------------------------------------------------------------------------------
A0YAF7_9GAMM/381-478--------------------------------------------------------------------------------
Q0C069_HYPNA/397-504--------------------------------------------------------------------------------
ARS_STRPU/411-541--------------------------------------------------------------------------------
ARS_HEMPU/396-526--------------------------------------------------------------------------------
O16138_HELER/402-534--------------------------------------------------------------------------------
A4AN36_MARSH/378-468--------------------------------------------------------------------------------
A4CMB0_ROBBH/401-491--------------------------------------------------------------------------------
A3XMW9_LEEBM/382-476--------------------------------------------------------------------------------
A7V8P9_BACUN/356-447--------------------------------------------------------------------------------
A6CB11_9PLAN/382-473--------------------------------------------------------------------------------
F0SFZ7_PLABD/380-468--------------------------------------------------------------------------------
C3ZQB5_BRAFL/423-551--------------------------------------------------------------------------------
C3ZQC1_BRAFL/344-471--------------------------------------------------------------------------------
A7SK49_NEMVE/435-563--------------------------------------------------------------------------------
A7SQ82_NEMVE/425-557--------------------------------------------------------------------------------
A7SK50_NEMVE/483-612--------------------------------------------------------------------------------
Q7ZWB8_DANRE/433-548--------------------------------------------------------------------------------
Q6DJK3_XENLA/433-566--------------------------------------------------------------------------------
Q32KK0_RAT/450-603--------------------------------------------------------------------------------
F1QB82_DANRE/433-568--------------------------------------------------------------------------------
Q4RYA1_TETNG/304-429--------------------------------------------------------------------------------
STS_MOUSE/445-581--------------------------------------------------------------------------------
STS_RAT/436-573--------------------------------------------------------------------------------
STS_HUMAN/437-572--------------------------------------------------------------------------------
D2HXW7_AILME/434-569--------------------------------------------------------------------------------
Q4TCJ7_TETNG/242-385--------------------------------------------------------------------------------
Q6GMA1_XENLA/439-573--------------------------------------------------------------------------------
ARSF_HUMAN/440-574--------------------------------------------------------------------------------
Q32KI0_CANFA/435-568--------------------------------------------------------------------------------
ARSE_HUMAN/448-582--------------------------------------------------------------------------------
Q32KI1_CANFA/444-578--------------------------------------------------------------------------------
A5D7J7_BOVIN/445-576--------------------------------------------------------------------------------
ARSH_HUMAN/418-551--------------------------------------------------------------------------------
F1NFQ0_CHICK/445-579--------------------------------------------------------------------------------
D2HFI2_AILME/436-570--------------------------------------------------------------------------------
ARSD_HUMAN/451-585--------------------------------------------------------------------------------
C3Y4J9_BRAFL/389-521--------------------------------------------------------------------------------
C3Y4X6_BRAFL/434-568--------------------------------------------------------------------------------
C3YBU1_BRAFL/392-524--------------------------------------------------------------------------------
C3ZST4_BRAFL/433-562--------------------------------------------------------------------------------
C3Z258_BRAFL/432-564--------------------------------------------------------------------------------
C3YQ76_BRAFL/419-552--------------------------------------------------------------------------------
C3YZM0_BRAFL/417-549--------------------------------------------------------------------------------

PF01663

Q7NDL2_GLOVI/4-434--------------------------------------------------------------------------------
Q9X5T4_STRLA/7-389--------------------------------------------------------------------------------
B0R301_HALS3/15-396--------------------------------------------------------------------------------
Q9X5S1_STRLA/5-395--------------------------------------------------------------------------------
Q9X5R9_STRLA/7-410--------------------------------------------------------------------------------
Q9YCS9_AERPE/3-432--------------------------------------------------------------------------------
Q9X5S9_STRLA/7-409--------------------------------------------------------------------------------
Q9UZH6_PYRAB/14-420--------------------------------------------------------------------------------
Q9YCR2_AERPE/4-405--------------------------------------------------------------------------------
V5Q348_ZYMMB/62-511--------------------------------------------------------------------------------
C6IK84_9BACE/29-473--------------------------------------------------------------------------------
ALPH_SYNE7/42-494--------------------------------------------------------------------------------
ALPH_ELIME/32-489--------------------------------------------------------------------------------
CDA_MYROD/31-491--------------------------------------------------------------------------------
Q7MEK0_VIBVY/30-506--------------------------------------------------------------------------------
Q84EY0_9GAMM/27-481--------------------------------------------------------------------------------
O29992_ARCFU/4-416--------------------------------------------------------------------------------
Q981Q5_RHILO/5-379--------------------------------------------------------------------------------
Q98IY7_RHILO/32-447--------------------------------------------------------------------------------
Q7UKE3_RHOBA/4-350--------------------------------------------------------------------------------
O69954_STRCO/13-378--------------------------------------------------------------------------------
Q8YZP2_NOSS1/4-370--------------------------------------------------------------------------------
Q7AYA7_9RHIZ/4-370--------------------------------------------------------------------------------
Q7NU73_CHRVO/4-375--------------------------------------------------------------------------------
D3MCQ1_PROAA/44-359--------------------------------------------------------------------------------
F7PA94_MYCPC/42-363--------------------------------------------------------------------------------
O50518_STRCO/58-383--------------------------------------------------------------------------------
Q6N507_RHOPA/30-497--------------------------------------------------------------------------------
Q7WNM8_BORBR/6-370--------------------------------------------------------------------------------
F0K5R6_CLOAE/8-378--------------------------------------------------------------------------------
Q8XKL9_CLOPE/10-374--------------------------------------------------------------------------------
C8K1F1_LISMN/5-366--------------------------------------------------------------------------------
Q73E52_BACC1/9-380--------------------------------------------------------------------------------
O45359_CAEEL/26-353--------------------------------------------------------------------------------
Q22129_CAEEL/24-374--------------------------------------------------------------------------------
O58841_PYRHO/4-322--------------------------------------------------------------------------------
ENPP6_XENLA/26-357--------------------------------------------------------------------------------
ENPP6_MOUSE/26-357--------------------------------------------------------------------------------
ENPP1_CAEEL/182-494--------------------------------------------------------------------------------
ENPP2_CAEEL/81-386--------------------------------------------------------------------------------
Q7MXP5_PORGI/37-349--------------------------------------------------------------------------------
ENPP7_HUMAN/33-356--------------------------------------------------------------------------------
Q6ZM30_DANRE/31-356--------------------------------------------------------------------------------
Q6CX45_KLULA/136-460--------------------------------------------------------------------------------
ENPP5_HUMAN/30-342--------------------------------------------------------------------------------
ENPP4_XENLA/30-339--------------------------------------------------------------------------------
K7BSV5_PANTR/28-339--------------------------------------------------------------------------------
Q6VZU9_CNPV/107-431--------------------------------------------------------------------------------
O90761_FOWPV/120-443--------------------------------------------------------------------------------
Q6PGY9_DANRE/161-472--------------------------------------------------------------------------------
ENPP2_RAT/165-477--------------------------------------------------------------------------------
Q7ZXN7_XENLA/166-476--------------------------------------------------------------------------------
ENPP3_MOUSE/161-485--------------------------------------------------------------------------------
ENPP1_RAT/194-520--------------------------------------------------------------------------------
Q9SU81_ARATH/60-394--------------------------------------------------------------------------------
Q9SU82_ARATH/57-390--------------------------------------------------------------------------------
Q42974_ORYSA/92-418--------------------------------------------------------------------------------
Q9FS13_SPIOL/96-418--------------------------------------------------------------------------------
Q9SU83_ARATH/109-435--------------------------------------------------------------------------------
M9N2F7_ASHG1/153-497--------------------------------------------------------------------------------
Q6FKX1_CANGA/187-587--------------------------------------------------------------------------------
N1P7V5_YEASC/170-545--------------------------------------------------------------------------------
M4TY79_9XANT/48-366--------------------------------------------------------------------------------
Q9PAB9_XYLFA/40-358--------------------------------------------------------------------------------
H2VFP5_ZYMMO/50-367--------------------------------------------------------------------------------
Q9A8S4_CAUCR/74-393--------------------------------------------------------------------------------
Q7SI20_NEUCR/254-584--------------------------------------------------------------------------------
YGK5_SCHPO/76-404--------------------------------------------------------------------------------
Q6BTN4_DEBHA/173-514--------------------------------------------------------------------------------
Q6C6J4_YARLI/277-608--------------------------------------------------------------------------------

PF00884

C3LB12_BACAC/143-439--------------------------------------------------------------------------------
A0A038KMS4_MYCTX/43-460--------------------------------------------------------------------------------
K4NNF3_HELPX/294-587--------------------------------------------------------------------------------
A1IT97_NEIMA/232-524--------------------------------------------------------------------------------
E8VE61_BACST/245-536--------------------------------------------------------------------------------
O43113_NEUCS/45-420--------------------------------------------------------------------------------
A0A038F731_MYCTX/212-635--------------------------------------------------------------------------------
O82879_STRMG/460-745--------------------------------------------------------------------------------
O85099_ECOLX/237-530--------------------------------------------------------------------------------
A0A017IKP4_ECOLX/260-505--------------------------------------------------------------------------------
ARS_HEMPU/52-373--------------------------------------------------------------------------------
ARS_CHLRE/27-385--------------------------------------------------------------------------------
ARSA_HUMAN/21-346--------------------------------------------------------------------------------
A0A017J6J3_ECOLX/86-419--------------------------------------------------------------------------------
A0A017J597_ECOLX/236-527--------------------------------------------------------------------------------
A0A017HZX0_ECOLX/4-341--------------------------------------------------------------------------------
ARSB_FELCA/47-366--------------------------------------------------------------------------------
GALNS_HUMAN/31-355--------------------------------------------------------------------------------
A0A017I1Q5_ECOLX/248-538--------------------------------------------------------------------------------
C9MG45_HAEIF/211-475--------------------------------------------------------------------------------
GNS_CAPHI/54-391--------------------------------------------------------------------------------
STS_MOUSE/35-421--------------------------------------------------------------------------------
ARS_STRPU/67-388--------------------------------------------------------------------------------
SPHM_HUMAN/23-328--------------------------------------------------------------------------------
A0A022NJX0_PSEAI/5-420--------------------------------------------------------------------------------
E8H705_ECO57/223-491--------------------------------------------------------------------------------
F6BMG6_SINMB/269-561--------------------------------------------------------------------------------
A0A017IT13_ECOLX/217-483--------------------------------------------------------------------------------
A0A024LN14_ECOLX/58-408--------------------------------------------------------------------------------
A0A038FFI8_MYCTX/37-466--------------------------------------------------------------------------------
A0A038VAH2_MYCTX/5-389--------------------------------------------------------------------------------
Q0Z8S6_VOLCA/26-386--------------------------------------------------------------------------------
Q45087_9BURK/4-384--------------------------------------------------------------------------------
A0A059MXH6_ENTFL/256-543--------------------------------------------------------------------------------
Q840W2_STRMG/270-555--------------------------------------------------------------------------------
M2E9Z0_STRMG/503-788--------------------------------------------------------------------------------
Q8G592_BIFLO/306-604--------------------------------------------------------------------------------
A0A029SCQ9_STRPY/480-765--------------------------------------------------------------------------------
Q8P1I3_STRP8/480-765--------------------------------------------------------------------------------
Q8XK47_CLOPE/257-551--------------------------------------------------------------------------------
Q984T6_RHILO/281-574--------------------------------------------------------------------------------
Q98EG2_RHILO/158-441--------------------------------------------------------------------------------
Q9A0F9_STRP1/480-765--------------------------------------------------------------------------------
Q9AI31_BURML/214-497--------------------------------------------------------------------------------
H8ID57_PASMH/287-557--------------------------------------------------------------------------------
Q9CM05_PASMU/231-523--------------------------------------------------------------------------------
A0A030RTZ7_PSEAI/238-530--------------------------------------------------------------------------------
A0A022NH93_PSEAI/238-529--------------------------------------------------------------------------------
A0A030XY34_PSEAI/231-522--------------------------------------------------------------------------------
A0A030YI64_PSEAI/223-501--------------------------------------------------------------------------------
F0ADR9_NEIME/214-487--------------------------------------------------------------------------------
A0A016X8V3_VIBCL/240-530--------------------------------------------------------------------------------
Q9PGC7_XYLFA/245-535--------------------------------------------------------------------------------
Q9RBI1_ACIAD/237-531--------------------------------------------------------------------------------
Q9RMJ0_NEIME/232-495--------------------------------------------------------------------------------
Q9X6R2_PSEAI/20-300--------------------------------------------------------------------------------
D5AWR1_RICPP/218-505--------------------------------------------------------------------------------
Q9ZJJ5_HELPJ/225-518--------------------------------------------------------------------------------
Q9ZN39_HELPJ/222-504--------------------------------------------------------------------------------

PF02995

Q19148_CAEEL/61-607--------------------------------------------------------------------------------
O18062_CAEEL/67-538--------------------------------------------------------------------------------
Q9VSJ3_DROME/115-607--------------------------------------------------------------------------------
Q21671_CAEEL/74-651--------------------------------------------------------------------------------
Q9VGG4_DROME/77-573--------------------------------------------------------------------------------
Q9VQH3_DROME/74-555--------------------------------------------------------------------------------
Q9VAU4_DROME/90-580--------------------------------------------------------------------------------
Q9VKK3_DROME/98-598--------------------------------------------------------------------------------
Q19486_CAEEL/79-568--------------------------------------------------------------------------------
Q9V9Q1_DROME/66-560--------------------------------------------------------------------------------
Q9VF91_DROME/73-581--------------------------------------------------------------------------------
Q9VLG3_DROME/84-577--------------------------------------------------------------------------------
Q9V9P7_DROME/68-547--------------------------------------------------------------------------------
O62436_CAEEL/78-581--------------------------------------------------------------------------------
Q9W0F7_DROME/16-518--------------------------------------------------------------------------------
Q8SY05_DROME/180-657--------------------------------------------------------------------------------
Q9VIP6_DROME/56-555--------------------------------------------------------------------------------

PF01676

APGM2_ARCFU/1-380................................................................................
DEOB_GEOSE/6-381................................................................................
E8VA73_BACST/4-499................................................................................
APGM_AQUAE/13-398................................................................................
A0A017I0E2_ECOLX/6-501................................................................................
I0ZIS4_HELPX/3-399................................................................................
PMGI_MESCR/20-545................................................................................
GPMI_PORPU/7-507................................................................................
F7URM6_SYNYG/7-504................................................................................
APGM_PYRHO/5-403................................................................................
PMGI_MAIZE/20-545................................................................................
PMGI_RICCO/17-542................................................................................
G4EU83_BACIU/7-382................................................................................
APGM1_ARCFU/1-399................................................................................
APGM1_METJA/4-402................................................................................
D8KJJ3_LACLN/6-399................................................................................
B1X727_ECODH/2-390................................................................................
GPMI_PSESM/6-497................................................................................
GPMI_ANTSP/7-499................................................................................
I0ZG59_HELPX/3-482................................................................................
PMGI_TOBAC/20-545................................................................................
M7ZXD7_TRIUA/25-880RPYLRRFVLVFFDDILIYSATWDEHLQHVAIVFNELRAHHLHLKRSKCSFGTPTVAYLGHVISADGGRSAGSSDSPATTG
A0A009END8_ECOLX/2-399................................................................................
APGM2_METTH/4-396................................................................................
GPMI_MYCGE/3-493................................................................................
M1GCD6_MYCPM/3-494................................................................................
GPMI_HELPY/3-482................................................................................
APGM1_METTH/1-400................................................................................
APGM2_METJA/1-398................................................................................

PF00245

PPB_BOMMO/74-515--------------------------------------------------------------------------------
PPBT_BOVIN/51-490--------------------------------------------------------------------------------
PPBI_MOUSE/52-486--------------------------------------------------------------------------------
PPBN_MOUSE/51-486--------------------------------------------------------------------------------
PPB1_HUMAN/55-490--------------------------------------------------------------------------------
B1W385_STRGG/41-448--------------------------------------------------------------------------------
A0A017K3Y5_ECOLX/64-470--------------------------------------------------------------------------------
A0A023ZB72_YEASX/66-527--------------------------------------------------------------------------------
J7JQ01_BACIU/49-459--------------------------------------------------------------------------------
G4EZI5_BACIU/43-455--------------------------------------------------------------------------------

PF08665

Q2RKS0_MOOTA/260-429--------------------------------------------------------------------------------
Q72AH5_DESVH/438-616--------------------------------------------------------------------------------
Q8TNC5_METAC/496-671--------------------------------------------------------------------------------
Q3A8U0_CARHZ/461-637--------------------------------------------------------------------------------
B1YIB9_EXIS2/462-638--------------------------------------------------------------------------------
Q5P0R1_AROAE/485-661--------------------------------------------------------------------------------
Q2W5M5_MAGSA/475-648--------------------------------------------------------------------------------
Q8ZK15_SALTY/474-650--------------------------------------------------------------------------------
Q7MVV4_PORGI/231-425--------------------------------------------------------------------------------
A5EWI8_DICNV/401-578--------------------------------------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480--------------------------------------------------------------------------------
Q7UHL2_RHOBA/84-501--------------------------------------------------------------------------------
Q7UN58_RHOBA/63-468--------------------------------------------------------------------------------
Q98BS1_RHILO/39-404--------------------------------------------------------------------------------
Q7UHK7_RHOBA/71-478--------------------------------------------------------------------------------
Q7UKW9_RHOBA/100-522--------------------------------------------------------------------------------
Q8P3X8_XANCP/29-384--------------------------------------------------------------------------------
Q7UZ35_RHOBA/49-467--------------------------------------------------------------------------------
Q7UFP1_RHOBA/49-464--------------------------------------------------------------------------------
Q7MLK9_VIBVY/33-420--------------------------------------------------------------------------------
Q7US09_RHOBA/66-482--------------------------------------------------------------------------------
Q7VYL6_BORPE/29-381--------------------------------------------------------------------------------
Q7UDW2_RHOBA/77-502--------------------------------------------------------------------------------
Q87HJ3_VIBPA/35-425--------------------------------------------------------------------------------
Q7UM62_RHOBA/63-489--------------------------------------------------------------------------------
Q7UJ64_RHOBA/59-474--------------------------------------------------------------------------------
Q7UIF5_RHOBA/61-494--------------------------------------------------------------------------------
Q7UYJ8_RHOBA/60-484--------------------------------------------------------------------------------
Q7MCK0_VIBVY/38-408--------------------------------------------------------------------------------
Q9A5N3_CAUCR/44-506--------------------------------------------------------------------------------
Q7ULC1_RHOBA/52-445--------------------------------------------------------------------------------
Q7UQT8_RHOBA/50-438--------------------------------------------------------------------------------
Q7UQ29_RHOBA/54-472--------------------------------------------------------------------------------
Q7UGB9_RHOBA/69-492--------------------------------------------------------------------------------
Q7UPP6_RHOBA/56-434--------------------------------------------------------------------------------
Q7UI66_RHOBA/46-421--------------------------------------------------------------------------------
Q7UVE3_RHOBA/81-505--------------------------------------------------------------------------------
Q7UW70_RHOBA/70-497--------------------------------------------------------------------------------
Q7UKM6_RHOBA/69-495--------------------------------------------------------------------------------
Q7UTL9_RHOBA/100-490--------------------------------------------------------------------------------
Q7UGF5_RHOBA/94-499--------------------------------------------------------------------------------
Q9A6V4_CAUCR/38-393--------------------------------------------------------------------------------
Q7UYC8_RHOBA/101-527--------------------------------------------------------------------------------
Q7UR29_RHOBA/60-444--------------------------------------------------------------------------------
Q7UYM7_RHOBA/45-446--------------------------------------------------------------------------------
Q7UV65_RHOBA/50-468--------------------------------------------------------------------------------
Q7UJ54_RHOBA/70-497--------------------------------------------------------------------------------
Q7UJ36_RHOBA/99-512--------------------------------------------------------------------------------
Q7NT93_CHRVO/33-383--------------------------------------------------------------------------------
Q7UEK9_RHOBA/80-501--------------------------------------------------------------------------------
Q7UQW1_RHOBA/70-487--------------------------------------------------------------------------------
Q7UPF7_RHOBA/65-448--------------------------------------------------------------------------------
Q7UYR5_RHOBA/95-521--------------------------------------------------------------------------------
Q7UWA1_RHOBA/72-492--------------------------------------------------------------------------------
Q89DL5_BRADU/42-392--------------------------------------------------------------------------------
Q7URV7_RHOBA/77-499--------------------------------------------------------------------------------
Q7MDY0_VIBVY/67-457--------------------------------------------------------------------------------
Q7UH70_RHOBA/75-488--------------------------------------------------------------------------------
Q7UVE1_RHOBA/82-507--------------------------------------------------------------------------------
Q7UQ53_RHOBA/45-480--------------------------------------------------------------------------------
Q7UP10_RHOBA/69-492--------------------------------------------------------------------------------

PF04185

Q47936_FRANO/55-471--------------------------------------------------------------------------------
PHOX_KLULA/65-312--------------------------------------------------------------------------------
Q98ES1_RHILO/58-274--------------------------------------------------------------------------------
A0A038F821_MYCTX/50-282--------------------------------------------------------------------------------
D0KPN6_SULS9/27-365--------------------------------------------------------------------------------
NPC6_ARATH/59-394--------------------------------------------------------------------------------
NPC5_ARATH/13-380--------------------------------------------------------------------------------
NPC3_ARATH/16-381--------------------------------------------------------------------------------
NPC1_ARATH/38-396--------------------------------------------------------------------------------
NPC2_ARATH/27-389--------------------------------------------------------------------------------
Q9KH04_BURML/84-547--------------------------------------------------------------------------------
Q983N8_RHILO/60-507--------------------------------------------------------------------------------
E2TNP6_MYCTX/52-433--------------------------------------------------------------------------------
A1KJH2_MYCBP/50-429--------------------------------------------------------------------------------
A4KJA2_MYCTX/52-435--------------------------------------------------------------------------------
A5WPW5_MYCTF/51-431--------------------------------------------------------------------------------
A0A030U552_PSEAI/51-437--------------------------------------------------------------------------------
A3NXI4_BURP0/47-438--------------------------------------------------------------------------------
B8H354_CAUCN/40-437--------------------------------------------------------------------------------
A0A022NDQ0_PSEAI/48-422--------------------------------------------------------------------------------

PF16347

G2PRM5_MURRD/414-516--------------------------------------------------------------------------------
G7USR5_PSEUP/397-499--------------------------------------------------------------------------------
D5BJX1_ZUNPS/413-515--------------------------------------------------------------------------------
G0J719_CYCMS/407-508--------------------------------------------------------------------------------
D2R402_PIRSD/397-498--------------------------------------------------------------------------------
G8NQI2_GRAMM/379-480--------------------------------------------------------------------------------
D2QMZ8_SPILD/410-511--------------------------------------------------------------------------------
A4AWR6_MARSH/414-516--------------------------------------------------------------------------------
A6LDP5_PARD8/412-514--------------------------------------------------------------------------------
A4CJM0_ROBBH/381-483--------------------------------------------------------------------------------
A2TWV5_9FLAO/422-523--------------------------------------------------------------------------------
G8UMU5_TANFA/417-519--------------------------------------------------------------------------------
D5BJT8_ZUNPS/386-488--------------------------------------------------------------------------------
F9YSE0_CAPCC/401-501--------------------------------------------------------------------------------
D3IBE7_9BACT/417-519--------------------------------------------------------------------------------
C7M893_CAPOD/396-496--------------------------------------------------------------------------------
G0J436_CYCMS/421-522--------------------------------------------------------------------------------
A3HWF8_9BACT/418-520--------------------------------------------------------------------------------
E8V2R6_TERSS/392-493--------------------------------------------------------------------------------
G8TRD3_NIAKG/412-512--------------------------------------------------------------------------------
H8KTX9_SOLCM/409-510--------------------------------------------------------------------------------
F4L7F1_HALH1/402-503--------------------------------------------------------------------------------
F3ZRQ1_9BACE/413-515--------------------------------------------------------------------------------
E6SVH3_BACT6/418-520--------------------------------------------------------------------------------
D2QEZ9_SPILD/447-548--------------------------------------------------------------------------------
G0IUX7_CYCMS/423-524--------------------------------------------------------------------------------
G0L151_ZOBGA/413-515--------------------------------------------------------------------------------
A6KZU2_BACV8/416-518--------------------------------------------------------------------------------
A6L8Y1_PARD8/413-515--------------------------------------------------------------------------------
I3YHK1_ALIFI/406-508--------------------------------------------------------------------------------
Q5LAU2_BACFN/415-517--------------------------------------------------------------------------------
R5M554_9BACE/414-516--------------------------------------------------------------------------------
R5UAM5_9BACE/410-512--------------------------------------------------------------------------------
R7DGX3_9PORP/412-514--------------------------------------------------------------------------------
W0EZJ7_9SPHI/397-497--------------------------------------------------------------------------------

PF14707

A9VBN0_MONBE/428-544--------------------------------------------------------------------------------
E6ZGQ8_DICLA/413-534--------------------------------------------------------------------------------
Q4S4L1_TETNG/407-528--------------------------------------------------------------------------------
E1BU03_CHICK/390-510--------------------------------------------------------------------------------
ARSG_MOUSE/402-522--------------------------------------------------------------------------------
A6QLR7_BOVIN/402-522--------------------------------------------------------------------------------
ARSG_CANFA/402-522--------------------------------------------------------------------------------
B4DQ74_HUMAN/301-421--------------------------------------------------------------------------------
A9V957_MONBE/437-571--------------------------------------------------------------------------------
F0Y2N2_AURAN/404-544--------------------------------------------------------------------------------
Q1YP24_9GAMM/409-501--------------------------------------------------------------------------------
C6W2Y6_DYAFD/349-461--------------------------------------------------------------------------------
D7VQY4_9SPHI/353-442--------------------------------------------------------------------------------
F2UD41_SALR5/491-612--------------------------------------------------------------------------------
A9UXW0_MONBE/287-431--------------------------------------------------------------------------------
F2UKF0_SALR5/383-527--------------------------------------------------------------------------------
B9QU81_9RHOB/44-158--------------------------------------------------------------------------------
E4YGB6_OIKDI/449-582--------------------------------------------------------------------------------
F2U742_SALR5/410-535--------------------------------------------------------------------------------
A9UPM8_MONBE/326-451--------------------------------------------------------------------------------
A8XD87_CAEBR/394-528--------------------------------------------------------------------------------
E1FX25_LOALO/406-541--------------------------------------------------------------------------------
F1KQC6_ASCSU/1702-1837--------------------------------------------------------------------------------
F2UCT8_SALR5/90-221--------------------------------------------------------------------------------
A9V7E7_MONBE/452-571--------------------------------------------------------------------------------
C1BQY6_9MAXI/368-496--------------------------------------------------------------------------------
Q4RJR3_TETNG/343-473--------------------------------------------------------------------------------
Q6AX40_XENLA/368-499--------------------------------------------------------------------------------
A1L2N0_XENLA/374-505--------------------------------------------------------------------------------
F1NWF7_CHICK/373-504--------------------------------------------------------------------------------
Q32KK2_RAT/368-501--------------------------------------------------------------------------------
ARSA_BOVIN/368-501--------------------------------------------------------------------------------
ARSA_HUMAN/368-501--------------------------------------------------------------------------------
E4XNY3_OIKDI/402-532--------------------------------------------------------------------------------
C3ZV84_BRAFL/657-789--------------------------------------------------------------------------------
Q4SI19_TETNG/405-541--------------------------------------------------------------------------------
F1QFT2_DANRE/220-352--------------------------------------------------------------------------------
Q5XG10_XENLA/375-507--------------------------------------------------------------------------------
GALNS_CANFA/377-509--------------------------------------------------------------------------------
F1NW57_CHICK/376-508--------------------------------------------------------------------------------
A0YAF7_9GAMM/381-478--------------------------------------------------------------------------------
Q0C069_HYPNA/397-504--------------------------------------------------------------------------------
ARS_STRPU/411-541--------------------------------------------------------------------------------
ARS_HEMPU/396-526--------------------------------------------------------------------------------
O16138_HELER/402-534--------------------------------------------------------------------------------
A4AN36_MARSH/378-468--------------------------------------------------------------------------------
A4CMB0_ROBBH/401-491--------------------------------------------------------------------------------
A3XMW9_LEEBM/382-476--------------------------------------------------------------------------------
A7V8P9_BACUN/356-447--------------------------------------------------------------------------------
A6CB11_9PLAN/382-473--------------------------------------------------------------------------------
F0SFZ7_PLABD/380-468--------------------------------------------------------------------------------
C3ZQB5_BRAFL/423-551--------------------------------------------------------------------------------
C3ZQC1_BRAFL/344-471--------------------------------------------------------------------------------
A7SK49_NEMVE/435-563--------------------------------------------------------------------------------
A7SQ82_NEMVE/425-557--------------------------------------------------------------------------------
A7SK50_NEMVE/483-612--------------------------------------------------------------------------------
Q7ZWB8_DANRE/433-548--------------------------------------------------------------------------------
Q6DJK3_XENLA/433-566--------------------------------------------------------------------------------
Q32KK0_RAT/450-603--------------------------------------------------------------------------------
F1QB82_DANRE/433-568--------------------------------------------------------------------------------
Q4RYA1_TETNG/304-429--------------------------------------------------------------------------------
STS_MOUSE/445-581--------------------------------------------------------------------------------
STS_RAT/436-573--------------------------------------------------------------------------------
STS_HUMAN/437-572--------------------------------------------------------------------------------
D2HXW7_AILME/434-569--------------------------------------------------------------------------------
Q4TCJ7_TETNG/242-385--------------------------------------------------------------------------------
Q6GMA1_XENLA/439-573--------------------------------------------------------------------------------
ARSF_HUMAN/440-574--------------------------------------------------------------------------------
Q32KI0_CANFA/435-568--------------------------------------------------------------------------------
ARSE_HUMAN/448-582--------------------------------------------------------------------------------
Q32KI1_CANFA/444-578--------------------------------------------------------------------------------
A5D7J7_BOVIN/445-576--------------------------------------------------------------------------------
ARSH_HUMAN/418-551--------------------------------------------------------------------------------
F1NFQ0_CHICK/445-579--------------------------------------------------------------------------------
D2HFI2_AILME/436-570--------------------------------------------------------------------------------
ARSD_HUMAN/451-585--------------------------------------------------------------------------------
C3Y4J9_BRAFL/389-521--------------------------------------------------------------------------------
C3Y4X6_BRAFL/434-568--------------------------------------------------------------------------------
C3YBU1_BRAFL/392-524--------------------------------------------------------------------------------
C3ZST4_BRAFL/433-562--------------------------------------------------------------------------------
C3Z258_BRAFL/432-564--------------------------------------------------------------------------------
C3YQ76_BRAFL/419-552--------------------------------------------------------------------------------
C3YZM0_BRAFL/417-549--------------------------------------------------------------------------------

PF01663

Q7NDL2_GLOVI/4-434---------------------------------------------------------------------GNHGVYDFIRM
Q9X5T4_STRLA/7-389---------------------------------------------------------------------ADHGFYS..YW
B0R301_HALS3/15-396---------------------------------------------------------------------GETGVYGFQ..
Q9X5S1_STRLA/5-395---------------------------------------------------------------------GRHGIYGFTDL
Q9X5R9_STRLA/7-410---------------------------------------------------------------------GGHGIYQ..FY
Q9YCS9_AERPE/3-432---------------------------------------------------------------------GKTGIVD..FL
Q9X5S9_STRLA/7-409---------------------------------------------------------------------GELGVYG..FR
Q9UZH6_PYRAB/14-420---------------------------------------------------------------------GELGLYG..FR
Q9YCR2_AERPE/4-405---------------------------------------------------------------------GELGVYGFRHR
V5Q348_ZYMMB/62-511---------------------------------------------------------------------ARTGIIANNWY
C6IK84_9BACE/29-473---------------------------------------------------------------------SVNGIISNRWM
ALPH_SYNE7/42-494---------------------------------------------------------------------AINGIIGNNWF
ALPH_ELIME/32-489---------------------------------------------------------------------SIHGIAGNDWY
CDA_MYROD/31-491---------------------------------------------------------------------AINGIAGNDFI
Q7MEK0_VIBVY/30-506---------------------------------------------------------------------SVHGMVGNVWY
Q84EY0_9GAMM/27-481---------------------------------------------------------------------ALHGIVNNEWY
O29992_ARCFU/4-416---------------------------------------------------------------------GEHGLVGQAWY
Q981Q5_RHILO/5-379---------------------------------------------------------------------ETHGIYGNHIF
Q98IY7_RHILO/32-447---------------------------------------------------------------------KSTGVFYDDSY
Q7UKE3_RHOBA/4-350---------------------------------------------------------------------RDHGIVGNGWL
O69954_STRCO/13-378---------------------------------------------------------------------SEHGIVGNGWY
Q8YZP2_NOSS1/4-370---------------------------------------------------------------------DEHGIVANGWY
Q7AYA7_9RHIZ/4-370---------------------------------------------------------------------SEHGIVGNGWL
Q7NU73_CHRVO/4-375---------------------------------------------------------------------EQHGIVGNGWL
D3MCQ1_PROAA/44-359---------------------------------------------------------------------GCHGVVGYTFR
F7PA94_MYCPC/42-363---------------------------------------------------------------------GQHGILGFTLR
O50518_STRCO/58-383---------------------------------------------------------------------GAHGLPGYTVR
Q6N507_RHOPA/30-497---------------------------------------------------------------------GDTGTFSNTIY
Q7WNM8_BORBR/6-370---------------------------------------------------------------------ARHGLLGNCML
F0K5R6_CLOAE/8-378---------------------------------------------------------------------EKHGIFNNEKM
Q8XKL9_CLOPE/10-374---------------------------------------------------------------------VNHGITNNIVL
C8K1F1_LISMN/5-366---------------------------------------------------------------------ATHGIINNTKV
Q73E52_BACC1/9-380---------------------------------------------------------------------NKHGVVSNTLL
O45359_CAEEL/26-353---------------------------------------------------------------------RRHGIIGDYIN
Q22129_CAEEL/24-374---------------------------------------------------------------------ENHGFTADYMW
O58841_PYRHO/4-322---------------------------------------------------------------------RHHWVVENGYY
ENPP6_XENLA/26-357---------------------------------------------------------------------ETHHMTGNFMW
ENPP6_MOUSE/26-357---------------------------------------------------------------------EVHQMIGNYMW
ENPP1_CAEEL/182-494---------------------------------------------------------------------ESHGITDNSVF
ENPP2_CAEEL/81-386---------------------------------------------------------------------ESHGITDNYVF
Q7MXP5_PORGI/37-349---------------------------------------------------------------------DHHGIVANEFV
ENPP7_HUMAN/33-356---------------------------------------------------------------------ENHGVVHNMYY
Q6ZM30_DANRE/31-356---------------------------------------------------------------------ENHGVIHNNWF
Q6CX45_KLULA/136-460---------------------------------------------------------------------HHHGIIANRFW
ENPP5_HUMAN/30-342---------------------------------------------------------------------ENHGIVANDMF
ENPP4_XENLA/30-339---------------------------------------------------------------------ESHGIVANRMY
K7BSV5_PANTR/28-339---------------------------------------------------------------------ESHGIVANSMY
Q6VZU9_CNPV/107-431---------------------------------------------------------------------TSHGIVNNEFL
O90761_FOWPV/120-443---------------------------------------------------------------------ISHGITDNEFI
Q6PGY9_DANRE/161-472---------------------------------------------------------------------ESHGIVGNSIH
ENPP2_RAT/165-477---------------------------------------------------------------------ESHGIVGNSMY
Q7ZXN7_XENLA/166-476---------------------------------------------------------------------ESHGIVGNSMY
ENPP3_MOUSE/161-485---------------------------------------------------------------------ESHGIIDNNMY
ENPP1_RAT/194-520---------------------------------------------------------------------ESHGIIDNKMY
Q9SU81_ARATH/60-394---------------------------------------------------------------------AYHGIIMNKFT
Q9SU82_ARATH/57-390---------------------------------------------------------------------ASHGIIMNKFT
Q42974_ORYSA/92-418---------------------------------------------------------------------SSHGIINNYFP
Q9FS13_SPIOL/96-418---------------------------------------------------------------------PHHGIINNYFV
Q9SU83_ARATH/109-435---------------------------------------------------------------------AYHGIINNHFV
M9N2F7_ASHG1/153-497---------------------------------------------------------------------GHHGIVSNVFY
Q6FKX1_CANGA/187-587---------------------------------------------------------------------SMHKMIANSFW
N1P7V5_YEASC/170-545---------------------------------------------------------------------IHHGIVSNVFW
M4TY79_9XANT/48-366---------------------------------------------------------------------DHHGIVHNSMR
Q9PAB9_XYLFA/40-358---------------------------------------------------------------------DHHGIVHNTME
H2VFP5_ZYMMO/50-367---------------------------------------------------------------------DHHGIVGNNMD
Q9A8S4_CAUCR/74-393---------------------------------------------------------------------DRNGIVANTMV
Q7SI20_NEUCR/254-584---------------------------------------------------------------------EAHGVVGNTFW
YGK5_SCHPO/76-404---------------------------------------------------------------------ESHGIVSNNFF
Q6BTN4_DEBHA/173-514---------------------------------------------------------------------SEHGIVGNTFF
Q6C6J4_YARLI/277-608---------------------------------------------------------------------SSHGIVGNTFF

PF00884

C3LB12_BACAC/143-439---------------------------------------------------------------------SLLMPG.SIPY
A0A038KMS4_MYCTX/43-460---------------------------------------------------------------------HSAGMGGITEI
K4NNF3_HELPX/294-587---------------------------------------------------------------------INDNNLVNSG.
A1IT97_NEIMA/232-524---------------------------------------------------------------------TDYD.......
E8VE61_BACST/245-536---------------------------------------------------------------------LAQGSVFV...
O43113_NEUCS/45-420---------------------------------------------------------------------HNTNVTDVSPP
A0A038F731_MYCTX/212-635---------------------------------------------------------------------HRVGFGSVCEF
O82879_STRMG/460-745---------------------------------------------------------------------YNFNSSVSTLY
O85099_ECOLX/237-530---------------------------------------------------------------------KN.........
A0A017IKP4_ECOLX/260-505---------------------------------------------------------------------SYMDG......
ARS_HEMPU/52-373---------------------------------------------------------------------VRIGTFGETRV
ARS_CHLRE/27-385---------------------------------------------------------------------HNTNFTSVLPP
ARSA_HUMAN/21-346---------------------------------------------------------------------VRMGMYPGVLV
A0A017J6J3_ECOLX/86-419---------------------------------------------------------------------IHHGILMPPMY
A0A017J597_ECOLX/236-527---------------------------------------------------------------------EHYK.......
A0A017HZX0_ECOLX/4-341---------------------------------------------------------------------NQSGPWTNN..
ARSB_FELCA/47-366---------------------------------------------------------------------IHTGLQHQIIW
GALNS_HUMAN/31-355---------------------------------------------------------------------IRNGFYTTNAH
A0A017I1Q5_ECOLX/248-538---------------------------------------------------------------------AEDN.......
C9MG45_HAEIF/211-475---------------------------------------------------------------------...........
GNS_CAPHI/54-391---------------------------------------------------------------------HNHHVVNNTLE
STS_MOUSE/35-421---------------------------------------------------------------------PRSGMAAHGRV
ARS_STRPU/67-388---------------------------------------------------------------------IRTGVYGEERI
SPHM_HUMAN/23-328---------------------------------------------------------------------HQNGMYGLHQD
A0A022NJX0_PSEAI/5-420---------------------------------------------------------------------HIAGIGTMAEA
E8H705_ECO57/223-491---------------------------------------------------------------------LS.........
F6BMG6_SINMB/269-561---------------------------------------------------------------------AFLPYG.SIPY
A0A017IT13_ECOLX/217-483---------------------------------------------------------------------...........
A0A024LN14_ECOLX/58-408---------------------------------------------------------------------ARFGVYSNTDA
A0A038FFI8_MYCTX/37-466---------------------------------------------------------------------TTVGMATIEEF
A0A038VAH2_MYCTX/5-389---------------------------------------------------------------------DLHGVTQTDGI
Q0Z8S6_VOLCA/26-386---------------------------------------------------------------------HNTNFTDVLGP
Q45087_9BURK/4-384---------------------------------------------------------------------MNHRAVQNT..
A0A059MXH6_ENTFL/256-543---------------------------------------------------------------------ELMNAQMTTPY
Q840W2_STRMG/270-555---------------------------------------------------------------------YNFSSSVSTLY
M2E9Z0_STRMG/503-788---------------------------------------------------------------------YNFNSSVSTLY
Q8G592_BIFLO/306-604---------------------------------------------------------------------ANFESSLSSPY
A0A029SCQ9_STRPY/480-765---------------------------------------------------------------------YNFSSSVSVLY
Q8P1I3_STRP8/480-765---------------------------------------------------------------------YNFSSSVSVLY
Q8XK47_CLOPE/257-551---------------------------------------------------------------------DYLPVGEIPNN
Q984T6_RHILO/281-574---------------------------------------------------------------------AFLPAG.SIPY
Q98EG2_RHILO/158-441---------------------------------------------------------------------LEEH.......
Q9A0F9_STRP1/480-765---------------------------------------------------------------------YNFSSSVSVLY
Q9AI31_BURML/214-497---------------------------------------------------------------------SHLGYARFYPY
H8ID57_PASMH/287-557---------------------------------------------------------------------TPARAVVKL..
Q9CM05_PASMU/231-523---------------------------------------------------------------------KHFS.......
A0A030RTZ7_PSEAI/238-530---------------------------------------------------------------------EH.........
A0A022NH93_PSEAI/238-529---------------------------------------------------------------------EDYS.......
A0A030XY34_PSEAI/231-522---------------------------------------------------------------------ADYS.......
A0A030YI64_PSEAI/223-501---------------------------------------------------------------------KLDSGTPKGVE
F0ADR9_NEIME/214-487---------------------------------------------------------------------ANGL.......
A0A016X8V3_VIBCL/240-530---------------------------------------------------------------------QNFD.......
Q9PGC7_XYLFA/245-535---------------------------------------------------------------------RNYD.......
Q9RBI1_ACIAD/237-531---------------------------------------------------------------------QNYD.......
Q9RMJ0_NEIME/232-495---------------------------------------------------------------------...........
Q9X6R2_PSEAI/20-300---------------------------------------------------------------------LPGFEYLMQT.
D5AWR1_RICPP/218-505---------------------------------------------------------------------SQ.........
Q9ZJJ5_HELPJ/225-518---------------------------------------------------------------------ET.........
Q9ZN39_HELPJ/222-504---------------------------------------------------------------------NSLG.......

PF02995

Q19148_CAEEL/61-607---------------------------------------------------------------------TARTMFMRHMP
O18062_CAEEL/67-538---------------------------------------------------------------------MNTGMAKRSFP
Q9VSJ3_DROME/115-607---------------------------------------------------------------------ISRVNLIRAMP
Q21671_CAEEL/74-651---------------------------------------------------------------------LSYSQAARSLP
Q9VGG4_DROME/77-573---------------------------------------------------------------------ISHMHYQRYFS
Q9VQH3_DROME/74-555---------------------------------------------------------------------ISHMHYMRYFH
Q9VAU4_DROME/90-580---------------------------------------------------------------------LSRINLRRTMP
Q9VKK3_DROME/98-598---------------------------------------------------------------------LSHLNFLRQMR
Q19486_CAEEL/79-568---------------------------------------------------------------------MSRGNFVRQMQ
Q9V9Q1_DROME/66-560---------------------------------------------------------------------ISQMHFHRSMA
Q9VF91_DROME/73-581---------------------------------------------------------------------LSRNAFIRKLP
Q9VLG3_DROME/84-577---------------------------------------------------------------------LSRINLRRTMP
Q9V9P7_DROME/68-547---------------------------------------------------------------------VSHMHFVRYFP
O62436_CAEEL/78-581---------------------------------------------------------------------LSQMSFRRKLP
Q9W0F7_DROME/16-518---------------------------------------------------------------------TSRMNLRRSMP
Q8SY05_DROME/180-657---------------------------------------------------------------------ISRMNLELTMP
Q9VIP6_DROME/56-555---------------------------------------------------------------------TSRINLRRAMP

PF01676

APGM2_ARCFU/1-380................................................................................
DEOB_GEOSE/6-381..........................................................IDELGPEHMETGALIVYTSADS
E8VA73_BACST/4-499.......................................................LTRVNVAIREGEFERNQTFLDAISN
APGM_AQUAE/13-398................................................................................
A0A017I0E2_ECOLX/6-501.......................................................LTRLDVEIKDRAFFANPVLTGAVDK
I0ZIS4_HELPX/3-399..........................................................IKDLGEKHLETLYPIFYTSADS
PMGI_MESCR/20-545.......................................................AKLVDLALESGKIYDGEGF.NYIKE
GPMI_PORPU/7-507.......................................................LVKIGNSIENKSFFNNVQLNCACDH
F7URM6_SYNYG/7-504.......................................................LVRISDAIEDGTFFDNQALIEVCQR
APGM_PYRHO/5-403................................................................................
PMGI_MAIZE/20-545.......................................................AKLVDQALASGKIYDGDGF.NYIKE
PMGI_RICCO/17-542.......................................................AKLVDLALASGKIYEGEGF.KYVKE
G4EU83_BACIU/7-382..........................................................LDELGQEHMETGALIVYTSADS
APGM1_ARCFU/1-399................................................................................
APGM1_METJA/4-402................................................................................
D8KJJ3_LACLN/6-399..........................................................IEDFGPRQLETGELIIYTSADP
B1X727_ECODH/2-390..........................................................EADLGQ................
GPMI_PSESM/6-497.......................................................FTRVTKAIRDGEFFENPTICAAVDK
GPMI_ANTSP/7-499.......................................................LVKISKSIKNKEFFNNYQLHNIYKY
I0ZG59_HELPX/3-482.......................................................LVKISLSLQNDELKNNPAFLNTIQK
PMGI_TOBAC/20-545.......................................................AKLVDLALASGKIYEGEGF.KYVKE
M7ZXD7_TRIUA/25-880NLSGNSDSSRRPSRGCFAATPSPGTTRRRRRSRPSRGPSRQAPSSRCPTSTGRSCAKLVDLALDSGKIYEGEGF.KYIQQ
A0A009END8_ECOLX/2-399..........................................................LDQLGEEHMKTGKPIFYTSADS
APGM2_METTH/4-396................................................................................
GPMI_MYCGE/3-493.......................................................LSLINQHIKDRSFFANKAFLKTIEH
M1GCD6_MYCPM/3-494.......................................................LSLINQNIKTGAFHHNQVLLEAIAR
GPMI_HELPY/3-482.......................................................LVKISLSLQNDELKNNPAFLNTIQK
APGM1_METTH/1-400................................................................................
APGM2_METJA/1-398................................................................................

PF00245

PPB_BOMMO/74-515----------------------------------------------------------------------NQGTLGVTAA
PPBT_BOVIN/51-490----------------------------------------------------------------------NEGTVGVSAA
PPBI_MOUSE/52-486----------------------------------------------------------------------NYKTIGLSAA
PPBN_MOUSE/51-486----------------------------------------------------------------------NMKVIGLSAA
PPB1_HUMAN/55-490----------------------------------------------------------------------NFQTIGLSAA
B1W385_STRGG/41-448----------------------------------------------------------------------VNGRVSKSHD
A0A017K3Y5_ECOLX/64-470----------------------------------------------------------------------YNGALGVDIH
A0A023ZB72_YEASX/66-527----------------------------------------------------------------------YNGAIGVDPH
J7JQ01_BACIU/49-459----------------------------------------------------------------------YNNAIGVDKN
G4EZI5_BACIU/43-455----------------------------------------------------------------------YNNAIAVDND

PF08665

Q2RKS0_MOOTA/260-429--------------------------------------------------------------------------------
Q72AH5_DESVH/438-616--------------------------------------------------------------------------------
Q8TNC5_METAC/496-671--------------------------------------------------------------------------------
Q3A8U0_CARHZ/461-637--------------------------------------------------------------------------------
B1YIB9_EXIS2/462-638--------------------------------------------------------------------------------
Q5P0R1_AROAE/485-661--------------------------------------------------------------------------------
Q2W5M5_MAGSA/475-648--------------------------------------------------------------------------------
Q8ZK15_SALTY/474-650--------------------------------------------------------------------------------
Q7MVV4_PORGI/231-425--------------------------------------------------------------------------------
A5EWI8_DICNV/401-578--------------------------------------------------------------------------------

PF07394

Q7UT83_RHOBA/61-480----------------------------------------------------------------ESLN...HPEALLHMN
Q7UHL2_RHOBA/84-501----------------------------------------------------------------DSVN...HPQSVYQMN
Q7UN58_RHOBA/63-468----------------------------------------------------------------RGQS...HGQAVGMVN
Q98BS1_RHILO/39-404----------------------------------------------------------------VFARLFKANQAAVVHA
Q7UHK7_RHOBA/71-478----------------------------------------------------------------ESND...HVPAIYQIN
Q7UKW9_RHOBA/100-522----------------------------------------------------------------EAIN...HDPAITFFQ
Q8P3X8_XANCP/29-384----------------------------------------------------------------SLLPLWQRKQLAFVPF
Q7UZ35_RHOBA/49-467----------------------------------------------------------------EQIN...HDPAHAFMN
Q7UFP1_RHOBA/49-464----------------------------------------------------------------EQIN...HDPAHTFFN
Q7MLK9_VIBVY/33-420----------------------------------------------------------------ELQGLVNRGKAIPIVN
Q7US09_RHOBA/66-482----------------------------------------------------------------NGIN...HSGGICQMN
Q7VYL6_BORPE/29-381----------------------------------------------------------------SLLPFYQRGELAFVPF
Q7UDW2_RHOBA/77-502----------------------------------------------------------------DQFN...HGPAQLMVH
Q87HJ3_VIBPA/35-425----------------------------------------------------------------ALAPLFQQGDANLVLN
Q7UM62_RHOBA/63-489----------------------------------------------------------------TQFN...HAPAQLLLH
Q7UJ64_RHOBA/59-474----------------------------------------------------------------DSVN...HPTAMYQMN
Q7UIF5_RHOBA/61-494----------------------------------------------------------------EDSN...HG.AQLQFH
Q7UYJ8_RHOBA/60-484----------------------------------------------------------------KTNT...HGPGENFMS
Q7MCK0_VIBVY/38-408----------------------------------------------------------------ALVPLIDEGYGLPIMA
Q9A5N3_CAUCR/44-506----------------------------------------------------------------NMQKAFNAGRLAALAN
Q7ULC1_RHOBA/52-445----------------------------------------------------------------DQGN...HGAGNHYMM
Q7UQT8_RHOBA/50-438----------------------------------------------------------------TLAA...HQLGREYIN
Q7UQ29_RHOBA/54-472----------------------------------------------------------------DVPN...HEPSLLLMN
Q7UGB9_RHOBA/69-492----------------------------------------------------------------DQFN...HAPAQMCLL
Q7UPP6_RHOBA/56-434----------------------------------------------------------------ETGA...HEQGRYLMR
Q7UI66_RHOBA/46-421----------------------------------------------------------------READ...HSRGSYYMH
Q7UVE3_RHOBA/81-505----------------------------------------------------------------DEIN...HAPAMTKFL
Q7UW70_RHOBA/70-497----------------------------------------------------------------TPNGLFNHTAAIYQMM
Q7UKM6_RHOBA/69-495----------------------------------------------------------------EAIN...HDPAVTYIN
Q7UTL9_RHOBA/100-490----------------------------------------------------------------DVID..EHAAATNRMH
Q7UGF5_RHOBA/94-499----------------------------------------------------------------TAAA..VHDAGWQMLQ
Q9A6V4_CAUCR/38-393----------------------------------------------------------------AVHALTQKGQARIAPA
Q7UYC8_RHOBA/101-527----------------------------------------------------------------ESIN...HDPGKTAFC
Q7UR29_RHOBA/60-444----------------------------------------------------------------GEAA...HERGTHNMF
Q7UYM7_RHOBA/45-446----------------------------------------------------------------KEGD...HGRGSYLMR
Q7UV65_RHOBA/50-468----------------------------------------------------------------TNPA...HGGASMKLH
Q7UJ54_RHOBA/70-497----------------------------------------------------------------DAIN...HDPGKTLFC
Q7UJ36_RHOBA/99-512----------------------------------------------------------------DAFN...HAPAQLMMS
Q7NT93_CHRVO/33-383----------------------------------------------------------------PLMPLWQDKQLALLQG
Q7UEK9_RHOBA/80-501----------------------------------------------------------------KSNT...HGPAENVMN
Q7UQW1_RHOBA/70-487----------------------------------------------------------------EFSE...HTFANYFLH
Q7UPF7_RHOBA/65-448----------------------------------------------------------------KEGD...HERAIYAMK
Q7UYR5_RHOBA/95-521----------------------------------------------------------------EAIN...HDPAITYIC
Q7UWA1_RHOBA/72-492----------------------------------------------------------------DSPI...HGSAMLMMN
Q89DL5_BRADU/42-392----------------------------------------------------------------EFARMYRDMHAAVIHA
Q7URV7_RHOBA/77-499----------------------------------------------------------------DTSA...HPQGENFLN
Q7MDY0_VIBVY/67-457----------------------------------------------------------------KLANVFNQGDANVVLN
Q7UH70_RHOBA/75-488----------------------------------------------------------------DVPN...HEPGLMMMN
Q7UVE1_RHOBA/82-507----------------------------------------------------------------DQFN...HGPAQLMVH
Q7UQ53_RHOBA/45-480----------------------------------------------------------------KTGV...HSQATYLQA
Q7UP10_RHOBA/69-492----------------------------------------------------------------EAIN...HGPAVTFMQ

PF04185

Q47936_FRANO/55-471---------------------------------------------------------------S.....FNGG.......
PHOX_KLULA/65-312---------------------------------------------------------------.................
Q98ES1_RHILO/58-274---------------------------------------------------------------.................
A0A038F821_MYCTX/50-282---------------------------------------------------------------.................
D0KPN6_SULS9/27-365---------------------------------------------------------------DY....WFDT.......
NPC6_ARATH/59-394---------------------------------------------------------------Q.....VFGS...GPGQ
NPC5_ARATH/13-380---------------------------------------------------------------QVFGKPWDSGHPDPNPG
NPC3_ARATH/16-381---------------------------------------------------------------QVFGKPFSDE...SPYP
NPC1_ARATH/38-396---------------------------------------------------------------Q.....IFGS.NDTSGD
NPC2_ARATH/27-389---------------------------------------------------------------Q.....VFGS.NDTSMD
Q9KH04_BURML/84-547---------------------------------------------------------------Q.....INGG.......
Q983N8_RHILO/60-507---------------------------------------------------------------Q.....INGG.......
E2TNP6_MYCTX/52-433---------------------------------------------------------------S.....WNGG.......
A1KJH2_MYCBP/50-429---------------------------------------------------------------S.....WNGG.......
A4KJA2_MYCTX/52-435---------------------------------------------------------------S.....WNGG.......
A5WPW5_MYCTF/51-431---------------------------------------------------------------A.....WNGG.......
A0A030U552_PSEAI/51-437---------------------------------------------------------------I.....WNQG.......
A3NXI4_BURP0/47-438---------------------------------------------------------------A.....WNKG.......
B8H354_CAUCN/40-437---------------------------------------------------------------A.....WDQG.......
A0A022NDQ0_PSEAI/48-422---------------------------------------------------------------A.....WNEG.......

PF16347

G2PRM5_MURRD/414-516--------------------------------------------------------------------------------
G7USR5_PSEUP/397-499--------------------------------------------------------------------------------
D5BJX1_ZUNPS/413-515--------------------------------------------------------------------------------
G0J719_CYCMS/407-508--------------------------------------------------------------------------------
D2R402_PIRSD/397-498--------------------------------------------------------------------------------
G8NQI2_GRAMM/379-480--------------------------------------------------------------------------------
D2QMZ8_SPILD/410-511--------------------------------------------------------------------------------
A4AWR6_MARSH/414-516--------------------------------------------------------------------------------
A6LDP5_PARD8/412-514--------------------------------------------------------------------------------
A4CJM0_ROBBH/381-483--------------------------------------------------------------------------------
A2TWV5_9FLAO/422-523--------------------------------------------------------------------------------
G8UMU5_TANFA/417-519--------------------------------------------------------------------------------
D5BJT8_ZUNPS/386-488--------------------------------------------------------------------------------
F9YSE0_CAPCC/401-501--------------------------------------------------------------------------------
D3IBE7_9BACT/417-519--------------------------------------------------------------------------------
C7M893_CAPOD/396-496--------------------------------------------------------------------------------
G0J436_CYCMS/421-522--------------------------------------------------------------------------------
A3HWF8_9BACT/418-520--------------------------------------------------------------------------------
E8V2R6_TERSS/392-493--------------------------------------------------------------------------------
G8TRD3_NIAKG/412-512--------------------------------------------------------------------------------
H8KTX9_SOLCM/409-510--------------------------------------------------------------------------------
F4L7F1_HALH1/402-503--------------------------------------------------------------------------------
F3ZRQ1_9BACE/413-515--------------------------------------------------------------------------------
E6SVH3_BACT6/418-520--------------------------------------------------------------------------------
D2QEZ9_SPILD/447-548--------------------------------------------------------------------------------
G0IUX7_CYCMS/423-524--------------------------------------------------------------------------------
G0L151_ZOBGA/413-515--------------------------------------------------------------------------------
A6KZU2_BACV8/416-518--------------------------------------------------------------------------------
A6L8Y1_PARD8/413-515--------------------------------------------------------------------------------
I3YHK1_ALIFI/406-508--------------------------------------------------------------------------------
Q5LAU2_BACFN/415-517--------------------------------------------------------------------------------
R5M554_9BACE/414-516--------------------------------------------------------------------------------
R5UAM5_9BACE/410-512--------------------------------------------------------------------------------
R7DGX3_9PORP/412-514--------------------------------------------------------------------------------
W0EZJ7_9SPHI/397-497--------------------------------------------------------------------------------

PF14707

A9VBN0_MONBE/428-544--------------------------------------------------------------------------------
E6ZGQ8_DICLA/413-534--------------------------------------------------------------------------------
Q4S4L1_TETNG/407-528--------------------------------------------------------------------------------
E1BU03_CHICK/390-510--------------------------------------------------------------------------------
ARSG_MOUSE/402-522--------------------------------------------------------------------------------
A6QLR7_BOVIN/402-522--------------------------------------------------------------------------------
ARSG_CANFA/402-522--------------------------------------------------------------------------------
B4DQ74_HUMAN/301-421--------------------------------------------------------------------------------
A9V957_MONBE/437-571--------------------------------------------------------------------------------
F0Y2N2_AURAN/404-544--------------------------------------------------------------------------------
Q1YP24_9GAMM/409-501--------------------------------------------------------------------------------
C6W2Y6_DYAFD/349-461--------------------------------------------------------------------------------
D7VQY4_9SPHI/353-442--------------------------------------------------------------------------------
F2UD41_SALR5/491-612--------------------------------------------------------------------------------
A9UXW0_MONBE/287-431--------------------------------------------------------------------------------
F2UKF0_SALR5/383-527--------------------------------------------------------------------------------
B9QU81_9RHOB/44-158--------------------------------------------------------------------------------
E4YGB6_OIKDI/449-582--------------------------------------------------------------------------------
F2U742_SALR5/410-535--------------------------------------------------------------------------------
A9UPM8_MONBE/326-451--------------------------------------------------------------------------------
A8XD87_CAEBR/394-528--------------------------------------------------------------------------------
E1FX25_LOALO/406-541--------------------------------------------------------------------------------
F1KQC6_ASCSU/1702-1837--------------------------------------------------------------------------------
F2UCT8_SALR5/90-221--------------------------------------------------------------------------------
A9V7E7_MONBE/452-571--------------------------------------------------------------------------------
C1BQY6_9MAXI/368-496--------------------------------------------------------------------------------
Q4RJR3_TETNG/343-473--------------------------------------------------------------------------------
Q6AX40_XENLA/368-499--------------------------------------------------------------------------------
A1L2N0_XENLA/374-505--------------------------------------------------------------------------------
F1NWF7_CHICK/373-504--------------------------------------------------------------------------------
Q32KK2_RAT/368-501--------------------------------------------------------------------------------
ARSA_BOVIN/368-501--------------------------------------------------------------------------------
ARSA_HUMAN/368-501--------------------------------------------------------------------------------
E4XNY3_OIKDI/402-532--------------------------------------------------------------------------------
C3ZV84_BRAFL/657-789--------------------------------------------------------------------------------
Q4SI19_TETNG/405-541--------------------------------------------------------------------------------
F1QFT2_DANRE/220-352--------------------------------------------------------------------------------
Q5XG10_XENLA/375-507--------------------------------------------------------------------------------
GALNS_CANFA/377-509--------------------------------------------------------------------------------
F1NW57_CHICK/376-508--------------------------------------------------------------------------------
A0YAF7_9GAMM/381-478--------------------------------------------------------------------------------
Q0C069_HYPNA/397-504--------------------------------------------------------------------------------
ARS_STRPU/411-541--------------------------------------------------------------------------------
ARS_HEMPU/396-526--------------------------------------------------------------------------------
O16138_HELER/402-534--------------------------------------------------------------------------------
A4AN36_MARSH/378-468--------------------------------------------------------------------------------
A4CMB0_ROBBH/401-491--------------------------------------------------------------------------------
A3XMW9_LEEBM/382-476--------------------------------------------------------------------------------
A7V8P9_BACUN/356-447--------------------------------------------------------------------------------
A6CB11_9PLAN/382-473--------------------------------------------------------------------------------
F0SFZ7_PLABD/380-468--------------------------------------------------------------------------------
C3ZQB5_BRAFL/423-551--------------------------------------------------------------------------------
C3ZQC1_BRAFL/344-471--------------------------------------------------------------------------------
A7SK49_NEMVE/435-563--------------------------------------------------------------------------------
A7SQ82_NEMVE/425-557--------------------------------------------------------------------------------
A7SK50_NEMVE/483-612--------------------------------------------------------------------------------
Q7ZWB8_DANRE/433-548--------------------------------------------------------------------------------
Q6DJK3_XENLA/433-566--------------------------------------------------------------------------------
Q32KK0_RAT/450-603--------------------------------------------------------------------------------
F1QB82_DANRE/433-568--------------------------------------------------------------------------------
Q4RYA1_TETNG/304-429--------------------------------------------------------------------------------
STS_MOUSE/445-581--------------------------------------------------------------------------------
STS_RAT/436-573--------------------------------------------------------------------------------
STS_HUMAN/437-572--------------------------------------------------------------------------------
D2HXW7_AILME/434-569--------------------------------------------------------------------------------
Q4TCJ7_TETNG/242-385--------------------------------------------------------------------------------
Q6GMA1_XENLA/439-573--------------------------------------------------------------------------------
ARSF_HUMAN/440-574--------------------------------------------------------------------------------
Q32KI0_CANFA/435-568--------------------------------------------------------------------------------
ARSE_HUMAN/448-582--------------------------------------------------------------------------------
Q32KI1_CANFA/444-578--------------------------------------------------------------------------------
A5D7J7_BOVIN/445-576--------------------------------------------------------------------------------
ARSH_HUMAN/418-551--------------------------------------------------------------------------------
F1NFQ0_CHICK/445-579--------------------------------------------------------------------------------
D2HFI2_AILME/436-570--------------------------------------------------------------------------------
ARSD_HUMAN/451-585--------------------------------------------------------------------------------
C3Y4J9_BRAFL/389-521--------------------------------------------------------------------------------
C3Y4X6_BRAFL/434-568--------------------------------------------------------------------------------
C3YBU1_BRAFL/392-524--------------------------------------------------------------------------------
C3ZST4_BRAFL/433-562--------------------------------------------------------------------------------
C3Z258_BRAFL/432-564--------------------------------------------------------------------------------
C3YQ76_BRAFL/419-552--------------------------------------------------------------------------------
C3YZM0_BRAFL/417-549--------------------------------------------------------------------------------

PF01663

Q7NDL2_GLOVI/4-434....------------------..------.EEKGDD--VFYTLYDARD...................------------
Q9X5T4_STRLA/7-389....------------------..------TCHDPEY--APQVLT.......................------------
B0R301_HALS3/15-396....------------------..------DRETGSY--ETYVPMGQD....................------------
Q9X5S1_STRLA/5-395....------------------..------APGDGYR--ITFPGVRQ.....................------------
Q9X5R9_STRLA/7-410....------------------..------DTQDPAY--GARVTRSGD....................------------
Q9YCS9_AERPE/3-432....------------------..------GRKGQEY--RLYPAD.......................------------
Q9X5S9_STRLA/7-409....------------------..------DRGAYDY--GPLKFATSHS...................------------
Q9UZH6_PYRAB/14-420....------------------..------HRKGNSY--TEYWIAHSKK...................------------
Q9YCR2_AERPE/4-405....------------------..------RPGDVGT--SYVVTSRS.....................------------
V5Q348_ZYMMB/62-511....------------------DF------SVKRADK--KVYCSEDPSLSADP...............------------
C6IK84_9BACE/29-473....------------------..------DVATLRP--.VNSTDDAAFMGYYT..............------------
ALPH_SYNE7/42-494....------------------..------DPQLGRD--.VYCVEDKSVKTVGS..............------------
ALPH_ELIME/32-489....------------------..------DKELGKS--.VYCTSDETVQPVGT..............------------
CDA_MYROD/31-491....------------------..------IQATGQN--.MYCTQDDSVQAVGG..............------------
Q7MEK0_VIBVY/30-506....------------------..------DRQKERL--.VYNVEDENYAMLNSHAGVNKATEIDPTQ------------
Q84EY0_9GAMM/27-481....------------------..------DRKSRQM--.VYCMEDLKTNILQT............SH------------
O29992_ARCFU/4-416....------------------..------DRAKGEY--VGYDFELTM....................------------
Q981Q5_RHILO/5-379RGDA------------------SV------APLAEDL--LVPTIATHARQA.GL..............------------
Q98IY7_RHILO/32-447....------------------..------DRTYFAP--ASDCKGEPGAEVAFA..............------------
Q7UKE3_RHOBA/4-350....------------------..------YRDTQEI--RFWQQTRTL....................------------
O69954_STRCO/13-378....------------------..------FRELGDV--LLWRQHNGL....................------------
Q8YZP2_NOSS1/4-370....------------------..------FRDECEI--KFWRQSNKL....................------------
Q7AYA7_9RHIZ/4-370....------------------..------FRDLMEV--WLWRQSNRL....................------------
Q7NU73_CHRVO/4-375....------------------..------FRELAEV--WFWRQSNRL....................------------
D3MCQ1_PROAA/44-359....------------------..------APSGRVM--NALSWVNGDD...................------------
F7PA94_MYCPC/42-363....------------------..------VPGTDRV--LNHVRWRDDPA..................------------
O50518_STRCO/58-383....------------------..------NPDTGAL--MNQLRWQPWTA..................------------
Q6N507_RHOPA/30-497.TGY------------------SV------PPAGNTV--VPFIENDDVLGDID...............------------
Q7WNM8_BORBR/6-370....------------------..------LREADGL--ANHSAGDPGFVERL...............------------
F0K5R6_CLOAE/8-378....------------------..------.......--.QIGVKTQE....................------------
Q8XKL9_CLOPE/10-374....------------------..------.......--.NFKDENPN....................------------
C8K1F1_LISMN/5-366....------------------..------QPEKDS.--.............................------------
Q73E52_BACC1/9-380....------------------..------QPGRES.--.............................------------
O45359_CAEEL/26-353....------------------..------NWKDNL.--.KFQNFTADSDF.S...............------------
Q22129_CAEEL/24-374....------------------..------DRKTNF.--.TFERGTGPNDT.E...............------------
O58841_PYRHO/4-322....------------------..------DRLSGVR--VKFYEYDVAFN..................------------
ENPP6_XENLA/26-357....------------------..------DPKKNI.--.SFDIGANEDSR.L...............------------
ENPP6_MOUSE/26-357....------------------..------DPRTNK.--.SFDIGVNRDSL.M...............------------
ENPP1_CAEEL/182-494....------------------..------DPTISPV--LESMKSTKY....................------------
ENPP2_CAEEL/81-386....------------------..------DPNLYPE--LLAMRKHEA....................------------
Q7MXP5_PORGI/37-349....------------------..------DSLLG..--.IFRISDRKAVE.T...............------------
ENPP7_HUMAN/33-356....------------------..------NTTSKVK--LPYHATLGI....................------------
Q6ZM30_DANRE/31-356....------------------..------NTTTQEK--KQYYMTQFV....................------------
Q6CX45_KLULA/136-460....------------------..------DSKNDV.--.EFQINDISSR..M...............------------
ENPP5_HUMAN/30-342....------------------..------DPIRNK.--.SFSLDHMNIY..D...............------------
ENPP4_XENLA/30-339....------------------..------DADTKQ.--.VFHMNDSH....................------------
K7BSV5_PANTR/28-339....------------------..------DAVTKK.--.HFSDSNDKD...................------------
Q6VZU9_CNPV/107-431....------------------..------DREDDI.--.EFTVQSEETS..E...............------------
O90761_FOWPV/120-443....------------------..------DRGTDI.--.EFTIASEETE..E...............------------
Q6PGY9_DANRE/161-472....------------------..------DPSFDAN--FNFRGKEKLN...................------------
ENPP2_RAT/165-477....------------------..------DPVFDA.--.SFHLRGREKF..N...............------------
Q7ZXN7_XENLA/166-476....------------------..------DPVFDA.--.NFSLRSREKF..N...............------------
ENPP3_MOUSE/161-485....------------------..------DVHLNK.--.NFSLSSVEKS..N...............------------
ENPP1_RAT/194-520....------------------..------DPKMNA.--.SFSLKSKEKF..N...............------------
Q9SU81_ARATH/60-394....------------------..------DPVTGE.--.VFNKGLQ.....................------------
Q9SU82_ARATH/57-390....------------------..------DPVSGE.--.LFNRNLN.....................------------
Q42974_ORYSA/92-418....------------------..------DPISGD.--.YFTMSSHE....................------------
Q9FS13_SPIOL/96-418....------------------..------DPITGD.--.KFSMASHE....................------------
Q9SU83_ARATH/109-435....------------------..------DPETGN.--.VFTMASHE....................------------
M9N2F7_ASHG1/153-497....------------------..------DDTLKKE--FVFVDSPQD....................------------
Q6FKX1_CANGA/187-587....------------------..------DSKNEV.--.EYRPGIID....................------------
N1P7V5_YEASC/170-545....------------------..------DPDLNE.--.EFHPGVLD....................------------
M4TY79_9XANT/48-366....------------------..------DPTLG..--.GFWLSKSEAVG.D...............------------
Q9PAB9_XYLFA/40-358....------------------..------DPLLG..--.AFESENQEAIS.D...............------------
H2VFP5_ZYMMO/50-367....------------------..------DAHITPD--SHFKMSDHQAAT.D...............------------
Q9A8S4_CAUCR/74-393....------------------..------DPSVSAE--.KFTMRSLD....................------------
Q7SI20_NEUCR/254-584....------------------..------DPTLRE.--.EFYYTDPARSM.D...............------------
YGK5_SCHPO/76-404....------------------..------DPVTGK.--.QFVNSMPECNK.D...............------------
Q6BTN4_DEBHA/173-514....------------------..------DPKLNK.--.QFVNTNPKQGGLD...............------------
Q6C6J4_YARLI/277-608....------------------..------DPDLNK.--.QFVNTDPSRSR.D...............------------

PF00884

C3LB12_BACAC/143-439QQA.------------------........IPSQKEI--PSVASELKKQ.GYY---------------------------
A0A038KMS4_MYCTX/43-460AT..------------------..GAPGYSSVLPNTM--SPIARTLKLN.GYN---------------------------
K4NNF3_HELPX/294-587....------------------........VILPSFP--MAIGNITKTL.GYK---------------------------
A1IT97_NEIMA/232-524....------------------........EIKAEHQ--DNLLDIVQRA.GVE---------------------------
E8VE61_BACST/245-536....------------------........NKAQNTL--QSVPAILKSK.NYT---------------------------
O43113_NEUCS/45-420YGGY------------------PKF.....ISQGFNE--AYLPVWLQKA.GYD---------------------------
A0A038F731_MYCTX/212-635PG..------------------..PYPGYSAVRPRSC--AALPRILRDN.GYV---------------------------
O82879_STRMG/460-745TEV.------------------........VPDMSVF--PSISNQFKSK...N---------------------------
O85099_ECOLX/237-530....------------------........PDLYLTQ--PSLMNMMKQA.GYK---------------------------
A0A017IKP4_ECOLX/260-505....------------------........ILSTRTP--AALITALNQQ.GYQ---------------------------
ARS_HEMPU/52-373FLPW------------------TK......TGLPKSE--LTIAEAMKEA.GYA---------------------------
ARS_CHLRE/27-385YGGW------------------AKW.....KGLGIDQ--SYLPLWLKDQ.GYN---------------------------
ARSA_HUMAN/21-346PSSR------------------........GGLPLEE--VTVAEVLAAR.GYL---------------------------
A0A017J6J3_ECOLX/86-419GQ..------------------........PGGLQGL--TTLPQLLHDQ.GYV---------------------------
A0A017J597_ECOLX/236-527....------------------........EELAQHQ--EGVLDIIQRA.GIN---------------------------
A0A017HZX0_ECOLX/4-341....------------------........VAPGKNI--STMGRYFKDA.GYH---------------------------
ARSB_FELCA/47-366PCQP------------------........SCVPLDE--KLLPQLLKEA.GYT---------------------------
GALNS_HUMAN/31-355ARNA------------------YTPQEIV.GGIPDSE--QLLPELLKKA.GYV---------------------------
A0A017I1Q5_ECOLX/248-538....------------------........PQRTLKE--QNIFAVLKQL.GFS---------------------------
C9MG45_HAEIF/211-475....------------------........KGETVYT--DNIISLAKKA.GVK---------------------------
GNS_CAPHI/54-391GNCS------------------SKS.....WQKIQEP--NTFPAILRSMCGYQ---------------------------
STS_MOUSE/35-421GVYL------------------FTASS...GGLPPSE--VTMARLLKGR.GYA---------------------------
ARS_STRPU/67-388FLPW------------------TT......TGLPLYE--VTIAEAMKGA.GYT---------------------------
SPHM_HUMAN/23-328VH..------------------..HFNSFD.....KV--RSLPLLLSQA.GVR---------------------------
A0A022NJX0_PSEAI/5-420LTPE------------------LEGKPGYEGHLNERV--VALPELLREA.GYQ---------------------------
E8H705_ECO57/223-491....------------------........HDIHNYP--DNIINMANQA.GFQ---------------------------
F6BMG6_SINMB/269-561Q...------------------........QYIRNPI--PSLATFFRGE.GYV---------------------------
A0A017IT13_ECOLX/217-483....------------------........DGKPQFQ--DNFVTLANRA.GFQ---------------------------
A0A024LN14_ECOLX/58-408Q...------------------........DGIPLTE--TFLPELFQNH.GYY---------------------------
A0A038FFI8_MYCTX/37-466TD..------------------..GFPNCNGRIPADT--ALLPEVLAEH.GYN---------------------------
A0A038VAH2_MYCTX/5-389GKRF------------------DDSRLR..WLRAGEV--PTLGNWFRAA.GYD---------------------------
Q0Z8S6_VOLCA/26-386HGGY------------------AKW.....KSLGIDK--SYLPVWLQNL.GYN---------------------------
Q45087_9BURK/4-384....------------------........VPLDQRH--LNLGKALRAI.GYD---------------------------
A0A059MXH6_ENTFL/256-543TMM.------------------........IPKMTEL--PSIVSLLKEQ.KYQ---------------------------
Q840W2_STRMG/270-555TEV.------------------........VPSMSVF--PSISDQFKSK...N---------------------------
M2E9Z0_STRMG/503-788TEV.------------------........VPDMSVF--PSISNQFKSK...N---------------------------
Q8G592_BIFLO/306-604QQL.------------------........VPSQHWT--PTINQLWGAP..VN---------------------------
A0A029SCQ9_STRPY/480-765SEV.------------------........FPKMAKP--HTISEFYQGK...N---------------------------
Q8P1I3_STRP8/480-765SEV.------------------........FPKMAKP--HTISEFYQGK...N---------------------------
Q8XK47_CLOPE/257-551N...------------------........ILKKQPV--ESLAYILHDY.GYG---------------------------
Q984T6_RHILO/281-574Q...------------------........QYVRTPT--PSVATFLKSE.GYR---------------------------
Q98EG2_RHILO/158-441....------------------........SQFLPGL--TCLGDVLKAR.GYR---------------------------
Q9A0F9_STRP1/480-765SEV.------------------........FPKMAKP--HTISEFYQGK...N---------------------------
Q9AI31_BURML/214-497....------------------........AFVRRIS--ASLAGWFRRA.GYR---------------------------
H8ID57_PASMH/287-557....------------------........SNSQHGF--FTIAELLAKQ.GYH---------------------------
Q9CM05_PASMU/231-523....------------------........NVQADHQ--DNLLDILQRA.GIA---------------------------
A0A030RTZ7_PSEAI/238-530....------------------........PDRFLTD--PSLMNLMKQA.GYK---------------------------
A0A022NH93_PSEAI/238-529....------------------........DKKAKTH--EGLLDILQRA.GVQ---------------------------
A0A030XY34_PSEAI/231-522....------------------........DARARTQ--EGLLDVLQRA.GLR---------------------------
A0A030YI64_PSEAI/223-501LL..------------------........NNPARAR--ECLPAQLRQH.GFS---------------------------
F0ADR9_NEIME/214-487....------------------........EQISGGD--TNMFRLAKEQ.GYE---------------------------
A0A016X8V3_VIBCL/240-530....------------------........RSRADNQ--DNVLDILQRA.GIS---------------------------
Q9PGC7_XYLFA/245-535....------------------........ESKIRGH--QSLLHVLERA.RIS---------------------------
Q9RBI1_ACIAD/237-531....------------------........ESLATHR--EGLLDITQRA.GYD---------------------------
Q9RMJ0_NEIME/232-495....------------------........GLPGEPN--NNIVSLAKQA.GFR---------------------------
Q9X6R2_PSEAI/20-300....------------------........PEGGHKF--SGLPQLLSAR.QYE---------------------------
D5AWR1_RICPP/218-505....------------------........IENSRLE--NSFLSILTNL.GFN---------------------------
Q9ZJJ5_HELPJ/225-518....------------------........TKPWYHY--HNMIDIFKRS.HYE---------------------------
Q9ZN39_HELPJ/222-504....------------------.............AY--ENLPTYLTKA.GVK---------------------------

PF02995

Q19148_CAEEL/61-607RTVE--------------VMA.KLDYHYLYGYTKVAD--NSMVNLAPILVGDMEEALKKPKYDKSGDF------------
O18062_CAEEL/67-538KLLS--------------YFKNEFQMIEFPFVNKVGE--NSRPNGLPLWFGKSIE...GGRRVTGDDV------------
Q9VSJ3_DROME/115-607KTAQ--------------YLY.DNGWFELAGYNKVDD--NTFPNIMAVLTG...........YNLPNA------------
Q21671_CAEEL/74-651RTVS--------------FFKSYMKGIIFPYMNKVGD--NSRPNGVALWFGKLLEK.VDRFIFDKPSL------------
Q9VGG4_DROME/77-573RVRD--------------LIE.GLPHTELWGYNRVGQ--NSYPNLIPLLSGQ.........SVDEVEA------------
Q9VQH3_DROME/74-555RVAD--------------FIE.HLPHTEFWGYNRVAL--NTYPNLIPLVSGL.........SVSEMEA------------
Q9VAU4_DROME/90-580KVYK--------------FLT.RDGWFEQQGYNKIGD--NTFPNLLAILTGY..........NPESAI------------
Q9VKK3_DROME/98-598RTAN--------------YVRKHLSHVEFWGYNKVGD--NTFPNLVPLLSG...........LDDQEL------------
Q19486_CAEEL/79-568KTYK--------------YMK.EAGFIDMEGHMKIHD--NTYGNLLAILTGK.........RGVGVKE------------
Q9V9Q1_DROME/66-560RTAN--------------FLL.SLPHVELKGFNRLGE--DGFDSLMPLLSG...........LSGQEL------------
Q9VF91_DROME/73-581RTYE--------------YLTQQLGATVLKGYNIVGD--GTPQALVPLLTG...........FTELEL------------
Q9VLG3_DROME/84-577KVFN--------------FLQ.GPGWYEMQGYNKVAD--NSFPNILAILSGY..........SASTAK------------
Q9V9P7_DROME/68-547LVMA--------------FLE.NHPHTKFFGYSRVGL--DANANLVPFLGG...........KSSRAA------------
O62436_CAEEL/78-581QTVK--------------FLEETLGSVVLNGYNIVGD--GTPQAFIPILTAQ.........TETELPL------------
Q9W0F7_DROME/16-518KVHK--------------FLQ.RPGWFEMQGYNKVGE--NTLPNLLAILTGN..........AEENAL------------
Q8SY05_DROME/180-657RMYE--------------YLN.NQHWFELQGYNKMGD--NTFPNLMAVLTG...........FNKTYA------------
Q9VIP6_DROME/56-555SVYK--------------FVR.QPGWFEMQGYNKVGD--NTFPNLLAALTG...........DSEKGV------------

PF01676

APGM2_ARCFU/1-380....--------------...IEALAR....GVK...--GKLVFRCNLVKVE.........DGVMVDY............
DEOB_GEOSE/6-381VLQI--------------AAHEEVIPL..........--EELYRICKIARELTLDE.KYMVGRVIARPFIGT........
E8VA73_BACST/4-499AKEN--------------NKALHLFGLLSDGGVHSHI--NHLFALLKLAKKEGLT...KVYIHGFLDG............
APGM_AQUAE/13-398....--------------...LEALGL....GIDVKD--TDIAVRGNYATVEYRN...G..KPIVVDR............
A0A017I0E2_ECOLX/6-501AKNA--------------GKAVHIMGLLSAGGVHSHE--DHIMAMVELAAERGAE...KIYLHAFLDG............
I0ZIS4_HELPX/3-399VFQI--------------AAHEERFGL..........--DNLYALCEEAFQILEP...LKIARVIARPFIGTN.......
PMGI_MESCR/20-545SFET--------------NT.LHLIGLLSDGGVHSRL--DQLQLLLKGSAERGAK...RIRVHILTDG............
GPMI_PORPU/7-507AIST--------------QTSLHLIGLCSNGGVHSHL--DHLLALIHVAESKKVP...NLYIHLITDG............
F7URM6_SYNYG/7-504VRDR--------------RGKLHLIGLCSDGGVHSHI--DHLLGLIDLAKLQGIS...QLCIHAITDG............
APGM_PYRHO/5-403....--------------...FEALGV....GLDLSK--DDLAFRVNFATLE.........NGIITDR............
PMGI_MAIZE/20-545SFES--------------GT.LHLIGLLSDGGVHSRL--DQLQLLLKGVSERGAK...KIRVHILTDG............
PMGI_RICCO/17-542CFDK--------------GT.LHLIGLLSDGGVHSRL--DQLQLLLKGAAEHGAK...RIRVHVLTDG............
G4EU83_BACIU/7-382VLQI--------------AAHEEVVPL..........--EELYRICETARELTLDP.KYMVGRIIARPFVGE........
APGM1_ARCFU/1-399....--------------...IEAAGV....GIEIKP--GDVAFRANFATVEGEG...SIFDKTVVDR............
APGM1_METJA/4-402....--------------...LEAFGV....GLDLKE--GDIAFRCNFATVDE........NFVVLDR............
D8KJJ3_LACLN/6-399VLQI--------------AAHEDVISR..........--EELYKICEYVRSITLEGSGIMIGRIIARPYVGE........
B1X727_ECODH/2-390VYNI--------------TANLSVISF..........--DDAIKIGRIVREQ......VQVGRVITFGGLLTDSQRILDA
GPMI_PSESM/6-497AVSA--------------GKAVHIMGLLSDGGVHSHQ--DHLVAMAELAVRRGAD...KIYLHAFLDG............
GPMI_ANTSP/7-499SCEK--------------NSKVHIVGLCSNGGVHSHI--NHLKALIQISKQYKV....MTCLHLITDG............
I0ZG59_HELPX/3-482S...--------------.PVVHLMGLMSDGGVHSHI--EHFIALA.LECEKSHK...KVCLHLITDG............
PMGI_TOBAC/20-545CFEK--------------GT.LHLIGLLSDGGVHSRL--DQVQLLLKGAAKHGAK...RIRVHALTDG............
M7ZXD7_TRIUA/25-880SFDT--------------GT.LHLIGLLSDGGVHSRI--DQLQLLLKGASEHGAK...RIRVHILTDG............
A0A009END8_ECOLX/2-399VFQI--------------ACHEETFGL..........--DKLYELCEIAREELTNG.GYNIGRVIARPFIGDK.......
APGM2_METTH/4-396....--------------...LEAASI....GVELGD--DDVAFRCNLINAD.........ERI.VDF............
GPMI_MYCGE/3-493VEKN--------------HSKIHLIGLFSNGGVHSHN--EHLLALIELFSKH..A...KVVLHLFGDG............
M1GCD6_MYCPM/3-494AKAN--------------NAKLHLIGLFSHGGVHSHM--DHLYALIKLAAPQ..V...KMVLHLFGDG............
GPMI_HELPY/3-482S...--------------.PVVHLMGLMSDGGVHSHI--EHFIALA.LECEKSHK...KVCLHLITDG............
APGM1_METTH/1-400....--------------...FEAAGV....GLDVKP--GDIAFRCNFATADE........DMIITDR............
APGM2_METJA/1-398....--------------...IEALGE....DIEIEK--NAIYLRASLGFVKKDE...K..GFLVIDR............

PF00245

PPB_BOMMO/74-515VPRH--------------DCEASTDV----TKRVQSI--AEWALADGRDVGIV---------------------------
PPBT_BOVIN/51-490TQRS--------------QC..NTTQ----GNEVTSI--LRWAKDAGKSVGIV---------------------------
PPBI_MOUSE/52-486ARFD--------------QC..NTTF----GNEVFSV--MYRAKKAGKSVGVV---------------------------
PPBN_MOUSE/51-486ARFN--------------QC..NTTW----GNEVVSV--MHRAKKAGKSVGVV---------------------------
PPB1_HUMAN/55-490ARFN--------------QC..NTTR----GNEVISV--MNRAKKAGKSVGVV---------------------------
B1W385_STRGG/41-448T...--------------........----DRPMPTL--LELARDRGYATGSV---------------------------
A0A017K3Y5_ECOLX/64-470....--------------........----EKDHPTI--LEMAKAAGLATGNV---------------------------
A0A023ZB72_YEASX/66-527....--------------........----HRPCGTV--LEAAKLAGYLTGLV---------------------------
J7JQ01_BACIU/49-459....--------------........----GKKVKSV--LEEAKQQGKSTGLV---------------------------
G4EZI5_BACIU/43-455....--------------........----GSEAKTV--LEAAKEKGKATGLV---------------------------

PF08665

Q2RKS0_MOOTA/260-429------------------------------......A--LGDRVEEERGFL-----------------------------
Q72AH5_DESVH/438-616------------------------------AIADNET--GTVLVDGQSSQG-----------------------------
Q8TNC5_METAC/496-671------------------------------EYR...G--REIFVDGISSEG-----------------------------
Q3A8U0_CARHZ/461-637------------------------------EID..SD--YEVFVDGISVEG-----------------------------
B1YIB9_EXIS2/462-638------------------------------DFD..EN--GRVLVDGKDSAG-----------------------------
Q5P0R1_AROAE/485-661------------------------------AYKINSN--LDVLADGQPVST-----------------------------
Q2W5M5_MAGSA/475-648------------------------------SYS..DK--GDVLVDGQSSAA-----------------------------
Q8ZK15_SALTY/474-650------------------------------CYQPGSG--DIVYADGLSTSG-----------------------------
Q7MVV4_PORGI/231-425------------------------------LQIEKMF--PDLWVDEESEEG-----------------------------
A5EWI8_DICNV/401-578------------------------------LYFPSSI--NSTNSEEKLWKQ-----------------------------

PF07394

Q7UT83_RHOBA/61-480TGSR..............LGGDPAVGAWATYGLGSEN..QNLPGFVVMTE...---------------------------
Q7UHL2_RHOBA/84-501TGSI..............LMGNPSVGSWVAYGLGSEN..QNMPAFVVLPD...---------------------------
Q7UN58_RHOBA/63-468TGSD..............NFVRPSVGAWISYALGAGH..PDLPAHVAIAP...---------------------------
Q98BS1_RHILO/39-404A.......................................ATGYRERSHFDGQ---------------------------
Q7UHK7_RHOBA/71-478SGLP..............RPGFPTAGAWVTYGLGSEN..QNLPGYVVLGN...---------------------------
Q7UKW9_RHOBA/100-522TGSQ..............IAGRPSLGSWISYGLGSEN..DDLPAFVVLVTK..---------------------------
Q8P3X8_XANCP/29-384A.......................................GTDDLSRSHFETQ---------------------------
Q7UZ35_RHOBA/49-467TGSI..............QKGRPSMGSWFLYGLGAET..DSLPGFIVFTSQG.---------------------------
Q7UFP1_RHOBA/49-464TGTA..............ISGRPSMGSWVLYGLGAET..QDLPGFIVLTSEG.---------------------------
Q7MLK9_VIBVY/33-420SGVL....................VEPTTKAELVNGT..RALPPFLFSHNSQQ---------------------------
Q7US09_RHOBA/66-482TGSQ..............FAGRPSLGSWVTYGMGTEN..ENLPAFVVMQE...---------------------------
Q7VYL6_BORPE/29-381A.......................................GTDDASRSHFETQ---------------------------
Q7UDW2_RHOBA/77-502TGAA..............PMGSPSIGSWVTYGLGSEN..EDLPGFIVLLS...---------------------------
Q87HJ3_VIBPA/35-425SGIL....................NQPVTKQAIEQGD..VPLPEQLFSHNSQT---------------------------
Q7UM62_RHOBA/63-489TGSQ..............NLGSASFGAWTMYGLGSEN..QNLPGFVVLVS...---------------------------
Q7UJ64_RHOBA/59-474CGNR..............FGGDPGIGAWVTYGLGSEN..QSLPGFIVLPE...---------------------------
Q7UIF5_RHOBA/61-494TGR............HRVDGFFPTVGSWATYGLGSLN..DNLPQFVVMGT...---------------------------
Q7UYJ8_RHOBA/60-484TGQT..............LDGFPSMGAWATWALGTEN..KNLPAYVAIAD...---------------------------
Q7MCK0_VIBVY/38-408NGQC..............................RGLDGDTLPIIPSGSGNHS---------------------------
Q9A5N3_CAUCR/44-506VGTL....................VAPLTKAQYQKPTAGVQIPPRLFSHNDQQ---------------------------
Q7ULC1_RHOBA/52-445TGAPPRIPVGC....GAFVSFHPSLGSVVSKEIGAPH...GIPAYFSLP....---------------------------
Q7UQT8_RHOBA/50-438CGTR...........PIPSLEYPSYGAVMTRECPGDH...DIPNHVAIP....---------------------------
Q7UQ29_RHOBA/54-472CGEA..............RLIRPAMGSWLTYGLGSDN..ENLPSFIAMC....---------------------------
Q7UGB9_RHOBA/69-492SGFE..............RFGRPSIGSWVSYGIGSKN..KNLPDFVTLIT...---------------------------
Q7UPP6_RHOBA/56-434TAYK...........QINSIQHPGMGAWMVDRQGRAN..KELPGNFLIG....---------------------------
Q7UI66_RHOBA/46-421TGYV...........PNPNIEHPSYGSVIAHELIDQRPELEIPPFVSVG....---------------------------
Q7UVE3_RHOBA/81-505TGHQ..............LPGRPSFGAWASYGLGSMN..SNLPDYVVLISKMK---------------------------
Q7UW70_RHOBA/70-497TGYTTDKVSPSGQLEPPSPKDFPNFGSNIVKMKPLDE...PMLPFVMLPR...---------------------------
Q7UKM6_RHOBA/69-495TGSQ..............QMGHASMGAWLSYGLGSEN..EDFPAYMVLLSQGS---------------------------
Q7UTL9_RHOBA/100-490TGRV...........VTGTVTYPSLGSVVAHELGSAD..SSVPPYVLIG....---------------------------
Q7UGF5_RHOBA/94-499TGRQ...........FTGGVNYPHAGAVVEYLQGRRT...DLPAHVVLPQT..---------------------------
Q9A6V4_CAUCR/38-393I.......................................ASPDRARSHFEAQ---------------------------
Q7UYC8_RHOBA/101-527TGTE..............LPGKPSMGAWLSYGLGTLN..KDLPDYIVMPSAYW---------------------------
Q7UR29_RHOBA/60-444TGYK...........PSPALSYPSFGAVVSHEYGPRN...NLPAYICVP....---------------------------
Q7UYM7_RHOBA/45-446TGQK...........PMGPVQYPCIGSAIGKQLAEDT..MSLPSNVSIG....---------------------------
Q7UV65_RHOBA/50-468TGSD..............VFVRPSMGAWVTYGLGTEN..QNLPGFITICP...---------------------------
Q7UJ54_RHOBA/70-497TGSE..............IPGKASLGSWLSYGLGRMN..ENLPDFIVLNSAFW---------------------------
Q7UJ36_RHOBA/99-512TGSQ..............QFGRPSMGSWTTYGLGSES..RDLPAYVVFNS...---------------------------
Q7NT93_CHRVO/33-383V.......................................GYPDPNLSHFRSI---------------------------
Q7UEK9_RHOBA/80-501TGFT..............FDGFPSMGAWVNFALGSEN..RDLPSFVAMED...---------------------------
Q7UQW1_RHOBA/70-487TGSG..............LQGRPSMGAWVNYGLGSEC..NNLPGFVVLNG...---------------------------
Q7UPF7_RHOBA/65-448SGYR...........PDPTLEHPSIGSILCHADDAGA...DIPRHISIL....---------------------------
Q7UYR5_RHOBA/95-521TGNQ..............LPGKASLGSWLSYGLGTEN..EDLPAFLVMTASWT---------------------------
Q7UWA1_RHOBA/72-492SGKI..............LSGSPALGSWLTYGLGSEN..QNMPGFVVMLD...---------------------------
Q89DL5_BRADU/42-392V.......................................ATPYRDRSHFDGQ---------------------------
Q7URV7_RHOBA/77-499TGFT..............MEGFPSFGSWVTYALGTEN..QELPAFVAIND...---------------------------
Q7MDY0_VIBVY/67-457SGIL....................CQPTTKQQILDGT..AMLPEQLFSHNSQS---------------------------
Q7UH70_RHOBA/75-488CGDI..............VRPRPSVGAWTLYGMGTEN..QSLPGYVVMC....---------------------------
Q7UVE1_RHOBA/82-507TGQT..............RMGNPSIGSWVTWGLGSEN..EDLPGYMVLLS...---------------------------
Q7UQ53_RHOBA/45-480TGFQ..............RPGFPGMGSWVSYGLGAIN..ENLPTFVVLPD...---------------------------
Q7UP10_RHOBA/69-492TGSM..............FPGRPSMGAWVDYGLGSEN..ENLPAFVVMTTKD.---------------------------

PF04185

Q47936_FRANO/55-471..LMNKFVEHGGHDNDTYKQNCDGQVMGYYDGNTVTA.LWNYAQNFALNDNTF---------------------------
PHOX_KLULA/65-312....................................L.SWLAEQGITLTNYW.---------------------------
Q98ES1_RHILO/58-274............................SLARRTAPY.LNRLARGGALFDRSY---------------------------
A0A038F821_MYCTX/50-282..................................APF.INSLAANGAMMAQAF---------------------------
D0KPN6_SULS9/27-365...DKGFVYYSGP...........QSLAYFSYQQTWI.LWDYAEEYVLADDYF---------------------------
NPC6_ARATH/59-394IPSMMGFVEQALSMPGNLSE....TVMKGFRPEAVPV.YAELVKEFAVFDRWF---------------------------
NPC5_ARATH/13-380PATMSGFAQNAERKMKG...MSS.AVMNGFKPDALPV.YKELVQNFAICDRWF---------------------------
NPC3_ARATH/16-381DPKMNGFVQNAEAITKGMSEK...VVMQGFPPEKLPV.FKELVQEFAVCDRWF---------------------------
NPC1_ARATH/38-396.PKMNGFAQQSESMEPG...MAK.NVMSGFKPEVLPV.YTELANEFGVFDRWF---------------------------
NPC2_ARATH/27-389PPPMNGFVQQAYSEDPS.GNMSA.SVMNGFEPDKVPV.YKSLVSEFAVFDRWF---------------------------
Q9KH04_BURML/84-547..RNDQFAAWADSGG.........LVMGHYRNSAETLRLWNLARGYTLCDNFF---------------------------
Q983N8_RHILO/60-507..KNDMFVAWADSGA.........MPMSNWDASKTDM..WAVAQKYVLADHFF---------------------------
E2TNP6_MYCTX/52-433..ANDGWLPAQAR.TRS.VANTP.VVMGYYARPDIPI.HYLLADTFTICDQYF---------------------------
A1KJH2_MYCBP/50-429..VNDNWLPAQAK.TRS.AAHTP.TVMGYYTRQDIPI.HYLLADAFTVCDRYF---------------------------
A4KJA2_MYCTX/52-435..ANDNWLPAQVPFSPL.QGNVP.VTMGFYTRRDLPI.HYLLADTFTVCDGYF---------------------------
A5WPW5_MYCTF/51-431..ANDNWLPAQAT.TRA.GPYVP.LTMGYYTRQDIPI.HYLLADTFTICDGYH---------------------------
A0A030U552_PSEAI/51-437..RNDKWMAVQYP...........EAMGYFKRGDIPY.YYALADAFTLCEAYH---------------------------
A3NXI4_BURP0/47-438..RYDRWIANKGT...........TTMAYLERDDIPF.HYQLADAFTICDAYH---------------------------
B8H354_CAUCN/40-437..RMDRWPDAKKP...........WSMGYFQRADIPF.QFALADAFTLCDAYH---------------------------
A0A022NDQ0_PSEAI/48-422..RMDKWLPAKTE...........RSLGYYKEQDIAF.QFAMANAFTICDAYH---------------------------

PF16347

G2PRM5_MURRD/414-516------------------------------------------HPSEHDVRRHY---------------------------
G7USR5_PSEUP/397-499------------------------------------------YPAVHCARKHR---------------------------
D5BJX1_ZUNPS/413-515------------------------------------------WPAFHMVKRHY---------------------------
G0J719_CYCMS/407-508------------------------------------------YPAEHMVKRHY---------------------------
D2R402_PIRSD/397-498------------------------------------------FPQPHHVHPHY---------------------------
G8NQI2_GRAMM/379-480------------------------------------------WPNPEATPPCR---------------------------
D2QMZ8_SPILD/410-511------------------------------------------YPQPHHVYPHF---------------------------
A4AWR6_MARSH/414-516------------------------------------------YPAEHAVKRHY---------------------------
A6LDP5_PARD8/412-514------------------------------------------YPAEHSVKRHY---------------------------
A4CJM0_ROBBH/381-483------------------------------------------YPAEHMVNRHY---------------------------
A2TWV5_9FLAO/422-523------------------------------------------YPGIHMVKRHY---------------------------
G8UMU5_TANFA/417-519------------------------------------------YPAEHAVRRHF---------------------------
D5BJT8_ZUNPS/386-488------------------------------------------FPFWHHVQPHF---------------------------
F9YSE0_CAPCC/401-501------------------------------------------N.GEHSVSPHF---------------------------
D3IBE7_9BACT/417-519------------------------------------------YPAEHAVKRHY---------------------------
C7M893_CAPOD/396-496------------------------------------------N.GEHAVSPHF---------------------------
G0J436_CYCMS/421-522------------------------------------------YPSVHMVKRHY---------------------------
A3HWF8_9BACT/418-520------------------------------------------YPAEHMVNRHY---------------------------
E8V2R6_TERSS/392-493------------------------------------------WPNPEKVAPHR---------------------------
G8TRD3_NIAKG/412-512------------------------------------------N.QEHKVAKHI---------------------------
H8KTX9_SOLCM/409-510------------------------------------------FPGFHDVRAHY---------------------------
F4L7F1_HALH1/402-503------------------------------------------K.GEHNVMKHF---------------------------
F3ZRQ1_9BACE/413-515------------------------------------------YPAEHAVKRHY---------------------------
E6SVH3_BACT6/418-520------------------------------------------YPAEHAVKKHY---------------------------
D2QEZ9_SPILD/447-548------------------------------------------YPQPHHVSPHF---------------------------
G0IUX7_CYCMS/423-524------------------------------------------YPSVHMVKRHY---------------------------
G0L151_ZOBGA/413-515------------------------------------------YPGPHSVKRHY---------------------------
A6KZU2_BACV8/416-518------------------------------------------YPAEHAVRRHY---------------------------
A6L8Y1_PARD8/413-515------------------------------------------YPAEHSVKRHY---------------------------
I3YHK1_ALIFI/406-508------------------------------------------YPAEHMVKRHY---------------------------
Q5LAU2_BACFN/415-517------------------------------------------YPAEHMVKRHY---------------------------
R5M554_9BACE/414-516------------------------------------------YPAEHMVKRHY---------------------------
R5UAM5_9BACE/410-512------------------------------------------YPAEHAVKRHY---------------------------
R7DGX3_9PORP/412-514------------------------------------------YPAEHAVKRHY---------------------------
W0EZJ7_9SPHI/397-497------------------------------------------N.GEHSVSPHF---------------------------

PF14707

A9VBN0_MONBE/428-544------------------------------.............RG...VEPCI---------------------------
E6ZGQ8_DICLA/413-534------------------------------.............GA...AEACG---------------------------
Q4S4L1_TETNG/407-528------------------------------.............GA...AKACG---------------------------
E1BU03_CHICK/390-510------------------------------.............GG...AKACD---------------------------
ARSG_MOUSE/402-522------------------------------.............GG...AKACD---------------------------
A6QLR7_BOVIN/402-522------------------------------.............GG...ARACD---------------------------
ARSG_CANFA/402-522------------------------------.............GG...AKACD---------------------------
B4DQ74_HUMAN/301-421------------------------------.............GG...ARACD---------------------------
A9V957_MONBE/437-571------------------------------.............SN...TAGCK---------------------------
F0Y2N2_AURAN/404-544------------------------------............GPG...LAGCD---------------------------
Q1YP24_9GAMM/409-501------------------------------...................QGAY---------------------------
C6W2Y6_DYAFD/349-461------------------------------....PGRTYEGSLPG...KNGQP---------------------------
D7VQY4_9SPHI/353-442------------------------------......................Y---------------------------
F2UD41_SALR5/491-612------------------------------....GGS....HAPNDYFVPSCR---------------------------
A9UXW0_MONBE/287-431------------------------------....PVWTSDARPSPL..CTECC---------------------------
F2UKF0_SALR5/383-527------------------------------....QIWASDARPTPL..CIECC---------------------------
B9QU81_9RHOB/44-158------------------------------...........QEHG...WAG..---------------------------
E4YGB6_OIKDI/449-582------------------------------....PSW.....DEG...TEGCA---------------------------
F2U742_SALR5/410-535------------------------------..................QSTTT---------------------------
A9UPM8_MONBE/326-451------------------------------..................ASTTS---------------------------
A8XD87_CAEBR/394-528------------------------------...SPIFLNTSVDPNL..DYFCP---------------------------
E1FX25_LOALO/406-541------------------------------...SPIFKNSTDDPQM..NKLCP---------------------------
F1KQC6_ASCSU/1702-1837------------------------------...SPIFRNSSDDPHM..DEFCP---------------------------
F2UCT8_SALR5/90-221------------------------------..................SESLK---------------------------
A9V7E7_MONBE/452-571------------------------------....SHW....YTNA...NNG..---------------------------
C1BQY6_9MAXI/368-496------------------------------...QGNE....LSDGHNYDVSCG---------------------------
Q4RJR3_TETNG/343-473------------------------------...QGAS....HSSTTP.DQDCS---------------------------
Q6AX40_XENLA/368-499------------------------------...QGAL....HSETTP.DPDCH---------------------------
A1L2N0_XENLA/374-505------------------------------...QGAF....HSDTTP.DADCH---------------------------
F1NWF7_CHICK/373-504------------------------------...QGSF....HSDTTP.DQACH---------------------------
Q32KK2_RAT/368-501------------------------------...QGSA....HSDTTP.DPACH---------------------------
ARSA_BOVIN/368-501------------------------------...QGSV....HSDTTA.DPACH---------------------------
ARSA_HUMAN/368-501------------------------------...QGSA....HSDTTA.DPACH---------------------------
E4XNY3_OIKDI/402-532------------------------------......WSGTKASSI...WHFCR---------------------------
C3ZV84_BRAFL/657-789------------------------------..WTNGQ..DERSKG...IDFCR---------------------------
Q4SI19_TETNG/405-541------------------------------..WSNSW..AELKKG...INFCP---------------------------
F1QFT2_DANRE/220-352------------------------------..WSNSM..EEFNKG...INFCP---------------------------
Q5XG10_XENLA/375-507------------------------------..WSNSW..EELSQG...INFCP---------------------------
GALNS_CANFA/377-509------------------------------..WTNSW..EEFRQG...IDFCP---------------------------
F1NW57_CHICK/376-508------------------------------..WSNSW..EDYSKG...IDFCP---------------------------
A0YAF7_9GAMM/381-478------------------------------..................VANIY---------------------------
Q0C069_HYPNA/397-504------------------------------...................YGAF---------------------------
ARS_STRPU/411-541------------------------------.QTDSSQ....MKLGER.CDGGF---------------------------
ARS_HEMPU/396-526------------------------------.QRVRSQ....DEYGLE.CAGGF---------------------------
O16138_HELER/402-534------------------------------....QRV....LSQGEY.GGKCQ---------------------------
A4AN36_MARSH/378-468------------------------------...................QGVY---------------------------
A4CMB0_ROBBH/401-491------------------------------..................KEAYV---------------------------
A3XMW9_LEEBM/382-476------------------------------...................QSAY---------------------------
A7V8P9_BACUN/356-447------------------------------..................LTDPY---------------------------
A6CB11_9PLAN/382-473------------------------------...................KPAY---------------------------