Sequence alignment for CL0091

PF08030

RBOHE_ARATH/752-935YDVLLLIG-LGIGATPFISILKDLLNNSRDEQTDNEFSRSDFSWNSCTSSYTTATPTSTHGGKKKAVKAHF-YWVTREPG
FRO3_ARATH/455-701HDSLVMVS-GGSGITPFISIIRDLLYVSS...............................TNAYKTPKITL-ICAFKNSS
FRE4_YEAST/530-699FDNVLLLA-GGSGLPGPISHALELGKTTA.................................ASGKNFVQL-VIAVRGLD
RBOHA_ARATH/707-885FEVVLLVG-LGIGATPMISIVSDIINNLKGVEEGSNRRQSPI.....HNMVTPPVSPSRKSETFRTKRAYF-YWVTREQG
D2VM77_NAEGR/378-610FEYVMLIA-AGIGVTPYSSLLKHFKFRLDAAA.........................SGQAPPLKIRRASF-YWINRDEG
FREL_CANAX/496-649CKNVVFVA-GGNGIPGIYSECVDLAKKSK....................................NQSIKL-IWIIRHWK
FRO2_ARATH/441-709HEALVMVC-GGSGITPFISVIRDLIATSQ...............................KETCKIPKITL-ICAFKKSS
FRE7_YEAST/423-596FTNVYLIC-SGSGISTCLPFLQKYGPILH.................................KTNLEVITL-DWVVRHRE
FRE6_YEAST/550-692FDHLLLLS-GGTGLPGPLDHAIKLSRNPD...................................KPKSIDL-IMAIKNPS
RBOHC_ARATH/715-888YEVVLLVG-LGIGATPMISIVKDIVNNIKAKEQAQLNRM..........ENGTSEPQRSKKESFRTRRAYF-YWVTREQG
RBOHD_ARATH/736-904YDVVLLVG-LGIGATPMISILKDIINNMKGPDRDSDI...............ENNNSNNNSKGFKTRKAYF-YWVTREQG
AIM14_YEAST/371-557GTNIAIIC-GGSGISFALPLFRHFFNKE....................................NVKYLKM-IWLIKDYS
RBOHF_ARATH/746-927YDVLLLVG-LGIGATPFISILKDLLNNIVKMEEHADSISDFSR..SSEYSTGSNGDTPRRKRILKTTNAYF-YWVTREQG
RBOHB_ARATH/661-826YDVLLLVG-LGIGATPLISIIRDVLNNIKNQNSIE..................RGTNQHIKNYVATKRAYF-YWVTREQG
FRE1_YEAST/527-666KRNLVGVA-AGLGVAAIYPHFVECLRLPS..................................TDQLQHKF-YWIVNDLS
D2VLT6_NAEGR/389-614YETVVLIA-AGIGATPYASLLKHFNYTLDLE..........................KRGGKPLKIKKCFF-YFINRDHG
FRP2_SCHPO/414-548YSYVLLIA-GGVGFSYTLPILRDLILKEC...................................NVTSITF-IWSCRSLS
FRE5_YEAST/531-674FESLLFIA-GGAGVPGPLSMAIKAGRQVK................................SNDSHQMIKF-VWSVRNLD
CY24B_HUMAN/401-551YEVVMLVG-AGIGVTPFASILKSVWYKYCN.............................NATNLKLKKIYF-YWLCRDTH
FRP1_SCHPO/414-548YSYLFLFA-GGVGVSYILPIILDTIKKQS...................................RTVHITF-VWSARSSA
FRE2_YEAST/537-691YNNVLLLT-GGTGLPGPIAHAIKLGKTSA.................................AAGKQSVKL-VIAVRGFD

PF00175

PYRK_ENTFO/113-207-----IVG.GGIGIPPLYELSKQLN....------------------------E..........KGVKVIH.FLGYASKE
NCB5R_YEAST/151-261-----MIA.GGTGIAPMYQIMKAIAMD.P------------------------H..........DTTKVSL.VFGNVHEE
FENR_ECOLI/111-223-----MLA.TGTAIGPYLSILQLGKDL..------------------------D..........RFKNLVL.VHAARYAA
ASCD_YERPS/205-308-----FLA.GGTGFAPVKSMVEALINK..------------------------N..........DQRQVHI.YWGMPAGH
NCPR_HUMAN/530-641-----MVG.PGTGVAPFIGFIQERA....------------------------WLRQQ..GKEV..GETLL.YYGCRRSD
DMPP_PSEUF/210-317-----FIA.GGSGLSSPQSMILDLLER..------------------------G..........DTRRITL.FQGARNRA
FRE_PHOLU/108-212-----LIA.GGTGFSYTRSILLTALEE..------------------------Q..........PKRHISM.YWGGRESQ
FRE_ECOLI/108-212-----LIA.GGTGFSYARSILLTALAR..------------------------N..........PNRDITI.YWGGREEQ
CYSJ_SALTY/457-564-----MIG.PGTGIAPFRSFMQQRAAE..------------------------G..........VEGKNWL.FFGNPHFT
NCPR_YEAST/538-656-----MIG.PGTGVAPFRGFIRERVAFLE------------------------SQKKGGNNVSL..GKHIL.FYGSRNTD
NIA_USTMA/836-967-----MIA.GGSGITPIWSTLKAIADEVL------------------------DASNP.SSPALDPIQIWI.VYGNRTEQ
NB5R3_RAT/177-285-----MIA.GGTGITPMLQVIRAVLKD.P------------------------N..........DHTVCYL.LFANQSEK
CPXB_BACME/901-1012-----MVG.PGTGVAPFRGFVQARK....------------------------QLKEQ..GQSL..GEAHL.YFGCRSPH
HMP_ECOLI/264-373-----LIS.AGVGQTPMLAMLDTLAKA..------------------------G..........HTAQVNW.FHAAENGD
NCPR_CANTR/532-645-----LIG.PGTGVAPLRGFVRERV....------------------------QQVKN..GVNV..GKTVL.FYGCRNSE
FENR_CYAPA/216-332-----MLA.TGTGIAPFRSFLRRMFEETH------------------------ADY......KF.NGLAWL.FLGVPTSS
NIA2_MAIZE/104-214-----MIQ.AGRGTTPDDDTEQAVLRDQP------------------------D..........DDTEMHL.VYANRTDH
Q896R9_CLOTE/103-186-----LVG.GGVGIAPLYLASKVLKGT..------------------------S..........KDTTVDI.FLGFSDEA
NCPR_MUSDO/524-635-----MVG.PGTGLAPFRGFIQERQ....------------------------FLRDG..GKVV..GDTIL.YFGCRKKD
NIA_LOTTE/29-137-----MLA.GGTGITPIYQVIQAVLKD.P------------------------D..........DRTEMFFAVYSNKTES
PYRK_BACAN/113-204-----LVG.GGIGVPPLYELSQRLV....------------------------A..........KGVRVIH.ILGFQTKD
MMOC_METCA/220-325-----FVA.GGTGLAPVVSMVRQMQEW..------------------------T..........APNETRI.YFGVNTEP
MCR1_YEAST/164-274-----LLG.AGTGINPLYQLAHHIVEN.P------------------------N..........DKTKVNL.LYGNKTPQ
HMP_CUPNH/271-379-----LIS.GGVGLTPMVSMLKVALQA..------------------------...........PPRQVVF.VHGARNSA
Q8KF58_CHLTE/104-198-----.IG.GGVGTAIAYPTAAALK....------------------------E..........AGNYVIT.INGARSKD
FRE_VIBFI/112-215-----LIA.GGTGFSYVRSILDHCISQ..------------------------Q..........IQKPIYL.YWGGRDEC
BENC_ACIAD/225-328-----MLA.GGTGIAPFLSMLQVLEQK..------------------------G..........SEHPVRL.VFGVTQDC
PYRKH_AQUAE/109-200-----LIG.GGVGLAGLTLLAKKLR....------------------------D..........MGKKVFI.AYGGRSRE
ASRB_SALTY/115-218-----VVA.GGTGVAPVKGLMRYFVENPQ------------------------E...........IGQLDM.ILGYKNRD
RFBI_SALTY/200-303-----FLA.GGTGFAPVKSMVEHLIQG..------------------------K..........CRREIYI.YWGMQYSK
Q891F8_CLOTE/110-206-----YIA.GGVGSAPVYPQVKWLN....------------------------S..........IGVKVDV.IIGAKTKE
NOS1_RAT/1246-1360-----LVG.PGTGIAPFRSFWQQRQF...------------------------DIQHK..GMNP..CPMVL.VFGCRQSK
NIA_NEUCR/855-967-----MVC.GGSGVTPIYQVAEAVAVD.D------------------------Q..........DGTECLV.LDGNRVEG
NIA_LEPMC/771-878-----MIC.GGSGITPIYQVLRAILQD.S------------------------A..........DSTHCTV.LNGNRLEE
PYRK_THEAC/96-181-----IIG.GGSGIASLLPIADS......------------------------..............DTDA.LISAKTKE
FENR1_PEA/213-329-----MLG.TGTGIAPFRSFLWKMFFEKH------------------------EDY......QF.NGLAWL.FLGVPTSS
NIA_ASPNG/745-852-----MIC.GGTGITPIFQVLRAVMQD.K------------------------Q..........DPTSCVV.LDGNRQEE
Q8U194_PYRFU/103-198-----MIG.GGVGVAEIYPVAKAMK....------------------------E..........KGNYVIS.ILGFRTKD
PYRK_THEVO/96-181-----LVG.GGSGIVSLYPIADQ......------------------------..............ETDA.LISAKTRD
NIA_CICIN/794-903-----MFA.GGTGITPDLSSDASYLKD.P------------------------E..........DDTEMYV.VYANRTED
NCPR_SCHPO/535-647-----MVG.PGTGVAPFRGFVMERA....------------------------NLASK..GVKV..AKTLL.FYGCQYSD
LUXG_VIBHA/108-212-----LVA.GGTGMSYTLSILKNSLAQ..------------------------G..........FNQPIYV.YWGAKDME
XYLZ_PSEPU/212-315-----LLA.GGTGLAPFTAMLEKIAEQ..------------------------G..........GEHPLHL.IYGVTHDH
NIA2_ARATH/791-900-----MLA.GGTGITPVYQIIQAILKD.P------------------------E..........DETEMYV.IYANRTEE
NIA2_HORVU/783-895-----MIC.GSSGITPMYQVIQAVLRDQP------------------------E..........DETEMHL.VYANRSED
FENR2_ORYSJ/232-347-----MIA.TGTGVAPFRGYLRRMFMEDV------------------------PKY......RF.GGLAWL.FLGVANTD
NIA_VOLCA/738-848-----FVA.GGTGITPCYAVIKAALRD.P------------------------E..........DKTQISL.VFANNTEE
Q8EUY1_MYCPE/114-209-----LIG.GGVGIPPLFELAKQFN....------------------------N..........KGINVIT.LLGFNKIE
PYRK_STRPN/105-196-----LVG.GGIGVPPLLEVAKELH....------------------------E..........RGVKVVT.VLGFANKD
Q8RBW4_THETN/103-198-----GIG.GGLGIAPLYPKLKMLH....------------------------Q..........QGVEVVS.IIGARTAE
FENR_ANASO/289-409-----MLA.TGTGIAPMRTYLWRMFKDAE------------------------RAANP..EYQF.KGFSWL.VFGVPTTP
NIA_BEABA/768-879-----MIC.AGSGVTPIFQVLRAVTSD.A------------------------Q..........DGTECLV.LDGNRCEK
Q8G659_BIFLO/126-220-----LVG.GGLGVPPLIYAAQKLA.E..------------------------H..........DASFATA.VFGYRNDH
FENR_SPISP/147-263-----MMA.TGTGIAPFRAFLWRIFKEQH------------------------EDY......KF.KGLAWL.FFGIPYSP
PYRK_CLOAB/106-192-----IVC.GGIGVAPMVYLAKNL.....------------------------...........KNCNVDF.YAGFKTVS
NIA_PHYIN/770-885-----FVA.GGTGITPVYQVMRAILED.A------------------------K..........DQTKVAL.IYCVRSQR
LUXG_PHOLE/109-213-----LIA.GGTGLSYINSILSCCISK..------------------------Q..........LSQPIYL.YWGVNNCN
NCPR_CATRO/568-679-----MIG.PGTGLAPFRGFLQERL....------------------------ALKEE..GAEL..GTAVF.FFGCRNRK
FENR_SYNP2/255-371-----MLA.TGTGIAPFRAFLWRMFKEQH------------------------EDY......KF.KGKAWL.IFGVPYTA
LUXG_VIBFI/111-215-----LIA.GGTGLSYINSILTNCLNR..------------------------N..........IPQDIYL.YWGVKNSS
NIA_EMENI/748-858-----MIC.GGTGITPVFQVLRAVMQD.E------------------------Q..........DETKCVM.LDGNRLEE
XYLA_PSEPU/221-327-----CVA.GGTGLAPIKCVLQSMTQA..------------------------Q..........RERDVLL.FFGARQQR
NIA_FUSOX/778-890-----MVC.GGSGITPIRQVLRAVIDN.P------------------------K..........DTTPCLV.FNGNRSVN
Q8KB48_CHLTE/115-207-----LVS.GGIGTAPMLFLEKTLA....------------------------A..........AGIPFHH.LVGGRSRS
PYRK_STRMU/111-202-----IIG.GGIGVPPLLEVAKQLC....------------------------K..........KGVEAYA.VLGFANKD
NOS2_HUMAN/979-1093-----LIG.PGTGIAPFRSFWQQRLH...------------------------DSQHK..GVRG..GRMTL.VFGCRRPD
NIA_BETPN/773-881-----MVA.GGTGITPIYQVIQAILKD.P------------------------E..........DETEMFV.VYANRTED
TMOF_PSEME/204-307-----FIA.GGSGIAPMVSMVNTLIAQ..------------------------G..........YEKPITV.FYGSRLEA
K502_ACTDE/195-300-----LISVTGYGMSAGRSFIEEGFGA..------------------------N..........KRSDVRL.YYGAENLE
PYRK_THETN/104-191-----IVG.GGVGIAPLLYLAKKV.....------------------------...........KAQKLYI.ALGFKRET
HMP_VIBPA/264-371-----LIS.AGVGLTPTLSMLESLTE...------------------------...........HHAPVTW.VHATENSK
PYRK_LACLA/115-208-----IVG.GGIGVPPLYELAKQLE....------------------------E..........KNCQMTI.LLGFASEK

PF08030

RBOHE_ARATH/752-935SVEW--FRGVM..EEISDMDCR....GQIELHNYLTSVYDE...............GDARSTLIKMVQALNHA.......
FRO3_ARATH/455-701DLSM--LNLIL.PN..STEISS...FIDIQIKAFVTREKVSTCNMNI..IKTLSFKPYVSDQPISPILGPNSWLWLATIL
FRE4_YEAST/530-699MLNA--CK.....KELMALKGL.....NVQVHIYNSKQELA...............SAEKISSNEVKNGETTAEKA....
RBOHA_ARATH/707-885SFDW--FKNVM..DEVTETDRK....NVIELHNYCTSVYEE...............GDARSALITM.....LQSLN....
D2VM77_NAEGR/378-610SWEW--FSDIL..NQLETENPE.....FFDIHTYMTGMLKA...............DDVKKIMFTSSEYQTQSNTAGNVQ
FREL_CANAX/496-649SLSW--FT.....EELEYLKKT.....NVQSTIYVTQPQDCSGLECFEHDVSFEKKSDEKDSVESSQYSL.ISNIK....
FRO2_ARATH/441-709EISM--LDLVLPLSGLETELSS...DINIKIEAFITRDNDAGDEAKAGKIKTLWFKPSLSDQSISSILGPNSWLWLGAIL
FRE7_YEAST/423-596DISW--IRDEM..CTLSNNLRQLFLDGKIVVRIYVCSDSTVPGIIK....TFPQTIDTASDQSDLAKREKDTEFGQDDTE
FRE6_YEAST/550-692FLNG--YK.....SEILELKNS...RSHVNVQVYLTQKTAV...............TKAANARDQLIH...FDDIM....
RBOHC_ARATH/715-888SFDW--FKNIM..NEVAERDAN....RVIEMHNYCTSVYEE...............GDARSALIHM.....LQSLN....
RBOHD_ARATH/736-904SFEW--FKGIM..DEISELDEE....GIIELHNYCTSVYEE...............GDARVALIAM.....LQSLQ....
AIM14_YEAST/371-557EYEL--VLDYLKTNGLTFEKKL...SNNKRISVFISGEYTA...............ETRLDEITTNIDDENSEYEMGSFN
RBOHF_ARATH/746-927SFDW--FKGVM..NEVAELDQR....GVIEMHNYLTSVYEE...............GDARSALITM.....VQALN....
RBOHB_ARATH/661-826SLEW--FSEVM..NEVAEYDSE....GMIELHNYCTSVYEE...............GDARSALITM.....LQSLH....
FRE1_YEAST/527-666HLKW--FE.....NELQWLKEK.....SCEVSVIYTGSSVE...............DTNSDESTKG.....FDDKE....
D2VLT6_NAEGR/389-614SWEW--FSNLL..NEMEDHHPE.....FFELNTYMTGKLKA...............EEIKKLYFGSSEYQQATGHKQTAD
FRP2_SCHPO/414-548LLKV--ASKSL..NSLLHQSNV.....RLKIINHFTGSISC...............KESSE..........FSNQT....
FRE5_YEAST/531-674LLEV--YR.....KEIMVLKEL.....NIDTKIYFTGERKD...............ESNTEEGAIANMSTEGRLLTTS..
CY24B_HUMAN/401-551AFEW--FADLL..QLLESQMQERNNAGFLSYNIYLTGWDES...............QAN............HFAVH....
FRP1_SCHPO/414-548LLNI--VHKSL..CEAVRYTEM.....NINIFCHLTNSYPV...............EEVSS..........LNSQS....
FRE2_YEAST/537-691VLEA--YK.....PELMCLENL.....NVQLHIYNTMEVPS...............LTPSDSLDISQQDEKADEKG....

PF00175

PYRK_ENTFO/113-207.VAY..YQQEF--MALGETH..-----.........--------------------..........FATDDGSFGA----
NCB5R_YEAST/151-261.DIL..LKKEL--EALVAMKPS-----..QFKIVYY--------------------L........DSPDREDWTGG----
FENR_ECOLI/111-223.DLS..YLPLM--QELEKRYEG-----..KLRIQTV--------------------V........SRETAAGS..L----
ASCD_YERPS/205-308.NF...YSDIA--NEWAIKHPN-----...IHYVPV--------------------.........VSGDDSTWTGA----
NCPR_HUMAN/530-641EDYL..YREEL--AQF..HRDG-----ALTQLNVAF--------------------..........SREQSH....----
DMPP_PSEUF/210-317.ELY..NCELF--EELAARHPN-----...FSYVPA--------------------L.......NQANDDPEWQGF----
FRE_PHOLU/108-212.HLY..DLAEL--RLLTERYPN-----...LKVIPV--------------------.........VEQSDNGWCGR----
FRE_ECOLI/108-212.HLY..DLCEL--EALSLKHPG-----...LQVVPV--------------------.........VEQPEAGWRGR----
CYSJ_SALTY/457-564EDFL..YQVEW--QRY..VKEG-----VLSRIDLAW--------------------..........SRDQKE....----
NCPR_YEAST/538-656.DFL..YQDEW--PEYAKKLDG-----SFE.MVVAH--------------------..........SRLPNTK...----
NIA_USTMA/836-967.DIL..IREEL--ERLRVALKG-----..NLKVWHV--------------------LS.....NCTPENEANWSMG----
NB5R3_RAT/177-285.DIL..LRPEL--EELRNEHSS-----..RFKLWYT--------------------.........VDKAPDAWDYS----
CPXB_BACME/901-1012EDYL..YQEEL--ENA..QSEG-----IIT.LHTAF--------------------..........SRMPNQP...----
HMP_ECOLI/264-373.VHA..FADEV--KELGQSLPR-----FTAHTWYRQ--------------------P.......SEADRAKGQFDS----
NCPR_CANTR/532-645QDFL..YKQEW--SEYASVLGE-----NFE.MFNAF--------------------..........SRQDPTK...----
FENR_CYAPA/216-332.TLL..YREEL--EKMQKANPN-----NFR.LDYAI--------------------..........SREQTDSKGE----
NIA2_MAIZE/104-214.DML..LREEI--DRAWLPRTR-----..RLKVWYV--------------------V........SKVPEDGWEYG----
Q896R9_CLOTE/103-186...L..LEEEY--KKVADKV..-----.........--------------------................VVNL----
NCPR_MUSDO/524-635EDFI..YREEL--EQY..VQNG-----TLT.LKTAF--------------------..........SRDQQE....----
NIA_LOTTE/29-137.DIL..LREEL--DAWAKKHSD-----..RFKVWYV--------------------.........VDKAGNDWAFS----
PYRK_BACAN/113-204.VVF..YEEKF--AELGDTY..-----.........--------------------..........VATVDGTHGT----
MMOC_METCA/220-325.ELF..YIDEL--KSLERSMRN-----...LTVKAC--------------------.........VWHPSGDWEGE----
MCR1_YEAST/164-274.DIL..LRKEL--DALKEKYPD-----..KFNVTYF--------------------V.......DDKQDDQDFDGE----
HMP_CUPNH/271-379.VHA..MRDRL--REAAKTYEN-----LDLFVFYDQ--------------------P.......LPEDVQGRDYDY----
Q8KF58_CHLTE/104-198.LVI..LEDEM--KAVSDEAY.-----.........--------------------..........ITTDDGSYGF----
FRE_VIBFI/112-215.QLY..AKAEL--ESIAQAHSH-----...ITFVPV--------------------..........VEKSEGWTGK----
BENC_ACIAD/225-328.DLV..ALEQL--DALQQKLPW-----...FEYRTV--------------------..........VAHAESQHER----
PYRKH_AQUAE/109-200.HLG..MVEWL--EKEEFPYE.-----.........--------------------..........LFTNDGSAGR----
ASRB_SALTY/115-218.CVL..YKEEM--ATWRGKHNL-----VLTL.....--------------------..........DEGEADDRYQ----
RFBI_SALTY/200-303.DFY...SALP--QQWSEQHDN-----...VHYIPV--------------------.........VSGDDAEWGGR----
Q891F8_CLOTE/110-206.MII..LEEEM--EKEAGNLY.-----.........--------------------..........IATDDGSYGY----
NOS1_RAT/1246-1360IDHI..YREET--LQA..KNKG-----VFRELYTAY--------------------..........SREPDRP...----
NIA_NEUCR/855-967.DIL..MKSEL--DELVERAKP-----MGRCRVKYT--------------------.........LSRPGAEWEGL----
NIA_LEPMC/771-878.DIL..CREDL--DRFAEENGE-----..RCTLVHT--------------------.........LTQAAEGWTGR----
PYRK_THEAC/96-181.ELI..FTDRF--PE.SRLF..-----.........--------------------..........IATDDGSEGF----
FENR1_PEA/213-329.SLL..YKEEF--EKMKEKAPE-----NFR.LDFAV--------------------..........SREQVNDKGE----
NIA_ASPNG/745-852.DIL..CRADL--DAYEALDSK-----..KCKVVHT--------------------.........LTKAPDSWTGR----
Q8U194_PYRFU/103-198.LVF..WEDKL--RSVSDEVI.-----.........--------------------..........VTTNDGSYGM----
PYRK_THEVO/96-181.ELI..FKDRF--PE.SRRF..-----.........--------------------..........IATDDGSDGF----
NIA_CICIN/794-903.DIL..LREEL--DAWADKYSD-----..RVKVWYV--------------------V........AKSIREGWKYS----
NCPR_SCHPO/535-647KDFL..YKEEW--QQYKDVLKD-----SFE.LITAF--------------------..........SREQDH....----
LUXG_VIBHA/108-212.NLY..VHDEL--VDIALENKN-----...VSYVPV--------------------.........TEISTCPQYAK----
XYLZ_PSEPU/212-315.DLV..EMDKL--EAFAARIPN-----...FSYSAC--------------------..........VASPDSAYPQ----
NIA2_ARATH/791-900.DIL..LREEL--DGWAEQYPD-----..RLKVWYV--------------------.........VESAKEGWAYS----
NIA2_HORVU/783-895.DIL..LRDEL--DRWATEYPD-----..RLKVWYV--------------------ID......QVKRPEDGWKFS----
FENR2_ORYSJ/232-347.SLL..YDEEF--TSYLKQYPD-----NFR.YDKAL--------------------..........SREQKNKNAG----
NIA_VOLCA/738-848.DIL..LREEL--DELANNHPD-----..RFHLWHT--------------------V........SQTNSSDWKFS----
Q8EUY1_MYCPE/114-209.DIF..LKEEF--EKISKVY..-----.........--------------------..........IATNDKKTKY----
PYRK_STRPN/105-196.AVI..LKTEL--AQYGQVF..-----.........--------------------..........VTTDDGSYGI----
Q8RBW4_THETN/103-198.LLI..LEEEI--KAVSDRMY.-----.........--------------------..........ICTDDGSKGR----
FENR_ANASO/289-409.NIL..YKEEL--EEIQQKYPD-----NFR.LTYAI--------------------..........SREQKNPQGG----
NIA_BEABA/768-879.DIL..CREEL--DAMVARAPA-----..RTTLLHK--------------------.........LSRPDASWCGL----
Q8G659_BIFLO/126-220.FA....EEYV--SRYADWS..-----.........--------------------..........WSIDDA....----
FENR_SPISP/147-263.NIL..YQQEL--EELQEEFPE-----NFR.LTLAI--------------------..........SREQQNPEGG----
PYRK_CLOAB/106-192.KTVDNVEKYV--KELK.....-----.........--------------------..........LSTEDGSIGH----
NIA_PHYIN/770-885.DLL..LRKEL--ETLQKLRPG-----..QCRIFYT--------------------LSDMELLDRNDPIVRGWAYG----
LUXG_PHOLE/109-213.LLY..ADQQL--KTLAAQYRN-----...INYIPV--------------------.........VENLNTDWQGK----
NCPR_CATRO/568-679MDYI..YEDEL--NHF..LEIG-----ALSELLVAF--------------------..........SREGPT....----
FENR_SYNP2/255-371.NIL..YKDDF--EKMAAENPD-----NFR.LTYAI--------------------..........SREQKTADGG----
LUXG_VIBFI/111-215.LLY..EDEEL--LELSLNNKN-----...LHYIPV--------------------.........IEDKSEEWIGK----
NIA_EMENI/748-858.DIL..LKNEL--DEFEALAGK-----KEKCKIVHT--------------------.........LTKGSESWTGR----
XYLA_PSEPU/221-327.DLY..CLDEI--EALQLDWGG-----..RFELIPV--------------------L.......SEESSTSSWKGK----
NIA_FUSOX/778-890.DIL..CMEEL--EELEAANPS-----..RCRVVNA--------------------.........LSNPPPEWNGL----
Q8KB48_CHLTE/115-207.DL...LTTSL--SNVS.....-----.........--------------------..........TATDDGSEGF----
PYRK_STRMU/111-202.AVI..LEEKM--SQYATVV..-----.........--------------------..........VTTDDGSYGQ----
NOS2_HUMAN/979-1093EDHI..YQEEM--LEM..AQKG-----VLHAVHTAY--------------------..........SRLPGKP...----
NIA_BETPN/773-881.DIL..LREEL--DDWAKKHE.-----..KLKVWYV--------------------V........KESKREGWEYS----
TMOF_PSEME/204-307.ELE..AAETL--FGWK...EN-----...LKLINV--------------------S.......SSVVGNSEKKYP----
K502_ACTDE/195-300.TMG..YQERF--KDWEASGVR-----VIPVL....--------------------..........SRPPPNWNGA----
PYRK_THETN/104-191...F..LVEKF--EGLGEVV..-----.........--------------------..........VTTEEGSTGR----
HMP_VIBPA/264-371.HHA..FKEHV--NQLVTAKEN-----MNALIWYNQ--------------------P.......TAEDKIGEDFHF----
PYRK_LACLA/115-208.VKI..LEKEF--AELKNVSLK-----.........--------------------..........IATDDGSYGT----

PF08030

RBOHE_ARATH/752-935.....................................................................KHGVDILSGTR
FRO3_ARATH/455-701SSSFMIFIIIIAIISRYHIYPIDQSSKEY....TSAYTSLIYLLAISISVVATSTVAMLCNKKSYFKGLYQNVDALSPLM
FRE4_YEAST/530-699...................................................................PSSLS.....NSE
RBOHA_ARATH/707-885...................................................................HAKHGVDVVSGTR
D2VM77_NAEGR/378-610QSGKVDFMVRALHKYDAQSSDEISLD..........RNDIVVVSEQDESGWWTGTNTTTKQTGLFPGNFVVKVDHVTKMA
FREL_CANAX/496-649...................................................................QGLSH........
FRO2_ARATH/441-709ASSFLIFMIIIGIITRYYIYPIDHNTNKIYSLTSKTIIYILVISVSIMATCSAAMLWNKKKYGKVESKQVQNVDRPSPTS
FRE7_YEAST/423-596SN..........................................................STFDKSNNEYKG........
FRE6_YEAST/550-692...................................................................TELTS........
RBOHC_ARATH/715-888...................................................................HAKNGVDIVSGTR
RBOHD_ARATH/736-904...................................................................HAKNGVDVVSGTR
AIM14_YEAST/371-557NEDEDLS.................................................ISNFNSENADSNDNTPETSHSPTK
RBOHF_ARATH/746-927...................................................................HAKNGVDIVSGTR
RBOHB_ARATH/661-826...................................................................HAKSGIDIVSGTR
FRE1_YEAST/527-666...................................................................ESEIT........
D2VLT6_NAEGR/389-614VLLRAMYDYTPVSSDELELHAND................IISLKEQDESGWWEGTNLTTNESGLFPSNYVIHIDALTKLR
FRP2_SCHPO/414-548...................................................................TENSE........
FRE5_YEAST/531-674.................................................................KSAEMIT........
CY24B_HUMAN/401-551...................................................................HDEEK.DVITGLK
FRP1_SCHPO/414-548...................................................................ARNYS........
FRE2_YEAST/537-691...................................................................TVVAT.....TLE

PF00175

PYRK_ENTFO/113-207--------------------------------------------------------------------------------
NCB5R_YEAST/151-261--------------------------------------------------------------------------------
FENR_ECOLI/111-223--------------------------------------------------------------------------------
ASCD_YERPS/205-308--------------------------------------------------------------------------------
NCPR_HUMAN/530-641--------------------------------------------------------------------------------
DMPP_PSEUF/210-317--------------------------------------------------------------------------------
FRE_PHOLU/108-212--------------------------------------------------------------------------------
FRE_ECOLI/108-212--------------------------------------------------------------------------------
CYSJ_SALTY/457-564--------------------------------------------------------------------------------
NCPR_YEAST/538-656--------------------------------------------------------------------------------
NIA_USTMA/836-967--------------------------------------------------------------------------------
NB5R3_RAT/177-285--------------------------------------------------------------------------------
CPXB_BACME/901-1012--------------------------------------------------------------------------------
HMP_ECOLI/264-373--------------------------------------------------------------------------------
NCPR_CANTR/532-645--------------------------------------------------------------------------------
FENR_CYAPA/216-332--------------------------------------------------------------------------------
NIA2_MAIZE/104-214--------------------------------------------------------------------------------
Q896R9_CLOTE/103-186--------------------------------------------------------------------------------
NCPR_MUSDO/524-635--------------------------------------------------------------------------------
NIA_LOTTE/29-137--------------------------------------------------------------------------------
PYRK_BACAN/113-204--------------------------------------------------------------------------------
MMOC_METCA/220-325--------------------------------------------------------------------------------
MCR1_YEAST/164-274--------------------------------------------------------------------------------
HMP_CUPNH/271-379--------------------------------------------------------------------------------
Q8KF58_CHLTE/104-198--------------------------------------------------------------------------------
FRE_VIBFI/112-215--------------------------------------------------------------------------------
BENC_ACIAD/225-328--------------------------------------------------------------------------------
PYRKH_AQUAE/109-200--------------------------------------------------------------------------------
ASRB_SALTY/115-218--------------------------------------------------------------------------------
RFBI_SALTY/200-303--------------------------------------------------------------------------------
Q891F8_CLOTE/110-206--------------------------------------------------------------------------------
NOS1_RAT/1246-1360--------------------------------------------------------------------------------
NIA_NEUCR/855-967--------------------------------------------------------------------------------
NIA_LEPMC/771-878--------------------------------------------------------------------------------
PYRK_THEAC/96-181--------------------------------------------------------------------------------
FENR1_PEA/213-329--------------------------------------------------------------------------------
NIA_ASPNG/745-852--------------------------------------------------------------------------------
Q8U194_PYRFU/103-198--------------------------------------------------------------------------------
PYRK_THEVO/96-181--------------------------------------------------------------------------------
NIA_CICIN/794-903--------------------------------------------------------------------------------
NCPR_SCHPO/535-647--------------------------------------------------------------------------------
LUXG_VIBHA/108-212--------------------------------------------------------------------------------
XYLZ_PSEPU/212-315--------------------------------------------------------------------------------
NIA2_ARATH/791-900--------------------------------------------------------------------------------
NIA2_HORVU/783-895--------------------------------------------------------------------------------
FENR2_ORYSJ/232-347--------------------------------------------------------------------------------
NIA_VOLCA/738-848--------------------------------------------------------------------------------
Q8EUY1_MYCPE/114-209--------------------------------------------------------------------------------
PYRK_STRPN/105-196--------------------------------------------------------------------------------
Q8RBW4_THETN/103-198--------------------------------------------------------------------------------
FENR_ANASO/289-409--------------------------------------------------------------------------------
NIA_BEABA/768-879--------------------------------------------------------------------------------
Q8G659_BIFLO/126-220--------------------------------------------------------------------------------
FENR_SPISP/147-263--------------------------------------------------------------------------------
PYRK_CLOAB/106-192--------------------------------------------------------------------------------
NIA_PHYIN/770-885--------------------------------------------------------------------------------
LUXG_PHOLE/109-213--------------------------------------------------------------------------------
NCPR_CATRO/568-679--------------------------------------------------------------------------------
FENR_SYNP2/255-371--------------------------------------------------------------------------------
LUXG_VIBFI/111-215--------------------------------------------------------------------------------
NIA_EMENI/748-858--------------------------------------------------------------------------------
XYLA_PSEPU/221-327--------------------------------------------------------------------------------
NIA_FUSOX/778-890--------------------------------------------------------------------------------
Q8KB48_CHLTE/115-207--------------------------------------------------------------------------------
PYRK_STRMU/111-202--------------------------------------------------------------------------------
NOS2_HUMAN/979-1093--------------------------------------------------------------------------------
NIA_BETPN/773-881--------------------------------------------------------------------------------
TMOF_PSEME/204-307--------------------------------------------------------------------------------
K502_ACTDE/195-300--------------------------------------------------------------------------------
PYRK_THETN/104-191--------------------------------------------------------------------------------
HMP_VIBPA/264-371--------------------------------------------------------------------------------
PYRK_LACLA/115-208--------------------------------------------------------------------------------

PF08030

RBOHE_ARATH/752-935.........................VRTHFA.RPNWKEVF----SSI.......ARKHPNSTVGVFYC....G-IQTVAK
FRO3_ARATH/455-701IESSP.............DQLLPEFTNIHYGERPNLNKLL----VGL...........KGSSVGVLVC....G-PRKMRE
FRE4_YEAST/530-699KAPSESENTELPLSLNDTSISDLEFATFHVG.RPNVEEIL----NES.........VNHSGSLAVVCC....G-PPIFVD
RBOHA_ARATH/707-885.........................VMSHFA.RPNWRSVF----KRI.......AVNHPKTRVGVFYC....G-AAGLVK
D2VM77_NAEGR/378-610.......................DSSKRNFG.RPNWDAEF----SDIRRYVEKNSSGAKKPNVGVFVC....G-PGGLSK
FREL_CANAX/496-649.........................VEFIEG.RPDISTQV----EQE........VKQADGAIGFVTC....G-HPAMVD
FRO2_ARATH/441-709SPTSSWGYNSLREIESTPQESLVQRTNLHFGERPNLKKLL----LDV...........EGSSVGVLVC....G-PKKMRQ
FRE7_YEAST/423-596........................LITIIPS.KPDLNQVI----NDY..............QIGFRNCFICSG-SDSLRY
FRE6_YEAST/550-692........................FAHIGNA.RPNFSNVI----ENA......IKSTPPGDSLAVVCC....G-PPVLVD
RBOHC_ARATH/715-888.........................VMSHFA.KPNWRNVY----KRI.......AMDHPNTKVGVFYC....G-APALTK
RBOHD_ARATH/736-904.........................VKSHFA.KPNWRQVY----KKI.......AVQHPGKRIGVFYC....G-MPGMIK
AIM14_YEAST/371-557.......................ENGSMIEV.KSKHSFTL----SNELKSFNNESAQVNQNETWLFSC....G-PPSLLQ
RBOHF_ARATH/746-927.........................VRTHFA.RPNWKKVL----TKL.......SSKHCNARIGVFYC....G-VPVLGK
RBOHB_ARATH/661-826.........................VRTHFA.RPNWRSVF----KHV.......AVNHVNQRVGVFYC....G-NTCIIG
FRE1_YEAST/527-666.........................VECLNK.RPDLKELV----RSEI.....KLSELENNNITFYSC....G-PATFND
D2VLT6_NAEGR/389-614.......................ENKNRHYG.RPDWERDL----ASVRNYAEKAHTRKGRAKVGVFVC....G-PPALSK
FRP2_SCHPO/414-548.........................MEFFDD.RPDLDMYI----QKF.......FDYVGYQTAALAAC....G-SQSFLK
FRE5_YEAST/531-674............................DFG.RPNIDEII----EEA.........VSGAKSLLVTCC....G-SEGFVD
CY24B_HUMAN/401-551.........................QKTLYG.RPNWDNEF----KTI.......ASQHPNTRIGVFLC....G-PEALAE
FRP1_SCHPO/414-548.........................LQYLNG.RPDVNDYF----KDF.......LHATGTQTAALASC....G-SDKLLR
FRE2_YEAST/537-691KSAN...............PLGFDGVVFHCG.RPNVKELL----HEA.........AELSGSLSVVCC....G-PPIFVD

PF00175

PYRK_ENTFO/113-207--------------------------------HGNVGRLLSE..ALAK......GRIPDA....VYAC----G.ANGMLK
NCB5R_YEAST/151-261--------------------------------VGYITKDVIK..EHLP........AATMDNVQILIC----G.PPAMVA
FENR_ECOLI/111-223--------------------------------TGRIPALI.ESGELEST....IGLPMNKETSHVMLC----G.NPQMVR
ASCD_YERPS/205-308--------------------------------TGFVHQAVLE..DIPD...........LSLFNVYAC----G.SLAMIT
NCPR_HUMAN/530-641--------------------------------KVYVQHLLKQ..DRE.H....LWKLI.EGGAHIYVC----GDARNMAR
DMPP_PSEUF/210-317--------------------------------KGFVHDAAKA..HFDG..........RFGGQKAYLC----G.PPPMID
FRE_PHOLU/108-212--------------------------------TGTVLKAVLE..DFGS...........LANYDIYIA----G.RFEMAK
FRE_ECOLI/108-212--------------------------------TGTVLTAVLQ..DHGT...........LAEHDIYIA----G.RFEMAK
CYSJ_SALTY/457-564--------------------------------KIYVQDKLRE..QGA.E....LWRWI.NDGAHIYVC----GDARRMAA
NCPR_YEAST/538-656--------------------------------KVYVQDKL.K..DYEDQ....VFEMI.NNGAFIYVC----GDAKGMAK
NIA_USTMA/836-967--------------------------------RGHITANVLR..THLPPPPAKPASEDELEDTLALVC----G.PPPMEK
NB5R3_RAT/177-285--------------------------------QGFVNEEMIR..DHLP.........PPGEETLILMC----G.PPPMIQ
CPXB_BACME/901-1012--------------------------------KTYVQHVM....EQDGK....KLIELLDQGAHFYIC----GDGSQMAP
HMP_ECOLI/264-373--------------------------------EGLMDLSKLE..GAFS...........DPTMQFYLC----G.PVGFMQ
NCPR_CANTR/532-645--------------------------------KVYVQDKILE..NSA.L....VDELL.SSGAIIYVC----GDASRMAR
FENR_CYAPA/216-332--------------------------------KMYIQNRIAE..YAN.E....FWNMIQKPNTFVYMC----G.LRGMED
NIA2_MAIZE/104-214--------------------------------VGRVDEHVMR..EHLP.........LGDSETIALVC----G.PPAMIE
Q896R9_CLOTE/103-186--------------------------------GGFITDDI........N.....PDEYDY....IFTC----G.PEVMMK
NCPR_MUSDO/524-635--------------------------------KIYVTHLIEQ..DAD.L....IWKVIGEQKGHFYIC----GDAKNMAV
NIA_LOTTE/29-137--------------------------------TGRVNESIMR..VHLP..........GPSDALALAC----G.PPPINS
PYRK_BACAN/113-204--------------------------------KGFVTDVI.D..HYGI........DFDI....LYSC----G.PLAMLR
MMOC_METCA/220-325--------------------------------QGSPIDALRE..DLES..........SDANPDIYLC----G.PPGMID
MCR1_YEAST/164-274--------------------------------ISFISKDFIQ..EHVP.........GPKESTHLFVC----G.PPPFMN
HMP_CUPNH/271-379--------------------------------PGLVDVKQIE..KSIL...........LPDADYYIC----G.PIPFMR
Q8KF58_CHLTE/104-198--------------------------------HGFVTQKL.Q..ELIDS.....GKKIDF....VLAI----G.PIPMMK
FRE_VIBFI/112-215--------------------------------TGNVLEAVKA..DFNS...........LADMDIYIA----G.RFEMAG
BENC_ACIAD/225-328--------------------------------KGYVTGHIEY..DWLN...........GGEVDVYLC----G.PVPMVE
PYRKH_AQUAE/109-200--------------------------------KGFVTEIL.K..EFST.............DWVVHAC----G.PKPMLK
ASRB_SALTY/115-218--------------------------------IGRVTDRLAD..MTLS..........DIDTMQAIVV----G.PPIMIT
RFBI_SALTY/200-303--------------------------------KGFVHHAVMD..DFDS...........LEFFDIYAC----G.SPVMID
Q891F8_CLOTE/110-206--------------------------------KGLVTGLL.K..DLVEN....KNKKYDL....VVTI----G.PMIMMK
NOS1_RAT/1246-1360--------------------------------KKYVQDVLQE..QLAES....VYRALKEQGGHIYVC----GDV.TMAA
NIA_NEUCR/855-967--------------------------------RGRLDKTMLE..REVG.......EGDLRGETMVLLC----G.PEGMQN
NIA_LEPMC/771-878--------------------------------RGRIGEELLK..EFCG..........TEEDGLVLVC----G.PEGLER
PYRK_THEAC/96-181--------------------------------HGFPHEFL.D..RL..D.....ISVYRK....IYVC----G.PEPMLY
FENR1_PEA/213-329--------------------------------KMYIQTRMAQ..YAE.E....LWELLKKDNTFVYMC----G.LKGMEK
NIA_ASPNG/745-852--------------------------------RGRISEDLLK..EHAI..........PDGKSMVLIC----G.PEAMEK
Q8U194_PYRFU/103-198--------------------------------KGFTTHAL.Q..KLIEE.....GRKIDL....VHAV----G.PAIMMK
PYRK_THEVO/96-181--------------------------------HGFAHELL.Q..RI..N.....IDSYEA....IYVC----G.PEQMMY
NIA_CICIN/794-903--------------------------------EGFITEDIMR..EHVP.........EVSEDTLALAC----G.PPPMIQ
NCPR_SCHPO/535-647--------------------------------KIYVQHRLLE..HSD.T....IAKLV.EEGAAFYIC----GDADHMAK
LUXG_VIBHA/108-212--------------------------------QGKVLECVMS..DFRN...........LSEFDIYLC----G.PYKMVE
XYLZ_PSEPU/212-315--------------------------------KGYVTQYIEP..KQLN...........GGEVDIYLC----G.PPPMVE
NIA2_ARATH/791-900--------------------------------TGFISEAIMR..EHIP........DGLDGSALAMAC----G.PPPMIQ
NIA2_HORVU/783-895--------------------------------VGFVTEDILR..AHVP.........EGGDDTLALAC----G.PPPMIK
FENR2_ORYSJ/232-347--------------------------------KMYVQDKIEE..YSD.E....IFKLL.DGGAHIYFC----G.LKGMMP
NIA_VOLCA/738-848--------------------------------TGRVTLEMFK..QHLF........ACSGPECLALMC----G.PPAMLE
Q8EUY1_MYCPE/114-209--------------------------------CGNVIQLL.N..YLIKS....ELINFDK....YYAC----G.PNKMLK
PYRK_STRPN/105-196--------------------------------KGNVSVVI.N..DLDS........QFDA....VYSC----G.APGMMK
Q8RBW4_THETN/103-198--------------------------------HGFVTVVL.K..ELLEQ.....GEKFDE....IIII----G.PPILMK
FENR_ANASO/289-409--------------------------------RMYIQDRVAE..HAD.E....LWQLIKNQKTHTYIC----G.LRGMEE
NIA_BEABA/768-879--------------------------------RGRMDKEYLE..EHIG......GFRKSDGREMVLVC----G.PAALEE
Q8G659_BIFLO/126-220--------------------------------EGNVVDLL.N..KLEQG....DDLKAYDRKPIILSC----G.PLPMMK
FENR_SPISP/147-263--------------------------------KMYIQDRIKE..NAD.Q....LWELIQKPNTHTYIC----G.LKGMEG
PYRK_CLOAB/106-192--------------------------------KGYVTDNF........K.....PEEYDY....VLCC----G.PEIMMY
NIA_PHYIN/770-885--------------------------------KSRLNFAMVK..NIIG...........SDAEDVCMC----G.PEGMIE
LUXG_PHOLE/109-213--------------------------------IGNVIDAVIE..DFSD...........LSDFDIYVC----G.PFGMSR
NCPR_CATRO/568-679--------------------------------KQYVQHKMAE..KAS.D....IWRMI.SDGAYVYVC----GDAKGMAR
FENR_SYNP2/255-371--------------------------------KVYVQSRVSE..YAD.E....LFEMIQKPNTHVYMC----G.LKGMQP
LUXG_VIBFI/111-215--------------------------------KGTVLDAVME..DFTD...........LAHFDIYVC----G.PFMMAK
NIA_EMENI/748-858--------------------------------RGRIDEELIR..QHAG.........TPDRETMVLVC----G.PEAMEK
XYLA_PSEPU/221-327--------------------------------RGMVTEYF.K..EYLT...........GQPYEGYLC----G.PPPMVD
NIA_FUSOX/778-890--------------------------------KGFVNQALVP..EYMDL.....PKASGEGDELLLVC----G.PPPMVK
Q8KB48_CHLTE/115-207--------------------------------HGNVVQLL.E..KYLT.......EQTDAGRVKVFAC----G.PNPMLK
PYRK_STRMU/111-202--------------------------------KGYVSTVV.D..NLDF........LADA....IYAC----G.APGMLK
NOS2_HUMAN/979-1093--------------------------------KVYVQDILRQ..QLASE....VLRVLHKEPGHLYVC----GDV.RMAR
NIA_BETPN/773-881--------------------------------VGYIRESILR..EHIP.........EGSDDVLALAC----G.APSMIE
TMOF_PSEME/204-307--------------------------------TGYVHEIIPE..YMEG...........LLGAEFYLC----G.PPQMIN
K502_ACTDE/195-300--------------------------------VGYVQDVYLK..DKPI.........ADPRTTGAVLI----G.NPNMVE
PYRK_THETN/104-191--------------------------------KGLVTSVV.E..EMIG........EVDI....VYGC----G.PKPMLK
HMP_VIBPA/264-371--------------------------------TGFVNLHEIE..AALK...........QDNVQVYFC----G.PVGFMQ
PYRK_LACLA/115-208--------------------------------KGHVGMLM.E..EIDF........EVDA....LYTC----G.APAMLK

PF08030

RBOHE_ARATH/752-935ELKKQAQ
FRO3_ARATH/455-701EVAKICS
FRE4_YEAST/530-699TARNQTA
RBOHA_ARATH/707-885ELRHLSL
D2VM77_NAEGR/378-610QVYSYAV
FREL_CANAX/496-649ELRFAVT
FRO2_ARATH/441-709KVAEICS
FRE7_YEAST/423-596TVGNSVA
FRE6_YEAST/550-692DVRNTVS
RBOHC_ARATH/715-888ELRHLAL
RBOHD_ARATH/736-904ELKNLAL
AIM14_YEAST/371-557LSKKYCN
RBOHF_ARATH/746-927ELSKLCN
RBOHB_ARATH/661-826ELKRLAQ
FRE1_YEAST/527-666DFRNAVV
D2VLT6_NAEGR/389-614DVYSYSL
FRP2_SCHPO/414-548RIKNSVN
FRE5_YEAST/531-674KTRELTA
CY24B_HUMAN/401-551TLSKQSI
FRP1_SCHPO/414-548HLKSCVN
FRE2_YEAST/537-691KVRNETA

PF00175

PYRK_ENTFO/113-207AIDS---
NCB5R_YEAST/151-261SVRR---
FENR_ECOLI/111-223DTQQ---
ASCD_YERPS/205-308AARN---
NCPR_HUMAN/530-641DVQN---
DMPP_PSEUF/210-317AAIT---
FRE_PHOLU/108-212IARE---
FRE_ECOLI/108-212IARD---
CYSJ_SALTY/457-564DVEK---
NCPR_YEAST/538-656GVST---
NIA_USTMA/836-967AVSD---
NB5R3_RAT/177-285FACL---
CPXB_BACME/901-1012AVEA---
HMP_ECOLI/264-373FTAK---
NCPR_CANTR/532-645DVQA---
FENR_CYAPA/216-332GIQQ---
NIA2_MAIZE/104-214CTVR---
Q896R9_CLOTE/103-186VLYN---
NCPR_MUSDO/524-635DVRN---
NIA_LOTTE/29-137AYGW---
PYRK_BACAN/113-204ALEG---
MMOC_METCA/220-325AACE---
MCR1_YEAST/164-274AYSG---
HMP_CUPNH/271-379MQHD---
Q8KF58_CHLTE/104-198AVAD---
FRE_VIBFI/112-215AARE---
BENC_ACIAD/225-328AVRS---
PYRKH_AQUAE/109-200TIKE---
ASRB_SALTY/115-218FTVK---
RFBI_SALTY/200-303ASKK---
Q891F8_CLOTE/110-206FATK---
NOS1_RAT/1246-1360DVLK---
NIA_NEUCR/855-967MVRE---
NIA_LEPMC/771-878SVKG---
PYRK_THEAC/96-181RVMQ---
FENR1_PEA/213-329GIDD---
NIA_ASPNG/745-852SARK---
Q8U194_PYRFU/103-198AVAE---
PYRK_THEVO/96-181KVLQ---
NIA_CICIN/794-903FAIN---
NCPR_SCHPO/535-647DVVN---
LUXG_VIBHA/108-212VARD---
XYLZ_PSEPU/212-315AVSQ---
NIA2_ARATH/791-900FAVQ---
NIA2_HORVU/783-895FAIS---
FENR2_ORYSJ/232-347GIQD---
NIA_VOLCA/738-848HCCV---
Q8EUY1_MYCPE/114-209ALIE---
PYRK_STRPN/105-196YINQ---
Q8RBW4_THETN/103-198IGSE---
FENR_ANASO/289-409GIDA---
NIA_BEABA/768-879TVRS---
Q8G659_BIFLO/126-220AVAD---
FENR_SPISP/147-263GIDE---
PYRK_CLOAB/106-192KVVK---
NIA_PHYIN/770-885YACK---
LUXG_PHOLE/109-213TAKD---
NCPR_CATRO/568-679DVHR---
FENR_SYNP2/255-371PIDE---
LUXG_VIBFI/111-215TAKE---
NIA_EMENI/748-858ASKK---
XYLA_PSEPU/221-327AAET---
NIA_FUSOX/778-890AVEA---
Q8KB48_CHLTE/115-207ALAS---
PYRK_STRMU/111-202YVDK---
NOS2_HUMAN/979-1093DVAH---
NIA_BETPN/773-881EAVR---
TMOF_PSEME/204-307SVQK---
K502_ACTDE/195-300ETRG---
PYRK_THETN/104-191ALQE---
HMP_VIBPA/264-371HVAK---
PYRK_LACLA/115-208AVAK---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window