Sequence alignment for CL0090

PF01152

Q7CX73_AGRFC/7-127-----------TLYEA-IGGD--------------------AT.VRALTRRFYELMDTL-PEAARCRAIH.---------
Q8XXM3_RALSO/11-128-----------LAFDL-LGGE--------------------AR.VRELADRFYDLMDLE-PAFAELRALHP---------
B2J6Y7_NOSP7/3-117-----------TLYDN-IGGQ--------------------PA.IEQVVDELHKRIATD-SL..LSPIFA.---------
F2CUR6_HORVD/26-145-----------NVFEA-LGGT--------------------PQPFVDLSTNFYTRVYED-EEEWFREIFS.---------
TRHBN_MYCTU/14-127-----------SIYDK-IGGH--------------------EA.IEVVVEDFYVRVLAD-DQ..LSAFFS.---------
Q63VR4_BURPS/25-145-----------TAFEL-VGGE--------------------AR.VRELVDRFYDLMDLE-PEFAGIRALH.---------
GLB3_ARATH/26-142-----------NLFDK-LGL.--------------------QT.FINLSTNFYTRVYDD-EEEWFQSIFS.---------
Q7APC3_RHIME/8-128-----------TLYEA-IGGD--------------------AT.VRALTQRFYELMDSL-PEAARCRAVH.---------
TRHBO_MYCLE/4-122-----------SFYDA-IGGA--------------------ET.FKAIVSRFYAQVPED-EI..LRELYP.---------

PF11563

E1FPN0_LOALO/43-200-----PRPSISSQGR.-.KVS---...ALGLSQRQIVKECMDKAKDDIAERIYRRITEKRDD--FRKFVEAL........
Q5B5X9_EMENI/37-216-----LEARINYLKDF-LDFN---...SSDMEALASGAKYIKTLIPAVVNLVYRKLLEY.DI--TARSFHTKDTASEAP.
A2QBB3_ASPNC/24-203-----LEARIDYLQRF-LDFN---...ADDIATLVRGAKYVKALAPTVVDKVYVKLLEF.DI--TARVFRTRNTAVEEE.
C4JH72_UNCRE/22-201-----LEARIRYLHNF-LDFN---...SNDIEALITGSKYIKTLIPAVVNIVYKKLLQY.DI--TARAFQTRSTSFEGS.
C4XIT4_DESMR/15-174-----TRQDIRRRKEL-LGFT---...EEDAQTLAELKLDIGLIVSSIVDEFYDDQVTK.PE--IERTIGD.........
D4AN62_ARTBC/20-213-----LPSRVNYLKAF-LKFT---...DEDGAAIQSAKGLIAPALPAILDTIYTNLIGF.DV--TAKSFVPPQPEQDKST
E9E781_METAQ/19-198-----LEARIQYLHSF-LDFS---...SNDIEALISGAKYIKALVPAVVNIVYRKLLQY.DI--TARAFTTKNTTQGGE.
E6U0Q9_BACCJ/24-180-----KGTEMERQLKM-INLT---...EKDLEVINAIQPFISKRINVIVDRFYKNLEIE.SS--LLDIIND.........
B6HCY7_PENRW/23-203-----LEERIKYLHNF-LDFN---...SADIEALLTGNKYIKQLIPAVVNLVYKKLLQY.DI--TSRAFHTRTTVDERE.
Q218B7_RHOPB/3-166-----NTSTIAERLRF-NSID---...QETIAALRAGKAFVLAELEPILDRFYQHIARF.PE--VSAHFKT.........
D3FWD3_BACPE/27-184-----NDKEIDMRMAY-MGFS---...TQSTEYLQELQAFVDEHADALLEAILDHVYSF.PH--LKKIAET.........
B7GLD2_ANOFW/25-175-----FHGRFIDTLSY-NHFT---...TEDFAKLKQIDELIAPHKQEMVHLFYEGLKQVQPE--ATKTITE.........
A4Y0T1_PSEMY/34-186-----DPHELSQRQRF-LNWS---...QIDNERLARHAPRLERANRQFIDALYERLAQY.PA--PAAILDD.........
C4L4W7_EXISA/25-181-----LPSELERQRQL-IRLE---...REDLAYLRAYQQELRQLTPQLVDVFYEELEKI.DE--MKDLIRQ.........
A1C4D9_ASPCL/22-201-----FPKRMAYIQAF-INFT---...RDDITTFNKGARYLKAAIPGLTHRLYEKMLEF.DI--TARALRTRSTSSEVQ.
Q7NUX9_CHRVO/5-158-----EMALLANMCRF-IGIR---...TEHLAQLPRHADAGLARRELLGKELYWHLLKS.PG--EAERLQRH........
E0SCN2_DICD3/9-166-----NELLLAEWQEL-VNLT---...SSDAHEL..LRDLCEEELRQLVSVFYDYMLQD.KK--ASLYLNT.........
C7Z0G0_NECH7/17-196-----LEARIDYLHKF-LDFD---...DRDLEALAFGSKFVKDLIPAVVHIVYRKLLQF.DI--TARAFEIRDTTSEAP.
A9GCE3_SORC5/10-164-----QETLFDEIKRY-VRFS---...EQDERWLAVLRAHAEPHFPRIADEFYDRIREH.EG--AHDVFTG.........
F0XJU9_GROCL/20-199-----LDARIQYLHSF-LDFS---...STDIDHLVAGAKYIKVLIPAVTNIVYRKLLQY.DI--TARAFETRSTSFEGP.
Q5WC98_BACSK/26-182-----DESDCQKQIGF-IDLH---...ASDLEYIHLLYPLVNEHIAPITEAFYEKLLEQ.PH--LRQLVTT.........
Q9KFH4_BACHD/32-188-----AESELSAQLRM-IHLT---...LDDLKRMKALQPLVEENMEVLADAFYSNIIKQ.PN--LNEIIET.........
B9JTP3_AGRVS/26-192-----QAGSLRDRLNF-AGLD---...QDACSLLRRHRVGLETDVETGLHAFFRKLQTA.PD--AARQFTG.........
D2QY57_PIRSD/6-164-----IHSRYRDLKRY-VGFT---...DEDAERISAARPTLALHIPALVADFYAELQRH.PD--AVKVITG.........
B1YHV6_EXIS2/30-187-----SDPSLTGRLEY-MGYT---...EEHLQTLKAMAPVVNSILDEVLEQVLDHLLLH.PE--MVQIAQT.........
B9JUN1_AGRVS/7-170-----DNGELHKRMAF-LKLT---...ASDLQVVAGLQPIIAHSIGPTLDVFYQTAKQH.PE--AAKFFSS.........
Q3IUQ9_NATPD/29-196-----DADEIEWRKEF-TRFD---...EDDAETLAEHAGTFERIADDLVEDFYDHLQSH.PE--TVDVIDS.........
C5G9L3_AJEDR/20-214-----LKSRLSYVKGF-LHFT---...EKDGAFIQAAKEIIAPAVPAVLDAVYTRLLSF.DI--TAKSFVPRQPEQDTNE
A2QT04_ASPNC/23-202-----LEARVRYLQQF-IGFT---...ADDVIALNRGSKYIKALAPTLVDRVYSKLLEA.DI--TARVFQTRSTTSELD.
C7ZI09_NECH7/13-198-----LEARIDYLHKF-LDWD---...DRDIEALAYGAQHIQNLIPAVVHIIYHKLSEF.DI--TARAFEVRNTSSESP.
B1YG08_EXIS2/27-183-----AGSAFAQQLQL-IDLT---...VEDLQIVRLIRHDVAEWMPQMVDAFYAELVRV.PE--LKQLIER.........
C1G0V6_PARBD/20-213-----LKSRIAYAKSF-LQFT---...EEDGALIQSAKDIVAPAVPAILEAVYTKLLSY.DI--TAKSFVPRQPEQAATE
A0KND7_AERHH/15-171-----TEFEIAHRKEL-LLLD---...ERDFALLASYRPKIEPHIDALVDKFYTLQTGI.TE--IALLIGD.........
D8PPS9_SCHCM/66-254-----INARMVYLKDF-VNFT---...RHDEDAIRHVGPLINDLIPEVVDALYSKLFEF.DI--TKQVFMQRNDGFDGPI
B3QU69_CHLT3/11-161-----DEAILEELLAM-TRMT---...EEEKKVLGEMRSQAESIVGEMINAFYDRLLSH.EN--TSEYLSD.........
B2IB39_BEII9/3-168-----DSSALQERLDF-MEIE---...AATKASLNALWPQVESAIGPILTRFYDKISRT.PA--TSRFFTD.........
Q3JC52_NITOC/22-196-----SLEDFDLLKKT-VLFT---...EEDEKYLRLAGEVLGDQVEEVLDLWYGFVGSH.PH--LVRYFSDLQG......
D2R7K0_PIRSD/13-194-----VAYRFGYLAEF-MNVT---...ADDLATVAAAGPHLAPVIPALVDAVYEKLAQY.DA--TWRHFVPRNAGYDGPT
Q2Y8W7_NITMU/15-174-----DKDRIRQALSL-LGLA---ADHKEEAAAINLLTEFIAERVDKIINSCLAVIAGS.DD--FELIERNI........
F2F0J0_SOLSS/31-187-----SMPELAQQMNL-IGLA---...EENLRHIKSYQPAIAAGVSEITDVFYENVLAV.PS--LKKIIEE.........
F2F399_SOLSS/32-188-----TYPNLHKQIEL-LKLT---...KEDLAVIKQLEPFAQQVVPDMVEKFYGAISLS.PE--LVDIIGS.........
C0ZJ13_BREBN/21-178-----MSDQLTGKIHF-LQMN---...QTDLDRLKQIEPLLTEHLEAITERHYHMLCQY.SH--LMQIIET.........
B0ULQ7_METS4/3-159-----SDADLDGRLTF-LEID---...AATAAMLPRLWPAIAPELPRIMARFYDKMLRT.PH--LAGMIGT.........
C6WYR1_METML/18-175-----SADEVQSRKDF-LEFS---...ERDSQLLKELGTLLAPLEGVFADLLSEHLDAH.PA--IAASHIH.........
B9J942_AGRRK/14-180-----QAGSLRDRLRF-AGLA---...AEQCEIVRRNRPMLETHLKAGLRDLFHRFQTF.PD--AARNFAS.........
C0ZKX8_BREBN/35-191-----GKSTLAKQLAM-INLT---...EEELSIVKALQPLIIQNIEAIIDYFYASIENE.PL--LMKIVDQ.........
A9CJK8_AGRFC/7-170-----TDRQLDERLNF-LGLG---...HGERQNLSDMKGVITGSLDASLDRFYTKVRAV.PE--TAKFFSS.........
C4KYX4_EXISA/28-185-----SDSSLNGRTHY-MGYT---...TSQVKRLQDMAPLVESVLDDVLENVLDHLMLQ.PE--MVQIANA.........
B2W0B6_PYRTR/24-203-----LESRIQYLHSF-LDFS---...SRDIEALSSGAKIIRTLIPAVVNIVYKKLLQY.DI--TARAFTTRSTSYSGR.
E3EZY8_KETVY/10-171-----AAADMENRLPF-IALD---...SAAQQRLRSLAGPIGAAMGPALDDFYARVAQT.PA--LRHHFPT.........
Q1AU74_RUBXD/22-196-----SLEELDLLRQT-VLFT---...GEDERYLRMAGEVLEGRLDELLDVWYGFVADH.SH--LVYYFSSPEG......
A8IPP6_AZOC5/62-225-----TQESLSQRLNF-IGMD---...KALQASLREARDLVVAAMPKILDGFYDHLMTY.PD--MARMFPT.........
Q1GI20_RUEST/15-172-----EASQHNNTLSW-FDIT---...PADQERVRSLAPIADHVGEEIIADFYAHILRF.ED--AAQQFAD.........
B2AU65_PODAN/21-200-----LEARVKYLHSF-LDFG---...VSDIEALKSGSKYIQALIPAVVNIVYKKLLQY.DI--TARAFTTRSTAFEGP.
Q0UTR0_PHANO/18-193-----LESRIEYLHSF-LDFS---...SRDIEALTHGAKYIQALIPAVVNIVYKKLLQY.DI--TARAFTTHTTASSLP.
A2R286_ASPNC/23-202-----FSKRMDFLRLF-LDFT---...DDDIIVFNKGAKFLKAALPVLTHRLYAKMLDF.DI--TARALRVRSTESEAQ.
A9EVT1_SORC5/5-161-----LEREVEDRRAF-FQIT---...DEDLARIAALRPHAEKRTERIVDAFYELLLDF.GP--TRELFRD.........
B8N2G0_ASPFN/23-202-----FGKRMEYIKTF-LDFT---...DDDVIIFNKGSKYLKTVIPELTHRLYEKMLEF.DI--TARALRTRSTTSEAQ.
C4JKA6_UNCRE/20-213-----VASRVAYLKAF-LKFT---...DEDGAALNAAKPVIAPAIPAVLDTIYTNLISF.DV--TAKAFVPRQPEQDEHD
D2VCV6_NAEGR/13-197-----LPYRFAYVAKF-VGFG---...EEDVKYIHESAAVLAPLVPTVVDLVYKKLFSF.DV--TKKTFMVRNDKFQGKM
Q9YFF4_AERPE/20-195-----TDLEFDLLKKT-VMLG---...EKDVMYLKKACDVLKDQVDEILDLWYGWVASN.EH--LIYYFSNPDT......
F0SHW9_RUBBR/6-164-----DYQRFLDLKSY-VGWT---...DDDNACSDELLTLLSDEIGPILDDFYTEIKKH.RA--AWRVITG.........
A8FBP1_BACP2/29-185-----DNTDIAKQIKM-IDLT---...QNDLLILNQLNSIVQEDIAHIVDKFYKNLEVE.SS--LMHIIQD.........
A8P1M8_COPC7/13-202-----FAYRIQYLRDF-IEFT---...SEDAAALHAARPVVAPLVPLVVDTVYEKLLSF.SV--TAKAFVPRQTGYSGET
A1CRU6_ASPCL/32-212-----LEARINYLRDF-LDFN---...SSDIEALTTGSKYIKALIPAVVNIVYKKLLEQ.DI--TARAFITKDTADETT.
Q47S02_THEFY/23-197-----GLEDLNKLKTT-VMFT---...SADEEALRMAGDVLEDQVEDVLDVWYGFVADH.PH--LLAYFSTPDG......
A9WGB2_CHLAA/23-194-----..EEWELLKQT-VLWT---...AEDEQYLRMAGEVLGDQVDAILDLWYGFVASH.AH--LVYYFTGSDG......
F0LY60_VIBFN/12-164-----...AIRRWASY-LAID---...QQTVDALREYYWIMEHNIDEVLAFVYDHLGSC.PE--TAQFYQN.........
HEMAT_BACSU/31-185-----.HADVKKQLKM-VRLG---...DAELYVLEQLQPLIQENIVNIVDAFYKNLDHE.SS--LMDIIND.........
Q2KCI4_RHIEC/11-175-----.AGSLRDRLRF-AGLD---...ADQCELVRRNRPALKAHLKAGLRDLFHRFQSY.PD--AARNFES.........
MCPE_RHIME/15-178-----..GSLLERLRF-AGLD---...EDACALLRDHRQALSPRIELALRALSHRLQAS.PD--AARHFDS.........
Q65LP1_BACLD/29-182-----QHAEFKKQLAM-VDLT---...DEDLWVLSRLKPLVTEHIETIVTRFYQNLEHE.SS--LMEIIHD.........
Q7D1B0_AGRFC/50-211-----...SLAGRLRF-AGLD---...EMQSDFLRNYRGMLEPYVKAGLRDVMTRFQSM.PD--CSPSFES.........
Q81JN0_BACAN/32-186-----.NSELKVQMDM-LHIS---...KEDLQIVKVLQPFIYEEIDWITEKFYANITKQ.PN--LITIIER.........
Q8TLY9_METAC/23-193-----..EDLKLLKEA-VMFT---...AEDEEYIQKAGEVLEDQVEEILDTWYGFVGSH.PH--LLYYFTSPDG......
Q9A5Y0_CAUCR/45-206-----.NAKLDQRMAF-MRFD---...ERSRAHLRAIKPVIDAEIGAALGQFYSQVRLF.PD--TRVKFRD.........
Q9AB06_CAUCR/8-170-----.DYAIGERTAF-MGID---...DKARSALRDLRPVIRAEIGKALDNFYGKVRAT.PE--TRKFFSD.........
U5L913_9BACI/33-184-----..EEVLRQIDM-IGLQ---...DSDLNYILSLQPYVKGNLPAIIEQFYKNLENE.KT--LTKIIND.........
U5LFP3_9BACI/32-184-----.DQDLKLQIEV-MGLT---...KEDLAILRAVRPIAEKHISAV....YNKLLTYEQE--DVRKITD.........
V6F1E9_9PROT/46-194-----..ERVTQYLDL-FQVD---...DAAQRLIADNCGKVVASVETMVNRASDWVQRT.PP--FGEKMNS.........

PF00042

Q19601_CAEEL/105-215-----ERILLEQSWRK.TRK.-----------------....TGADHIGSKIFFMVLTAQPD--IKAIFG.---------
GLB1B_ANATR/17-122-----QKDLLRLSWGV.LSV.-----------------.....DMEGTGLMLMANLFKTSSA--ARTKFAR---------
HBP1_CASGL/7-116-----QEALLKQSWEV.LKQ.-----------------.....NIPAHSLRLFALIIEAAPE--SKYVFS.---------
GLB1_PARCH/17-123-----QKKIVRKTWHQ.LMR.-----------------.....NKTSFVTDLFIRIFAYDPA--AQNKFPQ---------
MYG_GALGA/3-108-----DWDKVNSVWSA.MEA.-----------------.....NITAVGQNILLRLFEQYPE--SQSYFPK---------
HBAT_HORSE/7-107-----DRATVRALWKK.MGS.-----------------.....NVGVYATEALERMFLGFPS--TTTYFLH---------
HBA1_PLEWA/7-107-----DKHNVKAIWDH.VKG.-----------------.....HEEAIGAEALYRMFCCMPT--TRIYFP.---------
HBB0_MOUSE/8-112-----EKAAITSIWDK.V...-----------------.....DLEKVGGETLGRLLIVYPW--TQRFFDK---------
HBA1_XENBO/7-107-----DKKHIKAIMPS.IAA.-----------------.....HGDKFGGEALYRMFLVNPK--TKTYFPT---------
GLB_PAREP/8-117-----QDILLKELGPH.V.DT-----------------...PAHIVETGLGAYHALFTAHPQ--YIIHFSR---------
HBB1_CYGMA/8-112-----ELTIINDIFSH.L...-----------------.....DYDDIGPKALSRCLIVYPW--TQRHFSG---------
MYG_CYPCA/3-108-----DAELVLKCWGG.VEA.-----------------.....DFEGTGGEVLTRLFKQHPE--TQKLFPK---------
HBB2_XENLA/8-112-----EKAAITSVWQK.V...-----------------.....NVEHDGHDALGRLLIVYPW--TQRYFSN---------
HBAZ_CAPHI/7-107-----ERTIILSLWSK.IST.-----------------.....QADVIGTETLERLFSCYPQ--AKTYFPH---------
HBF1_URECA/7-113-----QIKAIQDHWFLNIKG.-----------------.....CLQAAADSIFFKYLTAYPG--DLAFFHK---------
HBB1_XENBO/7-111-----DRQLINSTWGK.V...-----------------.....CAKTIGKEALGRLLWTYPW--TQRYFSS---------
LGB1_LUPLU/8-116-----QVALVKSSFEE.FNA.-----------------.....NIPKNTHRFFTLVLEIAPG--AKDLFS.---------
MYG_HETPO/3-108-----EWEHVNKVWAV.VEP.-----------------.....DIPAVGLAILLRLFKEHKE--TKDLFPK---------
HBAD_ERYML/6-106-----DRRLLQASVGK.LGC.-----------------.....RLEDIGADALNRLLITFPQ--SKTYFSH---------
HMP_ECOLI/6-103-----TIATVKATIPL.LVE.-----------------.....TGPKLTAHFYDRMFTHNPE--LKEIFN.---------
Q18311_CAEEL/32-140-----TKKLVIQEWPR.VLA.-----------------.....QCPELFTEIWHKSATRSTS--IKLAFG.---------
GLB73_CHITH/23-129-----EASLVQSSWKA.VSH.-----------------.........NEVDILAAVFAAYPD--IQAKFPQ---------
HBB_LITCT/1-105-----GGSDVSAFLAK.V...-----------------.....DKRAVGGEALARLLIVYPW--TQRYFST---------
HBBN_AMMLE/2-106-----BKALITGFWSK.V...-----------------.....KVBZVGAZALGRLLVVYPW--TZRFFZH---------
HBAM_LITCT/6-102-----EKSAVASLWEK.IAP.-----------------.....QTNKLGAESMERLFKNHPE--TKSFFSR---------
HBA3_PLEWA/7-107-----EKALVVGLCGK.ISG.-----------------.....HCDALGGEALDRLFASFGQ--TRTYFSH---------
HBAD_PASMO/6-106-----DKKLIQQIWGK.LGG.-----------------.....AEEEIGADALWRMFHSYPS--TKTYFPH---------
HBB_HETPO/7-106-----ELHEITTTWKS.I...-----------------.....DKHSLGAKALARMFIVYPW--TTRYFGN---------
A2VF80_MYCTX/42-136-----DALRVLQNAFK.L...-----------------.....DDPELVRRFYAHWFALDAS--VRDLFP.---------
HBA_LEPPA/7-108-----DEVLIKEAWGL.L.H.-----------------.....QIPNAGGEALARMFSCYPG--TKSYFPH---------
GLB8_CHITH/9-115-----QLALFKSSWNT.VKH.-----------------.........NEVDILYAVFKANPD--IQAKFPQ---------
GLB2_LUMTE/8-114-----EGLKVKSEWGR.AYGS-----------------...GHDREAFSQAIWRATFAQVPE--SRSLFKR---------
Q20638_CAEEL/74-184-----EKELLRRTWSD.EFD.-----------------.....NLYELGSAIYCYIFDHNPN--CKQLFP.---------
HBB_ALLMI/7-111-----ERKFIVDLWAK.V...-----------------.....DVAQCGADALSRMLIVYPW--KRRYFEH---------
HBA_CATCL/6-107-----DKADVKIAWAK.ISP.-----------------.....RADEIGAEALGRMLTVYPQ--TKTYFAH---------
HBA_SQUAC/6-107-----DKTAIKHLTGS.LRT.-----------------.....NAEAWGAESLARMFATTPS--TKTYFSK---------
GLB2_TYLHE/9-115-----QRLKVKQQWAK.AYGV-----------------...GHERVELGIALWKSMFAQDND--ARDLFKR---------
GLB1_GLYDI/6-111-----QRQVIAATWKD.IAGA-----------------....DNGAGVGKDCLIKFLSAHPQ--MAAVFG.---------
GLB10_CHITH/11-117-----EVEQVQATWKA.VSH.-----------------.........DEVEILYTVFKAHPD--IMAKFPK---------
HBB_LEPPA/7-111-----EKQYIVSVFSK.I...-----------------.....DVDHVGANTLERVLIVFPW--TKRYFNS---------
GLB1_TYLHE/7-110-----QRIKVKQQWAQ.VYSV-----------------...GESRTDFAIDVFNNFFRTNPD--RS.LFNR---------
HBA1_TORMA/6-107-----NKKAIKNLLQK.IHS.-----------------.....QTEVLGAEALARLFECHPQ--TKSYFPK---------
GLB6_CHITH/22-128-----QADLVKKTWST.VKF.-----------------.........NEVDILYAVFKAYPD--IMAKFPQ---------
GLB_BUSCA/6-116-----QKTALKESWKV.LGAD-----------------...GPTMMKNGSLLFGLLFKTYPD--TKKHFKH---------
GLBH_CAEEL/10-119-----DLC.VKSLEGR.MVGT-----------------E..AQNI.ENGNAFYRYFFTNFPD--LRVYFKG---------
GLB2_NIPBR/16-114-----PISKAQQ......AQ.-----------------.........VGKDFYKFFFTNHPD--LRKYFKG---------
GLBH_TRICO/30-132-----DVVPLGSTPEK.L...-----------------........ENGREFYKYFFTNHQD--LRKYFKG---------
GLB_PSEDC/21-134-----TRELCMKSLEH.AKVG-----------------T..SKEAKQDGIDLYKHMFEHYPA--MKKYFKH---------
GLB_CERRH/6-116-----SKSALASSWKT.LAKD-----------------...AATIQNNGATLFSLLFKQFPD--TRNYFTH---------
GLB2_CHITH/22-128-----EASLVRGSWAQ.VKH.-----------------.........SEVDILYYIFKANPD--IMAKFPQ---------
GLB_TUBTU/6-112-----QRFKVKHQWAE.AFGT-----------------...SHHRLDFGLKLWNSIFRDAPE--IRGLFKR---------
GLB3_LAMSP/7-113-----QRLKVKRQWAE.AYGS-----------------...GNDREEFGHFIWTHVFKDAPS--ARDLFKR---------
GLB_ASCSU/21-134-----TRELCMKSLEH.AKVD-----------------T..SNEARQDGIDLYKHMFENYPP--LRKYFKN---------
GLB1_CALSO/5-105-----DIKNVQDTWGK.LYD.-----------------....QWDAVHASKFYNKLFKDSED--ISEAFVK---------
GLB2_CALSO/5-108-----DIAAVQTSWRR.CYCS-----------------...WDNE..DGLKFYQTLFDSNSK--IRHAFES---------
MYG_ALLMI/7-113-----EWKHVLDIWTK.VES.-----------------.....KLPEHGHEVIIRLLQEHPE--TQERFEK---------
Q21978_CAEEL/165-283-----SCEVVADSWRL.VESR-----------------SSAAETSACFGLFVFQRVFSKIPM--LRPLFG.---------
HBB_SQUAC/7-107-----EKALVNAVWTK.T...-----------------.....DHQAVVAKALERLFVVYPW--TKTYFVK---------
GLB3_TYLHE/8-117-----DRHEVLDNWKG.IWSA-----------------E.FTGRRVAIGQAIFQELFALDPN--AKGVFGR---------
GLBT_CHITH/13-116-----QVAAVKGDWEK.IKG.-----------------.........SGVEILYFFLNKFPG--NFPMFKK---------
GLB3_CHITH/20-120-----QISTVQASFDK.VKG.-----------------.........DPVGILYAVFKADPS--IMAKFTQ---------
GLB1_CHITH/21-126-----QIAAAKASWNT.VKN.-----------------.........NQVDILYAVFKANPD--IQTAFSQ---------
LGB1_MEDSA/7-112-----QEALVNSSWEA.FKQ.-----------------.....NLPRYSVFFYTVVLEKAPA--AKGLFS.---------
GLBC_NIPBR/21-135-----DVK..KHTVES.MKAV-----------------P.VGRDKAQNGIDFYKFFFTHHKD--LRKFFKG---------
HBA1_IGUIG/6-106-----DKNHIRAIWGH.VDN.-----------------.....NPEAFGVEALTRLFLAYPA--TKTYFAH---------
HBA1_BOSMU/6-106-----DKGNVKAAWGK.VGG.-----------------.....HAAEYGAEALERMFLSFPT--TKTYFPH---------
GLB_APLJU/6-113-----DAGLLAQSWAP.VFA.-----------------.....NSDANGASFLVALFTQFPE--SANFFND---------
HBA_HETPO/13-114-----DRAELAALSKV.LAQ.-----------------.....NAEAFGAEALARMFTVYAA--TKSYFKD---------
BAHG_VITST/6-103-----TINIIKATVPV.LKE.-----------------.....HGVTITTTFYKNLFAKHPE--VRPLFD.---------
GLB4_TYLHE/8-117-----DRREVQALWRS.IWSA-----------------E.DTGRRTLIGRLLFEELFEIDGA--TKGLFKR---------
GLB4_LUMTE/11-120-----DRREIRHIWDD.VWSS-----------------S.FTDRRVAIVRAVFDDLFKHYPT--SKALFER---------
HBP2_CASGL/13-122-----QEALVVKSWSA.MKP.-----------------.....NAGELGLKFFLKIFEIAPS--AQKLFS.---------
GLBP1_GLYDI/7-115-----QVAALKASWPE.VSAG-----------------....DGGAQLGLEMFTKYFHENPQ--MMFIFG.---------

PF00502

K9XWT9_STAC7/32-185.IFQQADDQGRYLSDQDIKQI...QTLTPQLTTSTTQAQLLRDRVEEIVSQARAEVLAAYPQ--ITEPGGD---------
Q7NLD6_GLOVI/7-176KAVVSADQKTGYIGGAELAAL...KTYIANGNKRLDAVNAITSNASCIVSDAVSGMICENPG--LISAGGN---------
K9U0M5_9CYAN/6-160KLIVNADAETRYPTPGELEQI...KILAQSGDRRLRLAQALTANREGIIKQAGSQLFQRRPD--IVSPGGN---------
B2J4C0_NOSP7/8-172KVVSQADTRGEYLSDAQLDAL...SELVKDGNKRADAVNRITSNASALVAAAARDLWAEQPQ--LITPGGN---------
PHEB_NOSS1/7-171KVVEQADRKGNYLSGDEINAL...SALVADSNKRLDIVNRLTSNASSIVANAYRALVAERPQ--IFNAGGA---------
K9U368_9CYAN/7-161EAIGAADTQGRFLSNTELQAI...NGRFDRASASMEAARALTSKAQQLVDGAAQAVYSKFPY--TTQMQGP---------
E0UA88_CYAP2/6-160KAIVNADAEARYLGPGELERI...KSFIGSGAARLRIAETLTGARETIIKQAGDRLFQKRPD--IVSPGGN---------
Q31RG0_SYNE7/6-160KSIVNADAEARYLSPGELERI...KTFVVGGDRRLRIAQTIAESRERIVKQAGNQLFQKRPD--VVSPGGN---------
A5GVQ7_SYNR3/7-171KVVAQADARGQFIGTGEIDAL...AAMVADSNKRLDAVNRITSNASSIVANAARDLFAQQPA--LIAPGGN---------
K9UI71_9CHRO/7-164NLIKTYDITGRYLDRNAIDSL...KSYFETGTARIAAAGVINANAALIVKKAASQLFEELPE--LIRAGGN---------
K9PBJ3_9CYAN/6-157KSIASADREARYLSPGELNAI...RDFYEGGFYRMRIAITLTENEQKIVEKASLKFWERCHD--TPSNSGN---------
B7JYL9_CYAP8/7-163NLIKNYDLTGRYLDRDAMDRL...KDYFSSGMARITAAAVINANSPEIVRQAGLQLFEEVPE--LIRPGGN---------
Q7M7F7_GLOVI/7-161EVIASADSQGRFLNNTELQAA...NGRFQRATASMEAARALTSNADSLVKGAVQEVYNKFPY--LTQPGQM---------
K9SEX3_9CYAN/6-160QVLVQADDELRYPTIDELESI...SSFMQTGEQRLRIASILAESEDKIVKKSSAELFKLHPE--YISPGGN---------
K9U364_9CYAN/7-161EAIAAADARGSYVSNTEMQAI...FGRFNRAQAGIEAAKAFANNGKKWAEAAANHVYQKFPY--TTQMQGS---------
Q7V589_PROMM/7-180RAVVGADAKGACLGSADLASL...RQHVADANIRIDATNAIAQHISCIAADAVSGMVCENTG--MTQPGGN---------
K9XSR9_STAC7/6-160QVILKADDELRYPSSGELEGI...KKFLTTGEQRVRIAETLAESEKKIVDKASKELFRIHPE--YRSPGGN---------
Q2JPU0_SYNJB/6-160QIIETADDQLRYLSVSELEAI...RNYMTTGERRLQIAQVLAENKKRIIDQAQKQLFAKRPE--YVQPGGN---------
K9SZ05_9SYNE/7-161EAIATADSQGRFLSNSELQAV...NGRFDRAKASMEAAKALTANAQSLIDGATQAVYSKFPY--TTSTPGN---------
K9SDD2_9CYAN/9-154....TVDAEGRYATDDELTFL...KGYIHSYELRINTYNKLRELENAIVEQSYEKVRSQDPN--VFNSSGT---------
Q7TTT3_SYNPX/31-183QIIGAADQERRQLSQEELLSL......CAASGQDASLPRRLQNHADDLVNQARCHLLEQQPQ--LVQPGGA---------
E0U6T1_CYAP2/7-183RAVVTADSKTAPIGGAELAEL...KKFIAEGNKRLDAVNAIASNASCAVSDAVAGMICENSG--LIQAGGN---------
K9UYY7_9CYAN/6-160KMIANADAEVRYLQPGEIDQI...RVFMKSSERRLHLVQVLNLSRDRIIKQAGKDLFQKRPS--LVSPGGN---------
B7K3F0_CYAP8/6-160QVILKADDELRYPSSGELEGI...QNFVKSGEQRIRIAETLSENDKKIVDQAQKRLFQKRPD--FRSPGGN---------
K9YHW9_CYASC/8-165SLIKNYDVSGRYLDRDAIDSL...KSYFQSGTTRIQVANIINANSPELVLNAGKQLFEEVPE--LIRAGGN---------
K9T4V8_9CYAN/7-171RVVSQADARGDFVSTAQIDAL...NKMVADGNKRLDAVNRITSNASAIVSNAARALFAEQPQ--LIAPGGN---------
A5GTB5_SYNR3/7-160.LILQADDELRYPTSGELRSM...AAFLNDGDRRVRVARVLTENERKIVDESAKQLFTRKPD--YVAPGGN---------
B2J478_NOSP7/7-163TVIGSADAAGRFPTTSDLESV...QGSIQRASARLEAAEKLAAGIDAVAKEAYDAAFKKYPY--LTQEGEA---------
PHEB1_SYNPW/7-183RSVVSADAKTAAVGAGDIAAL...RQYVAEGNKRLDAVNAITSNASCIVSDAVTGMICENTG--LIQAGGN---------
A5GVP3_SYNR3/7-164TVIGAADSASRFPSASDMESV...QGSIQRAAARLEAAEKLAGNYDAIAQRAVDAVYSQYPN--GATGRQP---------
B7K6K4_CYAP8/7-163TVIAAADAAGRFPSTSDLESV...QGSIQRAAARLEAAEKLGNNLDAVAKEAYDACIKKYPY--LNNAGEA---------
APCF_SYNY3/7-164TLIKNYDLTGRYLDRNAMDEL...KAYFESGSARIAAAAMINANSATIVKRAAAQLFEEIPE--LIRPSGN---------
APCF_SYNP2/7-164SLIRNYDTTGRYFDRDAIESL...KDYFASGNDRITVAAMINSQSAEIVKAAANSLFEAVPE--LLLAGGN---------
B2J479_NOSP7/8-184RAVIAADAKTAPIGGADLAAL...KSFIAEGNKRLDAVNAIASNASCAVSDAIAGIACENTG--LLQAGGN---------
K9VCF0_9CYAN/35-186...QDADNQSRYLTDEDLERI...KNLHPHLSLMLEKARLLREQAPNIVADARKKVLADFPN--ITEPGND---------
K9PSE2_9CYAN/6-160KSILNADTEARYLTPGELEPI...KSFVKNGERRLRLVQALTENRERIVKQSGTQLFQKRPD--VVSPGGN---------
K9TTH5_9CYAN/6-160QVILKADDELRYPSAGELENI...KNFLQTGIQRMRIAATLAENEKKIVQEASKKLWQKRPD--FIAPGGN---------
Q7U7B1_SYNPX/9-166..IGRYDQLGRYLDRSAIDSI...EKYLDESSLRIQAVELINREAAEIVREASQRLFRDEPE--LLLPGGN---------
K9TY40_9CYAN/7-164SVAKNCDLTGSSLNREVVETL...KEFLADGEKRVQVAGVIGSNAAEIVKTAVSLLFQEYPE--LVSPGGN---------
K9P5D8_CYAGP/8-172KLIAQADVRGEFLNSGQLDAL...SGVVADSFKRLDAVNRITSSASTLVTNAARELFAQQPA--LIAPGGN---------
K9U651_9CYAN/7-164SLIGTYDVAGRYFDRTALERL...KSYFDTGTARVQAAATVNSNAASIVKQAGSQLFAEQPE--LIRPGGN---------
K9XTU9_STAC7/7-164KLIKNYDVTGRYLDRNAMDTL...KAYFESGTARVTVATMITANAAAIVRQAGSSLFEQVPE--LIRPGGN---------
U5QS61_9CYAN/34-186..LQTADDEGRYLTDTDLEAL...LADGPHDARVVQAARLLRDEAPAIVSEAREQVLAHFPG--IAEAGGD---------
B0C339_ACAM1/7-156SVITSFDLQGKYIDGGALQQL...KHSFQIDEPKVEAAAIIRDNAAEIVKEAVAK......S--LDVPGSD---------
K9SW00_9SYNE/6-160QVLLKADDELRYPTIDELQDI...KTFLQTGGQRIRIASTLAENESKIVKKASAELWKIHPD--YIAPGGN---------
K9PBM8_CYAGP/6-160NSIINADAEARYLSPGELDQI...KSFVAGGQRRLRVAQVLAESRERIVKQAGGQLFQKRPD--LVSPGGN---------
K9Y8I8_HALP7/7-164TLIKNYDVTGRYLDRDAMDEL...QSYFASGMARVQAATLINSNAAAIVKEAGRQLFDEQPE--LIRPSGN---------
Q10UW8_TRIEI/7-161EAVSAADSQGRFLTNVELSAA...LGRFGRAQACLEAAKTLSEKSQALIDGAATAVYNKFPY--TTTMQGP---------
Q7NL79_GLOVI/7-160AVINNYDVQGKYLDGAALDKL...KAYFTTGAVRVRAAAVISSNATTIIKEAAAKALI.YSD--LTRPGGN---------
K9P5A2_CYAGP/7-160.LILQADDQLRYPTGGELRTM...VEFLSGGARRLSVVRVLTDNEKKIIAEASKQLFLRKPD--YVAPGGN---------
A5GL99_SYNPW/7-160.LILKADDDLRYPSSGELNSI...VEFLGQGSLRLSVVRILSDNEKKIVDESARQLFSLRPE--YVAPGGN---------
K9SQ75_9CYAN/7-161EAVSAADSQGRFISSTEMQIA...YGRFRQAAFGLDAAKSLSSNAQRLAEGAAAAVYNKFPY--TTSMEGA---------
Q10ZG9_TRIEI/37-188...QIADGEARYLTDNDLNSL...KNSSKLPIFSIEAASLLKDSASKIVDKAREKVLATYPN--ITAEGGD---------
PHCB_SYNP2/7-171RVVSQADARGEFISSDKLEAL...KKVVAEGTKRSDAVSRMTNNASSIVTNAARQLFADQPQ--LIAPGGN---------
Q10XZ6_TRIEI/7-164SLIKNYDIKGRYLDQNGIDQL...KSYFETGTARVQAATLINSQAASLVKQAAITLFAEQPE--LIRPGGN---------
U5QNF8_9CYAN/7-160.TILGADEQLRYPSVGELEQI...KSFMEDAPVRLQIAKTLSDASDRVVKQSGDKLFQRRPD--LNNPGGN---------
K9PDX9_9CYAN/6-157ELILNADSESRYPAPKELRVF...QEFLKSGDQRIRIAKILSQNEQQIVQNGSLKFWERCPN--TPSNSGN---------
Q117G1_TRIEI/7-161TTIASADLGGRYPSSSDLESV...QGSLQRAAARMEAAEKLASNYDAVAQEAVDAIYAKYP.--.SGSGKD---------
K9P457_CYAGP/8-162EAVAAADSQGRYLSNTELNAA...FGRYERAKNALEAAKALTAKADELVNGAAQAVYNKFPY--TTQLQGN---------
B7K6K8_CYAP8/35-188.IFQQADDQGRYLTDLELTRI...EAFSPERSSAVKKAKILREKADLIVNYAREKVLTTYPE--ITELGGT---------
K9TWK3_9CYAN/6-157KAIASADREARYLSPGELRTI...RDFYNGGENRLRIATTLIENRKEIVERGSLKFWECCPD--TPSNSGN---------
G3XCS9_PROMA/7-154TVIASADAAGRFPTISDIESV...KGSFDRAKDRLEAAEKLSIHIDRFTSQALDYVYGTE..--.......---------
K9XAE9_9CHRO/6-160KSIVNADAEARYLSPGELDRI...KSFVTSGERRLRIAQTLTDNRERIVKQAGDQLFQKRPD--VVSPGGN---------
K9TI03_9CYAN/11-165QVILKADDELRYPTNGELTSL...TQFFQTGQQRVRIATTLAENEKKIVEQASKRLWQKRPD--FISPGGN---------
Q7V590_PROMM/7-154TVITAADAAGRFPDISDLKAV...KVSFDRAAARMEAAEKLASGIDNVTADALKAVYSDG..--.......---------
E0U6S4_CYAP2/34-186..FQQADEEGRYLSDDELEQI...KNLSPNSSHLIESARLLRDQAQQIVDSARQQVLAQYPG--ITENGGD---------
K9SFN5_9CYAN/6-164RSITAAKEQNRFLNESEIKRA...YELSQTANARLDAVKSLSTSSDLILRLAIDQI......--....AGE---------
K9RE36_9CYAN/7-164NLIKNYDVTGRYFDRNAVDSL...KSYFESGTQRIQAAAAINANAAFIVKEAGVKLFEEQPE--LIRPGGN---------
Q8DIN1_THEEB/16-170QVLLKADDELRYPTTGELQTI...SDFFQTGEQRLRIATTLAENEKRIVEQASKQLWQKRPD--FISPGGN---------
Q2JLK1_SYNJB/7-160AVINSYDVQGKYLDSSAMEKL...KAFFATGELRVRAAATIAANASTIVKDAAAKALL.YSD--LTRPGGN---------
Q7NLD7_GLOVI/7-163TVLAAADAAGRFPSGSDLESV...QGNIQRSAARLEAAEKLAAGHAAVVKEAGDVVFKKYPY--LKTAGEA---------
PHEB2_SYNPX/7-177RAAVSADSSGSFIGGGELASL...KSFIADGNKRLDAVNAITSNASCIVSDAVAGICCENTG--LTAPNGG---------
K8GH86_9CYAN/6-155RTIAVADLEARYLTIAELQTI...RDFFEAGQQRLRIANILAANSQTIINTGTQRFWERCPV--TPSNSGN---------
B7K2Z2_CYAP8/11-156...NKIEDRGQFISSKQLTDL...EKYYKQEQIRLASLATLLNKISQLTKESVDVIHQKYLL--SFGYDSD---------
Q117E9_TRIEI/6-178EIIDAADAQGRFPSSSDLESLASIKELIDQGNKRLDAVNFISSNASCIVSDAVSGMICENPG--LIQAGGN---------
K9WFS1_9CYAN/7-161EAVSAADSQGRFLSSTELQVA...FGRFRQATASLEAAKSLSSNADRLAQGAAQAVYNKFPY--TTQMQGN---------
K9ZE77_ANACC/7-171RVVEQSDRQGAYLSDDQINAL...SAIVADGNKRLDVVNRLTSNASAITANAYRALVAEQPN--VFGPGGA---------
A5GVM9_SYNR3/34-181.LLQQADQERRLLSSSEIQSL......CQHSGVMTAPLEQLQGQAHQLVNQARQDLLEAKPH--LVKPGGA---------
K9UJM8_9CHRO/7-161EAVATADSQGRFLSSTELQVA...FGRIRQATASLDAAKALAGKAQSLADGAANAVYQKFPY--TTTMQGN---------
PHAC_SYNP2/6-160QVILRADDELRYPSSGELSGI...KNFLATGAVRIRIAEALADNEKKIVDQAQKQLFSIHPE--YRTSGGN---------
PHEB_PROMP/7-174NQILSNDRDLENISNKNIEDI...KEFINTANSRLDAIDSITNNSHAIAADAVTAMICENQD--SVNTKIS---------
K9T481_9CYAN/7-160SAINAFDVQGRYLDDDAIAKL...RGYFQSGTMRAKAATVIGANAKSIITKTVAKSLM.YTD--ITAPGGN---------
PHAC_SYNY3/6-160QVILQADDQLRYPTSGELKGI...QAFLTTGAQRIRIAETLAENEKKIVDQAQKQLFKKHPE--YRAPGGN---------
PHEA1_SYNPW/7-163TVVTAADAAGRFPSQNDLEAV...QGNIQRAAARLEAAEKLAAGLDAVTKEAGDACFNKYPY--LKQPGEA---------
K9XWE3_STAC7/7-183RAVVSADSKTSCIGGEQLASL...RNFVAEGNKRLDAVNAIASNASCIVSDAIAGMICENQG--LIQAGGN---------
K9XKS9_9CHRO/7-160SLINPADQRGKYLETEELEKL...RRYFQSGELRVKAASAISNNAANIIREAVANSLL.YGD--ITCPGGN---------
K9SIK8_9CYAN/7-160SLIGAYDATGRYLDRDAYDQI...KSYFDTGAERLKAASMITGNAAAIVQETGLTLFDAAPT--LIRPGGN---------
Q7NJA2_GLOVI/7-160TVIAKYDSQGKYFDNAAVDQL...KAYFATGELRVRSAAAISANAQSIIKEATAKALL.YSS--LTRTGGN---------
K9P3V2_CYAGP/7-164GLIGRYDQLGRYFDRNAIDRI...DSYFAQAEVRLAAVELINREAATIVREAAQRLWLEDPE--LLLPGGN---------
PHEB_PROMA/7-181RAVVSADSKGATIGSAELSSL...RKYVADANKRIDATLAITQNVSCIAADAISGMVCENTG--LTQPGGH---------
K8GG80_9CYAN/6-156EVIETADSEVRYPTAGEIWMI...QNFCKSGEQRIQIANKLACNERYLVERGSQKFWRRCPV--TPSNSGN---------
B0JFY1_MICAN/7-164SLIRKYDVTGRYLDRDAIDNL...KQYFASGTARLAAAALINANSAALVRGAAIRLFEEVPE--LIRAGGN---------
Q10YG0_TRIEI/6-160KSIVNADAEARYLSPGELERI...KDFVKAGETRVRIAQVMTESREKIIKEAGQQLFQKRPD--VVSPGGN---------
K9Q0C3_9CYAN/7-161EAVSVADSQGRFLSNTELQSL...FGRFERAAAAMAAAKSLSASSSSLITGAANAVYSKFPY--TTSTPGP---------
B0JXA2_MICAN/8-162EAVATADSQGRFLSSAELQVA...FGRFRQAAITLEAVKILAQKAPSLAQEAANAVYQKFPY--TTQLQGP---------
K9T2W8_9CYAN/6-157ELILNADSEARYPGPKELHIF...QDFLKTGEQRLRIAKFLADNEQQLVQNGSARFWERCPV--TPSNSGN---------
Q117G0_TRIEI/7-178RSVISADSSGSFIDGAGLESL...KSFIADGNKRLDAVNFIASNASCIVSDAVAGICCESPG--LTSPGGG---------
B8HS99_CYAP4/7-164SLISNYDTIGRYLDRDAVDTL...KAYFATGEARVQAAGVINANAAAIVKEAGSRLFTDLPE--LIQPGGN---------
B2J4C1_NOSP7/8-162EAIASADSQGRYLSSTEIQVA...FGRFRQAPASLQAAKALSANAQRLTEGAAQAVYNKFPY--TTQQQGP---------
K9SBH1_9CYAN/7-161EAIAAADTQGRFLSNAEMHQV...FGRYERAAAAMEAARALTKNSQKLIDGAAQAVYQKFPY--TTQQQGA---------
K9PZN7_9CYAN/7-163SLIRNYDTTGRYLDSNAIDNL...KSYFATGADRITTAAIVNGNSAEIVKFAANQLFEAVPE--LLLAGGN---------
Q2JJL1_SYNJB/7-162TLIKTYDLTGRYLDREAMDAL...KAFYDSGLRRIKAVNVINLNSVDIVKTAAAAMFAQVPD--LIRPGGN---------
A5GTI9_SYNR3/7-164GLIGRYDQQGRYLDRLAIEQI...DAYFAEADLRLAAVALINREAAEIVREASQRLWLADPE--LLLPGGN---------
K9TVG8_9CYAN/7-160ALINSSDVQGRYLDPSSLDKL...QNYFQSGDMRAKTAIAVSANAKNIVTKTVAKSLL.YTD--ITAPGGN---------
A5GVQ8_SYNR3/7-161EAVSAADSQGRFLSNTEIQSA...SGRFNRAKASLEAAKGLTAKADALVNGAAQAVYSKFPY--TTQMQGS---------
K9R5H1_9CYAN/6-160QVILQADDQLRYPSSGELKNI...KDYLQTGAQRLRIVNTLTENEKKIVEQATKTLWQKRPD--FIAPGGN---------
K8GCZ2_9CYAN/7-164RVINRYDVTDRFLDNAAIATL...TEFLETGSLRVQVVAVINANAVEIVRESARQLFEELPY--LIQPGGN---------
Q46H72_PROMT/7-154TVVSAADAAGRFPSMSDFESV...KGSFDRAKARLEAAEKLASCLDKFTNLAVDAVYQNG..--.......---------
K8GTM9_9CYAN/7-164SLIKNYDNTGRYLDRNAIDRL...KSYFDSGIVRVQAAAVITSNAAAIVKQAGLQLFEEQPE--LIRPGGN---------
Q7M7C7_GLOVI/7-171KAIVAADLRGSFLSEQELNQL...TNLVKESNKRLDAVNAITGNAAEIISDAAHKLFAEQTD--LIRPGGN---------
K9Q339_9CYAN/12-160SVINSADSQGRYISSDTLKSL...AKYLEENTRLTAIAEKIARKHDQILKQTISNFWDTSEF--EKVSSGQ---------
PHCA_SYNE7/8-162EAVAAADSQGRFLSSTELQVA...FGRFRQAASGLAAAKALANNADSLVNGAANAVYSKFPY--TTSTPGN---------
K9PVY8_9CYAN/33-185..FQAADDESRYLTDADFEVI...LQAAPSLEKSAAIAKSLRDNATNIVSQARVNVLAEFPG--ITDEGGE---------
K9WJQ0_9CYAN/7-183RAVVSADASTSVVS..DINAL...KAFVASGNRRLDAVNAIASNASCMVSDAVAGMICENQG--LIQAGGN---------
Q2JMW3_SYNJB/7-161EAIAAADNQGRFLNASELQAV...NGRYQRAAASLEAARVLTNNQQTLVREAVQEVFKRFPY--LTQPGEM---------
K9T540_9CYAN/6-157QVILNADEELRYPTPGELRLF...QNFCQSGEKRIRIANKLAANEKRLVERGSARFWRRCPV--TPSNSGN---------
Q31Q35_SYNE7/35-183...QAAEEEQRFLTDADLVAI....ALACLPNANPTAARFLRDDADELIAIARADLLDRFPG--ITELGGA---------
B8HKY2_CYAP4/8-172KVVYQADSRGEYLSDGQIDAL...AAFVRDGNKRVDVVNRISSNASTIVASAARSLFAEQPQ--LISPGGN---------
B2J9I8_NOSP7/36-187...QAADDAFRYLSDEDLLQI...QTKSSDNSELIPVAVLLRDRAAEIVDEAREQVLTTYPE--IIQPGGG---------
K9UJL4_9CHRO/35-186...QSADDRREYLTDDELDKI...EANSSSNSSLIPIARLLRDAATEIVDDARDRVLATFPA--ITQPGGG---------
K9XKJ2_9CHRO/7-171KVVSQADSRGEFLSSEQLDAL...TNMVKDGNKRLDTVNRITSNASSIVTDAARALFEEQPQ--LIQPGGN---------
Q8DHC5_THEEB/7-164TLIKNYDSTGRYLDRDAVDRL...RSYFNSGAARVKAAAVINANAAAIVKEAASALFTEQPE--LIQPGGN---------
E8R540_ISOPI/10-154.....NDSEGRYFTAEEQAKA...MEYARSLPIRLDAAQQVEKHEDEIVRYAVEQLKARYPR--.......---------
Q2JI97_SYNJB/7-171KVVAQADSKGAFLGENEFAAL...QQVIAEGNKRLDAVNRLTSNASKIVTDAIRQLFAEEPN--LNAPGGP---------
Q2JI98_SYNJB/8-159.AIATADSQGRYLSNSELQAI...NGRFQRAAASMEAARVLSSRADELVRGATEAVYAKFPY--TTQPGGQ---------
K9WKR7_9CYAN/37-189..FQAADDAGRYLTDEDLQHI...QAIAPNPSELIPVARQLRDQVNDIVNEARATVLNTFPN--ISQPGGG---------
Q31RP7_SYNE7/6-160QVILKADDELRYPSGGELKNI...TDFFKTGEQRLRIAQVLSDSEKKIVDQASRKLWQRRPD--FIAPGGN---------
D4ZTI6_ARTPN/7-164SLIKNYDITGRYLDRDAIDSL...KSYFVTGTARVQAAATITANAAELVKQAASQLFGDLPE--LIRPGGN---------
K9XIF5_9CHRO/6-157QVIAQSDDANRFLSNTELDKL...QDFFRTGEQRLKVAQILTQNEQKIVQEGSRRFWQVVPN--TPSNSGD---------
K9SXI2_9SYNE/7-160TLIGIYDATGRYLDRDAIDEL...KSYFGTGTARLKAASTITANAAGLVRQAGTKLFEVVPD--LIRPGGN---------
K9UCA0_9CHRO/6-160QVILRADDDLRYPSTGELKSI...QSFLQTGEQRIRIVSILAESEKKIVDRASKQLWKLHPE--YIAPGGN---------
K9SCA6_9CYAN/6-160QVILQADDELRYPTAGELNSI...KDFFQTGNQRVRIASILSENEKKIVQEASKQLWQKHPD--YIAPGGN---------
PHCA_SYNP2/7-161EAVALADSQGRFLSNTELQYL...YGRLRQGAFALEAAQTLTAKADTLVNGAAQAVYSKFPY--TTSTPGN---------
Q2JMW4_SYNJB/7-171RVIAQADARGAFLSDQDFDRL...AALVAEGNKRLDAVNRMTSNAAQIVTNAARSLFAQEPD--LIAPGGN---------
K8GE61_9CYAN/7-160TLINSSDTQGKYLDDASLEKL...QNYFRSGELRAKAATSISANASTLVTQAVARSLM.YTD--ITAPGGN---------
K9T5F0_9CYAN/6-157RSIANADREARYLNLGELNAI...RNFYEGGKNRLRIAQILTANEESIIARGSQKFWKRCPD--TPSNTGN---------
Q7NL72_GLOVI/36-187..LRTADAESRYLTDSDLDRL...AVLLPEAAPALETVRFLRDRARPIVSAARSQVLEEFPG--ITEPGGD---------
K9Z238_CYAAP/6-160QVILKADDELRYPSSGELQGI...KSFLETGLLRVKIAETLSENEKKIVEKASQELFKKRPD--FRAPGGN---------
K9XNJ3_STAC7/6-160KMIVNADAEIRYLTPGELEQI...NLFIKNSDRRLKLVKALTESRSYIVKQAANQLFQSRPY--LVSTGGN---------
K9PC78_9CYAN/6-157QVILNADEELRYPTPAEIRMI...QNFCHSGEKRIRIATTLAKNQNRLVEKASDKFWKVCPV--TPSNSGN---------
K9YD01_HALP7/6-160EVILKADDELRYPTSGELKVI...QEFLKTGEQRMQIAQTLAENEKKIVDQASKQLWKLHPE--YIAPGGN---------
K9TVZ1_9CYAN/6-157QMILNADEEVRYLTPGEIHAL...QNFYRSGTERIRLAKVLAQNEKKIVERATQKFWKICPR--TPSNSGN---------
K9SQM2_9CYAN/38-189...QAADDDRRYLTDPELNQI...QALAPAQSEMVSIAAQLRDEAKGIVDEARAEVLRTFPD--ITAPGGG---------
K9VPV9_9CYAN/6-160QLILQADDELRYPSTGELQSI...NDFFKTGEQRVRIATALSDSEKKIVEEASKKLWKKRPD--FISPGGN---------
K9T6U8_9CYAN/35-186...QKADDEGRYLTDEDIERI...KTLSSETLVSLERAKLLREKATEIVSEARKKVLERFPN--ITQPGGD---------
Q7U6V7_SYNPX/7-160.LILQADEDLRYPTSGELQSM...VAFLEQGAMRVSVVKVLTDNEKKIVDESAKQLFGRKPE--YVAPGGN---------
PHCB_SYNE7/8-172KVVAQADARGEFLSDAQLDAL...SRLVAEGNKRIDTVNRITGNASSIVANAARALFAEQPS--LIAPGGN---------
O50209_SYNE7/7-164SLIAGYDLAGKYLDRNAVDSL...RAYFAEGNARVQAAEIINANAASLVRDASAQLFEEVPE--LLRPGGN---------

PF01152

Q7CX73_AGRFC/7-127-------------PADL--SGSEAKFYDYLTGY------LGGP-----PVYVEKHGHPMLRRRHF------------VAP
Q8XXM3_RALSO/11-128-------------.PSL--DGSRDKLFWFLCGW------LGGP-----SHYIERFGHPRLRARHL------------PFE
B2J6Y7_NOSP7/3-117-------------GTDM--AKQRNHLVAFLGQI------FEGP-----KQY...GGRP.MDKTHA------------GLN
F2CUR6_HORVD/26-145-------------GSKK--EDAIQNQYEFLVQR------MGGP-----PLFSQRRGHPALIGRHR------------PFP
TRHBN_MYCTU/14-127-------------GTNM--SRLKGKQVEFFAAA------LGGP-----EPYT...GAP.MKQVHQ------------GRG
Q63VR4_BURPS/25-145-------------PPTL--EGSRDKLFWFLCGW------LGGP-----DHYIERFGHPRLRARHL------------PFP
GLB3_ARATH/26-142-------------NSNK--EDAIQNQYEFFVQR------MGGP-----PLYSQRKGHPALIGRHR------------PFP
Q7APC3_RHIME/8-128-------------PPDL--TGSEEKFYEYLTGW------LGGP-----PIYVQKRGHPMLRRRHF------------IAG
TRHBO_MYCLE/4-122-------------ADDL--AGAEERLRMFLEQY------WGGP-----RTYSSQRGHPRLRMRHA------------PFR

PF11563

E1FPN0_LOALO/43-200............PEEQR--CELASSLRNYLKNV......VNQL...TDRAAVQRISED-FGARHVQ.........YRSFG
Q5B5X9_EMENI/37-216.....IEDFYNEDSPPI--MRRKMFLRWYLTKI......VTDP...MQMDFWRYLNK.-VGLMHTAQE......RIHPLN
A2QBB3_ASPNC/24-203.....PDDYPTLNSPAV--QRRRQFLRWYMTKL......CSDP...TKPEFWRYLNQ.-VGRMHYGKE......RLHSLN
C4JH72_UNCRE/22-201.....LDEQPDENSPQI--LHRKMFLRGYLNRL......CSDP...SKMEFWEYLDK.-VGMMHVGRG......REHPLH
C4XIT4_DESMR/15-174.............SGTL--GRLKHHMSNYILDM......FSGT...YDDVYVLSRLR.-IGLVHD............RIG
D4AN62_ARTBC/20-213VSATTSVADLSLTHPNI--LHRKDFLKSYLVKL......VSNSDWSDDSKFWEYLDK.-VGVMHTGKPGFKHREKRPELR
E9E781_METAQ/19-198.....VGETLHEDSPQI--VHRKMFLRAYLNKL......CSDP...SKMEFWEYLDK.-VGMMHVGLG......RKHPLH
E6U0Q9_BACCJ/24-180.............NSSI--DRLKVTLKQHITEM......FDGL...IDEQYYSKRVR.-IAHIHV............KIG
B6HCY7_PENRW/23-203....PEEEYLHEETPKI--QRRKMFLRWYLTRL......CQDP...TTMDFWRYLNK.-VGMMHSGQV......RMSPLN
Q218B7_RHOPB/3-166.............PERM--VHARKMQIKHWGVI......LDGK...FDEAYEASVTK.-VGEVHN............KLG
D3FWD3_BACPE/27-184.............HSTR--ERLKGVFLYYLKNV......VEGD...VSLEDIRKKQK.-VGSVHN............NSD
B7GLD2_ANOFW/25-175.................--....ARIEAYLNAF......FTME...RNRAYVDESLR.-FFHLLR............KEK
A4Y0T1_PSEMY/34-186.............PATT--ARLKHSQCDYYRRL......WHSP...LDQAYVLERLR.-IGWVHQ............HVG
C4L4W7_EXISA/25-181.............HSSS--DKLKLTLSNHIMEM......FEGK...LNEAYIDRRLA.-IAKRHY............LIG
A1C4D9_ASPCL/22-201.....VDDYFTIDSPHV--QRRKIFWKWYLTRF......FSDP...SQIEYWQYLEK.-VGTMHTGKI......LLHPLT
Q7NUX9_CHRVO/5-158............HGCDQ--DELAAMLLAEWDAL......LSAP...LDSAVAAALVE.-QGELYC............RLG
E0SCN2_DICD3/9-166.............QQVA--NQLNESMYHWLRSV......LGSAT.ESLSALLERQQQ.-VGVIHA............RIG
C7Z0G0_NECH7/17-196.....LQSVLDDNSPEL--QERKNFLNSYLTKI......CSDQ...SKMAFWEYLDN.-VGAMHVGLR......RSKPLR
A9GCE3_SORC5/10-164.............EEQV--ERLKRSLVRWMTRI......CTGP...YDGAYFDESAK.-IGRIHV............RVG
F0XJU9_GROCL/20-199.....LDAVPAEDSPQI--LHRKMFLRAYLARL......CSDP...SQMTFWEYLDK.-VGMMHVGLG......RAHPLH
Q5WC98_BACSK/26-182.............HSSI--DALKQTLKQHILEM......FEGK...VDAAFFAKRKR.-IAQTHV............RIG
Q9KFH4_BACHD/32-188.............HSSV--ERLKETLKQHILEM......FNGE...IDQAFLQKRLQ.-IAQAHV............RIG
B9JTP3_AGRVS/26-192.............ERQI--DRLHDLYVSHWDVM......TDAR...FDALYAERVKV.-LADSQS............RMG
D2QY57_PIRSD/6-164............GPQQV--ARLQKTLHNWIEQF......LTGP...YDNHYVDARVN.-VGLRHV............EIG
B1YHV6_EXIS2/30-187.............SSTR--ERLKKVFADYFGSL......LTGN...MDDKFLAMRTR.-MGKTHN............RNF
B9JUN1_AGRVS/7-170.............DSHI--EHAKQKQIKHWSHL......LSGH...LDGAYVASATT.-IGRTHA............KLG
Q3IUQ9_NATPD/29-196............STKSV--EMLKETQREYLLNL......ADGD...YGQSYFDRRAR.-VGKIHD............MLD
C5G9L3_AJEDR/20-214PAAAGSVAELALDHPNI--VHRKDFLKNYLIRL......VSNKDWSDESSFWGYLDK.-VGIMHTGQAGFKHREKRPKLR
A2QT04_ASPNC/23-202.....VDEYPEFKSPYM--QCRRMFLRWYITRI......CSDP...TKIEFWAYLDK.-VGRMHRGKD......RMISFD
C7ZI09_NECH7/13-198.....SKDELSSDSSLL--MERQNFLNSYLTKMSQLSKGSSDQ...SKMAFWEYLDS.-VGAMHVGLQ......KSRELR
B1YG08_EXIS2/27-183.............HSTL--ERLKGTLAKHILQM......FDGQ...VTPDYINVRKR.-IADRHV............RIG
C1G0V6_PARBD/20-213P.AEASISELSLDHPNI--VHRKDFLKNYLVRL......VSNKNWADDSPFWDYLDK.-VSVIHTGKAGFKHREKRPKLR
A0KND7_AERHH/15-171.............ADTL--TRLRAAQRRYILDL......FSGL...YDLEYVNNRLR.-IGLVHK............RIG
D8PPS9_SCHCM/66-254...PTKLDDLTLDSAQL--VYRKVFMKNWCRRL......LSSD..FSSPKTFTWMDK.-VGVMHTGVKSFKHRTHVSPLH
B3QU69_CHLT3/11-161...............KI--ERMRETLKGWFLEL......FTGD...YNDKYVKSRLQ.-IGKVHV............RIG
B2IB39_BEII9/3-168.............KSHM--GHARQRQLDHWKVL......FNAE...FGADYERAVLA.-IGRTHA............RLG
Q3JC52_NITOC/22-196..........EPDSSYL--AAVRKRFAQWILDT......CNRT...YDQDWLNYQHE.-IGLRHYHTKKNKTDNVQSVPI
D2R7K0_PIRSD/13-194...ATSVDNLRADDPQI--AFRKTHLARYLRAL......VERT...YDAKMVSYLDM.-VGKMHTPLA......GSSELN
Q2Y8W7_NITMU/15-174...........GTEAFR--QKWKYRLRSFGKNF.............ATPGYFEERLA.-LAAAFA............HAN
F2F0J0_SOLSS/31-187.............RTKI--DRLKKTLSSYIISM......FDGV...FNEETIEAKRK.-LARMHF............KIG
F2F399_SOLSS/32-188.............SARM--DRLKGTLTKHLEAM......FNCN...INSHYIEERQT.-IAHVHV............KIG
C0ZJ13_BREBN/21-178.............HTTV--DRLAVSFRHYLQSL......PHAK...LDDAYVAGRKK.-IGEVHS............KIG
B0ULQ7_METS4/3-159...............QQ--TRLVAAQSAHWEQL......FSGR...FDAGYVDSIRR.-IGRVHH............KIG
C6WYR1_METML/18-175.............PDQL--SQLKQKQRGYFKQI......FTGD...YGPGYIKSRLR.-VGVTYQ............QLG
B9J942_AGRRK/14-180.............ESQL--ERLQDLQSSHWDVL......TDAR...FDSLYAERVKV.-LSDSES............KMG
C0ZKX8_BREBN/35-191.............NSTI--ERLKLTLKRHICEM......FSGR...IDSAYIEQRSR.-IAVIHM............RIG
A9CJK8_AGRFC/7-170.............EAHI--HHAKSMQLKHWSRI......ASGT...FNEDYTNAVTA.-IGRTHA............RLG
C4KYX4_EXISA/28-185.............SSTR--ERLKKVFADYFRSL......LTGN...IDDKFLAMRKR.-MGQTHH............HFA
B2W0B6_PYRTR/24-203.....VDAQLSEDSPQI--LHRKMFLRGYLNKL......CSDA...SKMEFWEYLDK.-VGMMHTGQG......RVHPLH
E3EZY8_KETVY/10-171.............QDRM--NSAKTRQESHWKRI......AQGD...FGPDYVAAVRR.-IGAIHA............DIG
Q1AU74_RUBXD/22-196..........EPIQEYL--ERVRERFKRWVLDA......CRRP...YDQEWLDYQQE.-IALRHTREKKNRTDGVEAPEE
A8IPP6_AZOC5/62-225.............AAVR--AHAKAMQIKHWGVI......LDGR...FDAAYVESVTR.-IGQTHA............RLG
Q1GI20_RUEST/15-172.............DTQI--ERVKRGQKKYFQEL......INAE...LDESYAEERKR.-IGGIHE............RAG
B2AU65_PODAN/21-200.....MDDTPDEDSPQI--LHRKMFLRAYLKKL......CSDP...AQMEFWEYLDK.-VGMMHTGIG......RTHPLH
Q0UTR0_PHANO/18-193.....IPDSLSESAPII--QHRKLFLRAYLTKL......CSDP...TQLEFWSYLDS.-VGKMHNT..........QALR
A2R286_ASPNC/23-202.....VDEYFTLDGPHV--QRRKIFWKWYLTRL......FSDP...SRLEYWEYLDK.-VGKMHTGKI......LMHPLK
A9EVT1_SORC5/5-161.............GDAL--RRVKRLQREYFLGL......FTGK...LDRAYVEHRLH.-VGAAHA............RIG
B8N2G0_ASPFN/23-202.....IEDLFTIDSPQV--QRRKIFWKWYLTRL......CSDP...GQPSYWEYLRK.-VGEMHTGKV......LMHPLT
C4JKA6_UNCRE/20-213P.AAATVEDLTLTHPNI--LHRKDFLKLYLVKL......VSNTDWSDNSKFWDYLDK.-VGLMHTGEPGFKHRSKRPQLR
D2VCV6_NAEGR/13-197E..DTLDELSDTSSEQI--KFRKDMLSKYLVKL......VTAD..YSDPALVKYLDW.-VGKIHTTKA......GNKDIV
Q9YFF4_AERPE/20-195.........GEPIKEYL--ERVRARFGAWILDT......TCRD...YNREWLDYQYE.-VGLRHHRSKKGVTDGVRTVPH
F0SHW9_RUBBR/6-164............GDAQV--TRLKSSLARWLQGT......LQAD...HDQNYVAERRM.-IGYRHV............DIG
A8FBP1_BACP2/29-185.............NSSV--ERLKKTLRIHISEM......FAGV...VDEAYVAKRIK.-IAQVHL............RIG
A8P1M8_COPC7/13-202...PTSLNDLSQSHPQI--KFRKDFLARYLVKL......VTMD..YDKMSTWEYLDK.-VGLMHTGEAGFSYRQNKPSLR
A1CRU6_ASPCL/32-212....HVDDWYTENSPQI--QNRKMFLRWYLIKL......CSDP...TQMEFWRYLNK.-VGVMHSGQE......RRVPLN
Q47S02_THEFY/23-197..........HPIQEYL--DRVRERFGQWILDT......CRRP...YNQEWLDYQQE.-IALRHTPEKKNVTDNANSVDN
A9WGB2_CHLAA/23-194..........QPIADYL--SRVRQRFGQWILDT......CRRP...YDQDWLNYQME.-IALRHYRTKKNQTDGVQSVPM
F0LY60_VIBFN/12-164.............EQSI--VRARGHLRDHLMLY.....VFRGH...FGVDYYNATIR.-IGQTHQ............RLG
HEMAT_BACSU/31-185.............HSSV--DRLKQTLKRHIQEM......FAGV...IDDEFIEKRNR.-IASIHL............RIG
Q2KCI4_RHIEC/11-175.............DRQV--DRLQDLQSSHWDVL......TDAR...FDSLYAERVKV.-LSDTES............KMG
MCPE_RHIME/15-178.............DRQI--DRLHDLQSSHWNVL......TDAR...FDGLYAERVKV.-LADTES............RMG
Q65LP1_BACLD/29-182.............NSSV--DRLKKTLTIHIQEM......FSGV...IDEAFLEKRIR.-IAHVHL............RIG
Q7D1B0_AGRFC/50-211.............ENQL--DRLHDLQSSHWSVL......TDAR...FDALYAERVKV.-LSDNAG............RMG
Q81JN0_BACAN/32-186.............YSSI--PKLKQTLKTHIKEL......FSGD...MHEDFIEQRVK.-IAKRHV............QIG
Q8TLY9_METAC/23-193..........TPNEKYL--AAVRKRFSRWILDT......CNRS...YDQAWLDYQYE.-IGLRHHRTKKNQTDNVESVPN
Q9A5Y0_CAUCR/45-206.............DGHM--AGAERAQAAHWRRI......AEAG...YGESYVRDVER.-IGRSHA............DAD
Q9AB06_CAUCR/8-170.............DRHM--NAASSRQQAHWGVI......AEGQ...FSDDYVQAVRA.-IGQTHA............RIG
U5L913_9BACI/33-184.............NSSV--ERLKNTLSAHIYEM......FSGK...IDTEFIQQRSV.-IAHVHV............KIG
U5LFP3_9BACI/32-184.............ISKI--GVTTEMSQQYILSL......FNGI...VDGEFVERRRT.-AAKAYV............QIG
V6F1E9_9PROT/46-194..............EAG--ATLKSALVEHWSRL......YRAE...FTADYIATAQQ.-LGFMLA............YLD

PF00042

Q19601_CAEEL/105-215L..EKIPTGRLKYDPRF--RQHALVYTKTLDFV------IRNL...DYPGKLEVYFEN-LGKRHV------------AMQ
GLB1B_ANATR/17-122L.GDVS...AGKDNSKL--RGHSITLMYALQNF------IDAL...DNVDRLKCVVEK-FAVNHI------------NRQ
HBP1_CASGL/7-116FLKD..SNEIPENNPKL--KAHAAVIFKTICES------ATELRQKGHAVWDNNTLKR-LGSIHL------------KNK
GLB1_PARCH/17-123M.AGMS.ASQLRSSRQM--QAHAIRVSSIMSEY------IEEL...DSD.ILPELLAT-LARTHD------------LNK
MYG_GALGA/3-108L.KN.KSLGELKDTADI--KAQADTVLKALGNI------VKK......KGNHSQPVKA-LAATHI------------TTH
HBAT_HORSE/7-107L..DLS.....LGSTQV--KAHGQKVADALTLA------VEHL.....E.DLPRALSA-LRHRHV------------REL
HBA1_PLEWA/7-107A.KDLS.....ERSSYL--HSHGKKVVGALTNA------VAHI.....D.DIDTAFSK-LSDKHA------------EEL
HBB0_MOUSE/8-112F.GNLSSAQAIMGNPRI--KAHGKKVLTSLGLA------VKNM.....D.NLKETFAH-LSELHC------------DKL
HBA1_XENBO/7-107F..DFH.....HNSKQI--SAHGKKVVDALNEA------SNHL.....D.NIAGSLSK-LSDLHA------------YDL
GLB_PAREP/8-117L.EG.HTIENVMQSEGI--KHYARTLTEAIVHM------LKEI...SNDAEVKKIAAQ-YGKDHT------------SRK
HBB1_CYGMA/8-112F.GNLYNAEAIIGNANV--AAHGIKVLHGLDRG------LKNM.....D.NIVDAYAE-LSTLHS------------EKL
MYG_CYPCA/3-108F.VG.IASNELAGNAAV--KAHGATVLKKLGEL------LKA......RGDHAAILKP-LATTHA------------NTH
HBB2_XENLA/8-112F.GNLSNSAAVAGNAKV--QAHGKKVLSAVGNA------ISHI.....D.SVKSSLQQ-LSKIHA------------TEL
HBAZ_CAPHI/7-107F..DLH.....SGSAQL--RAHGSKVVAAVGDA------VKSI.....D.NVTSALSK-LSELHA------------YVL
HBF1_URECA/7-113F.SS.VPLYGLRSNPAY--KAQTLTVINYLDKV------VDAL.....GGNAGALMKA-KVPSHD------------AMG
HBB1_XENBO/7-111F.GNLNSADAVFHNEAV--AAHGEKVVTSIGEA------IKHM.....D.DIKGYYAQ-LSKYHS------------ETL
LGB1_LUPLU/8-116FLKGSS..EVPQNNPDL--QAHAGKVFKLTYEA------AIQLQVNGAV.ASDATLKS-LGSVHV------------SKG
MYG_HETPO/3-108F.KE.IPVQQLGNNEDL--RKHGVTVLRALGNI------LKQ......KGKHSTNVKE-LADTHI------------NKH
HBAD_ERYML/6-106F..NLS.....PGSKDI--IHQGEKVGKALDSA------LKHL.....D.DIRGTLSQ-LSDLHA------------YNL
HMP_ECOLI/6-103M...........SNQRN--GDQREALFNAIAAY------ASNI...ENLPALLPAVEK-IAQKHT------------SFQ
Q18311_CAEEL/32-140I.AE.N..ESPMQNAAF--LGLSSTIQAFFYKL------IITYE.L.NDDQVREACEQ-LGARHV------------DFI
GLB73_CHITH/23-129F.AG.KDLASIKDTGAF--ATHATRIVSFLSEV------IALSGNESNASAVNSLVSK-LGDDHK------------ARG
HBB_LITCT/1-105F.GNLGSADAISHNSKV--LAHGQRVLDSIEEG------LKHP.....Z.BLKAYYAK-LSERHS------------GEL
HBBN_AMMLE/2-106F.GBLSSABAVMBBAKV--KAHGKKVLBSFSBG------LKHL.....B.BLKGAFAS-LSZLHC------------BKL
HBAM_LITCT/6-102F..DIS.....PGSQDL--LTHGGKIFGALGEA------IKSL..........DNLQK-YQDLHT------------NKL
HBA3_PLEWA/7-107F..DLS.....PGSADV--KRHGGKVLSAIGEA------AKHI.....D.SMDQALSK-LSDLHA------------YNL
HBAD_PASMO/6-106F..DLS.....QGSDQI--RGHGKKVVAALSNA------IKNL.....D.NLSQALSE-LSNLHA------------YNL
HBB_HETPO/7-106L.KEFT.....ACSYGV--KEHAKKVTGALGVA------VTHL.....G.DVKSQFTD-LSKKHA------------EEL
A2VF80_MYCTX/42-136P..........DMGAQR--AAFGQALHWVYGEL------VAQ...R..AEEPVAFLAQ-LGRDHR------------KYG
HBA_LEPPA/7-108FGHDFS.....ANNEKV--KHHGKKVVDAIGQG------VQHL.....H.DLSSCLHT-LSEKHA------------REL
GLB8_CHITH/9-115F.AG.KDLDSIKDSADF--AVHSGRIVGFFSEV------IGLIGNPENRPALKTLIDG-LASSHK------------ARG
GLB2_LUMTE/8-114VHGDDT......SHPAF--IAHAERVLGGLDIA------ISTL...DQPATLKEELDH-LQVQHE------------GRK
Q20638_CAEEL/74-184F.ISKYQGDEWKESKEF--RSQALKFVQTLAQV------VKNIYHMERTESFLYMVGQ-KHVKFA------------DRG
HBB_ALLMI/7-111F.GKMCNAHDILHNSKV--QEHGKKVLASFGEA------VKHL.....D.NIKGHFAN-LSKLHC------------EKF
HBA_CATCL/6-107W.ADLS.....PGSGPV--KHGKKVIMGAIGDA------VTKF.....D.DLLGGLAS-LSELHA------------SKL
HBA_SQUAC/6-107F.TDFS.....ANGKRV--KAHGGKVLNAVADA------TDHL.....D.NVAGHLDP-LAVLHG------------TTL
GLB2_TYLHE/9-115VHGEDV......HSPAF--EAHMARVFNGLDRV------ISSL...TDEPVLNAQLEH-LRQQHI------------KLG
GLB1_GLYDI/6-111F.SG.......ASDPGV--AALGAKVLAQIGVA------VSHL...GDEGKMVAQMKA-VGVRHK------------GYG
GLB10_CHITH/11-117F.AG.KDLEAIKDTADF--AVHASRIIGFFGEY------VTLLGSSGNQAAIRTLLHD-LGVFHK------------TRG
HBB_LEPPA/7-111F.GDLSSPGAIKHNNKV--SAHGRKVLAAIIEC------TRHF.....G.NIKGHLAN-LSHLHS------------EKL
GLB1_TYLHE/7-110VNGDNV......YSPEF--KAHMVRVFAGFDIL------ISVL...DDKPVLDQALAH-YAAFHK------------QFG
HBA1_TORMA/6-107F.SGFS.....ANDKRV--KHHGALVLKALVDT------NKHL.....D.DLPHHLNK-LAEKHG------------KGL
GLB6_CHITH/22-128F.AG.KDLDSIKDSAAF--ATHATRIVSFLSEV------ISLAGSDANIPAIQNLAKE-LATSHK------------PRG
GLB_BUSCA/6-116F..DDATFAAMDTTGVG--KAHGVAVFSGLGSM------ICSI...DDDDCVBGLAKK-LSRNHL------------ARG
GLBH_CAEEL/10-119A..EKYTADDVKKSERF--DKQGQRILLACHLL------ANVY...TNEEVFKGYVRE-TINRHR------------IYK
GLB2_NIPBR/16-114A..ENFTADDVQKSDRF--EKLGSGLLLSVHIL------ANTF...DNEDVFRAFCRE-TIDRHV------------GRG
GLBH_TRICO/30-132A..ETFTADDIAKSDRF--KKLGNQLLLSVHLA------ADTY...DNEMIFRAFVRD-TIDRHV------------DRG
GLB_PSEDC/21-134R..ENYTPADVQKDPFF--IKQGQNILLACHVL------CATY...DDRETFDAYVGE-LMARHE------------RDH
GLB_CERRH/6-116F.GNMS.DAEMKTTGVG--KAHSMAVFAGIGSM------IDSM...DDADCMNGLALK-LSRNHI------------QRK
GLB2_CHITH/22-128F.AG.KDLETLKGTGQF--ATHAGRIVGFVSEI------VALMGNSANMPAMETLIKD-MAANHK------------ARG
GLB_TUBTU/6-112VDGD.N.....AYSAEF--EAHAERVLGGLDMT------ISLL...DDQAAFDAQLAH-LKSQHA------------ERN
GLB3_LAMSP/7-113VRGDNI......HTPAF--RAHATRVLGGLDMC------IALL...DDEGVLNTQLAH-LASQHS------------SRG
GLB_ASCSU/21-134R..EEYTAEDVQNDPFF--AKQGQKILLACHVL------CATY...DDRETFNAYTRE-LLDRHA------------RDH
GLB1_CALSO/5-105A........GTGSGIAM--KRQALVFGAILQEF------VANL...NDPTALTLKIKG-LCATHK------------TRG
GLB2_CALSO/5-108A........GATNDTEM--EKQANLFGLMMTQF------IDNL...DDTTALNYKISG-LMATHK------------TRN
MYG_ALLMI/7-113F.KHMKTADEMKSSEKM--KQHGNTVFTALGNI------LKQ......KGNHAEVLKP-LAKSHA------------LEH
Q21978_CAEEL/165-283L.SESDDVFDLPDNHPV--RRHARLFTSILHIS------VKNV..DELEAQVAPTVFK-YGERHY------------RPD
HBB_SQUAC/7-107FNGKFH.....ASDSTV--QTHAGKVVSALTVA------YNHI.....D.DVKPHFVE-LSKKHY------------EEL
GLB3_TYLHE/8-117VNVD.K.....PSEADW--KAHVIRVINGLDLA------VNLL...EDPKALQEELKH-LARQHR------------ERS
GLBT_CHITH/13-116L.GN..DLAAAKGTAEF--KDQADKIIAFLQGV------IEKLG.S.DMGGAKALLNQ-LGTSHK------------AMG
GLB3_CHITH/20-120F.AG.KDLESIKGTAPF--EIHANRIVGFFSKI------IGEL......PNIEADVNT-FVASHK------------PRG
GLB1_CHITH/21-126F.AG.KDLDSIKGTPDF--SKHAGRVVGLFSEV------MDLLGNDANTPTILAKAKD-FGKSHK------------SRA
LGB1_MEDSA/7-112F...LKNSAEVQDSPQL--QAHAEKVFGLVRDS------AVQL..R.ATGGVVLGDAT-LGAIHV------------RKG
GLBC_NIPBR/21-135A..ENFGADDVQKSKRF--EKQGTALLLAVHVL------ANVY...DNQAVFHGFVRE-LMNRHE------------KRG
HBA1_IGUIG/6-106F..DLN.....PGSAQI--KAHGKKVVDALTQA------VNNL.....D.DIPDALAK-LADLHA------------EKL
HBA1_BOSMU/6-106F..DLS.....QGSAQV--KGHGAKVAAALTKA------VEHL.....D.DLPGALSE-LSDLHA------------HKL
GLB_APLJU/6-113F.KG.KSLADIQASPKL--RDVSSRIFARLNEF------VSNA...ADAGKMGSMLQQ-FATEHA------------GFG
HBA_HETPO/13-114Y.KDFT.....AAAPSI--KAHGAKVVTALAKA------CDHL.....D.DLKTHLHK-LATFHG------------SEL
BAHG_VITST/6-103M.......GRQESLEQP--KALAMTVLAAAQNI------ENL......P.AILPAVKK-IAVKHC------------QAG
GLB4_TYLHE/8-117VNVDDT......HSPEE--FAHVLRVVNGLDTL------IGVL..GDSD.TLNSLIDH-LAEQHK------------ARA
GLB4_LUMTE/11-120VKIDEP......ESGEF--KSHLVRVANGLDLL------INLL...DDTLVLQSHLGH-LADQHI------------QRK
HBP2_CASGL/13-122FLKD..SNVPLERNPKL--KSHAMSVFLMTCES------AVQLRKAGKVTVRESSLKK-LGASHF------------KHG
GLBP1_GLYDI/7-115YSGR.T..EALKHSSKL--QHHGKVIIDQIGKA------VAEM...DNAKQMAGTLHA-LGVRHK------------GFG

PF00502

K9XWT9_STAC7/32-185----------.LYPPAR..AEACWRDFWHFLRC------ITYGIAGQSVEYTSTTGLGYMEQLYQ------------ELK
Q7NLD6_GLOVI/7-176----------.CYTNRR..MAACLRDGEIVLRY------VTYALLAGDASVLEDRCLNGLKETYM------------ALG
K9U0M5_9CYAN/6-160----------.AYGREM..TATCLRDMDYYLRL------ITYAIVAGDATPIEEIGVIGVRQMYR------------SLG
B2J4C0_NOSP7/8-172----------.AYTSRR..AAACIRDLDIILRY------ITYAIFAGDSSVLDDRALNGLRETYL------------ALG
PHEB_NOSS1/7-171----------.CFHNRN..QAACIRDLGFILRY------VTYSVLAGDGSVMDDRCLNGLRETYQ------------ALG
K9U368_9CYAN/7-161----------.QYAADSRGKSKCARDIGHYLRM------VTYCLVAGGTGPMDEYLIAGLDEINR------------SFD
E0UA88_CYAP2/6-160----------.AYGEEM..TATCLRDMDYYLRL------ITYGVVAGDVTPIEEIGLVGVREMYK------------SLG
Q31RG0_SYNE7/6-160----------.AYGEDM..TATCLRDLDYYLRL------VTYGVVSGDITPIEEIGIVGVREMYK------------SLG
A5GVQ7_SYNR3/7-171----------.AYTSRR..MAACLRDMEIVLRY------VTYAVFAGDASVLEDRCLNGLRETYL------------ALG
K9UI71_9CHRO/7-164----------.AYTTRR..YAACLRDMDYYLRY------ASYAIVAGDTNVLDERVLQGLRETYN------------SLG
K9PBJ3_9CYAN/6-157----------....RIY..RSSCLRDQSWYIRL------ITYSIVLQDIEPLAEIGTIGVQEMYN------------SLE
B7JYL9_CYAP8/7-163----------.AYTTRR..YSACLRDMDYYLRY------ASYALVAGDSHVLDERVLQGLRETYN------------SLG
Q7M7F7_GLOVI/7-161----------.GYGDTN..QAKCARDISHYLRF------ITYSLVAGGTGPLDDYIVAGLREVNR------------TFN
K9SEX3_9CYAN/6-160----------.AYGQKQ..RAQCLRDFGWYIRV------VTYGVISGSKEPIEKIGIIGAREMYN------------SLG
K9U364_9CYAN/7-161----------.QYASTPEGKSKCVRDIDHYLRT------ISYCCVVGGTGPLDEYVVAGLKEFNS------------ALG
Q7V589_PROMM/7-180----------.CYPTRR..MAACLRDGEIILRY------VSYALLAGDASVLDDRCLNGLKETYD------------ALG
K9XSR9_STAC7/6-160----------.SYGQKQ..YNQCIRDFGWYLRL------VTYGVLSGDKEPIENTGLIGVREMYN------------SLN
Q2JPU0_SYNJB/6-160----------.AYGDKR..YNQCLRDYDWYLRL------VTYGIIAGSKEPIESIGLIGVREMYN------------ALN
K9SZ05_9SYNE/7-161----------.NYAADARGKSKCARDVGYYLRI------ITYSLVAGGTGPLDEYLVAGLAEINR------------TFE
K9SDD2_9CYAN/9-154----------DI.......TAKWKADTRRVLRY------SAVALLIDDTNRLKEHLLFWFQTVMQ------------AFK
Q7TTT3_SYNPX/31-183----------.LFPGER..ADACWRDCWHFLRV------IVYAVACQRSNFTNPTGMAALRELYQ------------RMG
E0U6T1_CYAP2/7-183----------.CYPNRR..MAACLRDGEIILRY------VTYALLAGDASVLDDRCLNGLKETYI------------ALG
K9UYY7_9CYAN/6-160----------.AYGKEM..TGTCLRDMDYYLRL------ITYSVAAGDTTPIEEIGIIGVRQMYR------------SLG
B7K3F0_CYAP8/6-160----------.AYSQRQ..YNQCLRDYSWYLRL------VTYGVLAGDKEPIEKIGLIGAKEMYN------------SLG
K9YHW9_CYASC/8-165----------.AYTTRR..YSACLRDMDYYLRY------ASYALIAGDTSVLDERVLQGLRETYN------------SLG
K9T4V8_9CYAN/7-171----------.AYTNRR..MAACLRDMEIILRY------VTYATFTGDASVLNDRCLNGLRETYV------------ALG
A5GTB5_SYNR3/7-160----------.AYGQKQ..RAQCLRDFSWYLRL------VTYGGLAGSTSFIESTGLIGAREMYN------------SLG
B2J478_NOSP7/7-163----------.GDTQVK..KDKCFRDIKHYLRL------INYSLVVGGTGPLDEWGIAGAREVYR------------SLG
PHEB1_SYNPW/7-183----------.CYPNRR..MAACLRDGEIILRY------ISYALLAGDASVLDDRCLNGLKETYI------------ALG
A5GVP3_SYNR3/7-164----------RQCATEG..KEKCKRDFVHYLRL------INYCLVTGGTGPLDELAINGQKEVYK------------ALS
B7K6K4_CYAP8/7-163----------.NSTDTF..KAKCARDIKHYLRL------IQYCLVVGGTGPLDEWGIAGQREVYR------------ALG
APCF_SYNY3/7-164----------.AYTTRR..FSACLRDMDYYLRY------ASYALIAADNNVLDERVLQGLRETYN------------SLG
APCF_SYNP2/7-164----------.AYTTRR..FSACLRDMDYYLRY------GTYALIAGDMDVLNERVLQGLRETYN------------SLG
B2J479_NOSP7/8-184----------.LYPTRR..MAACLRDAEIVLRY------VTYALLAGDSSVLDDRALNGLKETYT------------ALG
K9VCF0_9CYAN/35-186----------.LYPPER..AEACWRDFWQFLRC------ITYGIAGNSPQFTSQEGLKNMELLYQ------------ELR
K9PSE2_9CYAN/6-160----------.AYGQEM..TATCLRDIDYYLRL------ITYSIVAGDATPIQEIGVIGAREMYR------------SLG
K9TTH5_9CYAN/6-160----------.AYGERQ..RALCLRDYGWYLRL------ITYGVLAGDKEPIEKIGLVGVREMYN------------SLG
Q7U7B1_SYNPX/9-166----------.AYTTRR..LAACLRDMDYFLRY------ASYALVAADSTILNERVLNGLDDTYK------------SLG
K9TY40_9CYAN/7-164----------.AYTTRR..YNMYVRDMNYFLRY------CSYAIVAGDASVLDERLLAGLRDTFN------------SLG
K9P5D8_CYAGP/8-172----------.AYTHRR..VAACLRDLDIILRY------VTYAVYLGDASVLEDRCLNGLRETYL------------ALG
K9U651_9CYAN/7-164----------.AYTTRR..YAACLRDMDYYLRY------ATYALVAGNMDVLDERVLQGLRETYN------------SLG
K9XTU9_STAC7/7-164----------.AYTTRR..YSACLRDMDYYLRY------ASYALVAGDMNVLDERVLQGLRETYN------------SLG
U5QS61_9CYAN/34-186----------.LYPQAR..ADACWRDFWHFLRC------ISYGVAAERHDFTSSEGLHYMGLLYQ------------ELR
B0C339_ACAM1/7-156----------ALPTTRR..YAACVRDLDFYLRY------ATYAMVAGDTTILDERVLNGLKETYL------------ALG
K9SW00_9SYNE/6-160----------.AYGQRQ..RAQCLRDYGWYVRL------ISYGILAGDKDPIESIGIIGVREMYN------------SLG
K9PBM8_CYAGP/6-160----------.AYGEEM..TASCLRDMDYYLRL------VTYGVVAGDVTPIEEIGVIGAREMYR------------ALG
K9Y8I8_HALP7/7-164----------.AYTTRR..YSACLRDMDYYLRY------ATYALVAGDTYVLDERVLQGLRETYN------------SLG
Q10UW8_TRIEI/7-161----------.NYASTEIGKQKCSRDIGYYLRM------VTYCLIAGGTGPMDEILIAGISEINS------------TFE
Q7NL79_GLOVI/7-160----------.MYTTRR..YAACIRDMDYFLRY------ATYAMLAGDPSILDERVLNGLKETYN------------SLG
K9P5A2_CYAGP/7-160----------.AFGQKQ..RAQCLRDYSWYLRL------VTYGILAGSTELIQQIGVVGAREMYN------------SLG
A5GL99_SYNPW/7-160----------.AYGQKQ..RAQCLRDYSWYLRL------VTYGVLAGSTEMIEQIGLIGAREMYN------------SLG
K9SQ75_9CYAN/7-161----------.NYASTQRGKDKCVRDIGYYVRM------VTYCLIVGGTGPMDDYLIGGLTEINR------------TFE
Q10ZG9_TRIEI/37-188----------.LYPQAR..AEACWRDFWHFLRC------ITYGIAGNNKEFTSQEGLHYMNLLYQ------------ELL
PHCB_SYNP2/7-171----------.AYTNRR..MAACLRDMEIILRY------VTYATFTGDASVLNDRCLNGLRETYV------------ALG
Q10XZ6_TRIEI/7-164----------.AYTTRR..YAACLRDMDYYLRY------ATYALVAGNTDVLDERVLQGLRETYN------------SLG
U5QNF8_9CYAN/7-160----------.AYGEKR..LGSCIRDLGWYYRL------ITYSIVAGNNEPVDRIGLTGIFEMYR------------MLE
K9PDX9_9CYAN/6-157----------....ERK..TASCQRDQGWYVRL------VAYSILAGSEKPLEEIGTIGIKEMYN------------NLE
Q117G1_TRIEI/7-161----------.IGAEVQ..KSKCKRDIVHYLRL------INYCLVVGGTGPVDEWGIAGAREVYK------------ALG
K9P457_CYAGP/8-162----------.NYAFDARGKAKCSRDIGYYLRH------ITYSLVAGGTGPLDEYLIAGLDEINR------------AFE
B7K6K8_CYAP8/35-188----------.LYPPER..AEACWRDFWHFLRC------ITYAIAGNSPQFTSQEGLENMQLLYQ------------ELQ
K9TWK3_9CYAN/6-157----------....RTY..RASCLRDQDWYIRL------IAYTVIVGDVEPLKDIGIVGVKEMYE------------SLE
G3XCS9_PROMA/7-154----------.NYEQAN..KDKCSRDIHHYLRL------INYCLVTGGTGPLDEWGIAGMREVIR------------IQL
K9XAE9_9CHRO/6-160----------.AYGQEM..TATCLRDMDYYLRL------ITYGVVAGDVTPIEEIGVVGVREMYK------------SLG
K9TI03_9CYAN/11-165----------.AYGQRQ..RAQCLRDFGWYLRL------ATYGVLAGDKGPIEKIGIIGAREMYN------------ALG
Q7V590_PROMM/7-154----------.KYDLAT..RDKCARDINHYLRL------INYCLIAGSTGPLDEWGIAGVREVFR------------TLG
E0U6S4_CYAP2/34-186----------.LYPPER..AQACWRDFWHFLRC------ISYGIAGQTIPFTRAEGLKNMQLLYQ------------ELK
K9SFN5_9CYAN/6-164----------SVHTNIE..TNLCLDDGESILQY------VTYSLLSGSASILEEHYLDRFIEKYL------------DLG
K9RE36_9CYAN/7-164----------.AYTTRR..YAACLRDMDYYLRY------ATYALVAGSMDVLDERVLQGLRETYN------------SLG
Q8DIN1_THEEB/16-170----------.AYGQKQ..RALCLRDYGWYMRL------ITYGILAGDKDPIERTGIIGVREMYN------------SLG
Q2JLK1_SYNJB/7-160----------.MYTTRR..YAACIRDMDYYLRY------ATYAMLAGDPSILDERVLNGLKETYN------------SLG
Q7NLD7_GLOVI/7-163----------.GDSAEK..VAKCYRDIDHYMRL------INYCLVVGGTGPLDEWGISGAREVYR------------ALN
PHEB2_SYNPX/7-177----------.VYTNRK..MAACLRDGEIVLRY------VSYALLAGDASVLQDRCLNGLRETYA------------ALG
K8GH86_9CYAN/6-155----------....PTY..RASCIRDQGWYIRL------VTYALVEGDTKIIDTVGIRGAKEMYI------------SLG
B7K2Z2_CYAP8/11-156----------DN.......IKLVSNIIDSFLKD------IALSMLAGDPSILDKYRLNEFHEYLK------------SVN
Q117E9_TRIEI/6-178----------.CYPNRR..MAACLRDGEIILRY------VTYALIARDDSILNDRCLNGLKETYI------------ALG
K9WFS1_9CYAN/7-161----------.NYAADQRGKDKCVRDIGYYLRI------VTYCLVAGGTGPLDEYLIAGLDEINS------------TFE
K9ZE77_ANACC/7-171----------.CFHHRN..QAACIRDLGFILRY------VTYSIATGDSSIMDDRCLNGLRETYQ------------ALG
A5GVM9_SYNR3/34-181----------.LYPEHR..AEACWRDCFHFLRV------CCYAVAVAQPKFTNPEGMAALGELYA------------ALG
K9UJM8_9CHRO/7-161----------.NYASTPRGKAKCARDIGYYVRM------ISYCLIAGSTGPMDDYLIGGLAEINS------------TFD
PHAC_SYNP2/6-160----------.AATTKQ..YNQCLRDYGWYLRL------VTYGILAGDKDPIERIGLIGVKEMYN------------ALG
PHEB_PROMP/7-174----------.LDTTNK..MSVCLRDGEIILRI------VSYLLISDDESVLSKNCLKDLKNTYL------------ALG
K9T481_9CYAN/7-160----------.MYTCRR..YAACIRDLDYFLRY------ATYAMLAGDPSILDERILNGLRETYN------------SLG
PHAC_SYNY3/6-160----------.AYGQRQ..YNQCLRDYGWYLRL------VTYGVLAGNKEPIETTGLIGVKEMYN------------SLN
PHEA1_SYNPW/7-163----------.GENQTK..VDKCYRDLGHYLRL------INYCLVVGGTGPLDEWGIAGAREVYR------------TLG
K9XWE3_STAC7/7-183----------.CYPNRR..MAACLRDGEIILRY------VSYAILSGDASVLEDRCLNGLKETYT------------ALG
K9XKS9_9CHRO/7-160----------.MYPTRR..YAACIRDLTLFLRY------ATYAMLAADPSILDERVLDGLKETYN------------SLG
K9SIK8_9CYAN/7-160----------.AYTTRR..YAACLRDVDYFLRY------ATYALVAGDNFVLDERVLQGLRETYN------------SLG
Q7NJA2_GLOVI/7-160----------.MYYARR..FAACIRDMEYFLRY------ATFAMVAGDTSLLDEYVLNGLKETYT------------SLG
K9P3V2_CYAGP/7-164----------.AYTTRR..LAACLRDMDYFLRY------ASYALVADDFTILDERVLNGLDDTYK------------SLG
PHEB_PROMA/7-181----------.CYPTRR..MAACLRDGEIILRY------VSYALLAGDPSVLDDRCINGLKETYI------------ALG
K8GG80_9CYAN/6-156----------....LRK..TNSCQRDQGWYIRL------VAYCVLAGSQKPLEEIGTIGMKEMYR------------SLN
B0JFY1_MICAN/7-164----------.AYTTRR..YSACLRDMDYYLRY------ASYALVAADTNVLDERVLQGLRETYN------------SLG
Q10YG0_TRIEI/6-160----------.AYGEEM..TATCLRDLDYYLRL------ISYGIVSGDVTPIEEIGLVGVREMYK------------SLG
K9Q0C3_9CYAN/7-161----------.TYASSAVGKEKCARDIGYYLRM------VTYCLVAGGTGPMDEYLVAGLDEINR------------TFE
B0JXA2_MICAN/8-162----------.NYAYDERGKSKCVRDIGYYIRI------ITYALVVGGTGPIDEYLVAGLSEINS------------AFE
K9T2W8_9CYAN/6-157----------....PRK..TASCQRDQGWYIRL------IAYSVLAGSEKPLEEIGTIGIKEMYN------------SLE
Q117G0_TRIEI/7-178----------.VYTTRK..MAACLRDGDIILRY------ICYALLAGDASVLNDRCLNGLKETYA------------ALG
B8HS99_CYAP4/7-164----------.AYTTRR..YAACLRDMDYYLRY------ATYALVAGDTDVLDERVLEGLRETYN------------SLG
B2J4C1_NOSP7/8-162----------.NFASDARGKGKCVRDVGYYLRI------ITYALVVGGTGPLDDFLISGLAEINR------------TFD
K9SBH1_9CYAN/7-161----------.NMAADARGKAKCARDIGYYLRI------VTYCLVAGGTGPLDEFLLAGLDELNR------------AFD
K9PZN7_9CYAN/7-163----------.AYTTRR..YSACLRDMDYYLRY------GTYAIIAGNNDILNERVLQGLRETYN------------SLS
Q2JJL1_SYNJB/7-162----------.AYTTRR..YATCLRDMDYFLRY------ASYALVAADNSILDERVLAGLRETYN------------SLG
A5GTI9_SYNR3/7-164----------.AYTTRR..LAACLRDLDYFLRY------ASYALVAADWKMLDERVLNGLNDTYK------------SLG
K9TVG8_9CYAN/7-160----------.MYTCRR..YAACVRDLDYFLRY------ATYAMLAGDTSILDERILNGLRETYN------------SLG
A5GVQ8_SYNR3/7-161----------.NYSTTPEGKAKCSRDVGYYLRM------ITYCLVAGGTGPMDDYLIAGLDEINR------------TFE
K9R5H1_9CYAN/6-160----------.AYGQRE..RALCIRDYGWYLRL------VTYGILAGDKDPIEKIGLIGVKEMYN------------SLG
K8GCZ2_9CYAN/7-164----------.AYTTRR..HSMYLRDMDYFLRY------SSYALLTGDTSILDERLLAGLKDTFN------------SLG
Q46H72_PROMT/7-154----------.SYEQAN..KDKCVRDIHHYLRL------INYCLVTGGTGPLDEWGISGMREIIR------------IQL
K8GTM9_9CYAN/7-164----------.AYTTRR..YAACLRDMDYYLRY------ASYALVAGDTDVLDERVLEGLRETYN------------SLG
Q7M7C7_GLOVI/7-171----------.AYPNRR..MAACLRDMEIILRY------VSYALLAGDASVLEDRCLNGLKETYV------------ALG
K9Q339_9CYAN/12-160----------.........YTACLRDLDFFLRY------STYTMIAGDYSILDKRVLNGLAETYT------------SLD
PHCA_SYNE7/8-162----------.NFASTPEGKAKCARDIGYYLRI------VTYALVAGGTGPIDEYLLAGLDEINK------------TFD
K9PVY8_9CYAN/33-185----------.LYPAFR..ADACWRDFWHFLRC------VTYGITTDRTDYTSKAGLGFMEQLYQ------------ELK
K9WJQ0_9CYAN/7-183----------.CYPNRR..MAACLRDAEIILRY------VTYALLAGDASVLDDRCLNGLKETYA------------ALG
Q2JMW3_SYNJB/7-161----------.GHGDVF..QAKCARDIGYYLRF------ITYSLVAGGTGPLDEYLVAGLREVNR------------SFN
K9T540_9CYAN/6-157----------....MRK..TASCQRDQGWYIRL------IAYCVLAGNEQPLAEIGTIGMKEMYQ------------SLG
Q31Q35_SYNE7/35-183----------.LYPEAR..SQSCWRDCWQFLRC------LSYGVAAGRADYATPAGFEALAVVYE------------ELE
B8HKY2_CYAP4/8-172----------.AYTNRR..AAACLRDLEIILRY------ITYAIFTGDASVLDDRALNGLRETYL------------ALG
B2J9I8_NOSP7/36-187----------.LYPPER..AQACWRDFWHFLRC------ITYGIAGGHADYTNPTGLHYMNLLYQ------------ELQ
K9UJL4_9CHRO/35-186----------.LYPAAR..AEACWRDFWHFLRC------VTYGIAGGSVEYTSDMGLDYMNLLYQ------------ELQ
K9XKJ2_9CHRO/7-171----------.AYTNRR..MAACLRDMEIILRY------VTYAVMAGDASVLDDRCLNGLRETYQ------------ALG
Q8DHC5_THEEB/7-164----------.AYTTRR..YATCLRDMDYYLRY------ASYAIVAGDVDVLNERVLEGLRETYN------------SLG
E8R540_ISOPI/10-154----------.LDTMHERAWSKAMRDFSLVLRY------AVHSMILDDPDLGEERLYVWFRTILG------------SLG
Q2JI97_SYNJB/7-171----------.AYPSRN..VAACMRDMDIILRY------ITYAVAAGDASVLNERCLNGLRETYQ------------ALG
Q2JI98_SYNJB/8-159----------.CH..TQAGKDKCARDVRHYLRY------ITYCLVAGGTGPLDEYQLAGIREINA------------AFE
K9WKR7_9CYAN/37-189----------.LYPAER..ADACWRDFWHFLRC------ITYGIAGQHTDYTSTDGLHYMQLLYQ------------ELQ
Q31RP7_SYNE7/6-160----------.AYGQRQ..RAQCLRDYGWYLRL------ITYGVLAGDKEPIESIGLLGAREMYN------------SLG
D4ZTI6_ARTPN/7-164----------.AYTTRR..YAACLRDMDYYLRY------ATYALVAGDTDVLDERVLQGLRETYN------------SLG
K9XIF5_9CHRO/6-157----------....PQK..TALCQRDQSWYLRL------ISYAVLAGNMKPLEDIGVDGMREMYT------------SLG
K9SXI2_9SYNE/7-160----------.AYTTRR..YAACLRDLDYYLRY------ATYALVAGDNYVLDERVLQGLRETYN------------SLG
K9UCA0_9CHRO/6-160----------.ASGQKQ..RAQCIRDYGWYLRL------VTYGVLAGDKGPIEQIGLIGVRDMYN------------SLG
K9SCA6_9CYAN/6-160----------.AYGQRE..RALCLRDYGWYLRL------ITYGVLSGSKDPIEKIGVIGAREMYN------------SLG
PHCA_SYNP2/7-161----------.NFAADQRGKDKCARDIGYYLRM------VTYCLVAGGTGPMDEYLIAGVDEINR------------TFD
Q2JMW4_SYNJB/7-171----------.AYTNRR..MAACLRDMEIILRY------ITYATLAGDSSVLEDRCLNGLRETYI------------ALG
K8GE61_9CYAN/7-160----------.MYTCRR..YAACIRDLDYFLRY------ATYAMLAGDPSILDERVLNGLRETYN------------SLG
K9T5F0_9CYAN/6-157----------....ATF..RASCMRDQGWYIRL------ITYAIVVGDIEPLEKTGIKGVREMYE------------SLE
Q7NL72_GLOVI/36-187----------.LYPSVR..AEACWRDYWHFLRS------ITYGIAARRPNFTSPEGVHYLHLLYQ------------ELR
K9Z238_CYAAP/6-160----------.AAGQKQ..YNQCIRDFGWYLRL------ATYGVLAGDKEPIEKIGLIGAKEMYN------------SLG
K9XNJ3_STAC7/6-160----------.AYGKEK..TATCLRDMDYYLRL------VSYSIAAGDGAPIQELGIVGVSQMYK------------SLG
K9PC78_9CYAN/6-157----------....MRK..TASCQRDQGWYIRL------VAYCILAGNEQPLEDIGTIGMKEMYA------------SLG
K9YD01_HALP7/6-160----------.AFGSRE..RSLCIRDYGWYLRL------ITYGIVAGDKQPIESIGLVGVREMYN------------ALD
K9TVZ1_9CYAN/6-157----------....ARK..TEAAMRDIGWYIRL------VSYCLLAGNEKPLEEIGLIGMKELYN------------SVG
K9SQM2_9CYAN/38-189----------.LYPPER..AEACWRDFWHFLRC------VTYGIAGGRTDYLSAVGLDYLQQLYH------------ELS
K9VPV9_9CYAN/6-160----------.AYGQRE..RALCLRDYGWYLRL------ITYGILAGDKEPIESIGLIGVREMYN------------SLG
K9T6U8_9CYAN/35-186----------.LYPPER..AEACWRDFWHFLRC------ISYGIAGQSTAYTSQEGLNNMQLLYQ------------ELR
Q7U6V7_SYNPX/7-160----------.AYGQKQ..RAQCLRDYSWYLRL------VTYGVLAGSTEMIQDIGLVGAREMYN------------SLG
PHCB_SYNE7/8-172----------.AYTNRR..MAACLRDMEIILRY------VTYAVFTGDASILDDRCLNGLRETYL------------ALG
O50209_SYNE7/7-164----------.AYTTRR..YSACLRDLDYYLRY------ATYALVAGNTEVLDERVLQGLRETYT------------SLG

PF01152

Q7CX73_AGRFC/7-127IGPAERDEWLLCFRRA--MDETIENAK-----------LREIIWAPVERLAFHMQN---------------
Q8XXM3_RALSO/11-128IGTRERDQWMRCMALA--MQDLG...I-----------DDALQMRLMQAFWQTADW---------------
B2J6Y7_NOSP7/3-117LQQPHFDAIAKHLGEA--MAVRGVSAE-----------NTKAALDRVTNMKGAILN---------------
F2CUR6_HORVD/26-145VTHRAAERWLHHMQQA--LETT..QSI-----------NPDTKTKMMNFFRHTAYF---------------
TRHBN_MYCTU/14-127ITMHHFSLVAGHLADA--LTAAGVPSE-----------TITEILGVIAPLAVDVT.---------------
Q63VR4_BURPS/25-145IASSERDQWLRCIAWA--MQDVGLDEP-----------LRERLMHSFHDTADWMRN---------------
GLB3_ARATH/26-142VTHQAAERWLEHMQNA--LDDSV..DI-----------DQDSKIKMMKFFRHTAF.---------------
Q7APC3_RHIME/8-128IGPAERDEWLFCFTRA--LEETVSHPK-----------LREIILEPITRLAHHMQN---------------
TRHBO_MYCLE/4-122ITAIERDAWLRCMHTA--VASIDSHTL-----------DNEHRRELLDYLEMAAHS---------------

PF11563

E1FPN0_LOALO/43-200FRPDFFAITADAVTTE--CVLL..............DAAIHSASEALFAWSTLTTFMFSFVRDGYYSEQRR
Q5B5X9_EMENI/37-216IEYIHMGACLGYIQDL--FTEALLSHP.........TLSIARKTAMIRAISKIIWIQNDLIARWRMRDGEE
A2QBB3_ASPNC/24-203VEYIHIGACLGFIQDI--VMEAVLTYE.........KLTLPFRIALVRALGKVIWIQNDLFARWRLHDGEE
C4JH72_UNCRE/22-201IEFVHIGANLGFIQNV--LTEALLSHP.........RLPLSRKIALVTAIGKVIWVQNDLFAKWYVRDGDE
C4XIT4_DESMR/15-174VPPMLYISSIRTLFQI--LRERLTSKLS.......ANKQCSTCHGILGALEKIILFDLTLVMDTYIHALVK
D4AN62_ARTBC/20-213VEVMHMSLLLGFVEDI--VLQATMGAE.........ELDIQTKTNVIRAFNKLIWIQNDLFQKHYVSK.LE
E9E781_METAQ/19-198IEYVHLGTCLGFIQDI--MTEAILSHP.........RLHMYRKIALVKALNKVIWIQNDFMAKWHVREADE
E6U0Q9_BACCJ/24-180LQTKWYMSAFQDLLLS--LMELVDEII..........EDKTECLYIIKAITKVINLEQQLVLEAYEIETKR
B6HCY7_PENRW/23-203IEYIHLGACLGYIQDI--WIEAMLSHP.........HLSLRRKIALVRAVNKILWIQNDLFARYHSSDGEE
Q218B7_RHOPB/3-166LEPRWYIGGYNALISG--LMEAVALRMPTG...RFDRRALQKKTALQQAIIKASMLDMDYAIAVYIEAGRR
D3FWD3_BACPE/27-184LPIAWFLATYQVFLQL--IIPQLVSNF.........FKEPDKLTNYILALTGRFNFDSQLIVEEYLQSKMR
B7GLD2_ANOFW/25-175VNVGKLIVAFNQFNFF--VLTTLLAKV.........ALAPKRCLTLMEALQRAINIEQQLLVEVYTETLME
A4Y0T1_PSEMY/34-186VDLKWYLGAYRMYLDG--MLEALLEPS..............PASDCFASLIKKVFFDIGLALDSYGAAQRK
C4L4W7_EXISA/25-181LKGKWYMAAFQKIFET--LVLAIQHEQ..........LDADSKMKLMMAVSKIFNFEQQIVLEMFDDEADV
A1C4D9_ASPCL/22-201IEYIHMNACLGYLKEL--LLETIFLHE.........EMTVAFKFALVRSLSKILCIQNDLIARCHIRDGEE
Q7NUX9_CHRVO/5-158VSLGWLQGLYERCQPH--LLGGLEQAA...............GTEAARLLRKRILLDQMLKTHGYQQALKR
E0SCN2_DICD3/9-166IPTDLVARGARKLKNE--LFRLLDRKR.........NLDAALINQAVCFSSLVIDTAIEAMTTAYSPGYKS
C7Z0G0_NECH7/17-196VEYIHISATLCVIQHV--LTESILSHS.........VLPMSRRVAMVKALSKVIWIQNDLFAKWCVRDGEE
A9GCE3_SORC5/10-164LPQRYMFTAMTLIRLA--FHEIAQGAL............GAEVIPVRAAVSKVLDLELAIMLETYRDDFLA
F0XJU9_GROCL/20-199VEYIHIGATLSLIQDV--LTEAVLSHP.........RLSMGRKMGLVKALGKVIWIQNDLFAKWYVRDGEE
Q5WC98_BACSK/26-182LKTKWYIGAFHNLQLE--LQRMIVKHF..........KSGNEQFLAFCAVGKFINFEQQLVLEAYEEEERR
Q9KFH4_BACHD/32-188LQTKWYVSAFQQLTDS--LIQLLEQHL..........QSPSDIVLATRSLLKLLNLEQQLVLEAYENENKR
B9JTP3_AGRVS/26-192LDPRWQIAGHAVVLEG--LVSSVFADLANRGFMPSSRKRAAELQALVSALIRLVMVDVEIAVSLRFNELRL
D2QY57_PIRSD/6-164LDQVYAAVAVARLRSG--MIAAISSDA.........KLSPAQLSLTVQSINKLLDLDLAIISDVYEAEYVR
B1YHV6_EXIS2/30-187VPVTWFIASYAAFNTL--LIPKIVEHF.........QHEPAQLTNAILALNHAMNLDAQIVTSQYVDARLH
B9JUN1_AGRVS/7-170LDPRWYIDGYGLILSG--LVTGVLEAEMRG...TLFGSRLKGAIPKISALIRATMLDMDFAISTYGEALSE
Q3IUQ9_NATPD/29-196LGPKAYLGAYTIYYEG--IADAIADDIKSEFDGDEAAAAVDEAFDRMSSVLKAMNLDQQVAMDTYIHSYSE
C5G9L3_AJEDR/20-214VEVMHMSLLLAFVEEM--VLQAILGAE.........GVDLQTKTGMITAFNKLVWIQNDLFQRHYVAKKPE
A2QT04_ASPNC/23-202VEYIHIGACLGYIQDV--LIEGVMGCE.........KMSLPFRVALVRALGKVIWIQNDLFARWRVRDGAE
C7ZI09_NECH7/13-198IDYIHISLTLSLIQSV--MSQAILDHS.........SIPISRRAAIVKSFSKVIWIQNDLFARWYVRDGEE
B1YG08_EXIS2/27-183LQNKWYIAAFQKVLNV--LSRQIEDST..........LPESEQVRIVRSAGKLFNLEQQIVLTMYEEMVDA
C1G0V6_PARBD/20-213VELMHMSLLLGFVEDL--MLKTTLAAD.........GLDLRTKTSVLAAFNKLMWIQNDLFLRHYVAEKPE
A0KND7_AERHH/15-171VEPKLYLAAINTLKGL--LIEDIFTQI..........DHEPDRITMLTALDKLFLFDITLVFETYIRSLVS
D8PPS9_SCHCM/66-254VPYRDCALTLGWVGTV--LQTATLQLPE.......DKLSMKEKIDAVGAINKILWIQNDLFARHYID...E
B3QU69_CHLT3/11-161LPVRYPLAMMDVIMEY--GQKAALQSS..............QPEIASSAFRKLAALDIAIFNQAYESTQLK
B2IB39_BEII9/3-168LEPRWYIGAYALIGEG--LVETLIEQQWPKL.LPSAHKQAAKVSSSLASVWKALLLDIELSISAYLEAIET
Q3JC52_NITOC/22-196ISYRYLITFIYPITAT--IKPFLEKKG..........HSAEEVEKMHQAWFKSLLLQVTLWTNPYLRQEDY
D2R7K0_PIRSD/13-194VPLVQMNALLGFVADA--LIATIFSLG..........LDRETEIKTQRAFQKLLWVQNDLINRHYQTASTW
Q2Y8W7_NITMU/15-174IPLGALQLPSFLIQQS--LIDNLLDKS.........DFNADKTRILLCTILKLTALDLYIAAEGYHLPELN
F2F0J0_SOLSS/31-187LDPKWYMGTFQKLQET--MIMLISKDI..........ADVAGREIIQLNVSKLINLEMQVVLEEYEKENLN
F2F399_SOLSS/32-188LQSKWYIASFQSLMTT--FIDFISKIE..........MSNVDMAKAVDAFSKLINFEQQLVIEAYEKEEQR
C0ZJ13_BREBN/21-178LAPEWYTGSYLRVYEY--LIPAIVNTY.........SKRPQELSSVLLALMRIITLDSQIVLQSYQEDNDY
B0ULQ7_METS4/3-159LEPRWYIGGYAFVLNA--LVQVLVERA........GLLGRGGLPARIAALNKAVMLDMDFAISVYQDVLLE
C6WYR1_METML/18-175LEPRWHLSAYSKYLSW--VLPEVMRLV.........DNDAERFLAYSTAITKIAMFDSELSISAYFHADHE
B9J942_AGRRK/14-180LDPRWHVAGHGVVLEH--ILAGIVEEMGGRAVLPGTKRRARELSELVKAAVRLVMVDVEIAVSLRFNELRL
C0ZKX8_BREBN/35-191LEPKWYLSAFQNMLVS--LIDLLQKNI..........ADKDEFVQAITAVTKILSIEQQIVLEEYENEHEK
A9CJK8_AGRFC/7-170LEPRWYIGGYALMLDG--IVKAVIESELKG...LFMEKKAKKVKDALSATIKAALLDMDYSISVYLDVLAT
C4KYX4_EXISA/28-185VPVVWFLATYSAFNTL--LIPKVVETY.........QHDPAVLSESLLALSHAMNLDAQIVTEQYVNARLD
B2W0B6_PYRTR/24-203VEYVHVGVTLSFIQDI--MTEAVLSHP.........RLKMERKIGLVKALSKVLWIQNDLFAKWYVKDGEE
E3EZY8_KETVY/10-171LEPRWYIGGYGLVLDR--IIRDIVTTRRT.....WTGKDRARLAADLSAVVRAALVDIDLSITCYIDKLDE
Q1AU74_RUBXD/22-196VSLRYMISFIYPITAT--VRPFLEEGG..........RPAEDVEKMHQAWFKAVVLHVTLWSQPYAREGSF
A8IPP6_AZOC5/62-225LEPRWYIAGYALLLSG--LVAAIETGFKAG...RFDRTAPERKARLIEAVITAALLDMDFAISVYLDAGIK
Q1GI20_RUEST/15-172ITPTLYVGSYAYYLQR--LSQSILENG.........KEDPHKLFGLVLSMMKIAHYDMALALETYVEAREK
B2AU65_PODAN/21-200IEYIHIGAGLAVIQDV--LTEAILSHP.........RLHIQRKIAIVKALGKVIWIQNDLFTKWYVHDGEE
Q0UTR0_PHANO/18-193VEYIHIGATLSFIQDV--LTEAILEHP.........RMSMQRKVGLVKALSKVIWIQNDLFAKWYVRDGEE
A2R286_ASPNC/23-202IEYMHMNTCLGYVKEL--AYETISGHP.........EMSYPFKFALIRALNKIMTIQNDLISRCYIREGQE
A9EVT1_SORC5/5-161VEPTWYLGAYRRYMHL--LLEAFSDDI..........GDPAEVVRAFTSVQKLVYFDVSLALDAYFSTTFD
B8N2G0_ASPFN/23-202IEYIHMNACLGYVKQL--LFETISLHP.........DMSVKFKFALIRSMSKVFCIQNDLISKCYINEGQE
C4JKA6_UNCRE/20-213VELMHCSALLGFVEDI--VLNAVMGAQ.........DVDLPTKTKIIRAFNKLLWIQNDLFLKQYTPEPWS
D2VCV6_NAEGR/13-197IDYIHINALFGYVSDV--LLGTIAMCP.........QLNEEQRAKTVQAFNKLLWIQNDLFAKYYVDDDSR
Q9YFF4_AERPE/20-195IPLRYLIAFIYPITAT--IKPFLAKKG..........GSPEDIEGMYNAWFKSVVLQVAIWSHPYTKENDW
F0SHW9_RUBBR/6-164LDHVYVNAAFSRVRLR--LNETLSQQG.........QLSLERRMELHSSLGKRLDLDLAIMSAAYQAEYQS
A8FBP1_BACP2/29-185LQPKWYMAAFQDLLLS--IMDLFAQHI..........QDFKEYQTAVKATTKILNLEQQLVLDTFQNEYSK
A8P1M8_COPC7/13-202VEYIQCAILLGYVEDI--LVNAVLTHP.........DLDDATKLVVMRAFNKLIWIQNDLFARHYISEEKA
A1CRU6_ASPCL/32-212IEYIHIGVMLGFIQDI--FTEALMSHP.........TLSLQRKVALVRAIGKIIWIQNDLFARYRVRDGEE
Q47S02_THEFY/23-197IPLRYVIAFIYPVTAT--LRPFLAKKG..........HSADQVEAMYQAWFKSVTMQIALWSQPYTRDGYW
A9WGB2_CHLAA/23-194IPLRYMIAFIYPITAT--IREFLARKG..........HSAAEVDRMHQAWFKSIVLQVTLWSYPYTREGD.
F0LY60_VIBFN/12-164IDFKVYSGAYCIVMSQ--LARVVYQSL.........APNIDNIHRYMSALNRAIFLDLGLATAVYYDT...
HEMAT_BACSU/31-185LLPKWYMGAFQELLLS--MIDIYEASI..........TNQQELLKAIKATTKILNLEQQLVLEAFQSEYN.
Q2KCI4_RHIEC/11-175LDPRWHVAGHGVMLEH--VLSGLAEEIAGRPLLPSARRRTREISDLMTAIIRIVMVDVEIAVSLRFNALR.
MCPE_RHIME/15-178LDPRWQIASHAIVLEH--LILGAIEDAWPKSILSLGKARRRELRDLVAALVRAAFVDTEIAVSLRFNALR.
Q65LP1_BACLD/29-182LLPKWYLGAFQDLLLS--MLKIFENAL...........SDEEYRRSVKAVTKILNIEQQIVLEAFEDEH..
Q7D1B0_AGRFC/50-211LDPRWQIASHAVVLEH--LLGGLVAEHAPRSILPGNRKKSRELADAVKNVVRLVMVDTEIAVSLRFNEL..
Q81JN0_BACAN/32-186LHRKWYTAAYQELFRS--IMKILKTKI..........TTIDDFSYSINVINKLFTLEQELVIAAYESKYE.
Q8TLY9_METAC/23-193IGYRYLVAFIYPITAT--MKPFLARKG..........HTPEEVEKMYQAWFKATTLQVALWSYPYVKYG..
Q9A5Y0_CAUCR/45-206IAPQWYIGGYAVVVEE--VMRALVAKRAKG..LFNSAKSDAELADGLSALIKAAFLDMDLSVSTYIDVL..
Q9AB06_CAUCR/8-170LEPRWYIGGYAVVGDH--LVRAVIDSMWPR..GLLAKGGSDRAGEAVAALMKAIFLDMDFAISIYLETLE.
U5L913_9BACI/33-184LQPKWYMCAFQDLYLS--LCSMIIDTI..........SEKGPCTGAMLAVSKIISLEQQIVLEAYEQE...
U5LFP3_9BACI/32-184VQIHWYMSIYQLLMKN--ILEIVLQEL.........ELSSKDQSRVTFAMAKIFNLEIQLCISIMQQTME.
V6F1E9_9PROT/46-194LGASWYQAMAANAASQ--ALAMLRDQR..............HFDTLAGVLTRASQLDVSLVTHDYFEAAK.

PF00042

Q19601_CAEEL/105-215G.RGFEPGYWETFAEC--MT---------------------------------------------------
GLB1B_ANATR/17-122....ISADEFGEIVGP--LR---------------------------------------------------
HBP1_CASGL/7-116....ITDPHFEVMKGA--LL---------------------------------------------------
GLB1_PARCH/17-123....VGPAHYDLFAKV--LM---------------------------------------------------
MYG_GALGA/3-108...KIPPHYFTKITTI--AV---------------------------------------------------
HBAT_HORSE/7-107...RVDPASFQLLGHC--LL---------------------------------------------------
HBA1_PLEWA/7-107...MVDPANFPKLAHN--IL---------------------------------------------------
HBB0_MOUSE/8-112...HADPENFKLLGNM--LV---------------------------------------------------
HBA1_XENBO/7-107...RVDPGNFPLLAHN--IL---------------------------------------------------
GLB_PAREP/8-117....VTKDEFMSGEPI--FT---------------------------------------------------
HBB1_CYGMA/8-112...HVDPDNFKLLSDC--IT---------------------------------------------------
MYG_CYPCA/3-108...KIALNNFRLITEV--LV---------------------------------------------------
HBB2_XENLA/8-112...FVDPENFKRFGGV--LV---------------------------------------------------
HBAZ_CAPHI/7-107...RVDPVNFKFLSHC--LL---------------------------------------------------
HBF1_URECA/7-113....ITPKHFGQLLKL--VG---------------------------------------------------
HBB1_XENBO/7-111...HVDPCNFKRFGGC--LS---------------------------------------------------
LGB1_LUPLU/8-116....VVDAHFPVVKEA--IL---------------------------------------------------
MYG_HETPO/3-108...KIPPKNFVLITNI--AV---------------------------------------------------
HBAD_ERYML/6-106...RVDPVNFQLLSKC--IH---------------------------------------------------
HMP_ECOLI/6-103....IKPEQYNIVGEH--LL---------------------------------------------------
Q18311_CAEEL/32-140S.RGFNSHFWDIFLVC--MA---------------------------------------------------
GLB73_CHITH/23-129....VSAAQFGEFRTA--LV---------------------------------------------------
HBB_LITCT/1-105...HVDPANFYRLGNV--LI---------------------------------------------------
HBBN_AMMLE/2-106...HVBPZBFRLLGBV--LV---------------------------------------------------
HBAM_LITCT/6-102...KLSSDHMKLLSAA--II---------------------------------------------------
HBA3_PLEWA/7-107...RVDPGNFQLLSHC--IQ---------------------------------------------------
HBAD_PASMO/6-106...RVDPVNFKFLSQC--LQ---------------------------------------------------
HBB_HETPO/7-106...HVDVESFKLLAKC--FV---------------------------------------------------
A2VF80_MYCTX/42-136....VLPTQYDTLRRA--LY---------------------------------------------------
HBA_LEPPA/7-108...MVDPCNFQYLIEA--IM---------------------------------------------------
GLB8_CHITH/9-115....IEKAQFEEFRAS--LV---------------------------------------------------
GLB2_LUMTE/8-114....IPDNYFDAFKTA--IL---------------------------------------------------
Q20638_CAEEL/74-184....FKHEYWDIFQDA--ME---------------------------------------------------
HBB_ALLMI/7-111...HVDPENFKLLGDI--II---------------------------------------------------
HBA_CATCL/6-107...RVDPSNFKILANC--IT---------------------------------------------------
HBA_SQUAC/6-107...CVDPHNFPLLTQC--IL---------------------------------------------------
GLB2_TYLHE/9-115....ITGHMFNLMRTG--LA---------------------------------------------------
GLB1_GLYDI/6-111N.KHIKAQYFEPLGAS--LL---------------------------------------------------
GLB10_CHITH/11-117....ITKAQFGEFRET--MT---------------------------------------------------
HBB_LEPPA/7-111...HVDPHNFRVLGQC--LR---------------------------------------------------
GLB1_TYLHE/7-110....TIP..FKAFGQT--MF---------------------------------------------------
HBA1_TORMA/6-107...LVDPHNFKLFSDC--IA---------------------------------------------------
GLB6_CHITH/22-128....VSKDQFTEFRTA--LF---------------------------------------------------
GLB_BUSCA/6-116....VSAADFKLLEAV--FK---------------------------------------------------
GLBH_CAEEL/10-119....MDPALWMAFFTV--FT---------------------------------------------------
GLB2_NIPBR/16-114....LDPALWKAFWSV--WV---------------------------------------------------
GLBH_TRICO/30-132....LDPKLWKEFWSI--YQ---------------------------------------------------
GLB_PSEDC/21-134V..KIPNDVWNHFWEH--FI---------------------------------------------------
GLB_CERRH/6-116....IGASRFGEMRQV--FP---------------------------------------------------
GLB2_CHITH/22-128....IPKAQFNEFRAS--LV---------------------------------------------------
GLB_TUBTU/6-112....IKADYYGVFVNE--LL---------------------------------------------------
GLB3_LAMSP/7-113....VSAAQYDVVEHS--VM---------------------------------------------------
GLB_ASCSU/21-134V..HMPPEVWTDFWKL--FE---------------------------------------------------
GLB1_CALSO/5-105....ITN..MELFAFA--LA---------------------------------------------------
GLB2_CALSO/5-108...VVDPALFAIALNE--LV---------------------------------------------------
MYG_ALLMI/7-113...KIPVKYLEFISEI--IV---------------------------------------------------
Q21978_CAEEL/165-283ITPHMTEENVRVFCAQ--IV---------------------------------------------------
HBB_SQUAC/7-107...HVDPENFKLLANC--LE---------------------------------------------------
GLB3_TYLHE/8-117...GVKAVYFDEMEKA--LL---------------------------------------------------
GLBT_CHITH/13-116....ITKDQFDQFRQA--LT---------------------------------------------------
GLB3_CHITH/20-120....VTHDQLNNFRAG--FV---------------------------------------------------
GLB1_CHITH/21-126.....SPAQLDNFRKS--LV---------------------------------------------------
LGB1_MEDSA/7-112....VVDPHFVVVKEA--LL---------------------------------------------------
GLBC_NIPBR/21-135VDPKLWKIFFDDVWVP--FL---------------------------------------------------
HBA1_IGUIG/6-106...RVDPVNFGLLGHC--IL---------------------------------------------------
HBA1_BOSMU/6-106...RVDPVNFKLLSHS--LL---------------------------------------------------
GLB_APLJU/6-113....VGSAQFQNVRSM--FP---------------------------------------------------
HBA_HETPO/13-114...KVDPANFQYLSYC--LE---------------------------------------------------
BAHG_VITST/6-103....VAAAHYPIVGQE--LL---------------------------------------------------
GLB4_TYLHE/8-117...GFKTVYFKEFGKA--LN---------------------------------------------------
GLB4_LUMTE/11-120...GVTKEYFRGIGEA--FA---------------------------------------------------
HBP2_CASGL/13-122....VADEHFEVTKFA--LL---------------------------------------------------
GLBP1_GLYDI/7-115...DIRAEFFPALGMC--LL---------------------------------------------------

PF00502

K9XWT9_STAC7/32-185VPLEAMVLGLEKLKYY..SLQQFEEQ....EK........................IQLAPYFEHLINKM-
Q7NLD6_GLOVI/7-176VPIPSAIRAVSIMKAS..AVAFINNT....ASK.......RKIETP..QGDCAALASEAGSYFDMAASAL-
K9U0M5_9CYAN/6-160TPIEAVVESVRAMKNV..TSTMMSGE....DA........................GEVGAYFDYLIGAM-
B2J4C0_NOSP7/8-172TPGASVAVGIQKLKAA..SLAIVNDT....NNIT..............RGDCSALSAEIASYFDRAASAV-
PHEB_NOSS1/7-171TPGDAVASGIQKMKDA..AIAIANDS....KGIT..............KGDCSQLIAELASYFDRAASAV-
K9U368_9CYAN/7-161LSPSWYVEALKHIKSN..HG..LSGQ....AA........................NEANTYLDYAINAL-
E0UA88_CYAP2/6-160TDIGAVAQSVREMKEV..ALGLIASQ....DA........................GEAASYFDYVIGAL-
Q31RG0_SYNE7/6-160TPIEAVAEGVRELKSA..ATALLTGE....DA........................DEAGAYFDYVIGAL-
A5GVQ7_SYNR3/7-171TPGASVAAAINLMKET..AVNLVNDR....NGIT..............QGDCTALASEIGTYFDRAAAAV-
K9UI71_9CHRO/7-164VPIAPTVRGVQIMKDL..VKDLLATS.......................GVADT..SCVDAPFDHMTREI-
K9PBJ3_9CYAN/6-157IPLANLVIAIRCLKEV..SLDLFNLE....DA........................AELAPYFDYLIQEL-
B7JYL9_CYAP8/7-163VPIGPTVRGIQIMKDM..VKQMVADA.......................GVDNT..SFIDAPFDHLTRE.-
Q7M7F7_GLOVI/7-161LSPSWYIEALKHIKGK..VGSQLSGQ....PL........................TEANAYIDYCINAL-
K9SEX3_9CYAN/6-160VPMGGMADSIRCLKNA..ALDLMSKD....DA........................ETAAPYFDYVIQAM-
K9U364_9CYAN/7-161LSPSWYIAALEFVRDN..HG..LSGD....AA........................GEANTYLNYAINAL-
Q7V589_PROMM/7-180VPIKNAVRAVEIMKAA..TVAIITNT....NS...GPSAFQGISGK..GSDCQGIAAEAASYFDRVISSL-
K9XSR9_STAC7/6-160VPVPGMVDAIRCLKDA..ALALLTNE....DA........................KEAAPYFDYIIQAM-
Q2JPU0_SYNJB/6-160VPIAGMIDAIVFLKEA..ALSLLEPA....AA........................AEAAPYFDYIINAM-
K9SZ05_9SYNE/7-161LSPSWYVEALKSIKAS..HG..LTGQ....AA........................NEANTYIDYAINAL-
K9SDD2_9CYAN/9-154AQRSCNV.TYAVMQEV..VKQSLTEQ....EA........................KLVCPLLELTRNAL-
Q7TTT3_SYNPX/31-183VPTEGLNIALMQLNVL..AAQEFERGA...DQ........................ELINACFQHLIEQL-
E0U6T1_CYAP2/7-183VPLQSAARAVGIMKAI..AVAHITNT....NKMYEGTSKFRKMETP..QGDCSALAAEAASYFDRVIAAL-
K9UYY7_9CYAN/6-160TPIEAVAESVAAMKNI..TTSMLSGE....DV........................SEVGIYFDYLINAL-
B7K3F0_CYAP8/6-160VPVPGMVEAIKCLKDA..ALGLLSNE....DA........................REAAPYFDYIIQVM-
K9YHW9_CYASC/8-165VPIAPTVRGIQIMKEM..IKEMAFAS.......................GVEDT..SFVDEPFDHLTREL-
K9T4V8_9CYAN/7-171VPGASVAAGVQKMKEA..AIAIANDR....NNIT..............PGDCSALMAEISSYFDQAAAAV-
A5GTB5_SYNR3/7-160VPMPGMVEAMRCLKQA..SIALLSPD....DA........................QFISPFFDYLIQGM-
B2J478_NOSP7/7-163LPTAPYVTALTYTRDRACSPRDLSPQ....AL........................GEFRALLDYVINSL-
PHEB1_SYNPW/7-183VPAQSAARAVAIMKAS..ATAHIGET....NTQANGGAKFRKMETT..QGDCSALVAEAASYFDRVISAI-
A5GVP3_SYNR3/7-164IDAGTYVAGFSNMRNDGCAPRDMSPQ....AL........................TAYNTLLDYVINSL-
B7K6K4_CYAP8/7-163LPTAPYVEALSFARNRGCAPRDMSQQ....AL........................VEYNALLDYAINSL-
APCF_SYNY3/7-164VPIGPTVRGIQIMKEM..IEAMAEDS.......................SLNST..DFIASPFDHMTREL-
APCF_SYNP2/7-164VPIAPTVRGIQFLKDA..IKEMAAAA.......................GIANT..AFIDEPFDHMTREL-
B2J479_NOSP7/8-184VPTGSSVRAFQILKAI..SVAHITNT....NTEANAGKKFRKIDTP..QGDCSALAAEAASYFDRVISAL-
K9VCF0_9CYAN/35-186VPVSAMLCGLEQLKKV..SLQHFNSE....DR........................DLLSLYFDHLISGL-
K9PSE2_9CYAN/6-160TPIEAVAESIRAMKNI..TTSMMSAE....DA........................SEVGGYFDYLIAGL-
K9TTH5_9CYAN/6-160VPVPGMVESIRCLKNA..SLSLLSAE....EA........................AEAAPYFDYIIQAM-
Q7U7B1_SYNPX/9-166VPTGPTVRSIILLGEV..IVERLQAA.......................GVESARLAVVAAPFDHMARGL-
K9TY40_9CYAN/7-164IPLGPTARSIQLMKNI..VKEKLVTA.......................GMTNI..TFVDEPFDYVVREI-
K9P5D8_CYAGP/8-172VPGASVAEGVRLIKGA..AIELVLDR....NGIT..............QGDCSALASEIGTYFDRAAAAV-
K9U651_9CYAN/7-164VPIGPTVRGIQMMKDI..VKAQAVAA.......................GVENT..AFIDEPFDHMTREL-
K9XTU9_STAC7/7-164VPIGSTVIGIQIMNNL..VKQMATNA.......................GISDT..NFIDEPFEHLTREL-
U5QS61_9CYAN/34-186VPLPAMLLGLESLKKA..SLQRFAPE....MQ........................ATVAPCFEALIVQL-
B0C339_ACAM1/7-156VSLAATIKAIRAMQEV..TSDVVGSA....AG........................HEISPYFEHLCAGL-
K9SW00_9SYNE/6-160VPVNGMADSVRCLKTA..SLELLSEE....DA........................DLAEPYFDYVIQAM-
K9PBM8_CYAGP/6-160TPLEAMAEAVREMKTA..ATGLLTGS....DA........................EEAGFYFDYVVGAL-
K9Y8I8_HALP7/7-164VPIAPTVRGIEIMKEM..VKKMAEDA.......................GMLDT..SFIDKPFDHMNREL-
Q10UW8_TRIEI/7-161LSPSWYIEALKYIKAN..HG..ITGQ....GA........................TEANNYIDYAINAL-
Q7NL79_GLOVI/7-160VPIAATVGGIQAMKEV..VGGLVGPD....AA........................KEASIYFDYLSSGL-
K9P5A2_CYAGP/7-160VPLPGMVEAMRTLKEA..ALVLLGGE....EA........................ALAGPYFDYLIQGL-
A5GL99_SYNPW/7-160VPMPGMVDAMRAMREA..SLVLLSDD....QQ........................RLAGPYFDFLIQGM-
K9SQ75_9CYAN/7-161LSPSWYIEALKHVKAN..HG..LSGD....AA........................TDTNAYIDYAINAL-
Q10ZG9_TRIEI/37-188VPLSAMVCGLEAIKTA..SLKNFSSE....QQ........................AELVPYFDHLVTNL-
PHCB_SYNP2/7-171VPGASVAAGVRAMGKA..AVAIVMDP....AGVT..............SGDCSSLQQEIELYFETAAKAV-
Q10XZ6_TRIEI/7-164VPIGPTLIGISILKEL..IKSKVEAA.......................GIQTG..AFLAEPFDHLINEL-
U5QNF8_9CYAN/7-160VPIPAMVESVRLLKKE..ALDLLSPT....EA........................EIASPYFDYVINAM-
K9PDX9_9CYAN/6-157IPLRNIVEAMRCVKEE..AISLMSEE....DA........................VEVGPYFDYIIRAL-
Q117G1_TRIEI/7-161ISTDTYVTGLAKIRDRLCVPRDMSGQ....AA........................TELTAYLDYVINAM-
K9P457_CYAGP/8-162LSPSWYVEALNYIKAN..HG..ISGD....PG........................VIANNYIDYAINAL-
B7K6K8_CYAP8/35-188VPLDAMICGLKNLKTY..SLQQFNPE....EQ........................QELAPYFDHLISHL-
K9TWK3_9CYAN/6-157IPLRNWVECIRCLKEV..TLDLLSRE....DA........................AEVTPYFDCLIQGM-
G3XCS9_PROMA/7-154LPTAAYIEAFTYIRDNLDIPNDMGQQ....AG........................AEFKNLLDYLINAL-
K9XAE9_9CHRO/6-160TPIEAVAESVRAMKNV..ATSMMSSE....DA........................SEAGSYFDYLVGAM-
K9TI03_9CYAN/11-165VPMAGMAESIVCLKEA..SLALLSQE....DA........................TAAAPYFDYIVQAM-
Q7V590_PROMM/7-154IPTSAYIEAFSYIRERVCVPRDMDQQ....AA........................NEFKDLLNYLINAL-
E0U6S4_CYAP2/34-186VPLAAMISGLESLKTS..SLQQFNAP....EQ........................QALSPYFDHLIESL-
K9SFN5_9CYAN/6-164VSVDQLRNAIGTIRDV..VVDLLNHHVPQVNE.............KTNQGDHPTLVAEIIDYFELIID..-
K9RE36_9CYAN/7-164VPISPTVAGIQIMKDM..VKEQVASA.......................GISDT..SFVDEPFDYMTREL-
Q8DIN1_THEEB/16-170VPMTGMAEAMRCLKDA..SLALLSTE....DA........................EVAAPYFDYIIQEM-
Q2JLK1_SYNJB/7-160VPIGATIQAIQAMKEV..TAALVGAE....AG........................KEMGVYFDYICSGL-
Q7NLD7_GLOVI/7-163LPTAAYVAAFQYTRDRACAPRDMGPQ....AL........................TEFRSYLDYVINAL-
PHEB2_SYNPX/7-177VPTGSASRAVAIMKAA..AGALITNT....NSQP......KKMPVT..TGDCSNIAGEAASYFDMVISAI-
K8GH86_9CYAN/6-155IPLENLVECMRCLKES..ALDLLSLD....DA........................MVVAPYFDYIIC..-
B7K2Z2_CYAP8/11-156HSATWYAEALKNIKED....HGLQNE....AN........................KELHTYIDYLISAL-
Q117E9_TRIEI/6-178VPTTSASRAVGIMKAA..AVAFINNT....ASQ.......RKMSVT..KGDCSSLASECAGYFDTVIAAI-
K9WFS1_9CYAN/7-161LSPSWYVEALKYIKAN..HG..ITGD....AA........................TEANSYIDYAINAL-
K9ZE77_ANACC/7-171TPGATVASGIGKMKDA..AIAIANNN....DGIT..............RGDCSNLMSEVASYFDRAAAAV-
A5GVM9_SYNR3/34-181VPVDGLLLALARLQEL..AAQSYSESAPSLDA........................ELLDEAF.......-
K9UJM8_9CHRO/7-161LSPSWYVEALKYVKAN..HG..LSGD....SA........................SEANSYIDYAINAL-
PHAC_SYNP2/6-160VPVPGMVDAIRCLKDA..ALGVLDSE....EA........................RIAAPYFDFITQAM-
PHEB_PROMP/7-174VPLKNAIRVFELMRDA..TISDLKST....VNSMKGE...........KEFLSDLISNTEFQFERIINLL-
K9T481_9CYAN/7-160VPISATVRALQAMKEV..TADIVGPD....AG........................KEMGVYFDHICSGL-
PHAC_SYNY3/6-160VPVPGMVDAVTVLKDA..ALGLLSAE....DA........................NETAPYFDYIIQFM-
PHEA1_SYNPW/7-163LPTGPYVEALTYTRDRACAPRDMSPQ....AL........................NEFKSYLDYVINAL-
K9XWE3_STAC7/7-183VPLQSTARAVAIMKAS..SVAHINNT....NTEANGGKRFRKMEMK..DGDCSAISSEAASYFDRVASAL-
K9XKS9_9CHRO/7-160VPIQPTIQAIQAMKEV..TTRLVGAE....AG........................GEIGMYFDHICNGL-
K9SIK8_9CYAN/7-160VPIGSVAQSIQIMKAV..VVQLVGT...........................DA..SWLTGPFDYMANEL-
Q7NJA2_GLOVI/7-160VPIDATVKGINALREV..VASVVGPE....AA........................GEASKYFDHLAKGL-
K9P3V2_CYAGP/7-164VPTGPTVRSIALLGEV..IAEMLADA.......................GMADT..GLVRAPFEHLCRGL-
PHEB_PROMA/7-181VPLSNAIRAIEIMKIA..TVAIMTET....NS...GRKMFEGINSGS.GAECKDIASEAASYFDRVIDAL-
K8GG80_9CYAN/6-156IPIANWAEAMRCIKEE..VILLLGEA....DA........................ATVTPYFDHIIDT.-
B0JFY1_MICAN/7-164VPIGPTVRGIQIMSEM..IQTMATEA.......................GIADT..SLIAEPFDHLTREL-
Q10YG0_TRIEI/6-160TPIEAVAEGVRCMKTV..TCSLLDYE....AG........................SEAATYFDYVIGAM-
K9Q0C3_9CYAN/7-161LSPSWYIEALTYIKAN..HG..LSGQ....SA........................TETNNYIDYAINAL-
B0JXA2_MICAN/8-162LSPSWYIEALKYIKTN..HG..LSGD....AA........................VEANSYIDYVINAL-
K9T2W8_9CYAN/6-157IPIPNIVVAMQCLKEE..AVSMMSEE....DA........................AEVAPYFDYVIQAL-
Q117G0_TRIEI/7-178VPAGNAARAVAIMKAA..AVAFVTNT....ASQ.......RKMTVTEQPGSCDSLAAEVGGYFDAVVAAI-
B8HS99_CYAP4/7-164VPIGSTVQGIQIMKAI..VQERVAAA.......................GIATG..DFLNQPFDYMSRQL-
B2J4C1_NOSP7/8-162LSPSWYIEALKYIKAN..HG..LSGD....PA........................VEANSYIDYVINTL-
K9SBH1_9CYAN/7-161LSPSWYVEALRHIRAN..HG..VTGQ....AA........................VEANAYLDYAINAL-
K9PZN7_9CYAN/7-163VPIGPTVRGIQFIKEA..IKSAAAEA.......................GIADT..SFIDEPFEHMIRE.-
Q2JJL1_SYNJB/7-162VPIAPTVIGIQNMKTR..TLELLGSG.........................EDY..SFVAEPFDYLSAKL-
A5GTI9_SYNR3/7-164VPTGPTARGILLLSEV..VQEMLSAE.......................GVQSA..DVVRAPFEHMARAL-
K9TVG8_9CYAN/7-160VPIGATIRSVQAMKEV..VTSLVGAD....AG........................REMGVYFDHIAAGL-
A5GVQ8_SYNR3/7-161LSPSWYVEALNHIKAN..HG..LSGD....AA........................TEANSYIDYAINAL-
K9R5H1_9CYAN/6-160VPVPGMVEAIKGLKEA..SINLLSAE....DA........................QQAAPYFDLIIQAM-
K8GCZ2_9CYAN/7-164IPLGVTARSVQLMKER..THQKLIEA.......................QLGNP..AFVDEPFDYIIRAL-
Q46H72_PROMT/7-154LPTAAYIEAFIFIRDEIKINDVMGQQ....AE........................TEFKGLLDYLINAL-
K8GTM9_9CYAN/7-164VPIGPTVRGIQIMKDI..VKAQLEAS.......................GIASG..EVVDQPFDYMTREL-
Q7M7C7_GLOVI/7-171TPTRSVARAVQLMKET..AIGYVNSP....SGVT..............RGDCSALVNEAATYFDKAAASI-
K9Q339_9CYAN/12-160IPISRVLEALQSMKRV..LIELIDED....NL........................EIVTDCLDYLINGL-
PHCA_SYNE7/8-162LAPSWYVEALKYIKAN..HG..LSGD....SR........................DEANSYIDYLINAL-
K9PVY8_9CYAN/33-185VPLPAMLCGIQGLKTV..SLSYVEKD....VD........................IKFAQSFDHLLTQL-
K9WJQ0_9CYAN/7-183VPTTSTVRAVQIMKAQ..AAAHIKDT....PSEEFAGSKLRKMGAPVVEDRCASLVAEASSYFDRVISAL-
Q2JMW3_SYNJB/7-161LSPSWYIVALQYMKSR..ALGMLSGQ....AA........................NEAAIYFDYAINAL-
K9T540_9CYAN/6-157IPIFNWVEALKCLKEE..AIALLGEE....DA........................AEVTPYFDHIIQTL-
Q31Q35_SYNE7/35-183VPIAAMQQAIETLLGV..ALKRFPPE....VQ........................AQLQPCFDTLQT..-
B8HKY2_CYAP4/8-172VPGASVAAGIQKLKEA..SIALANDP....NGIT..............RGDCSTILAEVATYFDRAAAAV-
B2J9I8_NOSP7/36-187VPLDAMLLGLKSIKAA..SLKRCPAN....QQ........................EILNPYFDHLITQL-
K9UJL4_9CHRO/35-186VPLDAMVLGLQELKTA..SLTRVEPE....LK........................PTLAPYFDRLISKL-
K9XKJ2_9CHRO/7-171VPGGSVAAGVQKMKDA..AIKIANDP....NGIT..............QGDCSQLMSEVASYFDRAASAV-
Q8DHC5_THEEB/7-164VPIGPTVRGIQIMKEI..VRDRVAAA.......................GIEDT..GIVEQPFDYMCRQL-
E8R540_ISOPI/10-154FPPGFVRESYAHVWDG..VKQAVSAE....AA........................ALIEPHMRKAIDIL-
Q2JI97_SYNJB/7-171TPGSSVANGIQKMKKA..AVAVVNDP....NGIT..............RGDCSALIAEIESYFDRAAAAV-
Q2JI98_SYNJB/8-159LSPSWFIEALRYIKAN..HG..LTGQ....AA........................TEANTYIDYAINAL-
K9WKR7_9CYAN/37-189VPLDAMVVGLEGIKAA..SLKQVAPE....QQ........................ANLVPYFDHLIEQL-
Q31RP7_SYNE7/6-160VPLPGMAEAIRTLKEA..SLALLSSA....DA........................TVAAPYFDFLIQGM-
D4ZTI6_ARTPN/7-164VPIGPTVVGIGILKDL..ATEKVQAA.......................GIEVG..AYLEQPFDHLISEL-
K9XIF5_9CHRO/6-157VPVSNIGNCMRCLKEV..ATNMMSSE....EA........................AIAKPYFDYLIRAM-
K9SXI2_9SYNE/7-160VPIGPTVQGIQIIKDA..VIELVGV...........................NA..DWLTDPFDYISRQL-
K9UCA0_9CHRO/6-160VPVAGMADSIAALKEA..ALSFLTQD....DA........................AAAAPYFDYIIQEM-
K9SCA6_9CYAN/6-160VPVTGMADAIRSLKKA..ALGLLTDE....DA........................AEASAYFDFLIQGM-
PHCA_SYNP2/7-161LSPSWYVEALKHIKAN..HG..LTGD....AA........................TETNNYIDYAINAL-
Q2JMW4_SYNJB/7-171VPTTSVANGIAAMKKE..ALAKIMDP....KGIT..............PGDCSALQSEVASYFDKAAAAI-
K8GE61_9CYAN/7-160VPVGATIRAVQAMKDV..VTDLLGAE....AG........................KEMGVYFDYIAAGL-
K9T5F0_9CYAN/6-157IPLRNVVECMRCLKEV..TLEMLSLE....DA........................AEVAPYFDYLIQGM-
Q7NL72_GLOVI/36-187VPLGAMLLGIHCLRGA..SLQHFSVA....EQ........................QALGPYFDHLAER.-
K9Z238_CYAAP/6-160VPLPGMVESIRCLKTA..ALALLSKE....EA........................EETAPYFDYMIQYM-
K9XNJ3_STAC7/6-160TPIDSVAESVRAMKKI..ATSILSGE....DA........................SEVGTYFDYLIAAL-
K9PC78_9CYAN/6-157IPIFNWVEAVRCIKEA..AREFLGEE....DA........................AIAIPYFDHIIQTL-
K9YD01_HALP7/6-160VPVPGMADAIRCLKDA..SLGLLSAE....EA........................QEAAPYFDYIIQAM-
K9TVZ1_9CYAN/6-157IPLENVRQYMLCVKAE..VSAMLTPE....DA........................AEVIPYFDLILQVI-
K9SQM2_9CYAN/38-189VPLEAMVEGLGCLKNA..SLQRLTPA....HA........................DSLSPYFDRLIAEL-
K9VPV9_9CYAN/6-160VPVPGMVEAIRCLKEA..SLALLNQD....DA........................KEAAPYFDYIAQAM-
K9T6U8_9CYAN/35-186VPLEAMVLGLENLKCF..SLKQFQGE....EL........................ENIAPYFDHLIEKM-
Q7U6V7_SYNPX/7-160VPMPGMVEAMKTMKDA..SLALLSDA....QV........................MLAAPYFDYLIQGM-
PHCB_SYNE7/8-172VPGASVAEGVRKMKDA..AVAIVSDR....NGIT..............QGDCSAIISELGSYFDKAAAAV-
O50209_SYNE7/7-164VPSGPTVRGIAILRDR..VRQLVEQA.......................GISNA..AFVEVPFDHLGRNL-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window