Sequence alignment for CL0090

PF00502

K9XWT9_STAC7/32-185.IFQQADDQGRYLSDQDIKQI...QTLT---PQLTTS-TTQAQLLRDRVEEIVSQARAEVLAAYPQITEPGGD-------
Q7NLD6_GLOVI/7-176KAVVSADQKTGYIGGAELAAL...KTYI---ANGNKR-LDAVNAITSNASCIVSDAVSGMICENPGLISAGGN-------
K9U0M5_9CYAN/6-160KLIVNADAETRYPTPGELEQI...KILA---QSGDRR-LRLAQALTANREGIIKQAGSQLFQRRPDIVSPGGN-------
B2J4C0_NOSP7/8-172KVVSQADTRGEYLSDAQLDAL...SELV---KDGNKR-ADAVNRITSNASALVAAAARDLWAEQPQLITPGGN-------
PHEB_NOSS1/7-171KVVEQADRKGNYLSGDEINAL...SALV---ADSNKR-LDIVNRLTSNASSIVANAYRALVAERPQIFNAGGA-------
K9U368_9CYAN/7-161EAIGAADTQGRFLSNTELQAI...NGRF---DRASAS-MEAARALTSKAQQLVDGAAQAVYSKFPYTTQMQGP-------
E0UA88_CYAP2/6-160KAIVNADAEARYLGPGELERI...KSFI---GSGAAR-LRIAETLTGARETIIKQAGDRLFQKRPDIVSPGGN-------
Q31RG0_SYNE7/6-160KSIVNADAEARYLSPGELERI...KTFV---VGGDRR-LRIAQTIAESRERIVKQAGNQLFQKRPDVVSPGGN-------
A5GVQ7_SYNR3/7-171KVVAQADARGQFIGTGEIDAL...AAMV---ADSNKR-LDAVNRITSNASSIVANAARDLFAQQPALIAPGGN-------
K9UI71_9CHRO/7-164NLIKTYDITGRYLDRNAIDSL...KSYF---ETGTAR-IAAAGVINANAALIVKKAASQLFEELPELIRAGGN-------
K9PBJ3_9CYAN/6-157KSIASADREARYLSPGELNAI...RDFY---EGGFYR-MRIAITLTENEQKIVEKASLKFWERCHDTPSNSGN-------
B7JYL9_CYAP8/7-163NLIKNYDLTGRYLDRDAMDRL...KDYF---SSGMAR-ITAAAVINANSPEIVRQAGLQLFEEVPELIRPGGN-------
Q7M7F7_GLOVI/7-161EVIASADSQGRFLNNTELQAA...NGRF---QRATAS-MEAARALTSNADSLVKGAVQEVYNKFPYLTQPGQM-------
K9SEX3_9CYAN/6-160QVLVQADDELRYPTIDELESI...SSFM---QTGEQR-LRIASILAESEDKIVKKSSAELFKLHPEYISPGGN-------
K9U364_9CYAN/7-161EAIAAADARGSYVSNTEMQAI...FGRF---NRAQAG-IEAAKAFANNGKKWAEAAANHVYQKFPYTTQMQGS-------
Q7V589_PROMM/7-180RAVVGADAKGACLGSADLASL...RQHV---ADANIR-IDATNAIAQHISCIAADAVSGMVCENTGMTQPGGN-------
K9XSR9_STAC7/6-160QVILKADDELRYPSSGELEGI...KKFL---TTGEQR-VRIAETLAESEKKIVDKASKELFRIHPEYRSPGGN-------
Q2JPU0_SYNJB/6-160QIIETADDQLRYLSVSELEAI...RNYM---TTGERR-LQIAQVLAENKKRIIDQAQKQLFAKRPEYVQPGGN-------
K9SZ05_9SYNE/7-161EAIATADSQGRFLSNSELQAV...NGRF---DRAKAS-MEAAKALTANAQSLIDGATQAVYSKFPYTTSTPGN-------
K9SDD2_9CYAN/9-154....TVDAEGRYATDDELTFL...KGYI---HSYELR-INTYNKLRELENAIVEQSYEKVRSQDPNVFNSSGT-------
Q7TTT3_SYNPX/31-183QIIGAADQERRQLSQEELLSL......C---AASGQD-ASLPRRLQNHADDLVNQARCHLLEQQPQLVQPGGA-------
E0U6T1_CYAP2/7-183RAVVTADSKTAPIGGAELAEL...KKFI---AEGNKR-LDAVNAIASNASCAVSDAVAGMICENSGLIQAGGN-------
K9UYY7_9CYAN/6-160KMIANADAEVRYLQPGEIDQI...RVFM---KSSERR-LHLVQVLNLSRDRIIKQAGKDLFQKRPSLVSPGGN-------
B7K3F0_CYAP8/6-160QVILKADDELRYPSSGELEGI...QNFV---KSGEQR-IRIAETLSENDKKIVDQAQKRLFQKRPDFRSPGGN-------
K9YHW9_CYASC/8-165SLIKNYDVSGRYLDRDAIDSL...KSYF---QSGTTR-IQVANIINANSPELVLNAGKQLFEEVPELIRAGGN-------
K9T4V8_9CYAN/7-171RVVSQADARGDFVSTAQIDAL...NKMV---ADGNKR-LDAVNRITSNASAIVSNAARALFAEQPQLIAPGGN-------
A5GTB5_SYNR3/7-160.LILQADDELRYPTSGELRSM...AAFL---NDGDRR-VRVARVLTENERKIVDESAKQLFTRKPDYVAPGGN-------
B2J478_NOSP7/7-163TVIGSADAAGRFPTTSDLESV...QGSI---QRASAR-LEAAEKLAAGIDAVAKEAYDAAFKKYPYLTQEGEA-------
PHEB1_SYNPW/7-183RSVVSADAKTAAVGAGDIAAL...RQYV---AEGNKR-LDAVNAITSNASCIVSDAVTGMICENTGLIQAGGN-------
A5GVP3_SYNR3/7-164TVIGAADSASRFPSASDMESV...QGSI---QRAAAR-LEAAEKLAGNYDAIAQRAVDAVYSQYPNGATGRQP-------
B7K6K4_CYAP8/7-163TVIAAADAAGRFPSTSDLESV...QGSI---QRAAAR-LEAAEKLGNNLDAVAKEAYDACIKKYPYLNNAGEA-------
APCF_SYNY3/7-164TLIKNYDLTGRYLDRNAMDEL...KAYF---ESGSAR-IAAAAMINANSATIVKRAAAQLFEEIPELIRPSGN-------
APCF_SYNP2/7-164SLIRNYDTTGRYFDRDAIESL...KDYF---ASGNDR-ITVAAMINSQSAEIVKAAANSLFEAVPELLLAGGN-------
B2J479_NOSP7/8-184RAVIAADAKTAPIGGADLAAL...KSFI---AEGNKR-LDAVNAIASNASCAVSDAIAGIACENTGLLQAGGN-------
K9VCF0_9CYAN/35-186...QDADNQSRYLTDEDLERI...KNLH---PHLSLM-LEKARLLREQAPNIVADARKKVLADFPNITEPGND-------
K9PSE2_9CYAN/6-160KSILNADTEARYLTPGELEPI...KSFV---KNGERR-LRLVQALTENRERIVKQSGTQLFQKRPDVVSPGGN-------
K9TTH5_9CYAN/6-160QVILKADDELRYPSAGELENI...KNFL---QTGIQR-MRIAATLAENEKKIVQEASKKLWQKRPDFIAPGGN-------
Q7U7B1_SYNPX/9-166..IGRYDQLGRYLDRSAIDSI...EKYL---DESSLR-IQAVELINREAAEIVREASQRLFRDEPELLLPGGN-------
K9TY40_9CYAN/7-164SVAKNCDLTGSSLNREVVETL...KEFL---ADGEKR-VQVAGVIGSNAAEIVKTAVSLLFQEYPELVSPGGN-------
K9P5D8_CYAGP/8-172KLIAQADVRGEFLNSGQLDAL...SGVV---ADSFKR-LDAVNRITSSASTLVTNAARELFAQQPALIAPGGN-------
K9U651_9CYAN/7-164SLIGTYDVAGRYFDRTALERL...KSYF---DTGTAR-VQAAATVNSNAASIVKQAGSQLFAEQPELIRPGGN-------
K9XTU9_STAC7/7-164KLIKNYDVTGRYLDRNAMDTL...KAYF---ESGTAR-VTVATMITANAAAIVRQAGSSLFEQVPELIRPGGN-------
U5QS61_9CYAN/34-186..LQTADDEGRYLTDTDLEAL...LADG---PHDARV-VQAARLLRDEAPAIVSEAREQVLAHFPGIAEAGGD-------
B0C339_ACAM1/7-156SVITSFDLQGKYIDGGALQQL...KHSF---QIDEPK-VEAAAIIRDNAAEIVKEAVAK......SLDVPGSD-------
K9SW00_9SYNE/6-160QVLLKADDELRYPTIDELQDI...KTFL---QTGGQR-IRIASTLAENESKIVKKASAELWKIHPDYIAPGGN-------
K9PBM8_CYAGP/6-160NSIINADAEARYLSPGELDQI...KSFV---AGGQRR-LRVAQVLAESRERIVKQAGGQLFQKRPDLVSPGGN-------
K9Y8I8_HALP7/7-164TLIKNYDVTGRYLDRDAMDEL...QSYF---ASGMAR-VQAATLINSNAAAIVKEAGRQLFDEQPELIRPSGN-------
Q10UW8_TRIEI/7-161EAVSAADSQGRFLTNVELSAA...LGRF---GRAQAC-LEAAKTLSEKSQALIDGAATAVYNKFPYTTTMQGP-------
Q7NL79_GLOVI/7-160AVINNYDVQGKYLDGAALDKL...KAYF---TTGAVR-VRAAAVISSNATTIIKEAAAKALI.YSDLTRPGGN-------
K9P5A2_CYAGP/7-160.LILQADDQLRYPTGGELRTM...VEFL---SGGARR-LSVVRVLTDNEKKIIAEASKQLFLRKPDYVAPGGN-------
A5GL99_SYNPW/7-160.LILKADDDLRYPSSGELNSI...VEFL---GQGSLR-LSVVRILSDNEKKIVDESARQLFSLRPEYVAPGGN-------
K9SQ75_9CYAN/7-161EAVSAADSQGRFISSTEMQIA...YGRF---RQAAFG-LDAAKSLSSNAQRLAEGAAAAVYNKFPYTTSMEGA-------
Q10ZG9_TRIEI/37-188...QIADGEARYLTDNDLNSL...KNSS---KLPIFS-IEAASLLKDSASKIVDKAREKVLATYPNITAEGGD-------
PHCB_SYNP2/7-171RVVSQADARGEFISSDKLEAL...KKVV---AEGTKR-SDAVSRMTNNASSIVTNAARQLFADQPQLIAPGGN-------
Q10XZ6_TRIEI/7-164SLIKNYDIKGRYLDQNGIDQL...KSYF---ETGTAR-VQAATLINSQAASLVKQAAITLFAEQPELIRPGGN-------
U5QNF8_9CYAN/7-160.TILGADEQLRYPSVGELEQI...KSFM---EDAPVR-LQIAKTLSDASDRVVKQSGDKLFQRRPDLNNPGGN-------
K9PDX9_9CYAN/6-157ELILNADSESRYPAPKELRVF...QEFL---KSGDQR-IRIAKILSQNEQQIVQNGSLKFWERCPNTPSNSGN-------
Q117G1_TRIEI/7-161TTIASADLGGRYPSSSDLESV...QGSL---QRAAAR-MEAAEKLASNYDAVAQEAVDAIYAKYP..SGSGKD-------
K9P457_CYAGP/8-162EAVAAADSQGRYLSNTELNAA...FGRY---ERAKNA-LEAAKALTAKADELVNGAAQAVYNKFPYTTQLQGN-------
B7K6K8_CYAP8/35-188.IFQQADDQGRYLTDLELTRI...EAFS---PERSSA-VKKAKILREKADLIVNYAREKVLTTYPEITELGGT-------
K9TWK3_9CYAN/6-157KAIASADREARYLSPGELRTI...RDFY---NGGENR-LRIATTLIENRKEIVERGSLKFWECCPDTPSNSGN-------
G3XCS9_PROMA/7-154TVIASADAAGRFPTISDIESV...KGSF---DRAKDR-LEAAEKLSIHIDRFTSQALDYVYGTE.........-------
K9XAE9_9CHRO/6-160KSIVNADAEARYLSPGELDRI...KSFV---TSGERR-LRIAQTLTDNRERIVKQAGDQLFQKRPDVVSPGGN-------
K9TI03_9CYAN/11-165QVILKADDELRYPTNGELTSL...TQFF---QTGQQR-VRIATTLAENEKKIVEQASKRLWQKRPDFISPGGN-------
Q7V590_PROMM/7-154TVITAADAAGRFPDISDLKAV...KVSF---DRAAAR-MEAAEKLASGIDNVTADALKAVYSDG.........-------
E0U6S4_CYAP2/34-186..FQQADEEGRYLSDDELEQI...KNLS---PNSSHL-IESARLLRDQAQQIVDSARQQVLAQYPGITENGGD-------
K9SFN5_9CYAN/6-164RSITAAKEQNRFLNESEIKRA...YELS---QTANAR-LDAVKSLSTSSDLILRLAIDQI..........AGE-------
K9RE36_9CYAN/7-164NLIKNYDVTGRYFDRNAVDSL...KSYF---ESGTQR-IQAAAAINANAAFIVKEAGVKLFEEQPELIRPGGN-------
Q8DIN1_THEEB/16-170QVLLKADDELRYPTTGELQTI...SDFF---QTGEQR-LRIATTLAENEKRIVEQASKQLWQKRPDFISPGGN-------
Q2JLK1_SYNJB/7-160AVINSYDVQGKYLDSSAMEKL...KAFF---ATGELR-VRAAATIAANASTIVKDAAAKALL.YSDLTRPGGN-------
Q7NLD7_GLOVI/7-163TVLAAADAAGRFPSGSDLESV...QGNI---QRSAAR-LEAAEKLAAGHAAVVKEAGDVVFKKYPYLKTAGEA-------
PHEB2_SYNPX/7-177RAAVSADSSGSFIGGGELASL...KSFI---ADGNKR-LDAVNAITSNASCIVSDAVAGICCENTGLTAPNGG-------
K8GH86_9CYAN/6-155RTIAVADLEARYLTIAELQTI...RDFF---EAGQQR-LRIANILAANSQTIINTGTQRFWERCPVTPSNSGN-------
B7K2Z2_CYAP8/11-156...NKIEDRGQFISSKQLTDL...EKYY---KQEQIR-LASLATLLNKISQLTKESVDVIHQKYLLSFGYDSD-------
Q117E9_TRIEI/6-178EIIDAADAQGRFPSSSDLESLASIKELI---DQGNKR-LDAVNFISSNASCIVSDAVSGMICENPGLIQAGGN-------
K9WFS1_9CYAN/7-161EAVSAADSQGRFLSSTELQVA...FGRF---RQATAS-LEAAKSLSSNADRLAQGAAQAVYNKFPYTTQMQGN-------
K9ZE77_ANACC/7-171RVVEQSDRQGAYLSDDQINAL...SAIV---ADGNKR-LDVVNRLTSNASAITANAYRALVAEQPNVFGPGGA-------
A5GVM9_SYNR3/34-181.LLQQADQERRLLSSSEIQSL......C---QHSGVM-TAPLEQLQGQAHQLVNQARQDLLEAKPHLVKPGGA-------
K9UJM8_9CHRO/7-161EAVATADSQGRFLSSTELQVA...FGRI---RQATAS-LDAAKALAGKAQSLADGAANAVYQKFPYTTTMQGN-------
PHAC_SYNP2/6-160QVILRADDELRYPSSGELSGI...KNFL---ATGAVR-IRIAEALADNEKKIVDQAQKQLFSIHPEYRTSGGN-------
PHEB_PROMP/7-174NQILSNDRDLENISNKNIEDI...KEFI---NTANSR-LDAIDSITNNSHAIAADAVTAMICENQDSVNTKIS-------
K9T481_9CYAN/7-160SAINAFDVQGRYLDDDAIAKL...RGYF---QSGTMR-AKAATVIGANAKSIITKTVAKSLM.YTDITAPGGN-------
PHAC_SYNY3/6-160QVILQADDQLRYPTSGELKGI...QAFL---TTGAQR-IRIAETLAENEKKIVDQAQKQLFKKHPEYRAPGGN-------
PHEA1_SYNPW/7-163TVVTAADAAGRFPSQNDLEAV...QGNI---QRAAAR-LEAAEKLAAGLDAVTKEAGDACFNKYPYLKQPGEA-------
K9XWE3_STAC7/7-183RAVVSADSKTSCIGGEQLASL...RNFV---AEGNKR-LDAVNAIASNASCIVSDAIAGMICENQGLIQAGGN-------
K9XKS9_9CHRO/7-160SLINPADQRGKYLETEELEKL...RRYF---QSGELR-VKAASAISNNAANIIREAVANSLL.YGDITCPGGN-------
K9SIK8_9CYAN/7-160SLIGAYDATGRYLDRDAYDQI...KSYF---DTGAER-LKAASMITGNAAAIVQETGLTLFDAAPTLIRPGGN-------
Q7NJA2_GLOVI/7-160TVIAKYDSQGKYFDNAAVDQL...KAYF---ATGELR-VRSAAAISANAQSIIKEATAKALL.YSSLTRTGGN-------
K9P3V2_CYAGP/7-164GLIGRYDQLGRYFDRNAIDRI...DSYF---AQAEVR-LAAVELINREAATIVREAAQRLWLEDPELLLPGGN-------
PHEB_PROMA/7-181RAVVSADSKGATIGSAELSSL...RKYV---ADANKR-IDATLAITQNVSCIAADAISGMVCENTGLTQPGGH-------
K8GG80_9CYAN/6-156EVIETADSEVRYPTAGEIWMI...QNFC---KSGEQR-IQIANKLACNERYLVERGSQKFWRRCPVTPSNSGN-------
B0JFY1_MICAN/7-164SLIRKYDVTGRYLDRDAIDNL...KQYF---ASGTAR-LAAAALINANSAALVRGAAIRLFEEVPELIRAGGN-------
Q10YG0_TRIEI/6-160KSIVNADAEARYLSPGELERI...KDFV---KAGETR-VRIAQVMTESREKIIKEAGQQLFQKRPDVVSPGGN-------
K9Q0C3_9CYAN/7-161EAVSVADSQGRFLSNTELQSL...FGRF---ERAAAA-MAAAKSLSASSSSLITGAANAVYSKFPYTTSTPGP-------
B0JXA2_MICAN/8-162EAVATADSQGRFLSSAELQVA...FGRF---RQAAIT-LEAVKILAQKAPSLAQEAANAVYQKFPYTTQLQGP-------
K9T2W8_9CYAN/6-157ELILNADSEARYPGPKELHIF...QDFL---KTGEQR-LRIAKFLADNEQQLVQNGSARFWERCPVTPSNSGN-------
Q117G0_TRIEI/7-178RSVISADSSGSFIDGAGLESL...KSFI---ADGNKR-LDAVNFIASNASCIVSDAVAGICCESPGLTSPGGG-------
B8HS99_CYAP4/7-164SLISNYDTIGRYLDRDAVDTL...KAYF---ATGEAR-VQAAGVINANAAAIVKEAGSRLFTDLPELIQPGGN-------
B2J4C1_NOSP7/8-162EAIASADSQGRYLSSTEIQVA...FGRF---RQAPAS-LQAAKALSANAQRLTEGAAQAVYNKFPYTTQQQGP-------
K9SBH1_9CYAN/7-161EAIAAADTQGRFLSNAEMHQV...FGRY---ERAAAA-MEAARALTKNSQKLIDGAAQAVYQKFPYTTQQQGA-------
K9PZN7_9CYAN/7-163SLIRNYDTTGRYLDSNAIDNL...KSYF---ATGADR-ITTAAIVNGNSAEIVKFAANQLFEAVPELLLAGGN-------
Q2JJL1_SYNJB/7-162TLIKTYDLTGRYLDREAMDAL...KAFY---DSGLRR-IKAVNVINLNSVDIVKTAAAAMFAQVPDLIRPGGN-------
A5GTI9_SYNR3/7-164GLIGRYDQQGRYLDRLAIEQI...DAYF---AEADLR-LAAVALINREAAEIVREASQRLWLADPELLLPGGN-------
K9TVG8_9CYAN/7-160ALINSSDVQGRYLDPSSLDKL...QNYF---QSGDMR-AKTAIAVSANAKNIVTKTVAKSLL.YTDITAPGGN-------
A5GVQ8_SYNR3/7-161EAVSAADSQGRFLSNTEIQSA...SGRF---NRAKAS-LEAAKGLTAKADALVNGAAQAVYSKFPYTTQMQGS-------
K9R5H1_9CYAN/6-160QVILQADDQLRYPSSGELKNI...KDYL---QTGAQR-LRIVNTLTENEKKIVEQATKTLWQKRPDFIAPGGN-------
K8GCZ2_9CYAN/7-164RVINRYDVTDRFLDNAAIATL...TEFL---ETGSLR-VQVVAVINANAVEIVRESARQLFEELPYLIQPGGN-------
Q46H72_PROMT/7-154TVVSAADAAGRFPSMSDFESV...KGSF---DRAKAR-LEAAEKLASCLDKFTNLAVDAVYQNG.........-------
K8GTM9_9CYAN/7-164SLIKNYDNTGRYLDRNAIDRL...KSYF---DSGIVR-VQAAAVITSNAAAIVKQAGLQLFEEQPELIRPGGN-------
Q7M7C7_GLOVI/7-171KAIVAADLRGSFLSEQELNQL...TNLV---KESNKR-LDAVNAITGNAAEIISDAAHKLFAEQTDLIRPGGN-------
K9Q339_9CYAN/12-160SVINSADSQGRYISSDTLKSL...AKYL---EENTRL-TAIAEKIARKHDQILKQTISNFWDTSEFEKVSSGQ-------
PHCA_SYNE7/8-162EAVAAADSQGRFLSSTELQVA...FGRF---RQAASG-LAAAKALANNADSLVNGAANAVYSKFPYTTSTPGN-------
K9PVY8_9CYAN/33-185..FQAADDESRYLTDADFEVI...LQAA---PSLEKS-AAIAKSLRDNATNIVSQARVNVLAEFPGITDEGGE-------
K9WJQ0_9CYAN/7-183RAVVSADASTSVVS..DINAL...KAFV---ASGNRR-LDAVNAIASNASCMVSDAVAGMICENQGLIQAGGN-------
Q2JMW3_SYNJB/7-161EAIAAADNQGRFLNASELQAV...NGRY---QRAAAS-LEAARVLTNNQQTLVREAVQEVFKRFPYLTQPGEM-------
K9T540_9CYAN/6-157QVILNADEELRYPTPGELRLF...QNFC---QSGEKR-IRIANKLAANEKRLVERGSARFWRRCPVTPSNSGN-------
Q31Q35_SYNE7/35-183...QAAEEEQRFLTDADLVAI....ALA---CLPNAN-PTAARFLRDDADELIAIARADLLDRFPGITELGGA-------
B8HKY2_CYAP4/8-172KVVYQADSRGEYLSDGQIDAL...AAFV---RDGNKR-VDVVNRISSNASTIVASAARSLFAEQPQLISPGGN-------
B2J9I8_NOSP7/36-187...QAADDAFRYLSDEDLLQI...QTKS---SDNSEL-IPVAVLLRDRAAEIVDEAREQVLTTYPEIIQPGGG-------
K9UJL4_9CHRO/35-186...QSADDRREYLTDDELDKI...EANS---SSNSSL-IPIARLLRDAATEIVDDARDRVLATFPAITQPGGG-------
K9XKJ2_9CHRO/7-171KVVSQADSRGEFLSSEQLDAL...TNMV---KDGNKR-LDTVNRITSNASSIVTDAARALFEEQPQLIQPGGN-------
Q8DHC5_THEEB/7-164TLIKNYDSTGRYLDRDAVDRL...RSYF---NSGAAR-VKAAAVINANAAAIVKEAASALFTEQPELIQPGGN-------
E8R540_ISOPI/10-154.....NDSEGRYFTAEEQAKA...MEYA---RSLPIR-LDAAQQVEKHEDEIVRYAVEQLKARYPR.......-------
Q2JI97_SYNJB/7-171KVVAQADSKGAFLGENEFAAL...QQVI---AEGNKR-LDAVNRLTSNASKIVTDAIRQLFAEEPNLNAPGGP-------
Q2JI98_SYNJB/8-159.AIATADSQGRYLSNSELQAI...NGRF---QRAAAS-MEAARVLSSRADELVRGATEAVYAKFPYTTQPGGQ-------
K9WKR7_9CYAN/37-189..FQAADDAGRYLTDEDLQHI...QAIA---PNPSEL-IPVARQLRDQVNDIVNEARATVLNTFPNISQPGGG-------
Q31RP7_SYNE7/6-160QVILKADDELRYPSGGELKNI...TDFF---KTGEQR-LRIAQVLSDSEKKIVDQASRKLWQRRPDFIAPGGN-------
D4ZTI6_ARTPN/7-164SLIKNYDITGRYLDRDAIDSL...KSYF---VTGTAR-VQAAATITANAAELVKQAASQLFGDLPELIRPGGN-------
K9XIF5_9CHRO/6-157QVIAQSDDANRFLSNTELDKL...QDFF---RTGEQR-LKVAQILTQNEQKIVQEGSRRFWQVVPNTPSNSGD-------
K9SXI2_9SYNE/7-160TLIGIYDATGRYLDRDAIDEL...KSYF---GTGTAR-LKAASTITANAAGLVRQAGTKLFEVVPDLIRPGGN-------
K9UCA0_9CHRO/6-160QVILRADDDLRYPSTGELKSI...QSFL---QTGEQR-IRIVSILAESEKKIVDRASKQLWKLHPEYIAPGGN-------
K9SCA6_9CYAN/6-160QVILQADDELRYPTAGELNSI...KDFF---QTGNQR-VRIASILSENEKKIVQEASKQLWQKHPDYIAPGGN-------
PHCA_SYNP2/7-161EAVALADSQGRFLSNTELQYL...YGRL---RQGAFA-LEAAQTLTAKADTLVNGAAQAVYSKFPYTTSTPGN-------
Q2JMW4_SYNJB/7-171RVIAQADARGAFLSDQDFDRL...AALV---AEGNKR-LDAVNRMTSNAAQIVTNAARSLFAQEPDLIAPGGN-------
K8GE61_9CYAN/7-160TLINSSDTQGKYLDDASLEKL...QNYF---RSGELR-AKAATSISANASTLVTQAVARSLM.YTDITAPGGN-------
K9T5F0_9CYAN/6-157RSIANADREARYLNLGELNAI...RNFY---EGGKNR-LRIAQILTANEESIIARGSQKFWKRCPDTPSNTGN-------
Q7NL72_GLOVI/36-187..LRTADAESRYLTDSDLDRL...AVLL---PEAAPA-LETVRFLRDRARPIVSAARSQVLEEFPGITEPGGD-------
K9Z238_CYAAP/6-160QVILKADDELRYPSSGELQGI...KSFL---ETGLLR-VKIAETLSENEKKIVEKASQELFKKRPDFRAPGGN-------
K9XNJ3_STAC7/6-160KMIVNADAEIRYLTPGELEQI...NLFI---KNSDRR-LKLVKALTESRSYIVKQAANQLFQSRPYLVSTGGN-------
K9PC78_9CYAN/6-157QVILNADEELRYPTPAEIRMI...QNFC---HSGEKR-IRIATTLAKNQNRLVEKASDKFWKVCPVTPSNSGN-------
K9YD01_HALP7/6-160EVILKADDELRYPTSGELKVI...QEFL---KTGEQR-MQIAQTLAENEKKIVDQASKQLWKLHPEYIAPGGN-------
K9TVZ1_9CYAN/6-157QMILNADEEVRYLTPGEIHAL...QNFY---RSGTER-IRLAKVLAQNEKKIVERATQKFWKICPRTPSNSGN-------
K9SQM2_9CYAN/38-189...QAADDDRRYLTDPELNQI...QALA---PAQSEM-VSIAAQLRDEAKGIVDEARAEVLRTFPDITAPGGG-------
K9VPV9_9CYAN/6-160QLILQADDELRYPSTGELQSI...NDFF---KTGEQR-VRIATALSDSEKKIVEEASKKLWKKRPDFISPGGN-------
K9T6U8_9CYAN/35-186...QKADDEGRYLTDEDIERI...KTLS---SETLVS-LERAKLLREKATEIVSEARKKVLERFPNITQPGGD-------
Q7U6V7_SYNPX/7-160.LILQADEDLRYPTSGELQSM...VAFL---EQGAMR-VSVVKVLTDNEKKIVDESAKQLFGRKPEYVAPGGN-------
PHCB_SYNE7/8-172KVVAQADARGEFLSDAQLDAL...SRLV---AEGNKR-IDTVNRITGNASSIVANAARALFAEQPSLIAPGGN-------
O50209_SYNE7/7-164SLIAGYDLAGKYLDRNAVDSL...RAYF---AEGNAR-VQAAEIINANAASLVRDASAQLFEEVPELLRPGGN-------

PF01152

Q7CX73_AGRT5/7-127---------------TLYEAI-------------------------GGDAT.VRALTRRFYELMDTLPEAARC-------
Q8XXM3_RALSO/11-128---------------LAFDLL-------------------------GGEAR.VRELADRFYDLMDLEPAFAEL-------
B2J6Y7_NOSP7/3-117---------------TLYDNI-------------------------GGQPA.IEQVVDELHKRIATDSL..LS-------
F2CUR6_HORVD/26-145---------------NVFEAL-------------------------GGTPQPFVDLSTNFYTRVYEDEEEWFR-------
TRHBN_MYCTU/14-127---------------SIYDKI-------------------------GGHEA.IEVVVEDFYVRVLADDQ..LS-------
Q63VR4_BURPS/25-145---------------TAFELV-------------------------GGEAR.VRELVDRFYDLMDLEPEFAGI-------
GLB3_ARATH/26-142---------------NLFDKL-------------------------GL.QT.FINLSTNFYTRVYDDEEEWFQ-------
Q7APC3_RHIME/8-128---------------TLYEAI-------------------------GGDAT.VRALTQRFYELMDSLPEAARC-------
TRHBO_MYCLE/4-122---------------SFYDAI-------------------------GGAET.FKAIVSRFYAQVPEDEI..LR-------

PF00042

Q19601_CAEEL/105-215E-----------------------RILL---EQSWRK.TRK.....TGADHIGSKIFFMVLTAQPD--------------
GLB1B_ANATR/17-122Q-----------------------KDLL---RLSWGV.LSV......DMEGTGLMLMANLFKTSSA--------------
HBP1_CASGL/7-116Q-----------------------EALL---KQSWEV.LKQ......NIPAHSLRLFALIIEAAPE--------------
GLB1_PARCH/17-123Q-----------------------KKIV---RKTWHQ.LMR......NKTSFVTDLFIRIFAYDPA--------------
MYG_GALGA/3-108D-----------------------WDKV---NSVWSA.MEA......NITAVGQNILLRLFEQYPE--------------
HBAT_HORSE/7-107D-----------------------RATV---RALWKK.MGS......NVGVYATEALERMFLGFPS--------------
HBA1_PLEWA/7-107D-----------------------KHNV---KAIWDH.VKG......HEEAIGAEALYRMFCCMPT--------------
HBB0_MOUSE/8-112E-----------------------KAAI---TSIWDK.V........DLEKVGGETLGRLLIVYPW--------------
HBA1_XENBO/7-107D-----------------------KKHI---KAIMPS.IAA......HGDKFGGEALYRMFLVNPK--------------
GLB_PAREP/8-117Q-----------------------DILL---KELGPH.V.DT...PAHIVETGLGAYHALFTAHPQ--------------
HBB1_CYGMA/8-112E-----------------------LTII---NDIFSH.L........DYDDIGPKALSRCLIVYPW--------------
MYG_CYPCA/3-108D-----------------------AELV---LKCWGG.VEA......DFEGTGGEVLTRLFKQHPE--------------
HBB2_XENLA/8-112E-----------------------KAAI---TSVWQK.V........NVEHDGHDALGRLLIVYPW--------------
HBAZ_CAPHI/7-107E-----------------------RTII---LSLWSK.IST......QADVIGTETLERLFSCYPQ--------------
HBF1_URECA/7-113Q-----------------------IKAI---QDHWFLNIKG......CLQAAADSIFFKYLTAYPG--------------
HBB1_XENBO/7-111D-----------------------RQLI---NSTWGK.V........CAKTIGKEALGRLLWTYPW--------------
LGB1_LUPLU/8-116Q-----------------------VALV---KSSFEE.FNA......NIPKNTHRFFTLVLEIAPG--------------
MYG_HETPO/3-108E-----------------------WEHV---NKVWAV.VEP......DIPAVGLAILLRLFKEHKE--------------
HBAD_LIOMI/6-106D-----------------------RRLL---QASVGK.LGC......RLEDIGADALNRLLITFPQ--------------
A0A017IB98_ECOLX/6-103T-----------------------IATV---KATIPL.LVE......TGPKLTAHFYDRMFTHNPE--------------
Q18311_CAEEL/32-140T-----------------------KKLV---IQEWPR.VLA......QCPELFTEIWHKSATRSTS--------------
GLB73_CHITH/23-129E-----------------------ASLV---QSSWKA.VSH..........NEVDILAAVFAAYPD--------------
HBB_LITCT/1-105G-----------------------GSDV---SAFLAK.V........DKRAVGGEALARLLIVYPW--------------
HBBN_AMMLE/2-106B-----------------------KALI---TGFWSK.V........KVBZVGAZALGRLLVVYPW--------------
HBAM_LITCT/6-102E-----------------------KSAV---ASLWEK.IAP......QTNKLGAESMERLFKNHPE--------------
HBA3_PLEWA/7-107E-----------------------KALV---VGLCGK.ISG......HCDALGGEALDRLFASFGQ--------------
HBAD_PASMO/6-106D-----------------------KKLI---QQIWGK.LGG......AEEEIGADALWRMFHSYPS--------------
HBB_HETPO/7-106E-----------------------LHEI---TTTWKS.I........DKHSLGAKALARMFIVYPW--------------
A2VF80_MYCTX/42-136D-----------------------ALRV---LQNAFK.L........DDPELVRRFYAHWFALDAS--------------
HBA_LEPPA/7-108D-----------------------EVLI---KEAWGL.L.H......QIPNAGGEALARMFSCYPG--------------
GLB8_CHITH/9-115Q-----------------------LALF---KSSWNT.VKH..........NEVDILYAVFKANPD--------------
GLB2_LUMTE/8-114E-----------------------GLKV---KSEWGR.AYGS...GHDREAFSQAIWRATFAQVPE--------------
Q20638_CAEEL/74-184E-----------------------KELL---RRTWSD.EFD......NLYELGSAIYCYIFDHNPN--------------
HBB_ALLMI/7-111E-----------------------RKFI---VDLWAK.V........DVAQCGADALSRMLIVYPW--------------
HBA_CATCL/6-107D-----------------------KADV---KIAWAK.ISP......RADEIGAEALGRMLTVYPQ--------------
HBA_SQUAC/6-107D-----------------------KTAI---KHLTGS.LRT......NAEAWGAESLARMFATTPS--------------
GLB2_TYLHE/9-115Q-----------------------RLKV---KQQWAK.AYGV...GHERVELGIALWKSMFAQDND--------------
GLB1_GLYDI/6-111Q-----------------------RQVI---AATWKD.IAGA....DNGAGVGKDCLIKFLSAHPQ--------------
GLB10_CHITH/11-117E-----------------------VEQV---QATWKA.VSH..........DEVEILYTVFKAHPD--------------
HBB_LEPPA/7-111E-----------------------KQYI---VSVFSK.I........DVDHVGANTLERVLIVFPW--------------
GLB1_TYLHE/7-110Q-----------------------RIKV---KQQWAQ.VYSV...GESRTDFAIDVFNNFFRTNPD--------------
HBA1_TORMA/6-107N-----------------------KKAI---KNLLQK.IHS......QTEVLGAEALARLFECHPQ--------------
GLB6_CHITH/22-128Q-----------------------ADLV---KKTWST.VKF..........NEVDILYAVFKAYPD--------------
GLB_BUSCA/6-116Q-----------------------KTAL---KESWKV.LGAD...GPTMMKNGSLLFGLLFKTYPD--------------
GLBH_CAEEL/10-119D-----------------------LC.V---KSLEGR.MVGTE..AQNI.ENGNAFYRYFFTNFPD--------------
GLB2_NIPBR/16-114P-----------------------ISKA---QQ......AQ..........VGKDFYKFFFTNHPD--------------
GLBH_TRICO/30-132D-----------------------VVPL---GSTPEK.L...........ENGREFYKYFFTNHQD--------------
GLB_PSEDC/21-134T-----------------------RELC---MKSLEH.AKVGT..SKEAKQDGIDLYKHMFEHYPA--------------
GLB_CERRH/6-116S-----------------------KSAL---ASSWKT.LAKD...AATIQNNGATLFSLLFKQFPD--------------
GLB2_CHITH/22-128E-----------------------ASLV---RGSWAQ.VKH..........SEVDILYYIFKANPD--------------
GLB_TUBTU/6-112Q-----------------------RFKV---KHQWAE.AFGT...SHHRLDFGLKLWNSIFRDAPE--------------
GLB3_LAMSP/7-113Q-----------------------RLKV---KRQWAE.AYGS...GNDREEFGHFIWTHVFKDAPS--------------
GLB_ASCSU/21-134T-----------------------RELC---MKSLEH.AKVDT..SNEARQDGIDLYKHMFENYPP--------------
GLB1_CALSO/5-105D-----------------------IKNV---QDTWGK.LYD.....QWDAVHASKFYNKLFKDSED--------------
GLB2_CALSO/5-108D-----------------------IAAV---QTSWRR.CYCS...WDNE..DGLKFYQTLFDSNSK--------------
MYG_ALLMI/7-113E-----------------------WKHV---LDIWTK.VES......KLPEHGHEVIIRLLQEHPE--------------
Q21978_CAEEL/165-283S-----------------------CEVV---ADSWRL.VESRSSAAETSACFGLFVFQRVFSKIPM--------------
HBB_SQUAC/7-107E-----------------------KALV---NAVWTK.T........DHQAVVAKALERLFVVYPW--------------
GLB3_TYLHE/8-117D-----------------------RHEV---LDNWKG.IWSAE.FTGRRVAIGQAIFQELFALDPN--------------
GLBT_CHITH/13-116Q-----------------------VAAV---KGDWEK.IKG..........SGVEILYFFLNKFPG--------------
GLB3_CHITH/20-120Q-----------------------ISTV---QASFDK.VKG..........DPVGILYAVFKADPS--------------
GLB1_CHITH/21-126Q-----------------------IAAA---KASWNT.VKN..........NQVDILYAVFKANPD--------------
LGB1_MEDSA/7-112Q-----------------------EALV---NSSWEA.FKQ......NLPRYSVFFYTVVLEKAPA--------------
GLBC_NIPBR/21-135D-----------------------VK..---KHTVES.MKAVP.VGRDKAQNGIDFYKFFFTHHKD--------------
HBA1_IGUIG/6-106D-----------------------KNHI---RAIWGH.VDN......NPEAFGVEALTRLFLAYPA--------------
HBA1_BOSMU/6-106D-----------------------KGNV---KAAWGK.VGG......HAAEYGAEALERMFLSFPT--------------
GLB_APLJU/6-113D-----------------------AGLL---AQSWAP.VFA......NSDANGASFLVALFTQFPE--------------
HBA_HETPO/13-114D-----------------------RAEL---AALSKV.LAQ......NAEAFGAEALARMFTVYAA--------------
BAHG_VITST/6-103T-----------------------INII---KATVPV.LKE......HGVTITTTFYKNLFAKHPE--------------
GLB4_TYLHE/8-117D-----------------------RREV---QALWRS.IWSAE.DTGRRTLIGRLLFEELFEIDGA--------------
GLB4_LUMTE/11-120D-----------------------RREI---RHIWDD.VWSSS.FTDRRVAIVRAVFDDLFKHYPT--------------
HBP2_CASGL/13-122Q-----------------------EALV---VKSWSA.MKP......NAGELGLKFFLKIFEIAPS--------------
GLBP1_GLYDI/7-115Q-----------------------VAAL---KASWPE.VSAG....DGGAQLGLEMFTKYFHENPQ--------------

PF11563

E1FPN0_LOALO/43-200-------------PRPSISSQGR..KVS...ALGLSQRQIVKECMDKAKDDIAERIYRRITEKRDDFRKFVEAL......
Q5B5X9_EMENI/37-216-------------LEARINYLKDFLDFN...SSDMEALASGAKYIKTLIPAVVNLVYRKLLEY.DITARSFHTKDTASEA
A2QBB3_ASPNC/24-203-------------LEARIDYLQRFLDFN...ADDIATLVRGAKYVKALAPTVVDKVYVKLLEF.DITARVFRTRNTAVEE
C4JH72_UNCRE/22-201-------------LEARIRYLHNFLDFN...SNDIEALITGSKYIKTLIPAVVNIVYKKLLQY.DITARAFQTRSTSFEG
C4XIT4_DESMR/15-174-------------TRQDIRRRKELLGFT...EEDAQTLAELKLDIGLIVSSIVDEFYDDQVTK.PEIERTIGD.......
D4AN62_ARTBC/20-213-------------LPSRVNYLKAFLKFT...DEDGAAIQSAKGLIAPALPAILDTIYTNLIGF.DVTAKSFVPPQPEQDK
E9E781_METAQ/19-198-------------LEARIQYLHSFLDFS...SNDIEALISGAKYIKALVPAVVNIVYRKLLQY.DITARAFTTKNTTQGG
E6U0Q9_BACCJ/24-180-------------KGTEMERQLKMINLT...EKDLEVINAIQPFISKRINVIVDRFYKNLEIE.SSLLDIIND.......
B6HCY7_PENCW/23-203-------------LEERIKYLHNFLDFN...SADIEALLTGNKYIKQLIPAVVNLVYKKLLQY.DITSRAFHTRTTVDER
Q218B7_RHOPB/3-166-------------NTSTIAERLRFNSID...QETIAALRAGKAFVLAELEPILDRFYQHIARF.PEVSAHFKT.......
D3FWD3_BACPE/27-184-------------NDKEIDMRMAYMGFS...TQSTEYLQELQAFVDEHADALLEAILDHVYSF.PHLKKIAET.......
B7GLD2_ANOFW/25-175-------------FHGRFIDTLSYNHFT...TEDFAKLKQIDELIAPHKQEMVHLFYEGLKQVQPEATKTITE.......
A4Y0T1_PSEMY/34-186-------------DPHELSQRQRFLNWS...QIDNERLARHAPRLERANRQFIDALYERLAQY.PAPAAILDD.......
C4L4W7_EXISA/25-181-------------LPSELERQRQLIRLE...REDLAYLRAYQQELRQLTPQLVDVFYEELEKI.DEMKDLIRQ.......
A1C4D9_ASPCL/22-201-------------FPKRMAYIQAFINFT...RDDITTFNKGARYLKAAIPGLTHRLYEKMLEF.DITARALRTRSTSSEV
Q7NUX9_CHRVO/5-158-------------EMALLANMCRFIGIR...TEHLAQLPRHADAGLARRELLGKELYWHLLKS.PGEAERLQRH......
E0SCN2_DICD3/9-166-------------NELLLAEWQELVNLT...SSDAHEL..LRDLCEEELRQLVSVFYDYMLQD.KKASLYLNT.......
C7Z0G0_NECH7/17-196-------------LEARIDYLHKFLDFD...DRDLEALAFGSKFVKDLIPAVVHIVYRKLLQF.DITARAFEIRDTTSEA
A9GCE3_SORC5/10-164-------------QETLFDEIKRYVRFS...EQDERWLAVLRAHAEPHFPRIADEFYDRIREH.EGAHDVFTG.......
F0XJU9_GROCL/20-199-------------LDARIQYLHSFLDFS...STDIDHLVAGAKYIKVLIPAVTNIVYRKLLQY.DITARAFETRSTSFEG
Q5WC98_BACSK/26-182-------------DESDCQKQIGFIDLH...ASDLEYIHLLYPLVNEHIAPITEAFYEKLLEQ.PHLRQLVTT.......
Q9KFH4_BACHD/32-188-------------AESELSAQLRMIHLT...LDDLKRMKALQPLVEENMEVLADAFYSNIIKQ.PNLNEIIET.......
B9JTP3_AGRVS/26-192-------------QAGSLRDRLNFAGLD...QDACSLLRRHRVGLETDVETGLHAFFRKLQTA.PDAARQFTG.......
D2QY57_PIRSD/6-164-------------IHSRYRDLKRYVGFT...DEDAERISAARPTLALHIPALVADFYAELQRH.PDAVKVITG.......
B1YHV6_EXIS2/30-187-------------SDPSLTGRLEYMGYT...EEHLQTLKAMAPVVNSILDEVLEQVLDHLLLH.PEMVQIAQT.......
B9JUN1_AGRVS/7-170-------------DNGELHKRMAFLKLT...ASDLQVVAGLQPIIAHSIGPTLDVFYQTAKQH.PEAAKFFSS.......
Q3IUQ9_NATPD/29-196-------------DADEIEWRKEFTRFD...EDDAETLAEHAGTFERIADDLVEDFYDHLQSH.PETVDVIDS.......
C5G9L3_AJEDR/20-214-------------LKSRLSYVKGFLHFT...EKDGAFIQAAKEIIAPAVPAVLDAVYTRLLSF.DITAKSFVPRQPEQDT
A2QT04_ASPNC/23-202-------------LEARVRYLQQFIGFT...ADDVIALNRGSKYIKALAPTLVDRVYSKLLEA.DITARVFQTRSTTSEL
C7ZI09_NECH7/13-198-------------LEARIDYLHKFLDWD...DRDIEALAYGAQHIQNLIPAVVHIIYHKLSEF.DITARAFEVRNTSSES
B1HNN8_LYSSC/36-192-------------NHPNLQKQLQLLNLT...IEDLAIIKQLQPLANDLIPAMVEQFYAAISLS.QDLIDIINR.......
B1YG08_EXIS2/27-183-------------AGSAFAQQLQLIDLT...VEDLQIVRLIRHDVAEWMPQMVDAFYAELVRV.PELKQLIER.......
C0S330_PARBP/20-213-------------LKSRIAYAKSFLQFT...EEDGALIQSAKDIVAPAVPAILEAVYTKLLSY.DITAKSFVPRQPEQAA
A0KND7_AERHH/15-171-------------TEFEIAHRKELLLLD...ERDFALLASYRPKIEPHIDALVDKFYTLQTGI.TEIALLIGD.......
D8PPS9_SCHCM/66-254-------------INARMVYLKDFVNFT...RHDEDAIRHVGPLINDLIPEVVDALYSKLFEF.DITKQVFMQRNDGFDG
B3QU69_CHLT3/11-161-------------DEAILEELLAMTRMT...EEEKKVLGEMRSQAESIVGEMINAFYDRLLSH.ENTSEYLSD.......
B2IB39_BEII9/3-168-------------DSSALQERLDFMEIE...AATKASLNALWPQVESAIGPILTRFYDKISRT.PATSRFFTD.......
Q3JC52_NITOC/22-196-------------SLEDFDLLKKTVLFT...EEDEKYLRLAGEVLGDQVEEVLDLWYGFVGSH.PHLVRYFSDLQG....
D2R7K0_PIRSD/13-194-------------VAYRFGYLAEFMNVT...ADDLATVAAAGPHLAPVIPALVDAVYEKLAQY.DATWRHFVPRNAGYDG
Q2Y8W7_NITMU/15-174-------------DKDRIRQALSLLGLAADHKEEAAAINLLTEFIAERVDKIINSCLAVIAGS.DDFELIERNI......
F2F0J0_SOLSS/31-187-------------SMPELAQQMNLIGLA...EENLRHIKSYQPAIAAGVSEITDVFYENVLAV.PSLKKIIEE.......
F2F399_SOLSS/32-188-------------TYPNLHKQIELLKLT...KEDLAVIKQLEPFAQQVVPDMVEKFYGAISLS.PELVDIIGS.......
C0ZJ13_BREBN/21-178-------------MSDQLTGKIHFLQMN...QTDLDRLKQIEPLLTEHLEAITERHYHMLCQY.SHLMQIIET.......
B0ULQ7_METS4/3-159-------------SDADLDGRLTFLEID...AATAAMLPRLWPAIAPELPRIMARFYDKMLRT.PHLAGMIGT.......
C6WYR1_METML/18-175-------------SADEVQSRKDFLEFS...ERDSQLLKELGTLLAPLEGVFADLLSEHLDAH.PAIAASHIH.......
B9J942_AGRRK/14-180-------------QAGSLRDRLRFAGLA...AEQCEIVRRNRPMLETHLKAGLRDLFHRFQTF.PDAARNFAS.......
C0ZKX8_BREBN/35-191-------------GKSTLAKQLAMINLT...EEELSIVKALQPLIIQNIEAIIDYFYASIENE.PLLMKIVDQ.......
A9CJK8_AGRT5/7-170-------------TDRQLDERLNFLGLG...HGERQNLSDMKGVITGSLDASLDRFYTKVRAV.PETAKFFSS.......
C4KYX4_EXISA/28-185-------------SDSSLNGRTHYMGYT...TSQVKRLQDMAPLVESVLDDVLENVLDHLMLQ.PEMVQIANA.......
B2W0B6_PYRTR/24-203-------------LESRIQYLHSFLDFS...SRDIEALSSGAKIIRTLIPAVVNIVYKKLLQY.DITARAFTTRSTSYSG
E3EZY8_KETVY/10-171-------------AAADMENRLPFIALD...SAAQQRLRSLAGPIGAAMGPALDDFYARVAQT.PALRHHFPT.......
Q1AU74_RUBXD/22-196-------------SLEELDLLRQTVLFT...GEDERYLRMAGEVLEGRLDELLDVWYGFVADH.SHLVYYFSSPEG....
A8IPP6_AZOC5/62-225-------------TQESLSQRLNFIGMD...KALQASLREARDLVVAAMPKILDGFYDHLMTY.PDMARMFPT.......
Q1GI20_RUEST/15-172-------------EASQHNNTLSWFDIT...PADQERVRSLAPIADHVGEEIIADFYAHILRF.EDAAQQFAD.......
B2AU65_PODAN/21-200-------------LEARVKYLHSFLDFG...VSDIEALKSGSKYIQALIPAVVNIVYKKLLQY.DITARAFTTRSTAFEG
Q0UTR0_PHANO/18-193-------------LESRIEYLHSFLDFS...SRDIEALTHGAKYIQALIPAVVNIVYKKLLQY.DITARAFTTHTTASSL
A2R286_ASPNC/23-202-------------FSKRMDFLRLFLDFT...DDDIIVFNKGAKFLKAALPVLTHRLYAKMLDF.DITARALRVRSTESEA
A9EVT1_SORC5/5-161-------------LEREVEDRRAFFQIT...DEDLARIAALRPHAEKRTERIVDAFYELLLDF.GPTRELFRD.......
B8N2G0_ASPFN/23-202-------------FGKRMEYIKTFLDFT...DDDVIIFNKGSKYLKTVIPELTHRLYEKMLEF.DITARALRTRSTTSEA
C4JKA6_UNCRE/20-213-------------VASRVAYLKAFLKFT...DEDGAALNAAKPVIAPAIPAVLDTIYTNLISF.DVTAKAFVPRQPEQDE
D2VCV6_NAEGR/13-197-------------LPYRFAYVAKFVGFG...EEDVKYIHESAAVLAPLVPTVVDLVYKKLFSF.DVTKKTFMVRNDKFQG
Q9YFF4_AERPE/20-195-------------TDLEFDLLKKTVMLG...EKDVMYLKKACDVLKDQVDEILDLWYGWVASN.EHLIYYFSNPDT....
F0SHW9_PLABD/6-164-------------DYQRFLDLKSYVGWT...DDDNACSDELLTLLSDEIGPILDDFYTEIKKH.RAAWRVITG.......
A8FBP1_BACP2/29-185-------------DNTDIAKQIKMIDLT...QNDLLILNQLNSIVQEDIAHIVDKFYKNLEVE.SSLMHIIQD.......
A8P1M8_COPC7/13-202-------------FAYRIQYLRDFIEFT...SEDAAALHAARPVVAPLVPLVVDTVYEKLLSF.SVTAKAFVPRQTGYSG
A1CRU6_ASPCL/32-212-------------LEARINYLRDFLDFN...SSDIEALTTGSKYIKALIPAVVNIVYKKLLEQ.DITARAFITKDTADET
Q47S02_THEFY/23-197-------------GLEDLNKLKTTVMFT...SADEEALRMAGDVLEDQVEDVLDVWYGFVADH.PHLLAYFSTPDG....
A9WGB2_CHLAA/23-194-------------..EEWELLKQTVLWT...AEDEQYLRMAGEVLGDQVDAILDLWYGFVASH.AHLVYYFTGSDG....
B1HTR5_LYSSC/28-179-------------...LMVKQIEMLNVT...KQDLQYLKAFQPYVMDNVDHIVNRFYNMIGTE.QHLVNIISH.......
F0LY60_VIBFN/12-164-------------...AIRRWASYLAID...QQTVDALREYYWIMEHNIDEVLAFVYDHLGSC.PETAQFYQN.......
G0JLY5_9GAMM/7-158-------------.DANLKAFCHIGGLC...KEDQEIMTRVGPGIVPHVPLLTDRFYEILQED.QQTAPYIDG.......
HEMAT_BACSU/31-185-------------.HADVKKQLKMVRLG...DAELYVLEQLQPLIQENIVNIVDAFYKNLDHE.SSLMDIIND.......
Q2KCI4_RHIEC/11-175-------------.AGSLRDRLRFAGLD...ADQCELVRRNRPALKAHLKAGLRDLFHRFQSY.PDAARNFES.......
MCPE_RHIME/15-178-------------..GSLLERLRFAGLD...EDACALLRDHRQALSPRIELALRALSHRLQAS.PDAARHFDS.......
Q65LP1_BACLD/29-182-------------QHAEFKKQLAMVDLT...DEDLWVLSRLKPLVTEHIETIVTRFYQNLEHE.SSLMEIIHD.......
Q7D1B0_AGRT5/50-211-------------...SLAGRLRFAGLD...EMQSDFLRNYRGMLEPYVKAGLRDVMTRFQSM.PDCSPSFES.......
Q81JN0_BACAN/32-186-------------.NSELKVQMDMLHIS...KEDLQIVKVLQPFIYEEIDWITEKFYANITKQ.PNLITIIER.......
Q8TLY9_METAC/23-193-------------..EDLKLLKEAVMFT...AEDEEYIQKAGEVLEDQVEEILDTWYGFVGSH.PHLLYYFTSPDG....
Q9A5Y0_CAUCR/45-206-------------.NAKLDQRMAFMRFD...ERSRAHLRAIKPVIDAEIGAALGQFYSQVRLF.PDTRVKFRD.......
Q9AB06_CAUCR/8-170-------------.DYAIGERTAFMGID...DKARSALRDLRPVIRAEIGKALDNFYGKVRAT.PETRKFFSD.......
U5L913_9BACI/33-184-------------..EEVLRQIDMIGLQ...DSDLNYILSLQPYVKGNLPAIIEQFYKNLENE.KTLTKIIND.......
U5LFP3_9BACI/32-184-------------.DQDLKLQIEVMGLT...KEDLAILRAVRPIAEKHISAV....YNKLLTYEQEDVRKITD.......
V6F1E9_9PROT/46-194-------------..ERVTQYLDLFQVD...DAAQRLIADNCGKVVASVETMVNRASDWVQRT.PPFGEKMNS.......

PF00502

K9XWT9_STAC7/32-185-----------.LYP-PAR..AEACWRDFWHFLRCITYGIAGQ---SVEYTSTTGLGYMEQLYQ------------EL--
Q7NLD6_GLOVI/7-176-----------.CYT-NRR..MAACLRDGEIVLRYVTYALLAG---DASVLEDRCLNGLKETYM------------AL--
K9U0M5_9CYAN/6-160-----------.AYG-REM..TATCLRDMDYYLRLITYAIVAG---DATPIEEIGVIGVRQMYR------------SL--
B2J4C0_NOSP7/8-172-----------.AYT-SRR..AAACIRDLDIILRYITYAIFAG---DSSVLDDRALNGLRETYL------------AL--
PHEB_NOSS1/7-171-----------.CFH-NRN..QAACIRDLGFILRYVTYSVLAG---DGSVMDDRCLNGLRETYQ------------AL--
K9U368_9CYAN/7-161-----------.QYA-ADSRGKSKCARDIGHYLRMVTYCLVAG---GTGPMDEYLIAGLDEINR------------SF--
E0UA88_CYAP2/6-160-----------.AYG-EEM..TATCLRDMDYYLRLITYGVVAG---DVTPIEEIGLVGVREMYK------------SL--
Q31RG0_SYNE7/6-160-----------.AYG-EDM..TATCLRDLDYYLRLVTYGVVSG---DITPIEEIGIVGVREMYK------------SL--
A5GVQ7_SYNR3/7-171-----------.AYT-SRR..MAACLRDMEIVLRYVTYAVFAG---DASVLEDRCLNGLRETYL------------AL--
K9UI71_9CHRO/7-164-----------.AYT-TRR..YAACLRDMDYYLRYASYAIVAG---DTNVLDERVLQGLRETYN------------SL--
K9PBJ3_9CYAN/6-157-----------....-RIY..RSSCLRDQSWYIRLITYSIVLQ---DIEPLAEIGTIGVQEMYN------------SL--
B7JYL9_CYAP8/7-163-----------.AYT-TRR..YSACLRDMDYYLRYASYALVAG---DSHVLDERVLQGLRETYN------------SL--
Q7M7F7_GLOVI/7-161-----------.GYG-DTN..QAKCARDISHYLRFITYSLVAG---GTGPLDDYIVAGLREVNR------------TF--
K9SEX3_9CYAN/6-160-----------.AYG-QKQ..RAQCLRDFGWYIRVVTYGVISG---SKEPIEKIGIIGAREMYN------------SL--
K9U364_9CYAN/7-161-----------.QYA-STPEGKSKCVRDIDHYLRTISYCCVVG---GTGPLDEYVVAGLKEFNS------------AL--
Q7V589_PROMM/7-180-----------.CYP-TRR..MAACLRDGEIILRYVSYALLAG---DASVLDDRCLNGLKETYD------------AL--
K9XSR9_STAC7/6-160-----------.SYG-QKQ..YNQCIRDFGWYLRLVTYGVLSG---DKEPIENTGLIGVREMYN------------SL--
Q2JPU0_SYNJB/6-160-----------.AYG-DKR..YNQCLRDYDWYLRLVTYGIIAG---SKEPIESIGLIGVREMYN------------AL--
K9SZ05_9SYNE/7-161-----------.NYA-ADARGKSKCARDVGYYLRIITYSLVAG---GTGPLDEYLVAGLAEINR------------TF--
K9SDD2_9CYAN/9-154-----------DI..-.....TAKWKADTRRVLRYSAVALLID---DTNRLKEHLLFWFQTVMQ------------AF--
Q7TTT3_SYNPX/31-183-----------.LFP-GER..ADACWRDCWHFLRVIVYAVACQ---RSNFTNPTGMAALRELYQ------------RM--
E0U6T1_CYAP2/7-183-----------.CYP-NRR..MAACLRDGEIILRYVTYALLAG---DASVLDDRCLNGLKETYI------------AL--
K9UYY7_9CYAN/6-160-----------.AYG-KEM..TGTCLRDMDYYLRLITYSVAAG---DTTPIEEIGIIGVRQMYR------------SL--
B7K3F0_CYAP8/6-160-----------.AYS-QRQ..YNQCLRDYSWYLRLVTYGVLAG---DKEPIEKIGLIGAKEMYN------------SL--
K9YHW9_CYASC/8-165-----------.AYT-TRR..YSACLRDMDYYLRYASYALIAG---DTSVLDERVLQGLRETYN------------SL--
K9T4V8_9CYAN/7-171-----------.AYT-NRR..MAACLRDMEIILRYVTYATFTG---DASVLNDRCLNGLRETYV------------AL--
A5GTB5_SYNR3/7-160-----------.AYG-QKQ..RAQCLRDFSWYLRLVTYGGLAG---STSFIESTGLIGAREMYN------------SL--
B2J478_NOSP7/7-163-----------.GDT-QVK..KDKCFRDIKHYLRLINYSLVVG---GTGPLDEWGIAGAREVYR------------SL--
PHEB1_SYNPW/7-183-----------.CYP-NRR..MAACLRDGEIILRYISYALLAG---DASVLDDRCLNGLKETYI------------AL--
A5GVP3_SYNR3/7-164-----------RQCA-TEG..KEKCKRDFVHYLRLINYCLVTG---GTGPLDELAINGQKEVYK------------AL--
B7K6K4_CYAP8/7-163-----------.NST-DTF..KAKCARDIKHYLRLIQYCLVVG---GTGPLDEWGIAGQREVYR------------AL--
APCF_SYNY3/7-164-----------.AYT-TRR..FSACLRDMDYYLRYASYALIAA---DNNVLDERVLQGLRETYN------------SL--
APCF_SYNP2/7-164-----------.AYT-TRR..FSACLRDMDYYLRYGTYALIAG---DMDVLNERVLQGLRETYN------------SL--
B2J479_NOSP7/8-184-----------.LYP-TRR..MAACLRDAEIVLRYVTYALLAG---DSSVLDDRALNGLKETYT------------AL--
K9VCF0_9CYAN/35-186-----------.LYP-PER..AEACWRDFWQFLRCITYGIAGN---SPQFTSQEGLKNMELLYQ------------EL--
K9PSE2_9CYAN/6-160-----------.AYG-QEM..TATCLRDIDYYLRLITYSIVAG---DATPIQEIGVIGAREMYR------------SL--
K9TTH5_9CYAN/6-160-----------.AYG-ERQ..RALCLRDYGWYLRLITYGVLAG---DKEPIEKIGLVGVREMYN------------SL--
Q7U7B1_SYNPX/9-166-----------.AYT-TRR..LAACLRDMDYFLRYASYALVAA---DSTILNERVLNGLDDTYK------------SL--
K9TY40_9CYAN/7-164-----------.AYT-TRR..YNMYVRDMNYFLRYCSYAIVAG---DASVLDERLLAGLRDTFN------------SL--
K9P5D8_CYAGP/8-172-----------.AYT-HRR..VAACLRDLDIILRYVTYAVYLG---DASVLEDRCLNGLRETYL------------AL--
K9U651_9CYAN/7-164-----------.AYT-TRR..YAACLRDMDYYLRYATYALVAG---NMDVLDERVLQGLRETYN------------SL--
K9XTU9_STAC7/7-164-----------.AYT-TRR..YSACLRDMDYYLRYASYALVAG---DMNVLDERVLQGLRETYN------------SL--
U5QS61_9CYAN/34-186-----------.LYP-QAR..ADACWRDFWHFLRCISYGVAAE---RHDFTSSEGLHYMGLLYQ------------EL--
B0C339_ACAM1/7-156-----------ALPT-TRR..YAACVRDLDFYLRYATYAMVAG---DTTILDERVLNGLKETYL------------AL--
K9SW00_9SYNE/6-160-----------.AYG-QRQ..RAQCLRDYGWYVRLISYGILAG---DKDPIESIGIIGVREMYN------------SL--
K9PBM8_CYAGP/6-160-----------.AYG-EEM..TASCLRDMDYYLRLVTYGVVAG---DVTPIEEIGVIGAREMYR------------AL--
K9Y8I8_HALP7/7-164-----------.AYT-TRR..YSACLRDMDYYLRYATYALVAG---DTYVLDERVLQGLRETYN------------SL--
Q10UW8_TRIEI/7-161-----------.NYA-STEIGKQKCSRDIGYYLRMVTYCLIAG---GTGPMDEILIAGISEINS------------TF--
Q7NL79_GLOVI/7-160-----------.MYT-TRR..YAACIRDMDYFLRYATYAMLAG---DPSILDERVLNGLKETYN------------SL--
K9P5A2_CYAGP/7-160-----------.AFG-QKQ..RAQCLRDYSWYLRLVTYGILAG---STELIQQIGVVGAREMYN------------SL--
A5GL99_SYNPW/7-160-----------.AYG-QKQ..RAQCLRDYSWYLRLVTYGVLAG---STEMIEQIGLIGAREMYN------------SL--
K9SQ75_9CYAN/7-161-----------.NYA-STQRGKDKCVRDIGYYVRMVTYCLIVG---GTGPMDDYLIGGLTEINR------------TF--
Q10ZG9_TRIEI/37-188-----------.LYP-QAR..AEACWRDFWHFLRCITYGIAGN---NKEFTSQEGLHYMNLLYQ------------EL--
PHCB_SYNP2/7-171-----------.AYT-NRR..MAACLRDMEIILRYVTYATFTG---DASVLNDRCLNGLRETYV------------AL--
Q10XZ6_TRIEI/7-164-----------.AYT-TRR..YAACLRDMDYYLRYATYALVAG---NTDVLDERVLQGLRETYN------------SL--
U5QNF8_9CYAN/7-160-----------.AYG-EKR..LGSCIRDLGWYYRLITYSIVAG---NNEPVDRIGLTGIFEMYR------------ML--
K9PDX9_9CYAN/6-157-----------....-ERK..TASCQRDQGWYVRLVAYSILAG---SEKPLEEIGTIGIKEMYN------------NL--
Q117G1_TRIEI/7-161-----------.IGA-EVQ..KSKCKRDIVHYLRLINYCLVVG---GTGPVDEWGIAGAREVYK------------AL--
K9P457_CYAGP/8-162-----------.NYA-FDARGKAKCSRDIGYYLRHITYSLVAG---GTGPLDEYLIAGLDEINR------------AF--
B7K6K8_CYAP8/35-188-----------.LYP-PER..AEACWRDFWHFLRCITYAIAGN---SPQFTSQEGLENMQLLYQ------------EL--
K9TWK3_9CYAN/6-157-----------....-RTY..RASCLRDQDWYIRLIAYTVIVG---DVEPLKDIGIVGVKEMYE------------SL--
G3XCS9_PROMA/7-154-----------.NYE-QAN..KDKCSRDIHHYLRLINYCLVTG---GTGPLDEWGIAGMREVIR------------IQ--
K9XAE9_9CHRO/6-160-----------.AYG-QEM..TATCLRDMDYYLRLITYGVVAG---DVTPIEEIGVVGVREMYK------------SL--
K9TI03_9CYAN/11-165-----------.AYG-QRQ..RAQCLRDFGWYLRLATYGVLAG---DKGPIEKIGIIGAREMYN------------AL--
Q7V590_PROMM/7-154-----------.KYD-LAT..RDKCARDINHYLRLINYCLIAG---STGPLDEWGIAGVREVFR------------TL--
E0U6S4_CYAP2/34-186-----------.LYP-PER..AQACWRDFWHFLRCISYGIAGQ---TIPFTRAEGLKNMQLLYQ------------EL--
K9SFN5_9CYAN/6-164-----------SVHT-NIE..TNLCLDDGESILQYVTYSLLSG---SASILEEHYLDRFIEKYL------------DL--
K9RE36_9CYAN/7-164-----------.AYT-TRR..YAACLRDMDYYLRYATYALVAG---SMDVLDERVLQGLRETYN------------SL--
Q8DIN1_THEEB/16-170-----------.AYG-QKQ..RALCLRDYGWYMRLITYGILAG---DKDPIERTGIIGVREMYN------------SL--
Q2JLK1_SYNJB/7-160-----------.MYT-TRR..YAACIRDMDYYLRYATYAMLAG---DPSILDERVLNGLKETYN------------SL--
Q7NLD7_GLOVI/7-163-----------.GDS-AEK..VAKCYRDIDHYMRLINYCLVVG---GTGPLDEWGISGAREVYR------------AL--
PHEB2_SYNPX/7-177-----------.VYT-NRK..MAACLRDGEIVLRYVSYALLAG---DASVLQDRCLNGLRETYA------------AL--
K8GH86_9CYAN/6-155-----------....-PTY..RASCIRDQGWYIRLVTYALVEG---DTKIIDTVGIRGAKEMYI------------SL--
B7K2Z2_CYAP8/11-156-----------DN..-.....IKLVSNIIDSFLKDIALSMLAG---DPSILDKYRLNEFHEYLK------------SV--
Q117E9_TRIEI/6-178-----------.CYP-NRR..MAACLRDGEIILRYVTYALIAR---DDSILNDRCLNGLKETYI------------AL--
K9WFS1_9CYAN/7-161-----------.NYA-ADQRGKDKCVRDIGYYLRIVTYCLVAG---GTGPLDEYLIAGLDEINS------------TF--
K9ZE77_ANACC/7-171-----------.CFH-HRN..QAACIRDLGFILRYVTYSIATG---DSSIMDDRCLNGLRETYQ------------AL--
A5GVM9_SYNR3/34-181-----------.LYP-EHR..AEACWRDCFHFLRVCCYAVAVA---QPKFTNPEGMAALGELYA------------AL--
K9UJM8_9CHRO/7-161-----------.NYA-STPRGKAKCARDIGYYVRMISYCLIAG---STGPMDDYLIGGLAEINS------------TF--
PHAC_SYNP2/6-160-----------.AAT-TKQ..YNQCLRDYGWYLRLVTYGILAG---DKDPIERIGLIGVKEMYN------------AL--
PHEB_PROMP/7-174-----------.LDT-TNK..MSVCLRDGEIILRIVSYLLISD---DESVLSKNCLKDLKNTYL------------AL--
K9T481_9CYAN/7-160-----------.MYT-CRR..YAACIRDLDYFLRYATYAMLAG---DPSILDERILNGLRETYN------------SL--
PHAC_SYNY3/6-160-----------.AYG-QRQ..YNQCLRDYGWYLRLVTYGVLAG---NKEPIETTGLIGVKEMYN------------SL--
PHEA1_SYNPW/7-163-----------.GEN-QTK..VDKCYRDLGHYLRLINYCLVVG---GTGPLDEWGIAGAREVYR------------TL--
K9XWE3_STAC7/7-183-----------.CYP-NRR..MAACLRDGEIILRYVSYAILSG---DASVLEDRCLNGLKETYT------------AL--
K9XKS9_9CHRO/7-160-----------.MYP-TRR..YAACIRDLTLFLRYATYAMLAA---DPSILDERVLDGLKETYN------------SL--
K9SIK8_9CYAN/7-160-----------.AYT-TRR..YAACLRDVDYFLRYATYALVAG---DNFVLDERVLQGLRETYN------------SL--
Q7NJA2_GLOVI/7-160-----------.MYY-ARR..FAACIRDMEYFLRYATFAMVAG---DTSLLDEYVLNGLKETYT------------SL--
K9P3V2_CYAGP/7-164-----------.AYT-TRR..LAACLRDMDYFLRYASYALVAD---DFTILDERVLNGLDDTYK------------SL--
PHEB_PROMA/7-181-----------.CYP-TRR..MAACLRDGEIILRYVSYALLAG---DPSVLDDRCINGLKETYI------------AL--
K8GG80_9CYAN/6-156-----------....-LRK..TNSCQRDQGWYIRLVAYCVLAG---SQKPLEEIGTIGMKEMYR------------SL--
B0JFY1_MICAN/7-164-----------.AYT-TRR..YSACLRDMDYYLRYASYALVAA---DTNVLDERVLQGLRETYN------------SL--
Q10YG0_TRIEI/6-160-----------.AYG-EEM..TATCLRDLDYYLRLISYGIVSG---DVTPIEEIGLVGVREMYK------------SL--
K9Q0C3_9CYAN/7-161-----------.TYA-SSAVGKEKCARDIGYYLRMVTYCLVAG---GTGPMDEYLVAGLDEINR------------TF--
B0JXA2_MICAN/8-162-----------.NYA-YDERGKSKCVRDIGYYIRIITYALVVG---GTGPIDEYLVAGLSEINS------------AF--
K9T2W8_9CYAN/6-157-----------....-PRK..TASCQRDQGWYIRLIAYSVLAG---SEKPLEEIGTIGIKEMYN------------SL--
Q117G0_TRIEI/7-178-----------.VYT-TRK..MAACLRDGDIILRYICYALLAG---DASVLNDRCLNGLKETYA------------AL--
B8HS99_CYAP4/7-164-----------.AYT-TRR..YAACLRDMDYYLRYATYALVAG---DTDVLDERVLEGLRETYN------------SL--
B2J4C1_NOSP7/8-162-----------.NFA-SDARGKGKCVRDVGYYLRIITYALVVG---GTGPLDDFLISGLAEINR------------TF--
K9SBH1_9CYAN/7-161-----------.NMA-ADARGKAKCARDIGYYLRIVTYCLVAG---GTGPLDEFLLAGLDELNR------------AF--
K9PZN7_9CYAN/7-163-----------.AYT-TRR..YSACLRDMDYYLRYGTYAIIAG---NNDILNERVLQGLRETYN------------SL--
Q2JJL1_SYNJB/7-162-----------.AYT-TRR..YATCLRDMDYFLRYASYALVAA---DNSILDERVLAGLRETYN------------SL--
A5GTI9_SYNR3/7-164-----------.AYT-TRR..LAACLRDLDYFLRYASYALVAA---DWKMLDERVLNGLNDTYK------------SL--
K9TVG8_9CYAN/7-160-----------.MYT-CRR..YAACVRDLDYFLRYATYAMLAG---DTSILDERILNGLRETYN------------SL--
A5GVQ8_SYNR3/7-161-----------.NYS-TTPEGKAKCSRDVGYYLRMITYCLVAG---GTGPMDDYLIAGLDEINR------------TF--
K9R5H1_9CYAN/6-160-----------.AYG-QRE..RALCIRDYGWYLRLVTYGILAG---DKDPIEKIGLIGVKEMYN------------SL--
K8GCZ2_9CYAN/7-164-----------.AYT-TRR..HSMYLRDMDYFLRYSSYALLTG---DTSILDERLLAGLKDTFN------------SL--
Q46H72_PROMT/7-154-----------.SYE-QAN..KDKCVRDIHHYLRLINYCLVTG---GTGPLDEWGISGMREIIR------------IQ--
K8GTM9_9CYAN/7-164-----------.AYT-TRR..YAACLRDMDYYLRYASYALVAG---DTDVLDERVLEGLRETYN------------SL--
Q7M7C7_GLOVI/7-171-----------.AYP-NRR..MAACLRDMEIILRYVSYALLAG---DASVLEDRCLNGLKETYV------------AL--
K9Q339_9CYAN/12-160-----------....-.....YTACLRDLDFFLRYSTYTMIAG---DYSILDKRVLNGLAETYT------------SL--
PHCA_SYNE7/8-162-----------.NFA-STPEGKAKCARDIGYYLRIVTYALVAG---GTGPIDEYLLAGLDEINK------------TF--
K9PVY8_9CYAN/33-185-----------.LYP-AFR..ADACWRDFWHFLRCVTYGITTD---RTDYTSKAGLGFMEQLYQ------------EL--
K9WJQ0_9CYAN/7-183-----------.CYP-NRR..MAACLRDAEIILRYVTYALLAG---DASVLDDRCLNGLKETYA------------AL--
Q2JMW3_SYNJB/7-161-----------.GHG-DVF..QAKCARDIGYYLRFITYSLVAG---GTGPLDEYLVAGLREVNR------------SF--
K9T540_9CYAN/6-157-----------....-MRK..TASCQRDQGWYIRLIAYCVLAG---NEQPLAEIGTIGMKEMYQ------------SL--
Q31Q35_SYNE7/35-183-----------.LYP-EAR..SQSCWRDCWQFLRCLSYGVAAG---RADYATPAGFEALAVVYE------------EL--
B8HKY2_CYAP4/8-172-----------.AYT-NRR..AAACLRDLEIILRYITYAIFTG---DASVLDDRALNGLRETYL------------AL--
B2J9I8_NOSP7/36-187-----------.LYP-PER..AQACWRDFWHFLRCITYGIAGG---HADYTNPTGLHYMNLLYQ------------EL--
K9UJL4_9CHRO/35-186-----------.LYP-AAR..AEACWRDFWHFLRCVTYGIAGG---SVEYTSDMGLDYMNLLYQ------------EL--
K9XKJ2_9CHRO/7-171-----------.AYT-NRR..MAACLRDMEIILRYVTYAVMAG---DASVLDDRCLNGLRETYQ------------AL--
Q8DHC5_THEEB/7-164-----------.AYT-TRR..YATCLRDMDYYLRYASYAIVAG---DVDVLNERVLEGLRETYN------------SL--
E8R540_ISOPI/10-154-----------.LDT-MHERAWSKAMRDFSLVLRYAVHSMILD---DPDLGEERLYVWFRTILG------------SL--
Q2JI97_SYNJB/7-171-----------.AYP-SRN..VAACMRDMDIILRYITYAVAAG---DASVLNERCLNGLRETYQ------------AL--
Q2JI98_SYNJB/8-159-----------.CH.-.TQAGKDKCARDVRHYLRYITYCLVAG---GTGPLDEYQLAGIREINA------------AF--
K9WKR7_9CYAN/37-189-----------.LYP-AER..ADACWRDFWHFLRCITYGIAGQ---HTDYTSTDGLHYMQLLYQ------------EL--
Q31RP7_SYNE7/6-160-----------.AYG-QRQ..RAQCLRDYGWYLRLITYGVLAG---DKEPIESIGLLGAREMYN------------SL--
D4ZTI6_ARTPN/7-164-----------.AYT-TRR..YAACLRDMDYYLRYATYALVAG---DTDVLDERVLQGLRETYN------------SL--
K9XIF5_9CHRO/6-157-----------....-PQK..TALCQRDQSWYLRLISYAVLAG---NMKPLEDIGVDGMREMYT------------SL--
K9SXI2_9SYNE/7-160-----------.AYT-TRR..YAACLRDLDYYLRYATYALVAG---DNYVLDERVLQGLRETYN------------SL--
K9UCA0_9CHRO/6-160-----------.ASG-QKQ..RAQCIRDYGWYLRLVTYGVLAG---DKGPIEQIGLIGVRDMYN------------SL--
K9SCA6_9CYAN/6-160-----------.AYG-QRE..RALCLRDYGWYLRLITYGVLSG---SKDPIEKIGVIGAREMYN------------SL--
PHCA_SYNP2/7-161-----------.NFA-ADQRGKDKCARDIGYYLRMVTYCLVAG---GTGPMDEYLIAGVDEINR------------TF--
Q2JMW4_SYNJB/7-171-----------.AYT-NRR..MAACLRDMEIILRYITYATLAG---DSSVLEDRCLNGLRETYI------------AL--
K8GE61_9CYAN/7-160-----------.MYT-CRR..YAACIRDLDYFLRYATYAMLAG---DPSILDERVLNGLRETYN------------SL--
K9T5F0_9CYAN/6-157-----------....-ATF..RASCMRDQGWYIRLITYAIVVG---DIEPLEKTGIKGVREMYE------------SL--
Q7NL72_GLOVI/36-187-----------.LYP-SVR..AEACWRDYWHFLRSITYGIAAR---RPNFTSPEGVHYLHLLYQ------------EL--
K9Z238_CYAAP/6-160-----------.AAG-QKQ..YNQCIRDFGWYLRLATYGVLAG---DKEPIEKIGLIGAKEMYN------------SL--
K9XNJ3_STAC7/6-160-----------.AYG-KEK..TATCLRDMDYYLRLVSYSIAAG---DGAPIQELGIVGVSQMYK------------SL--
K9PC78_9CYAN/6-157-----------....-MRK..TASCQRDQGWYIRLVAYCILAG---NEQPLEDIGTIGMKEMYA------------SL--
K9YD01_HALP7/6-160-----------.AFG-SRE..RSLCIRDYGWYLRLITYGIVAG---DKQPIESIGLVGVREMYN------------AL--
K9TVZ1_9CYAN/6-157-----------....-ARK..TEAAMRDIGWYIRLVSYCLLAG---NEKPLEEIGLIGMKELYN------------SV--
K9SQM2_9CYAN/38-189-----------.LYP-PER..AEACWRDFWHFLRCVTYGIAGG---RTDYLSAVGLDYLQQLYH------------EL--
K9VPV9_9CYAN/6-160-----------.AYG-QRE..RALCLRDYGWYLRLITYGILAG---DKEPIESIGLIGVREMYN------------SL--
K9T6U8_9CYAN/35-186-----------.LYP-PER..AEACWRDFWHFLRCISYGIAGQ---STAYTSQEGLNNMQLLYQ------------EL--
Q7U6V7_SYNPX/7-160-----------.AYG-QKQ..RAQCLRDYSWYLRLVTYGVLAG---STEMIQDIGLVGAREMYN------------SL--
PHCB_SYNE7/8-172-----------.AYT-NRR..MAACLRDMEIILRYVTYAVFTG---DASILDDRCLNGLRETYL------------AL--
O50209_SYNE7/7-164-----------.AYT-TRR..YSACLRDLDYYLRYATYALVAG---NTEVLDERVLQGLRETYT------------SL--

PF01152

Q7CX73_AGRT5/7-127-----------RAIH.PAD--LSGSEAKFYDYLT----GYLGG---PPVYVEKHGHPMLRRRHF------------VA--
Q8XXM3_RALSO/11-128-----------RALHP.PS--LDGSRDKLFWFLC----GWLGG---PSHYIERFGHPRLRARHL------------PF--
B2J6Y7_NOSP7/3-117-----------PIFA.GTD--MAKQRNHLVAFLG----QIFEG---PKQY...GGRP.MDKTHA------------GL--
F2CUR6_HORVD/26-145-----------EIFS.GSK--KEDAIQNQYEFLV----QRMGG---PPLFSQRRGHPALIGRHR------------PF--
TRHBN_MYCTU/14-127-----------AFFS.GTN--MSRLKGKQVEFFA----AALGG---PEPYT...GAP.MKQVHQ------------GR--
Q63VR4_BURPS/25-145-----------RALH.PPT--LEGSRDKLFWFLC----GWLGG---PDHYIERFGHPRLRARHL------------PF--
GLB3_ARATH/26-142-----------SIFS.NSN--KEDAIQNQYEFFV----QRMGG---PPLYSQRKGHPALIGRHR------------PF--
Q7APC3_RHIME/8-128-----------RAVH.PPD--LTGSEEKFYEYLT----GWLGG---PPIYVQKRGHPMLRRRHF------------IA--
TRHBO_MYCLE/4-122-----------ELYP.ADD--LAGAEERLRMFLE----QYWGG---PRTYSSQRGHPRLRMRHA------------PF--

PF00042

Q19601_CAEEL/105-215---------------------IKAIFG.L..EKIPTGRLKYDP---RFRQHALVYTKTLDFVIR------------NL..
GLB1B_ANATR/17-122---------------------ARTKFARL.GDVS...AGKDNS---KLRGHSITLMYALQNFID------------AL..
HBP1_CASGL/7-116---------------------SKYVFS.FLKD..SNEIPENNP---KLKAHAAVIFKTICESAT------------ELRQ
GLB1_PARCH/17-123---------------------AQNKFPQM.AGMS.ASQLRSSR---QMQAHAIRVSSIMSEYIE------------EL..
MYG_GALGA/3-108---------------------SQSYFPKL.KN.KSLGELKDTA---DIKAQADTVLKALGNIVK------------K...
HBAT_HORSE/7-107---------------------TTTYFLHL..DLS.....LGST---QVKAHGQKVADALTLAVE------------HL..
HBA1_PLEWA/7-107---------------------TRIYFP.A.KDLS.....ERSS---YLHSHGKKVVGALTNAVA------------HI..
HBB0_MOUSE/8-112---------------------TQRFFDKF.GNLSSAQAIMGNP---RIKAHGKKVLTSLGLAVK------------NM..
HBA1_XENBO/7-107---------------------TKTYFPTF..DFH.....HNSK---QISAHGKKVVDALNEASN------------HL..
GLB_PAREP/8-117---------------------YIIHFSRL.EG.HTIENVMQSE---GIKHYARTLTEAIVHMLK------------EI..
HBB1_CYGMA/8-112---------------------TQRHFSGF.GNLYNAEAIIGNA---NVAAHGIKVLHGLDRGLK------------NM..
MYG_CYPCA/3-108---------------------TQKLFPKF.VG.IASNELAGNA---AVKAHGATVLKKLGELLK------------A...
HBB2_XENLA/8-112---------------------TQRYFSNF.GNLSNSAAVAGNA---KVQAHGKKVLSAVGNAIS------------HI..
HBAZ_CAPHI/7-107---------------------AKTYFPHF..DLH.....SGSA---QLRAHGSKVVAAVGDAVK------------SI..
HBF1_URECA/7-113---------------------DLAFFHKF.SS.VPLYGLRSNP---AYKAQTLTVINYLDKVVD------------AL..
HBB1_XENBO/7-111---------------------TQRYFSSF.GNLNSADAVFHNE---AVAAHGEKVVTSIGEAIK------------HM..
LGB1_LUPLU/8-116---------------------AKDLFS.FLKGSS..EVPQNNP---DLQAHAGKVFKLTYEAAI------------QLQV
MYG_HETPO/3-108---------------------TKDLFPKF.KE.IPVQQLGNNE---DLRKHGVTVLRALGNILK------------Q...
HBAD_LIOMI/6-106---------------------SKTYFSHF..NLS.....PGSK---DIIHQGEKVGKALDSALK------------HL..
A0A017IB98_ECOLX/6-103---------------------LKEIFN.M...........SNQ---RNGDQREALFNAIAAYAS------------NI..
Q18311_CAEEL/32-140---------------------IKLAFG.I.AE.N..ESPMQNA---AFLGLSSTIQAFFYKLII------------TYE.
GLB73_CHITH/23-129---------------------IQAKFPQF.AG.KDLASIKDTG---AFATHATRIVSFLSEVIA------------LSGN
HBB_LITCT/1-105---------------------TQRYFSTF.GNLGSADAISHNS---KVLAHGQRVLDSIEEGLK------------HP..
HBBN_AMMLE/2-106---------------------TZRFFZHF.GBLSSABAVMBBA---KVKAHGKKVLBSFSBGLK------------HL..
HBAM_LITCT/6-102---------------------TKSFFSRF..DIS.....PGSQ---DLLTHGGKIFGALGEAIK------------SL..
HBA3_PLEWA/7-107---------------------TRTYFSHF..DLS.....PGSA---DVKRHGGKVLSAIGEAAK------------HI..
HBAD_PASMO/6-106---------------------TKTYFPHF..DLS.....QGSD---QIRGHGKKVVAALSNAIK------------NL..
HBB_HETPO/7-106---------------------TTRYFGNL.KEFT.....ACSY---GVKEHAKKVTGALGVAVT------------HL..
A2VF80_MYCTX/42-136---------------------VRDLFP.P..........DMGA---QRAAFGQALHWVYGELVA------------Q...
HBA_LEPPA/7-108---------------------TKSYFPHFGHDFS.....ANNE---KVKHHGKKVVDAIGQGVQ------------HL..
GLB8_CHITH/9-115---------------------IQAKFPQF.AG.KDLDSIKDSA---DFAVHSGRIVGFFSEVIG------------LIGN
GLB2_LUMTE/8-114---------------------SRSLFKRVHGDDT......SHP---AFIAHAERVLGGLDIAIS------------TL..
Q20638_CAEEL/74-184---------------------CKQLFP.F.ISKYQGDEWKESK---EFRSQALKFVQTLAQVVK------------NIYH
HBB_ALLMI/7-111---------------------KRRYFEHF.GKMCNAHDILHNS---KVQEHGKKVLASFGEAVK------------HL..
HBA_CATCL/6-107---------------------TKTYFAHW.ADLS.....PGSG---PVKHGKKVIMGAIGDAVT------------KF..
HBA_SQUAC/6-107---------------------TKTYFSKF.TDFS.....ANGK---RVKAHGGKVLNAVADATD------------HL..
GLB2_TYLHE/9-115---------------------ARDLFKRVHGEDV......HSP---AFEAHMARVFNGLDRVIS------------SL..
GLB1_GLYDI/6-111---------------------MAAVFG.F.SG.......ASDP---GVAALGAKVLAQIGVAVS------------HL..
GLB10_CHITH/11-117---------------------IMAKFPKF.AG.KDLEAIKDTA---DFAVHASRIIGFFGEYVT------------LLGS
HBB_LEPPA/7-111---------------------TKRYFNSF.GDLSSPGAIKHNN---KVSAHGRKVLAAIIECTR------------HF..
GLB1_TYLHE/7-110---------------------RS.LFNRVNGDNV......YSP---EFKAHMVRVFAGFDILIS------------VL..
HBA1_TORMA/6-107---------------------TKSYFPKF.SGFS.....ANDK---RVKHHGALVLKALVDTNK------------HL..
GLB6_CHITH/22-128---------------------IMAKFPQF.AG.KDLDSIKDSA---AFATHATRIVSFLSEVIS------------LAGS
GLB_BUSCA/6-116---------------------TKKHFKHF..DDATFAAMDTTG---VGKAHGVAVFSGLGSMIC------------SI..
GLBH_CAEEL/10-119---------------------LRVYFKGA..EKYTADDVKKSE---RFDKQGQRILLACHLLAN------------VY..
GLB2_NIPBR/16-114---------------------LRKYFKGA..ENFTADDVQKSD---RFEKLGSGLLLSVHILAN------------TF..
GLBH_TRICO/30-132---------------------LRKYFKGA..ETFTADDIAKSD---RFKKLGNQLLLSVHLAAD------------TY..
GLB_PSEDC/21-134---------------------MKKYFKHR..ENYTPADVQKDP---FFIKQGQNILLACHVLCA------------TY..
GLB_CERRH/6-116---------------------TRNYFTHF.GNMS.DAEMKTTG---VGKAHSMAVFAGIGSMID------------SM..
GLB2_CHITH/22-128---------------------IMAKFPQF.AG.KDLETLKGTG---QFATHAGRIVGFVSEIVA------------LMGN
GLB_TUBTU/6-112---------------------IRGLFKRVDGD.N.....AYSA---EFEAHAERVLGGLDMTIS------------LL..
GLB3_LAMSP/7-113---------------------ARDLFKRVRGDNI......HTP---AFRAHATRVLGGLDMCIA------------LL..
GLB_ASCSU/21-134---------------------LRKYFKNR..EEYTAEDVQNDP---FFAKQGQKILLACHVLCA------------TY..
GLB1_CALSO/5-105---------------------ISEAFVKA........GTGSGI---AMKRQALVFGAILQEFVA------------NL..
GLB2_CALSO/5-108---------------------IRHAFESA........GATNDT---EMEKQANLFGLMMTQFID------------NL..
MYG_ALLMI/7-113---------------------TQERFEKF.KHMKTADEMKSSE---KMKQHGNTVFTALGNILK------------Q...
Q21978_CAEEL/165-283---------------------LRPLFG.L.SESDDVFDLPDNH---PVRRHARLFTSILHISVK------------NV..
HBB_SQUAC/7-107---------------------TKTYFVKFNGKFH.....ASDS---TVQTHAGKVVSALTVAYN------------HI..
GLB3_TYLHE/8-117---------------------AKGVFGRVNVD.K.....PSEA---DWKAHVIRVINGLDLAVN------------LL..
GLBT_CHITH/13-116---------------------NFPMFKKL.GN..DLAAAKGTA---EFKDQADKIIAFLQGVIE------------KLG.
GLB3_CHITH/20-120---------------------IMAKFTQF.AG.KDLESIKGTA---PFEIHANRIVGFFSKIIG------------EL..
GLB1_CHITH/21-126---------------------IQTAFSQF.AG.KDLDSIKGTP---DFSKHAGRVVGLFSEVMD------------LLGN
LGB1_MEDSA/7-112---------------------AKGLFS.F...LKNSAEVQDSP---QLQAHAEKVFGLVRDSAV------------QL..
GLBC_NIPBR/21-135---------------------LRKFFKGA..ENFGADDVQKSK---RFEKQGTALLLAVHVLAN------------VY..
HBA1_IGUIG/6-106---------------------TKTYFAHF..DLN.....PGSA---QIKAHGKKVVDALTQAVN------------NL..
HBA1_BOSMU/6-106---------------------TKTYFPHF..DLS.....QGSA---QVKGHGAKVAAALTKAVE------------HL..
GLB_APLJU/6-113---------------------SANFFNDF.KG.KSLADIQASP---KLRDVSSRIFARLNEFVS------------NA..
HBA_HETPO/13-114---------------------TKSYFKDY.KDFT.....AAAP---SIKAHGAKVVTALAKACD------------HL..
BAHG_VITST/6-103---------------------VRPLFD.M.......GRQESLE---QPKALAMTVLAAAQNIEN------------L...
GLB4_TYLHE/8-117---------------------TKGLFKRVNVDDT......HSP---EEFAHVLRVVNGLDTLIG------------VL..
GLB4_LUMTE/11-120---------------------SKALFERVKIDEP......ESG---EFKSHLVRVANGLDLLIN------------LL..
HBP2_CASGL/13-122---------------------AQKLFS.FLKD..SNVPLERNP---KLKSHAMSVFLMTCESAV------------QLRK
GLBP1_GLYDI/7-115---------------------MMFIFG.YSGR.T..EALKHSS---KLQHHGKVIIDQIGKAVA------------EM..

PF11563

E1FPN0_LOALO/43-200..............PEEQRCELASSLRNYLKNV......VNQL...TDRAAVQRISEDFGARHVQ.........YRSF--
Q5B5X9_EMENI/37-216P......IEDFYNEDSPPIMRRKMFLRWYLTKI......VTDP...MQMDFWRYLNK.VGLMHTAQE......RIHPL--
A2QBB3_ASPNC/24-203E......PDDYPTLNSPAVQRRRQFLRWYMTKL......CSDP...TKPEFWRYLNQ.VGRMHYGKE......RLHSL--
C4JH72_UNCRE/22-201S......LDEQPDENSPQILHRKMFLRGYLNRL......CSDP...SKMEFWEYLDK.VGMMHVGRG......REHPL--
C4XIT4_DESMR/15-174...............SGTLGRLKHHMSNYILDM......FSGT...YDDVYVLSRLR.IGLVHD............RI--
D4AN62_ARTBC/20-213STVSATTSVADLSLTHPNILHRKDFLKSYLVKL......VSNSDWSDDSKFWEYLDK.VGVMHTGKPGFKHREKRPEL--
E9E781_METAQ/19-198E......VGETLHEDSPQIVHRKMFLRAYLNKL......CSDP...SKMEFWEYLDK.VGMMHVGLG......RKHPL--
E6U0Q9_BACCJ/24-180...............NSSIDRLKVTLKQHITEM......FDGL...IDEQYYSKRVR.IAHIHV............KI--
B6HCY7_PENCW/23-203E.....PEEEYLHEETPKIQRRKMFLRWYLTRL......CQDP...TTMDFWRYLNK.VGMMHSGQV......RMSPL--
Q218B7_RHOPB/3-166...............PERMVHARKMQIKHWGVI......LDGK...FDEAYEASVTK.VGEVHN............KL--
D3FWD3_BACPE/27-184...............HSTRERLKGVFLYYLKNV......VEGD...VSLEDIRKKQK.VGSVHN............NS--
B7GLD2_ANOFW/25-175.......................ARIEAYLNAF......FTME...RNRAYVDESLR.FFHLLR............KE--
A4Y0T1_PSEMY/34-186...............PATTARLKHSQCDYYRRL......WHSP...LDQAYVLERLR.IGWVHQ............HV--
C4L4W7_EXISA/25-181...............HSSSDKLKLTLSNHIMEM......FEGK...LNEAYIDRRLA.IAKRHY............LI--
A1C4D9_ASPCL/22-201Q......VDDYFTIDSPHVQRRKIFWKWYLTRF......FSDP...SQIEYWQYLEK.VGTMHTGKI......LLHPL--
Q7NUX9_CHRVO/5-158..............HGCDQDELAAMLLAEWDAL......LSAP...LDSAVAAALVE.QGELYC............RL--
E0SCN2_DICD3/9-166...............QQVANQLNESMYHWLRSV......LGSAT.ESLSALLERQQQ.VGVIHA............RI--
C7Z0G0_NECH7/17-196P......LQSVLDDNSPELQERKNFLNSYLTKI......CSDQ...SKMAFWEYLDN.VGAMHVGLR......RSKPL--
A9GCE3_SORC5/10-164...............EEQVERLKRSLVRWMTRI......CTGP...YDGAYFDESAK.IGRIHV............RV--
F0XJU9_GROCL/20-199P......LDAVPAEDSPQILHRKMFLRAYLARL......CSDP...SQMTFWEYLDK.VGMMHVGLG......RAHPL--
Q5WC98_BACSK/26-182...............HSSIDALKQTLKQHILEM......FEGK...VDAAFFAKRKR.IAQTHV............RI--
Q9KFH4_BACHD/32-188...............HSSVERLKETLKQHILEM......FNGE...IDQAFLQKRLQ.IAQAHV............RI--
B9JTP3_AGRVS/26-192...............ERQIDRLHDLYVSHWDVM......TDAR...FDALYAERVKV.LADSQS............RM--
D2QY57_PIRSD/6-164..............GPQQVARLQKTLHNWIEQF......LTGP...YDNHYVDARVN.VGLRHV............EI--
B1YHV6_EXIS2/30-187...............SSTRERLKKVFADYFGSL......LTGN...MDDKFLAMRTR.MGKTHN............RN--
B9JUN1_AGRVS/7-170...............DSHIEHAKQKQIKHWSHL......LSGH...LDGAYVASATT.IGRTHA............KL--
Q3IUQ9_NATPD/29-196..............STKSVEMLKETQREYLLNL......ADGD...YGQSYFDRRAR.VGKIHD............ML--
C5G9L3_AJEDR/20-214NEPAAAGSVAELALDHPNIVHRKDFLKNYLIRL......VSNKDWSDESSFWGYLDK.VGIMHTGQAGFKHREKRPKL--
A2QT04_ASPNC/23-202D......VDEYPEFKSPYMQCRRMFLRWYITRI......CSDP...TKIEFWAYLDK.VGRMHRGKD......RMISF--
C7ZI09_NECH7/13-198P......SKDELSSDSSLLMERQNFLNSYLTKMSQLSKGSSDQ...SKMAFWEYLDS.VGAMHVGLQ......KSREL--
B1HNN8_LYSSC/36-192...............TSHIDRLKITLHKHLSDI......FESH...INDAYIAERKA.IAEAHV............RI--
B1YG08_EXIS2/27-183...............HSTLERLKGTLAKHILQM......FDGQ...VTPDYINVRKR.IADRHV............RI--
C0S330_PARBP/20-213TEP.AEASISELSLDHPNIVHRKDFLKNYLVRL......VSNKNWADDSPFWDYLDK.VSVIHTGKAGFKHREKRPKL--
A0KND7_AERHH/15-171...............ADTLTRLRAAQRRYILDL......FSGL...YDLEYVNNRLR.IGLVHK............RI--
D8PPS9_SCHCM/66-254PI...PTKLDDLTLDSAQLVYRKVFMKNWCRRL......LSSD..FSSPKTFTWMDK.VGVMHTGVKSFKHRTHVSPL--
B3QU69_CHLT3/11-161.................KIERMRETLKGWFLEL......FTGD...YNDKYVKSRLQ.IGKVHV............RI--
B2IB39_BEII9/3-168...............KSHMGHARQRQLDHWKVL......FNAE...FGADYERAVLA.IGRTHA............RL--
Q3JC52_NITOC/22-196............EPDSSYLAAVRKRFAQWILDT......CNRT...YDQDWLNYQHE.IGLRHYHTKKNKTDNVQSVP--
D2R7K0_PIRSD/13-194PT...ATSVDNLRADDPQIAFRKTHLARYLRAL......VERT...YDAKMVSYLDM.VGKMHTPLA......GSSEL--
Q2Y8W7_NITMU/15-174.............GTEAFRQKWKYRLRSFGKNF.............ATPGYFEERLA.LAAAFA............HA--
F2F0J0_SOLSS/31-187...............RTKIDRLKKTLSSYIISM......FDGV...FNEETIEAKRK.LARMHF............KI--
F2F399_SOLSS/32-188...............SARMDRLKGTLTKHLEAM......FNCN...INSHYIEERQT.IAHVHV............KI--
C0ZJ13_BREBN/21-178...............HTTVDRLAVSFRHYLQSL......PHAK...LDDAYVAGRKK.IGEVHS............KI--
B0ULQ7_METS4/3-159.................QQTRLVAAQSAHWEQL......FSGR...FDAGYVDSIRR.IGRVHH............KI--
C6WYR1_METML/18-175...............PDQLSQLKQKQRGYFKQI......FTGD...YGPGYIKSRLR.VGVTYQ............QL--
B9J942_AGRRK/14-180...............ESQLERLQDLQSSHWDVL......TDAR...FDSLYAERVKV.LSDSES............KM--
C0ZKX8_BREBN/35-191...............NSTIERLKLTLKRHICEM......FSGR...IDSAYIEQRSR.IAVIHM............RI--
A9CJK8_AGRT5/7-170...............EAHIHHAKSMQLKHWSRI......ASGT...FNEDYTNAVTA.IGRTHA............RL--
C4KYX4_EXISA/28-185...............SSTRERLKKVFADYFRSL......LTGN...IDDKFLAMRKR.MGQTHH............HF--
B2W0B6_PYRTR/24-203R......VDAQLSEDSPQILHRKMFLRGYLNKL......CSDA...SKMEFWEYLDK.VGMMHTGQG......RVHPL--
E3EZY8_KETVY/10-171...............QDRMNSAKTRQESHWKRI......AQGD...FGPDYVAAVRR.IGAIHA............DI--
Q1AU74_RUBXD/22-196............EPIQEYLERVRERFKRWVLDA......CRRP...YDQEWLDYQQE.IALRHTREKKNRTDGVEAPE--
A8IPP6_AZOC5/62-225...............AAVRAHAKAMQIKHWGVI......LDGR...FDAAYVESVTR.IGQTHA............RL--
Q1GI20_RUEST/15-172...............DTQIERVKRGQKKYFQEL......INAE...LDESYAEERKR.IGGIHE............RA--
B2AU65_PODAN/21-200P......MDDTPDEDSPQILHRKMFLRAYLKKL......CSDP...AQMEFWEYLDK.VGMMHTGIG......RTHPL--
Q0UTR0_PHANO/18-193P......IPDSLSESAPIIQHRKLFLRAYLTKL......CSDP...TQLEFWSYLDS.VGKMHNT..........QAL--
A2R286_ASPNC/23-202Q......VDEYFTLDGPHVQRRKIFWKWYLTRL......FSDP...SRLEYWEYLDK.VGKMHTGKI......LMHPL--
A9EVT1_SORC5/5-161...............GDALRRVKRLQREYFLGL......FTGK...LDRAYVEHRLH.VGAAHA............RI--
B8N2G0_ASPFN/23-202Q......IEDLFTIDSPQVQRRKIFWKWYLTRL......CSDP...GQPSYWEYLRK.VGEMHTGKV......LMHPL--
C4JKA6_UNCRE/20-213HDP.AAATVEDLTLTHPNILHRKDFLKLYLVKL......VSNTDWSDNSKFWDYLDK.VGLMHTGEPGFKHRSKRPQL--
D2VCV6_NAEGR/13-197KME..DTLDELSDTSSEQIKFRKDMLSKYLVKL......VTAD..YSDPALVKYLDW.VGKIHTTKA......GNKDI--
Q9YFF4_AERPE/20-195...........GEPIKEYLERVRARFGAWILDT......TCRD...YNREWLDYQYE.VGLRHHRSKKGVTDGVRTVP--
F0SHW9_PLABD/6-164..............GDAQVTRLKSSLARWLQGT......LQAD...HDQNYVAERRM.IGYRHV............DI--
A8FBP1_BACP2/29-185...............NSSVERLKKTLRIHISEM......FAGV...VDEAYVAKRIK.IAQVHL............RI--
A8P1M8_COPC7/13-202ET...PTSLNDLSQSHPQIKFRKDFLARYLVKL......VTMD..YDKMSTWEYLDK.VGLMHTGEAGFSYRQNKPSL--
A1CRU6_ASPCL/32-212T.....HVDDWYTENSPQIQNRKMFLRWYLIKL......CSDP...TQMEFWRYLNK.VGVMHSGQE......RRVPL--
Q47S02_THEFY/23-197............HPIQEYLDRVRERFGQWILDT......CRRP...YNQEWLDYQQE.IALRHTPEKKNVTDNANSVD--
A9WGB2_CHLAA/23-194............QPIADYLSRVRQRFGQWILDT......CRRP...YDQDWLNYQME.IALRHYRTKKNQTDGVQSVP--
B1HTR5_LYSSC/28-179...............HSSVEKLKVTLRQHIIEM......FNGT...IDEVYYQRRVK.IAKVHV............HI--
F0LY60_VIBFN/12-164...............EQSIVRARGHLRDHLMLY.....VFRGH...FGVDYYNATIR.IGQTHQ............RL--
G0JLY5_9GAMM/7-158.................RIDVLKKTHIAWLQDL......FSGD...YDEAFIRRQEK.IGEVHV............KV--
HEMAT_BACSU/31-185...............HSSVDRLKQTLKRHIQEM......FAGV...IDDEFIEKRNR.IASIHL............RI--
Q2KCI4_RHIEC/11-175...............DRQVDRLQDLQSSHWDVL......TDAR...FDSLYAERVKV.LSDTES............KM--
MCPE_RHIME/15-178...............DRQIDRLHDLQSSHWNVL......TDAR...FDGLYAERVKV.LADTES............RM--
Q65LP1_BACLD/29-182...............NSSVDRLKKTLTIHIQEM......FSGV...IDEAFLEKRIR.IAHVHL............RI--
Q7D1B0_AGRT5/50-211...............ENQLDRLHDLQSSHWSVL......TDAR...FDALYAERVKV.LSDNAG............RM--
Q81JN0_BACAN/32-186...............YSSIPKLKQTLKTHIKEL......FSGD...MHEDFIEQRVK.IAKRHV............QI--
Q8TLY9_METAC/23-193............TPNEKYLAAVRKRFSRWILDT......CNRS...YDQAWLDYQYE.IGLRHHRTKKNQTDNVESVP--
Q9A5Y0_CAUCR/45-206...............DGHMAGAERAQAAHWRRI......AEAG...YGESYVRDVER.IGRSHA............DA--
Q9AB06_CAUCR/8-170...............DRHMNAASSRQQAHWGVI......AEGQ...FSDDYVQAVRA.IGQTHA............RI--
U5L913_9BACI/33-184...............NSSVERLKNTLSAHIYEM......FSGK...IDTEFIQQRSV.IAHVHV............KI--
U5LFP3_9BACI/32-184...............ISKIGVTTEMSQQYILSL......FNGI...VDGEFVERRRT.AAKAYV............QI--
V6F1E9_9PROT/46-194................EAGATLKSALVEHWSRL......YRAE...FTADYIATAQQ.LGFMLA............YL--

PF00502

K9XWT9_STAC7/32-185KVPLEAMVLGLEKLKYY..SLQQFEEQ....EK........................IQLAPYFEHLINKM-
Q7NLD6_GLOVI/7-176GVPIPSAIRAVSIMKAS..AVAFINNT....ASK.......RKIETP..QGDCAALASEAGSYFDMAASAL-
K9U0M5_9CYAN/6-160GTPIEAVVESVRAMKNV..TSTMMSGE....DA........................GEVGAYFDYLIGAM-
B2J4C0_NOSP7/8-172GTPGASVAVGIQKLKAA..SLAIVNDT....NNIT..............RGDCSALSAEIASYFDRAASAV-
PHEB_NOSS1/7-171GTPGDAVASGIQKMKDA..AIAIANDS....KGIT..............KGDCSQLIAELASYFDRAASAV-
K9U368_9CYAN/7-161DLSPSWYVEALKHIKSN..HG..LSGQ....AA........................NEANTYLDYAINAL-
E0UA88_CYAP2/6-160GTDIGAVAQSVREMKEV..ALGLIASQ....DA........................GEAASYFDYVIGAL-
Q31RG0_SYNE7/6-160GTPIEAVAEGVRELKSA..ATALLTGE....DA........................DEAGAYFDYVIGAL-
A5GVQ7_SYNR3/7-171GTPGASVAAAINLMKET..AVNLVNDR....NGIT..............QGDCTALASEIGTYFDRAAAAV-
K9UI71_9CHRO/7-164GVPIAPTVRGVQIMKDL..VKDLLATS.......................GVADT..SCVDAPFDHMTREI-
K9PBJ3_9CYAN/6-157EIPLANLVIAIRCLKEV..SLDLFNLE....DA........................AELAPYFDYLIQEL-
B7JYL9_CYAP8/7-163GVPIGPTVRGIQIMKDM..VKQMVADA.......................GVDNT..SFIDAPFDHLTRE.-
Q7M7F7_GLOVI/7-161NLSPSWYIEALKHIKGK..VGSQLSGQ....PL........................TEANAYIDYCINAL-
K9SEX3_9CYAN/6-160GVPMGGMADSIRCLKNA..ALDLMSKD....DA........................ETAAPYFDYVIQAM-
K9U364_9CYAN/7-161GLSPSWYIAALEFVRDN..HG..LSGD....AA........................GEANTYLNYAINAL-
Q7V589_PROMM/7-180GVPIKNAVRAVEIMKAA..TVAIITNT....NS...GPSAFQGISGK..GSDCQGIAAEAASYFDRVISSL-
K9XSR9_STAC7/6-160NVPVPGMVDAIRCLKDA..ALALLTNE....DA........................KEAAPYFDYIIQAM-
Q2JPU0_SYNJB/6-160NVPIAGMIDAIVFLKEA..ALSLLEPA....AA........................AEAAPYFDYIINAM-
K9SZ05_9SYNE/7-161ELSPSWYVEALKSIKAS..HG..LTGQ....AA........................NEANTYIDYAINAL-
K9SDD2_9CYAN/9-154KAQRSCNV.TYAVMQEV..VKQSLTEQ....EA........................KLVCPLLELTRNAL-
Q7TTT3_SYNPX/31-183GVPTEGLNIALMQLNVL..AAQEFERGA...DQ........................ELINACFQHLIEQL-
E0U6T1_CYAP2/7-183GVPLQSAARAVGIMKAI..AVAHITNT....NKMYEGTSKFRKMETP..QGDCSALAAEAASYFDRVIAAL-
K9UYY7_9CYAN/6-160GTPIEAVAESVAAMKNI..TTSMLSGE....DV........................SEVGIYFDYLINAL-
B7K3F0_CYAP8/6-160GVPVPGMVEAIKCLKDA..ALGLLSNE....DA........................REAAPYFDYIIQVM-
K9YHW9_CYASC/8-165GVPIAPTVRGIQIMKEM..IKEMAFAS.......................GVEDT..SFVDEPFDHLTREL-
K9T4V8_9CYAN/7-171GVPGASVAAGVQKMKEA..AIAIANDR....NNIT..............PGDCSALMAEISSYFDQAAAAV-
A5GTB5_SYNR3/7-160GVPMPGMVEAMRCLKQA..SIALLSPD....DA........................QFISPFFDYLIQGM-
B2J478_NOSP7/7-163GLPTAPYVTALTYTRDRACSPRDLSPQ....AL........................GEFRALLDYVINSL-
PHEB1_SYNPW/7-183GVPAQSAARAVAIMKAS..ATAHIGET....NTQANGGAKFRKMETT..QGDCSALVAEAASYFDRVISAI-
A5GVP3_SYNR3/7-164SIDAGTYVAGFSNMRNDGCAPRDMSPQ....AL........................TAYNTLLDYVINSL-
B7K6K4_CYAP8/7-163GLPTAPYVEALSFARNRGCAPRDMSQQ....AL........................VEYNALLDYAINSL-
APCF_SYNY3/7-164GVPIGPTVRGIQIMKEM..IEAMAEDS.......................SLNST..DFIASPFDHMTREL-
APCF_SYNP2/7-164GVPIAPTVRGIQFLKDA..IKEMAAAA.......................GIANT..AFIDEPFDHMTREL-
B2J479_NOSP7/8-184GVPTGSSVRAFQILKAI..SVAHITNT....NTEANAGKKFRKIDTP..QGDCSALAAEAASYFDRVISAL-
K9VCF0_9CYAN/35-186RVPVSAMLCGLEQLKKV..SLQHFNSE....DR........................DLLSLYFDHLISGL-
K9PSE2_9CYAN/6-160GTPIEAVAESIRAMKNI..TTSMMSAE....DA........................SEVGGYFDYLIAGL-
K9TTH5_9CYAN/6-160GVPVPGMVESIRCLKNA..SLSLLSAE....EA........................AEAAPYFDYIIQAM-
Q7U7B1_SYNPX/9-166GVPTGPTVRSIILLGEV..IVERLQAA.......................GVESARLAVVAAPFDHMARGL-
K9TY40_9CYAN/7-164GIPLGPTARSIQLMKNI..VKEKLVTA.......................GMTNI..TFVDEPFDYVVREI-
K9P5D8_CYAGP/8-172GVPGASVAEGVRLIKGA..AIELVLDR....NGIT..............QGDCSALASEIGTYFDRAAAAV-
K9U651_9CYAN/7-164GVPIGPTVRGIQMMKDI..VKAQAVAA.......................GVENT..AFIDEPFDHMTREL-
K9XTU9_STAC7/7-164GVPIGSTVIGIQIMNNL..VKQMATNA.......................GISDT..NFIDEPFEHLTREL-
U5QS61_9CYAN/34-186RVPLPAMLLGLESLKKA..SLQRFAPE....MQ........................ATVAPCFEALIVQL-
B0C339_ACAM1/7-156GVSLAATIKAIRAMQEV..TSDVVGSA....AG........................HEISPYFEHLCAGL-
K9SW00_9SYNE/6-160GVPVNGMADSVRCLKTA..SLELLSEE....DA........................DLAEPYFDYVIQAM-
K9PBM8_CYAGP/6-160GTPLEAMAEAVREMKTA..ATGLLTGS....DA........................EEAGFYFDYVVGAL-
K9Y8I8_HALP7/7-164GVPIAPTVRGIEIMKEM..VKKMAEDA.......................GMLDT..SFIDKPFDHMNREL-
Q10UW8_TRIEI/7-161ELSPSWYIEALKYIKAN..HG..ITGQ....GA........................TEANNYIDYAINAL-
Q7NL79_GLOVI/7-160GVPIAATVGGIQAMKEV..VGGLVGPD....AA........................KEASIYFDYLSSGL-
K9P5A2_CYAGP/7-160GVPLPGMVEAMRTLKEA..ALVLLGGE....EA........................ALAGPYFDYLIQGL-
A5GL99_SYNPW/7-160GVPMPGMVDAMRAMREA..SLVLLSDD....QQ........................RLAGPYFDFLIQGM-
K9SQ75_9CYAN/7-161ELSPSWYIEALKHVKAN..HG..LSGD....AA........................TDTNAYIDYAINAL-
Q10ZG9_TRIEI/37-188LVPLSAMVCGLEAIKTA..SLKNFSSE....QQ........................AELVPYFDHLVTNL-
PHCB_SYNP2/7-171GVPGASVAAGVRAMGKA..AVAIVMDP....AGVT..............SGDCSSLQQEIELYFETAAKAV-
Q10XZ6_TRIEI/7-164GVPIGPTLIGISILKEL..IKSKVEAA.......................GIQTG..AFLAEPFDHLINEL-
U5QNF8_9CYAN/7-160EVPIPAMVESVRLLKKE..ALDLLSPT....EA........................EIASPYFDYVINAM-
K9PDX9_9CYAN/6-157EIPLRNIVEAMRCVKEE..AISLMSEE....DA........................VEVGPYFDYIIRAL-
Q117G1_TRIEI/7-161GISTDTYVTGLAKIRDRLCVPRDMSGQ....AA........................TELTAYLDYVINAM-
K9P457_CYAGP/8-162ELSPSWYVEALNYIKAN..HG..ISGD....PG........................VIANNYIDYAINAL-
B7K6K8_CYAP8/35-188QVPLDAMICGLKNLKTY..SLQQFNPE....EQ........................QELAPYFDHLISHL-
K9TWK3_9CYAN/6-157EIPLRNWVECIRCLKEV..TLDLLSRE....DA........................AEVTPYFDCLIQGM-
G3XCS9_PROMA/7-154LLPTAAYIEAFTYIRDNLDIPNDMGQQ....AG........................AEFKNLLDYLINAL-
K9XAE9_9CHRO/6-160GTPIEAVAESVRAMKNV..ATSMMSSE....DA........................SEAGSYFDYLVGAM-
K9TI03_9CYAN/11-165GVPMAGMAESIVCLKEA..SLALLSQE....DA........................TAAAPYFDYIVQAM-
Q7V590_PROMM/7-154GIPTSAYIEAFSYIRERVCVPRDMDQQ....AA........................NEFKDLLNYLINAL-
E0U6S4_CYAP2/34-186KVPLAAMISGLESLKTS..SLQQFNAP....EQ........................QALSPYFDHLIESL-
K9SFN5_9CYAN/6-164GVSVDQLRNAIGTIRDV..VVDLLNHHVPQVNE.............KTNQGDHPTLVAEIIDYFELIID..-
K9RE36_9CYAN/7-164GVPISPTVAGIQIMKDM..VKEQVASA.......................GISDT..SFVDEPFDYMTREL-
Q8DIN1_THEEB/16-170GVPMTGMAEAMRCLKDA..SLALLSTE....DA........................EVAAPYFDYIIQEM-
Q2JLK1_SYNJB/7-160GVPIGATIQAIQAMKEV..TAALVGAE....AG........................KEMGVYFDYICSGL-
Q7NLD7_GLOVI/7-163NLPTAAYVAAFQYTRDRACAPRDMGPQ....AL........................TEFRSYLDYVINAL-
PHEB2_SYNPX/7-177GVPTGSASRAVAIMKAA..AGALITNT....NSQP......KKMPVT..TGDCSNIAGEAASYFDMVISAI-
K8GH86_9CYAN/6-155GIPLENLVECMRCLKES..ALDLLSLD....DA........................MVVAPYFDYIIC..-
B7K2Z2_CYAP8/11-156NHSATWYAEALKNIKED....HGLQNE....AN........................KELHTYIDYLISAL-
Q117E9_TRIEI/6-178GVPTTSASRAVGIMKAA..AVAFINNT....ASQ.......RKMSVT..KGDCSSLASECAGYFDTVIAAI-
K9WFS1_9CYAN/7-161ELSPSWYVEALKYIKAN..HG..ITGD....AA........................TEANSYIDYAINAL-
K9ZE77_ANACC/7-171GTPGATVASGIGKMKDA..AIAIANNN....DGIT..............RGDCSNLMSEVASYFDRAAAAV-
A5GVM9_SYNR3/34-181GVPVDGLLLALARLQEL..AAQSYSESAPSLDA........................ELLDEAF.......-
K9UJM8_9CHRO/7-161DLSPSWYVEALKYVKAN..HG..LSGD....SA........................SEANSYIDYAINAL-
PHAC_SYNP2/6-160GVPVPGMVDAIRCLKDA..ALGVLDSE....EA........................RIAAPYFDFITQAM-
PHEB_PROMP/7-174GVPLKNAIRVFELMRDA..TISDLKST....VNSMKGE...........KEFLSDLISNTEFQFERIINLL-
K9T481_9CYAN/7-160GVPISATVRALQAMKEV..TADIVGPD....AG........................KEMGVYFDHICSGL-
PHAC_SYNY3/6-160NVPVPGMVDAVTVLKDA..ALGLLSAE....DA........................NETAPYFDYIIQFM-
PHEA1_SYNPW/7-163GLPTGPYVEALTYTRDRACAPRDMSPQ....AL........................NEFKSYLDYVINAL-
K9XWE3_STAC7/7-183GVPLQSTARAVAIMKAS..SVAHINNT....NTEANGGKRFRKMEMK..DGDCSAISSEAASYFDRVASAL-
K9XKS9_9CHRO/7-160GVPIQPTIQAIQAMKEV..TTRLVGAE....AG........................GEIGMYFDHICNGL-
K9SIK8_9CYAN/7-160GVPIGSVAQSIQIMKAV..VVQLVGT...........................DA..SWLTGPFDYMANEL-
Q7NJA2_GLOVI/7-160GVPIDATVKGINALREV..VASVVGPE....AA........................GEASKYFDHLAKGL-
K9P3V2_CYAGP/7-164GVPTGPTVRSIALLGEV..IAEMLADA.......................GMADT..GLVRAPFEHLCRGL-
PHEB_PROMA/7-181GVPLSNAIRAIEIMKIA..TVAIMTET....NS...GRKMFEGINSGS.GAECKDIASEAASYFDRVIDAL-
K8GG80_9CYAN/6-156NIPIANWAEAMRCIKEE..VILLLGEA....DA........................ATVTPYFDHIIDT.-
B0JFY1_MICAN/7-164GVPIGPTVRGIQIMSEM..IQTMATEA.......................GIADT..SLIAEPFDHLTREL-
Q10YG0_TRIEI/6-160GTPIEAVAEGVRCMKTV..TCSLLDYE....AG........................SEAATYFDYVIGAM-
K9Q0C3_9CYAN/7-161ELSPSWYIEALTYIKAN..HG..LSGQ....SA........................TETNNYIDYAINAL-
B0JXA2_MICAN/8-162ELSPSWYIEALKYIKTN..HG..LSGD....AA........................VEANSYIDYVINAL-
K9T2W8_9CYAN/6-157EIPIPNIVVAMQCLKEE..AVSMMSEE....DA........................AEVAPYFDYVIQAL-
Q117G0_TRIEI/7-178GVPAGNAARAVAIMKAA..AVAFVTNT....ASQ.......RKMTVTEQPGSCDSLAAEVGGYFDAVVAAI-
B8HS99_CYAP4/7-164GVPIGSTVQGIQIMKAI..VQERVAAA.......................GIATG..DFLNQPFDYMSRQL-
B2J4C1_NOSP7/8-162DLSPSWYIEALKYIKAN..HG..LSGD....PA........................VEANSYIDYVINTL-
K9SBH1_9CYAN/7-161DLSPSWYVEALRHIRAN..HG..VTGQ....AA........................VEANAYLDYAINAL-
K9PZN7_9CYAN/7-163SVPIGPTVRGIQFIKEA..IKSAAAEA.......................GIADT..SFIDEPFEHMIRE.-
Q2JJL1_SYNJB/7-162GVPIAPTVIGIQNMKTR..TLELLGSG.........................EDY..SFVAEPFDYLSAKL-
A5GTI9_SYNR3/7-164GVPTGPTARGILLLSEV..VQEMLSAE.......................GVQSA..DVVRAPFEHMARAL-
K9TVG8_9CYAN/7-160GVPIGATIRSVQAMKEV..VTSLVGAD....AG........................REMGVYFDHIAAGL-
A5GVQ8_SYNR3/7-161ELSPSWYVEALNHIKAN..HG..LSGD....AA........................TEANSYIDYAINAL-
K9R5H1_9CYAN/6-160GVPVPGMVEAIKGLKEA..SINLLSAE....DA........................QQAAPYFDLIIQAM-
K8GCZ2_9CYAN/7-164GIPLGVTARSVQLMKER..THQKLIEA.......................QLGNP..AFVDEPFDYIIRAL-
Q46H72_PROMT/7-154LLPTAAYIEAFIFIRDEIKINDVMGQQ....AE........................TEFKGLLDYLINAL-
K8GTM9_9CYAN/7-164GVPIGPTVRGIQIMKDI..VKAQLEAS.......................GIASG..EVVDQPFDYMTREL-
Q7M7C7_GLOVI/7-171GTPTRSVARAVQLMKET..AIGYVNSP....SGVT..............RGDCSALVNEAATYFDKAAASI-
K9Q339_9CYAN/12-160DIPISRVLEALQSMKRV..LIELIDED....NL........................EIVTDCLDYLINGL-
PHCA_SYNE7/8-162DLAPSWYVEALKYIKAN..HG..LSGD....SR........................DEANSYIDYLINAL-
K9PVY8_9CYAN/33-185KVPLPAMLCGIQGLKTV..SLSYVEKD....VD........................IKFAQSFDHLLTQL-
K9WJQ0_9CYAN/7-183GVPTTSTVRAVQIMKAQ..AAAHIKDT....PSEEFAGSKLRKMGAPVVEDRCASLVAEASSYFDRVISAL-
Q2JMW3_SYNJB/7-161NLSPSWYIVALQYMKSR..ALGMLSGQ....AA........................NEAAIYFDYAINAL-
K9T540_9CYAN/6-157GIPIFNWVEALKCLKEE..AIALLGEE....DA........................AEVTPYFDHIIQTL-
Q31Q35_SYNE7/35-183EVPIAAMQQAIETLLGV..ALKRFPPE....VQ........................AQLQPCFDTLQT..-
B8HKY2_CYAP4/8-172GVPGASVAAGIQKLKEA..SIALANDP....NGIT..............RGDCSTILAEVATYFDRAAAAV-
B2J9I8_NOSP7/36-187QVPLDAMLLGLKSIKAA..SLKRCPAN....QQ........................EILNPYFDHLITQL-
K9UJL4_9CHRO/35-186QVPLDAMVLGLQELKTA..SLTRVEPE....LK........................PTLAPYFDRLISKL-
K9XKJ2_9CHRO/7-171GVPGGSVAAGVQKMKDA..AIKIANDP....NGIT..............QGDCSQLMSEVASYFDRAASAV-
Q8DHC5_THEEB/7-164GVPIGPTVRGIQIMKEI..VRDRVAAA.......................GIEDT..GIVEQPFDYMCRQL-
E8R540_ISOPI/10-154GFPPGFVRESYAHVWDG..VKQAVSAE....AA........................ALIEPHMRKAIDIL-
Q2JI97_SYNJB/7-171GTPGSSVANGIQKMKKA..AVAVVNDP....NGIT..............RGDCSALIAEIESYFDRAAAAV-
Q2JI98_SYNJB/8-159ELSPSWFIEALRYIKAN..HG..LTGQ....AA........................TEANTYIDYAINAL-
K9WKR7_9CYAN/37-189QVPLDAMVVGLEGIKAA..SLKQVAPE....QQ........................ANLVPYFDHLIEQL-
Q31RP7_SYNE7/6-160GVPLPGMAEAIRTLKEA..SLALLSSA....DA........................TVAAPYFDFLIQGM-
D4ZTI6_ARTPN/7-164GVPIGPTVVGIGILKDL..ATEKVQAA.......................GIEVG..AYLEQPFDHLISEL-
K9XIF5_9CHRO/6-157GVPVSNIGNCMRCLKEV..ATNMMSSE....EA........................AIAKPYFDYLIRAM-
K9SXI2_9SYNE/7-160GVPIGPTVQGIQIIKDA..VIELVGV...........................NA..DWLTDPFDYISRQL-
K9UCA0_9CHRO/6-160GVPVAGMADSIAALKEA..ALSFLTQD....DA........................AAAAPYFDYIIQEM-
K9SCA6_9CYAN/6-160GVPVTGMADAIRSLKKA..ALGLLTDE....DA........................AEASAYFDFLIQGM-
PHCA_SYNP2/7-161DLSPSWYVEALKHIKAN..HG..LTGD....AA........................TETNNYIDYAINAL-
Q2JMW4_SYNJB/7-171GVPTTSVANGIAAMKKE..ALAKIMDP....KGIT..............PGDCSALQSEVASYFDKAAAAI-
K8GE61_9CYAN/7-160GVPVGATIRAVQAMKDV..VTDLLGAE....AG........................KEMGVYFDYIAAGL-
K9T5F0_9CYAN/6-157EIPLRNVVECMRCLKEV..TLEMLSLE....DA........................AEVAPYFDYLIQGM-
Q7NL72_GLOVI/36-187RVPLGAMLLGIHCLRGA..SLQHFSVA....EQ........................QALGPYFDHLAER.-
K9Z238_CYAAP/6-160GVPLPGMVESIRCLKTA..ALALLSKE....EA........................EETAPYFDYMIQYM-
K9XNJ3_STAC7/6-160GTPIDSVAESVRAMKKI..ATSILSGE....DA........................SEVGTYFDYLIAAL-
K9PC78_9CYAN/6-157GIPIFNWVEAVRCIKEA..AREFLGEE....DA........................AIAIPYFDHIIQTL-
K9YD01_HALP7/6-160DVPVPGMADAIRCLKDA..SLGLLSAE....EA........................QEAAPYFDYIIQAM-
K9TVZ1_9CYAN/6-157GIPLENVRQYMLCVKAE..VSAMLTPE....DA........................AEVIPYFDLILQVI-
K9SQM2_9CYAN/38-189SVPLEAMVEGLGCLKNA..SLQRLTPA....HA........................DSLSPYFDRLIAEL-
K9VPV9_9CYAN/6-160GVPVPGMVEAIRCLKEA..SLALLNQD....DA........................KEAAPYFDYIAQAM-
K9T6U8_9CYAN/35-186RVPLEAMVLGLENLKCF..SLKQFQGE....EL........................ENIAPYFDHLIEKM-
Q7U6V7_SYNPX/7-160GVPMPGMVEAMKTMKDA..SLALLSDA....QV........................MLAAPYFDYLIQGM-
PHCB_SYNE7/8-172GVPGASVAEGVRKMKDA..AVAIVSDR....NGIT..............QGDCSAIISELGSYFDKAAAAV-
O50209_SYNE7/7-164GVPSGPTVRGIAILRDR..VRQLVEQA.......................GISNA..AFVEVPFDHLGRNL-

PF01152

Q7CX73_AGRT5/7-127PIGPAERDEWLLCFRRA--MDETIENAKLREII------------------------WAPVERLAFHMQN--
Q8XXM3_RALSO/11-128EIGTRERDQWMRCMALA--MQDLG...IDDALQ------------------------MRLMQAFWQTADW--
B2J6Y7_NOSP7/3-117NLQQPHFDAIAKHLGEA--MAVRGVSAENTKAA------------------------LDRVTNMKGAILN--
F2CUR6_HORVD/26-145PVTHRAAERWLHHMQQA--LETT..QSINPDTK------------------------TKMMNFFRHTAYF--
TRHBN_MYCTU/14-127GITMHHFSLVAGHLADA--LTAAGVPSETITEI------------------------LGVIAPLAVDVT.--
Q63VR4_BURPS/25-145PIASSERDQWLRCIAWA--MQDVGLDEPLRERL------------------------MHSFHDTADWMRN--
GLB3_ARATH/26-142PVTHQAAERWLEHMQNA--LDDSV..DIDQDSK------------------------IKMMKFFRHTAF.--
Q7APC3_RHIME/8-128GIGPAERDEWLFCFTRA--LEETVSHPKLREII------------------------LEPITRLAHHMQN--
TRHBO_MYCLE/4-122RITAIERDAWLRCMHTA--VASIDSHTLDNEHR------------------------RELLDYLEMAAHS--

PF00042

Q19601_CAEEL/105-215.DYPGKLEVYFENLGKR--HVAMQG.R------------------------------GFEPGYWETFAECMT
GLB1B_ANATR/17-122.DNVDRLKCVVEKFAVN--HINRQ...------------------------------.ISADEFGEIVGPLR
HBP1_CASGL/7-116KGHAVWDNNTLKRLGSI--HLKNK...------------------------------.ITDPHFEVMKGALL
GLB1_PARCH/17-123.DSD.ILPELLATLART--HDLNK...------------------------------.VGPAHYDLFAKVLM
MYG_GALGA/3-108...KGNHSQPVKALAAT--HITTH...------------------------------KIPPHYFTKITTIAV
HBAT_HORSE/7-107...E.DLPRALSALRHR--HVREL...------------------------------RVDPASFQLLGHCLL
HBA1_PLEWA/7-107...D.DIDTAFSKLSDK--HAEEL...------------------------------MVDPANFPKLAHNIL
HBB0_MOUSE/8-112...D.NLKETFAHLSEL--HCDKL...------------------------------HADPENFKLLGNMLV
HBA1_XENBO/7-107...D.NIAGSLSKLSDL--HAYDL...------------------------------RVDPGNFPLLAHNIL
GLB_PAREP/8-117.SNDAEVKKIAAQYGKD--HTSRK...------------------------------.VTKDEFMSGEPIFT
HBB1_CYGMA/8-112...D.NIVDAYAELSTL--HSEKL...------------------------------HVDPDNFKLLSDCIT
MYG_CYPCA/3-108...RGDHAAILKPLATT--HANTH...------------------------------KIALNNFRLITEVLV
HBB2_XENLA/8-112...D.SVKSSLQQLSKI--HATEL...------------------------------FVDPENFKRFGGVLV
HBAZ_CAPHI/7-107...D.NVTSALSKLSEL--HAYVL...------------------------------RVDPVNFKFLSHCLL
HBF1_URECA/7-113...GGNAGALMKAKVPS--HDAMG...------------------------------.ITPKHFGQLLKLVG
HBB1_XENBO/7-111...D.DIKGYYAQLSKY--HSETL...------------------------------HVDPCNFKRFGGCLS
LGB1_LUPLU/8-116NGAV.ASDATLKSLGSV--HVSKG...------------------------------.VVDAHFPVVKEAIL
MYG_HETPO/3-108...KGKHSTNVKELADT--HINKH...------------------------------KIPPKNFVLITNIAV
HBAD_LIOMI/6-106...D.DIRGTLSQLSDL--HAYNL...------------------------------RVDPVNFQLLSKCIH
A0A017IB98_ECOLX/6-103.ENLPALLPAVEKIAQK--HTSFQ...------------------------------.IKPEQYNIVGEHLL
Q18311_CAEEL/32-140L.NDDQVREACEQLGAR--HVDFIS.R------------------------------GFNSHFWDIFLVCMA
GLB73_CHITH/23-129ESNASAVNSLVSKLGDD--HKARG...------------------------------.VSAAQFGEFRTALV
HBB_LITCT/1-105...Z.BLKAYYAKLSER--HSGEL...------------------------------HVDPANFYRLGNVLI
HBBN_AMMLE/2-106...B.BLKGAFASLSZL--HCBKL...------------------------------HVBPZBFRLLGBVLV
HBAM_LITCT/6-102........DNLQKYQDL--HTNKL...------------------------------KLSSDHMKLLSAAII
HBA3_PLEWA/7-107...D.SMDQALSKLSDL--HAYNL...------------------------------RVDPGNFQLLSHCIQ
HBAD_PASMO/6-106...D.NLSQALSELSNL--HAYNL...------------------------------RVDPVNFKFLSQCLQ
HBB_HETPO/7-106...G.DVKSQFTDLSKK--HAEEL...------------------------------HVDVESFKLLAKCFV
A2VF80_MYCTX/42-136R..AEEPVAFLAQLGRD--HRKYG...------------------------------.VLPTQYDTLRRALY
HBA_LEPPA/7-108...H.DLSSCLHTLSEK--HAREL...------------------------------MVDPCNFQYLIEAIM
GLB8_CHITH/9-115PENRPALKTLIDGLASS--HKARG...------------------------------.IEKAQFEEFRASLV
GLB2_LUMTE/8-114.DQPATLKEELDHLQVQ--HEGRK...------------------------------.IPDNYFDAFKTAIL
Q20638_CAEEL/74-184MERTESFLYMVGQKHVK--FADRG...------------------------------.FKHEYWDIFQDAME
HBB_ALLMI/7-111...D.NIKGHFANLSKL--HCEKF...------------------------------HVDPENFKLLGDIII
HBA_CATCL/6-107...D.DLLGGLASLSEL--HASKL...------------------------------RVDPSNFKILANCIT
HBA_SQUAC/6-107...D.NVAGHLDPLAVL--HGTTL...------------------------------CVDPHNFPLLTQCIL
GLB2_TYLHE/9-115.TDEPVLNAQLEHLRQQ--HIKLG...------------------------------.ITGHMFNLMRTGLA
GLB1_GLYDI/6-111.GDEGKMVAQMKAVGVR--HKGYGN.K------------------------------HIKAQYFEPLGASLL
GLB10_CHITH/11-117SGNQAAIRTLLHDLGVF--HKTRG...------------------------------.ITKAQFGEFRETMT
HBB_LEPPA/7-111...G.NIKGHLANLSHL--HSEKL...------------------------------HVDPHNFRVLGQCLR
GLB1_TYLHE/7-110.DDKPVLDQALAHYAAF--HKQFG...------------------------------.TIP..FKAFGQTMF
HBA1_TORMA/6-107...D.DLPHHLNKLAEK--HGKGL...------------------------------LVDPHNFKLFSDCIA
GLB6_CHITH/22-128DANIPAIQNLAKELATS--HKPRG...------------------------------.VSKDQFTEFRTALF
GLB_BUSCA/6-116.DDDDCVBGLAKKLSRN--HLARG...------------------------------.VSAADFKLLEAVFK
GLBH_CAEEL/10-119.TNEEVFKGYVRETINR--HRIYK...------------------------------.MDPALWMAFFTVFT
GLB2_NIPBR/16-114.DNEDVFRAFCRETIDR--HVGRG...------------------------------.LDPALWKAFWSVWV
GLBH_TRICO/30-132.DNEMIFRAFVRDTIDR--HVDRG...------------------------------.LDPKLWKEFWSIYQ
GLB_PSEDC/21-134.DDRETFDAYVGELMAR--HERDHV..------------------------------KIPNDVWNHFWEHFI
GLB_CERRH/6-116.DDADCMNGLALKLSRN--HIQRK...------------------------------.IGASRFGEMRQVFP
GLB2_CHITH/22-128SANMPAMETLIKDMAAN--HKARG...------------------------------.IPKAQFNEFRASLV
GLB_TUBTU/6-112.DDQAAFDAQLAHLKSQ--HAERN...------------------------------.IKADYYGVFVNELL
GLB3_LAMSP/7-113.DDEGVLNTQLAHLASQ--HSSRG...------------------------------.VSAAQYDVVEHSVM
GLB_ASCSU/21-134.DDRETFNAYTRELLDR--HARDHV..------------------------------HMPPEVWTDFWKLFE
GLB1_CALSO/5-105.NDPTALTLKIKGLCAT--HKTRG...------------------------------.ITN..MELFAFALA
GLB2_CALSO/5-108.DDTTALNYKISGLMAT--HKTRN...------------------------------VVDPALFAIALNELV
MYG_ALLMI/7-113...KGNHAEVLKPLAKS--HALEH...------------------------------KIPVKYLEFISEIIV
Q21978_CAEEL/165-283DELEAQVAPTVFKYGER--HYRPDITP------------------------------HMTEENVRVFCAQIV
HBB_SQUAC/7-107...D.DVKPHFVELSKK--HYEEL...------------------------------HVDPENFKLLANCLE
GLB3_TYLHE/8-117.EDPKALQEELKHLARQ--HRERS...------------------------------GVKAVYFDEMEKALL
GLBT_CHITH/13-116S.DMGGAKALLNQLGTS--HKAMG...------------------------------.ITKDQFDQFRQALT
GLB3_CHITH/20-120....PNIEADVNTFVAS--HKPRG...------------------------------.VTHDQLNNFRAGFV
GLB1_CHITH/21-126DANTPTILAKAKDFGKS--HKSRA...------------------------------..SPAQLDNFRKSLV
LGB1_MEDSA/7-112R.ATGGVVLGDATLGAI--HVRKG...------------------------------.VVDPHFVVVKEALL
GLBC_NIPBR/21-135.DNQAVFHGFVRELMNR--HEKRGVDP------------------------------KLWKIFFDDVWVPFL
HBA1_IGUIG/6-106...D.DIPDALAKLADL--HAEKL...------------------------------RVDPVNFGLLGHCIL
HBA1_BOSMU/6-106...D.DLPGALSELSDL--HAHKL...------------------------------RVDPVNFKLLSHSLL
GLB_APLJU/6-113.ADAGKMGSMLQQFATE--HAGFG...------------------------------.VGSAQFQNVRSMFP
HBA_HETPO/13-114...D.DLKTHLHKLATF--HGSEL...------------------------------KVDPANFQYLSYCLE
BAHG_VITST/6-103...P.AILPAVKKIAVK--HCQAG...------------------------------.VAAAHYPIVGQELL
GLB4_TYLHE/8-117GDSD.TLNSLIDHLAEQ--HKARA...------------------------------GFKTVYFKEFGKALN
GLB4_LUMTE/11-120.DDTLVLQSHLGHLADQ--HIQRK...------------------------------GVTKEYFRGIGEAFA
HBP2_CASGL/13-122AGKVTVRESSLKKLGAS--HFKHG...------------------------------.VADEHFEVTKFALL
GLBP1_GLYDI/7-115.DNAKQMAGTLHALGVR--HKGFG...------------------------------DIRAEFFPALGMCLL

PF11563

E1FPN0_LOALO/43-200GFRPDFFAITADAVTTE--CVLL..............DAAIHSASEALFAWSTLTTFMFSFVRDGYYSEQRR
Q5B5X9_EMENI/37-216NIEYIHMGACLGYIQDL--FTEALLSHP.........TLSIARKTAMIRAISKIIWIQNDLIARWRMRDGEE
A2QBB3_ASPNC/24-203NVEYIHIGACLGFIQDI--VMEAVLTYE.........KLTLPFRIALVRALGKVIWIQNDLFARWRLHDGEE
C4JH72_UNCRE/22-201HIEFVHIGANLGFIQNV--LTEALLSHP.........RLPLSRKIALVTAIGKVIWVQNDLFAKWYVRDGDE
C4XIT4_DESMR/15-174GVPPMLYISSIRTLFQI--LRERLTSKLS.......ANKQCSTCHGILGALEKIILFDLTLVMDTYIHALVK
D4AN62_ARTBC/20-213RVEVMHMSLLLGFVEDI--VLQATMGAE.........ELDIQTKTNVIRAFNKLIWIQNDLFQKHYVSK.LE
E9E781_METAQ/19-198HIEYVHLGTCLGFIQDI--MTEAILSHP.........RLHMYRKIALVKALNKVIWIQNDFMAKWHVREADE
E6U0Q9_BACCJ/24-180GLQTKWYMSAFQDLLLS--LMELVDEII..........EDKTECLYIIKAITKVINLEQQLVLEAYEIETKR
B6HCY7_PENCW/23-203NIEYIHLGACLGYIQDI--WIEAMLSHP.........HLSLRRKIALVRAVNKILWIQNDLFARYHSSDGEE
Q218B7_RHOPB/3-166GLEPRWYIGGYNALISG--LMEAVALRMPTG...RFDRRALQKKTALQQAIIKASMLDMDYAIAVYIEAGRR
D3FWD3_BACPE/27-184DLPIAWFLATYQVFLQL--IIPQLVSNF.........FKEPDKLTNYILALTGRFNFDSQLIVEEYLQSKMR
B7GLD2_ANOFW/25-175KVNVGKLIVAFNQFNFF--VLTTLLAKV.........ALAPKRCLTLMEALQRAINIEQQLLVEVYTETLME
A4Y0T1_PSEMY/34-186GVDLKWYLGAYRMYLDG--MLEALLEPS..............PASDCFASLIKKVFFDIGLALDSYGAAQRK
C4L4W7_EXISA/25-181GLKGKWYMAAFQKIFET--LVLAIQHEQ..........LDADSKMKLMMAVSKIFNFEQQIVLEMFDDEADV
A1C4D9_ASPCL/22-201TIEYIHMNACLGYLKEL--LLETIFLHE.........EMTVAFKFALVRSLSKILCIQNDLIARCHIRDGEE
Q7NUX9_CHRVO/5-158GVSLGWLQGLYERCQPH--LLGGLEQAA...............GTEAARLLRKRILLDQMLKTHGYQQALKR
E0SCN2_DICD3/9-166GIPTDLVARGARKLKNE--LFRLLDRKR.........NLDAALINQAVCFSSLVIDTAIEAMTTAYSPGYKS
C7Z0G0_NECH7/17-196RVEYIHISATLCVIQHV--LTESILSHS.........VLPMSRRVAMVKALSKVIWIQNDLFAKWCVRDGEE
A9GCE3_SORC5/10-164GLPQRYMFTAMTLIRLA--FHEIAQGAL............GAEVIPVRAAVSKVLDLELAIMLETYRDDFLA
F0XJU9_GROCL/20-199HVEYIHIGATLSLIQDV--LTEAVLSHP.........RLSMGRKMGLVKALGKVIWIQNDLFAKWYVRDGEE
Q5WC98_BACSK/26-182GLKTKWYIGAFHNLQLE--LQRMIVKHF..........KSGNEQFLAFCAVGKFINFEQQLVLEAYEEEERR
Q9KFH4_BACHD/32-188GLQTKWYVSAFQQLTDS--LIQLLEQHL..........QSPSDIVLATRSLLKLLNLEQQLVLEAYENENKR
B9JTP3_AGRVS/26-192GLDPRWQIAGHAVVLEG--LVSSVFADLANRGFMPSSRKRAAELQALVSALIRLVMVDVEIAVSLRFNELRL
D2QY57_PIRSD/6-164GLDQVYAAVAVARLRSG--MIAAISSDA.........KLSPAQLSLTVQSINKLLDLDLAIISDVYEAEYVR
B1YHV6_EXIS2/30-187FVPVTWFIASYAAFNTL--LIPKIVEHF.........QHEPAQLTNAILALNHAMNLDAQIVTSQYVDARLH
B9JUN1_AGRVS/7-170GLDPRWYIDGYGLILSG--LVTGVLEAEMRG...TLFGSRLKGAIPKISALIRATMLDMDFAISTYGEALSE
Q3IUQ9_NATPD/29-196DLGPKAYLGAYTIYYEG--IADAIADDIKSEFDGDEAAAAVDEAFDRMSSVLKAMNLDQQVAMDTYIHSYSE
C5G9L3_AJEDR/20-214RVEVMHMSLLLAFVEEM--VLQAILGAE.........GVDLQTKTGMITAFNKLVWIQNDLFQRHYVAKKPE
A2QT04_ASPNC/23-202DVEYIHIGACLGYIQDV--LIEGVMGCE.........KMSLPFRVALVRALGKVIWIQNDLFARWRVRDGAE
C7ZI09_NECH7/13-198RIDYIHISLTLSLIQSV--MSQAILDHS.........SIPISRRAAIVKSFSKVIWIQNDLFARWYVRDGEE
B1HNN8_LYSSC/36-192GLQSKWYIASFQSLTST--FTNFVNEVD..........ISKNDAIRAINAFCKIINFEQQLVIEAYEKEEDR
B1YG08_EXIS2/27-183GLQNKWYIAAFQKVLNV--LSRQIEDST..........LPESEQVRIVRSAGKLFNLEQQIVLTMYEEMVDA
C0S330_PARBP/20-213RVELMHMSLLLGFVEDL--MLKTTLAAD.........GLDLRTKTSVLAAFNKLMWIQNDLFLRHYVAEKPE
A0KND7_AERHH/15-171GVEPKLYLAAINTLKGL--LIEDIFTQI..........DHEPDRITMLTALDKLFLFDITLVFETYIRSLVS
D8PPS9_SCHCM/66-254HVPYRDCALTLGWVGTV--LQTATLQLPE.......DKLSMKEKIDAVGAINKILWIQNDLFARHYID...E
B3QU69_CHLT3/11-161GLPVRYPLAMMDVIMEY--GQKAALQSS..............QPEIASSAFRKLAALDIAIFNQAYESTQLK
B2IB39_BEII9/3-168GLEPRWYIGAYALIGEG--LVETLIEQQWPKL.LPSAHKQAAKVSSSLASVWKALLLDIELSISAYLEAIET
Q3JC52_NITOC/22-196IISYRYLITFIYPITAT--IKPFLEKKG..........HSAEEVEKMHQAWFKSLLLQVTLWTNPYLRQEDY
D2R7K0_PIRSD/13-194NVPLVQMNALLGFVADA--LIATIFSLG..........LDRETEIKTQRAFQKLLWVQNDLINRHYQTASTW
Q2Y8W7_NITMU/15-174NIPLGALQLPSFLIQQS--LIDNLLDKS.........DFNADKTRILLCTILKLTALDLYIAAEGYHLPELN
F2F0J0_SOLSS/31-187GLDPKWYMGTFQKLQET--MIMLISKDI..........ADVAGREIIQLNVSKLINLEMQVVLEEYEKENLN
F2F399_SOLSS/32-188GLQSKWYIASFQSLMTT--FIDFISKIE..........MSNVDMAKAVDAFSKLINFEQQLVIEAYEKEEQR
C0ZJ13_BREBN/21-178GLAPEWYTGSYLRVYEY--LIPAIVNTY.........SKRPQELSSVLLALMRIITLDSQIVLQSYQEDNDY
B0ULQ7_METS4/3-159GLEPRWYIGGYAFVLNA--LVQVLVERA........GLLGRGGLPARIAALNKAVMLDMDFAISVYQDVLLE
C6WYR1_METML/18-175GLEPRWHLSAYSKYLSW--VLPEVMRLV.........DNDAERFLAYSTAITKIAMFDSELSISAYFHADHE
B9J942_AGRRK/14-180GLDPRWHVAGHGVVLEH--ILAGIVEEMGGRAVLPGTKRRARELSELVKAAVRLVMVDVEIAVSLRFNELRL
C0ZKX8_BREBN/35-191GLEPKWYLSAFQNMLVS--LIDLLQKNI..........ADKDEFVQAITAVTKILSIEQQIVLEEYENEHEK
A9CJK8_AGRT5/7-170GLEPRWYIGGYALMLDG--IVKAVIESELKG...LFMEKKAKKVKDALSATIKAALLDMDYSISVYLDVLAT
C4KYX4_EXISA/28-185AVPVVWFLATYSAFNTL--LIPKVVETY.........QHDPAVLSESLLALSHAMNLDAQIVTEQYVNARLD
B2W0B6_PYRTR/24-203HVEYVHVGVTLSFIQDI--MTEAVLSHP.........RLKMERKIGLVKALSKVLWIQNDLFAKWYVKDGEE
E3EZY8_KETVY/10-171GLEPRWYIGGYGLVLDR--IIRDIVTTRRT.....WTGKDRARLAADLSAVVRAALVDIDLSITCYIDKLDE
Q1AU74_RUBXD/22-196EVSLRYMISFIYPITAT--VRPFLEEGG..........RPAEDVEKMHQAWFKAVVLHVTLWSQPYAREGSF
A8IPP6_AZOC5/62-225GLEPRWYIAGYALLLSG--LVAAIETGFKAG...RFDRTAPERKARLIEAVITAALLDMDFAISVYLDAGIK
Q1GI20_RUEST/15-172GITPTLYVGSYAYYLQR--LSQSILENG.........KEDPHKLFGLVLSMMKIAHYDMALALETYVEAREK
B2AU65_PODAN/21-200HIEYIHIGAGLAVIQDV--LTEAILSHP.........RLHIQRKIAIVKALGKVIWIQNDLFTKWYVHDGEE
Q0UTR0_PHANO/18-193RVEYIHIGATLSFIQDV--LTEAILEHP.........RMSMQRKVGLVKALSKVIWIQNDLFAKWYVRDGEE
A2R286_ASPNC/23-202KIEYMHMNTCLGYVKEL--AYETISGHP.........EMSYPFKFALIRALNKIMTIQNDLISRCYIREGQE
A9EVT1_SORC5/5-161GVEPTWYLGAYRRYMHL--LLEAFSDDI..........GDPAEVVRAFTSVQKLVYFDVSLALDAYFSTTFD
B8N2G0_ASPFN/23-202TIEYIHMNACLGYVKQL--LFETISLHP.........DMSVKFKFALIRSMSKVFCIQNDLISKCYINEGQE
C4JKA6_UNCRE/20-213RVELMHCSALLGFVEDI--VLNAVMGAQ.........DVDLPTKTKIIRAFNKLLWIQNDLFLKQYTPEPWS
D2VCV6_NAEGR/13-197VIDYIHINALFGYVSDV--LLGTIAMCP.........QLNEEQRAKTVQAFNKLLWIQNDLFAKYYVDDDSR
Q9YFF4_AERPE/20-195HIPLRYLIAFIYPITAT--IKPFLAKKG..........GSPEDIEGMYNAWFKSVVLQVAIWSHPYTKENDW
F0SHW9_PLABD/6-164GLDHVYVNAAFSRVRLR--LNETLSQQG.........QLSLERRMELHSSLGKRLDLDLAIMSAAYQAEYQS
A8FBP1_BACP2/29-185GLQPKWYMAAFQDLLLS--IMDLFAQHI..........QDFKEYQTAVKATTKILNLEQQLVLDTFQNEYSK
A8P1M8_COPC7/13-202RVEYIQCAILLGYVEDI--LVNAVLTHP.........DLDDATKLVVMRAFNKLIWIQNDLFARHYISEEKA
A1CRU6_ASPCL/32-212NIEYIHIGVMLGFIQDI--FTEALMSHP.........TLSLQRKVALVRAIGKIIWIQNDLFARYRVRDGEE
Q47S02_THEFY/23-197NIPLRYVIAFIYPVTAT--LRPFLAKKG..........HSADQVEAMYQAWFKSVTMQIALWSQPYTRDGYW
A9WGB2_CHLAA/23-194MIPLRYMIAFIYPITAT--IREFLARKG..........HSAAEVDRMHQAWFKSIVLQVTLWSYPYTREGD.
B1HTR5_LYSSC/28-179GLRTQWYICAFQDLSLS--FIDLVEQHI..........GHPQDQFNTIRAISKICNFEQQLVLEAYENTV..
F0LY60_VIBFN/12-164GIDFKVYSGAYCIVMSQ--LARVVYQSL.........APNIDNIHRYMSALNRAIFLDLGLATAVYYDT...
G0JLY5_9GAMM/7-158RVPPLFVAASMSFLRAA--LPPVIAENV..........PDQHDMGKAVAALLRLLDLCQYLIDRKYNDAL..
HEMAT_BACSU/31-185GLLPKWYMGAFQELLLS--MIDIYEASI..........TNQQELLKAIKATTKILNLEQQLVLEAFQSEYN.
Q2KCI4_RHIEC/11-175GLDPRWHVAGHGVMLEH--VLSGLAEEIAGRPLLPSARRRTREISDLMTAIIRIVMVDVEIAVSLRFNALR.
MCPE_RHIME/15-178GLDPRWQIASHAIVLEH--LILGAIEDAWPKSILSLGKARRRELRDLVAALVRAAFVDTEIAVSLRFNALR.
Q65LP1_BACLD/29-182GLLPKWYLGAFQDLLLS--MLKIFENAL...........SDEEYRRSVKAVTKILNIEQQIVLEAFEDEH..
Q7D1B0_AGRT5/50-211GLDPRWQIASHAVVLEH--LLGGLVAEHAPRSILPGNRKKSRELADAVKNVVRLVMVDTEIAVSLRFNEL..
Q81JN0_BACAN/32-186GLHRKWYTAAYQELFRS--IMKILKTKI..........TTIDDFSYSINVINKLFTLEQELVIAAYESKYE.
Q8TLY9_METAC/23-193NIGYRYLVAFIYPITAT--MKPFLARKG..........HTPEEVEKMYQAWFKATTLQVALWSYPYVKYG..
Q9A5Y0_CAUCR/45-206DIAPQWYIGGYAVVVEE--VMRALVAKRAKG..LFNSAKSDAELADGLSALIKAAFLDMDLSVSTYIDVL..
Q9AB06_CAUCR/8-170GLEPRWYIGGYAVVGDH--LVRAVIDSMWPR..GLLAKGGSDRAGEAVAALMKAIFLDMDFAISIYLETLE.
U5L913_9BACI/33-184GLQPKWYMCAFQDLYLS--LCSMIIDTI..........SEKGPCTGAMLAVSKIISLEQQIVLEAYEQE...
U5LFP3_9BACI/32-184GVQIHWYMSIYQLLMKN--ILEIVLQEL.........ELSSKDQSRVTFAMAKIFNLEIQLCISIMQQTME.
V6F1E9_9PROT/46-194DLGASWYQAMAANAASQ--ALAMLRDQR..............HFDTLAGVLTRASQLDVSLVTHDYFEAAK.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window