Sequence alignment for CL0091

PF08030

RBOHE_ARATH/752-935YDVLLLIGLGIGATPFISILKDLLNNSRDEQTDNEFSRSDFSWNSCTSSYTTATPTSTHGGKKKAVKAHFYWVTREPGSV
FRO3_ARATH/455-701HDSLVMVSGGSGITPFISIIRDLLYVSS...............................TNAYKTPKITLICAFKNSSDL
FRE4_YEAST/530-699FDNVLLLAGGSGLPGPISHALELGKTTA.................................ASGKNFVQLVIAVRGLDML
RBOHA_ARATH/707-885FEVVLLVGLGIGATPMISIVSDIINNLKGVEEGSNRRQSPI.....HNMVTPPVSPSRKSETFRTKRAYFYWVTREQGSF
D2VM77_NAEGR/378-610FEYVMLIAAGIGVTPYSSLLKHFKFRLDAAA.........................SGQAPPLKIRRASFYWINRDEGSW
FREL_CANAX/496-649CKNVVFVAGGNGIPGIYSECVDLAKKSK....................................NQSIKLIWIIRHWKSL
FRO2_ARATH/441-709HEALVMVCGGSGITPFISVIRDLIATSQ...............................KETCKIPKITLICAFKKSSEI
N1P2S4_YEASC/423-596FTNVYLICSGSGISTCLPFLQKYGPILH.................................KTNLEVITLDWVVRHREDI
A7A0K9_YEAS7/550-692FDHLLLLSGGTGLPGPLDHAIKLSRNPD...................................KPKSIDLIMAIKNPSFL
RBOHC_ARATH/715-888YEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRM..........ENGTSEPQRSKKESFRTRRAYFYWVTREQGSF
RBOHD_ARATH/736-904YDVVLLVGLGIGATPMISILKDIINNMKGPDRDSDI...............ENNNSNNNSKGFKTRKAYFYWVTREQGSF
N1P4D3_YEASC/371-557GTNIAIICGGSGISFALPLFRHFFNKE....................................NVKYLKMIWLIKDYSEY
RBOHF_ARATH/746-927YDVLLLVGLGIGATPFISILKDLLNNIVKMEEHADSISDFSR..SSEYSTGSNGDTPRRKRILKTTNAYFYWVTREQGSF
RBOHB_ARATH/661-826YDVLLLVGLGIGATPLISIIRDVLNNIKNQNSIE..................RGTNQHIKNYVATKRAYFYWVTREQGSL
A7A1A2_YEAS7/527-666KRNLVGVAAGLGVAAIYPHFVECLRLPS..................................TDQLQHKFYWIVNDLSHL
D2VLT6_NAEGR/389-614YETVVLIAAGIGATPYASLLKHFNYTLDLE..........................KRGGKPLKIKKCFFYFINRDHGSW
FRP2_SCHPO/414-548YSYVLLIAGGVGFSYTLPILRDLILKEC...................................NVTSITFIWSCRSLSLL
A0A023ZHU9_YEASX/531-674FESLLFIAGGAGVPGPLSMAIKAGRQVK................................SNDSHQMIKFVWSVRNLDLL
G3QXY3_GORGO/401-551YEVVMLVGAGIGVTPFASILKSVWYKYCN.............................NATNLKLKKIYFYWLCRDTHAF
FRP1_SCHPO/414-548YSYLFLFAGGVGVSYILPIILDTIKKQS...................................RTVHITFVWSARSSALL
N1P892_YEASC/537-691YNNVLLLTGGTGLPGPIAHAIKLGKTSA.................................AAGKQSVKLVIAVRGFDVL

PF00175

NCB5R_YEAST/151-261-----MIAGGTGIAPMYQIMKAIAMD.P------------------------H..........DTTKVSLVFGNVHEE.D
FENR_ECOLI/111-223-----MLATGTAIGPYLSILQLGKDL..------------------------D..........RFKNLVLVHAARYAA.D
FRE_ECOLI/108-212-----LIAGGTGFSYARSILLTALAR..------------------------N..........PNRDITIYWGGREEQ.H
CYSJ_SALTY/457-564-----MIGPGTGIAPFRSFMQQRAAE..------------------------G..........VEGKNWLFFGNPHFTED
NCPR_YEAST/538-656-----MIGPGTGVAPFRGFIRERVAFLE------------------------SQKKGGNNVSL..GKHILFYGSRNTD.D
NIA_USTMA/836-967-----MIAGGSGITPIWSTLKAIADEVL------------------------DASNP.SSPALDPIQIWIVYGNRTEQ.D
NB5R3_RAT/177-285-----MIAGGTGITPMLQVIRAVLKD.P------------------------N..........DHTVCYLLFANQSEK.D
HMP_ECOLI/264-373-----LISAGVGQTPMLAMLDTLAKA..------------------------G..........HTAQVNWFHAAENGD.V
NIA2_MAIZE/104-214-----MIQAGRGTTPDDDTEQAVLRDQP------------------------D..........DDTEMHLVYANRTDH.D
MMOC_METCA/220-325-----FVAGGTGLAPVVSMVRQMQEW..------------------------T..........APNETRIYFGVNTEP.E
MCR1_YEAST/164-274-----LLGAGTGINPLYQLAHHIVEN.P------------------------N..........DKTKVNLLYGNKTPQ.D
HMP_CUPNH/271-379-----LISGGVGLTPMVSMLKVALQA..------------------------...........PPRQVVFVHGARNSA.V
BENC_ACIAD/225-328-----MLAGGTGIAPFLSMLQVLEQK..------------------------G..........SEHPVRLVFGVTQDC.D
ASRB_SALTY/115-218-----VVAGGTGVAPVKGLMRYFVENPQ------------------------E...........IGQLDMILGYKNRD.C
RFBI_SALTY/200-303-----FLAGGTGFAPVKSMVEHLIQG..------------------------K..........CRREIYIYWGMQYSK.D
NOS1_RAT/1246-1360-----LVGPGTGIAPFRSFWQQRQF...------------------------DIQHK..GMNP..CPMVLVFGCRQSKID
NIA_NEUCR/855-967-----MVCGGSGVTPIYQVAEAVAVD.D------------------------Q..........DGTECLVLDGNRVEG.D
NIA2_ARATH/791-900-----MLAGGTGITPVYQIIQAILKD.P------------------------E..........DETEMYVIYANRTEE.D
FENR2_ORYSJ/232-347-----MIATGTGVAPFRGYLRRMFMEDV------------------------PKY......RF.GGLAWLFLGVANTD.S
FENR_SYNP2/255-371-----MLATGTGIAPFRAFLWRMFKEQH------------------------EDY......KF.KGKAWLIFGVPYTA.N
NIA_EMENI/748-858-----MICGGTGITPVFQVLRAVMQD.E------------------------Q..........DETKCVMLDGNRLEE.D
NOS2_HUMAN/979-1093-----LIGPGTGIAPFRSFWQQRLH...------------------------DSQHK..GVRG..GRMTLVFGCRRPDED
HMP_VIBPA/264-371-----LISAGVGLTPTLSMLESLTE...------------------------...........HHAPVTWVHATENSK.H
A2QRD2_ASPNC/745-852-----MICGGTGITPIFQVLRAVMQD.K------------------------Q..........DPTSCVVLDGNRQEE.D
B9T6D1_RICCO/218-333-----MLGTGTGIAPFRSFLWKMFFE..------------------------KHE.....DYKFNGLAWLFLGVPTSS.S
C5M346_CANTT/532-644-----LIGPGTGVAPLRGFVRERVQQ.V------------------------KN.......GVNVGKTVLFYGCRNSEQD
D0NK31_PHYIT/770-885-----FVAGGTGITPVYQVMRAILED.A------------------------K..........DQTKVALIYCVRSQR.D
D4ZYS5_ARTPN/254-368-----MMATGTGIAPFRAFLWRIFKE..------------------------QHE.....DYKFKGLAWLFFGIPYSP.N
D5DIB6_BACMD/901-1011-----MVGPGTGVAPFRGFVQARKQL.K------------------------EK.......GQSLGEAHLYFGCRSPHED
E5A6Z2_LEPMJ/771-877-----MICGGSGITPIYQVLRAILQD.S------------------------A..........DSTHCTVLNGNRLEE.D
F9FUM7_FUSOF/778-889-----MVCGGSGITPIRQVLRAVMHN.P------------------------K..........DTTPCLVFNGNRSVN.D
J4W0U8_BEAB2/768-878-----MICAGSGVTPIFQVLRAVTCD.A------------------------Q..........DGTECLVLDGNRCEK.D
FENR_NOSS1/289-407-----MLATGTGIAPMRTYLWRMFKD.A------------------------ERAAN..PEYQFKGFSWLVFGVPTTP.N
ASCD_YERPE/205-307-----FLAGGTGFAPVKSMVEALINK..------------------------N..........DQRQVHIYWGMPAGH.N
Q4JFI7_VOLCA/738-847-----FVAGGTGITPCYAVIKAALRD.P------------------------E..........DKTQISLVFANNTEE.D
Q5E8T9_VIBF1/112-214-----LIAGGTGFSYVRSILDHCISQ..------------------------K..........IQKPIYLYWGGRDEC.Q
Q7MZ90_PHOLL/108-211-----LIAGGTGFSYTRSILLTALEE..------------------------Q..........PERQISMYWGGREPQ.H
W5GC34_WHEAT/45-155-----MICGGSGITPMYQVIQAVLRDQP------------------------E..........DETEMHLVYANRSED.D

PF08030

RBOHE_ARATH/752-935EWFRGVM..EEISDMDCR....GQIELHNYLTSVYDE...............GDARSTLIKMVQALNHA...........
FRO3_ARATH/455-701SMLNLIL.PN..STEISS...FIDIQIKAFVTREKVSTCNMNI..IKTLSFKPYVSDQPISPILGPNSWLWLATILSSSF
FRE4_YEAST/530-699NACK.....KELMALKGL.....NVQVHIYNSKQELA...............SAEKISSNEVKNGETTAEKA........
RBOHA_ARATH/707-885DWFKNVM..DEVTETDRK....NVIELHNYCTSVYEE...............GDARSALITM.....LQSLN........
D2VM77_NAEGR/378-610EWFSDIL..NQLETENPE.....FFDIHTYMTGMLKA...............DDVKKIMFTSSEYQTQSNTAGNVQQSGK
FREL_CANAX/496-649SWFT.....EELEYLKKT.....NVQSTIYVTQPQDCSGLECFEHDVSFEKKSDEKDSVESSQYSL.ISNIK........
FRO2_ARATH/441-709SMLDLVLPLSGLETELSS...DINIKIEAFITRDNDAGDEAKAGKIKTLWFKPSLSDQSISSILGPNSWLWLGAILASSF
N1P2S4_YEASC/423-596SWIRDEM..CTLSNNLRQLFLDGKIVVRIYVCSDSTVPGIIK....TFPQTIDTASDQSDLAKREKDTEFGQDDTESN..
A7A0K9_YEAS7/550-692NGYK.....SEILELKNS...RSHVNVQVYLTQKTAV...............TKAANARDQLIH...FDDIM........
RBOHC_ARATH/715-888DWFKNIM..NEVAERDAN....RVIEMHNYCTSVYEE...............GDARSALIHM.....LQSLN........
RBOHD_ARATH/736-904EWFKGIM..DEISELDEE....GIIELHNYCTSVYEE...............GDARVALIAM.....LQSLQ........
N1P4D3_YEASC/371-557ELVLDYLKTNGLTFEKKL...SNNKRISVFISGEYTA...............ETRLDEITTNIDDENSEYEMGSFNNEDE
RBOHF_ARATH/746-927DWFKGVM..NEVAELDQR....GVIEMHNYLTSVYEE...............GDARSALITM.....VQALN........
RBOHB_ARATH/661-826EWFSEVM..NEVAEYDSE....GMIELHNYCTSVYEE...............GDARSALITM.....LQSLH........
A7A1A2_YEAS7/527-666KWFE.....NELQWLKEK.....SCEVSVIYTGSSVE...............DTNSDESTKG.....FDDKE........
D2VLT6_NAEGR/389-614EWFSNLL..NEMEDHHPE.....FFELNTYMTGKLKA...............EEIKKLYFGSSEYQQATGHKQTADVLLR
FRP2_SCHPO/414-548KVASKSL..NSLLHQSNV.....RLKIINHFTGSISC...............KESSE..........FSNQT........
A0A023ZHU9_YEASX/531-674EVYR.....KEIMVLKEL.....NIDTKIYFTGERKD...............ESNTEEGAIANMSTEGRLLTTS......
G3QXY3_GORGO/401-551EWFADLL..QLLESQMQERNNAGFLSYNIYLTGWDES...............QAN............HFAVH........
FRP1_SCHPO/414-548NIVHKSL..CEAVRYTEM.....NINIFCHLTNSYPV...............EEVSS..........LNSQS........
N1P892_YEASC/537-691EAYK.....PELMCLENL.....NVQLHIYNTMEVPS...............LTPSDSLDISQQDEKADEKG........

PF00175

NCB5R_YEAST/151-261ILLKKEL--EALVAMKPS-----..QFKIV----------------------YYL........DSPDREDWT--------
FENR_ECOLI/111-223LSYLPLM--QELEKRYEG-----..KLRIQ----------------------TVV........SRETAAGS.--------
FRE_ECOLI/108-212LYDLCEL--EALSLKHPG-----...LQVV----------------------PV.........VEQPEAGWR--------
CYSJ_SALTY/457-564FLYQVEW--QRY..VKEG-----VLSRIDL----------------------AW..........SRDQKE..--------
NCPR_YEAST/538-656FLYQDEW--PEYAKKLDG-----SFE.MVV----------------------AH..........SRLPNTK.--------
NIA_USTMA/836-967ILIREEL--ERLRVALKG-----..NLKVW----------------------HVLS.....NCTPENEANWS--------
NB5R3_RAT/177-285ILLRPEL--EELRNEHSS-----..RFKLW----------------------YT.........VDKAPDAWD--------
HMP_ECOLI/264-373HAFADEV--KELGQSLPR-----FTAHTWY----------------------RQP.......SEADRAKGQF--------
NIA2_MAIZE/104-214MLLREEI--DRAWLPRTR-----..RLKVW----------------------YVV........SKVPEDGWE--------
MMOC_METCA/220-325LFYIDEL--KSLERSMRN-----...LTVK----------------------AC.........VWHPSGDWE--------
MCR1_YEAST/164-274ILLRKEL--DALKEKYPD-----..KFNVT----------------------YFV.......DDKQDDQDFD--------
HMP_CUPNH/271-379HAMRDRL--REAAKTYEN-----LDLFVFY----------------------DQP.......LPEDVQGRDY--------
BENC_ACIAD/225-328LVALEQL--DALQQKLPW-----...FEYR----------------------TV..........VAHAESQH--------
ASRB_SALTY/115-218VLYKEEM--ATWRGKHNL-----VLTL...----------------------............DEGEADDR--------
RFBI_SALTY/200-303FY.SALP--QQWSEQHDN-----...VHYI----------------------PV.........VSGDDAEWG--------
NOS1_RAT/1246-1360HIYREET--LQA..KNKG-----VFRELYT----------------------AY..........SREPDRP.--------
NIA_NEUCR/855-967ILMKSEL--DELVERAKP-----MGRCRVK----------------------YT.........LSRPGAEWE--------
NIA2_ARATH/791-900ILLREEL--DGWAEQYPD-----..RLKVW----------------------YV.........VESAKEGWA--------
FENR2_ORYSJ/232-347LLYDEEF--TSYLKQYPD-----NFR.YDK----------------------AL..........SREQKNKN--------
FENR_SYNP2/255-371ILYKDDF--EKMAAENPD-----NFR.LTY----------------------AI..........SREQKTAD--------
NIA_EMENI/748-858ILLKNEL--DEFEALAGK-----KEKCKIV----------------------HT.........LTKGSESWT--------
NOS2_HUMAN/979-1093HIYQEEM--LEM..AQKG-----VLHAVHT----------------------AY..........SRLPGKP.--------
HMP_VIBPA/264-371HAFKEHV--NQLVTAKEN-----MNALIWY----------------------NQP.......TAEDKIGEDF--------
A2QRD2_ASPNC/745-852ILCRADL--DAYEALDSK-----..KCKVV----------------------HT.........LTKAPDSWT--------
B9T6D1_RICCO/218-333LLYKEEF--EKMKEIAPD-----NFR.LDF----------------------AV..........SREQTNEK--------
C5M346_CANTT/532-644FLYKQEW--SEYASVLGE-----..NFEMF----------------------NA.........FSRQDPTK.--------
D0NK31_PHYIT/770-885LLLRKEL--ETLQKLRPG-----..QCRIF----------------------YTLSDMELLDRNDPIVRGWA--------
D4ZYS5_ARTPN/254-368ILYQQEL--EELQQQFPE-----..NFRLT----------------------LA.........ISREQQNPE--------
D5DIB6_BACMD/901-1011YLYQEEL--ENAQNEGI.-----..ITLHT----------------------AF..........SRVPNQP.--------
E5A6Z2_LEPMJ/771-877ILCREDL--DRFAEENGE-----..RCTLV----------------------HT.........LTQAAEGWT--------
F9FUM7_FUSOF/778-889ILCMEEL--EELEAANPS-----..RCRVV----------------------NA.........LSNPPPEWN--------
J4W0U8_BEAB2/768-878ILCREEL--DAMVARAPA-----..RTTLL----------------------HK.........LSRPDASWC--------
FENR_NOSS1/289-407ILYKEEL--EEIQQKYPD-----..NFRLT----------------------YA.........ISREQKNPQ--------
ASCD_YERPE/205-307F.YSDIA--NEWAIKHPN-----...IHYV----------------------PV.........VSGDDSTWT--------
Q4JFI7_VOLCA/738-847ILLREEL--DELANNHPD-----..RFHLW----------------------HTV........SQTNSSDWK--------
Q5E8T9_VIBF1/112-214LYAKAEL--ETIAQAHSH-----...ITFV----------------------PV..........VEKSEGWT--------
Q7MZ90_PHOLL/108-211LYDLAEL--QLLTERYPN-----...LTVV----------------------PV.........VEQSENGWC--------
W5GC34_WHEAT/45-155ILLRDEL--DRWAAEYPE-----..RLKVW----------------------YVID......QVKRPEDGWR--------

PF08030

RBOHE_ARATH/752-935.................................................................KHGVDILSGTR....
FRO3_ARATH/455-701MIFIIIIAIISRYHIYPIDQSSKEY....TSAYTSLIYLLAISISVVATSTVAMLCNKKSYFKGLYQNVDALSPLMIESS
FRE4_YEAST/530-699...............................................................PSSLS.....NSEKAPS
RBOHA_ARATH/707-885...............................................................HAKHGVDVVSGTR....
D2VM77_NAEGR/378-610VDFMVRALHKYDAQSSDEISLD..........RNDIVVVSEQDESGWWTGTNTTTKQTGLFPGNFVVKVDHVTKMA....
FREL_CANAX/496-649...............................................................QGLSH............
FRO2_ARATH/441-709LIFMIIIGIITRYYIYPIDHNTNKIYSLTSKTIIYILVISVSIMATCSAAMLWNKKKYGKVESKQVQNVDRPSPTSSPTS
N1P2S4_YEASC/423-596........................................................STFDKSNNEYKG............
A7A0K9_YEAS7/550-692...............................................................TELTS............
RBOHC_ARATH/715-888...............................................................HAKNGVDIVSGTR....
RBOHD_ARATH/736-904...............................................................HAKNGVDVVSGTR....
N1P4D3_YEASC/371-557DLS.................................................ISNFNSENADSNDNTPETSHSPTK....
RBOHF_ARATH/746-927...............................................................HAKNGVDIVSGTR....
RBOHB_ARATH/661-826...............................................................HAKSGIDIVSGTR....
A7A1A2_YEAS7/527-666...............................................................ESEIT............
D2VLT6_NAEGR/389-614AMYDYTPVSSDELELHAND................IISLKEQDESGWWEGTNLTTNESGLFPSNYVIHIDALTKLR....
FRP2_SCHPO/414-548...............................................................TENSE............
A0A023ZHU9_YEASX/531-674.............................................................KSAEMIT............
G3QXY3_GORGO/401-551...............................................................HDEEK.DVITGLK....
FRP1_SCHPO/414-548...............................................................ARNYS............
N1P892_YEASC/537-691...............................................................TVVAT.....TLEKSAN

PF00175

NCB5R_YEAST/151-261--------------------------------------------------------------------------------
FENR_ECOLI/111-223--------------------------------------------------------------------------------
FRE_ECOLI/108-212--------------------------------------------------------------------------------
CYSJ_SALTY/457-564--------------------------------------------------------------------------------
NCPR_YEAST/538-656--------------------------------------------------------------------------------
NIA_USTMA/836-967--------------------------------------------------------------------------------
NB5R3_RAT/177-285--------------------------------------------------------------------------------
HMP_ECOLI/264-373--------------------------------------------------------------------------------
NIA2_MAIZE/104-214--------------------------------------------------------------------------------
MMOC_METCA/220-325--------------------------------------------------------------------------------
MCR1_YEAST/164-274--------------------------------------------------------------------------------
HMP_CUPNH/271-379--------------------------------------------------------------------------------
BENC_ACIAD/225-328--------------------------------------------------------------------------------
ASRB_SALTY/115-218--------------------------------------------------------------------------------
RFBI_SALTY/200-303--------------------------------------------------------------------------------
NOS1_RAT/1246-1360--------------------------------------------------------------------------------
NIA_NEUCR/855-967--------------------------------------------------------------------------------
NIA2_ARATH/791-900--------------------------------------------------------------------------------
FENR2_ORYSJ/232-347--------------------------------------------------------------------------------
FENR_SYNP2/255-371--------------------------------------------------------------------------------
NIA_EMENI/748-858--------------------------------------------------------------------------------
NOS2_HUMAN/979-1093--------------------------------------------------------------------------------
HMP_VIBPA/264-371--------------------------------------------------------------------------------
A2QRD2_ASPNC/745-852--------------------------------------------------------------------------------
B9T6D1_RICCO/218-333--------------------------------------------------------------------------------
C5M346_CANTT/532-644--------------------------------------------------------------------------------
D0NK31_PHYIT/770-885--------------------------------------------------------------------------------
D4ZYS5_ARTPN/254-368--------------------------------------------------------------------------------
D5DIB6_BACMD/901-1011--------------------------------------------------------------------------------
E5A6Z2_LEPMJ/771-877--------------------------------------------------------------------------------
F9FUM7_FUSOF/778-889--------------------------------------------------------------------------------
J4W0U8_BEAB2/768-878--------------------------------------------------------------------------------
FENR_NOSS1/289-407--------------------------------------------------------------------------------
ASCD_YERPE/205-307--------------------------------------------------------------------------------
Q4JFI7_VOLCA/738-847--------------------------------------------------------------------------------
Q5E8T9_VIBF1/112-214--------------------------------------------------------------------------------
Q7MZ90_PHOLL/108-211--------------------------------------------------------------------------------
W5GC34_WHEAT/45-155--------------------------------------------------------------------------------

PF08030

RBOHE_ARATH/752-935.....................VRTHFA.RPNWKEVFSSI.......ARKHPNSTVGVFYC....G-IQTVAKELKKQAQ
FRO3_ARATH/455-701P.............DQLLPEFTNIHYGERPNLNKLLVGL...........KGSSVGVLVC....G-PRKMREEVAKICS
FRE4_YEAST/530-699ESENTELPLSLNDTSISDLEFATFHVG.RPNVEEILNES.........VNHSGSLAVVCC....G-PPIFVDTARNQTA
RBOHA_ARATH/707-885.....................VMSHFA.RPNWRSVFKRI.......AVNHPKTRVGVFYC....G-AAGLVKELRHLSL
D2VM77_NAEGR/378-610...................DSSKRNFG.RPNWDAEFSDIRRYVEKNSSGAKKPNVGVFVC....G-PGGLSKQVYSYAV
FREL_CANAX/496-649.....................VEFIEG.RPDISTQVEQE........VKQADGAIGFVTC....G-HPAMVDELRFAVT
FRO2_ARATH/441-709SWGYNSLREIESTPQESLVQRTNLHFGERPNLKKLLLDV...........EGSSVGVLVC....G-PKKMRQKVAEICS
N1P2S4_YEASC/423-596....................LITIIPS.KPDLNQVINDY..............QIGFRNCFICSG-SDSLRYTVGNSVA
A7A0K9_YEAS7/550-692....................FAHIGNA.RPNFSNVIENA......IKSTPPGDSLAVVCC....G-PPVLVDDVRNTVS
RBOHC_ARATH/715-888.....................VMSHFA.KPNWRNVYKRI.......AMDHPNTKVGVFYC....G-APALTKELRHLAL
RBOHD_ARATH/736-904.....................VKSHFA.KPNWRQVYKKI.......AVQHPGKRIGVFYC....G-MPGMIKELKNLAL
N1P4D3_YEASC/371-557...................ENGSMIEV.KSKHSFTLSNELKSFNNESAQVNQNETWLFSC....G-PPSLLQLSKKYCN
RBOHF_ARATH/746-927.....................VRTHFA.RPNWKKVLTKL.......SSKHCNARIGVFYC....G-VPVLGKELSKLCN
RBOHB_ARATH/661-826.....................VRTHFA.RPNWRSVFKHV.......AVNHVNQRVGVFYC....G-NTCIIGELKRLAQ
A7A1A2_YEAS7/527-666.....................VECLNK.RPDLKELVRSEI.....KLSELENNNITFYSC....G-PATFNDDFRNAVV
D2VLT6_NAEGR/389-614...................ENKNRHYG.RPDWERDLASVRNYAEKAHTRKGRAKVGVFVC....G-PPALSKDVYSYSL
FRP2_SCHPO/414-548.....................MEFFDD.RPDLDMYIQKF.......FDYVGYQTAALAAC....G-SQSFLKRIKNSVN
A0A023ZHU9_YEASX/531-674........................DFG.RPNIDEIIEEA.........VSGAKSLLVTCC....G-SEGFVDKTRELTA
G3QXY3_GORGO/401-551.....................QKTLYG.RPNWDNEFKTI.......ASQHPNTRIGVFLC....G-PEALAETLSKQSI
FRP1_SCHPO/414-548.....................LQYLNG.RPDVNDYFKDF.......LHATGTQTAALASC....G-SDKLLRHLKSCVN
N1P892_YEASC/537-691...............PLGFDGVVFHCG.RPNVKELLHEA.........AELSGSLSVVCC....G-PPIFVDKVRNETA

PF00175

NCB5R_YEAST/151-261---------------------GGVGYI-TKDVIK..EHLP........AATMDNVQILIC----G.PPAMVASVRR---
FENR_ECOLI/111-223---------------------.LTGRI-PALI.ESGELEST....IGLPMNKETSHVMLC----G.NPQMVRDTQQ---
FRE_ECOLI/108-212---------------------GRTGTV-LTAVLQ..DHGT...........LAEHDIYIA----G.RFEMAKIARD---
CYSJ_SALTY/457-564---------------------..KIYV-QDKLRE..QGA.E....LWRWI.NDGAHIYVC----GDARRMAADVEK---
NCPR_YEAST/538-656---------------------..KVYV-QDKL.K..DYEDQ....VFEMI.NNGAFIYVC----GDAKGMAKGVST---
NIA_USTMA/836-967---------------------MGRGHI-TANVLR..THLPPPPAKPASEDELEDTLALVC----G.PPPMEKAVSD---
NB5R3_RAT/177-285---------------------YSQGFV-NEEMIR..DHLP.........PPGEETLILMC----G.PPPMIQFACL---
HMP_ECOLI/264-373---------------------DSEGLM-DLSKLE..GAFS...........DPTMQFYLC----G.PVGFMQFTAK---
NIA2_MAIZE/104-214---------------------YGVGRV-DEHVMR..EHLP.........LGDSETIALVC----G.PPAMIECTVR---
MMOC_METCA/220-325---------------------GEQGSP-IDALRE..DLES..........SDANPDIYLC----G.PPGMIDAACE---
MCR1_YEAST/164-274---------------------GEISFI-SKDFIQ..EHVP.........GPKESTHLFVC----G.PPPFMNAYSG---
HMP_CUPNH/271-379---------------------DYPGLV-DVKQIE..KSIL...........LPDADYYIC----G.PIPFMRMQHD---
BENC_ACIAD/225-328---------------------ERKGYV-TGHIEY..DWLN...........GGEVDVYLC----G.PVPMVEAVRS---
ASRB_SALTY/115-218---------------------YQIGRV-TDRLAD..MTLS..........DIDTMQAIVV----G.PPIMITFTVK---
RFBI_SALTY/200-303---------------------GRKGFV-HHAVMD..DFDS...........LEFFDIYAC----G.SPVMIDASKK---
NOS1_RAT/1246-1360---------------------..KKYV-QDVLQE..QLAES....VYRALKEQGGHIYVC----GDV.TMAADVLK---
NIA_NEUCR/855-967---------------------GLRGRL-DKTMLE..REVG.......EGDLRGETMVLLC----G.PEGMQNMVRE---
NIA2_ARATH/791-900---------------------YSTGFI-SEAIMR..EHIP........DGLDGSALAMAC----G.PPPMIQFAVQ---
FENR2_ORYSJ/232-347---------------------AGKMYV-QDKIEE..YSD.E....IFKLL.DGGAHIYFC----G.LKGMMPGIQD---
FENR_SYNP2/255-371---------------------GGKVYV-QSRVSE..YAD.E....LFEMIQKPNTHVYMC----G.LKGMQPPIDE---
NIA_EMENI/748-858---------------------GRRGRI-DEELIR..QHAG.........TPDRETMVLVC----G.PEAMEKASKK---
NOS2_HUMAN/979-1093---------------------..KVYV-QDILRQ..QLASE....VLRVLHKEPGHLYVC----GDV.RMARDVAH---
HMP_VIBPA/264-371---------------------HFTGFV-NLHEIE..AALK...........QDNVQVYFC----G.PVGFMQHVAK---
A2QRD2_ASPNC/745-852---------------------GRRGRI-SEDLLK..EHAI..........PDGKSMVLIC----G.PEAMEKSARK---
B9T6D1_RICCO/218-333---------------------GEKMYI-QTRMAQ..YAEEL.....WELLKKDNTFVYMC----G.LKGMEKGID.---
C5M346_CANTT/532-644---------------------..KVYV-QDKILE..NSAL......VDELLSSGAIIYVC----GDASRMARDVQ.---
D0NK31_PHYIT/770-885---------------------YGKSRL-NFAMVK..NIIG...........SDADHVCMC----G.PEGMIEYACK---
D4ZYS5_ARTPN/254-368---------------------GGKMYI-QDRIKE..NADQL.....WELIQKPNTHTYIC----G.LKGMEGGI..---
D5DIB6_BACMD/901-1011---------------------..KTYV-QHVMEQ..DGKK......LIELLDQGAHFYIC----GDGSQMAPDVE.---
E5A6Z2_LEPMJ/771-877---------------------GRRGRI-GEELLK..EFCG..........TEEDGLVLVC----G.PEALERSVK.---
F9FUM7_FUSOF/778-889---------------------GLKGFV-NQALVP..EYMDL.....PKASGEGDELVLVC----G.PPPMVKAVE.---
J4W0U8_BEAB2/768-878---------------------GLRGRM-DKEYLE..EHIGG.....FR.KSDGREMVLVC----G.PAALEETVR.---
FENR_NOSS1/289-407---------------------GGRMYI-QDRVAE..HADEL.....WQLIKNEKTHTYIC----G.LRGMEEGI..---
ASCD_YERPE/205-307---------------------GATGFV-HQAVLE..DIPD...........LSLFNVYAC----G.SLAMITAAR.---
Q4JFI7_VOLCA/738-847---------------------FSTGRV-TLEMFK..QHLF........ACSGPECLALMC----G.PPAMLEHCC.---
Q5E8T9_VIBF1/112-214---------------------GKTGNV-LEAVKA..DFNS...........LADMDIYIA----G.RFEMAGAAR.---
Q7MZ90_PHOLL/108-211---------------------GRTGTV-LKAVLE..DFGS...........LANYDIYIA----G.RFEMAKIAR.---
W5GC34_WHEAT/45-155---------------------FSVGFV-TEDILR..AHVP.........EGGDDTLALAC----G.PPPMIKFA..---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window