Sequence alignment for CL0093

PF12770

A0LJ53_SYNFM/581-921--------------------------------RRRAGELHDLLI..P.-----AKARELI.........-----------
A0LQE8_SYNFM/635-947--------------------------------RPASRKLFTAVLG.P.-----ISRD..L.......EQ-----------
A1BCK0_CHLPD/513-826--------------------------------EETGETLYRELWE.PV-----LDLL..........QD-----------
A1BEL3_CHLPD/43-361--------------------------------KPIGSALWSALGDGVE-----LQQA..........KH-----------
A1BEL6_CHLPD/46-364--------------------------------QALGSALWQVLDADEK-----LQHA..........KK-----------
A4HBL7_LEIBR/1053-1432--------------------------------QEPLRVLYQACIH.P.-----......IIGYVRALDS-----------
A8L4T6_FRASN/741-1051--------------------------------EKASRWLGRAVMD.PV-----LRLL............-----------
A9WBC0_CHLAA/673-929--------------------------------RVLLQRLYRTLIE.P.-----................-----------
A9WER9_CHLAA/54-394--------------------------------TRYGQELFRRLFP.TR-----LSHQFRVSQRTAAQQQ-----------
A9WF91_CHLAA/60-360--------------------------------VAYGTALGTMLLSDPD-----LLAQFQAARAIARRGR-----------
B0C874_ACAM1/207-507--------------------------------LESAQQLYQWMVQ.P.-----LAAE..L.......EK-----------
B2IXC0_NOSP7/1396-1691--------------------------------LRPSQQLYRWIIA.P.-----LEAD..L.......QA-----------
B2IZZ4_NOSP7/695-973--------------------------------QEVAKTLAEMLAF.PK-----LLEG..........LP-----------
B2JAK0_NOSP7/526-830--------------------------------DIELNKLYKILL..PQ-----VIQEGLI........Q-----------
B2JAM9_NOSP7/866-1190--------------------------------EKVATKLSQMLLQ.P.-----VAQE............-----------
B4JKU3_DROGR/1402-1700--------------------------------PACLHTLYNLLLA.P.-----......FDDLLPSVAS-----------
C3Z401_BRAFL/1278-1602--------------------------------KPPLRALYDLLIS.P.-----......MEDVLPRMNG-----------
F0SR63_RUBBR/137-574--------------------------------QLSIERIKTVVWD.P.-----......VHEALSSDDG-----------
Q01RE6_SOLUE/865-1136--------------------------------QVVATRLHEQLVR.P.-----FGKE..I.........-----------
Q024J7_SOLUE/541-814--------------------------------IPAGDRLYQLLIQ.P.-----LRAW..I.........-----------
Q025F1_SOLUE/607-877--------------------------------RTAAAALYRKLLG.PA-----AAEL............-----------
Q028B5_SOLUE/667-935--------------------------------QKLAVSLYRELLE.P.-----AAEQ..L.........-----------
Q02DA1_SOLUE/510-786--------------------------------QRDARQLYDWLIA.P.-----LAER..L.........-----------
Q10YT7_TRIEI/1003-1309--------------------------------KDTARELDQKLMQ.P.-----VRQL..L.........-----------
Q10YU6_TRIEI/544-838--------------------------------KFQSNQLYNWLIK.P.-----FEGYLEIDL...KDDA-----------
Q112V9_TRIEI/62-390--------------------------------TKVGEALFEALFD.AQ-----LREYFLAYYQDILKQQ-----------
Q113D1_TRIEI/130-430--------------------------------NSQAKKIRGWLLK...-----LQEK..L.........-----------
Q113U8_TRIEI/3002-3297--------------------------------LSPAKKLYDWFIT.P.-----ISAE..L.......EA-----------
Q115J8_TRIEI/1466-1777--------------------------------EKLGEILHIKEILQPI-----LESE............-----------
Q117G6_TRIEI/881-1206--------------------------------KKTARELDEKLMQ.P.-----VRQL..I.........-----------
Q119J2_TRIEI/1474-1770--------------------------------LSNAKKLYKWLIA.P.-----ISQE..L.......VA-----------
Q16H64_AEDAE/1315-1614--------------------------------PSCLHVLYNLLLA.P.-----......FEDLLPDIST-----------
Q2G6U6_NOVAD/692-1020--------------------------------LDKSRALYKTLFG.A.-----VEDL..L.........-----------
Q2S6G2_SALRD/540-844--------------------------------LRPLRALHDHLYA.P.-----VAAH..L.........-----------
Q2W535_MAGSA/875-1218--------------------------------LDVGQQVHKLIWQ.P.-----LERA..L.........-----------
Q38C46_TRYB2/1044-1397--------------------------------VEPLKTLYNIFIE.P.-----......IAAYIRSSDP-----------
Q3AQG5_CHLCH/44-362--------------------------------QAIGSILWRLLDADEA-----LANA..........KQ-----------
Q5LLA3_RUEPO/680-970--------------------------------RIFGELLFETLLP.QE-----VRRLYDV.........-----------
Q7NCT1_GLOVI/600-923--------------------------------HKLARLLHQKLLA.P.-----LGSQ............-----------
Q7NF67_GLOVI/550-854--------------------------------KAAARRLDRALME.P.-----VRAK..L.........-----------
Q7NFD7_GLOVI/666-979--------------------------------RKLARTIDERTMR.P.-----VRTR..L.........-----------
Q7NIF7_GLOVI/691-997--------------------------------RALARQLDSLLMQ.P.-----LRAR..L.........-----------
Q7NJE3_GLOVI/660-988--------------------------------DKLARQLHQKLLA.P.-----LQGN............-----------
Q7NLR0_GLOVI/653-961--------------------------------KPLARRLDQQLIA.P.-----IRRK..L.........-----------
Q7NVB0_CHRVO/67-386--------------------------------QDTARALADLFGQVPG-----LTAD..MAGHEVGDDG-----------
Q82I85_STRAW/1175-1481--------------------------------ERLCGWAWYAAMR.P.-----......LFAEFPEPRA-----------
Q82L10_STRAW/969-1256--------------------------------TGTLAWLWDVLAE.PV-----LDA...LGFTGPPESG-----------
Q8DGG5_THEEB/541-835--------------------------------QRAAQALTEQVIT.P.-----IRPW..L.........-----------
Q8DH74_THEEB/570-891--------------------------------KPSLKAAYGRLLA.P.-----LEPF..L.........-----------
Q8DHI1_THEEB/67-394--------------------------------GASGNQITNIGTQQPN-----LLKE..........VR-----------
Q8DIE5_THEEB/1127-1420--------------------------------LPAAQQLYQWLIA.P.-----LRPQ..L.......DA-----------
Q8YZU5_NOSS1/56-340--------------------------------TKDAENIYDAIIS.P.-----IEKY..L.......TE-----------
TTC28_HUMAN/1390-1713--------------------------------KPPLRALYDLLIA.P.-----......MEGGLMHSSG-----------

PF03568

Q5KMS4_CRYNJ/1710-2122--------------------------------DDRNTMFISRHQNGYE....PIVFCLPVDRQGR.REG...DD..D...
A8PX94_MALGO/1441-1824--------------------------------SDARELIVARYGDAYD....PCVFVLPLHRQSY.RDA...ED..DD..
M7XLD2_RHOT1/1703-2100--------------------------------...DALIISRHRHTDE....PIVFKLPLDRLAR.REG...EE..E...
U5HB45_USTV1/1850-2253--------------------------------.ERDALILVHHQANRQ....PLVFRLPLDRITR.RED...KE..ED..
F4RLY9_MELLP/91-479--------------------------------QDRDSLFLVQHHNATD....PLVLKLPMNRQNR.REG...EE..D...
T1IUX7_STRMM/1624-1980--------------------------------...QPLVLTKFQKRMK....PIVARVPTATYKPVEGG...TC......
A7RYA6_NEMVE/1651-2034--------------------------------...SYLMVTRLRNGSA....PVVLRL..ALPDD.SEG...TESSGNDH
T1FT05_HELRO/413-770--------------------------------...DQLILTRFVHGET....PLNIPLPHVDVDE.RR............
W4Y9R2_STRPU/1031-1383--------------------------------.ASSQLVITRIQKGQQ....PIVVRL......P.MNG...GD......
G3N6G2_GASAC/1731-2077--------------------------------EMGDSVLLSRLEKGSV....PVTVHTTTSK.QR.HSI...S.......
H3DAQ7_TETNG/1711-2057--------------------------------QMGESIMLSRFERGSA....PVTVHIPTSK.QQ.RPV...S.......
I3KSG7_ORENI/1715-2061--------------------------------EMGNSIMLTRLEKSSA....PVTVYIDTSK.QK.HPI...S.......
H2L8K9_ORYLA/1692-2038--------------------------------ELENSVILTRLEKGSA....PVTLHISTSK.QQ.IKI...H.......
M3ZIW2_XIPMA/1768-2114--------------------------------EMGESLMLTRLEKDSS....PITLHISTSR.QE.LTV...R.......
ESPL1_MOUSE/1716-2065--------------------------------TLSNTLLLTRLEKDNP....PITVKIPTAQ.NK.LPL...S.......
F7BUI1_CALJA/1724-2073--------------------------------TVGNTLLLTRLEKDSP....PVTVQIPTAQ.NK.LPL...S.......
G3VPI8_SARHA/1713-2063--------------------------------TVGDTLLLTRLEKNTP....PVTIQIPTAQTKK.MPL...S.......
U3IXX7_ANAPL/1332-1679--------------------------------SMGDTLLLTRLERGST....PITIHIPTAL.TK.APL...S.......
G1KFP0_ANOCA/1819-2167--------------------------------AIGNTLLLTKLEKDAD....PVTIQIQTMH.AQ.VSL...S.......
H3B3H1_LATCH/1699-2055--------------------------------AVGDTLLVSRLEKGCT....PVTVQIPTAQ.SE.MPL...S.......
F6VXN8_XENTR/1732-2080--------------------------------.PGDTILLTRLVRGRP....PVTVQIPTAH.LK.VSI...S.......
Q6ZHH8_ORYSJ/455-870--------------------------------YFPAWMMLSRFDSTNK....PITMLLPVDAISKETQH...EDSCTKEL
W5GJD2_WHEAT/891-1304--------------------------------.FPAWMLLSRFDSTNK....PTTMLLPVDSISKEAHN...EDSSIKEL
K3Z105_SETIT/1078-1484--------------------------------YFPAWMLLSRFDSTGE....PTTMLLPVDAISGSQS....EDSSIKDL
C5XYE8_SORBI/457-870--------------------------------..PAWMLLSRFDSTNE....PTTLLLPVDAISAEMQF...DDSCIKDL
C5XSY3_SORBI/1425-1832--------------------------------..RAWILLSRFDSTSE....PTTLLLPVDAISE.MQF...EDSCIKDL
K3Y3B2_SETIT/1404-1817--------------------------------.FPAWMLISRFHSTNK....PTAMLLPVGAILEEMQS...EGSSIKDL
M0UBW7_MUSAM/65-479--------------------------------.FPAWILLSRLLANSQ....PVVMLLPVNLLHEEVQL...EDISDQKF
ESP1_ARATH/1641-2060--------------------------------PVCAWVLISRLNPESQ....PVATLLPVDSIVEDMS....DDSANLSS
M4DS49_BRARP/1599-2019--------------------------------PVCAWVLVSRLTLKSQ....PVATLLPVDSVLEDMSD...DDSATISS
B9GZR1_POPTR/1674-2094--------------------------------CISAWMLLSRLKFKSQ....PIMMLLPVNKVLEETSD...DDCAMSCT
B9SSN4_RICCO/1627-2045--------------------------------RVCAWMLLSRLNSKSH....PIMMLLPVDLISEETSD...DDAPNPGS
I1MDQ8_SOYBN/1648-2063--------------------------------.VQAWMLVSRLSFKNE....PVVMLLPLDSILQASC....EGDLSTGS
K4B224_SOLLC/1600-2023--------------------------------PIQSWVLLSRMSSTSQ....PITVLLPVHSILNEAA....DDVAEFTS
W1NKX2_AMBTC/1-423--------------------------------.....MLLSRLNLMRQ....PVVLLLPVDSVLEDVQ....QDNWTTSV
K7H1P7_CAEJA/245-604--------------------------------ADNKQIYLIKLHADRE....PIIM..PIAHYSQ.......AS......
E3LM18_CAERE/731-1090--------------------------------ADDKKIYMIKLHADRE....PIIM..PLAHYSQ.......AV......
G5ED39_CAEEL/727-1081--------------------------------ADDKTIYLVKLHADRD....PIIM..PLAHYSQ.......AV......
Q23491_CAEEL/749-1101--------------------------------ADDKTIYLVKLHADRD....PIIM..PLAHYHQ.......AI......
S3CR95_OPHP1/1758-2208--------------------------------ENKHDLCITKLQAGQS....PFVIRLPLERAIS.RDA...DN..E...
F0XAD9_GROCL/1636-2054--------------------------------ENNQDLCITKLQAGSS....PFVLRLPLERAVS.RDA...DT..E...
G2R9B0_THITE/1619-2058--------------------------------DGNHDLCITKLQAGES....PFVIRLPLERASS.RDA...DS..D...
Q2H6Q9_CHAGB/1612-2026--------------------------------EGNHDLCITKLQAGQS....PFVIRLPLERASS.REA...DS..D...
G0SHM3_CHATD/1723-2150--------------------------------DGGHDLCITRLQAGQA....PFVLRLPLERASS.RDSSVDET..D...
G4UQF5_NEUT9/1626-2085--------------------------------DNKHDLCITKLQAGCT....PFVLRLPLDRASS.RDA...DN..E...
G4N8I2_MAGO7/1627-2057--------------------------------DNKHDLCISRLQAGHS....PFVIRLPLERATS.RDT...DN..E...
J3P7L5_GAGT3/1606-2054--------------------------------DNKHDLCVSRLQAGHS....PFVIRLPLERGSS.RDS...AN..D...
R8BFS3_TOGMI/72-487--------------------------------ENKHDLCITKMQADQS....PFIIRLPLERANS.RDA...DN..E...
N4UZ87_COLOR/1637-2043--------------------------------DNRKDLCITKLRAGQS....PFILRLPLERVAS.RDG...ED..E...
G2X6M8_VERDV/1704-2113--------------------------------ENRHDLCITKLQADHT....PFVLRLPLERAVS.RDA...DT..E...
G0RRT6_HYPJQ/1566-1971--------------------------------DNRHDLCITKFQAGQG....PFILRLPLERANS.RDA...DS..E...
M1WFQ9_CLAP2/1438-1889--------------------------------DNRHDLSITKLQAGHS....PFILRLPLERANG.RDA...HS..E...
J5K578_BEAB2/1584-1996--------------------------------DNHHDLCLTKFQAGHS....PFILRLPLERANS.RDA...DC..E...
C7YYU1_NECH7/1580-1992--------------------------------DNHHDLCITKFQAGHS....PFILRLPLERANS.RDA...DS..E...
M7T4Q8_EUTLA/44-499--------------------------------DSQHDLCITKLQAGHS....PFAIRLPLDRASS.RDS...DS..E...
L8G205_PSED2/1652-2056--------------------------------ESRDELVLAKFEAGHS....PFILRVPLERNSS.RDA...DE..E...
N1JFH1_BLUG1/1598-2001--------------------------------ENQHELSLTKLQAYQS....PFILRLPLGRNNS.IDA...DE..E...
K1X2E6_MARBU/1659-2061--------------------------------ESRQELSITKLQAGHS....PFVLRLPLGRHNS.MDA...DE..E...
S3D029_GLAL2/1639-2043--------------------------------DSHNELVITRLQAGQS....PFVLRLPLGRHNS.MDA...DE..D...
M7TX51_BOTF1/1640-2041--------------------------------ENRQELSITKLQTGHS....PFVLRLPLGRNNS.MDA...DE..E...
BIMB_EMENI/1609-2004--------------------------------ADRAEFVVSRLHRGCS....PFLLRLPLRRGNS..ED...EE..E...
Q2USV7_ASPOR/1630-2030--------------------------------ADRSEFIVSRLHQGRS....PFLLRLPLKRGNS.EEE...DE......
G7XGU8_ASPKW/1627-2026--------------------------------TDRTEFVVSRLQKGRS....PFLLRLPLKRGSS..ED...EE..E...
S8BGE7_PENO1/1622-2018--------------------------------ADCSEFYVSRLQKNRP....PFLLRLPLRRGNS.DED...EE..E...
B6GZP8_PENRW/1602-1998--------------------------------ADRTEFVVSRLQKDGS....PFLLRLPLHRGNS.EDD...DE..E...
Q4WUU6_ASPFU/1638-2039--------------------------------ADCTEFIISRLRKDHS....PFLLRLPLKRGNA..ED...DE..D...
B6QNB5_TALMQ/1619-2016--------------------------------PDRTEFIISRMSHGSS....PFLLRLPLKRSEE.DNQ...DE..D...
V5GCB2_BYSSN/1684-2084--------------------------------ADRTDIVISKMHKGRA....PFLLRLPLKRGDSEDEE...EE..E...
F0UL09_AJEC8/1642-2044--------------------------------GDHKEFIISKLRSGRP....PFLLRLPLKRGNL.EEM...DE..D...
C5FSW7_ARTOC/1655-2058--------------------------------PSQDEFIISKLRSGQH....PLILRLPLKRGGE.DDM...DE..E...
H6C6Q4_EXODN/1587-1987--------------------------------DDRSELLVARLNAGRS....PFIVRIPLTRPEA.SET...ET..E...
U1G8A9_ENDPU/1638-2036--------------------------------DDSSEMIISKIRQNYS....PFLLRLPLDRSAG.EDL...DE..E...
K2R7J5_MACPH/1619-2043--------------------------------EARDELYITRYVPYQS....PFILRLPMARHNS.RDM...DE..E...
R7YNT5_CONA1/1696-2117--------------------------------EAGSDLYVTRYQANQT....PFILRLPMARQSS.QLM..DDE..D...
E4ZTB4_LEPMJ/1652-2063--------------------------------ESRDELYITRFESGMS....PFVLRLPLARHAS.REM...DE..E...
N1QAI8_PSEFD/1492-1912--------------------------------QTCDELYIVRYRHGQS....PLVLRLPFSRHRS.EDS...EE..G...
N1QHR1_SPHMS/1187-1599--------------------------------EKCDELYVARYRSGQT....PLLIRLPFSRQKS.EDD...DE..G...
N1PZ16_DOTSN/1513-1936--------------------------------ESCEELYVAKYRGAQS....PLVLRIPFSRQKS.DEA...EQ..E...
D5GKQ4_TUBMM/1633-2033--------------------------------ESREELYLSRFQAGQS....QLMVRLPLTRHNS.RDD...YE..D...
U4LG69_PYROM/1616-2019--------------------------------ENKKELYITRFQAGQS....QLMVRLPLNRHNN.RDE...YS..D...
S8C8B1_DACHA/1639-2040--------------------------------ESREELFFTRYEAGQI....PFMIRVPLMISEE.MSM...DE..E...
Q6CCJ0_YARLI/1210-1588--------------------------------PTSGDLIVCQYACNQE....PFLLRLPLHRHNS.RDV...DE..H...
S9X830_SCHCR/1385-1771--------------------------------ESKEELFITKFAHKSS....PLIFRLPFKRHNA.RDA...DE..E...
CUT1_SCHPO/1383-1770--------------------------------NSGEDLFISKIRKGHS....PLIFRLPLQRHNS.RDA...DE..E...
B6K0I6_SCHJY/1359-1747--------------------------------ESKEDLFLSKVRKNQN....PLVVRLPLQRHNS.RDA...DE..E...
M7PDE3_PNEMU/1489-1882--------------------------------ESKNDLYITRLQRQLS....PLVLRLPLNRSNS.RDA...DQ..D...
G8BT64_TETPH/1165-1563--------------------------------PLTNHLLLSKIDSSSN...KTIHVRLPLNRINS.REL...DT..Q...
I2H0Y5_TETBL/1280-1677--------------------------------PITGHLIISKSFSYNN...KKLHIRISLDRARS.RDL...DA..N...
S6EFD3_ZYGB2/1145-1542--------------------------------PSNDSLLLSKIDSKFG...KNVQLRMPLNRAYA.RDL...DC..H...
C5DU01_ZYGRC/1141-1538--------------------------------PANENLLINKLESKSG...RMIHLRVPLDRTYT.RDL...DS..H...
G8ZWZ1_TORDC/1158-1555--------------------------------PVTKNLLLSKIETCHD...RNVHIRMPLNRTHT.RDL...DC..M...
G0WDN6_NAUDC/1191-1589--------------------------------SITGNLLLSKIDPVTK...KLNHLSIPLNRGNA.RDL...DT..L...
G0VFB3_NAUCC/1164-1562--------------------------------SITGNLLLSKLSATNG...HKSHLSIPLNRANL.RDL...DA..Y...
H2B1L5_KAZAF/1161-1559--------------------------------PVTGNLLLSKIDTVKK...RRILLNIPLNGSNA.RDL...DS..L...
ESP1_YEAST/1175-1571--------------------------------PITGNLLLSKLEPRRK...RRTHLRLPLIRSNS.RDL...DE..V...
J7RG90_KAZNA/1160-1562--------------------------------PLTENLVLTKYEGQSH...RRTTLRISLKENRS.KDT...HC..G...
Q75EJ0_ASHGO/1152-1552--------------------------------KYNGDLLLSKVVSTTG...KHFHLRLPLNRHES.RDL...SQ..E...
C5DHM1_LACTC/1178-1575--------------------------------EITGDLLLSKMDSGRD...SKVCLRLPLNRSNS.RDM...DE..I...
Q6CQQ7_KLULA/1118-1516--------------------------------QLTGDLLITRFDTVRN...KHLHLRLPLNRHNS.RDL...SE..E...
Q6FTE1_CANGA/1151-1548--------------------------------KLTNTLIIRRISNLDS...KNIMAKIPIDRNVS.RDL...DA..D...
K0K8V1_WICCF/1175-1568--------------------------------AFNGDLIISRLTRDST...VPSVLRLPLSRHSS.RTI...DE..E...
A5DNR9_PICGU/1178-1576--------------------------------PNSDSLLLTRLTHLGS....PFVVRLPLSRMKQ.RGK...NT......
A3GFF5_PICST/1168-1555--------------------------------PYSGDILLSRYIKGKH....PWFLRLPISR..Y.HDR...SPRTS...
Q6BTB7_DEBHA/1338-1753--------------------------------PYTGDLLLSKSLKDSYN..TPFFLRIPLSKRGT.EDG...SP......
Q5A8X8_CANAL/1101-1536--------------------------------QNTGDLLISKLTKGSP...NPIFMRLPLSRF.....P...SS......
C5MEH0_CANTT/925-1303--------------------------------QQTGDLLLSKRTKDS....NPVFIRLPLNRF.K.NGV...SP......
M3HH45_CANMX/1423-1797--------------------------------PKTGDLLLSKITKNT....QPLFVRLPLNRL.H.NDP...SF......
G8B5X7_CANPC/1052-1424--------------------------------ERTGDLLISKIRAGN....LPTFIRLSVTRF.K.QRE...SV..G...
A5DVQ7_LODEL/1109-1530--------------------------------EHTGDLLLSKCSRGS....LPIFIRLSLERY.I.DRE...GI..D...
G3AGZ6_SPAPN/1149-1535--------------------------------SHSGDLLLSKIDRGK....DPVFLRLPVKRF.Q.SRV...NQPDK...
G8YBL5_PICSO/1309-1719--------------------------------PISGDLILSKLMSDFN...EPFFLRIGSSRFSS.VTK...SQ..K...
C4XY11_CLAL4/1177-1564--------------------------------ELSGNLIITKFESGQT...LPFVFKLPFRKN...........NGS...
G3B782_CANTC/1213-1609--------------------------------.GSDELVLARLSKESDY..KPICLRLPLKRMMD.HGS...TA..S...
W1QIM9_OGAPD/1167-1527--------------------------------...GCLLLTRYGPKQD....PVFIKLPLERHLIGRHA...........
C4QYS2_PICPG/1259-1619--------------------------------SVTGDMLLSYFSSAED....SVIIRIPFQ.....PNT...........
K5WME3_PHACS/1732-2136--------------------------------EDRNTMFVTRQRPRRE....PLIFCIPLK..DR.REN...VD..DT..
M2R2K9_CERS8/1618-2024--------------------------------EDKNTMFISRQRHNSQ....PLVFCLPLK..GR.REN...VE..DE..
F8PLA9_SERL3/1278-1688--------------------------------EDKNTMFVCRQRARSD....PLIFCVPLK..GR.RET...DD..D...
S8E105_FOMPI/1678-2083--------------------------------EDKNMLFVSRQRTGRE....PLVFCLPLR..GR.RED...EG..D...
A8NBE9_COPC7/1839-2276--------------------------------.DKGTLLVSRQECGESG.VEPLVFSVPLK..GR.RDN...GG..GED.
B0E1W0_LACBS/104-540--------------------------------DDKSTLFISRREGGVEG.SQPLVFCVPLK..GR.RDN...GD..DND.
D8Q1W5_SCHCM/1450-1878--------------------------------EDKRTLFLSRQEGGEQS..EPLVFCIPLQ..GR.RDN.......DDD.
V2X3W8_MONRO/1588-2040--------------------------------DDRKTLFISRQRGGRETKDRPLMFCIPLQ..GR.RES...PD..DDS.
J0DCK6_AURST/1634-2046--------------------------------EDKKSMFVSRQRPKEE....PLVFCVPLERHNR.RDE...DD..EDD.
R9AIE1_WALI9/1639-2036--------------------------------DDKKTMFVVKYRKNLE....PLVVSLPLDNRQNKREGGGEEG......
I4YB88_WALMC/1631-2030--------------------------------DDKKTMFVVKFRKNSE....PLLVSLPLDNRQNKREGGGEEG......
G4T5A4_PIRID/1472-1874--------------------------------.ARNTLIVARNRQDK.....CDLFKLPLKRGAR.REH...DE..EP..

PF01364

KGP83_PORGN/244-595MLVV....A..GAKF.................KEALKPWLTWKAQK......GFYLDVHYTDEAEVGT............
D1JG83_9ARCH/891-1295FAYT....K..IPKL.................SLTAAQIAA...........ARKAPVIDINKNPEEII...........
A2U064_9FLAO/401-768YLVI....T..NSDL.................ANEAQRLVDYHQTN.....SNLVGKVVLLDEIYNEFS...........
Q7MTE2_PORGI/239-573MIVI....V..AKKY.................EGDIKDFVDWKNQR......GLRTEVKVAEDIASPV............
D3HWT0_9BACT/400-777MVII....IPTSQKL.................LAQAQRLKAFHEAH.....DSLSVRIVPADELFNEFS...........
Q5S3Q9_9FLAO/543-910YLIV....T..PRIL.................KSQADRLADFHRNY.....SKLNVKVVTLDAIYNEFS...........
A9DMD5_9FLAO/555-923YIII....T..PDAF.................VSQAERLADFHRNN.....SGMIVKVVTLASIYNEFN...........
B0VGA8_CLOAI/228-563ILLIYGNNT..DPIF.................TAKLNEFVAWKRQK......GYDVNFVSTAETGGA.............
B7B5I7_9PORP/382-753MIII....A..QPNF.................TTQAERLAEAHRTK.....DNLTVRVVTPESIYNEFS...........
B8FFM0_DESAA/254-600FVIV....T..TGDL.................KDAFKNFIDIRNL.......DHTVKLALLNDIKKEF............
A3U7G6_CROAH/540-908YLML....V..DNTL.................ISEANRLAQYRRDR.....DGLNVKVVQLQTIYNEFS...........
D2QSX9_SPILD/414-786LLIV....T..PAAW.................RDQADRLAQFRRDH.....DQLSVLVVTTQQALNEFG...........
A3HW99_9BACT/398-769YILV....G..HHALEIP..........ADQFQNPLQSYAEHRAS.PL..GGGYKTLTIFMEEIYDQYG...........
B0VHP2_CLOAI/234-563ILVI....K..HSMF.................DATIQPWVDWKRQL......GFTVDVVDVTTAGS..............
A8ZUB1_DESOH/278-656YVLI....T..SQAIIDD...........VSIDPSVADFIAHRQAQ......GLTTAVVSIDSVLADDN...........
B0VIM2_CLOAI/182-528MLII....T..HSQL.................TNYQQDYIAWKKSI......GFDVYTANKSDIGS..............
Q2Z0E1_9BACT/643-1013YVMI....A..YDGF.................YDEALRLKNHRESAA...GGGYDVRLVRLSDVYSEFS...........
B3QXR8_CHLT3/734-1131YIII....T..SDEFINSS........NFEKTSNPVRQYKEYRESYLKAIGETGNVLVVTTQAVYDEFN...........
C2MCN4_9PORP/405-781YLMI....T..TEAL.................RPAAERLASYHREH.....SGLRVQVVTQQELFDEYN...........
A4A325_9PLAN/24-399TLVV....C..PEPL.................VPALRPWLDFRAAQ......GRQIGLITETA.................
A7NR84_ROSCS/499-867VLYI....A..PAPF.................HAALTPLVDLRRAQ......GYSVAVVDVQHLYDGWS...........
Q11Q36_CYTH3/558-932MIIV....T..HPDF.................QSQAQRLANFRTTN.....DGLRVYVCTTEQIYNEFG...........
Q7MX16_PORGI/272-637YLVI....Y..DDMFNVN...........QQPHDEIKRLCEHRAFY.....NGFDVAAVSIKDVLNSFPS..........
A0B5K7_METTP/796-1154FSHT....K..VPKL.................SLASMQVAA...........AKRAIVMDVAKDPQYVD...........
D0MH89_RHOM4/586-975LAII....T..ADTF.................RVYAEQLAEHRRD......QGLRVVVATVEQIYNEFS...........
A8UH97_9FLAO/539-910YIIL....A..PSQF.................ISQAERLAQINRDQ.....YNLNVKVVDLQTVYNEFS...........
B8KYL6_9GAMM/364-704YLMI....V..HSTL.................RTSLEPLAEFHRNR......GRTVVVADVEAIFDQFN...........
B8FIK5_DESAA/1139-1542YLII....T..TQAL.................AAAFETLEVHRTSV.....SGMACAVETVEDIEVNYP...........
Q11US7_CYTH3/392-767YFII....Y..PEVF.................NSSALSYDQYRSS.NA..GGNYDVERCSFEKLCNLYS...........
C6W101_DYAFD/326-680YLII....T..HPLMRTP...........VNGLDVVAEYAQYRAS.EA..GGGYHTSAAYSYELFDQFN...........
A5FJM8_FLAJ1/544-914YVIV....T..PRSL.................SSQAERLANFHRTN.....SNLNVKVISLENIYQEFS...........
Q7UG73_RHOBA/51-444VVVV....A..SPEF.................DETLEPWIQMRSEE......GLRVAIAR....................
A3J247_9FLAO/540-919YLII....T..PDFL.................STQAERLADFHRNN.....SGLSVRVVTLEKIYHEFA...........
A9WIM0_CHLAA/500-869AIYI....A..PRAL.................IGELEPLLARRQAQ......GWSPLAIAVEDVYAGWS...........
B0VHE7_CLOAI/227-554MLVIYGNYT..DTNY.................LSKINEFVTWKKQR......GFIVNAVSTGVTGI..............
C6VT06_DYAFD/394-758YIII....T..TDEL.................RDGAAAFAEYRSSPA...GGSFKPLIVNIRDIYDQFN...........
C6X3N8_FLAB3/546-921YLMI....T..VPEM.................MSQAQRLAAFYQDK.....FN..VAVVDVNKIYNEFS...........
A0LQH1_SYNFM/790-1132YIVI....T..SPEL.................SGAASSLADYRRRS.....KGLTTLVVTTEQIYDAFS...........
A1ZVJ9_9BACT/406-774LVII....V..PEVF.................LSEAERLAAFRRTN.....DGLSVTVVKLSQVYNEFS...........
B0VHF1_CLOAI/214-595YLIV....A..DAEK.................ITQWTPLKTFQEIR......GKTVLIKSMSEIIAEN............
B0VIE7_CLOAI/193-598LLVI....T..TPEL.................YTALDWLVTFRQSQ......GVDVSFCDI.AIALASG...........
C6W3P4_DYAFD/414-806YMIV....S..SESL.................IEAADSIALYRSAETA..GRKFKTGIFKIRDIYNQFN...........
B2RGP6_PORG3/408-787LIIV....S..TQAL.................LPEADRLATYRREK.....NGLKVLVVLQEQVFNEFS...........
D2QJ99_SPILD/409-770YVII....T..HEALMTPLTD.....SLTGRVTNAIQSYAAYRAS.VA..GGTHDTLTITMQQLIDQYN...........
A9B5Q8_HERA2/466-850TIYL....A..PKQW.................HSLVQPLINRRQQQ......GWQPLLVDVQAIYDRWS...........
D2QFF3_SPILD/397-745YVII....T..HASL.................RQSAATYAGYRSS.AA..GGSYKPFIVESDSLYDQFN...........
B0VH03_CLOAI/589-939NIIV....A..PAEF.................LQQAQELANKYREI.....YQISSKVILVDDIYNQFN...........
D2R2P5_PIRSD/21-411TVVV....C..PREF.................VAALDPLLAHRYAQ......GHRFAYVANTG.................
C6W0Z3_DYAFD/393-758LLII....T..PAEW.................VGEANRLAGFRNSN.....DGLDVLVVTTDQVYNEYA...........
A3XQP5_LEEBM/552-929YLMI....T..PNEL.................RAQAERLAQHNRTY.....RNLNVKVVTLDAIYNEFS...........
Q2PY26_9BACT/412-780YVIV....A..PEHM.................LIEAERLAQFHRD......RGLTVQAVDVQHVYNEFS...........
Q26FX7_FLABB/537-909YLII....A..PDFL.................ENEAQRLANYHITS.....SNLNTKVVTLTDIYNEFS...........
B0VJT2_CLOAI/236-566YLIIYGNNS..DINF.................TSALNEYVLWKKQK......GADVMVASTAANEAGN............
C6BTD6_DESAD/56-402NVIV....C..TADF.................MRAARYFSYLHREF.....EGVKSVIVKVPSTNGTAE...........
D2QE53_SPILD/328-1007YLII....T..DDRRWTFQNGKPVAGNALPLDSAGKTATSHFLRLAEWKAKRGIDAKVVTVSEIVQGGSSTGLKWGDFTD
A2BK55_HYPBU/159-551MIII....VPDDTLV.................EMYAEDIAKLHREM......GLNVRIVTTSYIYENYPEAELPSDVCRP
B0VHP1_CLOAI/283-636YVII....L..PDNF.................IAPMQPFIDWKKQE......GYNVIVAPTSITGT..............
Q1Q1Y4_9BACT/620-970YIII....T..HEDF.................YDNALALASHRIDD......GLRVVTVKVGDIYDEFN...........
C7PNY3_CHIPD/396-764MLIV....T..TPSL.................RTAASKLAAWHGTH.....DGLNVRVVTVNEIYNEFA...........
Q6LFY5_PHOPR/224-617YLII....T..ADRF.................QQTVEPLAAWKRKK......GYQVHVATITEVGN..............
B3QVL4_CHLT3/688-1063YIII....Y..ATDY.................KSDAERLLAHRSSTSIWGSHALSGIAVDAQQVYNEFS...........
A9B187_HERA2/552-907YLLISYNPA.NSSSW.................SDALQPLITQRASQ......GLKPLLIDVQQIYDQFG...........
R5M3W7_9BACE/537-910MIII....SPDRKDL.................MTQAERLAQAHREK.....DGLSVLVLAAPQIYNEFS...........
B0VJY1_CLOAI/655-1014VIVI....A..PWQFT...............SVEGTLQLKSLWESE......GHTVKIVDVQDIYDEFN...........
B8G4Y1_CHLAD/584-1054FLII....A..PQSVI...............QAGALADFVDFKRRL......GFEVEVVSIEQAGQGASPN........D
A1ZEG7_9BACT/410-775YLII....T..HASLRQA..........TGGVSDPVQAYAAYRAS.TE..GGGFDTLTVNVKLLYNQFN...........
B0VF22_CLOAI/223-583MIII....T..NNDR.................ISWFSEYSAWRSAK......GVSNSIYSMEDIVSAY............
A0LKV0_SYNFM/924-1265YCIV....T..HGLF.................TDGARRIAEQKRNE......GYNPAIVDVEVLYNRYS...........
A8ZTD5_DESOH/257-648LLII....S..PPEL.................VAAADRLANWKRAQ......GILTEVRTTGQTGT..............
A9B8S0_HERA2/477-840VIIA.......PRAF.................LPALDPLR............TPTTVLVAREDLDAAWA...........
C3JBB2_POREA/421-799LIIL....S..PEAF.................LSEAERLAEFHRSV.....DGMQVLVVGETALFNEFN...........
C9SW40_VERA1/279-917YLII....T..DDVTWDPVAIA..PGVSRPGLIKEFERLAEAKRAR......GISTRVVSITDIVAGRWGN.........
C9LI59_9BACT/509-899MVII....IPQSGKL.................LAQAERLAEAHKKQ......GLRVKVVRADQLYNEYS...........
B5ICF9_ACIB4/214-642NIII....T..SPQL.................KAAAQRLADFHNST......GVTSWVVTTTWIAKNYQPAP......NP
Y048_ARCFU/22-377EIIL....T..SEKL.................INSAYQLQEIHEKV......GIQSDIVTVEQIWDSYSPVE......DP
A3I371_9BACT/360-725LLII....T..TDEF.................SFAANKLKS.HKTN.....LGINTEVVFLKDIYNSFS...........

PF11713

MARTX_VIBCH/3469-3626--------------------------------TRFDGQIIVQM..END--------------------------------
A0KHZ7_AERHH/3609-3767--------------------------------TRFTSQVIIQT..EDD--------------------------------
Q2KX68_BORA1/2483-2627--------------------------------DPYRKRTVVVV..GDD--------------------------------
Q2SAY5_HAHCH/1-160--------------------------------MNYDKQLIIVLLTEPK--------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------TRFDGQIILQM..EDD--------------------------------
Q7N726_PHOLL/2997-3151--------------------------------TRFDGQIIIQM..END--------------------------------
Q7VV06_BORPE/2551-2702--------------------------------DPYANRVIVQL..AQD--------------------------------
Q7VV06_BORPE/2959-3112--------------------------------DPYALRSIVQL..GTD--------------------------------
Q7VV06_BORPE/3397-3549--------------------------------DRYGHRTIVQL..GSD--------------------------------
Q7VV06_BORPE/3808-3959--------------------------------DRYAHRVIVQL..GSD--------------------------------
Q189K3_PEPD6/575-754--------------------------------.RGYIHYIVQL..QGD--------------------------------
Q189K5_PEPD6/577-756--------------------------------.KNYVHYIIQL..QGD--------------------------------
Q7CGR6_YERPE/772-928--------------------------------.NHHLQFIVLL..QDD--------------------------------

PF01650

LGMN_HUMAN/29-286-----------------------------------HWVVIVAGSNG-----WYN----YRHQADACHAYQIIHR.NG---
VPED_ARATH/46-316-----------------------------------RWAVLVAGSNE-----YYN----YRHQADICHAYQILRK.GG---
VPEG_ARATH/59-330-----------------------------------RWAVLVAGSSG-----YWN----YRHQADICHAYQLLRK.GG---
A0CQC7_PARTE/19-285-----------------------------------NWALLVSGSNA-----FYN----YRHQADVCHSYKTLIR.NG---
A2FXM6_TRIVA/13-267-----------------------------------TWAVIFCGSRD-----FYN----YRHTADSYYMYHLIAEVNN---
O24539_VICNA/53-325-----------------------------------RWAVLVAGSNG-----YGN----YRHQADVCHAYQLLIK.GG---
HGLB_SCHMA/37-291-----------------------------------KWAVLVAGSNG-----YPN----YRHQADVCHAYHVLRS.KG---
HGLB_SCHJA/31-285-----------------------------------KWAVLVAGSNG-----FEN----YRHQADVCHAYHVLLS.KG---
VPE_VICSA/56-325-----------------------------------RWAILLAGSNG-----YWN----YRHQSDVCHAYQLLRK.GG---
A0A080VK93_PSEAI/341-579-----------------------------------LYALSLGGDGR-----QGV----FLREAD..YAGDLLGQRFA---
Q08BI0_DANRE/27-278-----------------------------------AWVLLVAGSKD-----WDN----YRHQANVCCAYQLMKK.QG---
Q0MYV8_EMIHU/33-301-----------------------------------HWAVLIAGSSG-----YGN----YRHQADVCHAYQIMIK.NG---
Q22P32_TETTS/20-285-----------------------------------NYSVLVAGSKG-----YEN----YRHQADVCHAYHTLVK.KG---
Q22P33_TETTS/20-285-----------------------------------NYSVLVAGSKG-----YEN----YRHQADVCHAYQSLLK.KG---
D0MXB3_PHYIT/25-298-----------------------------------HWAVIVSGSNG-----YSN----YRHQSDACHAYHIVRR.HG---
Q2UVF3_HAECO/29-287-----------------------------------LYALLVAGSDG-----WWN----YRHQADVSHAYHTLIN.HG---
Q4K5F2_PSEF5/335-570-----------------------------------LYSLTLAGDGK-----QSV----FLREAD..YVSNMLASRFG---
Q4RED0_TETNG/30-283-----------------------------------NWVVIVAGSNG-----WDN----YRHQADACHAYQIVHR.NG---
Q8P9N6_XANCP/124-392-----------------------------------LYVVGFAGDAS-----DDV----FRNETL..YLKQLFEQRFD---
Q6EHZ7_TRIVA/12-258-----------------------------------RFAVLIAGSND-----FYN----YRHQADIFNMYQQLVK.RG---
Q6FEB2_ACIAD/229-477-----------------------------------WYFLGVAGASY-----QDV----FKSEIM..RIKDQFDTRFG---
Q6L4R2_ORYSJ/41-319-----------------------------------RWAVLIAGSNG-----FYN----YRHQADVCHAYQIMRK.GG---
Q6NYJ7_DANRE/32-288-----------------------------------HWVVIVAGSNG-----WYN----YRHQADVCHAYQIVHK.NG---
Q6PRC7_IXORI/38-293-----------------------------------LWALLVAGSNG-----YYN----YRHQADICHAYHVLHN.HG---
Q711M2_FASHE/21-278-----------------------------------NWAVLVAGSNG-----WPN----YRHHADVCHAYQVLIK.NG---
VPE1_ORYSJ/62-334-----------------------------------RWAVLVAGSSG-----YGN----YRHQADVCHAYQILQK.GG---
Q852T1_TOBAC/49-320-----------------------------------KWAVLVAGSRG-----YWN----YRHQADVCHAYQLLKK.GG---
Q88QE3_PSEPK/400-640-----------------------------------LYSLVVAGDGQ-----QSV----FLREAD..YVSRMLKVRFG---
Q949L7_BETVU/51-321-----------------------------------RWAVLIAGSSG-----YWN----YRHQADVCHAYQVLKK.GG---
Q9LLQ4_SESIN/54-326-----------------------------------RWAVLVAGSNG-----FGN----YRHQADVCHAYQILKK.GG---
Q9LWZ3_ORYSJ/41-304-----------------------------------KWALLIAGSKG-----YEN----YRHQADVCHAYQIMKK.GG---
Q9SBX2_MAIZE/45-317-----------------------------------RWAVLIAGSNG-----YYN----YRHQADICHAYQIMKK.GG---
Q9SMD0_SOLLC/39-316-----------------------------------KWAVLVAGSKE-----WYN----YRHQANLCHAYQLLKK.GG---
Q9XG75_TOBAC/40-306-----------------------------------KWAVLVAGSNE-----WDN----YRHQADVCHAYQLLKK.GG---

PF00656

Q7QGM9_ANOGA/35-227-----------------------------------AYVLVF..HHD.....QFK....NPKN..........NREGS---
DRONC_DROME/196-443-----------------------------------GVLLMV..NIM.....DYP....DQNR..........RRIGA---
O42284_CHICK/42-279-----------------------------------RRALLI..CNT.....KFK....HLR...........QRDGA---
CAS1A_XENLA/144-382-----------------------------------GLALII..CNE.....KFE....NLN...........ERHGA---
CASPC_MOUSE/176-415-----------------------------------RLALII..CNK.....KFD....YLF...........DRDNA---
CASP4_MOUSE/132-369-----------------------------------RKALII..CNT.....EFK....HLS...........LRYGA---
CASP5_HUMAN/193-430-----------------------------------RLALII..CNT.....KFD....HLP...........ARNGA---
CASPD_BOVIN/136-373-----------------------------------RLALII..CNT.....EFD....HMP...........PRNGA---
CASP1_CANLF/163-400-----------------------------------RLALII..CNI.....EFD....HLS...........TRDGA---
CASP1_FELCA/161-406-----------------------------------RLALII..CNT.....TFD....HLS...........LRKGA---
CASP1_MOUSE/162-398-----------------------------------RLALII..CNT.....EFQ....HLS...........PRVGA---
CASP1_HUMAN/163-400-----------------------------------RLALII..CNE.....EFD....SIP...........RRTGA---
CASP1_PIG/163-400-----------------------------------RLALII..CNT.....EFE....NLP...........RRDGA---
Q9I9L7_DANRE/145-379-----------------------------------RLALLI..NNV.....DFD....DKAM..........KRSGS---
Q9DDJ2_DANRE/174-400-----------------------------------GLALLI..TNI.....QFA....NTQH..........NRDGA---
Q6NTR7_XENLA/280-494-----------------------------------GFCLII..DCV...............................---
CFLAR_MOUSE/257-480-----------------------------------GICLII..DCI...............................---
Q6QN97_PIG/259-484-----------------------------------GICLII..DCV...............................---
CFLAR_HUMAN/252-477-----------------------------------GICLII..DCI...............................---
Q9NBW3_DROME/38-248-----------------------------------PAVYIL..NHE.....QFP....QDS.......QL..NRKGS---
Q9TZP5_CAEEL/26-261-----------------------------------CRAIII..NNV.....VFC....GME...........KRIGS---
CASPE_MOUSE/22-256-----------------------------------RLALTL..CVT.......K..................AREGS---
CASPE_HUMAN/18-241-----------------------------------RLALIL..CVT.......K..................AREGS---
Q8I749_SUBDO/254-491-----------------------------------GICLII..NNH.....QFY....HSDPE.....KCHSNRGGA---
CASP2_RAT/200-445-----------------------------------GLALVM..SNV.....HFT.GEKDLE...........FRSGG---
CASP2_CHICK/171-416-----------------------------------GLALIL..SNI.....HFS.SEKDLE...........YRSGG---
Q9GV89_HYDVU/93-318-----------------------------------GFVLII..NNE.....KFV....EEE...........NRDGS---
Q9IB63_XENLA/144-396-----------------------------------GFCLII..NNM.....NFH.ECTGLS...........TRTGS---
CASP9_HUMAN/161-413-----------------------------------GHCLII..NNV.....NFC.RESGLR...........TRTGS---
Q90WU0_CHICK/148-400-----------------------------------GHCLIF..NNV.....SFS.RDSDLS...........TRAGS---
Q9IB64_XENLA/261-494-----------------------------------GWCVVI..NNY.....DFK....EARS...QDCKYT.DREGT---
Q6E5N8_ICTPU/119-362-----------------------------------GFCVII..NNV.....NFA....SPLK..........ERYGS---
Q9I8J3_DANRE/238-473-----------------------------------GYCLII..NNY.....NFL....ESTN.......LL.KRTGT---
Q6PAD9_XENLA/268-495-----------------------------------GYCLII..DNS.....IFA....KGK...........RREGS---
Q90WU1_CHICK/237-479-----------------------------------GVCLIL..NNH.....NFA....KAREAVPELRRMK.DRNGT---
CASP8_HUMAN/234-476-----------------------------------GYCLII..NNH.....NFA....KAREKVPKLHSIR.DRNGT---
CASP8_MOUSE/236-478-----------------------------------GYCLII..NNH.....DFS....KAREDITQLRKMK.DRKGT---
Q9Y1U6_PRIPA/173-413-----------------------------------GYALII..SNE.....HFR....TMP...........QRRGT---
CED3_CAEEL/243-494-----------------------------------GMCLII..NNE.....HFE....QMP...........TRNGT---
Q7QKT2_ANOGA/35-260-----------------------------------GIAVVI..NNN.......R..................DRKGS---
Q7PZJ9_ANOGA/20-250-----------------------------------GIAVVI..NDS.......E..................NRDGW---
Q9GV88_HYDVU/84-316-----------------------------------GTLTII..NVK.....NFM....KSSN......KHEYPRLGT---
Q7Q1E0_ANOGA/62-291-----------------------------------GMALIF..SHN.....KYNVRNVSLP...........VREGS---
CASP1_SPOFR/61-293-----------------------------------GMAIIF..NHE.....HFD..IHSLK...........SRTGT---
CASP1_DROME/79-313-----------------------------------GVALIF..NHE.....FFD..IPSLK...........SRTGT---
Q7Q4X6_ANOGA/73-309-----------------------------------GLALIF..NHE.....NFD..VPQLR...........SRAGT---
DRICE_DROME/94-328-----------------------------------GMALIF..NHE.....HFE..VPTLK...........SRAGT---
Q9NHF9_DROME/56-302-----------------------------------GIALIL..NHK.....DVK....GQK...........QRVGT---
Q7Q803_ANOGA/54-306-----------------------------------GVAAVF..NHR.....KFL....HAS...........ERKGT---
Q7PV92_ANOGA/14-237-----------------------------------GIALII..NQV.....IFS....SMA...........VRVGS---
Q86FL0_ANOST/52-286-----------------------------------GIAIII..NQV.....NFS....GMA...........KREGS---
Q8I6Y2_GEOCY/158-414-----------------------------------GMALII..NNR.....NFT...CGMK...........ERVGT---
Q8ITP3_BRAFL/87-323-----------------------------------GQAIII..NNK.....DFE.KHTGMN...........TRRGT---
O88550_RAT/68-301-----------------------------------GKCIII..NNK.....NFD.KATGMD...........VRNGT---
Q6DCI2_XENLA/78-314-----------------------------------GRCIII..NNK.....IFD.KITGMG...........ARNGT---
Q8JIS8_ORYLA/58-285-----------------------------------GICLII..NNK.....NFH.KDSGMG...........PRNGT---
CASP3_XENLA/56-280-----------------------------------GMCLII..NNK.....NFH..SSNMA...........VRNGT---
O93417_CHICK/53-281-----------------------------------GVCVII..NNK.....NFH.RDTGLS...........SRSGT---
Q98UI8_DANRE/48-280-----------------------------------GHCIII..NNK.....NFD.RRTGMN...........PRNGT---
Q8JG42_TAKRU/51-279-----------------------------------GHCIII..NNK.....NFD.RRTGMN...........TRNGT---
Q8ITP2_BRAFL/151-396-----------------------------------GLCLVF..DNE.....EFH.WTTKMN...........RRRGS---
Q9IB66_XENLA/58-298-----------------------------------GLALIF..NHE.....DFY.WQLRLG...........SRRGT---
Q9I8S9_ONCMY/57-297-----------------------------------GLALIF..NQE.....HFF.WHLRMP...........PRNGT---
O93415_CHICK/57-299-----------------------------------GVALIF..NHE.....HFF.WHLRLP...........DRRGT---
CASP6_MOUSE/28-270-----------------------------------GVALIF..NHE.....RFF.WHLTLP...........ERRGT---
PCP_DICDI/188-404-----------------------------------RISFII..GNS.....KYS....QHR...........KLDGV---
Q7AKE1_STRCO/9-268-----------------------------------SRVVLV..GVA.....DYD.....HL....P......PLPGI---
A0A063TRB6_BORBO/552-800-----------------------------------.HAMIV..GIN.....EFG....EASL..........NLQYA---
Q7NPG1_GLOVI/7-278-----------------------------------.KALIV..AIN.....DYP....GTTN..........DLPSC---
Q87Z21_PSESM/2-224-----------------------------------KKALVI..GID.....NYP.....TA...........PLMGC---
Q82I86_STRAW/5-276-----------------------------------.HALLV..GID.....DYP....SQTAT.........PLRGA---
P74453_SYNY3/40-299-----------------------------------KWALLLAAGQG.....NGA....NGDR.R........GLMGC---
Q8YS65_NOSS1/4-245-----------------------------------NWAIAI..GVN.....QYD....YLE...........PLNYA---
Q9DDL2_DANRE/323-560-----------------------------------KVALLI..GNM.....NYL....HHR...........QLRAP---
Q98CE0_RHILO/5-237-----------------------------------RVALVM..ADN.....DYR....LVR...........PLANP---
Q6N0T4_RHOPA/30-250-----------------------------------RVALVI..GNS.....KYP....DADK..........PLSQA---
Q89XG2_BRADU/27-247-----------------------------------RYALVI..GNA.....KYP....DADA..........PLKEP---
Q89XE4_BRADU/58-278-----------------------------------RLALVI..GNG.....HYP....DANA..........PLTQS---
Q6NBN5_RHOPA/57-277-----------------------------------RLALVI..GNA.....HYP....DAAS..........PLLQP---
Q98JS7_RHILO/35-253-----------------------------------RAAIVV..GNS.....EYP.....FA...........PLTNP---
Q985X8_RHILO/35-256-----------------------------------RLAFVI..GNA.....AYP.....SG...........SLATP---
Q6N5Q1_RHOPA/33-253-----------------------------------RIALVI..GNG.....AYA.....KA...........PLSTA---
Q89KP2_BRADU/86-307-----------------------------------RIALVV..GNG.....AYA.....KS...........PLATT---
Q89IK1_BRADU/30-253-----------------------------------RVALVI..GNG.....AYA....STA...........QLPNP---
Q98G71_RHILO/26-252-----------------------------------RVALVI..GNG.....TYA....EAG...........TLANP---
Q6AKF4_DESPS/28-248-----------------------------------RIALII..GNS.....DYR.....IR...........SLKNP---
Q98IJ6_RHILO/11-238-----------------------------------RIALVL..GNS.....QYQ....HAA...........PLANP---
Q89MV1_BRADU/176-400-----------------------------------RIALVV..GNS.....AYK....NIT...........PLDNP---
Q89HT8_BRADU/51-272-----------------------------------RVALVI..GNS.....NYQ....NAP...........QLQNP---
Q89FZ4_BRADU/32-256-----------------------------------RLALVI..GQS.....AYR....TVP...........ELPNA---
Q6N329_RHOPA/73-298-----------------------------------RVALVI..GQS.....AYR....AVP...........ALPNP---
Q98IJ9_RHILO/30-261-----------------------------------RVALVI..GNS.....KYV....NAV...........ALPNP---
Q89HP3_BRADU/336-569-----------------------------------RMALII..GNG.....AYA....HVK...........ALPNP---
Q7RFI8_PLAYO/964-1364-----------------------------------KKAVVI..GCN......YM.....GEKDSIN......QLHGS---
Q74F93_GEOSL/6-270-----------------------------------..ALAL..GLNAVDPKHYG.....GWA...G......KLNAC---
MCA9_ARATH/10-321-----------------------------------RLAVLV..GCN......YP.....NTR...N......ELHGC---
MCA8_ARATH/3-378-----------------------------------KKALLI..GIN......YP.....GTA...V......ELRGC---
MCA7_ARATH/3-401-----------------------------------KRALLI..GIN......YP....GTTE..........ELQGC---
Q70VV0_PICAB/3-415-----------------------------------KKAVLV..GCN......YP....GTKA..........ELKGC---
Q9ZSP8_HEVBR/3-415-----------------------------------KKAVLI..GIN......YP....GTKA..........ELKGC---
MCA4_ARATH/3-416-----------------------------------KKAVLI..GIN......YP....GTKA..........ELRGC---
MCA5_ARATH/3-408-----------------------------------KKAVLI..GIN......YP....GTKA..........ELRGC---
MCA6_ARATH/3-366-----------------------------------KKALLI..GIN......YV....GTKA..........ELRGC---
MCA1_ARATH/80-362-----------------------------------KRAVIC..GIS......YR.....FSR...H......ELKGC---
MCA2_ARATH/116-414-----------------------------------KRAVIV..GVS......YK....NTKD..........ELKGC---
MCA1_SCHPO/130-422-----------------------------------RKALLI..GIN......YL.....NTQ...N......ELQGC---
MCA1_YARLI/168-458-----------------------------------KKALLI..GCN......YI....GSKN..........ALRGC---
MCA1_DEBHA/146-437-----------------------------------KKALLV..GIN......YT.....GSK...N......QLRGC---
MCA1_ASHGO/154-449-----------------------------------RKALLI..GIN.....YFN....SSA...........ELRGC---
MCA1_KLULA/138-430-----------------------------------RKALLI..GIN......YF.....GSA...N......ELRGC---
MCA1_CANGA/98-389-----------------------------------RKALLI..GIN......YI.....GSK...N......ALRGC---
B5VS82_YEAS6/157-450-----------------------------------RKALII..GIN......YI.....GSK...N......QLRGC---
Q386I9_TRYB2/84-341-----------------------------------.RALFI..GID......YK....GTPA..........ELRGC---
Q38D34_TRYB2/63-322-----------------------------------.KALFI..GIN......YT....GSSA..........QLGGC---
Q8T8E6_9TRYP/84-343-----------------------------------.RALFI..GIN......YY.....GTS...A......ALSGC---

PF14538

W1QFK7_OGAPD/56-210--------------------------------KKTTTAALVMCLNLGIPPPDI....QKPAD...YPVLEAFVDPTT...
L8WVZ0_THACA/73-224--------------------------------LRTARAALVVCLNIGVDPPDV....VKTQP...CATLECWVDPFS...
A2EZ34_TRIVA/89-236--------------------------------.KVDCVYLMCSQSNLFPQPDSDY..FSRKP.....MLYMWRNMSN...
Q6C6R4_YARLI/86-238--------------------------------QRTVSAAIVVCLNLGVDPPDV....IKTDP...CSRLEAWVDPQT...
M2WI96_DOTSN/172-328--------------------------------LKTVSALLAVCLNVGVDPPDV....IKTNP...CARLECWVDPVPPDS
K2S4T3_MACPH/104-258--------------------------------LKTVSAVLALCLNIGVDPPDV....IKTNP...CAKLECWIDPTV...
C4LXC3_ENTHI/42-194--------------------------------VRTPHLIICCCLNIGTEPPGY....KKPKV...SSNTFGWINTKE...
T1G0Q6_HELRO/62-216--------------------------------MKTVSVALVLCLNIGVDPPDT....VKISP...CARQQCWIGLLDVNG
B0CNS4_LACBS/34-185--------------------------------LKTATAALVLCLNIDVDPPDI....IKTNP...CANLECWVDPHT...
F0ZAV4_DICPU/115-266--------------------------------MKTVSVALVLCLNIGVDPPDV....IKTYP...CARMECWIDPAS...
U9UGJ5_RHIID/52-203--------------------------------LKTVSGALVLCLNIGVDPPDV....VKPSP...CAKLECWVDPFA...
Q5KIS3_CRYNJ/92-243--------------------------------LKTVTAGLFICLNLGVDPPDI....VKTNP...CAKTECWIDPTQ...
B0WBU4_CULQU/30-181--------------------------------......LTSAHLNTAIQT.......VDVAGWELTERTNAWINLLC...
A5DWK2_LODEL/143-295--------------------------------QKTISAVLVLCLNLGVDPPDV....MKTYP...CAKFEAWCDPTT...
G0VGR8_NAUCC/79-231--------------------------------QKTVSAALLLCLNLGVDPPDL....VKTHP...CARMESWVDPLN...
I3J5N7_ORENI/57-208--------------------------------MKTVSVALVLCLNVGVDPPDV....VKTSP...CARLECWIDPLS...
A2DYM2_TRIVA/68-215--------------------------------HQVACAYLLCSSSIYFPPPDSEY..FTDKP.....TIYMWRNMSK...
D8TLK8_VOLCA/11-162--------------------------------LKTTSVALVLCLNIGVDPPDV....IKISP...CARLECWVDPMS...
G4M000_SCHMA/43-194--------------------------------IKTLTVALVICLNIDIDPPDV....QKIPP...FSRVEAWVDPTDANS
C1MUE6_MICPC/45-196--------------------------------MKTTSVALVLCLNIGVDPPDV....LKISP...CARMQCWINPLS...
Q387I9_TRYB2/89-240--------------------------------.....LLLILCLNNGNDPPDF....SRIDP...CARLECWEEPYI...
C4M2F5_ENTHI/38-189--------------------------------IKTIHLILTLCLNIGTDSPDQ....IKQKD...SASKECWIDTAG...
G4TT65_PIRID/72-223--------------------------------LKTGNGAIVVCLNLDVDPPDV....VKTQP...CAVLEGWVDPRK...
G0NWW0_CAEBE/64-218--------------------------------LRTASVAIVMCLHLGVDPPEAPS..RKDAP....ARLLSWVDPYK...
A2DJF0_TRIVA/83-228--------------------------------VPEGVHIHLNTLTRLIPG..........KP.QNRKFIHTWEDLSV...
K3WJU9_PYTUL/84-235--------------------------------MKTMDVGLVMCLNIGTDPPDI....VKSSP...CARKECWVEPSS...
A2G590_TRIVA/30-180--------------------------------TKTKAALCLLCLFDGLHTPTIRR..LSRKPRLICNKPLLTFDPTV...
B8M6V6_TALSN/189-342--------------------------------LKTVSAALAICLNIGVDPPDV....VKTNP...CAKLECWVDPTS...
A2FJN8_TRIVA/41-191--------------------------------VKTKGAICFLCLFDGLRTPTIRR..LSRKPRLICNRPLLTFDPSV...
A2DLR3_TRIVA/97-242--------------------------------..IQSVILITTKTYQFSENVSEY..LKDTP.....IIFGWQNIYQ...
E5SIN8_TRISP/44-195--------------------------------MKTVSVALVLCLNIGIDPPDT....VKPKP...CARTECWIDPQC...
I1G727_AMPQE/53-204--------------------------------LKTWSVALALCLNIGVDPPDV....VKTTP...CARKECWIDPLS...
U1MN31_ASCSU/95-246--------------------------------MKTVSVALVLCLNIGVDPPDV....QKPNP...CARQECWIDPHG...
I1L744_SOYBN/123-274--------------------------------MKTGCVALVLCLNISVDPPDV....IKISP...CARMECWIDPFS...
E4XFS5_OIKDI/48-228--------------------------------FKARGIITCLCLNIDVDPEDWREDLAKDVP...VARREGNINAWD...
D2VMD1_NAEGR/144-294--------------------------------LKTVHVALVVCLNIGVDPPDV....VKVQP...CAKLECWVDPQT...
A9TBL2_PHYPA/91-242--------------------------------MKTGWVALCMCLNIGVDPPDV....IKISP...CARLECWIDPFS...
B7PLB3_IXOSC/92-247--------------------------------MKTVSVALVMCLNIGVDPPDV....VKTQP...CARLQCWLGEDAGIR
A0A0D2USM0_CAPO3/727-878--------------------------------MKTVCVALVLCLNIGVDPPDI....VKTSP...CARLECWMDPFS...
B8CBK6_THAPS/256-409--------------------------------MKTVGICLILALNVGTDPPDL....NKPNP...CAKLQCWLDPTS...
A4I1A2_LEIIN/114-279--------------------------------VRITQAVLLMYLHIGSDPPGF....PRVEP...CAKMECWVDPMV...
F4RLY3_MELLP/215-367--------------------------------.RTVCAALFLCLRLGFDPPDV....VKTSP...APKLEAWVDPKM...
K4DUJ2_TRYCR/62-218--------------------------------VKSTQVILFLCLNIGSDPPDY....PRIEP...CARLECWIDPHV...
H1VVG4_COLHI/158-309--------------------------------LKTVSAALAVCLNISVEPPDQ....LKTNP...GAKLEAWTDPTT...
M7XEP3_RHOT1/113-265--------------------------------IRTASAVLVVCLRIGYDPPDI....IKTDP...CAKLECWVDPFA...
A2GCD5_TRIVA/98-247--------------------------------EPIECVVVNVAHLEQFPKPSSDF..AKQIP.....SIFAWQNTNN...
D8RG53_SELML/72-223--------------------------------MKTVSVALVVCLNIGVDPPDI....IKVSP...CARMECWIDPSS...
A2F9H3_TRIVA/31-181--------------------------------NKTKSAICFLCLFDGLRIPSIRR..LVRKPRNICDRPLLTFDPTY...
L0PHF8_PNEJ8/131-282--------------------------------LKTVSAALCICINIGVDPPDI....VKTSP...CAKLECWIDPFS...
RTOR2_ARATH/94-246--------------------------------MKTGCVALVMCLHITVDPPDV....IKISP...CARLECWIDPFS...
M5E8T5_MALS4/58-209--------------------------------LRTVTAALVMCLNIGVDPPDV....SKTNP...CSKLICWMDPES...
B3RPQ9_TRIAD/43-194--------------------------------MKTVSVALVLCLNVGVDPPDL....IKPTP...CARLECWLDPLT...
I4Y9Q8_WALMC/76-227--------------------------------LKTITCAIVLCLNLGVDPPDV....VKTEP...CAVLETWVDPTN...
A2E4G0_TRIVA/101-242--------------------------------.....VIFSMTRPIQYKLLQSDY..INSRP.....PIFAWSLSTS...
A0A068XPC4_HYMMI/269-417--------------------------------IKTINVALVLCLNIEIDPPDV....QKIPP...YSRVEAWVDPAD...
U4LGP0_PYROM/223-374--------------------------------LKTVSAALVLCLNLGVDPPDI....VKTNP...CAKLECWVDTLS...
A2F8U1_TRIVA/65-210--------------------------------..TTQGIVVMCIPNLLQPPHL....RGTNS......VYCWSKTST...
D8T9J0_SELML/50-197--------------------------------MKTGCVALVLCLNIGIDPPDV....IKISP...CARMECWIEPSA...
A9V5A2_MONBE/628-777--------------------------------SKTLTLGLILCLNIGVTPPDV....VRTHP...CAKLEAWIDPEE...
F0XXV0_AURAN/12-164--------------------------------MKTVSVALVLCLNIGTDPPDA....VAASP...RARRECWLEPFA...
A2E336_TRIVA/54-202--------------------------------.SKSSIFIVLPFLEQTQENQTEY..CKLYP.....FYVYWIQISN...
B4R5C8_DROSI/214-365--------------------------------MKTASVALVLCLNIGVDPPDV....VKIQP...CSRLECWIDPSS...
A2EU18_TRIVA/81-227--------------------------------LGTI.VYMISSRNQIVQQTES....LHNKK.....LIMAWSNIKN...
A2DYB3_TRIVA/12-162--------------------------------NKTKAVLSFLCLFDGLRNPSIRR..LVRKPRTVIQRPLLTFDPTY...
S2KE38_MUCC1/106-257--------------------------------IKTVSGLLVVCLNIGTDPPDI....VKTNP...CAKLECWIDPFL...
G7E3R0_MIXOS/173-325--------------------------------LKTAVASLLLCLRIGFDPPDA....VKTDP...CAKTECWIDPFS...

PF03415

Q8A866_BACTN/37-399-----------------------------------VYIAGDN..SLSRFASEDLNEMIEGMQSVDDNHNNLLVYMDK-..
Q9WZB1_THEMA/121-462-----------------------------------VWMAADN..NLYYYSEDDLSEMRNASGSV.....SVVVVYDG-I.
Q8XM44_CLOPE/59-508-----------------------------------VYADCDN..NLEEYILNDIEEMKEGYKNNPNL..NIIVLVDR-IP
Q9X1S5_THEMA/586-937-----------------------------------VWMCADN..NLESFALNDLSEMLNSNENV.....SVVVIFDG-F.
Q9WYY6_THEMA/5-301-----------------------------------SWI...............................NVFALVDY-R.
Q8TIY6_METAC/66-593-----------------------------------VYMVGSDLESSNGYASKDIFEIIDGASMLNGNETEILIAYGG-AA

PF12770

A0LJ53_SYNFM/581-921-----------------------SS-------------------------AK...V--------------LLVVPTG...
A0LQE8_SYNFM/635-947-----------------------AG-------------------------AT...T--------------LLLSLDG...
A1BCK0_CHLPD/513-826-----------------------MG-------------------------IADDAE--------------LVWFPQG...
A1BEL3_CHLPD/43-361-----------------------QA-------------------------GQSILP--------------IVIESDI...
A1BEL6_CHLPD/46-364-----------------------QA-------------------------GTGILP--------------LVIASDD...
A4HBL7_LEIBR/1053-1432-----------------------QL-------------------------LFGDGM--------------ITVVPSG...
A8L4T6_FRASN/741-1051-----------------------AP-------------------------YR...R--------------AVLMPGG...
A9WBC0_CHLAA/673-929-----------------------LP-------------------------IPVEGK--------------LLIAPCA...
A9WER9_CHLAA/54-394-----------------------QP-------------------------LR..LR--------------LALDPQD...
A9WF91_CHLAA/60-360-----------------------RP-------------------------LPIRFR--------------LFIAPSA...
B0C874_ACAM1/207-507-----------------------KK-------------------------ID...T--------------IIFSMDA...
B2IXC0_NOSP7/1396-1691-----------------------RE-------------------------IN...N--------------LVFLPDM...
B2IZZ4_NOSP7/695-973-----------------------KD-------------------------IR...A--------------LTIVPDD...
B2JAK0_NOSP7/526-830-----------------------LK-------------------------AN...R--------------IAIVTDN...
B2JAM9_NOSP7/866-1190-----------------------LG-------------------------NK...R--------------LLIVGDG...
B4JKU3_DROGR/1402-1700-----------------------VS-------------------------RQGRRE--------------LILVLDS...
C3Z401_BRAFL/1278-1602-----------------------PK-------------------------SPA.GQ--------------LVLVLDG...
F0SR63_RUBBR/137-574-----------------------DS-------------------------VR...Q--------------VVVLPSP...
Q01RE6_SOLUE/865-1136-----------------------EH-------------------------AR...R--------------IWIEPDD...
Q024J7_SOLUE/541-814-----------------------PA-------------------------GS...R--------------VILTPDG...
Q025F1_SOLUE/607-877-----------------------RG-------------------------KS...T--------------IVVVPDG...
Q028B5_SOLUE/667-935-----------------------RG-------------------------KS...T--------------VVIAPDG...
Q02DA1_SOLUE/510-786-----------------------DP-------------------------SR...T--------------LVIEPDG...
Q10YT7_TRIEI/1003-1309-----------------------GS-------------------------QK...Q--------------ILISPDS...
Q10YU6_TRIEI/544-838-----------------------SQ-------------------------IK...T--------------LVFVLEG...
Q112V9_TRIEI/62-390-----------------------DA-------------------------.....N--------------LGIILEINEE
Q113D1_TRIEI/130-430-----------------------QE-------------------------RQHNFS--------------YLIINDR...
Q113U8_TRIEI/3002-3297-----------------------AN-------------------------ID...T--------------LLFSMSE...
Q115J8_TRIEI/1466-1777-----------------------..-------------------------CQ...R--------------LTLIPHS...
Q117G6_TRIEI/881-1206-----------------------GS-------------------------KE...Q--------------ILISPDS...
Q119J2_TRIEI/1474-1770-----------------------YN-------------------------IN...M--------------IVFSMDS...
Q16H64_AEDAE/1315-1614-----------------------TS-------------------------RIGRRE--------------LILVLEK...
Q2G6U6_NOVAD/692-1020-----------------------PQ-------------------------TR...H--------------LVFEPDG...
Q2S6G2_SALRD/540-844-----------------------PD-------------------------GQ...P--------------LTVIPDG...
Q2W535_MAGSA/875-1218-----------------------GG-------------------------RT...K--------------VYIIPDG...
Q38C46_TRYB2/1044-1397-----------------------RL-------------------------LAKNGV--------------VTIIPTD...
Q3AQG5_CHLCH/44-362-----------------------RA-------------------------GQHIVP--------------LLLSSND...
Q5LLA3_RUEPO/680-970-----------------------AR-------------------------SREHDK--------------LFVIFTSM..
Q7NCT1_GLOVI/600-923-----------------------LQ-------------------------AK...H--------------LLIAPDG...
Q7NF67_GLOVI/550-854-----------------------GG-------------------------RR...R--------------LLVSPDG...
Q7NFD7_GLOVI/666-979-----------------------GG-------------------------VK...H--------------LLLSPDG...
Q7NIF7_GLOVI/691-997-----------------------GD-------------------------VH...T--------------LWIAPDA...
Q7NJE3_GLOVI/660-988-----------------------PG-------------------------VK...H--------------LFLAPDG...
Q7NLR0_GLOVI/653-961-----------------------GN-------------------------TR...Q--------------ILISPDG...
Q7NVB0_CHRVO/67-386-----------------------NS-------------------------YT...Q--------------LRLVLSA...
Q82I85_STRAW/1175-1481-----------------------GR-------------------------VP...R--------------LVLVPMG...
Q82L10_STRAW/969-1256-----------------------AP-------------------------WP...R--------------LWWSPSG...
Q8DGG5_THEEB/541-835-----------------------GN-------------------------AT...H--------------LLIAPDG...
Q8DH74_THEEB/570-891-----------------------EG-------------------------ST...H--------------LLVAPDG...
Q8DHI1_THEEB/67-394-----------------------HT-------------------------YE...N--------------LVISLGT...
Q8DIE5_THEEB/1127-1420-----------------------QG-------------------------IE...T--------------LVFVLDS...
Q8YZU5_NOSS1/56-340-----------------------QR-------------------------IK...T--------------LVFIQDG...
TTC28_HUMAN/1390-1713-----------------------PV-------------------------GRH.RQ--------------LILVLEG...

PF03568

Q5KMS4_CRYNJ/1710-2122..IWTFD................AA-------------------------VEELET--------------IVKASNE---
A8PX94_MALGO/1441-1824.DVLHVE................TV-------------------------MTELRQ--------------IIHSSNV---
M7XLD2_RHOT1/1703-2100.DAFTFD................VA-------------------------MNELQD--------------IIERNNS---
U5HB45_USTV1/1850-2253.EGLSYA................QA-------------------------SAELAD--------------IVARSNS---
F4RLY9_MELLP/91-479..LFTLS................TA-------------------------LQELQN--------------IVSCSNA---
T1IUX7_STRMM/1624-1980.......................TF-------------------------LEEFER--------------INEANRD---
A7RYA6_NEMVE/1651-2034CEAASKAVMDLC......KLFQGSV-------------------------DESFAD--------------VLRDSAE---
T1FT05_HELRO/413-770.......................TL-------------------------LEQFDW--------------LLKENMN---
W4Y9R2_STRPU/1031-1383.......................GM-------------------------VNTLER--------------ILAESKE---
G3N6G2_GASAC/1731-2077.......................WM-------------------------VREMES--------------IQVEQKL---
H3DAQ7_TETNG/1711-2057.......................WM-------------------------VQEMDE--------------ILVKQKV---
I3KSG7_ORENI/1715-2061.......................QL-------------------------VQEMDS--------------ILVEQKV---
H2L8K9_ORYLA/1692-2038.......................QL-------------------------LQEMDS--------------ILAEQKV---
M3ZIW2_XIPMA/1768-2114.......................WL-------------------------VQEMDS--------------ILVEQKV---
ESPL1_MOUSE/1716-2065.......................AV-------------------------LKEFDA--------------IQKDQKE---
F7BUI1_CALJA/1724-2073.......................SA-------------------------LSEFDA--------------IQKAQKE---
G3VPI8_SARHA/1713-2063.......................LA-------------------------LGEFDA--------------IQKEQKE---
U3IXX7_ANAPL/1332-1679.......................SV-------------------------LSDFDT--------------IQKEQKE---
G1KFP0_ANOCA/1819-2167.......................AA-------------------------LSELDA--------------ILEKQKE---
H3B3H1_LATCH/1699-2055.......................SL-------------------------LCKFDS--------------FLEEQKT---
F6VXN8_XENTR/1732-2080.......................ST-------------------------LQEFDE--------------IQKQQKA---
Q6ZHH8_ORYSJ/455-870DNLMRATDKNWQCP..WGYTIIDYV-------------------------APTFRK--------------ILEENFI---
W5GJD2_WHEAT/891-1304DNPTRASDKNWKCP..WSCTIIDYV-------------------------APTFRK--------------LLEDNFR---
K3Z105_SETIT/1078-1484GNPIGVLDKKWQCP..WGYAITDYV-------------------------APTFKK--------------ILDENFV---
C5XYE8_SORBI/457-870GNPTRVLDKKWQCP..WGYGITDYV-------------------------APIFRN--------------ILEENFM---
C5XSY3_SORBI/1425-1832GNPTRVLDKKWQCP..WGYGITDDV-------------------------APIFRN--------------ILEENFM---
K3Y3B2_SETIT/1404-1817GNRMSVSDKKWQCP..WGYAITDHV-------------------------APTFRS--------------ILEENFM---
M0UBW7_MUSAM/65-479SDADTGSIKHWHCP..WGYTVIDCI-------------------------LPSYKQ--------------LLEENFL---
ESP1_ARATH/1641-2060TEATQVKSLKGPWLCPWGTTVVDEV-------------------------APAFKS--------------ILEESHS---
M4DS49_BRARP/1599-2019TEATQVKNLERRWLCPWGSTVVDDV-------------------------APAFKS--------------ILEESHI---
B9GZR1_POPTR/1674-2094GEFLVSNNLDKHWHCPWGSTVVDDV-------------------------APTFRF--------------ILEENY.---
B9SSN4_RICCO/1627-2045EEFPESNDLDKHWHCPWGFTVIDEV-------------------------SPAFKL--------------ILEENY.---
I1MDQ8_SOYBN/1648-2063GTSPKCEEHSEKWHCPWGFTVVDDV-------------------------APTFKT--------------ILEENYL---
K4B224_SOLLC/1600-2023SFPFEVKDKHWHCP..WVSSVIDDV-------------------------APVFRD--------------ILENNY.---
W1NKX2_AMBTC/1-423GTISNNNGSSKEWSCPWNRNVLDDV-------------------------AAQFRV--------------ILEENF.---
K7H1P7_CAEJA/245-604.......................EL-------------------------MDKFTY--------------LLEEDER---
E3LM18_CAERE/731-1090.......................EL-------------------------MDKFTF--------------MLEEDER---
G5ED39_CAEEL/727-1081.......................EL-------------------------MDKFTF--------------LLDEDEM---
Q23491_CAEEL/749-1101.......................EV-------------------------MDKFTY--------------LLEEDRQ---
S3CR95_OPHP1/1758-2208..VFNFQ................QG-------------------------RAELLE--------------IVKAIND---
F0XAD9_GROCL/1636-2054..VFSFQ................QG-------------------------RSELLE--------------IIAATNA---
G2R9B0_THITE/1619-2058..VFDFQ................QG-------------------------RAELLE--------------IIKLVNK---
Q2H6Q9_CHAGB/1612-2026..AFDFQ................QG-------------------------RSELLE--------------IIKLINK---
G0SHM3_CHATD/1723-2150..VFDFH................TG-------------------------RAELLE--------------IIKEINR---
G4UQF5_NEUT9/1626-2085..VFNYQ................QG-------------------------RAELLE--------------IIRLANE---
G4N8I2_MAGO7/1627-2057..SFNYQ................TG-------------------------RAELLE--------------IIELANA---
J3P7L5_GAGT3/1606-2054..SFNYH................QG-------------------------RAELQE--------------IIGLADG---
R8BFS3_TOGMI/72-487..IFNFQ................QG-------------------------RTEILE--------------VIRLANE---
N4UZ87_COLOR/1637-2043..LFDFQ................HG-------------------------YEELMD--------------IIDATNE---
G2X6M8_VERDV/1704-2113..VFDFE................QG-------------------------HGELLE--------------VIRLINE---
G0RRT6_HYPJQ/1566-1971..VFNFE................HG-------------------------REELLE--------------LIKLANE---
M1WFQ9_CLAP2/1438-1889..VFNFE................HG-------------------------REELID--------------IIRLANE---
J5K578_BEAB2/1584-1996..VYNFE................HG-------------------------KEELLD--------------IIELANE---
C7YYU1_NECH7/1580-1992..VFNFE................HG-------------------------REEMLE--------------IIRLANE---
M7T4Q8_EUTLA/44-499..ILSFQ................DG-------------------------RSELLD--------------IIKSANR---
L8G205_PSED2/1652-2056..VFGFD................QG-------------------------KAELHE--------------IIDLANA---
N1JFH1_BLUG1/1598-2001..VFGFE................QG-------------------------RAELRE--------------IVRLANE---
K1X2E6_MARBU/1659-2061..VFGFE................QG-------------------------HAELRD--------------IIDMANE---
S3D029_GLAL2/1639-2043..VFGFE................QG-------------------------RCELQE--------------IIDLANE---
M7TX51_BOTF1/1640-2041..VFGFE................QG-------------------------KSELIN--------------IIDLAKA---
BIMB_EMENI/1609-2004..QFTFE................DG-------------------------RDEMKE--------------LIRLANE---
Q2USV7_ASPOR/1630-2030..QFTFD................DG-------------------------REEMQE--------------LIKLANE---
G7XGU8_ASPKW/1627-2026..QYTFE................DG-------------------------KGDMQE--------------LIRLANE---
S8BGE7_PENO1/1622-2018..QFTFE................DG-------------------------KEEMRE--------------LIKLANQ---
B6GZP8_PENRW/1602-1998..QFTFE................DG-------------------------KEEMQE--------------LIKLANE---
Q4WUU6_ASPFU/1638-2039..QFTFE................DG-------------------------RREMQE--------------IIRLANE---
B6QNB5_TALMQ/1619-2016..DFTFD................WG-------------------------KNEMKE--------------IIALANA---
V5GCB2_BYSSN/1684-2084..EFTFD................EG-------------------------KRELQD--------------IIKLANI---
F0UL09_AJEC8/1642-2044..EFDFG................EG-------------------------KKELLE--------------IIRLANE---
C5FSW7_ARTOC/1655-2058..TFSFQ................EG-------------------------KAELLE--------------IIRLANA---
H6C6Q4_EXODN/1587-1987..DLDFD................KA-------------------------KAELQD--------------IIAQANS---
U1G8A9_ENDPU/1638-2036..PFRFH................TA-------------------------YSELGD--------------IISNANL---
K2R7J5_MACPH/1619-2043..IFGFE................EG-------------------------KAELRE--------------IIDLSNF---
R7YNT5_CONA1/1696-2117..VFDFT................AG-------------------------KVELNE--------------IIELSDF---
E4ZTB4_LEPMJ/1652-2063..EFSFE................DG-------------------------KRDFDE--------------IIELSDF---
N1QAI8_PSEFD/1492-1912..QFHFN................AG-------------------------RAELQD--------------IIQLSDY---
N1QHR1_SPHMS/1187-1599..LFDFE................AG-------------------------KAELRE--------------IIELSNY---
N1PZ16_DOTSN/1513-1936..LFLFE................DG-------------------------KSELEE--------------IINLSNF---
D5GKQ4_TUBMM/1633-2033..RWEYE................SM-------------------------LEELNE--------------IVKGANI---
U4LG69_PYROM/1616-2019..LIEYD................AA-------------------------IKELRD--------------IIEKSNQ---
S8C8B1_DACHA/1639-2040..QFGFE................KG-------------------------LASFRD--------------IVNRANV---
Q6CCJ0_YARLI/1210-1588..PFLFS................DG-------------------------LDELKS--------------IISESDT---
S9X830_SCHCR/1385-1771..ILSFE................KA-------------------------QSAFEK--------------IIGKSNE---
CUT1_SCHPO/1383-1770..ILVFT................KA-------------------------QTELFR--------------IISKSNQ---
B6K0I6_SCHJY/1359-1747..IFLFQ................SA-------------------------YDELQS--------------IIDRSNQ---
M7PDE3_PNEMU/1489-1882..TLTYD................NV-------------------------FNELNE--------------IIFRSNE---
G8BT64_TETPH/1165-1563..CYTFQ................DA-------------------------SDELNS--------------IIKASNR---
I2H0Y5_TETBL/1280-1677..SISFK................QF-------------------------KNELDT--------------IIKLNND---
S6EFD3_ZYGB2/1145-1542..KLTFG................EA-------------------------KEELES--------------IIQENNR---
C5DU01_ZYGRC/1141-1538..RMTFY................EA-------------------------RNELIS--------------IVQESNA---
G8ZWZ1_TORDC/1158-1555..TLTFD................DA-------------------------RRELFN--------------IIEKSNA---
G0WDN6_NAUDC/1191-1589..YLSFK................DA-------------------------SMELQN--------------IIEESNR---
G0VFB3_NAUCC/1164-1562..SLTFV................EA-------------------------VKELAY--------------IIDESNS---
H2B1L5_KAZAF/1161-1559..HLSFK................EA-------------------------RKELQN--------------IIDESDK---
ESP1_YEAST/1175-1571..HLSFP................EA-------------------------TKKLLS--------------IINESNQ---
J7RG90_KAZNA/1160-1562..HLSFS................AA-------------------------LEEMNT--------------IVEENNK---
Q75EJ0_ASHGO/1152-1552..TLTFA................LL-------------------------MEELND--------------IIEKNNR---
C5DHM1_LACTC/1178-1575..ELSFD................NA-------------------------VNELTQ--------------IIKESNK---
Q6CQQ7_KLULA/1118-1516..VLGFE................AA-------------------------LDELNH--------------IISSNNC---
Q6FTE1_CANGA/1151-1548..SLTFQ................QA-------------------------SESLQK--------------IINDSNE---
K0K8V1_WICCF/1175-1568..SFSFT................DA-------------------------MRDLNQ--------------IIQESNA---
A5DNR9_PICGU/1178-1576...VSID................QV-------------------------FSKLQA--------------IVEASNK---
A3GFF5_PICST/1168-1555..VISFQ................EM-------------------------ETQFKE--------------IIRQSDL---
Q6BTB7_DEBHA/1338-1753..GLSFI................EM-------------------------TNSLKS--------------IIKQSDI---
Q5A8X8_CANAL/1101-1536...LGFQ................QL-------------------------MQNFEK--------------IIDDSNL---
C5MEH0_CANTT/925-1303...MNFE................TM-------------------------KKELEN--------------IIEESNL---
M3HH45_CANMX/1423-1797...KTFD................VI-------------------------KNELEH--------------VIRESNL---
G8B5X7_CANPC/1052-1424..TLRFD................EM-------------------------KREFKR--------------IFQENRK---
A5DVQ7_LODEL/1109-1530..VMNFE................RL-------------------------KQEFNR--------------IFEENRK---
G3AGZ6_SPAPN/1149-1535..IVGFK................EI-------------------------KARFAS--------------IIQESDQ---
G8YBL5_PICSO/1309-1719..LTSFG................EI-------------------------KSYLKS--------------IISRSNS---
C4XY11_CLAL4/1177-1564..FKSFA................DI-------------------------SACLQR--------------IIEDSNG---
G3B782_CANTC/1213-1609..SLSFT................GA-------------------------LDKLNA--------------IIKRSDD---
W1QIM9_OGAPD/1167-1527....SFG................SA-------------------------VQELEA--------------IIQESDR---
C4QYS2_PICPG/1259-1619....SWK................VF-------------------------KDRFND--------------IIEASAQ---
K5WME3_PHACS/1732-2136.EFLTFD................DA-------------------------IAELKE--------------IIRLSDE---
M2R2K9_CERS8/1618-2024.QHLTFD................DA-------------------------LEELKE--------------IIRLSDE---
F8PLA9_SERL3/1278-1688.EHLTFD................DA-------------------------LNELKE--------------IIRLSDQ---
S8E105_FOMPI/1678-2083.ERLTFA................DA-------------------------MDELKE--------------IMRLNDE---
A8NBE9_COPC7/1839-2276EEHLTFE................DA-------------------------MQEFND--------------IIRLSDE---
B0E1W0_LACBS/104-540EDHLGFD................DA-------------------------IGELRE--------------IVRLSDE---
D8Q1W5_SCHCM/1450-1878EEYLSFD................DA-------------------------LSEMGE--------------IIRLSNE---
V2X3W8_MONRO/1588-2040EHQLTFE................DA-------------------------IEEFSD--------------IIRLSNE---
J0DCK6_AURST/1634-2046EERLTYH................DA-------------------------MAELAA--------------IIRESNE---
R9AIE1_WALI9/1639-2036..AFTYM................DA-------------------------MNELES--------------VIEESDD---
I4YB88_WALMC/1631-2030..AFTYR................DA-------------------------IDELQS--------------IIEESDK---
G4T5A4_PIRID/1472-1874.EVLPLG................SV-------------------------VKELDD--------------IIASSVR---

PF01364

KGP83_PORGN/244-595..........TN-----------AS.........................IKAFIH--------------KKYNDGLAAS
D1JG83_9ARCH/891-1295..PMEA....EE-----------TL.........................KESVLD--------------YKIK......
A2U064_9FLAO/401-768..SGSK....DI-----------TG.........................IRDFIK--------------HLYTTN.SSP
Q7MTE2_PORGI/239-573..........TA-----------NA.........................IQQFVK--------------QEYEKEGNDL
D3HWT0_9BACT/400-777..GGTP....DA-----------AA.........................YRRYLK--------------MMYDRA.STA
Q5S3Q9_9FLAO/543-910..TSKQ....DI-----------GA.........................IRNLVR--------------YIYENA.P.E
A9DMD5_9FLAO/555-923..TGNP....DI-----------GA.........................IRNFIK--------------YVYDNA.STV
B0VGA8_CLOAI/228-563..........ST-----------QA.........................IKNYIQ--------------TQYDNPSTRP
B7B5I7_9PORP/382-753..SGTP....DA-----------TA.........................YRRFMK--------------MFYDRQ.TSE
B8FFM0_DESAA/254-600..PATG....DD-----------VS.........................IKDFLT--------------YAYNNW....
A3U7G6_CROAH/540-908..SGQQ....DI-----------SA.........................IRNFVK--------------YVYDNA.SSP
D2QSX9_SPILD/414-786..SGQP....DP-----------TA.........................IRDMVR--------------YFYQQQ.P..
A3HW99_9BACT/398-769..YGEE....GP-----------TA.........................LFEFLR--------------TYYPAH.Q..
B0VHP2_CLOAI/234-563..........TA-----------AN.........................IKTYIQ--------------NQYNLNDGLM
A8ZUB1_DESOH/278-656.YTGRN....DA-----------ET.........................LRNFII--------------YAYENLNTEY
B0VIM2_CLOAI/182-528..........TV-----------QD.........................IKNFIA--------------NHYQTYKCDY
Q2Z0E1_9BACT/643-1013..WGLV....DP-----------SA.........................IRDYLK--------------YLSDNSVVPP
B3QXR8_CHLT3/734-1131..YGIK....SP-----------HA.........................IRDFLD--------------YAYHEWAVAP
C2MCN4_9PORP/405-781..GGTP....DA-----------TA.........................YRLMLW--------------DYKRRY.EAE
A4A325_9PLAN/24-399..........SK-----------ER.........................IRAAIR--------------ETAKSGS...
A7NR84_ROSCS/499-867..DGQV....DP-----------DA.........................IRAFLQ--------------FARPQA....
Q11Q36_CYTH3/558-932..SGKK....DL-----------TA.........................IRDFVK--------------MVYDRG.S.A
Q7MX16_PORGI/272-637NATSYI....NE-----------TK.........................LKNFIR--------------SVYNQSNAKR
A0B5K7_METTP/796-1154..PGEV....EE-----------WL.........................RESVGE--------------KKLR......
D0MH89_RHOM4/586-975..GGVP....DM-----------RA.........................VRDYLK--------------FLYDRA.PDE
A8UH97_9FLAO/539-910..TGSQ....DI-----------AA.........................LRNFVK--------------YVYDNA.SIP
B8KYL6_9GAMM/364-704..NGIH....AP-----------DA.........................LRRFVQ--------------YARSHWQKPA
B8FIK5_DESAA/1139-1542...GLD....SQ-----------EK.........................IRNCIR--------------DYVENQGTTF
Q11US7_CYTH3/392-767..YGEY....SS-----------IA.........................IKRYCS--------------EIIQVN.S..
C6W101_DYAFD/326-680..AGQP....GP-----------QG.........................IRNAIR--------------WLCDHG.N..
A5FJM8_FLAJ1/544-914..SGKQ....DI-----------AA.........................IRNCIR--------------YIYNNA.SSS
Q7UG73_RHOBA/51-444..........PA-----------DN.........................ASDTHQ--------------QIWNVGGADT
A3J247_9FLAO/540-919..SGKQ....DV-----------AA.........................IRNFIK--------------YVYWNA.SAS
A9WIM0_CHLAA/500-869..GGEP....DP-----------RA.........................IRDFLR--------------YAAATWSPAP
B0VHE7_CLOAI/227-554..........TN-----------TN.........................IKSYIQ--------------TAYNNPATRP
C6VT06_DYAFD/394-758..YGEP....SP-----------VG.........................IKRFMS--------------YMLSD..SK.
C6X3N8_FLAB3/546-921..SGSK....DI-----------TA.........................IRDFTT--------------RL.....NTT
A0LQH1_SYNFM/790-1132..WGIV....TP-----------YA.........................IRDFLA--------------QASSWNPAPK
A1ZVJ9_9BACT/406-774..SGKQ....DV-----------TA.........................LRDFAR--------------MLYLRD.S..
B0VHF1_CLOAI/214-595..QGID....TQ-----------DK.........................LRNYII--------------SLYTTN....
B0VIE7_CLOAI/193-598..TGTD....NA-----------EK.........................LRNYLQ--------------NTYAST....
C6W3P4_DYAFD/414-806..YGEP....SP-----------IA.........................IRRFVD--------------FMISDLKKDN
B2RGP6_PORG3/408-787..GGTP....DA-----------TA.........................YRLFAK--------------MFYDRW.KAN
D2QJ99_SPILD/409-770..YGER....SP-----------LA.........................IQQFMN--------------QMRQQN.P..
A9B5Q8_HERA2/466-850..SGNV....DP-----------LA.........................IRDFMR--------------YLASTWPQAP
D2QFF3_SPILD/397-745..YGEK....SP-----------LA.........................LRRFAD--------------YLVANT.A..
B0VH03_CLOAI/589-939..GGHI....DP-----------AA.........................IRLALK--------------YYYFNL...P
D2R2P5_PIRSD/21-411..........SA-----------AE.........................IRTAVR--------------RVAATSLEQG
C6W0Z3_DYAFD/393-758..SGSS....DI-----------TA.........................IRDFAR--------------NLYQKT.P..
A3XQP5_LEEBM/552-929..SGKQ....DI-----------GA.........................IRNLVR--------------YVYENA.SSA
Q2PY26_9BACT/412-780..GGVQ....DL-----------TA.........................IKDMMR--------------MLWSNA.SSP
Q26FX7_FLABB/537-909..EGEQ....DI-----------AA.........................IRNFVK--------------YVYDNA.SSP
B0VJT2_CLOAI/236-566..........TT-----------TS.........................IKNYIQ--------------TKYNNPETRP
C6BTD6_DESAD/56-402..SEAK....VV-----------AG.........................IQSQVA--------------KLNKDGKLMS
D2QE53_SPILD/328-1007CGNGLKA..RDL-----------AE........................LIRNFVK--------------YAYKSW....
A2BK55_HYPBU/159-551GETAPEYNESLA-----------AK.........................IISFLR--------------EAVDAGVNY.
B0VHP1_CLOAI/283-636..........TT-----------TS.........................IKAYMQ--------------NLWNSATSEN
Q1Q1Y4_9BACT/620-970..DGIF....SP-----------QA.........................IRDFLS--------------YTYNNWQEPA
C7PNY3_CHIPD/396-764..SGTP....DP-----------TA.........................IRDFVK--------------MCHDRG.G..
Q6LFY5_PHOPR/224-617..........TQ-----------AQ.........................IKAYIK--------------DAYSNGTM..
B3QVL4_CHLT3/688-1063..GGKQ....DF-----------TA.........................IRDFLK--------------FLYDNA.SSL
A9B187_HERA2/552-907..DGRV....DQ-----------QA.........................IADFIK--------------YAYHNWQAPA
R5M3W7_9BACE/537-910..SGTP....DG-----------TA.........................YRRLMK--------------MLYDRF.PNK
B0VJY1_CLOAI/655-1014..AGIT....GA-----------EP.........................IRDFLR--------------YAYNNW...S
B8G4Y1_CHLAD/584-1054IA........LV-----------KN.........................IRNFEI--------------GRYQTYGSRF
A1ZEG7_9BACT/410-775..YGEY....SP-----------LA.........................IKKFAR--------------YMYDKG.N..
B0VF22_CLOAI/223-583..PGVD....NA-----------EK.........................LRNFII--------------NAYQTWANSS
A0LKV0_SYNFM/924-1265..AGVP....EP-----------NA.........................LRRFLR--------------CARVHSGGAL
A8ZTD5_DESOH/257-648..........TA-----------AE.........................IQAFIQ--------------DAYDTWSIPP
A9B8S0_HERA2/477-840..FGHV....SP-----------MA.........................IRTFLQ--------------HAAATWPSPP
C3JBB2_POREA/421-799..AGTP....DA-----------TA.........................YRLMAK--------------YFYDRW.MAA
C9SW40_VERA1/279-917FRAGSR....DL-----------QE........................VIRRFLK--------------DVRTRW....
C9LI59_9BACT/509-899..SGTP....DV-----------AA.........................YRRYMK--------------MLYDRA.QSN
B5ICF9_ACIB4/214-642PVNGYA....NA-----------TTDPYGLLGGQALPLEKNMIIGYNYTLAKKIIA--------------FLQNESYGSN
Y048_ARCFU/22-377LVSGYS....TE-----------QVYDSYN..............YTLALKIISFLR--------------TVNASY....
A3I371_9BACT/360-725..YGNK....DI-----------TG.........................IRNFIA--------------KIYQES....

PF11713

MARTX_VIBCH/3469-3626-----------------------PV-------------------------VAKAAA--------------NLAGKHA---
A0KHZ7_AERHH/3609-3767-----------------------PV-------------------------AAKAAA--------------SLAGKHP---
Q2KX68_BORA1/2483-2627-----------------------LQ-------------------------ALQSAE--------------RLADKHP---
Q2SAY5_HAHCH/1-160-----------------------DN-------------------------LRSFGR--------------NLYRKHP---
Q7N1Z0_PHOLL/2456-2614-----------------------PI-------------------------AARAAA--------------NLAGKHP---
Q7N726_PHOLL/2997-3151-----------------------PI-------------------------VAKAAL--------------NLASKHR---
Q7VV06_BORPE/2551-2702-----------------------DV-------------------------ATQAAQ--------------ALFHKHA---
Q7VV06_BORPE/2959-3112-----------------------AA-------------------------TARAAA--------------ALHGKHP---
Q7VV06_BORPE/3397-3549-----------------------AL-------------------------TETAAR--------------RLFRKHA---
Q7VV06_BORPE/3808-3959-----------------------TV-------------------------TESAAR--------------RLFRKHA---
Q189K3_PEPD6/575-754-----------------------KI-------------------------SYEAAC--------------NLFAKTP---
Q189K5_PEPD6/577-756-----------------------DI-------------------------SYEATC--------------NLFSKNP---
Q7CGR6_YERPE/772-928-----------------------SL-------------------------SKRVGE--------------IIASYNN---

PF01650

LGMN_HUMAN/29-286----------------------IPD-------------------------EQIVVM--------------MY--DD.IA-
VPED_ARATH/46-316----------------------LKD-------------------------ENIIVF--------------MY--DD.IA-
VPEG_ARATH/59-330----------------------LKE-------------------------ENIVVF--------------MY--DD.IA-
A0CQC7_PARTE/19-285----------------------YNP-------------------------ENVIVF--------------AY--DD.IA-
A2FXM6_TRIVA/13-267----------------------LDK-------------------------DKIILM--------------CY--DD.IV-
O24539_VICNA/53-325----------------------VKE-------------------------ENIVVF--------------MY--DD.IA-
HGLB_SCHMA/37-291----------------------IKP-------------------------EHIITM--------------MY--DD.IA-
HGLB_SCHJA/31-285----------------------VKP-------------------------EHIITF--------------MY--DD.IA-
VPE_VICSA/56-325----------------------SKE-------------------------ENIIVF--------------MY--DD.IA-
A0A080VK93_PSEAI/341-579----------------------ARG-------------------------V.IRLV--------------NH--RDHFG-
Q08BI0_DANRE/27-278----------------------IPD-------------------------EQIVVM--------------IY--DD.IA-
Q0MYV8_EMIHU/33-301----------------------IDP-------------------------DKIITL--------------AV--DD.VA-
Q22P32_TETTS/20-285----------------------FAP-------------------------ENIIVF--------------LY--ND.VA-
Q22P33_TETTS/20-285----------------------FQP-------------------------ENIIVF--------------LY--ND.VA-
D0MXB3_PHYIT/25-298----------------------IPA-------------------------ENVVLM--------------MY--DD.VA-
Q2UVF3_HAECO/29-287----------------------VKP-------------------------DNIIVM--------------MK--DD.IA-
Q4K5F2_PSEF5/335-570----------------------AYG-------------------------Q.IRLV--------------NH--RDHLM-
Q4RED0_TETNG/30-283----------------------IPD-------------------------EQIVVM--------------MY--DD.LA-
Q8P9N6_XANCP/124-392----------------------ARG-------------------------RVITLV--------------NH--PDNLG-
Q6EHZ7_TRIVA/12-258----------------------FDD-------------------------QHITMM--------------AY--DD.IA-
Q6FEB2_ACIAD/229-477----------------------TFG-------------------------RSMMLV--------------NN--PD...-
Q6L4R2_ORYSJ/41-319----------------------VEE-------------------------QNIVVM--------------MY--DD.IA-
Q6NYJ7_DANRE/32-288----------------------IPD-------------------------EQIVVM--------------MY--DD.LA-
Q6PRC7_IXORI/38-293----------------------IPD-------------------------ERIVVM--------------MY--DD.IA-
Q711M2_FASHE/21-278----------------------FAP-------------------------ENIVTI--------------MY--ND.VA-
VPE1_ORYSJ/62-334----------------------VKE-------------------------ENIVVF--------------MY--DD.IA-
Q852T1_TOBAC/49-320----------------------LKD-------------------------ENIIVF--------------MY--DD.IA-
Q88QE3_PSEPK/400-640----------------------ARG-------------------------Q.VTLV--------------NH--RDHMA-
Q949L7_BETVU/51-321----------------------LKD-------------------------ENIIVF--------------MY--DD.IA-
Q9LLQ4_SESIN/54-326----------------------LRD-------------------------ENIIVF--------------MY--DD.IA-
Q9LWZ3_ORYSJ/41-304----------------------LKD-------------------------QNIVVM--------------MY--DD.IA-
Q9SBX2_MAIZE/45-317----------------------LKD-------------------------ENIVVF--------------MY--DD.IA-
Q9SMD0_SOLLC/39-316----------------------LKD-------------------------EHIIVF--------------MY--DD.IA-
Q9XG75_TOBAC/40-306----------------------LKD-------------------------ENIIVF--------------MY--DD.IA-

PF00656

Q7QGM9_ANOGA/35-227----------------------AND-------------------------MKQIKE--------------FC..QH....
DRONC_DROME/196-443----------------------EKD-------------------------SKSLIH--------------LF..QE.LN.
O42284_CHICK/42-279----------------------EVD-------------------------VKEMTK--------------LL..EG.LG.
CAS1A_XENLA/144-382----------------------KVD-------------------------LDGMTK--------------LL..NE.LG.
CASPC_MOUSE/176-415----------------------DTD-------------------------ILNMQE--------------LL..EN.LG.
CASP4_MOUSE/132-369----------------------NFD-------------------------IIGMKG--------------LL..ED.LG.
CASP5_HUMAN/193-430----------------------HYD-------------------------IVGMKR--------------LL..QG.LG.
CASPD_BOVIN/136-373----------------------ALD-------------------------ILGMKQ--------------LL..EG.LG.
CASP1_CANLF/163-400----------------------ELD-------------------------IAGMES--------------LL..EG.LG.
CASP1_FELCA/161-406----------------------DLD-------------------------VAGMRR--------------LL..TD.LG.
CASP1_MOUSE/162-398----------------------QVD-------------------------LREMKL--------------LL..ED.LG.
CASP1_HUMAN/163-400----------------------EVD-------------------------ITGMTM--------------LL..QN.LG.
CASP1_PIG/163-400----------------------DVD-------------------------IRDMKI--------------LL..ED.LG.
Q9I9L7_DANRE/145-379----------------------EKD-------------------------EENMEK--------------LL..KE.LD.
Q9DDJ2_DANRE/174-400----------------------DRD-------------------------EENAEW--------------LL..RS.LG.
Q6NTR7_XENLA/280-494----------------------GND-------------------------ASLLEN--------------TF..KS.LR.
CFLAR_MOUSE/257-480----------------------GND-------------------------TKYLQE--------------TF..TS.LG.
Q6QN97_PIG/259-484----------------------GND-------------------------TDVLRD--------------TF..SS.LG.
CFLAR_HUMAN/252-477----------------------GNE-------------------------TELLRD--------------TF..TS.LG.
Q9NBW3_DROME/38-248----------------------SND-------------------------VNALRK--------------TF..ES.LK.
Q9TZP5_CAEEL/26-261----------------------DKD-------------------------KKKLSK--------------LF..ER.LG.
CASPE_MOUSE/22-256----------------------EVD-------------------------MEALER--------------MF..RY.LK.
CASPE_HUMAN/18-241----------------------EED-------------------------LDALEH--------------MF..RQ.LR.
Q8I749_SUBDO/254-491----------------------HID-------------------------VHNLTQ--------------TF..KY.LR.
CASP2_RAT/200-445----------------------DVD-------------------------HTTLVT--------------LF..KL.LG.
CASP2_CHICK/171-416----------------------DVD-------------------------CASLEL--------------LF..KH.LG.
Q9GV89_HYDVU/93-318----------------------EVD-------------------------VQALNS--------------FF..KGTLG.
Q9IB63_XENLA/144-396----------------------DID-------------------------RDKLAN--------------RM..RS.FH.
CASP9_HUMAN/161-413----------------------NID-------------------------CEKLRR--------------RF..SS.LH.
Q90WU0_CHICK/148-400----------------------DID-------------------------CEKLEK--------------RF..RS.LC.
Q9IB64_XENLA/261-494----------------------AKD-------------------------AEEITR--------------IF..NA.RG.
Q6E5N8_ICTPU/119-362----------------------KLD-------------------------EDSLKE--------------VF..QW.LG.
Q9I8J3_DANRE/238-473----------------------DMD-------------------------KDRLAK--------------LF..SR.MH.
Q6PAD9_XENLA/268-495----------------------DKD-------------------------AGALRD--------------VF..KW.LG.
Q90WU1_CHICK/237-479----------------------HVD-------------------------ADALRK--------------VF..SN.LH.
CASP8_HUMAN/234-476----------------------HLD-------------------------AGALTT--------------TF..EE.LH.
CASP8_MOUSE/236-478----------------------DCD-------------------------KEALSK--------------TF..KE.LH.
Q9Y1U6_PRIPA/173-413----------------------KAD-------------------------VIALKN--------------LF.ISK.LG.
CED3_CAEEL/243-494----------------------KAD-------------------------KDNLTN--------------LF..RC.MG.
Q7QKT2_ANOGA/35-260----------------------EKD-------------------------VKALQA--------------VL..SH.LQ.
Q7PZJ9_ANOGA/20-250----------------------EKD-------------------------LEAVET--------------VL..QR.LK.
Q9GV88_HYDVU/84-316----------------------DVD-------------------------AESLCD--------------LF..LK.LG.
Q7Q1E0_ANOGA/62-291----------------------AID-------------------------CKRLKE--------------TL..EL.FR.
CASP1_SPOFR/61-293----------------------NVD-------------------------SDNLSK--------------VL..KT.LG.
CASP1_DROME/79-313----------------------NVD-------------------------AQELKK--------------AF..EN.LG.
Q7Q4X6_ANOGA/73-309----------------------NVD-------------------------CENLTA--------------SL..KG.LD.
DRICE_DROME/94-328----------------------NVD-------------------------CENLTR--------------VL..KQ.LD.
Q9NHF9_DROME/56-302----------------------ERD-------------------------RDDMEA--------------TL..QG.FG.
Q7Q803_ANOGA/54-306----------------------DAD-------------------------CDNIRQ--------------VL..IY.LQ.
Q7PV92_ANOGA/14-237----------------------SKD-------------------------RTDIST--------------VL..QR.IG.
Q86FL0_ANOST/52-286----------------------DRD-------------------------RDSIGA--------------VL..ES.IG.
Q8I6Y2_GEOCY/158-414----------------------DKD-------------------------AENLYG--------------LF..NW.LG.
Q8ITP3_BRAFL/87-323----------------------DLD-------------------------ANNLYR--------------IF..SK.LG.
O88550_RAT/68-301----------------------DKD-------------------------AEALFK--------------CF..RS.LG.
Q6DCI2_XENLA/78-314----------------------DID-------------------------ARELLR--------------CF..KG.LG.
Q8JIS8_ORYLA/58-285----------------------DND-------------------------AAAAWK--------------SF..MK.LG.
CASP3_XENLA/56-280----------------------DVD-------------------------ALKLHE--------------TF..TG.LG.
O93417_CHICK/53-281----------------------DAD-------------------------AASVRE--------------VF..MK.LG.
Q98UI8_DANRE/48-280----------------------DVD-------------------------AGNVMN--------------VF..RK.LG.
Q8JG42_TAKRU/51-279----------------------DVD-------------------------AANAMK--------------VF..LS.LG.
Q8ITP2_BRAFL/151-396----------------------HVD-------------------------AGNLKV--------------MF..EG.LG.
Q9IB66_XENLA/58-298----------------------NTD-------------------------SMNLNR--------------IL..TD.LG.
Q9I8S9_ONCMY/57-297----------------------NAD-------------------------RSNLVK--------------RF..ED.LN.
O93415_CHICK/57-299----------------------LAD-------------------------RNNLKR--------------SL..TD.LG.
CASP6_MOUSE/28-270----------------------NAD-------------------------RDNLTR--------------RF..SD.LG.
PCP_DICDI/188-404----------------------IND-------------------------VNSFYC--------------AL.....LG.
Q7AKE1_STRCO/9-268----------------------RNN-------------------------LAALAE--------------FF.TSP.QG.
A0A063TRB6_BORBO/552-800----------------------VND-------------------------ANAIAR--------------ELRERT.RG.
Q7NPG1_GLOVI/7-278----------------------LED-------------------------ARKFIE--------------VLKSPS.YG.
Q87Z21_PSESM/2-224----------------------VND-------------------------AVAIAE--------------LLENDG.NGD
Q82I86_STRAW/5-276----------------------VTD-------------------------VEEAAR--------------LV..TELVG.
P74453_SYNY3/40-299----------------------TTD-------------------------RQLLGE--------------VL.TGR.YG.
Q8YS65_NOSS1/4-245----------------------KRD-------------------------AELIQQ--------------FL.IKE.AG.
Q9DDL2_DANRE/323-560----------------------MAD-------------------------VHELTN--------------LL..RQ.LD.
Q98CE0_RHILO/5-237----------------------IHD-------------------------GEAMEA--------------AL..KK.LG.
Q6N0T4_RHOPA/30-250----------------------VSD-------------------------ARELAD--------------DL..KR.AG.
Q89XG2_BRADU/27-247----------------------LND-------------------------ARDVAD--------------EL..KR.DG.
Q89XE4_BRADU/58-278----------------------IND-------------------------ARALSS--------------TL..RK.NG.
Q6NBN5_RHOPA/57-277----------------------IND-------------------------ARLLSA--------------SL..RH.EG.
Q98JS7_RHILO/35-253----------------------RND-------------------------AKLIAN--------------TL..TE.LK.
Q985X8_RHILO/35-256----------------------AND-------------------------AGLIAQ--------------TL..QA.AG.
Q6N5Q1_RHOPA/33-253----------------------AND-------------------------GGLIAQ--------------TL..QA.AG.
Q89KP2_BRADU/86-307----------------------AND-------------------------AGLIAQ--------------TL..QA.AG.
Q89IK1_BRADU/30-253----------------------PHD-------------------------AEDVAS--------------SL..RR.SG.
Q98G71_RHILO/26-252----------------------VND-------------------------ALDIAD--------------KL..RS.IG.
Q6AKF4_DESPS/28-248----------------------VND-------------------------AKDFSR--------------TL..SA.LG.
Q98IJ6_RHILO/11-238----------------------ARD-------------------------AQAMAE--------------RL..QN.LG.
Q89MV1_BRADU/176-400----------------------SKD-------------------------ASLMAE--------------TL..ST.LG.
Q89HT8_BRADU/51-272----------------------DND-------------------------AESMAK--------------FL..NS.AG.
Q89FZ4_BRADU/32-256----------------------AND-------------------------AKGMTE--------------LL..GN.AG.
Q6N329_RHOPA/73-298----------------------VND-------------------------AKAIAA--------------LL..GE.AG.
Q98IJ9_RHILO/30-261----------------------AND-------------------------AHLIAS--------------TL..RN.AG.
Q89HP3_BRADU/336-569----------------------PND-------------------------ARAVAK--------------SL..RD.IG.
Q7RFI8_PLAYO/964-1364----------------------AND-------------------------AYVFSR--------------AL.VKY.FN.
Q74F93_GEOSL/6-270----------------------EAD-------------------------AEDMAA--------------IA.AER..G.
MCA9_ARATH/10-321----------------------IND-------------------------VLAMKE--------------TI.LSR.FG.
MCA8_ARATH/3-378----------------------VND-------------------------VHRMQK--------------CL.IEL.YG.
MCA7_ARATH/3-401----------------------VND-------------------------VHRMHK--------------CL.VDR.FG.
Q70VV0_PICAB/3-415----------------------VND-------------------------VNRMYK--------------CL.VER.YG.
Q9ZSP8_HEVBR/3-415----------------------IND-------------------------VKRMYR--------------CL.VDR.YG.
MCA4_ARATH/3-416----------------------VND-------------------------VRRMYK--------------CL.VER.YG.
MCA5_ARATH/3-408----------------------VND-------------------------VRRVHK--------------SL.VDR.FG.
MCA6_ARATH/3-366----------------------VND-------------------------VRRMRI--------------SL.VER.YG.
MCA1_ARATH/80-362----------------------IND-------------------------AKCMRH--------------LL.INK.FK.
MCA2_ARATH/116-414----------------------IND-------------------------ANCMKF--------------ML.MKR.FQ.
MCA1_SCHPO/130-422----------------------IND-------------------------VMSMSQ--------------LL.IQR.YG.
MCA1_YARLI/168-458----------------------IND-------------------------VHNLQR--------------YL.VQR.AG.
MCA1_DEBHA/146-437----------------------IND-------------------------VKNMSN--------------FL.NQH.FG.
MCA1_ASHGO/154-449----------------------IND-------------------------VQNIKN--------------FL.ISR.YG.
MCA1_KLULA/138-430----------------------IND-------------------------SHNMFN--------------FL.TQR.YG.
MCA1_CANGA/98-389----------------------IND-------------------------AHNIFN--------------YL.TTY.CG.
B5VS82_YEAS6/157-450----------------------IND-------------------------AHNIFN--------------FL.TNG.YG.
Q386I9_TRYB2/84-341----------------------QAD-------------------------AVMMAG--------------TM..EK.IG.
Q38D34_TRYB2/63-322----------------------VND-------------------------VMHMLQ--------------TL..QR.IE.
Q8T8E6_9TRYP/84-343----------------------CND-------------------------VKQMLA--------------TL..QK.KG.

PF14538

W1QFK7_OGAPD/56-210..YSDPKKA.L...........QAI-------------------------GKNLQS..............NY--ESCEG-
L8WVZ0_THACA/73-224M.P..SNKA.L...........EAI-------------------------GRNLQH..............QF--EN...-
A2EZ34_TRIVA/89-236...................ILPSDF-------------------------SAYLQD..............YM--HE.KY-
Q6C6R4_YARLI/86-238ISD..SKKA.T...........EQI-------------------------GKQLQM..............QY--EV...-
M2WI96_DOTSN/172-328S.NQNSNNT.N...........AQI-------------------------GKNLQS..............QY--EN...-
K2S4T3_MACPH/104-258S.TGTSGHTPM...........NNI-------------------------GKALQT..............QY--EQ...-
C4LXC3_ENTHI/42-194.....HKKREI..........GYEI-------------------------TNQLGI..............QY--QR..Y-
T1G0Q6_HELRO/62-216G.N..VQKP.I...........EII-------------------------GAALQK..............QY--ER...-
B0CNS4_LACBS/34-185L.P..AQKA.L...........EAI-------------------------GNNLQH..............QF--EG...-
F0ZAV4_DICPU/115-266Q.P..PQKS.L...........DLI-------------------------GKTLQA..............QY--EK...-
U9UGJ5_RHIID/52-203L.P..PAKA.L...........DAI-------------------------GKNLQA..............QY--EQ...-
Q5KIS3_CRYNJ/92-243L.P..APKA.I...........DAI-------------------------GRNLHQ..............QF--ET...-
B0WBU4_CULQU/30-181LED...................DST-------------------------AKLLRSERRHFQSFDREHSHYF--RS...-
A5DWK2_LODEL/143-295FTD..TKKA.L...........ENI-------------------------GKNLQS..............QY--ET...-
G0VGR8_NAUCC/79-231FQD..SKKA.I...........EQI-------------------------GKNLQS..............QY--ET...-
I3J5N7_ORENI/57-208M.S..PQKA.L...........ETI-------------------------GANLQK..............QY--EN...-
A2DYM2_TRIVA/68-215...................TLPSDF-------------------------SSYVQE..............YF--HD.KY-
D8TLK8_VOLCA/11-162A.Q..PAKA.L...........EHI-------------------------GKNLQA..............QY--ER...-
G4M000_SCHMA/43-194LHA.......L...........GNI-------------------------GKNLQA..............QY--ER...-
C1MUE6_MICPC/45-196M.Q..PQKA.L...........DAI-------------------------GKALQA..............QY--ER...-
Q387I9_TRYB2/89-240..........ARMPHIVTGGGSERI-------------------------AALLQR..............QY--HS...-
C4M2F5_ENTHI/38-189..K..TNRKLV...........YDI-------------------------AANLTD..............QY--RS...-
G4TT65_PIRID/72-223L.G..SAKA.L...........EAI-------------------------GKNLCQ..............QF--QS...-
G0NWW0_CAEBE/64-218...CGAHKAAL............EV-------------------------AMSTQR..............AY--EK...-
A2DJF0_TRIVA/83-228...................VNTVEA-------------------------VRTLQG..............FF--PSQYF-
K3WJU9_PYTUL/84-235M.P..PQKA.L...........ETI-------------------------GKTLQS..............QY--ER...-
A2G590_TRIVA/30-180....................FAPSS-------------------------SNAIQD..............LY--SA...-
B8M6V6_TALSN/189-342T.TGGQNKM.M...........EQI-------------------------GKKLQE..............QY--EN...-
A2FJN8_TRIVA/41-191....................FAPSS-------------------------QNAIQN..............LY--MN...-
A2DLR3_TRIVA/97-242...................MQASDI-------------------------SSNIQT..............CY--RS.LY-
E5SIN8_TRISP/44-195M.P..MQKA.L...........ESI-------------------------GTALQR..............QY--QW...-
I1G727_AMPQE/53-204R.G..SQKA.M...........ELI-------------------------ANSLQK..............QY--ER...-
U1MN31_ASCSU/95-246M.N..PQKA.I...........AKI-------------------------ASALQK..............NY--ER...-
I1L744_SOYBN/123-274M.A..PQKA.L...........ESI-------------------------GKTLSS..............QY--ER...-
E4XFS5_OIKDI/48-228..........VNDNFDNELPPQDVI-------------------------YRNVQDTLKSNFIELAPRVLQT--NTFNW-
D2VMD1_NAEGR/144-294..H..PQKA.L...........EAI-------------------------GSNLKL..............QY--ER...-
A9TBL2_PHYPA/91-242T.A..SVKA.L...........EAI-------------------------AKNLQT..............QY--ER...-
B7PLB3_IXOSC/92-247RSP..PQKA.L...........EAI-------------------------GAALQK..............QY--ER...-
A0A0D2USM0_CAPO3/727-878V.P..PQRA.L...........EQI-------------------------GLRLEQ..............QY--SR...-
B8CBK6_THAPS/256-409I.S..RAKA.K...........ERI-------------------------GERLEQ..............QY--AK...-
A4I1A2_LEIIN/114-279..AHVAKSAHRSGRGSGAGGGSDSI-------------------------AETLER..............QY--RS...-
F4RLY3_MELLP/215-367Y....PKESVL...........ETI-------------------------AKRLQD..............QF--ESLAP-
K4DUJ2_TRYCR/62-218..........AQISRFALEGGSDSI-------------------------AEILER..............QY--RS...-
H1VVG4_COLHI/158-309P.P..PQKA.L...........ENI-------------------------GKALQA..............QY--ET...-
M7XEP3_RHOT1/113-265I.A..KDKA.M...........ERI-------------------------GKNLQQ..............QF--ENLA.-
A2GCD5_TRIVA/98-247...................SFSSEY-------------------------PTTIQT..............YF--KN.TY-
D8RG53_SELML/72-223L.A..PQKA.L...........DTI-------------------------GKNLQS..............QY--AL...-
A2F9H3_TRIVA/31-181....................YAPDS-------------------------RKAIED..............MY--NN...-
L0PHF8_PNEJ8/131-282L.P..SQKS.L...........EAI-------------------------GKNLQQ..............QY--ET...-
RTOR2_ARATH/94-246MFP..PRRA.L...........EAI-------------------------GQNLSI..............QY--ER...-
M5E8T5_MALS4/58-209L.D..ASKA.L...........PAI-------------------------GRNLQV..............QF--ET...-
B3RPQ9_TRIAD/43-194M.N..PNKS.L...........EAV-------------------------GNSLQK..............QY--ER...-
I4Y9Q8_WALMC/76-227M.P..PPKA.L...........ETI-------------------------GRNLQQ..............RF--ES...-
A2E4G0_TRIVA/101-242......................SID-------------------------PKSLYS..............VY--KS.AY-
A0A068XPC4_HYMMI/269-417.....AGYRVV...........EMI-------------------------GKNLQS..............QY--ER...-
U4LGP0_PYROM/223-374Q.P..ASKA.L...........ESI-------------------------GKNLQI..............QY--ET...-
A2F8U1_TRIVA/65-210..ESTSNPQ.............QEI-------------------------AKAIVT..............QY--QQ...-
D8T9J0_SELML/50-197.......KA.I...........DVI-------------------------GQTLQS..............QY--KR...-
A9V5A2_MONBE/628-777.....KPKA.I...........ELI-------------------------SQRLTS..............QY--LR...-
F0XXV0_AURAN/12-164GPS..RQKA.L...........ETI-------------------------GAALQA..............QY--ER...-
A2E336_TRIVA/54-202TTQTLLSSVIL...........KEI-------------------------NAGFSD..............IF--PR...-
B4R5C8_DROSI/214-365V.S..PPKA.M...........ELI-------------------------GSNLQM..............QY--ER...-
A2EU18_TRIVA/81-227...................MSDTEF-------------------------PGIIQK..............FF--KA.GY-
A2DYB3_TRIVA/12-162....................YAPQT-------------------------KHVVQD..............VY--RA...-
S2KE38_MUCC1/106-257L.I..PQKS.L...........EAI-------------------------GKSLHN..............QY--ET...-
G7E3R0_MIXOS/173-325L.N..KDKV.M...........DAI-------------------------GRNLQL..............QY--ENLA.-

PF03415

Q8A866_BACTN/37-399....................GSNPK-------------------------LIRLRK------------------DKDVV-
Q9WZB1_THEMA/121-462....................GIGDG-------------------------MLVLDE------------------SGNF.-
Q8XM44_CLOPE/59-508GYSNDSKVLGSNFEDTRLYKIGENS-------------------------AERISG------------------KSEF.-
Q9X1S5_THEMA/586-937....................FHSDW-------------------------IYVLNE------------------EGEW.-
Q9WYY6_THEMA/5-301....................SSSDT-------------------------LYRVEE------------------.....-
Q8TIY6_METAC/66-593AEGWEGMTI...........AELED-------------------------LRKDSE------------------DGVIG-

PF12770

A0LJ53_SYNFM/581-921...SLYTIPFEM..LV----------------------------------------------------------------
A0LQE8_SYNFM/635-947...ALRYIPFSC..LY----------------------------------------------------------------
A1BCK0_CHLPD/513-826...GSGVFPVHAAWRQ----------------------------------------------------------------
A1BEL3_CHLPD/43-361..PAILQLPWEM..LW----------------------------------------------------------------
A1BEL6_CHLPD/46-364..PAILQLPWET..LY----------------------------------------------------------------
A4HBL7_LEIBR/1053-1432...QMWLVPFHA..LL----------------------------------------------------------------
A8L4T6_FRASN/741-1051...LLGSAPLHAARLA----------------------------------------------------------------
A9WBC0_CHLAA/673-929...PIHLAPFAA..LW----------------------------------------------------------------
A9WER9_CHLAA/54-394..AELQAIPWELLHFP----------------------------------------------------------------
A9WF91_CHLAA/60-360..AELHALRWETLCMP----------------------------------------------------------------
B0C874_ACAM1/207-507...GLRSLPLAA..LH----------------------------------------------------------------
B2IXC0_NOSP7/1396-1691...GLRSTPMAA..LH----------------------------------------------------------------
B2IZZ4_NOSP7/695-973...ILHGFPFAA..IR----------------------------------------------------------------
B2JAK0_NOSP7/526-830...TLDFIPFSA..LR----------------------------------------------------------------
B2JAM9_NOSP7/866-1190...ILQYIPFAA..LP----------------------------------------------------------------
B4JKU3_DROGR/1402-1700...ALYLVPFAI..LR----------------------------------------------------------------
C3Z401_BRAFL/1278-1602...DLYLVPFAV..LK----------------------------------------------------------------
F0SR63_RUBBR/137-574...LLQQIPLEV..LA----------------------------------------------------------------
Q01RE6_SOLUE/865-1136...WLSLLPFRA..LR----------------------------------------------------------------
Q024J7_SOLUE/541-814...ALHGLNFESLPLP----------------------------------------------------------------
Q025F1_SOLUE/607-877...VLWNLPFQA..LV----------------------------------------------------------------
Q028B5_SOLUE/667-935...FLWQLPFQA..LE----------------------------------------------------------------
Q02DA1_SOLUE/510-786...PVGTIPIQA..LM----------------------------------------------------------------
Q10YT7_TRIEI/1003-1309...NLNLIPFEA..LV----------------------------------------------------------------
Q10YU6_TRIEI/544-838...NLRNIPMSV..LY----------------------------------------------------------------
Q112V9_TRIEI/62-390AMPEVVAYPWELMCLP----------------------------------------------------------------
Q113D1_TRIEI/130-430...TTFEIPWEMLELK----------------------------------------------------------------
Q113U8_TRIEI/3002-3297...SLRALPVAA..LH----------------------------------------------------------------
Q115J8_TRIEI/1466-1777...FLHFLPLHILPIN----------------------------------------------------------------
Q117G6_TRIEI/881-1206...HLNLIPFEA..LV----------------------------------------------------------------
Q119J2_TRIEI/1474-1770...GLRTIPIAA..LH----------------------------------------------------------------
Q16H64_AEDAE/1315-1614...ELYLVPFAI..LR----------------------------------------------------------------
Q2G6U6_NOVAD/692-1020...AMLQLPPTV..LV----------------------------------------------------------------
Q2S6G2_SALRD/540-844...PMFHVPFSMLATA----------------------------------------------------------------
Q2W535_MAGSA/875-1218...MLNIAPISA..MV----------------------------------------------------------------
Q38C46_TRYB2/1044-1397...GLWLVPFNA..LM----------------------------------------------------------------
Q3AQG5_CHLCH/44-362..AAIQQLPWET..IY----------------------------------------------------------------
Q5LLA3_RUEPO/680-970.IHWVFDMPWEF..AR----------------------------------------------------------------
Q7NCT1_GLOVI/600-923...QLNTLPFAA..LV----------------------------------------------------------------
Q7NF67_GLOVI/550-854...ALNLIPFAA..LV----------------------------------------------------------------
Q7NFD7_GLOVI/666-979...QLHTLPFGV..LV----------------------------------------------------------------
Q7NIF7_GLOVI/691-997...QLNLLPFGA..LV----------------------------------------------------------------
Q7NJE3_GLOVI/660-988...QLNTMPFAA..LV----------------------------------------------------------------
Q7NLR0_GLOVI/653-961...LLNLLPIAA..LV----------------------------------------------------------------
Q7NVB0_CHRVO/67-386..AELALLPFEL..ML----------------------------------------------------------------
Q82I85_STRAW/1175-1481...ALGLVPWHAAWEQ----------------------------------------------------------------
Q82L10_STRAW/969-1256...VLNSFPLHAAGRH----------------------------------------------------------------
Q8DGG5_THEEB/541-835...ELNTIPFQA..LV----------------------------------------------------------------
Q8DH74_THEEB/570-891...QLNTLSFEA..LV----------------------------------------------------------------
Q8DHI1_THEEB/67-394...WLNRTRINF..LS----------------------------------------------------------------
Q8DIE5_THEEB/1127-1420...GMRGIPVAA..LH----------------------------------------------------------------
Q8YZU5_NOSS1/56-340...FLRDVPMAA..LY----------------------------------------------------------------
TTC28_HUMAN/1390-1713...ELYLIPFAL..LK----------------------------------------------------------------

PF03568

Q5KMS4_CRYNJ/1710-2122---GARR.A.KHITTS----------------------------------------------------------------
A8PX94_MALGO/1441-1824---GVQG.A.KDVKAL----------------------------------------------------------------
M7XLD2_RHOT1/1703-2100---GAQNAKLVD..GK----------------------------------------------------------------
U5HB45_USTV1/1850-2253---GAQNAKNVE..GK----------------------------------------------------------------
F4RLY9_MELLP/91-479---ATQRARHVS..GH----------------------------------------------------------------
T1IUX7_STRMM/1624-1980---TMKS.........----------------------------------------------------------------
A7RYA6_NEMVE/1651-2034---SMNI.........----------------------------------------------------------------
T1FT05_HELRO/413-770---TMKV.........----------------------------------------------------------------
W4Y9R2_STRPU/1031-1383---TVKE.........----------------------------------------------------------------
G3N6G2_GASAC/1731-2077---VSSV.........----------------------------------------------------------------
H3DAQ7_TETNG/1711-2057---VSCV.........----------------------------------------------------------------
I3KSG7_ORENI/1715-2061---VSCV.........----------------------------------------------------------------
H2L8K9_ORYLA/1692-2038---VSCV.........----------------------------------------------------------------
M3ZIW2_XIPMA/1768-2114---VSCV.........----------------------------------------------------------------
ESPL1_MOUSE/1716-2065---NSSC.........----------------------------------------------------------------
F7BUI1_CALJA/1724-2073---NSSC.........----------------------------------------------------------------
G3VPI8_SARHA/1713-2063---NSSC.........----------------------------------------------------------------
U3IXX7_ANAPL/1332-1679---TISC.........----------------------------------------------------------------
G1KFP0_ANOCA/1819-2167---ISNF.........----------------------------------------------------------------
H3B3H1_LATCH/1699-2055---INYE.........----------------------------------------------------------------
F6VXN8_XENTR/1732-2080---VNNL.........----------------------------------------------------------------
Q6ZHH8_ORYSJ/455-870---SLSSATLTLNDGQ----------------------------------------------------------------
W5GJD2_WHEAT/891-1304---SLSGAIDIPKDGQ----------------------------------------------------------------
K3Z105_SETIT/1078-1484---SLSSATLTINDVH----------------------------------------------------------------
C5XYE8_SORBI/457-870---SLSSASLTFNDVN----------------------------------------------------------------
C5XSY3_SORBI/1425-1832---SLSSAPLSINDVN----------------------------------------------------------------
K3Y3B2_SETIT/1404-1817---SLSSATLTINDGQ----------------------------------------------------------------
M0UBW7_MUSAM/65-479---LLSNTTFAAADIQ----------------------------------------------------------------
ESP1_ARATH/1641-2060---SSST...TEEDTI----------------------------------------------------------------
M4DS49_BRARP/1599-2019---SSGS...PVEDTR----------------------------------------------------------------
B9GZR1_POPTR/1674-2094---.LSSSKFPLEDTK----------------------------------------------------------------
B9SSN4_RICCO/1627-2045---.LSSSIFPLEDTK----------------------------------------------------------------
I1MDQ8_SOYBN/1648-2063---STKS...PLEDTT----------------------------------------------------------------
K4B224_SOLLC/1600-2023---.LSSSVHLLEDTT----------------------------------------------------------------
W1NKX2_AMBTC/1-423---.LSSSTLFSVDTN----------------------------------------------------------------
K7H1P7_CAEJA/245-604---IAKF........P----------------------------------------------------------------
E3LM18_CAERE/731-1090---IAKY........P----------------------------------------------------------------
G5ED39_CAEEL/727-1081---IAKY........P----------------------------------------------------------------
Q23491_CAEEL/749-1101---IVSN........H----------------------------------------------------------------
S3CR95_OPHP1/1758-2208---SCHG.A.RDMSVK----------------------------------------------------------------
F0XAD9_GROCL/1636-2054---SCHD.A.RDMTVK----------------------------------------------------------------
G2R9B0_THITE/1619-2058---TCHD.S.RDMTVK----------------------------------------------------------------
Q2H6Q9_CHAGB/1612-2026---TCHD.S.RDMTAK----------------------------------------------------------------
G0SHM3_CHATD/1723-2150---TCHD.S.RDMAAK----------------------------------------------------------------
G4UQF5_NEUT9/1626-2085---TCHD.A.RDFTVK----------------------------------------------------------------
G4N8I2_MAGO7/1627-2057---SCHD.A.RDMSAK----------------------------------------------------------------
J3P7L5_GAGT3/1606-2054---SAHR.A.KDMAKK----------------------------------------------------------------
R8BFS3_TOGMI/72-487---TCHD.A.RDLSIK----------------------------------------------------------------
N4UZ87_COLOR/1637-2043---SCHS.A.RTYTSN----------------------------------------------------------------
G2X6M8_VERDV/1704-2113---SCHDEG.RDWSAK----------------------------------------------------------------
G0RRT6_HYPJQ/1566-1971---SSHS.A.RDFTAK----------------------------------------------------------------
M1WFQ9_CLAP2/1438-1889---TSHS.A.RDFSAK----------------------------------------------------------------
J5K578_BEAB2/1584-1996---TSHS.A.RDFSLK----------------------------------------------------------------
C7YYU1_NECH7/1580-1992---TSHS.ASRDFSAK----------------------------------------------------------------
M7T4Q8_EUTLA/44-499---TCHD.A.RDMSQK----------------------------------------------------------------
L8G205_PSED2/1652-2056---SAHG.G.RDVSGR----------------------------------------------------------------
N1JFH1_BLUG1/1598-2001---SAHD.A.GNRTDR----------------------------------------------------------------
K1X2E6_MARBU/1659-2061---SAHD.A.LCRNGR----------------------------------------------------------------
S3D029_GLAL2/1639-2043---SAHS.A.RDMSSK----------------------------------------------------------------
M7TX51_BOTF1/1640-2041---NSQS.G.PSRTGR----------------------------------------------------------------
BIMB_EMENI/1609-2004---SAHA.A.KLQVDR----------------------------------------------------------------
Q2USV7_ASPOR/1630-2030---SSHA.A.KAQTDR----------------------------------------------------------------
G7XGU8_ASPKW/1627-2026---SAHA.A.KHQTDR----------------------------------------------------------------
S8BGE7_PENO1/1622-2018---SAHA.A.KAQTTK----------------------------------------------------------------
B6GZP8_PENRW/1602-1998---SAHA.A.KAQTDK----------------------------------------------------------------
Q4WUU6_ASPFU/1638-2039---TAHA.A.KLQKDR----------------------------------------------------------------
B6QNB5_TALMQ/1619-2016---SAHD.A.KTRIDK----------------------------------------------------------------
V5GCB2_BYSSN/1684-2084---SAHD.A.RSRTDR----------------------------------------------------------------
F0UL09_AJEC8/1642-2044---SAHN.A.RASIDK----------------------------------------------------------------
C5FSW7_ARTOC/1655-2058---SAHN.T.GSYVGK----------------------------------------------------------------
H6C6Q4_EXODN/1587-1987---SSHD.PRGCSADK----------------------------------------------------------------
U1G8A9_ENDPU/1638-2036---TAHD.M.KAGSNR----------------------------------------------------------------
K2R7J5_MACPH/1619-2043---STRN.A.PDLSKK----------------------------------------------------------------
R7YNT5_CONA1/1696-2117---STHH.Q.RDMSVK----------------------------------------------------------------
E4ZTB4_LEPMJ/1652-2063---STRT.A.KDMTSR----------------------------------------------------------------
N1QAI8_PSEFD/1492-1912---TCHN.S.IDTSIK----------------------------------------------------------------
N1QHR1_SPHMS/1187-1599---SCHS.S.IETNAK----------------------------------------------------------------
N1PZ16_DOTSN/1513-1936---SCHN.N.LDTSAK----------------------------------------------------------------
D5GKQ4_TUBMM/1633-2033---SAHN.A.KDMTSK----------------------------------------------------------------
U4LG69_PYROM/1616-2019---STHQ.A.KYMENK----------------------------------------------------------------
S8C8B1_DACHA/1639-2040---STHS.A.KDMITK----------------------------------------------------------------
Q6CCJ0_YARLI/1210-1588---MTRT.G...TAFP----------------------------------------------------------------
S9X830_SCHCR/1385-1771---TAQN.G.KDYTTK----------------------------------------------------------------
CUT1_SCHPO/1383-1770---MAQN.G.KHYTRR----------------------------------------------------------------
B6K0I6_SCHJY/1359-1747---ITRE.G.KDYKTR----------------------------------------------------------------
M7PDE3_PNEMU/1489-1882---TAQI.A.KNISTS----------------------------------------------------------------
G8BT64_TETPH/1165-1563---STSLEVTSNVSTK----------------------------------------------------------------
I2H0Y5_TETBL/1280-1677---TTSLSVTSKIKTK----------------------------------------------------------------
S6EFD3_ZYGB2/1145-1542---STSIEVTSAIKTK----------------------------------------------------------------
C5DU01_ZYGRC/1141-1538---TTSAEVTSAIKTR----------------------------------------------------------------
G8ZWZ1_TORDC/1158-1555---STSVEVTSSITTK----------------------------------------------------------------
G0WDN6_NAUDC/1191-1589---STSFEVTNLIKTK----------------------------------------------------------------
G0VFB3_NAUCC/1164-1562---TTSVEVTSSIKTK----------------------------------------------------------------
H2B1L5_KAZAF/1161-1559---TTSAEVTSKITTS----------------------------------------------------------------
ESP1_YEAST/1175-1571---TTSVEVTNKIKTR----------------------------------------------------------------
J7RG90_KAZNA/1160-1562---TTSTEVTTQITTP----------------------------------------------------------------
Q75EJ0_ASHGO/1152-1552---TTSIEVTSVIKTK----------------------------------------------------------------
C5DHM1_LACTC/1178-1575---TTSVEVTSNISTK----------------------------------------------------------------
Q6CQQ7_KLULA/1118-1516---TTSIEVTSVITTK----------------------------------------------------------------
Q6FTE1_CANGA/1151-1548---SVSKNVTETIKDK----------------------------------------------------------------
K0K8V1_WICCF/1175-1568---TTSKERIASIKTA----------------------------------------------------------------
A5DNR9_PICGU/1178-1576---STQVTTTSQIKTK----------------------------------------------------------------
A3GFF5_PICST/1168-1555---STKSSTTSKIHTK----------------------------------------------------------------
Q6BTB7_DEBHA/1338-1753---STRPETTSKIKSK----------------------------------------------------------------
Q5A8X8_CANAL/1101-1536---STKRKTTSKILTV----------------------------------------------------------------
C5MEH0_CANTT/925-1303---STKKATTSKIITV----------------------------------------------------------------
M3HH45_CANMX/1423-1797---STKKAVTSKVVTV----------------------------------------------------------------
G8B5X7_CANPC/1052-1424---STLYSTTSLVKTT----------------------------------------------------------------
A5DVQ7_LODEL/1109-1530---LTHNSTTSMIKTV----------------------------------------------------------------
G3AGZ6_SPAPN/1149-1535---STKKEVTSRVNTK----------------------------------------------------------------
G8YBL5_PICSO/1309-1719---TTSPEMTSQVQTR----------------------------------------------------------------
C4XY11_CLAL4/1177-1564---STKKSVTTSVKTK----------------------------------------------------------------
G3B782_CANTC/1213-1609---SIKPQTTSKIRTK----------------------------------------------------------------
W1QIM9_OGAPD/1167-1527---TTRIEVTSLVKTR----------------------------------------------------------------
C4QYS2_PICPG/1259-1619---TTNQERTTNVRTK----------------------------------------------------------------
K5WME3_PHACS/1732-2136---GTRQAQHVTK.DR----------------------------------------------------------------
M2R2K9_CERS8/1618-2024---GTRQAANVHKDDR----------------------------------------------------------------
F8PLA9_SERL3/1278-1688---GTRQAAHVKKDDQ----------------------------------------------------------------
S8E105_FOMPI/1678-2083---GTRGAASVKKNDR----------------------------------------------------------------
A8NBE9_COPC7/1839-2276---GTKSAIHVRSDDE----------------------------------------------------------------
B0E1W0_LACBS/104-540---GTKTAVNIKSDDE----------------------------------------------------------------
D8Q1W5_SCHCM/1450-1878---STKSAVNIR.NDP----------------------------------------------------------------
V2X3W8_MONRO/1588-2040---TTKVAASI.RNDQ----------------------------------------------------------------
J0DCK6_AURST/1634-2046---ATARGQGTQGMPK----------------------------------------------------------------
R9AIE1_WALI9/1639-2036---SIKSASDGNVKSD----------------------------------------------------------------
I4YB88_WALMC/1631-2030---SIKSASDGQVITD----------------------------------------------------------------
G4T5A4_PIRID/1472-1874---NGRKAAEVAGKGR----------------------------------------------------------------

PF01364

KGP83_PORGN/244-595A...APVF....LALV----------------------------------------------------------------
D1JG83_9ARCH/891-1295.....PDY....LIVV----------------------------------------------------------------
A2U064_9FLAO/401-768S..TQLKY....VCFF----------------------------------------------------------------
Q7MTE2_PORGI/239-573T...Y.......VLLI----------------------------------------------------------------
D3HWT0_9BACT/400-777S..TMPKY....LLLF----------------------------------------------------------------
Q5S3Q9_9FLAO/543-910G..KKINY....LCLF----------------------------------------------------------------
A9DMD5_9FLAO/555-923D..NRVKY....VCMF----------------------------------------------------------------
B0VGA8_CLOAI/228-563D...F.......IILL----------------------------------------------------------------
B7B5I7_9PORP/382-753A..DAPKY....LLLF----------------------------------------------------------------
B8FFM0_DESAA/254-600A..LRPKW....VILG----------------------------------------------------------------
A3U7G6_CROAH/540-908A..SRLKY....VCLF----------------------------------------------------------------
D2QSX9_SPILD/414-786T...KLRY....VLLF----------------------------------------------------------------
A3HW99_9BACT/398-769.....PTH....LLLA----------------------------------------------------------------
B0VHP2_CLOAI/234-563....F.......VQLV----------------------------------------------------------------
A8ZUB1_DESOH/278-656............VLLG----------------------------------------------------------------
B0VIM2_CLOAI/182-528............LFLW----------------------------------------------------------------
Q2Z0E1_9BACT/643-1013T...H.......ALLV----------------------------------------------------------------
B3QXR8_CHLT3/734-1131T...Y.......VLLL----------------------------------------------------------------
C2MCN4_9PORP/405-781H..GAESYH.PLLLLM----------------------------------------------------------------
A4A325_9PLAN/24-399.....LRW....VVLV----------------------------------------------------------------
A7NR84_ROSCS/499-867............VTLV----------------------------------------------------------------
Q11Q36_CYTH3/558-932G..SQLKY....LLLF----------------------------------------------------------------
Q7MX16_PORGI/272-637TLDGKLGY....VLLI----------------------------------------------------------------
A0B5K7_METTP/796-1154.....PEY....LLVV----------------------------------------------------------------
D0MH89_RHOM4/586-975S..SLLRY....ALLF----------------------------------------------------------------
A8UH97_9FLAO/539-910S..KRLKY....LCLF----------------------------------------------------------------
B8KYL6_9GAMM/364-704P..AM.......LLLV----------------------------------------------------------------
B8FIK5_DESAA/1139-1542............VALG----------------------------------------------------------------
Q11US7_CYTH3/392-767....KEKY....LLIL----------------------------------------------------------------
C6W101_DYAFD/326-680.....LQF....VLLA----------------------------------------------------------------
A5FJM8_FLAJ1/544-914D..KRVKY....LNLF----------------------------------------------------------------
Q7UG73_RHOBA/51-444R...Y.......IVLV----------------------------------------------------------------
A3J247_9FLAO/540-919D..KRVKY....VNLF----------------------------------------------------------------
A9WIM0_CHLAA/500-869E...A.......VILV----------------------------------------------------------------
B0VHE7_CLOAI/227-554D...Y.......IVLI----------------------------------------------------------------
C6VT06_DYAFD/394-758.....DKY....LFLI----------------------------------------------------------------
C6X3N8_FLAB3/546-921S..GKLQY....LFIL----------------------------------------------------------------
A0LQH1_SYNFM/790-1132....F.......VVFA----------------------------------------------------------------
A1ZVJ9_9BACT/406-774Q...VFKY....LLLF----------------------------------------------------------------
B0VHF1_CLOAI/214-595....PLRY....VFLA----------------------------------------------------------------
B0VIE7_CLOAI/193-598....PFSY....LLLV----------------------------------------------------------------
C6W3P4_DYAFD/414-806LG.RLDKY....LLLL----------------------------------------------------------------
B2RGP6_PORG3/408-787A..PVGETFPMQMLLF----------------------------------------------------------------
D2QJ99_SPILD/409-770E...HLRY....LLLI----------------------------------------------------------------
A9B5Q8_HERA2/466-850Q...S.......LVLV----------------------------------------------------------------
D2QFF3_SPILD/397-745.....VKH....LLLV----------------------------------------------------------------
B0VH03_CLOAI/589-939A..PRITS....LTLL----------------------------------------------------------------
D2R2P5_PIRSD/21-411G...KLRY....VLLV----------------------------------------------------------------
C6W0Z3_DYAFD/393-758G...KLKY....LLLF----------------------------------------------------------------
A3XQP5_LEEBM/552-929E..NRLKY....LCLF----------------------------------------------------------------
Q2PY26_9BACT/412-780S..DKPEY....LLLF----------------------------------------------------------------
Q26FX7_FLABB/537-909A..NRVRY....LNMF----------------------------------------------------------------
B0VJT2_CLOAI/236-566D...F.......VVLI----------------------------------------------------------------
C6BTD6_DESAD/56-402............VLIL----------------------------------------------------------------
D2QE53_SPILD/328-1007....KTRY....LLIG----------------------------------------------------------------
A2BK55_HYPBU/159-551............VLII----------------------------------------------------------------
B0VHP1_CLOAI/283-636PAPSY.......LLIV----------------------------------------------------------------
Q1Q1Y4_9BACT/620-970P..AY.......VVLI----------------------------------------------------------------
C7PNY3_CHIPD/396-764.....LQY....LLLF----------------------------------------------------------------
Q6LFY5_PHOPR/224-617.....TSY....VLLV----------------------------------------------------------------
B3QVL4_CHLT3/688-1063D..DAPKY....VLLF----------------------------------------------------------------
A9B187_HERA2/552-907P..SF.......VVLV----------------------------------------------------------------
R5M3W7_9BACE/537-910A..ESPKY....LLFF----------------------------------------------------------------
B0VJY1_CLOAI/655-1014S..PQLSS....VILL----------------------------------------------------------------
B8G4Y1_CHLAD/584-1054R...Y.......LMLI----------------------------------------------------------------
A1ZEG7_9BACT/410-775.....PKF....LFLI----------------------------------------------------------------
B0VF22_CLOAI/223-583Q...PLEY....VILG----------------------------------------------------------------
A0LKV0_SYNFM/924-1265R...Y.......VLLV----------------------------------------------------------------
A8ZTD5_DESOH/257-648S...Y.......VLLV----------------------------------------------------------------
A9B8S0_HERA2/477-840T...S.......VLLV----------------------------------------------------------------
C3JBB2_POREA/421-799H..PGEKQSAQQLLLF----------------------------------------------------------------
C9SW40_VERA1/279-917....GVNW....LLLG----------------------------------------------------------------
C9LI59_9BACT/509-899A..DMPRY....LLLF----------------------------------------------------------------
B5ICF9_ACIB4/214-642.....VEY....ITIF----------------------------------------------------------------
Y048_ARCFU/22-377............VTIL----------------------------------------------------------------
A3I371_9BACT/360-725K...SLKN....VLIL----------------------------------------------------------------

PF11713

MARTX_VIBCH/3469-3626--------------------------------------------------------------------------------
A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------

PF01650

LGMN_HUMAN/29-286--YSEDNPTPGIVINR----------------------------------------------------------------
VPED_ARATH/46-316--FSSENPRPGVIINK----------------------------------------------------------------
VPEG_ARATH/59-330--NNYENPRPGTIINS----------------------------------------------------------------
A0CQC7_PARTE/19-285--QNRQNIYKGAIYNQ----------------------------------------------------------------
A2FXM6_TRIVA/13-267--NDAENPFKGQIFRS----------------------------------------------------------------
O24539_VICNA/53-325--YNEMNPRPGVIINH----------------------------------------------------------------
HGLB_SCHMA/37-291--YNLMNPFPGKLFND----------------------------------------------------------------
HGLB_SCHJA/31-285--HNKENPFPGKIFND----------------------------------------------------------------
VPE_VICSA/56-325--SNEENPRPGVIINK----------------------------------------------------------------
A0A080VK93_PSEAI/341-579--DR...PLAT.....----------------------------------------------------------------
Q08BI0_DANRE/27-278--NNPNNPFPGSIRSV----------------------------------------------------------------
Q0MYV8_EMIHU/33-301--NDDMNPFPGKLFNK----------------------------------------------------------------
Q22P32_TETTS/20-285--FDKSNPFKGKLFNK----------------------------------------------------------------
Q22P33_TETTS/20-285--NNKQNPFKGKLFNQ----------------------------------------------------------------
D0MXB3_PHYIT/25-298--WHESNPYRGQLYNK----------------------------------------------------------------
Q2UVF3_HAECO/29-287--NHERNPYKGKIFND----------------------------------------------------------------
Q4K5F2_PSEF5/335-570--NR...PMAT.....----------------------------------------------------------------
Q4RED0_TETNG/30-283--ENRMNPTPGKLINR----------------------------------------------------------------
Q8P9N6_XANCP/124-392--ERPYAPLAT.....----------------------------------------------------------------
Q6EHZ7_TRIVA/12-258--LSSENPFRGKVFHT----------------------------------------------------------------
Q6FEB2_ACIAD/229-477--TRTQIPIAS.....----------------------------------------------------------------
Q6L4R2_ORYSJ/41-319--HNPDNPRPGLIFNH----------------------------------------------------------------
Q6NYJ7_DANRE/32-288--ESPDNPTKGVVINR----------------------------------------------------------------
Q6PRC7_IXORI/38-293--HDPSNPTPGIIINH----------------------------------------------------------------
Q711M2_FASHE/21-278--YSRQNPYRGKIFHD----------------------------------------------------------------
VPE1_ORYSJ/62-334--HNILNPRPGTIINH----------------------------------------------------------------
Q852T1_TOBAC/49-320--HNFENPRPGVIINS----------------------------------------------------------------
Q88QE3_PSEPK/400-640--TR...PMAT.....----------------------------------------------------------------
Q949L7_BETVU/51-321--YDEENPRPGVLINS----------------------------------------------------------------
Q9LLQ4_SESIN/54-326--MNELNPRKGVIINH----------------------------------------------------------------
Q9LWZ3_ORYSJ/41-304--YNPENPHKGVIINK----------------------------------------------------------------
Q9SBX2_MAIZE/45-317--HSPENPRPGVIINH----------------------------------------------------------------
Q9SMD0_SOLLC/39-316--NNPENPRPGVIINN----------------------------------------------------------------
Q9XG75_TOBAC/40-306--YNKNNPRPGIIINS----------------------------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227..YRCDR...LDINEN................................................................
DRONC_DROME/196-443..FTIFP......YGN................................................................
O42284_CHICK/42-279..YNVEC......HED................................................................
CAS1A_XENLA/144-382..YQVHP......HTN................................................................
CASPC_MOUSE/176-415..YSVVL......KEN................................................................
CASP4_MOUSE/132-369..YDVVV......KEE................................................................
CASP5_HUMAN/193-430..YTVVD......EKN................................................................
CASPD_BOVIN/136-373..YTVEV......EEK................................................................
CASP1_CANLF/163-400..YSVVV......KRK................................................................
CASP1_FELCA/161-406..YSVHI......KEE................................................................
CASP1_MOUSE/162-398..YTVKV......KEN................................................................
CASP1_HUMAN/163-400..YSVDV......KKN................................................................
CASP1_PIG/163-400..YSVDV......REN................................................................
Q9I9L7_DANRE/145-379..YQVVK......RPN................................................................
Q9DDJ2_DANRE/174-400..FAVMK......YRN................................................................
Q6NTR7_XENLA/280-494..FTVRT......DRY................................................................
CFLAR_MOUSE/257-480..YHIQL......FLF................................................................
Q6QN97_PIG/259-484..YEVQY......FLY................................................................
CFLAR_HUMAN/252-477..YEVQK......FLH................................................................
Q9NBW3_DROME/38-248..CRVEV......ISN................................................................
Q9TZP5_CAEEL/26-261..YQSTS......YDN................................................................
CASPE_MOUSE/22-256..FESTM......KRD................................................................
CASPE_HUMAN/18-241..FESTM......KRD................................................................
Q8I749_SUBDO/254-491..YKVEV......VEN................................................................
CASP2_RAT/200-445..YNVHV......LYD................................................................
CASP2_CHICK/171-416..YQVTV......FHD................................................................
Q9GV89_HYDVU/93-318..WCVKS......CNN................................................................
Q9IB63_XENLA/144-396..FEVTV......KDN................................................................
CASP9_HUMAN/161-413..FMVEV......KGD................................................................
Q90WU0_CHICK/148-400..FHVRT......LRN................................................................
Q9IB64_XENLA/261-494..YITEE......HRD................................................................
Q6E5N8_ICTPU/119-362..FNVCV......HKN................................................................
Q9I8J3_DANRE/238-473..FQIEV......RND................................................................
Q6PAD9_XENLA/268-495..LDVEI......VEN................................................................
Q90WU1_CHICK/237-479..FTVAE......YKD................................................................
CASP8_HUMAN/234-476..FEIKP......HDD................................................................
CASP8_MOUSE/236-478..FEIVS......YDD................................................................
Q9Y1U6_PRIPA/173-413..YEVEV......HEN................................................................
CED3_CAEEL/243-494..YTVIC......KDN................................................................
Q7QKT2_ANOGA/35-260..FDVRL......LSD................................................................
Q7PZJ9_ANOGA/20-250..CDVRT......FCD................................................................
Q9GV88_HYDVU/84-316..FKIDR......LNN................................................................
Q7Q1E0_ANOGA/62-291..FDVKV......YPD................................................................
CASP1_SPOFR/61-293..FKVTV......FPN................................................................
CASP1_DROME/79-313..FAVSV......HKD................................................................
Q7Q4X6_ANOGA/73-309..FEVHV......FKD................................................................
DRICE_DROME/94-328..FEVTV......YKD................................................................
Q9NHF9_DROME/56-302..FDVRT......FDD................................................................
Q7Q803_ANOGA/54-306..FEVRV......YDD................................................................
Q7PV92_ANOGA/14-237..FEVRV......MDD................................................................
Q86FL0_ANOST/52-286..FDVRV......FNN................................................................
Q8I6Y2_GEOCY/158-414..MATIR......KDN................................................................
Q8ITP3_BRAFL/87-323..FETKV......FDN................................................................
O88550_RAT/68-301..FEVTV......YND................................................................
Q6DCI2_XENLA/78-314..FDVNV......YNN................................................................
Q8JIS8_ORYLA/58-285..YEIQM......YND................................................................
CASP3_XENLA/56-280..YEVMV......CND................................................................
O93417_CHICK/53-281..YKVKL......NND................................................................
Q98UI8_DANRE/48-280..YIVKV......YND................................................................
Q8JG42_TAKRU/51-279..YKVKV......HND................................................................
Q8ITP2_BRAFL/151-396..FSVEV......LKD................................................................
Q9IB66_XENLA/58-298..FDVQN......YYN................................................................
Q9I8S9_ONCMY/57-297..FEVQA......FDN................................................................
O93415_CHICK/57-299..FEVRI......FDD................................................................
CASP6_MOUSE/28-270..FEVKC......FND................................................................
PCP_DICDI/188-404CSFHSDN...IVWLID................................................................
Q7AKE1_STRCO/9-268..WGLPP..EHCTVVT................................................................
A0A063TRB6_BORBO/552-800..LYRDV..RIELLTT................................................................
Q7NPG1_GLOVI/7-278..LRTQQ..LRTLYDA................................................................
Q87Z21_PSESM/2-224PNFSVIK..LVSNEQD................................................................
Q82I86_STRAW/5-276..ERADL......LFL................................................................
P74453_SYNY3/40-299..FDQAK..IAGLDPQ................................................................
Q8YS65_NOSS1/4-245..FDQVI....LFSDD................................................................
Q9DDL2_DANRE/323-560..FKVVS......LLD................................................................
Q98CE0_RHILO/5-237..FEVIL......ETN................................................................
Q6N0T4_RHOPA/30-250..FDAEL......GED................................................................
Q89XG2_BRADU/27-247..FSVEI......GEN................................................................
Q89XE4_BRADU/58-278..FDVDM......VED................................................................
Q6NBN5_RHOPA/57-277..YDVDM......IED................................................................
Q98JS7_RHILO/35-253..FDVLL......FYD................................................................
Q985X8_RHILO/35-256..FDVVG......ARD................................................................
Q6N5Q1_RHOPA/33-253..FDVSG......ARD................................................................
Q89KP2_BRADU/86-307..FDVVG......ARD................................................................
Q89IK1_BRADU/30-253..FEVLQ......GID................................................................
Q98G71_RHILO/26-252..FEVIE......GND................................................................
Q6AKF4_DESPS/28-248..FETII......KVN................................................................
Q98IJ6_RHILO/11-238..FEVVS......GFD................................................................
Q89MV1_BRADU/176-400..FTLVG...GRAQLD................................................................
Q89HT8_BRADU/51-272..FEVVA......ATD................................................................
Q89FZ4_BRADU/32-256..FTVTT......AAN................................................................
Q6N329_RHOPA/73-298..FEVTE......ASD................................................................
Q98IJ9_RHILO/30-261..FDVIE......GVD................................................................
Q89HP3_BRADU/336-569..FTVSE......GVD................................................................
Q7RFI8_PLAYO/964-1364..FLPEN..ILLLIDSFPSNAYIYDDFDMNRTKYINEKNNYTYNEEKKEKKYLFNLFNKKNIYDNKEVSNDYENNNSCVD
Q74F93_GEOSL/6-270..FAVTT..LMTKA..................................................................
MCA9_ARATH/10-321..FKQDD..IEVLTDE................................................................
MCA8_ARATH/3-378..FANKD..IVIMIDT................................................................
MCA7_ARATH/3-401..FAEEDITVLIDTDE................................................................
Q70VV0_PICAB/3-415..FEEENIRVLIDTDD................................................................
Q9ZSP8_HEVBR/3-415..FSEEDITVLIDIDE................................................................
MCA4_ARATH/3-416..FSEENITVLIDTDE................................................................
MCA5_ARATH/3-408..FSERNITELIDTDE................................................................
MCA6_ARATH/3-366..FSEENIKMLIDTDS................................................................
MCA1_ARATH/80-362..FSPDS..ILMLTEE................................................................
MCA2_ARATH/116-414..FPESC..ILMLTEE................................................................
MCA1_SCHPO/130-422..YKQED..MVIMTDT................................................................
MCA1_YARLI/168-458..YKPDD..MVILTDD................................................................
MCA1_DEBHA/146-437..YSYDD..MVILTDD................................................................
MCA1_ASHGO/154-449..YREEN..MVILTDD................................................................
MCA1_KLULA/138-430..YKAED..IVMLNDD................................................................
MCA1_CANGA/98-389..YRPED..IVMLTDD................................................................
B5VS82_YEAS6/157-450..YSSDD..IVILTDD................................................................
Q386I9_TRYB2/84-341..IPITERCVLMDTDD................................................................
Q38D34_TRYB2/63-322..FPISE..CCILVDD................................................................
Q8T8E6_9TRYP/84-343..LPINE..AVILVDE................................................................

PF14538

W1QFK7_OGAPD/56-210--VSSRI..KYKQSLD----------------------------------------------------------------
L8WVZ0_THACA/73-224--LNPRM..NYKPYLD----------------------------------------------------------------
A2EZ34_TRIVA/89-236--SNYRKVLRMFFQVA----------------------------------------------------------------
Q6C6R4_YARLI/86-238--LSMRT..RYKQSLD----------------------------------------------------------------
M2WI96_DOTSN/172-328--LSLRT..RYKVILD----------------------------------------------------------------
K2S4T3_MACPH/104-258--LSMRT..RYKLCLD----------------------------------------------------------------
C4LXC3_ENTHI/42-194--CTPTV..STEGLWD----------------------------------------------------------------
T1G0Q6_HELRO/62-216--WQPKA..RYKLSLD----------------------------------------------------------------
B0CNS4_LACBS/34-185--LSLKI..GYKYILD----------------------------------------------------------------
F0ZAV4_DICPU/115-266--WQSKA..RYKQCLD----------------------------------------------------------------
U9UGJ5_RHIID/52-203--LSIRT..RYRQYLD----------------------------------------------------------------
Q5KIS3_CRYNJ/92-243--LNPKV..KYKAFLD----------------------------------------------------------------
B0WBU4_CULQU/30-181--.......RFRSLPD----------------------------------------------------------------
A5DWK2_LODEL/143-295--LSLRT..RYKQSLD----------------------------------------------------------------
G0VGR8_NAUCC/79-231--LSLRC..RYKQSLD----------------------------------------------------------------
I3J5N7_ORENI/57-208--WQPRA..RYKQSLD----------------------------------------------------------------
A2DYM2_TRIVA/68-215--VSIKKQLRFFFQVA----------------------------------------------------------------
D8TLK8_VOLCA/11-162--WQPRA..KYKMHLD----------------------------------------------------------------
G4M000_SCHMA/43-194--WQPRA..RYKQCLD----------------------------------------------------------------
C1MUE6_MICPC/45-196--WQPRA..KYKLQLD----------------------------------------------------------------
Q387I9_TRYB2/89-240--..QLQGAVSSMAVE----------------------------------------------------------------
C4M2F5_ENTHI/38-189--WQNGS..KIEPCCD----------------------------------------------------------------
G4TT65_PIRID/72-223--LNPRI..KYKPFLD----------------------------------------------------------------
G0NWW0_CAEBE/64-218--WQPKSKTRYKICCD----------------------------------------------------------------
A2DJF0_TRIVA/83-228--KHAKW..STQTSRS----------------------------------------------------------------
K3WJU9_PYTUL/84-235--WQARA..RYRQCLD----------------------------------------------------------------
A2G590_TRIVA/30-180--...SMKCPAEIFVD----------------------------------------------------------------
B8M6V6_TALSN/189-342--LSLRT..RYKQYLD----------------------------------------------------------------
A2FJN8_TRIVA/41-191--...SLKCSADIVVD----------------------------------------------------------------
A2DLR3_TRIVA/97-242--LHLRQHLVFSYVIG----------------------------------------------------------------
E5SIN8_TRISP/44-195--WQPRA..RYKQALD----------------------------------------------------------------
I1G727_AMPQE/53-204--WQPRA..RYKQLLD----------------------------------------------------------------
U1MN31_ASCSU/95-246--WQPRA..RYKNAND----------------------------------------------------------------
I1L744_SOYBN/123-274--WQPKA..RYKCQLD----------------------------------------------------------------
E4XFS5_OIKDI/48-228--KQLHHSDAYKQKIF----------------------------------------------------------------
D2VMD1_NAEGR/144-294--WQPRA..RYKQCLD----------------------------------------------------------------
A9TBL2_PHYPA/91-242--WQPRA..RYKVSLD----------------------------------------------------------------
B7PLB3_IXOSC/92-247--WQSRA..RYKLSLD----------------------------------------------------------------
A0A0D2USM0_CAPO3/727-878--WQNKA..RYKPSLD----------------------------------------------------------------
B8CBK6_THAPS/256-409--WQQRSKLKYRRAID----------------------------------------------------------------
A4I1A2_LEIIN/114-279--.VLRDDVGVMRVVE----------------------------------------------------------------
F4RLY3_MELLP/215-367--PHARV..KFKTYPD----------------------------------------------------------------
K4DUJ2_TRYCR/62-218--..QQRDAVFKRAVD----------------------------------------------------------------
H1VVG4_COLHI/158-309--LAIRT..RYKQYLD----------------------------------------------------------------
M7XEP3_RHOT1/113-265--ATPKT..RYKQYLD----------------------------------------------------------------
A2GCD5_TRIVA/98-247--HQIRQKIRFFFSIA----------------------------------------------------------------
D8RG53_SELML/72-223--WQPRA..RYKLALD----------------------------------------------------------------
A2F9H3_TRIVA/31-181--...AIKCPCDFAVD----------------------------------------------------------------
L0PHF8_PNEJ8/131-282--LSMRT..RYKQYLD----------------------------------------------------------------
RTOR2_ARATH/94-246--WLARA..RYKVELD----------------------------------------------------------------
M5E8T5_MALS4/58-209--LSMKT..RYKQYLD----------------------------------------------------------------
B3RPQ9_TRIAD/43-194--WQPKA..RYKQSLD----------------------------------------------------------------
I4Y9Q8_WALMC/76-227--LSQRT..RVKQYLD----------------------------------------------------------------
A2E4G0_TRIVA/101-242--QNLRNQIRFAANCP----------------------------------------------------------------
A0A068XPC4_HYMMI/269-417--WQPKG..CYRQCLD----------------------------------------------------------------
U4LGP0_PYROM/223-374--LSIRT..RYKQYLD----------------------------------------------------------------
A2F8U1_TRIVA/65-210--CMPKM..ALAARVN----------------------------------------------------------------
D8T9J0_SELML/50-197--WQPKA..LYNLRLD----------------------------------------------------------------
A9V5A2_MONBE/628-777--WQPKA..KFRQAPD----------------------------------------------------------------
F0XXV0_AURAN/12-164--WQSRA..RYRQLLD----------------------------------------------------------------
A2E336_TRIVA/54-202--.......HSIISNE----------------------------------------------------------------
B4R5C8_DROSI/214-365--WQPRA..RYKKCND----------------------------------------------------------------
A2EU18_TRIVA/81-227--KIRNYKPTFYSMLN----------------------------------------------------------------
A2DYB3_TRIVA/12-162--...AIQCPCEMIVD----------------------------------------------------------------
S2KE38_MUCC1/106-257--INGRT..RFKLSLD----------------------------------------------------------------
G7E3R0_MIXOS/173-325--GTSKT..RYKFYPD----------------------------------------------------------------

PF03415

Q8A866_BACTN/37-399--VQDVIATYDAQ.NS----------------------------------------------------------------
Q9WZB1_THEMA/121-462--.QAVVGTMGIDFNS----------------------------------------------------------------
Q8XM44_CLOPE/59-508--.PEITTTSNYEANM----------------------------------------------------------------
Q9X1S5_THEMA/586-937--.EG..GPADAEIDS----------------------------------------------------------------
Q9WYY6_THEMA/5-301--.GLIPLETFDEINS----------------------------------------------------------------
Q8TIY6_METAC/66-593--NEEIHRRAYPHANM----------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921-------------------------R-----PA--ATKT...............SRKTQYLIEN...QAIL..YLSSASL
A0LQE8_SYNFM/635-947-------------------------D-----GR--.......................KYLIER...YTPVVFTPASRDR
A1BCK0_CHLPD/513-826-------------------------D-----SD--GS....................KRWLIDR...FTVR..YAPDFQV
A1BEL3_CHLPD/43-361-------------------------H-----PE--Y......................GFLALH...KEFT.........
A1BEL6_CHLPD/46-364-------------------------H-----PD--Y......................GFLARH...EGFT.........
A4HBL7_LEIBR/1053-1432-------------------------N-----VK--AG....................DRYFVEE...AAVQ..MAFS...
A8L4T6_FRASN/741-1051-------------------------E-----TV--GG...................AGTYALDR...LTLV..YAPSVRA
A9WBC0_CHLAA/673-929-------------------------N-----GN--.......................NYLMER...YLIE..QIPTGA.
A9WER9_CHLAA/54-394-------------------------A-----TD--NQS..................QLIPLTTS...DQIL.........
A9WF91_CHLAA/60-360-------------------------D-----G.--.......................EPLLMG...EEVY.........
B0C874_ACAM1/207-507-------------------------D-----GQ--.......................QFLVEQ...YNLA..LIPSFS.
B2IXC0_NOSP7/1396-1691-------------------------D-----GK--.......................GFLVEK...YSIG..LMPSIS.
B2IZZ4_NOSP7/695-973-------------------------Y-----KE--.......................KYLIEH...YAIS..IAYESKG
B2JAK0_NOSP7/526-830-------------------------T-----ND--G......................QYLIEK...YEIF..YLPSVTA
B2JAM9_NOSP7/866-1190-------------------------N-----PT--QT...................KLQPLLVE...HEIV..NAPSAST
B4JKU3_DROGR/1402-1700-------------------------A-----AG--DD....................GEYLSER...CALL..TAPSLQA
C3Z401_BRAFL/1278-1602-------------------------G-----SS--S.....................NECLYER...YGLV..VTPSIQA
F0SR63_RUBBR/137-574-------------------------G-----DD--................................YVVS..YCPSATL
Q01RE6_SOLUE/865-1136-------------------------D-----DR--G......................FWLAEQ...HPIG..VISGLAD
Q024J7_SOLUE/541-814-------------------------G-----DT--P......................RYLIQE...VTLS..LAPSLAL
Q025F1_SOLUE/607-877-------------------------R-----PD--G......................AHLLER...QTVF..YAPSLTF
Q028B5_SOLUE/667-935-------------------------T-----EP--E......................RYLMED...RAIF..YTPSLSV
Q02DA1_SOLUE/510-786-------------------------D-----PA--F......................HYVGER...FAIT..IAAGLAD
Q10YT7_TRIEI/1003-1309-------------------------D-----EN--N......................RFLVEN...YSFT..YLSSGRD
Q10YU6_TRIEI/544-838-------------------------D-----SK--R.....................ERYLVER...YAIA..VAPSLE.
Q112V9_TRIEI/62-390-------------------------E-----KY--NQ...................GQIYFATN...RKLS..FYRRRYQ
Q113D1_TRIEI/130-430-------------------------N-----N.--.......................DYLGAS................
Q113U8_TRIEI/3002-3297-------------------------D-----GE--.......................QFLIEK...YSLS..LIPSIS.
Q115J8_TRIEI/1466-1777-------------------------N-----PE--NSQE................NPEKKYLQDYFNQGVS..YAPSCQI
Q117G6_TRIEI/881-1206-------------------------D-----EN--N......................QYLVEN...YSIT..YLSSGRD
Q119J2_TRIEI/1474-1770-------------------------D-----GQ--.......................QFLVEK...YSLG..LIPSFT.
Q16H64_AEDAE/1315-1614-------------------------S-----GD--ES....................GEYLSER...CSLL..TVPSLHT
Q2G6U6_NOVAD/692-1020-------------------------S-----GD--KGIEAYKARMESPDGDPFDFTGVEWLGRG...REVS..IAVSPRG
Q2S6G2_SALRD/540-844-------------------------A-----PG--GRYD...............HEQARFVLHE...RPTA..LDLSASL
Q2W535_MAGSA/875-1218-------------------------E-----PN--R......................KYLIER...IDLH..VLNSSRD
Q38C46_TRYB2/1044-1397-------------------------S-----RN--G......................NFVIED...FAFQ..LGFS...
Q3AQG5_CHLCH/44-362-------------------------H-----PD--Y......................GFLARH...EGFT.........
Q5LLA3_RUEPO/680-970-------------------------D-----PE--R.....................GTYLATE....DVH..FIRNV..
Q7NCT1_GLOVI/600-923-------------------------G-----QD--G......................HPLLQD...HTLT..YLVSGRE
Q7NF67_GLOVI/550-854-------------------------D-----EH--G......................RFLVER...FTIQ..YLGSGRD
Q7NFD7_GLOVI/666-979-------------------------D-----EQ--G......................HYLIEK...YTLS..YLNAGRD
Q7NIF7_GLOVI/691-997-------------------------D-----EQ--G......................RYLLER...FELV..YLSSGRD
Q7NJE3_GLOVI/660-988-------------------------A-----QD--G......................RSLLQR...YALT..YLVSGRE
Q7NLR0_GLOVI/653-961-------------------------D-----ER--N......................RYLVEN...YTIS..YLSSGRD
Q7NVB0_CHRVO/67-386-------------------------S-----PP--GQP.................GAGQHLLLQ............AQRP
Q82I85_STRAW/1175-1481-------------------------G-----DD--GR....................RRYALQA...AEIS..YAASARL
Q82L10_STRAW/969-1256-------------------------G-----SG--EA...................ADAAVLDR...VASS..YTPTLRA
Q8DGG5_THEEB/541-835-------------------------D-----AQ--G......................RYLVES...YWIT..LLTSGRE
Q8DH74_THEEB/570-891-------------------------D-----RQ--D......................RYLVQS...YTIT..LLTSGRD
Q8DHI1_THEEB/67-394-------------------------E-----AQ--LNE..................QSAFSREQASFFGLGNFILPPP..
Q8DIE5_THEEB/1127-1420-------------------------D-----GK--.......................GFLVER...FSMA..LVPSLR.
Q8YZU5_NOSS1/56-340-------------------------D-----KK--E.....................SRYLTEK...YAVA..TTSSLQ.
TTC28_HUMAN/1390-1713-------------------------G-----SS--S.....................NEYLYER...FGLL..AVPSIRS

PF03568

Q5KMS4_CRYNJ/1710-2122-------------------------E-----GK..A----------------------EWWAER---RALD---------
A8PX94_MALGO/1441-1824-------------------------E-----AR..K----------------------VWWTHR---RALD---------
M7XLD2_RHOT1/1703-2100-------------------------E-----QR..A----------------------AWWAER---KELD---------
U5HB45_USTV1/1850-2253-------------------------E-----AR..I----------------------AWWAER---KELD---------
F4RLY9_MELLP/91-479-------------------------D-----EK..V----------------------TWWTER---KELD---------
T1IUX7_STRMM/1624-1980-------------------------D-----NR..N----------------------VWWDKR---RKLN---------
A7RYA6_NEMVE/1651-2034-------------------------S-----ST..K----------------------EWCQRR---SNLD---------
T1FT05_HELRO/413-770-------------------------T-----NK..K----------------------EWWDRR---QSLD---------
W4Y9R2_STRPU/1031-1383-------------------------T-----DK..R----------------------VWWTTR---QRLD---------
G3N6G2_GASAC/1731-2077-------------------------S-----EK..V----------------------KWWEGR---RVLD---------
H3DAQ7_TETNG/1711-2057-------------------------S-----EK..A----------------------KWWEGR---RALD---------
I3KSG7_ORENI/1715-2061-------------------------S-----EK..A----------------------KWWEGR---RALD---------
H2L8K9_ORYLA/1692-2038-------------------------A-----EK..A----------------------LWWEGR---RALD---------
M3ZIW2_XIPMA/1768-2114-------------------------A-----EK..A----------------------KWWEGR---RALD---------
ESPL1_MOUSE/1716-2065-------------------------T-----EK..R----------------------VWWTGR---LALD---------
F7BUI1_CALJA/1724-2073-------------------------T-----DK..R----------------------EWWTGR---LALD---------
G3VPI8_SARHA/1713-2063-------------------------T-----EK..S----------------------KWWATR---LKLD---------
U3IXX7_ANAPL/1332-1679-------------------------T-----NK..R----------------------EWWLCR---SELD---------
G1KFP0_ANOCA/1819-2167-------------------------T-----EK..E----------------------DWWTGR---IALD---------
H3B3H1_LATCH/1699-2055-------------------------T-----DK..K----------------------IWWEGR---ADLD---------
F6VXN8_XENTR/1732-2080-------------------------T-----DK..K----------------------EWWEGR---MELD---------
Q6ZHH8_ORYSJ/455-870-------------------------A-----NH..V----------------------KWWSHR---MKLN---------
W5GJD2_WHEAT/891-1304-------------------------A-----NA..V----------------------RWWSDR---MKLN---------
K3Z105_SETIT/1078-1484-------------------------A-----DH..V----------------------RWWSHR---MKLN---------
C5XYE8_SORBI/457-870-------------------------A-----DR..V----------------------RWWSHR---IRLN---------
C5XSY3_SORBI/1425-1832-------------------------A-----DH..V----------------------RWWSHR---KKLN---------
K3Y3B2_SETIT/1404-1817-------------------------A-----NC..V----------------------RWWAHR---MKLN---------
M0UBW7_MUSAM/65-479-------------------------M-----KN..A----------------------SWWSQR---TMLN---------
ESP1_ARATH/1641-2060-------------------------E-----SR..G----------------------LWWKKR---KKLN---------
M4DS49_BRARP/1599-2019-------------------------E-----HR..N----------------------SWWKKR---KTLD---------
B9GZR1_POPTR/1674-2094-------------------------E-----NR..N----------------------LWWTKR---KELD---------
B9SSN4_RICCO/1627-2045-------------------------E-----NR..T----------------------LWWMRR---KKLD---------
I1MDQ8_SOYBN/1648-2063-------------------------Q-----NR..M----------------------LWWKRR---KNLD---------
K4B224_SOLLC/1600-2023-------------------------E-----NR..S----------------------SWWKWR---KQLD---------
W1NKX2_AMBTC/1-423-------------------------E-----NR..S----------------------IWWNWR---TKLN---------
K7H1P7_CAEJA/245-604-------------------------G-----DMSPT----------------------TFWERR---KGVD---------
E3LM18_CAERE/731-1090-------------------------G-----EMTPE----------------------EFWKRR---KVVD---------
G5ED39_CAEEL/727-1081-------------------------G-----DITPE----------------------EFWKRR---KIVD---------
Q23491_CAEEL/749-1101-------------------------E-----KYKFE----------------------ECWDRR---KIVD---------
S3CR95_OPHP1/1758-2208-------------------------G-----AK..S----------------------DWWSER---EELD---------
F0XAD9_GROCL/1636-2054-------------------------G-----AK..S----------------------AWWTER---TALD---------
G2R9B0_THITE/1619-2058-------------------------G-----AK..S----------------------AWWAER---EALD---------
Q2H6Q9_CHAGB/1612-2026-------------------------G-----AK..G----------------------AWWTER---EALD---------
G0SHM3_CHATD/1723-2150-------------------------G-----ER..E----------------------KWWAER---EALD---------
G4UQF5_NEUT9/1626-2085-------------------------G-----AK..T----------------------AWWADR---EALD---------
G4N8I2_MAGO7/1627-2057-------------------------G-----AK..T----------------------AWWSHR---EELD---------
J3P7L5_GAGT3/1606-2054-------------------------R-----LK..S----------------------EWWAER---EELD---------
R8BFS3_TOGMI/72-487-------------------------G-----AK..S----------------------AWWADR---AALD---------
N4UZ87_COLOR/1637-2043-------------------------G-----AK..E----------------------AWWKRR---EELD---------
G2X6M8_VERDV/1704-2113-------------------------G-----AK..A----------------------AWWQER---EALD---------
G0RRT6_HYPJQ/1566-1971-------------------------G-----ER..G----------------------AWWAER---QALD---------
M1WFQ9_CLAP2/1438-1889-------------------------N-----ER..N----------------------AWWAER---EALD---------
J5K578_BEAB2/1584-1996-------------------------G-----ER..N----------------------AWWAER---ETLD---------
C7YYU1_NECH7/1580-1992-------------------------G-----AK..S----------------------AWWAER---EALD---------
M7T4Q8_EUTLA/44-499-------------------------E-----AK..S----------------------VWWTER---EELD---------
L8G205_PSED2/1652-2056-------------------------E-----GK..I----------------------AWWAER---DELN---------
N1JFH1_BLUG1/1598-2001-------------------------K-----SK..L----------------------MWWEER---EALD---------
K1X2E6_MARBU/1659-2061-------------------------E-----AK..T----------------------AWWEER---EALD---------
S3D029_GLAL2/1639-2043-------------------------E-----AR..I----------------------QWWEER---DELD---------
M7TX51_BOTF1/1640-2041-------------------------E-----AK..L----------------------AWWAER---AELD---------
BIMB_EMENI/1609-2004-------------------------Q-----MK..K----------------------EWWKNR---EALD---------
Q2USV7_ASPOR/1630-2030-------------------------Q-----MK..K----------------------DWWKNR---EALD---------
G7XGU8_ASPKW/1627-2026-------------------------Q-----MK..K----------------------DWWKNR---EALD---------
S8BGE7_PENO1/1622-2018-------------------------Q-----MK..K----------------------EWWTNR---EALD---------
B6GZP8_PENRW/1602-1998-------------------------L-----SK..K----------------------EWWKTR---EALD---------
Q4WUU6_ASPFU/1638-2039-------------------------H-----SK..K----------------------EWWRNR---EALN---------
B6QNB5_TALMQ/1619-2016-------------------------N-----SK..K----------------------QWWATR---ESLD---------
V5GCB2_BYSSN/1684-2084-------------------------Q-----SR..K----------------------EWWANR---EALD---------
F0UL09_AJEC8/1642-2044-------------------------S-----AK..R----------------------EWWATR---QSLD---------
C5FSW7_ARTOC/1655-2058-------------------------K-----EK..K----------------------EWWANR---ENLD---------
H6C6Q4_EXODN/1587-1987-------------------------S-----LR..K----------------------AWYNER---KALD---------
U1G8A9_ENDPU/1638-2036-------------------------Q-----AK..K----------------------LWWATR---EALD---------
K2R7J5_MACPH/1619-2043-------------------------G-----AK..T----------------------EWWAER---EALD---------
R7YNT5_CONA1/1696-2117-------------------------G-----AK..T----------------------GWWAER---EALD---------
E4ZTB4_LEPMJ/1652-2063-------------------------E-----AR..Q----------------------QWWTER---EALD---------
N1QAI8_PSEFD/1492-1912-------------------------G-----AK..T----------------------KWWSER---EALD---------
N1QHR1_SPHMS/1187-1599-------------------------G-----AK..T----------------------NWWSER---EALD---------
N1PZ16_DOTSN/1513-1936-------------------------G-----AK..T----------------------NWWAER---EALD---------
D5GKQ4_TUBMM/1633-2033-------------------------G-----AR..T----------------------EWWKQR---ESLD---------
U4LG69_PYROM/1616-2019-------------------------N-----DR..A----------------------TWWTER---QQLD---------
S8C8B1_DACHA/1639-2040-------------------------D-----VR..A----------------------KWWSER---EVLD---------
Q6CCJ0_YARLI/1210-1588-------------------------G-----GS..E----------------------AWWAKR---HELD---------
S9X830_SCHCR/1385-1771-------------------------Q-----EK..E----------------------SWWKQR---RELD---------
CUT1_SCHPO/1383-1770-------------------------E-----DK..E----------------------TWWKER---RHLD---------
B6K0I6_SCHJY/1359-1747-------------------------E-----EK..E----------------------RWWKER---RELD---------
M7PDE3_PNEMU/1489-1882-------------------------A-----HK..V----------------------VWWKER---QELD---------
G8BT64_TETPH/1165-1563-------------------------E-----EK..K----------------------QWWKSR---YDLD---------
I2H0Y5_TETBL/1280-1677-------------------------E-----DR..K----------------------SWWKQR---HDLD---------
S6EFD3_ZYGB2/1145-1542-------------------------E-----ER..K----------------------AWWETR---YRLD---------
C5DU01_ZYGRC/1141-1538-------------------------E-----ER..R----------------------MWWETR---YDLD---------
G8ZWZ1_TORDC/1158-1555-------------------------D-----ER..K----------------------KWWQTR---YELD---------
G0WDN6_NAUDC/1191-1589-------------------------E-----QR..K----------------------EWWDLR---HELD---------
G0VFB3_NAUCC/1164-1562-------------------------E-----DR..K----------------------TWWKSR---YELD---------
H2B1L5_KAZAF/1161-1559-------------------------D-----AR..K----------------------AWWRKR---YDLD---------
ESP1_YEAST/1175-1571-------------------------E-----ER..K----------------------SWWTTR---YDLD---------
J7RG90_KAZNA/1160-1562-------------------------E-----GR..K----------------------KWWQSR---YQLD---------
Q75EJ0_ASHGO/1152-1552-------------------------E-----DR..R----------------------EWWEER---YSLD---------
C5DHM1_LACTC/1178-1575-------------------------D-----AR..K----------------------RWWQYR---YELD---------
Q6CQQ7_KLULA/1118-1516-------------------------E-----QR..K----------------------NWWDER---YALN---------
Q6FTE1_CANGA/1151-1548-------------------------N-----DV..R----------------------NWWKRR---YDLD---------
K0K8V1_WICCF/1175-1568-------------------------E-----DR..Q----------------------QWHQER---FELD---------
A5DNR9_PICGU/1178-1576-------------------------D-----DR..K----------------------KWWSTR---FGLD---------
A3GFF5_PICST/1168-1555-------------------------E-----ER..K----------------------NWWRLR---FSLD---------
Q6BTB7_DEBHA/1338-1753-------------------------E-----DR..K----------------------NWWKLR---FSLD---------
Q5A8X8_CANAL/1101-1536-------------------------E-----DR..K----------------------QWWRSR---FTLD---------
C5MEH0_CANTT/925-1303-------------------------E-----DR..K----------------------QWWRSR---FTLD---------
M3HH45_CANMX/1423-1797-------------------------D-----DR..K----------------------SWWRSR---FTLD---------
G8B5X7_CANPC/1052-1424-------------------------Q-----DR..K----------------------KWWKTR---FTLD---------
A5DVQ7_LODEL/1109-1530-------------------------D-----DR..K----------------------GWWKQR---FTLD---------
G3AGZ6_SPAPN/1149-1535-------------------------A-----QR..Q----------------------KWWKLR---FELD---------
G8YBL5_PICSO/1309-1719-------------------------D-----DR..K----------------------TWWKIR---FALD---------
C4XY11_CLAL4/1177-1564-------------------------E-----DR..R----------------------NWWKMR---FELD---------
G3B782_CANTC/1213-1609-------------------------E-----DR..T----------------------NWWRLR---FSLD---------
W1QIM9_OGAPD/1167-1527-------------------------A-----DR..A----------------------NWWAQR---KSLD---------
C4QYS2_PICPG/1259-1619-------------------------A-----DR..Q----------------------DWWKER---RELD---------
K5WME3_PHACS/1732-2136-------------------------V-----SR..S----------------------AWWADR---AALD---------
M2R2K9_CERS8/1618-2024-------------------------K-----AR..A----------------------AWWTDR---RALD---------
F8PLA9_SERL3/1278-1688-------------------------K-----AR..T----------------------AWWADR---SALD---------
S8E105_FOMPI/1678-2083-------------------------A-----AR..A----------------------AWWAAR---GALD---------
A8NBE9_COPC7/1839-2276-------------------------E-----AR..S----------------------NWWRQR---NELD---------
B0E1W0_LACBS/104-540-------------------------E-----AR..A----------------------NWWKLR---GDLD---------
D8Q1W5_SCHCM/1450-1878-------------------------E-----AR..Q----------------------NWWKER---AGLD---------
V2X3W8_MONRO/1588-2040-------------------------A-----AR..A----------------------KWWKER---GTLD---------
J0DCK6_AURST/1634-2046-------------------------E-----AR..V----------------------AWWAAR---NELD---------
R9AIE1_WALI9/1639-2036-------------------------D-----EK..V----------------------AWWNKR---KTLD---------
I4YB88_WALMC/1631-2030-------------------------D-----DK..V----------------------DWWNCR---KHLD---------
G4T5A4_PIRID/1472-1874-------------------------N-----AK..A----------------------RWWAER---SELD---------

PF01364

KGP83_PORGN/244-595-------------------------G-----DT--...................................DVISGEKG..
D1JG83_9ARCH/891-1295-------------------------G-----GT--GSVPFVDTELVQNLTVTYDNYSLVEDYLPQDFIDALNDPKIQEKI
A2U064_9FLAO/401-768-------------------------G-----DS--SYD...................YKDR..IAANNNI..VPVKLSTI
Q7MTE2_PORGI/239-573-------------------------G-----DH--...................................KDIPAKI...
D3HWT0_9BACT/400-777-------------------------G-----DG--VWDNR..............MLTPECR..NLNPDDY..LLCFESEN
Q5S3Q9_9FLAO/543-910-------------------------G-----DA--SFD...................YKDR..VKNNTNL..VPNLQSLG
A9DMD5_9FLAO/555-923-------------------------G-----DA--SYD...................YKDR..IEGNTNI..VPVYQAFD
B0VGA8_CLOAI/228-563-------------------------G-----DT--................................NGSYTIPTYTEQ.
B7B5I7_9PORP/382-753-------------------------G-----DG--SFDNR..............KLTSAWK..SVDMSNM..LLTYQTEN
B8FFM0_DESAA/254-600-------------------------G-----DV--...................................DKIPTHHTAC
A3U7G6_CROAH/540-908-------------------------G-----EG--SVD...................YKDR..LQNNNLI..IPTYQRLR
D2QSX9_SPILD/414-786-------------------------G-----DA--TFNYR..............NIGGLVS..PAQLANM..VPVYESRE
A3HW99_9BACT/398-769-------------------------G-----RS--LTMYSTAR.........QNGVNYFYRNNPSAFSFQNLVPPGG...
B0VHP2_CLOAI/234-563-------------------------G-----DA--...................................PQIPTLT...
A8ZUB1_DESOH/278-656-------------------------G-----DT--...................................GIIPPRTLWC
B0VIM2_CLOAI/182-528-------------------------G-----DV--................................NGTYAIPTNFIVS
Q2Z0E1_9BACT/643-1013-------------------------G-----DS--SLD..................YRHY....LTTGIECFVPTYYTG.
B3QXR8_CHLT3/734-1131-------------------------G-----DA--.............................SYSTSNDYVPTMHVQT
C2MCN4_9PORP/405-781-------------------------G-----DG--AYDNR..............KVSQDWSARDFQLTEF..LLTYQGEN
A4A325_9PLAN/24-399-------------------------G-----DV--..........................PGDQPTPEAPGVPTHLMDA
A7NR84_ROSCS/499-867-------------------------G-----DG--SSDP................FDYTD....RGAKNVNLIPPYLAMV
Q11Q36_CYTH3/558-932-------------------------G-----KP--TYD...................YKNH..TGIGGNF..VPTYESRE
Q7MX16_PORGI/272-637-------------------------G-----KP--LSKYL..............ADTDNTKVPTSFIHNVSLIPSHPT..
A0B5K7_METTP/796-1154-------------------------G-----DP--GSLPFPT..........TGVKQELE...........GDP......
D0MH89_RHOM4/586-975-------------------------G-----DG--HYNY.................RELWQ..KPTLKNW..VPPYETVD
A8UH97_9FLAO/539-910-------------------------G-----DG--SYD...................YKDR..IRNNTNL..VPSWYSTN
B8KYL6_9GAMM/364-704-------------------------G-----DA--S.......................WERATPTGNSRNLVPTEQVM.
B8FIK5_DESAA/1139-1542-------------------------G-----DD--...................................TVVPARMCYI
Q11US7_CYTH3/392-767-------------------------G-----KG--VVPSMSNFINNVGSVVYRKNPSFYWTNTDFKNHFVNLVPPFG...
C6W101_DYAFD/326-680-------------------------G-----RS--IDPQK...............ARKMK.....DSWQTDMVPNAG...
A5FJM8_FLAJ1/544-914-------------------------G-----DA--SFD...................YKNR..IANNNNI..VPIYQALR
Q7UG73_RHOBA/51-444-------------------------G-----DT--.........................PDYDTPRNQPHQIPTWMIPA
A3J247_9FLAO/540-919-------------------------G-----DA--SYD...................YKNR..LFNNTNI..VPVFHGFN
A9WIM0_CHLAA/500-869-------------------------G-----DG--SSD..................PRDY....LRRGWPTLIPPYLAEV
B0VHE7_CLOAI/227-554-------------------------G-----DT--..................................DGTIAVTS...
C6VT06_DYAFD/394-758-------------------------G-----KS--I.......................TQNEKMVRELPGEVPTIG...
C6X3N8_FLAB3/546-921-------------------------G-----DT--SYD...................FRGK..NNPGSDI..VPSYQSEE
A0LQH1_SYNFM/790-1132-------------------------G-----EG--SFD...................YKN....VKGYRDALVPPLMAD.
A1ZVJ9_9BACT/406-774-------------------------G-----DA--SFD...................YKDR..VANNTNF..VPIYESRE
B0VHF1_CLOAI/214-595-------------------------G-----DT--DVIPHRGFYV.....SVNNSDEGTD....................
B0VIE7_CLOAI/193-598-------------------------G-----DY--..........................D.TVPVAYVTPEPNGQ...
C6W3P4_DYAFD/414-806-------------------------G-----IS--V.......................TRNDRINKELLNEVPTFS...
B2RGP6_PORG3/408-787-------------------------G-----DG--AHDNR..............KVSVAWQKPYLQQTEF..LLTFQAVN
D2QJ99_SPILD/409-770-------------------------G-----RA--RSTPG...............VRNNP.....SQSGLDMVMTAG...
A9B5Q8_HERA2/466-850-------------------------G-----DG--TID..................PLNY....LGRNNPNMIPPLPAYT
D2QFF3_SPILD/397-745-------------------------G-----RA--NSYPY...............TVKTA.....TD...DLVPTMG...
B0VH03_CLOAI/589-939-------------------------G-----IG--TMDWR...............NFSGF....SAPKNK..LIVWQ...
D2R2P5_PIRSD/21-411-------------------------G-----DA--E.......................PGSGTNIELRRRCVPTYHVDA
C6W0Z3_DYAFD/393-758-------------------------G-----DA--TYDYR..............NLLRNQS..PAQRAAW..VPVYESRE
A3XQP5_LEEBM/552-929-------------------------G-----DT--SFD...................YKDR..IDNNNNL..VPTFNTYY
Q2PY26_9BACT/412-780-------------------------G-----DC--SYD...................MKGR..LSPDQNQ..IPAFQSQA
Q26FX7_FLABB/537-909-------------------------G-----DA--SFD...................YKDR..ISIRENI..VPSFHTAE
B0VJT2_CLOAI/236-566-------------------------G-----DT--................................SGSYTIPANSA..
C6BTD6_DESAD/56-402-------------------------G-----NR--...................................DIVPPARFD.
D2QE53_SPILD/328-1007-------------------------G-----DT--DIVPMRNMVSYVSDKGNYGWDFVYVSDPVPPIRKCFKIPGQSIAK
A2BK55_HYPBU/159-551-------------------------G-----GA--...................................AEVPPVYVCS
B0VHP1_CLOAI/283-636-------------------------G-----DV--...................................AQVPTNNG..
Q1Q1Y4_9BACT/620-970-------------------------G-----DA--YQDYN..............DNLASGTINYVPSQIIETDELGE...
C7PNY3_CHIPD/396-764-------------------------G-----DA--SYD...................YKNR..IAGNTNM..IPTWQSTI
Q6LFY5_PHOPR/224-617-------------------------G-----DH--...................................EDIPGYEIVG
B3QVL4_CHLT3/688-1063-------------------------G-----DG--DWD...................FRS....IKNDDYEKLVTYQSDE
A9B187_HERA2/552-907-------------------------G-----DG--TADPH...............DYADI....IGQPVTNFIPPYLADV
R5M3W7_9BACE/537-910-------------------------G-----DC--SYDNR..............MLTSSWK..NYRPENF..LLSYQSET
B0VJY1_CLOAI/655-1014-------------------------G-----EG--VDDT................RDNSP....SRIYNL..IPVKKTWT
B8G4Y1_CHLAD/584-1054-------------------------G-----TN--...................................QVLPYAQVEA
A1ZEG7_9BACT/410-775-------------------------G-----KG--LSIDQS.............ATSLNPRIIP.AHRGQDLIPPFG...
B0VF22_CLOAI/223-583-------------------------G-----DD--EIVPERGA........YGQVGDTVD....................
A0LKV0_SYNFM/924-1265-------------------------G-----DD--TFD..................PKDH....LGRGLVSFIPSLNGMD
A8ZTD5_DESOH/257-648-------------------------G-----DV--...................................EFIPTHR...
A9B8S0_HERA2/477-840-------------------------G-----DG--TTD..................PRDV....LGYGQPPLIPPYLAEV
C3JBB2_POREA/421-799-------------------------G-----DG--AADNR..............KVSVHWESIGLQNTPF..LLTYQSSN
C9SW40_VERA1/279-917-------------------------G-----DT--SIVPVRRVAGALEGGIEPPLTVNPPANNKSFWTGSHLRIHAVNPG
C9LI59_9BACT/509-899-------------------------G-----DC--FWDNR...............MLTTT...KLNAADF..LLAYEAGP
B5ICF9_ACIB4/214-642-------------------------G-----NA--R......................AVPPSYYWTDQYMYLLAYYGLS
Y048_ARCFU/22-377-------------------------G-----DA--...................................DIVPPSYYAK
A3I371_9BACT/360-725-------------------------G-----KG--TFD...................YKGK..LGGRPNI..VPTYSSRN

PF11713

MARTX_VIBCH/3469-3626-------------------------E-----SS-----------------------------------------------
A0KHZ7_AERHH/3609-3767-------------------------D-----RS-----------------------------------------------
Q2KX68_BORA1/2483-2627-------------------------A-----NT-----------------------------------------------
Q2SAY5_HAHCH/1-160-------------------------D-----KS-----------------------------------------------
Q7N1Z0_PHOLL/2456-2614-------------------------D-----SS-----------------------------------------------
Q7N726_PHOLL/2997-3151-------------------------K-----SS-----------------------------------------------
Q7VV06_BORPE/2551-2702-------------------------E-----QS-----------------------------------------------
Q7VV06_BORPE/2959-3112-------------------------A-----NS-----------------------------------------------
Q7VV06_BORPE/3397-3549-------------------------G-----NA-----------------------------------------------
Q7VV06_BORPE/3808-3959-------------------------A-----TS-----------------------------------------------
Q189K3_PEPD6/575-754-------------------------Y-----DS-----------------------------------------------
Q189K5_PEPD6/577-756-------------------------K-----NS-----------------------------------------------
Q7CGR6_YERPE/772-928-------------------------N-----KS-----------------------------------------------

PF01650

LGMN_HUMAN/29-286------------------PN.....G.....TD-----------------------------------------------
VPED_ARATH/46-316------------------PD.....G.....ED-----------------------------------------------
VPEG_ARATH/59-330------------------PH.....G.....KD-----------------------------------------------
A0CQC7_PARTE/19-285------------------PNED.GFS.....EN-----------------------------------------------
A2FXM6_TRIVA/13-267------------------LD.....H.....LN-----------------------------------------------
O24539_VICNA/53-325------------------PQ.....G.....PN-----------------------------------------------
HGLB_SCHMA/37-291------------------YN.....H.....KD-----------------------------------------------
HGLB_SCHJA/31-285------------------YR.....H.....KD-----------------------------------------------
VPE_VICSA/56-325------------------PD.....G.....DD-----------------------------------------------
A0A080VK93_PSEAI/341-579------------------.......R.....ES-----------------------------------------------
Q08BI0_DANRE/27-278------------------VD.....Q.....TN-----------------------------------------------
Q0MYV8_EMIHU/33-301------------------PTGDGTPG.....TD-----------------------------------------------
Q22P32_TETTS/20-285------------------PL.....G.....DD-----------------------------------------------
Q22P33_TETTS/20-285------------------PN.....G.....QD-----------------------------------------------
D0MXB3_PHYIT/25-298------------------PTTKNASHGAVQPVD-----------------------------------------------
Q2UVF3_HAECO/29-287------------------PS.....L.....TD-----------------------------------------------
Q4K5F2_PSEF5/335-570------------------.......R.....EN-----------------------------------------------
Q4RED0_TETNG/30-283------------------PS.....G.....SD-----------------------------------------------
Q8P9N6_XANCP/124-392------------------.......Y.....DN-----------------------------------------------
Q6EHZ7_TRIVA/12-258------------------LK.....H.....VN-----------------------------------------------
Q6FEB2_ACIAD/229-477------------------.......R.....TS-----------------------------------------------
Q6L4R2_ORYSJ/41-319------------------PS.....G.....PD-----------------------------------------------
Q6NYJ7_DANRE/32-288------------------PN.....G.....SD-----------------------------------------------
Q6PRC7_IXORI/38-293------------------LN.....G.....SN-----------------------------------------------
Q711M2_FASHE/21-278------------------YK.....H.....KD-----------------------------------------------
VPE1_ORYSJ/62-334------------------PK.....G.....GD-----------------------------------------------
Q852T1_TOBAC/49-320------------------PN.....G.....DD-----------------------------------------------
Q88QE3_PSEPK/400-640------------------.......R.....EN-----------------------------------------------
Q949L7_BETVU/51-321------------------PY.....G.....HD-----------------------------------------------
Q9LLQ4_SESIN/54-326------------------PT.....G.....GD-----------------------------------------------
Q9LWZ3_ORYSJ/41-304------------------PN.....G.....PN-----------------------------------------------
Q9SBX2_MAIZE/45-317------------------PQ.....G.....GD-----------------------------------------------
Q9SMD0_SOLLC/39-316------------------PH.....G.....HD-----------------------------------------------
Q9XG75_TOBAC/40-306------------------PH.....G.....HD-----------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227..................KT-----K-----AE-----------------------------------------------
DRONC_DROME/196-443..................VN-----Q-----DQ-----------------------------------------------
O42284_CHICK/42-279..................KT-----S-----QE-----------------------------------------------
CAS1A_XENLA/144-382..................LT-----K-----TE-----------------------------------------------
CASPC_MOUSE/176-415..................LT-----A-----QE-----------------------------------------------
CASP4_MOUSE/132-369..................LT-----A-----EG-----------------------------------------------
CASP5_HUMAN/193-430..................LT-----A-----RD-----------------------------------------------
CASPD_BOVIN/136-373..................LT-----A-----RD-----------------------------------------------
CASP1_CANLF/163-400..................LT-----A-----KG-----------------------------------------------
CASP1_FELCA/161-406..................LT-----A-----KD-----------------------------------------------
CASP1_MOUSE/162-398..................LT-----A-----LE-----------------------------------------------
CASP1_HUMAN/163-400..................LT-----A-----SD-----------------------------------------------
CASP1_PIG/163-400..................LT-----A-----SD-----------------------------------------------
Q9I9L7_DANRE/145-379..................LS-----A-----KE-----------------------------------------------
Q9DDJ2_DANRE/174-400..................LS-----G-----KD-----------------------------------------------
Q6NTR7_XENLA/280-494..................CN-----V-----EH-----------------------------------------------
CFLAR_MOUSE/257-480..................PK-----S-----HD-----------------------------------------------
Q6QN97_PIG/259-484..................LK-----V-----EQ-----------------------------------------------
CFLAR_HUMAN/252-477..................LS-----M-----HG-----------------------------------------------
Q9NBW3_DROME/38-248..................PA-----L-----PD-----------------------------------------------
Q9TZP5_CAEEL/26-261..................LK-----S-----SE-----------------------------------------------
CASPE_MOUSE/22-256..................PT-----A-----QQ-----------------------------------------------
CASPE_HUMAN/18-241..................PT-----A-----EQ-----------------------------------------------
Q8I749_SUBDO/254-491..................IS-----S-----SE-----------------------------------------------
CASP2_RAT/200-445..................QT-----A-----QE-----------------------------------------------
CASP2_CHICK/171-416..................QS-----A-----EE-----------------------------------------------
Q9GV89_HYDVU/93-318..................LK-----R-----ED-----------------------------------------------
Q9IB63_XENLA/144-396..................LT-----G-----QA-----------------------------------------------
CASP9_HUMAN/161-413..................LT-----A-----KK-----------------------------------------------
Q90WU0_CHICK/148-400..................LK-----A-----QE-----------------------------------------------
Q9IB64_XENLA/261-494..................LT-----A-----AN-----------------------------------------------
Q6E5N8_ICTPU/119-362..................QT-----A-----EQ-----------------------------------------------
Q9I8J3_DANRE/238-473..................LE-----A-----WA-----------------------------------------------
Q6PAD9_XENLA/268-495..................LG-----S-----EE-----------------------------------------------
Q90WU1_CHICK/237-479..................CT-----A-----EE-----------------------------------------------
CASP8_HUMAN/234-476..................CT-----V-----EQ-----------------------------------------------
CASP8_MOUSE/236-478..................CT-----A-----NE-----------------------------------------------
Q9Y1U6_PRIPA/173-413..................LT-----G-----KE-----------------------------------------------
CED3_CAEEL/243-494..................LT-----G-----RG-----------------------------------------------
Q7QKT2_ANOGA/35-260..................KT-----T-----VE-----------------------------------------------
Q7PZJ9_ANOGA/20-250..................KT-----K-----HE-----------------------------------------------
Q9GV88_HYDVU/84-316..................PK-----S-----TD-----------------------------------------------
Q7Q1E0_ANOGA/62-291..................FK-----L-----EE-----------------------------------------------
CASP1_SPOFR/61-293..................LK-----S-----EE-----------------------------------------------
CASP1_DROME/79-313..................CK-----L-----RD-----------------------------------------------
Q7Q4X6_ANOGA/73-309..................LK-----L-----RD-----------------------------------------------
DRICE_DROME/94-328..................CR-----Y-----KD-----------------------------------------------
Q9NHF9_DROME/56-302..................LT-----F-----SE-----------------------------------------------
Q7Q803_ANOGA/54-306..................LT-----R-----KE-----------------------------------------------
Q7PV92_ANOGA/14-237..................PN-----R-----KQ-----------------------------------------------
Q86FL0_ANOST/52-286..................LD-----K-----KD-----------------------------------------------
Q8I6Y2_GEOCY/158-414..................LT-----G-----KA-----------------------------------------------
Q8ITP3_BRAFL/87-323..................LP-----C-----RK-----------------------------------------------
O88550_RAT/68-301..................CS-----C-----AK-----------------------------------------------
Q6DCI2_XENLA/78-314..................KS-----C-----EE-----------------------------------------------
Q8JIS8_ORYLA/58-285..................QT-----V-----DQ-----------------------------------------------
CASP3_XENLA/56-280..................QK-----S-----SD-----------------------------------------------
O93417_CHICK/53-281..................LS-----S-----RD-----------------------------------------------
Q98UI8_DANRE/48-280..................QT-----V-----AQ-----------------------------------------------
Q8JG42_TAKRU/51-279..................QT-----V-----NQ-----------------------------------------------
Q8ITP2_BRAFL/151-396..................KE-----I-----TE-----------------------------------------------
Q9IB66_XENLA/58-298..................LR-----T-----MD-----------------------------------------------
Q9I8S9_ONCMY/57-297..................LK-----V-----EE-----------------------------------------------
O93415_CHICK/57-299..................LK-----A-----ED-----------------------------------------------
CASP6_MOUSE/28-270..................LR-----A-----EE-----------------------------------------------
PCP_DICDI/188-404..................SD-----L-----RT-----------------------------------------------
Q7AKE1_STRCO/9-268........NP........CQ-----S-----SE-----------------------------------------------
A0A063TRB6_BORBO/552-800..................PQ-----Q-----TS-----------------------------------------------
Q7NPG1_GLOVI/7-278.................EAT-----I-----KN-----------------------------------------------
Q87Z21_PSESM/2-224..................VT-----S-----ES-----------------------------------------------
Q82I86_STRAW/5-276..................RD-----G-----EA-----------------------------------------------
P74453_SYNY3/40-299..............GITLSA-----L-----EI-----------------------------------------------
Q8YS65_NOSS1/4-245........SPNFGVSSTRPT-----R-----TH-----------------------------------------------
Q9DDL2_DANRE/323-560..................LN-----W-----QE-----------------------------------------------
Q98CE0_RHILO/5-237..................RD-----L-----RR-----------------------------------------------
Q6N0T4_RHOPA/30-250..................LS-----G-----DA-----------------------------------------------
Q89XG2_BRADU/27-247..................LT-----G-----DG-----------------------------------------------
Q89XE4_BRADU/58-278..................AT-----K-----DD-----------------------------------------------
Q6NBN5_RHOPA/57-277..................AS-----R-----DE-----------------------------------------------
Q98JS7_RHILO/35-253...................V-----K-----KS-----------------------------------------------
Q985X8_RHILO/35-256..................VD-----Q-----ES-----------------------------------------------
Q6N5Q1_RHOPA/33-253..................LD-----G-----DT-----------------------------------------------
Q89KP2_BRADU/86-307..................LD-----G-----DT-----------------------------------------------
Q89IK1_BRADU/30-253..................LR-----Q-----AD-----------------------------------------------
Q98G71_RHILO/26-252..................LG-----K-----RE-----------------------------------------------
Q6AKF4_DESPS/28-248..................AD-----Q-----EG-----------------------------------------------
Q98IJ6_RHILO/11-238..................LT-----K-----QQ-----------------------------------------------
Q89MV1_BRADU/176-400..................LD-----K-----GA-----------------------------------------------
Q89HT8_BRADU/51-272..................LT-----Q-----ND-----------------------------------------------
Q89FZ4_BRADU/32-256..................LA-----Q-----NE-----------------------------------------------
Q6N329_RHOPA/73-298..................LG-----Q-----TE-----------------------------------------------
Q98IJ9_RHILO/30-261..................QD-----N-----AG-----------------------------------------------
Q89HP3_BRADU/336-569..................LD-----R-----AA-----------------------------------------------
Q7RFI8_PLAYO/964-1364VDIKNVDLSSKNIDFSLWPT-----R-----IN-----------------------------------------------
Q74F93_GEOSL/6-270..................AT-----R-----AK-----------------------------------------------
MCA9_ARATH/10-321........PESKVK....PT-----G-----AN-----------------------------------------------
MCA8_ARATH/3-378........DKSCIQ....PT-----G-----KN-----------------------------------------------
MCA7_ARATH/3-401..............SYTQPT-----G-----KN-----------------------------------------------
Q70VV0_PICAB/3-415..............SYPQPT-----G-----AN-----------------------------------------------
Q9ZSP8_HEVBR/3-415..............SYIQPT-----G-----KN-----------------------------------------------
MCA4_ARATH/3-416..............SSTQPT-----G-----KN-----------------------------------------------
MCA5_ARATH/3-408..............SSTKPT-----G-----KN-----------------------------------------------
MCA6_ARATH/3-366..............SSIKPT-----G-----KN-----------------------------------------------
MCA1_ARATH/80-362........ETDPYRI...PT-----K-----QN-----------------------------------------------
MCA2_ARATH/116-414...........EADPMRWPT-----K-----NN-----------------------------------------------
MCA1_SCHPO/130-422........ASNQRAI...PT-----R-----QN-----------------------------------------------
MCA1_YARLI/168-458...........QRDQRSIPT-----K-----QN-----------------------------------------------
MCA1_DEBHA/146-437........QNQRARI...PT-----K-----EN-----------------------------------------------
MCA1_ASHGO/154-449...........QHDPVRIPT-----K-----AN-----------------------------------------------
MCA1_KLULA/138-430........TTDPVRV...PT-----K-----AN-----------------------------------------------
MCA1_CANGA/98-389........QREMVKI...PL-----K-----EN-----------------------------------------------
B5VS82_YEAS6/157-450........QNDLVRV...PT-----R-----AN-----------------------------------------------
Q386I9_TRYB2/84-341...........PRFNAIKPT-----R-----AN-----------------------------------------------
Q38D34_TRYB2/63-322.........RRFPNFTAMPT-----R-----EN-----------------------------------------------
Q8T8E6_9TRYP/84-343........DNFPGRTDQ.PT-----R-----DN-----------------------------------------------

PF14538

W1QFK7_OGAPD/56-210------------------PS-----V-----ED-----------------------------------------------
L8WVZ0_THACA/73-224------------------PS-----V-----ED-----------------------------------------------
A2EZ34_TRIVA/89-236------------------PT-----I-----DK-----------------------------------------------
Q6C6R4_YARLI/86-238------------------PN-----V-----ED-----------------------------------------------
M2WI96_DOTSN/172-328------------------PT-----I-----EE-----------------------------------------------
K2S4T3_MACPH/104-258------------------PT-----V-----DE-----------------------------------------------
C4LXC3_ENTHI/42-194------------------PS-----I-----EK-----------------------------------------------
T1G0Q6_HELRO/62-216------------------PT-----T-----DD-----------------------------------------------
B0CNS4_LACBS/34-185------------------PS-----V-----ED-----------------------------------------------
F0ZAV4_DICPU/115-266------------------PT-----V-----EE-----------------------------------------------
U9UGJ5_RHIID/52-203------------------PS-----V-----DE-----------------------------------------------
Q5KIS3_CRYNJ/92-243------------------PS-----I-----ED-----------------------------------------------
B0WBU4_CULQU/30-181------------------VC-----V-----TD-----------------------------------------------
A5DWK2_LODEL/143-295------------------PC-----V-----ED-----------------------------------------------
G0VGR8_NAUCC/79-231------------------PC-----V-----ED-----------------------------------------------
I3J5N7_ORENI/57-208------------------PT-----V-----DE-----------------------------------------------
A2DYM2_TRIVA/68-215------------------PS-----I-----EK-----------------------------------------------
D8TLK8_VOLCA/11-162------------------PT-----V-----ED-----------------------------------------------
G4M000_SCHMA/43-194------------------PT-----L-----DD-----------------------------------------------
C1MUE6_MICPC/45-196------------------PT-----V-----ED-----------------------------------------------
Q387I9_TRYB2/89-240------------------VE-----L-----ED-----------------------------------------------
C4M2F5_ENTHI/38-189------------------PT-----Y-----ED-----------------------------------------------
G4TT65_PIRID/72-223------------------PS-----I-----DE-----------------------------------------------
G0NWW0_CAEBE/64-218------------------PP-----I-----DD-----------------------------------------------
A2DJF0_TRIVA/83-228------------------QV-----E-----LN-----------------------------------------------
K3WJU9_PYTUL/84-235------------------PT-----V-----DE-----------------------------------------------
A2G590_TRIVA/30-180------------------PP-----G-----NK-----------------------------------------------
B8M6V6_TALSN/189-342------------------PS-----V-----DE-----------------------------------------------
A2FJN8_TRIVA/41-191------------------PP-----V-----KD-----------------------------------------------
A2DLR3_TRIVA/97-242------------------LS-----Q-----TK-----------------------------------------------
E5SIN8_TRISP/44-195------------------PT-----V-----DD-----------------------------------------------
I1G727_AMPQE/53-204------------------PT-----T-----DE-----------------------------------------------
U1MN31_ASCSU/95-246------------------PT-----V-----ED-----------------------------------------------
I1L744_SOYBN/123-274------------------PT-----V-----DE-----------------------------------------------
E4XFS5_OIKDI/48-228------------------QN-----I-----DN-----------------------------------------------
D2VMD1_NAEGR/144-294------------------PT-----V-----ED-----------------------------------------------
A9TBL2_PHYPA/91-242------------------PT-----V-----ED-----------------------------------------------
B7PLB3_IXOSC/92-247------------------PT-----V-----EE-----------------------------------------------
A0A0D2USM0_CAPO3/727-878------------------PT-----V-----DD-----------------------------------------------
B8CBK6_THAPS/256-409------------------PT-----V-----EI-----------------------------------------------
A4I1A2_LEIIN/114-279------------------AS-----L-----EV-----------------------------------------------
F4RLY3_MELLP/215-367------------------VY-----S-----EE-----------------------------------------------
K4DUJ2_TRYCR/62-218------------------AH-----L-----EE-----------------------------------------------
H1VVG4_COLHI/158-309------------------PS-----V-----EE-----------------------------------------------
M7XEP3_RHOT1/113-265------------------PP-----I-----ED-----------------------------------------------
A2GCD5_TRIVA/98-247------------------PN-----A-----DR-----------------------------------------------
D8RG53_SELML/72-223------------------PT-----A-----DE-----------------------------------------------
A2F9H3_TRIVA/31-181------------------PS-----A-----QT-----------------------------------------------
L0PHF8_PNEJ8/131-282------------------PS-----I-----EE-----------------------------------------------
RTOR2_ARATH/94-246------------------PT-----K-----DD-----------------------------------------------
M5E8T5_MALS4/58-209------------------PI-----V-----EE-----------------------------------------------
B3RPQ9_TRIAD/43-194------------------PT-----V-----EE-----------------------------------------------
I4Y9Q8_WALMC/76-227------------------PS-----V-----EE-----------------------------------------------
A2E4G0_TRIVA/101-242------------------PS-----S-----EK-----------------------------------------------
A0A068XPC4_HYMMI/269-417------------------PN-----L-----EE-----------------------------------------------
U4LGP0_PYROM/223-374------------------PF-----V-----ED-----------------------------------------------
A2F8U1_TRIVA/65-210------------------PT-----I-----ND-----------------------------------------------
D8T9J0_SELML/50-197------------------ST-----V-----DE-----------------------------------------------
A9V5A2_MONBE/628-777------------------PT-----L-----DE-----------------------------------------------
F0XXV0_AURAN/12-164------------------PT-----A-----DE-----------------------------------------------
A2E336_TRIVA/54-202------------------KY-----F-----TR-----------------------------------------------
B4R5C8_DROSI/214-365------------------PT-----V-----DD-----------------------------------------------
A2EU18_TRIVA/81-227------------------PT-----A-----NS-----------------------------------------------
A2DYB3_TRIVA/12-162------------------PS-----A-----QN-----------------------------------------------
S2KE38_MUCC1/106-257------------------PS-----V-----EE-----------------------------------------------
G7E3R0_MIXOS/173-325------------------PT-----V-----ED-----------------------------------------------

PF03415

Q8A866_BACTN/37-399------------------VD-----V-----DV-----------------------------------------------
Q9WZB1_THEMA/121-462------------------GS-----Y-----TN-----------------------------------------------
Q8XM44_CLOPE/59-508------------------GD-----A-----NT-----------------------------------------------
Q9X1S5_THEMA/586-937------------------GN-----I-----SE-----------------------------------------------
Q9WYY6_THEMA/5-301------------------GD-----P-----VV-----------------------------------------------
Q8TIY6_METAC/66-593------------------GD-----D-----AG-----------------------------------------------

PF12770

A0LJ53_SYNFM/581-921.-------------------------------------------------------------------------------
A0LQE8_SYNFM/635-947.-------------------------------------------------------------------------------
A1BCK0_CHLPD/513-826.-------------------------------------------------------------------------------
A1BEL3_CHLPD/43-361.-------------------------------------------------------------------------------
A1BEL6_CHLPD/46-364.-------------------------------------------------------------------------------
A4HBL7_LEIBR/1053-1432.-------------------------------------------------------------------------------
A8L4T6_FRASN/741-1051.-------------------------------------------------------------------------------
A9WBC0_CHLAA/673-929.-------------------------------------------------------------------------------
A9WER9_CHLAA/54-394.-------------------------------------------------------------------------------
A9WF91_CHLAA/60-360.-------------------------------------------------------------------------------
B0C874_ACAM1/207-507.-------------------------------------------------------------------------------
B2IXC0_NOSP7/1396-1691.-------------------------------------------------------------------------------
B2IZZ4_NOSP7/695-973.-------------------------------------------------------------------------------
B2JAK0_NOSP7/526-830Q-------------------------------------------------------------------------------
B2JAM9_NOSP7/866-1190.-------------------------------------------------------------------------------
B4JKU3_DROGR/1402-1700.-------------------------------------------------------------------------------
C3Z401_BRAFL/1278-1602.-------------------------------------------------------------------------------
F0SR63_RUBBR/137-574.-------------------------------------------------------------------------------
Q01RE6_SOLUE/865-1136.-------------------------------------------------------------------------------
Q024J7_SOLUE/541-814.-------------------------------------------------------------------------------
Q025F1_SOLUE/607-877.-------------------------------------------------------------------------------
Q028B5_SOLUE/667-935L-------------------------------------------------------------------------------
Q02DA1_SOLUE/510-786.-------------------------------------------------------------------------------
Q10YT7_TRIEI/1003-1309.-------------------------------------------------------------------------------
Q10YU6_TRIEI/544-838.-------------------------------------------------------------------------------
Q112V9_TRIEI/62-390.-------------------------------------------------------------------------------
Q113D1_TRIEI/130-430.-------------------------------------------------------------------------------
Q113U8_TRIEI/3002-3297.-------------------------------------------------------------------------------
Q115J8_TRIEI/1466-1777.-------------------------------------------------------------------------------
Q117G6_TRIEI/881-1206.-------------------------------------------------------------------------------
Q119J2_TRIEI/1474-1770.-------------------------------------------------------------------------------
Q16H64_AEDAE/1315-1614.-------------------------------------------------------------------------------
Q2G6U6_NOVAD/692-1020.-------------------------------------------------------------------------------
Q2S6G2_SALRD/540-844A-------------------------------------------------------------------------------
Q2W535_MAGSA/875-1218.-------------------------------------------------------------------------------
Q38C46_TRYB2/1044-1397.-------------------------------------------------------------------------------
Q3AQG5_CHLCH/44-362.-------------------------------------------------------------------------------
Q5LLA3_RUEPO/680-970.-------------------------------------------------------------------------------
Q7NCT1_GLOVI/600-923.-------------------------------------------------------------------------------
Q7NF67_GLOVI/550-854.-------------------------------------------------------------------------------
Q7NFD7_GLOVI/666-979.-------------------------------------------------------------------------------
Q7NIF7_GLOVI/691-997.-------------------------------------------------------------------------------
Q7NJE3_GLOVI/660-988.-------------------------------------------------------------------------------
Q7NLR0_GLOVI/653-961.-------------------------------------------------------------------------------
Q7NVB0_CHRVO/67-386.-------------------------------------------------------------------------------
Q82I85_STRAW/1175-1481.-------------------------------------------------------------------------------
Q82L10_STRAW/969-1256L-------------------------------------------------------------------------------
Q8DGG5_THEEB/541-835.-------------------------------------------------------------------------------
Q8DH74_THEEB/570-891.-------------------------------------------------------------------------------
Q8DHI1_THEEB/67-394.-------------------------------------------------------------------------------
Q8DIE5_THEEB/1127-1420.-------------------------------------------------------------------------------
Q8YZU5_NOSS1/56-340.-------------------------------------------------------------------------------
TTC28_HUMAN/1390-1713.-------------------------------------------------------------------------------

PF03568

Q5KMS4_CRYNJ/1710-2122--------------------------------------------------------------------------------
A8PX94_MALGO/1441-1824--------------------------------------------------------------------------------
M7XLD2_RHOT1/1703-2100--------------------------------------------------------------------------------
U5HB45_USTV1/1850-2253--------------------------------------------------------------------------------
F4RLY9_MELLP/91-479--------------------------------------------------------------------------------
T1IUX7_STRMM/1624-1980--------------------------------------------------------------------------------
A7RYA6_NEMVE/1651-2034--------------------------------------------------------------------------------
T1FT05_HELRO/413-770--------------------------------------------------------------------------------
W4Y9R2_STRPU/1031-1383--------------------------------------------------------------------------------
G3N6G2_GASAC/1731-2077--------------------------------------------------------------------------------
H3DAQ7_TETNG/1711-2057--------------------------------------------------------------------------------
I3KSG7_ORENI/1715-2061--------------------------------------------------------------------------------
H2L8K9_ORYLA/1692-2038--------------------------------------------------------------------------------
M3ZIW2_XIPMA/1768-2114--------------------------------------------------------------------------------
ESPL1_MOUSE/1716-2065--------------------------------------------------------------------------------
F7BUI1_CALJA/1724-2073--------------------------------------------------------------------------------
G3VPI8_SARHA/1713-2063--------------------------------------------------------------------------------
U3IXX7_ANAPL/1332-1679--------------------------------------------------------------------------------
G1KFP0_ANOCA/1819-2167--------------------------------------------------------------------------------
H3B3H1_LATCH/1699-2055--------------------------------------------------------------------------------
F6VXN8_XENTR/1732-2080--------------------------------------------------------------------------------
Q6ZHH8_ORYSJ/455-870--------------------------------------------------------------------------------
W5GJD2_WHEAT/891-1304--------------------------------------------------------------------------------
K3Z105_SETIT/1078-1484--------------------------------------------------------------------------------
C5XYE8_SORBI/457-870--------------------------------------------------------------------------------
C5XSY3_SORBI/1425-1832--------------------------------------------------------------------------------
K3Y3B2_SETIT/1404-1817--------------------------------------------------------------------------------
M0UBW7_MUSAM/65-479--------------------------------------------------------------------------------
ESP1_ARATH/1641-2060--------------------------------------------------------------------------------
M4DS49_BRARP/1599-2019--------------------------------------------------------------------------------
B9GZR1_POPTR/1674-2094--------------------------------------------------------------------------------
B9SSN4_RICCO/1627-2045--------------------------------------------------------------------------------
I1MDQ8_SOYBN/1648-2063--------------------------------------------------------------------------------
K4B224_SOLLC/1600-2023--------------------------------------------------------------------------------
W1NKX2_AMBTC/1-423--------------------------------------------------------------------------------
K7H1P7_CAEJA/245-604--------------------------------------------------------------------------------
E3LM18_CAERE/731-1090--------------------------------------------------------------------------------
G5ED39_CAEEL/727-1081--------------------------------------------------------------------------------
Q23491_CAEEL/749-1101--------------------------------------------------------------------------------
S3CR95_OPHP1/1758-2208--------------------------------------------------------------------------------
F0XAD9_GROCL/1636-2054--------------------------------------------------------------------------------
G2R9B0_THITE/1619-2058--------------------------------------------------------------------------------
Q2H6Q9_CHAGB/1612-2026--------------------------------------------------------------------------------
G0SHM3_CHATD/1723-2150--------------------------------------------------------------------------------
G4UQF5_NEUT9/1626-2085--------------------------------------------------------------------------------
G4N8I2_MAGO7/1627-2057--------------------------------------------------------------------------------
J3P7L5_GAGT3/1606-2054--------------------------------------------------------------------------------
R8BFS3_TOGMI/72-487--------------------------------------------------------------------------------
N4UZ87_COLOR/1637-2043--------------------------------------------------------------------------------
G2X6M8_VERDV/1704-2113--------------------------------------------------------------------------------
G0RRT6_HYPJQ/1566-1971--------------------------------------------------------------------------------
M1WFQ9_CLAP2/1438-1889--------------------------------------------------------------------------------
J5K578_BEAB2/1584-1996--------------------------------------------------------------------------------
C7YYU1_NECH7/1580-1992--------------------------------------------------------------------------------
M7T4Q8_EUTLA/44-499--------------------------------------------------------------------------------
L8G205_PSED2/1652-2056--------------------------------------------------------------------------------
N1JFH1_BLUG1/1598-2001--------------------------------------------------------------------------------
K1X2E6_MARBU/1659-2061--------------------------------------------------------------------------------
S3D029_GLAL2/1639-2043--------------------------------------------------------------------------------
M7TX51_BOTF1/1640-2041--------------------------------------------------------------------------------
BIMB_EMENI/1609-2004--------------------------------------------------------------------------------
Q2USV7_ASPOR/1630-2030--------------------------------------------------------------------------------
G7XGU8_ASPKW/1627-2026--------------------------------------------------------------------------------
S8BGE7_PENO1/1622-2018--------------------------------------------------------------------------------
B6GZP8_PENRW/1602-1998--------------------------------------------------------------------------------
Q4WUU6_ASPFU/1638-2039--------------------------------------------------------------------------------
B6QNB5_TALMQ/1619-2016--------------------------------------------------------------------------------
V5GCB2_BYSSN/1684-2084--------------------------------------------------------------------------------
F0UL09_AJEC8/1642-2044--------------------------------------------------------------------------------
C5FSW7_ARTOC/1655-2058--------------------------------------------------------------------------------
H6C6Q4_EXODN/1587-1987--------------------------------------------------------------------------------
U1G8A9_ENDPU/1638-2036--------------------------------------------------------------------------------
K2R7J5_MACPH/1619-2043--------------------------------------------------------------------------------
R7YNT5_CONA1/1696-2117--------------------------------------------------------------------------------
E4ZTB4_LEPMJ/1652-2063--------------------------------------------------------------------------------
N1QAI8_PSEFD/1492-1912--------------------------------------------------------------------------------
N1QHR1_SPHMS/1187-1599--------------------------------------------------------------------------------
N1PZ16_DOTSN/1513-1936--------------------------------------------------------------------------------
D5GKQ4_TUBMM/1633-2033--------------------------------------------------------------------------------
U4LG69_PYROM/1616-2019--------------------------------------------------------------------------------
S8C8B1_DACHA/1639-2040--------------------------------------------------------------------------------
Q6CCJ0_YARLI/1210-1588--------------------------------------------------------------------------------
S9X830_SCHCR/1385-1771--------------------------------------------------------------------------------
CUT1_SCHPO/1383-1770--------------------------------------------------------------------------------
B6K0I6_SCHJY/1359-1747--------------------------------------------------------------------------------
M7PDE3_PNEMU/1489-1882--------------------------------------------------------------------------------
G8BT64_TETPH/1165-1563--------------------------------------------------------------------------------
I2H0Y5_TETBL/1280-1677--------------------------------------------------------------------------------
S6EFD3_ZYGB2/1145-1542--------------------------------------------------------------------------------
C5DU01_ZYGRC/1141-1538--------------------------------------------------------------------------------
G8ZWZ1_TORDC/1158-1555--------------------------------------------------------------------------------
G0WDN6_NAUDC/1191-1589--------------------------------------------------------------------------------
G0VFB3_NAUCC/1164-1562--------------------------------------------------------------------------------
H2B1L5_KAZAF/1161-1559--------------------------------------------------------------------------------
ESP1_YEAST/1175-1571--------------------------------------------------------------------------------
J7RG90_KAZNA/1160-1562--------------------------------------------------------------------------------
Q75EJ0_ASHGO/1152-1552--------------------------------------------------------------------------------
C5DHM1_LACTC/1178-1575--------------------------------------------------------------------------------
Q6CQQ7_KLULA/1118-1516--------------------------------------------------------------------------------
Q6FTE1_CANGA/1151-1548--------------------------------------------------------------------------------
K0K8V1_WICCF/1175-1568--------------------------------------------------------------------------------
A5DNR9_PICGU/1178-1576--------------------------------------------------------------------------------
A3GFF5_PICST/1168-1555--------------------------------------------------------------------------------
Q6BTB7_DEBHA/1338-1753--------------------------------------------------------------------------------
Q5A8X8_CANAL/1101-1536--------------------------------------------------------------------------------
C5MEH0_CANTT/925-1303--------------------------------------------------------------------------------
M3HH45_CANMX/1423-1797--------------------------------------------------------------------------------
G8B5X7_CANPC/1052-1424--------------------------------------------------------------------------------
A5DVQ7_LODEL/1109-1530--------------------------------------------------------------------------------
G3AGZ6_SPAPN/1149-1535--------------------------------------------------------------------------------
G8YBL5_PICSO/1309-1719--------------------------------------------------------------------------------
C4XY11_CLAL4/1177-1564--------------------------------------------------------------------------------
G3B782_CANTC/1213-1609--------------------------------------------------------------------------------
W1QIM9_OGAPD/1167-1527--------------------------------------------------------------------------------
C4QYS2_PICPG/1259-1619--------------------------------------------------------------------------------
K5WME3_PHACS/1732-2136--------------------------------------------------------------------------------
M2R2K9_CERS8/1618-2024--------------------------------------------------------------------------------
F8PLA9_SERL3/1278-1688--------------------------------------------------------------------------------
S8E105_FOMPI/1678-2083--------------------------------------------------------------------------------
A8NBE9_COPC7/1839-2276--------------------------------------------------------------------------------
B0E1W0_LACBS/104-540--------------------------------------------------------------------------------
D8Q1W5_SCHCM/1450-1878--------------------------------------------------------------------------------
V2X3W8_MONRO/1588-2040--------------------------------------------------------------------------------
J0DCK6_AURST/1634-2046--------------------------------------------------------------------------------
R9AIE1_WALI9/1639-2036--------------------------------------------------------------------------------
I4YB88_WALMC/1631-2030--------------------------------------------------------------------------------
G4T5A4_PIRID/1472-1874--------------------------------------------------------------------------------

PF01364

KGP83_PORGN/244-595................................................................................
D1JG83_9ARCH/891-1295TLLAQEGY........................................................................
A2U064_9FLAO/401-768S...............................................................................
Q7MTE2_PORGI/239-573................................................................................
D3HWT0_9BACT/400-777S...............................................................................
Q5S3Q9_9FLAO/543-910S...............................................................................
A9DMD5_9FLAO/555-923S...............................................................................
B0VGA8_CLOAI/228-563................................................................................
B7B5I7_9PORP/382-753S...............................................................................
B8FFM0_DESAA/254-600ATWN............................................................................
A3U7G6_CROAH/540-908S...............................................................................
D2QSX9_SPILD/414-786S...............................................................................
A3HW99_9BACT/398-769................................................................................
B0VHP2_CLOAI/234-563................................................................................
A8ZUB1_DESOH/278-656E...............................................................................
B0VIM2_CLOAI/182-528P...............................................................................
Q2Z0E1_9BACT/643-1013................................................................................
B3QXR8_CHLT3/734-1131................................................................................
C2MCN4_9PORP/405-781S...............................................................................
A4A325_9PLAN/24-399VVN.............................................................................
A7NR84_ROSCS/499-867................................................................................
Q11Q36_CYTH3/558-932S...............................................................................
Q7MX16_PORGI/272-637................................................................................
A0B5K7_METTP/796-1154................................................................................
D0MH89_RHOM4/586-975S...............................................................................
A8UH97_9FLAO/539-910S...............................................................................
B8KYL6_9GAMM/364-704................................................................................
B8FIK5_DESAA/1139-1542A...............................................................................
Q11US7_CYTH3/392-767................................................................................
C6W101_DYAFD/326-680................................................................................
A5FJM8_FLAJ1/544-914S...............................................................................
Q7UG73_RHOBA/51-444PVT.............................................................................
A3J247_9FLAO/540-919PLASET..........................................................................
A9WIM0_CHLAA/500-869................................................................................
B0VHE7_CLOAI/227-554................................................................................
C6VT06_DYAFD/394-758................................................................................
C6X3N8_FLAB3/546-921S...............................................................................
A0LQH1_SYNFM/790-1132................................................................................
A1ZVJ9_9BACT/406-774S...............................................................................
B0VHF1_CLOAI/214-595................................................................................
B0VIE7_CLOAI/193-598................................................................................
C6W3P4_DYAFD/414-806................................................................................
B2RGP6_PORG3/408-787S...............................................................................
D2QJ99_SPILD/409-770................................................................................
A9B5Q8_HERA2/466-850................................................................................
D2QFF3_SPILD/397-745................................................................................
B0VH03_CLOAI/589-939................................................................................
D2R2P5_PIRSD/21-411KVN.............................................................................
C6W0Z3_DYAFD/393-758S...............................................................................
A3XQP5_LEEBM/552-929S...............................................................................
Q2PY26_9BACT/412-780S...............................................................................
Q26FX7_FLABB/537-909A...............................................................................
B0VJT2_CLOAI/236-566................................................................................
C6BTD6_DESAD/56-402................................................................................
D2QE53_SPILD/328-1007LRHDSSTGAFALRTVPDPQNPGKTKQVFDDTQPFRTLCNATSGKIISFNLNASAQQPGWYFTKESEFMDAKKTTGFTRLA
A2BK55_HYPBU/159-551PILS............................................................................
B0VHP1_CLOAI/283-636................................................................................
Q1Q1Y4_9BACT/620-970................................................................................
C7PNY3_CHIPD/396-764S...............................................................................
Q6LFY5_PHOPR/224-617HP..............................................................................
B3QVL4_CHLT3/688-1063V...............................................................................
A9B187_HERA2/552-907................................................................................
R5M3W7_9BACE/537-910S...............................................................................
B0VJY1_CLOAI/655-1014................................................................................
B8G4Y1_CHLAD/584-1054GADKDYSQAP......................................................................
A1ZEG7_9BACT/410-775................................................................................
B0VF22_CLOAI/223-583................................................................................
A0LKV0_SYNFM/924-1265................................................................................
A8ZTD5_DESOH/257-648................................................................................
A9B8S0_HERA2/477-840................................................................................
C3JBB2_POREA/421-799S...............................................................................
C9SW40_VERA1/279-917TWWGASTDNLLVRPDTGALIRYDAAGTSSSTSPGW........................................YFTTA
C9LI59_9BACT/509-899GDGQT...........................................................................
B5ICF9_ACIB4/214-642................................................................................
Y048_ARCFU/22-377................................................................................
A3I371_9BACT/360-725S...............................................................................

PF11713

MARTX_VIBCH/3469-3626--------------------------------------------------------------------------------
A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------

PF01650

LGMN_HUMAN/29-286--------------------------------------------------------------------------------
VPED_ARATH/46-316--------------------------------------------------------------------------------
VPEG_ARATH/59-330--------------------------------------------------------------------------------
A0CQC7_PARTE/19-285--------------------------------------------------------------------------------
A2FXM6_TRIVA/13-267--------------------------------------------------------------------------------
O24539_VICNA/53-325--------------------------------------------------------------------------------
HGLB_SCHMA/37-291--------------------------------------------------------------------------------
HGLB_SCHJA/31-285--------------------------------------------------------------------------------
VPE_VICSA/56-325--------------------------------------------------------------------------------
A0A080VK93_PSEAI/341-579--------------------------------------------------------------------------------
Q08BI0_DANRE/27-278--------------------------------------------------------------------------------
Q0MYV8_EMIHU/33-301--------------------------------------------------------------------------------
Q22P32_TETTS/20-285--------------------------------------------------------------------------------
Q22P33_TETTS/20-285--------------------------------------------------------------------------------
D0MXB3_PHYIT/25-298--------------------------------------------------------------------------------
Q2UVF3_HAECO/29-287--------------------------------------------------------------------------------
Q4K5F2_PSEF5/335-570--------------------------------------------------------------------------------
Q4RED0_TETNG/30-283--------------------------------------------------------------------------------
Q8P9N6_XANCP/124-392--------------------------------------------------------------------------------
Q6EHZ7_TRIVA/12-258--------------------------------------------------------------------------------
Q6FEB2_ACIAD/229-477--------------------------------------------------------------------------------
Q6L4R2_ORYSJ/41-319--------------------------------------------------------------------------------
Q6NYJ7_DANRE/32-288--------------------------------------------------------------------------------
Q6PRC7_IXORI/38-293--------------------------------------------------------------------------------
Q711M2_FASHE/21-278--------------------------------------------------------------------------------
VPE1_ORYSJ/62-334--------------------------------------------------------------------------------
Q852T1_TOBAC/49-320--------------------------------------------------------------------------------
Q88QE3_PSEPK/400-640--------------------------------------------------------------------------------
Q949L7_BETVU/51-321--------------------------------------------------------------------------------
Q9LLQ4_SESIN/54-326--------------------------------------------------------------------------------
Q9LWZ3_ORYSJ/41-304--------------------------------------------------------------------------------
Q9SBX2_MAIZE/45-317--------------------------------------------------------------------------------
Q9SMD0_SOLLC/39-316--------------------------------------------------------------------------------
Q9XG75_TOBAC/40-306--------------------------------------------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227--------------------------------------------------------------------------------
DRONC_DROME/196-443--------------------------------------------------------------------------------
O42284_CHICK/42-279--------------------------------------------------------------------------------
CAS1A_XENLA/144-382--------------------------------------------------------------------------------
CASPC_MOUSE/176-415--------------------------------------------------------------------------------
CASP4_MOUSE/132-369--------------------------------------------------------------------------------
CASP5_HUMAN/193-430--------------------------------------------------------------------------------
CASPD_BOVIN/136-373--------------------------------------------------------------------------------
CASP1_CANLF/163-400--------------------------------------------------------------------------------
CASP1_FELCA/161-406--------------------------------------------------------------------------------
CASP1_MOUSE/162-398--------------------------------------------------------------------------------
CASP1_HUMAN/163-400--------------------------------------------------------------------------------
CASP1_PIG/163-400--------------------------------------------------------------------------------
Q9I9L7_DANRE/145-379--------------------------------------------------------------------------------
Q9DDJ2_DANRE/174-400--------------------------------------------------------------------------------
Q6NTR7_XENLA/280-494--------------------------------------------------------------------------------
CFLAR_MOUSE/257-480--------------------------------------------------------------------------------
Q6QN97_PIG/259-484--------------------------------------------------------------------------------
CFLAR_HUMAN/252-477--------------------------------------------------------------------------------
Q9NBW3_DROME/38-248--------------------------------------------------------------------------------
Q9TZP5_CAEEL/26-261--------------------------------------------------------------------------------
CASPE_MOUSE/22-256--------------------------------------------------------------------------------
CASPE_HUMAN/18-241--------------------------------------------------------------------------------
Q8I749_SUBDO/254-491--------------------------------------------------------------------------------
CASP2_RAT/200-445--------------------------------------------------------------------------------
CASP2_CHICK/171-416--------------------------------------------------------------------------------
Q9GV89_HYDVU/93-318--------------------------------------------------------------------------------
Q9IB63_XENLA/144-396--------------------------------------------------------------------------------
CASP9_HUMAN/161-413--------------------------------------------------------------------------------
Q90WU0_CHICK/148-400--------------------------------------------------------------------------------
Q9IB64_XENLA/261-494--------------------------------------------------------------------------------
Q6E5N8_ICTPU/119-362--------------------------------------------------------------------------------
Q9I8J3_DANRE/238-473--------------------------------------------------------------------------------
Q6PAD9_XENLA/268-495--------------------------------------------------------------------------------
Q90WU1_CHICK/237-479--------------------------------------------------------------------------------
CASP8_HUMAN/234-476--------------------------------------------------------------------------------
CASP8_MOUSE/236-478--------------------------------------------------------------------------------
Q9Y1U6_PRIPA/173-413--------------------------------------------------------------------------------
CED3_CAEEL/243-494--------------------------------------------------------------------------------
Q7QKT2_ANOGA/35-260--------------------------------------------------------------------------------
Q7PZJ9_ANOGA/20-250--------------------------------------------------------------------------------
Q9GV88_HYDVU/84-316--------------------------------------------------------------------------------
Q7Q1E0_ANOGA/62-291--------------------------------------------------------------------------------
CASP1_SPOFR/61-293--------------------------------------------------------------------------------
CASP1_DROME/79-313--------------------------------------------------------------------------------
Q7Q4X6_ANOGA/73-309--------------------------------------------------------------------------------
DRICE_DROME/94-328--------------------------------------------------------------------------------
Q9NHF9_DROME/56-302--------------------------------------------------------------------------------
Q7Q803_ANOGA/54-306--------------------------------------------------------------------------------
Q7PV92_ANOGA/14-237--------------------------------------------------------------------------------
Q86FL0_ANOST/52-286--------------------------------------------------------------------------------
Q8I6Y2_GEOCY/158-414--------------------------------------------------------------------------------
Q8ITP3_BRAFL/87-323--------------------------------------------------------------------------------
O88550_RAT/68-301--------------------------------------------------------------------------------
Q6DCI2_XENLA/78-314--------------------------------------------------------------------------------
Q8JIS8_ORYLA/58-285--------------------------------------------------------------------------------
CASP3_XENLA/56-280--------------------------------------------------------------------------------
O93417_CHICK/53-281--------------------------------------------------------------------------------
Q98UI8_DANRE/48-280--------------------------------------------------------------------------------
Q8JG42_TAKRU/51-279--------------------------------------------------------------------------------
Q8ITP2_BRAFL/151-396--------------------------------------------------------------------------------
Q9IB66_XENLA/58-298--------------------------------------------------------------------------------
Q9I8S9_ONCMY/57-297--------------------------------------------------------------------------------
O93415_CHICK/57-299--------------------------------------------------------------------------------
CASP6_MOUSE/28-270--------------------------------------------------------------------------------
PCP_DICDI/188-404--------------------------------------------------------------------------------
Q7AKE1_STRCO/9-268--------------------------------------------------------------------------------
A0A063TRB6_BORBO/552-800--------------------------------------------------------------------------------
Q7NPG1_GLOVI/7-278--------------------------------------------------------------------------------
Q87Z21_PSESM/2-224--------------------------------------------------------------------------------
Q82I86_STRAW/5-276--------------------------------------------------------------------------------
P74453_SYNY3/40-299--------------------------------------------------------------------------------
Q8YS65_NOSS1/4-245--------------------------------------------------------------------------------
Q9DDL2_DANRE/323-560--------------------------------------------------------------------------------
Q98CE0_RHILO/5-237--------------------------------------------------------------------------------
Q6N0T4_RHOPA/30-250--------------------------------------------------------------------------------
Q89XG2_BRADU/27-247--------------------------------------------------------------------------------
Q89XE4_BRADU/58-278--------------------------------------------------------------------------------
Q6NBN5_RHOPA/57-277--------------------------------------------------------------------------------
Q98JS7_RHILO/35-253--------------------------------------------------------------------------------
Q985X8_RHILO/35-256--------------------------------------------------------------------------------
Q6N5Q1_RHOPA/33-253--------------------------------------------------------------------------------
Q89KP2_BRADU/86-307--------------------------------------------------------------------------------
Q89IK1_BRADU/30-253--------------------------------------------------------------------------------
Q98G71_RHILO/26-252--------------------------------------------------------------------------------
Q6AKF4_DESPS/28-248--------------------------------------------------------------------------------
Q98IJ6_RHILO/11-238--------------------------------------------------------------------------------
Q89MV1_BRADU/176-400--------------------------------------------------------------------------------
Q89HT8_BRADU/51-272--------------------------------------------------------------------------------
Q89FZ4_BRADU/32-256--------------------------------------------------------------------------------
Q6N329_RHOPA/73-298--------------------------------------------------------------------------------
Q98IJ9_RHILO/30-261--------------------------------------------------------------------------------
Q89HP3_BRADU/336-569--------------------------------------------------------------------------------
Q7RFI8_PLAYO/964-1364--------------------------------------------------------------------------------
Q74F93_GEOSL/6-270--------------------------------------------------------------------------------
MCA9_ARATH/10-321--------------------------------------------------------------------------------
MCA8_ARATH/3-378--------------------------------------------------------------------------------
MCA7_ARATH/3-401--------------------------------------------------------------------------------
Q70VV0_PICAB/3-415--------------------------------------------------------------------------------
Q9ZSP8_HEVBR/3-415--------------------------------------------------------------------------------
MCA4_ARATH/3-416--------------------------------------------------------------------------------
MCA5_ARATH/3-408--------------------------------------------------------------------------------
MCA6_ARATH/3-366--------------------------------------------------------------------------------
MCA1_ARATH/80-362--------------------------------------------------------------------------------
MCA2_ARATH/116-414--------------------------------------------------------------------------------
MCA1_SCHPO/130-422--------------------------------------------------------------------------------
MCA1_YARLI/168-458--------------------------------------------------------------------------------
MCA1_DEBHA/146-437--------------------------------------------------------------------------------
MCA1_ASHGO/154-449--------------------------------------------------------------------------------
MCA1_KLULA/138-430--------------------------------------------------------------------------------
MCA1_CANGA/98-389--------------------------------------------------------------------------------
B5VS82_YEAS6/157-450--------------------------------------------------------------------------------
Q386I9_TRYB2/84-341--------------------------------------------------------------------------------
Q38D34_TRYB2/63-322--------------------------------------------------------------------------------
Q8T8E6_9TRYP/84-343--------------------------------------------------------------------------------

PF14538

W1QFK7_OGAPD/56-210--------------------------------------------------------------------------------
L8WVZ0_THACA/73-224--------------------------------------------------------------------------------
A2EZ34_TRIVA/89-236--------------------------------------------------------------------------------
Q6C6R4_YARLI/86-238--------------------------------------------------------------------------------
M2WI96_DOTSN/172-328--------------------------------------------------------------------------------
K2S4T3_MACPH/104-258--------------------------------------------------------------------------------
C4LXC3_ENTHI/42-194--------------------------------------------------------------------------------
T1G0Q6_HELRO/62-216--------------------------------------------------------------------------------
B0CNS4_LACBS/34-185--------------------------------------------------------------------------------
F0ZAV4_DICPU/115-266--------------------------------------------------------------------------------
U9UGJ5_RHIID/52-203--------------------------------------------------------------------------------
Q5KIS3_CRYNJ/92-243--------------------------------------------------------------------------------
B0WBU4_CULQU/30-181--------------------------------------------------------------------------------
A5DWK2_LODEL/143-295--------------------------------------------------------------------------------
G0VGR8_NAUCC/79-231--------------------------------------------------------------------------------
I3J5N7_ORENI/57-208--------------------------------------------------------------------------------
A2DYM2_TRIVA/68-215--------------------------------------------------------------------------------
D8TLK8_VOLCA/11-162--------------------------------------------------------------------------------
G4M000_SCHMA/43-194--------------------------------------------------------------------------------
C1MUE6_MICPC/45-196--------------------------------------------------------------------------------
Q387I9_TRYB2/89-240--------------------------------------------------------------------------------
C4M2F5_ENTHI/38-189--------------------------------------------------------------------------------
G4TT65_PIRID/72-223--------------------------------------------------------------------------------
G0NWW0_CAEBE/64-218--------------------------------------------------------------------------------
A2DJF0_TRIVA/83-228--------------------------------------------------------------------------------
K3WJU9_PYTUL/84-235--------------------------------------------------------------------------------
A2G590_TRIVA/30-180--------------------------------------------------------------------------------
B8M6V6_TALSN/189-342--------------------------------------------------------------------------------
A2FJN8_TRIVA/41-191--------------------------------------------------------------------------------
A2DLR3_TRIVA/97-242--------------------------------------------------------------------------------
E5SIN8_TRISP/44-195--------------------------------------------------------------------------------
I1G727_AMPQE/53-204--------------------------------------------------------------------------------
U1MN31_ASCSU/95-246--------------------------------------------------------------------------------
I1L744_SOYBN/123-274--------------------------------------------------------------------------------
E4XFS5_OIKDI/48-228--------------------------------------------------------------------------------
D2VMD1_NAEGR/144-294--------------------------------------------------------------------------------
A9TBL2_PHYPA/91-242--------------------------------------------------------------------------------
B7PLB3_IXOSC/92-247--------------------------------------------------------------------------------
A0A0D2USM0_CAPO3/727-878--------------------------------------------------------------------------------
B8CBK6_THAPS/256-409--------------------------------------------------------------------------------
A4I1A2_LEIIN/114-279--------------------------------------------------------------------------------
F4RLY3_MELLP/215-367--------------------------------------------------------------------------------
K4DUJ2_TRYCR/62-218--------------------------------------------------------------------------------
H1VVG4_COLHI/158-309--------------------------------------------------------------------------------
M7XEP3_RHOT1/113-265--------------------------------------------------------------------------------
A2GCD5_TRIVA/98-247--------------------------------------------------------------------------------
D8RG53_SELML/72-223--------------------------------------------------------------------------------
A2F9H3_TRIVA/31-181--------------------------------------------------------------------------------
L0PHF8_PNEJ8/131-282--------------------------------------------------------------------------------
RTOR2_ARATH/94-246--------------------------------------------------------------------------------
M5E8T5_MALS4/58-209--------------------------------------------------------------------------------
B3RPQ9_TRIAD/43-194--------------------------------------------------------------------------------
I4Y9Q8_WALMC/76-227--------------------------------------------------------------------------------
A2E4G0_TRIVA/101-242--------------------------------------------------------------------------------
A0A068XPC4_HYMMI/269-417--------------------------------------------------------------------------------
U4LGP0_PYROM/223-374--------------------------------------------------------------------------------
A2F8U1_TRIVA/65-210--------------------------------------------------------------------------------
D8T9J0_SELML/50-197--------------------------------------------------------------------------------
A9V5A2_MONBE/628-777--------------------------------------------------------------------------------
F0XXV0_AURAN/12-164--------------------------------------------------------------------------------
A2E336_TRIVA/54-202--------------------------------------------------------------------------------
B4R5C8_DROSI/214-365--------------------------------------------------------------------------------
A2EU18_TRIVA/81-227--------------------------------------------------------------------------------
A2DYB3_TRIVA/12-162--------------------------------------------------------------------------------
S2KE38_MUCC1/106-257--------------------------------------------------------------------------------
G7E3R0_MIXOS/173-325--------------------------------------------------------------------------------

PF03415

Q8A866_BACTN/37-399--------------------------------------------------------------------------------
Q9WZB1_THEMA/121-462--------------------------------------------------------------------------------
Q8XM44_CLOPE/59-508--------------------------------------------------------------------------------
Q9X1S5_THEMA/586-937--------------------------------------------------------------------------------
Q9WYY6_THEMA/5-301--------------------------------------------------------------------------------
Q8TIY6_METAC/66-593--------------------------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921-------------------------..LKTLR-------EAAAIRKAGADY.....PLL---------------------
A0LQE8_SYNFM/635-947-------------------------..LRDSP-------SLSWQVAG...........F---------------------
A1BCK0_CHLPD/513-826-------------------------..LLSGE-------SGVGCASGSL.........L---------------------
A1BEL3_CHLPD/43-361-------------------------..LSRS.-------SPAIKVHMPDIETGPLRILL---------------------
A1BEL6_CHLPD/46-364-------------------------..LSRT.-------IPSIKTGVSDIEPGPLRILL---------------------
A4HBL7_LEIBR/1053-1432-------------------------..ATQAA-------FAALSAVRVQQQDLHREVVA---------------------
A8L4T6_FRASN/741-1051-------------------------..LAATR-------IAPGPARSGDL.......LL---------------------
A9WBC0_CHLAA/673-929-------------------------..LLGIP-------VPAGPSGPA..........L---------------------
A9WER9_CHLAA/54-394-------------------------..FSRYI-------DSEQFALFEPIDHHPIRLLL---------------------
A9WF91_CHLAA/60-360-------------------------..FSRYL-------TSNDVQPIRARSRNALRVLI---------------------
B0C874_ACAM1/207-507-------------------------..LTDTR-------FAPIQGKQV..........L---------------------
B2IXC0_NOSP7/1396-1691-------------------------..LTNTL-------YKDIKKSQV..........L---------------------
B2IZZ4_NOSP7/695-973-------------------------..RRSPS-------NSIISKQKA..........L---------------------
B2JAK0_NOSP7/526-830-------------------------LLIEDDE-------RVSNVQLPDINNNETQRNIF---------------------
B2JAM9_NOSP7/866-1190-------------------------..ISVVR-------NETKNRNVAVKK......LA---------------------
B4JKU3_DROGR/1402-1700-------------------------..LRGRS-------RSRRDRGRPPT.......AL---------------------
C3Z401_BRAFL/1278-1602-------------------------..LSMNQ-------QGHPQSRPSDVL.....PGL---------------------
F0SR63_RUBBR/137-574-------------------------..LVELC-------NRVDGQASGL.........L---------------------
Q01RE6_SOLUE/865-1136-------------------------..LAPTG-------EAAISAASRM.........L---------------------
Q024J7_SOLUE/541-814-------------------------..LAGKP-------PDSHPAHRL..........L---------------------
Q025F1_SOLUE/607-877-------------------------..LRQDR-------RSGGPAGREL.........L---------------------
Q028B5_SOLUE/667-935-------------------------YEMEKMR-------PAHRASQPR..........L---------------------
Q02DA1_SOLUE/510-786-------------------------..YQRRT-------VAGPVESGARA........L---------------------
Q10YT7_TRIEI/1003-1309-------------------------..LLTFT-------STPRNTSPA..........V---------------------
Q10YU6_TRIEI/544-838-------------------------..LLPPK-------PLLKQQIRV..........L---------------------
Q112V9_TRIEI/62-390-------------------------..LEESN-------KLSIKINQDEQLK....IAL---------------------
Q113D1_TRIEI/130-430-------------------------..LVTVR-------WQDITNPEDLDNVNGFINLE---------------------
Q113U8_TRIEI/3002-3297-------------------------..LMDTN-------YRPLQGTQV..........L---------------------
Q115J8_TRIEI/1466-1777-------------------------..LQKVR-------ERNNQEFQSL.........F---------------------
Q117G6_TRIEI/881-1206-------------------------..LLQLT-------TKARKTSPA..........L---------------------
Q119J2_TRIEI/1474-1770-------------------------..LTDTR-------YLGLDGSQV..........L---------------------
Q16H64_AEDAE/1315-1614-------------------------..LRQKS-------RTKTREPGLNS.......AL---------------------
Q2G6U6_NOVAD/692-1020-------------------------..FLDIR-------KLAASTAPRNY........L---------------------
Q2S6G2_SALRD/540-844-------------------------TDTSATR-------GDAASSSSDL.........A---------------------
Q2W535_MAGSA/875-1218-------------------------..L..LP-------SSIPAAKGGY.........L---------------------
Q38C46_TRYB2/1044-1397-------------------------..ATQCR-------LAALSAKRVQQRCLFQNLVL---------------------
Q3AQG5_CHLCH/44-362-------------------------..FSRT.-------IPSVQKALPDAAKGPLRILL---------------------
Q5LLA3_RUEPO/680-970-------------------------..LTQTP-------VEKLSPRES.LK.....ILI---------------------
Q7NCT1_GLOVI/600-923-------------------------..LPRLA-------QASSAPRSAP.........L---------------------
Q7NF67_GLOVI/550-854-------------------------..LLRLA-------.RPATLRHPP.........L---------------------
Q7NFD7_GLOVI/666-979-------------------------..LTRLQ-------ERASDPREAP.........L---------------------
Q7NIF7_GLOVI/691-997-------------------------..LIRLS-------DLPVPPRQGP.........L---------------------
Q7NJE3_GLOVI/660-988-------------------------..LPRLE-------QAAPAPRSGP.........L---------------------
Q7NLR0_GLOVI/653-961-------------------------..LLRLG-------RSQPAAQSA..........L---------------------
Q7NVB0_CHRVO/67-386-------------------------..ICLTR-------EIRRVTDDAVSWPVHPRILV---------------------
Q82I85_STRAW/1175-1481-------------------------..LCEVA-------ARPAVAHSGAA........L---------------------
Q82L10_STRAW/969-1256-------------------------LFSRARR-------RAAPGRRRT..........L---------------------
Q8DGG5_THEEB/541-835-------------------------..LLRIL-------.SRPVTANPP.........L---------------------
Q8DH74_THEEB/570-891-------------------------..LLRLQ-------.QRGKPANPP.........L---------------------
Q8DHI1_THEEB/67-394-------------------------..ISEIH-------RISVQTDFVQLWRYPWHDWT---------------------
Q8DIE5_THEEB/1127-1420-------------------------..LTDTR-------YRSIQRERI..........L---------------------
Q8YZU5_NOSS1/56-340-------------------------..LTDLK-------PLSSQVNRA..........L---------------------
TTC28_HUMAN/1390-1713-------------------------..LSVQS-------KSHLRKNPP.TYSSSTSMAA---------------------

PF03568

Q5KMS4_CRYNJ/1710-2122------------------------------KR-------MEELCVNLEFVWLGAFK.TI---------------------
A8PX94_MALGO/1441-1824------------------------------AQ-------LGSLLQLVQDAWFSGLH.GL---------------------
M7XLD2_RHOT1/1703-2100------------------------------QR-------LGNLLQTVEDAWLGAFK.SV---------------------
U5HB45_USTV1/1850-2253------------------------------AR-------LKGLLQSMEDSWLGAFK.CI---------------------
F4RLY9_MELLP/91-479------------------------------GR-------MRRLVENIENHWLGGCK.GF---------------------
T1IUX7_STRMM/1624-1980------------------------------LQ-------LKDFVEDLENVWIGHWK.GL---------------------
A7RYA6_NEMVE/1651-2034------------------------------DS-------LKNVLERLERSWLGKWR.GV---------------------
T1FT05_HELRO/413-770------------------------------EK-------LDELLESFEKEWFSCWI.GG---------------------
W4Y9R2_STRPU/1031-1383------------------------------EE-------MQGLTKDMENNLLSYWK.GL---------------------
G3N6G2_GASAC/1731-2077------------------------------SR-------VERLLKEMEE.FLGCWW.SF---------------------
H3DAQ7_TETNG/1711-2057------------------------------SR-------VEGLLKEMEE.LLGCWR.SL---------------------
I3KSG7_ORENI/1715-2061------------------------------SR-------VEQLLKDMER.LLGCWR.TF---------------------
H2L8K9_ORYLA/1692-2038------------------------------SR-------VEHLLKEMEE.VLGCWK.SF---------------------
M3ZIW2_XIPMA/1768-2114------------------------------CR-------LQQLLKEMEK.MLGCWQ.SF---------------------
ESPL1_MOUSE/1716-2065------------------------------QR-------MEALITALEEQVLGCWR.GL---------------------
F7BUI1_CALJA/1724-2073------------------------------HR-------MEVLIASLEKSVLGCWK.GL---------------------
G3VPI8_SARHA/1713-2063------------------------------RR-------MEDLITSLEKHILGCWK.MM---------------------
U3IXX7_ANAPL/1332-1679------------------------------RR-------MKSLIDTLETEVLGCWK.GV---------------------
G1KFP0_ANOCA/1819-2167------------------------------KR-------MKALTESLETHILGCWK.GA---------------------
H3B3H1_LATCH/1699-2055------------------------------KR-------MKLLMDSMEVYCLSCWK.GM---------------------
F6VXN8_XENTR/1732-2080------------------------------CR-------MKALIRLLEEQILGCWK.VL---------------------
Q6ZHH8_ORYSJ/455-870------------------------------NH-------LDKMLKDMEESWLGPWK.CL---------------------
W5GJD2_WHEAT/891-1304------------------------------ND-------LNEILENMEKLWLGPWK.YL---------------------
K3Z105_SETIT/1078-1484------------------------------NC-------LDNMLKDMEESWFGPWK.CL---------------------
C5XYE8_SORBI/457-870------------------------------NY-------LANTLKDIEDSWFGPWK.CL---------------------
C5XSY3_SORBI/1425-1832------------------------------NY-------LANTLKDIENSWFGPWK.CL---------------------
K3Y3B2_SETIT/1404-1817------------------------------NY-------LDKLLKDMEELWLGPWK.CL---------------------
M0UBW7_MUSAM/65-479------------------------------NR-------LNKLLKSMEISWLGPWG.CL---------------------
ESP1_ARATH/1641-2060------------------------------HR-------LGIFLRNLEASWLGPWR.CL---------------------
M4DS49_BRARP/1599-2019------------------------------HH-------LKKFLRNLEASWLGPWR.CL---------------------
B9GZR1_POPTR/1674-2094------------------------------HR-------LGKLLRKIEDSWLGPWR.CV---------------------
B9SSN4_RICCO/1627-2045------------------------------FQ-------LGKLLRKMEDLWLGPWR.CV---------------------
I1MDQ8_SOYBN/1648-2063------------------------------HC-------LDKLLRNLEESWFGSWK.CL---------------------
K4B224_SOLLC/1600-2023------------------------------KR-------LANFLRNLEDSWLGPWR.CL---------------------
W1NKX2_AMBTC/1-423------------------------------DR-------LGTLLRSVEDSWFGPWS.FL---------------------
K7H1P7_CAEJA/245-604------------------------------AR-------LASFVGEVEKNFLGVSA.HL---------------------
E3LM18_CAERE/731-1090------------------------------AR-------MKLFLEEVQNNFLNVAA.NL---------------------
G5ED39_CAEEL/727-1081------------------------------GR-------MMTFVDEVQKHFLGVAA.SL---------------------
Q23491_CAEEL/749-1101------------------------------CQ-------MKKCVENTQKHFLGAAA.SL---------------------
S3CR95_OPHP1/1758-2208------------------------------AR-------LKELLDNVEQIWLGGFR.GI---------------------
F0XAD9_GROCL/1636-2054------------------------------EQ-------LRELLDNVEQVWLGGFR.GI---------------------
G2R9B0_THITE/1619-2058------------------------------DR-------LKELLMNMEHVWLGGFK.GI---------------------
Q2H6Q9_CHAGB/1612-2026------------------------------ER-------LKELLGSIEQIWLGGFR.GI---------------------
G0SHM3_CHATD/1723-2150------------------------------QR-------LKELLMNIEHVWLGGFR.GV---------------------
G4UQF5_NEUT9/1626-2085------------------------------NR-------MKDLLTNIEQIWLGGFR.GI---------------------
G4N8I2_MAGO7/1627-2057------------------------------ER-------LKNLLDNVEQVWLGGFK.GI---------------------
J3P7L5_GAGT3/1606-2054------------------------------KR-------LGELLENVEQVWLGGFK.GI---------------------
R8BFS3_TOGMI/72-487------------------------------DR-------MKDLLENIENIWLGGFK.GI---------------------
N4UZ87_COLOR/1637-2043------------------------------VR-------FKDLLDNVEEVWLGGFK.GI---------------------
G2X6M8_VERDV/1704-2113------------------------------KR-------MKQLLDNIEQIWLGGFK.GI---------------------
G0RRT6_HYPJQ/1566-1971------------------------------SR-------LKKLLVTIETTWLGGFK.GI---------------------
M1WFQ9_CLAP2/1438-1889------------------------------TR-------LKELLLTIETTWLGGFK.GI---------------------
J5K578_BEAB2/1584-1996------------------------------TR-------LKECLTQIETTWLGGFK.GI---------------------
C7YYU1_NECH7/1580-1992------------------------------ER-------LRDLLSTIETTWLGGFK.GI---------------------
M7T4Q8_EUTLA/44-499------------------------------ER-------LKNLLTDIEKMWLGGFK.GI---------------------
L8G205_PSED2/1652-2056------------------------------VR-------LKELLDNVEKVWLGGFK.GI---------------------
N1JFH1_BLUG1/1598-2001------------------------------AR-------MCALLTNIEKVWLGGFR.GI---------------------
K1X2E6_MARBU/1659-2061------------------------------AR-------LKDLLENIEKVWLGGFT.GI---------------------
S3D029_GLAL2/1639-2043------------------------------SR-------MKELLENIEKVWLGGFT.GI---------------------
M7TX51_BOTF1/1640-2041------------------------------SR-------LKDLLENIEKVWLGGFA.GI---------------------
BIMB_EMENI/1609-2004------------------------------RR-------MENLLQNIENVWFGGFR.GI---------------------
Q2USV7_ASPOR/1630-2030------------------------------RR-------METLLQNIENVWFGGFR.GI---------------------
G7XGU8_ASPKW/1627-2026------------------------------RR-------MEALLQHIETVWFGGFR.GI---------------------
S8BGE7_PENO1/1622-2018------------------------------QR-------MESLLHNVENVWFGGFR.GI---------------------
B6GZP8_PENRW/1602-1998------------------------------RR-------MENVLQNIENIWFGGFR.GV---------------------
Q4WUU6_ASPFU/1638-2039------------------------------QR-------LQNLLQNIENVWFGGFR.GI---------------------
B6QNB5_TALMQ/1619-2016------------------------------RR-------LETLLDNMENIWLGGFR.GI---------------------
V5GCB2_BYSSN/1684-2084------------------------------RR-------LETLLCNVENIWLGGFR.GV---------------------
F0UL09_AJEC8/1642-2044------------------------------NR-------LRDLLSNIETVWFGGFR.GI---------------------
C5FSW7_ARTOC/1655-2058------------------------------KQ-------LGDLLQNIETVWFGGFR.GI---------------------
H6C6Q4_EXODN/1587-1987------------------------------QQ-------LATLLDNMENVWFGGFR.GL---------------------
U1G8A9_ENDPU/1638-2036------------------------------AR-------LASLLENIETLWLGGFR.GV---------------------
K2R7J5_MACPH/1619-2043------------------------------AR-------LGDLLANIENIWLGGFR.GI---------------------
R7YNT5_CONA1/1696-2117------------------------------NR-------LKELLVNIENIWLGGFR.GI---------------------
E4ZTB4_LEPMJ/1652-2063------------------------------TR-------LHELLVNMENIWLGGFK.GV---------------------
N1QAI8_PSEFD/1492-1912------------------------------KR-------LHELLMNMEKHWLGGFK.GV---------------------
N1QHR1_SPHMS/1187-1599------------------------------RR-------LQGLLINIENIWLGGFR.GV---------------------
N1PZ16_DOTSN/1513-1936------------------------------RR-------LHELLINMENLWLGGFR.GI---------------------
D5GKQ4_TUBMM/1633-2033------------------------------TQ-------LKDLLSVIEYHWLGGFK.GV---------------------
U4LG69_PYROM/1616-2019------------------------------DQ-------LRDLLSGIEKGWLGGFK.GI---------------------
S8C8B1_DACHA/1639-2040------------------------------NE-------LHDLLLNIENNWLRGYK.GI---------------------
Q6CCJ0_YARLI/1210-1588------------------------------AR-------LKQLLHDAEFCWFGGFL.GI---------------------
S9X830_SCHCR/1385-1771------------------------------NS-------LAKLLRYVELSWLGGFK.GI---------------------
CUT1_SCHPO/1383-1770------------------------------QC-------LQQLLENIEISWLGGFK.GI---------------------
B6K0I6_SCHJY/1359-1747------------------------------CT-------LAALLNNIESCWLGGFK.GI---------------------
M7PDE3_PNEMU/1489-1882------------------------------AK-------LKQLLINVEHCWLGGFK.GI---------------------
G8BT64_TETPH/1165-1563------------------------------KR-------MEGLITKIDNSWFSGFS.SF---------------------
I2H0Y5_TETBL/1280-1677------------------------------KK-------LQDLLLQLEITWLSGLK.GI---------------------
S6EFD3_ZYGB2/1145-1542------------------------------RR-------LESLLSSIEHYWFSSLK.GL---------------------
C5DU01_ZYGRC/1141-1538------------------------------RR-------LELLITNMEHYWFNGLK.GI---------------------
G8ZWZ1_TORDC/1158-1555------------------------------HR-------LQELLNNIEVCWFNGMK.GL---------------------
G0WDN6_NAUDC/1191-1589------------------------------GR-------LQTLLQNIEYSWFNGFK.GI---------------------
G0VFB3_NAUCC/1164-1562------------------------------NR-------LSSLLHNIETSWFAGLK.GL---------------------
H2B1L5_KAZAF/1161-1559------------------------------KR-------LQNLLEKVEATWFNGFR.GF---------------------
ESP1_YEAST/1175-1571------------------------------KR-------MQQLLNNIENSWFNGVQ.GF---------------------
J7RG90_KAZNA/1160-1562------------------------------KR-------LEQLLEKICNFWINGFA.GY---------------------
Q75EJ0_ASHGO/1152-1552------------------------------KR-------MCDLMRRIEDSWICGFC.GF---------------------
C5DHM1_LACTC/1178-1575------------------------------SK-------LQSLLSKIESSWFSGFK.TF---------------------
Q6CQQ7_KLULA/1118-1516------------------------------NR-------LQTLLTKIEDSWFCGFK.GV---------------------
Q6FTE1_CANGA/1151-1548------------------------------EL-------LGNLIERIEKTWLNGLS.GI---------------------
K0K8V1_WICCF/1175-1568------------------------------EK-------LAGFLDKIEYCWIGGFK.GM---------------------
A5DNR9_PICGU/1178-1576------------------------------LQ-------FESLLDLVRKTWIGGFS.GL---------------------
A3GFF5_PICST/1168-1555------------------------------LK-------MKDLLDHISDYWFGGFK.GL---------------------
Q6BTB7_DEBHA/1338-1753------------------------------LE-------LKNLLDHVENDWLGGFK.GI---------------------
Q5A8X8_CANAL/1101-1536------------------------------FQ-------LQDILHHVESKWFGGFISGI---------------------
C5MEH0_CANTT/925-1303------------------------------YE-------LQDILNHVEQYWIGGFV.GI---------------------
M3HH45_CANMX/1423-1797------------------------------YQ-------MQDIFEYVERFWFGGFT.GL---------------------
G8B5X7_CANPC/1052-1424------------------------------YE-------LQDLISHVERFWFGGFR.GI---------------------
A5DVQ7_LODEL/1109-1530------------------------------YE-------LKDLCQHVEDFWLGGFK.GI---------------------
G3AGZ6_SPAPN/1149-1535------------------------------YR-------LQELLNEVQNYWIGGFG.GI---------------------
G8YBL5_PICSO/1309-1719------------------------------LE-------LQELLTCLETDFFCAFR.GF---------------------
C4XY11_CLAL4/1177-1564------------------------------QR-------LKNLLDDVEDELLKGFK.GV---------------------
G3B782_CANTC/1213-1609------------------------------MK-------LKEVLELIEYQWLGAFR.GI---------------------
W1QIM9_OGAPD/1167-1527------------------------------RR-------LKQLLWEIDSHWFGCFK.GV---------------------
C4QYS2_PICPG/1259-1619------------------------------LR-------LQKMLESFENDHLGALK.GI---------------------
K5WME3_PHACS/1732-2136------------------------------ER-------MKALLANIEFCWLGAFK.TI---------------------
M2R2K9_CERS8/1618-2024------------------------------QR-------MRELLENIEFCWLGAFK.TI---------------------
F8PLA9_SERL3/1278-1688------------------------------KR-------MQELLENIEYCWLGAFK.TI---------------------
S8E105_FOMPI/1678-2083------------------------------QR-------LRDLLGNIEFCWLGAFK.TV---------------------
A8NBE9_COPC7/1839-2276------------------------------VR-------LKDLLENIEFCWLGAFK.TI---------------------
B0E1W0_LACBS/104-540------------------------------TR-------LRELLENIEFCWLGAFK.TI---------------------
D8Q1W5_SCHCM/1450-1878------------------------------TR-------LKELLQSIEFCWLGGFK.TI---------------------
V2X3W8_MONRO/1588-2040------------------------------TR-------LQELLENIEFCWLGAFK.TI---------------------
J0DCK6_AURST/1634-2046------------------------------QR-------LKQLLDNIEYCWLGAFK.SV---------------------
R9AIE1_WALI9/1639-2036------------------------------SR-------MRQLVKNIEFCWLGVFK.SL---------------------
I4YB88_WALMC/1631-2030------------------------------SR-------MRQFVKNIEFCWLGVFK.SL---------------------
G4T5A4_PIRID/1472-1874------------------------------DR-------LKTLLENMEYCWFGGFK.TI---------------------

PF01364

KGP83_PORGN/244-595...............................K-------KTKKVTDLYYSAVD...........................
D1JG83_9ARCH/891-1295.....................LNSPNNPILTL-------MGFDIYRDYNIQLD...........................
A2U064_9FLAO/401-768............................FNLA-------SS.YVTDDFFVMLDDNEGTM.....................
Q7MTE2_PORGI/239-573................................-------TPGIKSDQVYGQIVG..........................
D3HWT0_9BACT/400-777............................FNKV-------TC.YVDDGWFGLLDDGEGTN.....................
Q5S3Q9_9FLAO/543-910............................FTLS-------DS.FVSDEFFGMMDPDEGRM.....................
A9DMD5_9FLAO/555-923............................FNLT-------RG.FMTDDFYGMMDPDEGLL.....................
B0VGA8_CLOAI/228-563..............................MS-------TYGGEGDYPYTFLAG..........................
B7B5I7_9PORP/382-753.............................LSS-------QS.YVIDDYFGFLDDADNKK.....................
B8FFM0_DESAA/254-600.........................DPGDEPH-------HGLMASDHFYADIS...........................
A3U7G6_CROAH/540-908............................FSLL-------SS.FASDDYFGMIDPNEGTF.....................
D2QSX9_SPILD/414-786............................LHPV-------LS.YSSDDYFGFMDSHEGEWPE...................
A3HW99_9BACT/398-769................................-------...YPTADNNFVVGLDPS.......................
B0VHP2_CLOAI/234-563................................-------YSGGGSDPSYALLAG..........................
A8ZUB1_DESOH/278-656............................AGRY-------EDYIPSDLYYQCLDGDFNFDGDEEWGE..............
B0VIM2_CLOAI/182-528.............................EYP-------TENDADDNYYTMLEG..........................
Q2Z0E1_9BACT/643-1013...............................G-------VLYWPTDVWFVGFDAV.........................
B3QXR8_CHLT3/734-1131..............................LR-------FGATAADVWYAMVDGLDESG.....................
C2MCN4_9PORP/405-781.............................TNV-------YS.YSTDDYFGLLTEGLRGV.....................
A4A325_9PLAN/24-399...........................VHFGS-------EPTLVTDNYYADVD...........................
A7NR84_ROSCS/499-867.............................DPW-------LGETACETCYAQLDGERPT......................
Q11Q36_CYTH3/558-932............................LKEL-------QS.YNSDDYFGFMDNTEGYWDE...................
Q7MX16_PORGI/272-637...............................F-------GSICASDYFFSCVSP..........................
A0B5K7_METTP/796-1154................................-------ISYDVYRDYRIEMD...........................
D0MH89_RHOM4/586-975............................YHPI-------NS.YTSDDYFGLLDDDEGLWPDY..................
A8UH97_9FLAO/539-910............................FSLT-------NS.FVSDDFYAMLDSNEGSM.....................
B8KYL6_9GAMM/364-704..............................VQ-------GHFAASDNRLVSVEG..........................
B8FIK5_DESAA/1139-1542............................YAYY-------EEETPADLYYSDLDGDWDANGNGVY................
Q11US7_CYTH3/392-767................................-------...EPGSDLMFSVD...........................
C6W101_DYAFD/326-680................................-------...WPGSDIALATTKG.........................
A5FJM8_FLAJ1/544-914............................NSVG-------ESGFASDDFFGLMDSNEGVV.....................
Q7UG73_RHOBA/51-444...........................SRFGS-------TSTLPTDLPYGDRD...........................
A3J247_9FLAO/540-919.......................NNISNFSLY-------SS.FMSDDFYGLMDDGEGQM.....................
A9WIM0_CHLAA/500-869.............................DPW-------LGETACEVCFAQLDGDDPTA.....................
B0VHE7_CLOAI/227-554................................-------.NNTYVDYQYTWLAG..........................
C6VT06_DYAFD/394-758................................-------...YPGSDILLVEGIAGA.......................
C6X3N8_FLAB3/546-921............................RDYE-------LS.FVTDDYYTMTKPQPVTSI....................
A0LQH1_SYNFM/790-1132..............................TP-------NGLAPSDARLADFAG..........................
A1ZVJ9_9BACT/406-774............................LHPI-------LS.HSSDDYFGFLEASEGEWTE...................
B0VHF1_CLOAI/214-595................................-------.ADIPADMYYACLDGNWNTDGDSY.................
B0VIE7_CLOAI/193-598................................-------.ETVPTDFFYSDLSSNWDTDNDGKRGEY.............
C6W3P4_DYAFD/414-806................................-------...FPGSDLLLIEGLQGT.......................
B2RGP6_PORG3/408-787.............................TNV-------NS.YVTDDYFGLLDDQPASV.....................
D2QJ99_SPILD/409-770................................-------...YPGSDGLLTAG...........................
A9B5Q8_HERA2/466-850.............................DPW-------LGEIACDTCFVQLDGANPL......................
D2QFF3_SPILD/397-745................................-------...YPGSDILLSAGLGGF.......................
B0VH03_CLOAI/589-939................................-------GSYIVSDDYFGMFN...........................
D2R2P5_PIRSD/21-411...........................VKFGS-------EPTIPSDNWFADLD...........................
C6W0Z3_DYAFD/393-758............................LNPV-------YT.YSSDDYFGFMDEAEGDWNE...................
A3XQP5_LEEBM/552-929............................FSQS-------QS.YMSDDFFGSLDPEEGVIENNS.................
Q2PY26_9BACT/412-780............................FSLY-------SS.FVTDDYLGFMDDNEGIQ.....................
Q26FX7_FLABB/537-909............................TSLT-------QS.YVTDDFFTYMNPNEGNV.....................
B0VJT2_CLOAI/236-566................................-------ANSGVTDYNYTFLAG..........................
C6BTD6_DESAD/56-402..............................SG-------NEVHLSDYGYGG.............................
D2QE53_SPILD/328-1007KPETDDLGKIYMILEGPDASVSSTYGFYWLGN-------DRNIPTDFYYASVDGSCYSVLGRYDFDPLASGRYG......
A2BK55_HYPBU/159-551..........................ELVSPR-------EAAIPSDYYYSDPD...........................
B0VHP1_CLOAI/283-636...............................N-------AGSHPTDLTYVRLQG..........................
Q1Q1Y4_9BACT/620-970................................-------...TPSDNWFVLVSG..........................
C7PNY3_CHIPD/396-764............................TDPV-------YA.YPSDDFFGFLDDADDINDN...................
Q6LFY5_PHOPR/224-617............................YHGK-------NHRWHTDYEYTLVDG..........................
B3QVL4_CHLT3/688-1063............................LELV-------NDVSIADDFFGSVDGDEIP......................
A9B187_HERA2/552-907.............................DPW-------LRETAADNRYVTVAG..........................
R5M3W7_9BACE/537-910............................LEET-------SS.YVTDDYFGFLDDGEGEN.....................
B0VJY1_CLOAI/655-1014..............................YK-------HGATASDPWYGCIVG..........................
B8G4Y1_CHLAD/584-1054...................WNSNCRNPQGTEP-------GSGWRTDWYYADLTSNWDTNGNGCLGDGIFGD.........
A1ZEG7_9BACT/410-775................................-------...YPPSDVMYTAGFNPI.......................
B0VF22_CLOAI/223-583................................-------.ARMPTDIYFSNLDGNWNANQNQIW................
A0LKV0_SYNFM/924-1265..............................EI-------FGRVPSENRYADLN...........................
A8ZTD5_DESOH/257-648................................-------GDGCGTDLYYATVDG..........................
A9B8S0_HERA2/477-840.............................DLW-------LGETACEACYGQLDGADPL......................
C3JBB2_POREA/421-799.............................LNI-------YS.YTTDDYFGYLRDGEDHL.....................
C9SW40_VERA1/279-917DDYATRSATPTNFVRVEGPSSLVNAGLQFIYA-------WNTLPTDFYYASLTSWVVRTRPVRFGPVTFQMPYVYTPPHD
C9LI59_9BACT/509-899.........................DISIGTL-------YS.YVTDDYFGMLDDGEGNS.....................
B5ICF9_ACIB4/214-642.............................DMY-------DAWIPTDAFYAQPNYNSTY......................
Y048_ARCFU/22-377.............................LIF-------YEPFPTDFFYASPD...........................
A3I371_9BACT/360-725............................LDPL-------KS.YSSDDYYALIDFGQGMWEE...................

PF11713

MARTX_VIBCH/3469-3626------------------------------VV-------VQLDSD.GNYRVVYGD....---------------------
A0KHZ7_AERHH/3609-3767------------------------------LV-------VQLDAD.GNYRVVYGD....---------------------
Q2KX68_BORA1/2483-2627------------------------------EL-------RQWLAS.GETKILRAA....---------------------
Q2SAY5_HAHCH/1-160------------------------------EL-------VEYDVA.SKTHVVINSA...---------------------
Q7N1Z0_PHOLL/2456-2614------------------------------VV-------IQLDAN.GKYRVVYGD....---------------------
Q7N726_PHOLL/2997-3151------------------------------VV-------VKLDSN.GKYHVIYGD....---------------------
Q7VV06_BORPE/2551-2702------------------------------DW-------YRQADD.GSLHPVHPL....---------------------
Q7VV06_BORPE/2959-3112------------------------------NW-------YLQTRD.GGLEPVRQA....---------------------
Q7VV06_BORPE/3397-3549------------------------------SW-------YSQDAS.GQLTQVRAP....---------------------
Q7VV06_BORPE/3808-3959------------------------------LW-------YGQTLE.GTLMLKQGG....---------------------
Q189K3_PEPD6/575-754------------------------------VL-------FQKNIE.DSEIAYYYNPGDG---------------------
Q189K5_PEPD6/577-756------------------------------II-------IQRNMN.ESAKSYFLSDDGE---------------------
Q7CGR6_YERPE/772-928------------------------------IV-------LQFDARSSEARIAYGT....---------------------

PF01650

LGMN_HUMAN/29-286----------------------------VYQG.VPKDYTGEDVTPQNFLAVLRGDAEAV---------------------
VPED_ARATH/46-316----------------------------VYKG.VPKDYTKEAVNVQNFYNVLLGNESGV---------------------
VPEG_ARATH/59-330----------------------------VYQG.VPKDYTGDDVNVDNLFAVILGDKTAV---------------------
A0CQC7_PARTE/19-285----------------------------VYDG.CVIDYSKTDVNPANFLNVLKGNYDHL---------------------
A2FXM6_TRIVA/13-267----------------------------VYPGRANVKYTAGKVTATNFYKVLTGDN...---------------------
O24539_VICNA/53-325----------------------------VYDG.VPKDYNGDFVTAENFYAVILGDKSKV---------------------
HGLB_SCHMA/37-291----------------------------WYEG.VVIDYRGKNVNSKTFLKVLKGDKS..---------------------
HGLB_SCHJA/31-285----------------------------YYKG.VVIDYKGKKVNPKTFLQVLKGDKR..---------------------
VPE_VICSA/56-325----------------------------VYAG.VPKDYTGAEVHADNFYAALLGNKSAL---------------------
A0A080VK93_PSEAI/341-579----------------------------LSRA.......VRTLAER.............---------------------
Q08BI0_DANRE/27-278----------------------------VYKS.VPLDYTGNKVKSKNFLAVLRGDDS..---------------------
Q0MYV8_EMIHU/33-301----------------------------VYAG.CKIDYSGSMVTPETFVKVLTGDAAGL---------------------
Q22P32_TETTS/20-285----------------------------VYEG.CKIDYQGEDVTPKNYMSVLTGKKSDV---------------------
Q22P33_TETTS/20-285----------------------------VYAG.CKIDYQGNDVTPKNYMSVLTGDKQAV---------------------
D0MXB3_PHYIT/25-298----------------------------VYKG.CNIDFRGVEVTPETFLNVLTGNSSGA---------------------
Q2UVF3_HAECO/29-287----------------------------VYEG.VVIDYKDKSVTPSNFLAILQGNETAV---------------------
Q4K5F2_PSEF5/335-570----------------------------LRRA.......AQTLAER.............---------------------
Q4RED0_TETNG/30-283----------------------------VYKG.VPKDYTGDDVTPENFLAVLKGDSANA---------------------
Q8P9N6_XANCP/124-392----------------------------LYDT.......LAAIGKR.............---------------------
Q6EHZ7_TRIVA/12-258----------------------------IYPGSSKINYAHNSVTADQFYTVLT......---------------------
Q6FEB2_ACIAD/229-477----------------------------IAMA.......LNRIGQQ.............---------------------
Q6L4R2_ORYSJ/41-319----------------------------VYAG.VPKDYTGDDVNVNNFLAVLLGNRSAL---------------------
Q6NYJ7_DANRE/32-288----------------------------VYKG.VLKDYIGDDVTPENFLAVLKGDAASV---------------------
Q6PRC7_IXORI/38-293----------------------------VYAG.VPKDYTGDLVTPKNFLSILQGKK..I---------------------
Q711M2_FASHE/21-278----------------------------VYEG.VKIDYSGLQTSVNTFASVLSGDEHWK---------------------
VPE1_ORYSJ/62-334----------------------------VYAG.VPKDYTGHQVTTENFFAVLLGNKTAV---------------------
Q852T1_TOBAC/49-320----------------------------VYKG.VPKDYTGHHVTANNFLAVILGNKAAL---------------------
Q88QE3_PSEPK/400-640----------------------------LSRA.......AATLAER.............---------------------
Q949L7_BETVU/51-321----------------------------VYAG.VPKDYTGEDVTVNNFFAAILGNKDAI---------------------
Q9LLQ4_SESIN/54-326----------------------------VYAG.VPKDYTGEQVTAENLYAVILGDKSAI---------------------
Q9LWZ3_ORYSJ/41-304----------------------------VYAG.VPKDYNGNDVNKNNFLAVLLGKKSAL---------------------
Q9SBX2_MAIZE/45-317----------------------------VYAG.VPKDYTGRDVNVDNFFAVLLGNKTAL---------------------
Q9SMD0_SOLLC/39-316----------------------------VYKG.VPKDYTGKDCNAQNFYSVILGNKSAL---------------------
Q9XG75_TOBAC/40-306----------------------------VYKG.VPKDYTGKDCNADNFFAVILGNKSAL---------------------

PF00656

Q7QGM9_ANOGA/35-227----------------------------VTRK-------MGEIS.R----------------------------------
DRONC_DROME/196-443----------------------------FFKL-------LTMVTSS----------------------------------
O42284_CHICK/42-279----------------------------MTTV-------MKKFADH----------------------------------
CAS1A_XENLA/144-382----------------------------MVKV-------MKEFAAQ----------------------------------
CASPC_MOUSE/176-415----------------------------METE-------LMQFAGR----------------------------------
CASP4_MOUSE/132-369----------------------------MESE-------MKDFAAL----------------------------------
CASP5_HUMAN/193-430----------------------------MESV-------LRAFAAR----------------------------------
CASPD_BOVIN/136-373----------------------------MESV-------LWKFAAR----------------------------------
CASP1_CANLF/163-400----------------------------MESV-------LREFAAR----------------------------------
CASP1_FELCA/161-406----------------------------MESE-------LRAFAAR----------------------------------
CASP1_MOUSE/162-398----------------------------MVKE-------VKEFAAC----------------------------------
CASP1_HUMAN/163-400----------------------------MTTE-------LEAFAHR----------------------------------
CASP1_PIG/163-400----------------------------MAIE-------LKAFAAR----------------------------------
Q9I9L7_DANRE/145-379----------------------------MDEA-------IRDFAQR----------------------------------
Q9DDJ2_DANRE/174-400----------------------------IRRA-------VENFSKR----------------------------------
Q6NTR7_XENLA/280-494----------------------------LESI-------LKDVANM----------------------------------
CFLAR_MOUSE/257-480----------------------------ITQI-------VRRYASM----------------------------------
Q6QN97_PIG/259-484----------------------------ISKI-------LRKVARM----------------------------------
CFLAR_HUMAN/252-477----------------------------ISQI-------LGQFACM----------------------------------
Q9NBW3_DROME/38-248----------------------------VKNK-------VKEWS.A----------------------------------
Q9TZP5_CAEEL/26-261----------------------------ILET-------VRQFT.Q----------------------------------
CASPE_MOUSE/22-256----------------------------FLEE-------LDEFQQT----------------------------------
CASPE_HUMAN/18-241----------------------------FQEE-------LEKFQQA----------------------------------
Q8I749_SUBDO/254-491----------------------------MNKV-------MLRKA.S----------------------------------
CASP2_RAT/200-445----------------------------MQEK-------LQNFAQL----------------------------------
CASP2_CHICK/171-416----------------------------MESA-------LERFSKL----------------------------------
Q9GV89_HYDVU/93-318----------------------------IINI-------VYSLS.Q----------------------------------
Q9IB63_XENLA/144-396----------------------------MHDH-------LQALA.D----------------------------------
CASP9_HUMAN/161-413----------------------------MVLA-------LLELA.Q----------------------------------
Q90WU0_CHICK/148-400----------------------------IDVE-------LRKLA.R----------------------------------
Q9IB64_XENLA/261-494----------------------------IQKT-------LEMYS.K----------------------------------
Q6E5N8_ICTPU/119-362----------------------------MKDL-------LKKYS..----------------------------------
Q9I8J3_DANRE/238-473----------------------------IKDE-------IKQFA.N----------------------------------
Q6PAD9_XENLA/268-495----------------------------IRDR-------IKKFK.S----------------------------------
Q90WU1_CHICK/237-479----------------------------IRNI-------VNNYR.C----------------------------------
CASP8_HUMAN/234-476----------------------------IYEI-------LKIYQ.L----------------------------------
CASP8_MOUSE/236-478----------------------------IHEI-------LEGYQ.S----------------------------------
Q9Y1U6_PRIPA/173-413----------------------------LHNN-------IKSFASS----------------------------------
CED3_CAEEL/243-494----------------------------MLLT-------IRDFAKH----------------------------------
Q7QKT2_ANOGA/35-260----------------------------IRHA-------LKEVS.K----------------------------------
Q7PZJ9_ANOGA/20-250----------------------------IRDA-------LRNVS.K----------------------------------
Q9GV88_HYDVU/84-316----------------------------VLNI-------LKQAA.N----------------------------------
Q7Q1E0_ANOGA/62-291----------------------------IKSV-------IGKVS.S----------------------------------
CASP1_SPOFR/61-293----------------------------INKF-------IQQTA.E----------------------------------
CASP1_DROME/79-313----------------------------ILKH-------VGKAA.E----------------------------------
Q7Q4X6_ANOGA/73-309----------------------------LQKE-------VERVS.Q----------------------------------
DRICE_DROME/94-328----------------------------ILRT-------IEYAA.S----------------------------------
Q9NHF9_DROME/56-302----------------------------INDT-------LKEVA.R----------------------------------
Q7Q803_ANOGA/54-306----------------------------IKQV-------LDDLA.E----------------------------------
Q7PV92_ANOGA/14-237----------------------------LLSA-------LKQLA.G----------------------------------
Q86FL0_ANOST/52-286----------------------------LLDE-------LDKVA.H----------------------------------
Q8I6Y2_GEOCY/158-414----------------------------MTRE-------FEDLA.R----------------------------------
Q8ITP3_BRAFL/87-323----------------------------ILSV-------LQ.LAAR----------------------------------
O88550_RAT/68-301----------------------------MQDL-------LRRAS.E----------------------------------
Q6DCI2_XENLA/78-314----------------------------MENL-------LRTVA.Q----------------------------------
Q8JIS8_ORYLA/58-285----------------------------MKKL-------FRQMS.N----------------------------------
CASP3_XENLA/56-280----------------------------IIGR-------LKKIS.E----------------------------------
O93417_CHICK/53-281----------------------------IFKL-------LKNVS.E----------------------------------
Q98UI8_DANRE/48-280----------------------------IMQV-------LTTVA.H----------------------------------
Q8JG42_TAKRU/51-279----------------------------MKQL-------LVSAA.E----------------------------------
Q8ITP2_BRAFL/151-396----------------------------IRQI-------LHSAALK----------------------------------
Q9IB66_XENLA/58-298----------------------------VLEK-------IQEAS.T----------------------------------
Q9I8S9_ONCMY/57-297----------------------------VLDQ-------ISQAA.E----------------------------------
O93415_CHICK/57-299----------------------------VLKK-------VFEAS.R----------------------------------
CASP6_MOUSE/28-270----------------------------LLLK-------IHEVS.T----------------------------------
PCP_DICDI/188-404----------------------------FYDK-------WYTFLQL----------------------------------
Q7AKE1_STRCO/9-268----------------------------FIDP-------VQRAAAE----------------------------------
A0A063TRB6_BORBO/552-800----------------------------RASL-------IESLRRY----------------------------------
Q7NPG1_GLOVI/7-278----------------------------VTDG-------LDWLLSG----------------------------------
Q87Z21_PSESM/2-224----------------------------LINA-------ISELFSG----------------------------------
Q82I86_STRAW/5-276----------------------------TVAA-------VEDAVVR----------------------------------
P74453_SYNY3/40-299----------------------------LFDE-------HLRQ..Q----------------------------------
Q8YS65_NOSS1/4-245----------------------------LRRV-------LLTLFES----------------------------------
Q9DDL2_DANRE/323-560----------------------------MHSA-------VTEFLLL----------------------------------
Q98CE0_RHILO/5-237----------------------------MRRA-------LDDF..R----------------------------------
Q6N0T4_RHOPA/30-250----------------------------MRRA-------FDRLYQR----------------------------------
Q89XG2_BRADU/27-247----------------------------MRRA-------FDKLYGK----------------------------------
Q89XE4_BRADU/58-278----------------------------MVRA-------VNRLKSR----------------------------------
Q6NBN5_RHOPA/57-277----------------------------ILRA-------VERIKAR----------------------------------
Q98JS7_RHILO/35-253----------------------------AEKD-------LNDAI.R----------------------------------
Q985X8_RHILO/35-256----------------------------LRGA-------YRDFLAK----------------------------------
Q6N5Q1_RHOPA/33-253----------------------------LRGA-------FRDFVKK----------------------------------
Q89KP2_BRADU/86-307----------------------------LRKS-------FRDFIQK----------------------------------
Q89IK1_BRADU/30-253----------------------------MQDL-------TIRFARA----------------------------------
Q98G71_RHILO/26-252----------------------------LERS-------IGEFSDA----------------------------------
Q6AKF4_DESPS/28-248----------------------------FEES-------VRKFGKK----------------------------------
Q98IJ6_RHILO/11-238----------------------------TQVT-------VAQFAKQ----------------------------------
Q89MV1_BRADU/176-400----------------------------MDIA-------VRSFGRQ----------------------------------
Q89HT8_BRADU/51-272----------------------------MLRV-------VQDFSAK----------------------------------
Q89FZ4_BRADU/32-256----------------------------MRTA-------ISDFAGK----------------------------------
Q6N329_RHOPA/73-298----------------------------LRTK-------VGDFAAT----------------------------------
Q98IJ9_RHILO/30-261----------------------------MHGL-------ISKFTEE----------------------------------
Q89HP3_BRADU/336-569----------------------------MQKM-------TRDFLRD----------------------------------
Q7RFI8_PLAYO/964-1364----------------------------ILKA-------VNWLVRD----------------------------------
Q74F93_GEOSL/6-270----------------------------VIDA-------IGKAAKA----------------------------------
MCA9_ARATH/10-321----------------------------IKAA-------LRRMVDK----------------------------------
MCA8_ARATH/3-378----------------------------ICDE-------LDNLIAS----------------------------------
MCA7_ARATH/3-401----------------------------IRQA-------LSELIKP----------------------------------
Q70VV0_PICAB/3-415----------------------------VRRA-------LKTLVEG----------------------------------
Q9ZSP8_HEVBR/3-415----------------------------IRRV-------LTDLVRS----------------------------------
MCA4_ARATH/3-416----------------------------IRRA-------LADLVES----------------------------------
MCA5_ARATH/3-408----------------------------IRRA-------LLNLVES----------------------------------
MCA6_ARATH/3-366----------------------------IRQA-------LLDLVEP----------------------------------
MCA1_ARATH/80-362----------------------------MRMA-------LYWLVQG----------------------------------
MCA2_ARATH/116-414----------------------------ITMA-------MHWLVLS----------------------------------
MCA1_SCHPO/130-422----------------------------MLDA-------MRWLVSD----------------------------------
MCA1_YARLI/168-458----------------------------ILQA-------CQWLVKG----------------------------------
MCA1_DEBHA/146-437----------------------------IIRA-------MQWLVKD----------------------------------
MCA1_ASHGO/154-449----------------------------ILRA-------MHWLVQG----------------------------------
MCA1_KLULA/138-430----------------------------MLRA-------MQWLVKD----------------------------------
MCA1_CANGA/98-389----------------------------IIRA-------MQWLVKD----------------------------------
B5VS82_YEAS6/157-450----------------------------MIRA-------MQWLVKD----------------------------------
Q386I9_TRYB2/84-341----------------------------ILQH-------MAWLVKD----------------------------------
Q38D34_TRYB2/63-322----------------------------IIKY-------MAWLVYD----------------------------------
Q8T8E6_9TRYP/84-343----------------------------IVRY-------MAWLVKD----------------------------------

PF14538

W1QFK7_OGAPD/56-210----------------------------LKRL-------CTTLRRS----------------------------------
L8WVZ0_THACA/73-224----------------------------TRKW-------CIGLRKM----------------------------------
A2EZ34_TRIVA/89-236----------------------------LSN.-------ANSLRTN----------------------------------
Q6C6R4_YARLI/86-238----------------------------IKRF-------CIGLRRG----------------------------------
M2WI96_DOTSN/172-328----------------------------LKKY-------TTSLRRT----------------------------------
K2S4T3_MACPH/104-258----------------------------TRRY-------CSTLRKN----------------------------------
C4LXC3_ENTHI/42-194----------------------------VKKA-------CIGARER----------------------------------
T1G0Q6_HELRO/62-216----------------------------IKKL-------CQSLRRN----------------------------------
B0CNS4_LACBS/34-185----------------------------LRRF-------CQTLRKQ----------------------------------
F0ZAV4_DICPU/115-266----------------------------VKKL-------CLSLRRN----------------------------------
U9UGJ5_RHIID/52-203----------------------------MKKF-------CTNLRKS----------------------------------
Q5KIS3_CRYNJ/92-243----------------------------TKKN-------CISMRKT----------------------------------
B0WBU4_CULQU/30-181----------------------------LRSA-------CDQLKAH----------------------------------
A5DWK2_LODEL/143-295----------------------------VKRF-------CNTLRRN----------------------------------
G0VGR8_NAUCC/79-231----------------------------VKRF-------CNSLRRS----------------------------------
I3J5N7_ORENI/57-208----------------------------VKKL-------CTSLRRN----------------------------------
A2DYM2_TRIVA/68-215----------------------------LQN.-------IATMRRE----------------------------------
D8TLK8_VOLCA/11-162----------------------------VKKL-------CLSCRRN----------------------------------
G4M000_SCHMA/43-194----------------------------VKKL-------CLSLRRN----------------------------------
C1MUE6_MICPC/45-196----------------------------VKKL-------CLSCRRN----------------------------------
Q387I9_TRYB2/89-240----------------------------AKKR-------MANIRLD----------------------------------
C4M2F5_ENTHI/38-189----------------------------VRRL-------CLTFRRM----------------------------------
G4TT65_PIRID/72-223----------------------------ARRF-------CVNLRKT----------------------------------
G0NWW0_CAEBE/64-218----------------------------VRKV-------ATNLRRI----------------------------------
A2DJF0_TRIVA/83-228----------------------------FSSP-------IRHICLQ----------------------------------
K3WJU9_PYTUL/84-235----------------------------TKQL-------CVSMRRH----------------------------------
A2G590_TRIVA/30-180----------------------------ISEV-------IKTYSQN----------------------------------
B8M6V6_TALSN/189-342----------------------------TKKF-------CISLRRN----------------------------------
A2FJN8_TRIVA/41-191----------------------------ALDM-------MHKLSQN----------------------------------
A2DLR3_TRIVA/97-242----------------------------IDT.-------IIQLRKN----------------------------------
E5SIN8_TRISP/44-195----------------------------VRRL-------CISMRKN----------------------------------
I1G727_AMPQE/53-204----------------------------VRKL-------CIALRKN----------------------------------
U1MN31_ASCSU/95-246----------------------------VRRL-------CQSMRRN----------------------------------
I1L744_SOYBN/123-274----------------------------VKKL-------CTTCRKY----------------------------------
E4XFS5_OIKDI/48-228----------------------------MVRI-------TQSRMGR----------------------------------
D2VMD1_NAEGR/144-294----------------------------VKKT-------CVQLRKS----------------------------------
A9TBL2_PHYPA/91-242----------------------------VKKL-------CLSCRKN----------------------------------
B7PLB3_IXOSC/92-247----------------------------VKKL-------CSSLRRN----------------------------------
A0A0D2USM0_CAPO3/727-878----------------------------IKRL-------CTSLRRN----------------------------------
B8CBK6_THAPS/256-409----------------------------VKDL-------CFRMRES----------------------------------
A4I1A2_LEIIN/114-279----------------------------SKSA-------LAKSRRM----------------------------------
F4RLY3_MELLP/215-367----------------------------FKKT-------LIGLRKY----------------------------------
K4DUJ2_TRYCR/62-218----------------------------AKHL-------MMSSRRK----------------------------------
H1VVG4_COLHI/158-309----------------------------TKKF-------CQSLRRN----------------------------------
M7XEP3_RHOT1/113-265----------------------------AKKF-------CTGARKT----------------------------------
A2GCD5_TRIVA/98-247----------------------------LNN.-------LSSIRSE----------------------------------
D8RG53_SELML/72-223----------------------------VKKL-------CSQCRKN----------------------------------
A2F9H3_TRIVA/31-181----------------------------VLTL-------LRKHCSS----------------------------------
L0PHF8_PNEJ8/131-282----------------------------TKKF-------CSTQRRN----------------------------------
RTOR2_ARATH/94-246----------------------------VRKL-------CLSCRKY----------------------------------
M5E8T5_MALS4/58-209----------------------------TKRF-------CTNLRRN----------------------------------
B3RPQ9_TRIAD/43-194----------------------------VKKL-------CLSLRRN----------------------------------
I4Y9Q8_WALMC/76-227----------------------------MRKL-------CASLRRN----------------------------------
A2E4G0_TRIVA/101-242----------------------------LAQ.-------ISQIRRD----------------------------------
A0A068XPC4_HYMMI/269-417----------------------------VKKI-------CVNMRRN----------------------------------
U4LGP0_PYROM/223-374----------------------------TKKF-------CCSLRRN----------------------------------
A2F8U1_TRIVA/65-210----------------------------FKNS-------LSKIKLQ----------------------------------
D8T9J0_SELML/50-197----------------------------VKKL-------CVQCRET----------------------------------
A9V5A2_MONBE/628-777----------------------------VKRL-------CLALRRR----------------------------------
F0XXV0_AURAN/12-164----------------------------LRRL-------CAALRRS----------------------------------
A2E336_TRIVA/54-202----------------------------IPCY-------LQKMRQD----------------------------------
B4R5C8_DROSI/214-365----------------------------VKKL-------CTSLRRN----------------------------------
A2EU18_TRIVA/81-227----------------------------VSY.-------LQQFRHD----------------------------------
A2DYB3_TRIVA/12-162----------------------------VLAM-------LRKHASS----------------------------------
S2KE38_MUCC1/106-257----------------------------TKKV-------CCQMRRN----------------------------------
G7E3R0_MIXOS/173-325----------------------------TKKL-------CVNMRKQ----------------------------------

PF03415

Q8A866_BACTN/37-399----------------------------MKNV-------FTTAFSH----------------------------------
Q9WZB1_THEMA/121-462----------------------------LEAW-------LEMILNQ----------------------------------
Q8XM44_CLOPE/59-508----------------------------LKKF-------IKFCKKN----------------------------------
Q9X1S5_THEMA/586-937----------------------------LINY-------MEYASN.----------------------------------
Q9WYY6_THEMA/5-301----------------------------LSSF-------LNAYRG.----------------------------------
Q8TIY6_METAC/66-593----------------------------LETF-------LSYIREN----------------------------------

PF12770

A0LJ53_SYNFM/581-921---------------------VFANP----SYP......TAPIPHGMTVPLSKRTDAG......................
A0LQE8_SYNFM/635-947---------------------GVADK----VSD......HF.......................................
A1BCK0_CHLPD/513-826---------------------LVANP----C.................................................
A1BEL3_CHLPD/43-361---------------------FSSLP----DDLDE..TDQ........................................
A1BEL6_CHLPD/46-364---------------------FSSLP----DNLGE..KNQ........................................
A4HBL7_LEIBR/1053-1432---------------------VQGDA----DHD......AA.......................................
A8L4T6_FRASN/741-1051---------------------AVADP----ASS......GA.......................................
A9WBC0_CHLAA/673-929---------------------VIGAS----AD................................................
A9WER9_CHLAA/54-394---------------------IFSEP----TDL......DR.......................................
A9WF91_CHLAA/60-360---------------------AIANP----HGI...............................................
B0C874_ACAM1/207-507---------------------GMGIT----QEV.....EGQ.......................................
B2IXC0_NOSP7/1396-1691---------------------AMGVS----QST.....QGQ.......................................
B2IZZ4_NOSP7/695-973---------------------VVGVS----NGNK....QF........................................
B2JAK0_NOSP7/526-830---------------------LIGNP----LFS......NPYTV....................................
B2JAM9_NOSP7/866-1190---------------------VLADP----VFS......KDDDRLKPDVTQSVQNRG.......................
B4JKU3_DROGR/1402-1700---------------------VVGGP----RVP.......A.......................................
C3Z401_BRAFL/1278-1602---------------------VLGNP----KLP.......P.......................................
F0SR63_RUBBR/137-574---------------------AVGDP----KFR......VDDASPPESVAGVRVNKVVEGSVAESAGVKPGDVIVAIDGR
Q01RE6_SOLUE/865-1136---------------------VVSAP----AAG......AR.......................................
Q024J7_SOLUE/541-814---------------------LLGDP----ITN......DP.......................................
Q025F1_SOLUE/607-877---------------------AMGNP----GA................................................
Q028B5_SOLUE/667-935---------------------MAVDA----..................................................
Q02DA1_SOLUE/510-786---------------------VVADP----TLG......RE.......................................
Q10YT7_TRIEI/1003-1309---------------------LLGYP----TYS......EKDQVTI..................................
Q10YU6_TRIEI/544-838---------------------TTGTD----KEAPSYRQRGY.......................................
Q112V9_TRIEI/62-390---------------------VVSKP----TAD...............................................
Q113D1_TRIEI/130-430---------------------VTEKK----CCG......KI.......................................
Q113U8_TRIEI/3002-3297---------------------AMGAS----EFI......AK.......................................
Q115J8_TRIEI/1466-1777---------------------AIQTP----T.................................................
Q117G6_TRIEI/881-1206---------------------LLGDP----NYE......KKDKIAT..................................
Q119J2_TRIEI/1474-1770---------------------AMGAS----KFSP...NTNE.......................................
Q16H64_AEDAE/1315-1614---------------------VVGGP----KIP.......S.......................................
Q2G6U6_NOVAD/692-1020---------------------GLGHN----AKP......AARPVT...................................
Q2S6G2_SALRD/540-844---------------------AFGVS----SFD......SLRPPPPSL................................
Q2W535_MAGSA/875-1218---------------------INAGP----DYN......TEEVTGKATLEKARS..........................
Q38C46_TRYB2/1044-1397---------------------VQKQA----DAT......EQ.......................................
Q3AQG5_CHLCH/44-362---------------------FSSLP----DDLTE..KEQ........................................
Q5LLA3_RUEPO/680-970---------------------ATSEP----RDQ......RR.......................................
Q7NCT1_GLOVI/600-923---------------------VLGGP----DFA......RAAAGLSPATQQRAGP.........................
Q7NF67_GLOVI/550-854---------------------LIANP----DFD......RADAVVDRLA...............................
Q7NFD7_GLOVI/666-979---------------------VVAGP----DYG......RSPAALQAP................................
Q7NIF7_GLOVI/691-997---------------------LVAAP----DFD......NAGPPAVNAA...............................
Q7NJE3_GLOVI/660-988---------------------VLGGP----DFA......RAAAGPPLASRPAAERRAT......................
Q7NLR0_GLOVI/653-961---------------------IVANP----NFD......NAEVARTRSAGE.............................
Q7NVB0_CHRVO/67-386---------------------VLASP----..................................................
Q82I85_STRAW/1175-1481---------------------VVGNP----T.................................................
Q82L10_STRAW/969-1256---------------------AVAMP----QTA......GQ.......................................
Q8DGG5_THEEB/541-835---------------------IIADP----SFD......RSST.....................................
Q8DH74_THEEB/570-891---------------------VVGNP----TFS......QGSGRALAGS...............................
Q8DHI1_THEEB/67-394---------------------PIRQH----SNL.......D.......................................
Q8DIE5_THEEB/1127-1420---------------------AMGAS----EFL......DQ.......................................
Q8YZU5_NOSS1/56-340---------------------VLALS----QES...............................................
TTC28_HUMAN/1390-1713---------------------VIGNP----KLP.......S.......................................

PF03568

Q5KMS4_CRYNJ/1710-2122---------------------LSPRN...RFSK-----------------------------------------------
A8PX94_MALGO/1441-1824---------------------LAPWP.....SP-----------------------------------------------
M7XLD2_RHOT1/1703-2100---------------------FYDAR...LHSG-----------------------------------------------
U5HB45_USTV1/1850-2253---------------------FSDTQ...DIGA-----------------------------------------------
F4RLY9_MELLP/91-479---------------------LRCSN.....SI-----------------------------------------------
T1IUX7_STRMM/1624-1980---------------------LLGRP....ISR-----------------------------------------------
A7RYA6_NEMVE/1651-2034---------------------ILGRH....SMP-----------------------------------------------
T1FT05_HELRO/413-770---------------------LMGRL....VDA-----------------------------------------------
W4Y9R2_STRPU/1031-1383---------------------LQGSY....TDQ-----------------------------------------------
G3N6G2_GASAC/1731-2077---------------------LLPPS....LDP-----------------------------------------------
H3DAQ7_TETNG/1711-2057---------------------LLPLS....SDA-----------------------------------------------
I3KSG7_ORENI/1715-2061---------------------LLPLS....LDA-----------------------------------------------
H2L8K9_ORYLA/1692-2038---------------------LLPLT....KDP-----------------------------------------------
M3ZIW2_XIPMA/1768-2114---------------------FLPLA....QDP-----------------------------------------------
ESPL1_MOUSE/1716-2065---------------------LLPCS....ADP-----------------------------------------------
F7BUI1_CALJA/1724-2073---------------------LLPSS....EEP-----------------------------------------------
G3VPI8_SARHA/1713-2063---------------------LVPFT....GNP-----------------------------------------------
U3IXX7_ANAPL/1332-1679---------------------LLPAS....QEP-----------------------------------------------
G1KFP0_ANOCA/1819-2167---------------------LLPTC....EDP-----------------------------------------------
H3B3H1_LATCH/1699-2055---------------------LLPSS....KDP-----------------------------------------------
F6VXN8_XENTR/1732-2080---------------------LSCPC....SSD-----------------------------------------------
Q6ZHH8_ORYSJ/455-870---------------------LLGYD....LTD-----------------------------------------------
W5GJD2_WHEAT/891-1304---------------------LLGHQ....SAD-----------------------------------------------
K3Z105_SETIT/1078-1484---------------------LLGHQ....LSD-----------------------------------------------
C5XYE8_SORBI/457-870---------------------LLGHR....LSD-----------------------------------------------
C5XSY3_SORBI/1425-1832---------------------LLGHR....LSD-----------------------------------------------
K3Y3B2_SETIT/1404-1817---------------------LLGHQ....PSN-----------------------------------------------
M0UBW7_MUSAM/65-479---------------------LLGER....SVP-----------------------------------------------
ESP1_ARATH/1641-2060---------------------LLGEW....SNY-----------------------------------------------
M4DS49_BRARP/1599-2019---------------------LLGDL....SNF-----------------------------------------------
B9GZR1_POPTR/1674-2094---------------------LLGDW....FNY-----------------------------------------------
B9SSN4_RICCO/1627-2045---------------------LLGEL....SDS-----------------------------------------------
I1MDQ8_SOYBN/1648-2063---------------------LLGEW....LNC-----------------------------------------------
K4B224_SOLLC/1600-2023---------------------LLGEL....SEC-----------------------------------------------
W1NKX2_AMBTC/1-423---------------------LLGEL....FDD-----------------------------------------------
K7H1P7_CAEJA/245-604---------------------LRPSD....RLG-----------------------------------------------
E3LM18_CAERE/731-1090---------------------LMPSG....RLG-----------------------------------------------
G5ED39_CAEEL/727-1081---------------------LMPSG....QLG-----------------------------------------------
Q23491_CAEEL/749-1101---------------------LLPSG....RLG-----------------------------------------------
S3CR95_OPHP1/1758-2208---------------------FSQHV....RRP-----------------------------------------------
F0XAD9_GROCL/1636-2054---------------------FSQHT....RRA-----------------------------------------------
G2R9B0_THITE/1619-2058---------------------FSQHV....RRP-----------------------------------------------
Q2H6Q9_CHAGB/1612-2026---------------------FSQHV....RRP-----------------------------------------------
G0SHM3_CHATD/1723-2150---------------------FSQHG....RRP-----------------------------------------------
G4UQF5_NEUT9/1626-2085---------------------FSQHQTQGGKRK-----------------------------------------------
G4N8I2_MAGO7/1627-2057---------------------FSQQK....RCS-----------------------------------------------
J3P7L5_GAGT3/1606-2054---------------------FSQQR....RSP-----------------------------------------------
R8BFS3_TOGMI/72-487---------------------FSQHQ....RRS-----------------------------------------------
N4UZ87_COLOR/1637-2043---------------------FSQHR....HRP-----------------------------------------------
G2X6M8_VERDV/1704-2113---------------------FSQHP....RRD-----------------------------------------------
G0RRT6_HYPJQ/1566-1971---------------------FSQHR....RLG-----------------------------------------------
M1WFQ9_CLAP2/1438-1889---------------------FSQHQ....RRP-----------------------------------------------
J5K578_BEAB2/1584-1996---------------------FSQHR....RRS-----------------------------------------------
C7YYU1_NECH7/1580-1992---------------------FSQHE....RRP-----------------------------------------------
M7T4Q8_EUTLA/44-499---------------------FTQHH....KRS-----------------------------------------------
L8G205_PSED2/1652-2056---------------------FSQHT....IQP-----------------------------------------------
N1JFH1_BLUG1/1598-2001---------------------FSQHV....RRP-----------------------------------------------
K1X2E6_MARBU/1659-2061---------------------FSQHT....RRP-----------------------------------------------
S3D029_GLAL2/1639-2043---------------------FSQQS....RHP-----------------------------------------------
M7TX51_BOTF1/1640-2041---------------------FSQFT....RKS-----------------------------------------------
BIMB_EMENI/1609-2004---------------------FSPIP....LCE-----------------------------------------------
Q2USV7_ASPOR/1630-2030---------------------FSPVP....HDT-----------------------------------------------
G7XGU8_ASPKW/1627-2026---------------------FSPVP....HET-----------------------------------------------
S8BGE7_PENO1/1622-2018---------------------FSPLA....KHS-----------------------------------------------
B6GZP8_PENRW/1602-1998---------------------FSPLS....RET-----------------------------------------------
Q4WUU6_ASPFU/1638-2039---------------------FSPMA....HEG-----------------------------------------------
B6QNB5_TALMQ/1619-2016---------------------FDTFP....RNS-----------------------------------------------
V5GCB2_BYSSN/1684-2084---------------------FSPAS....RNV-----------------------------------------------
F0UL09_AJEC8/1642-2044---------------------FSQSP....RNI-----------------------------------------------
C5FSW7_ARTOC/1655-2058---------------------FSQIP....RND-----------------------------------------------
H6C6Q4_EXODN/1587-1987---------------------LSAPE....IDD-----------------------------------------------
U1G8A9_ENDPU/1638-2036---------------------FSDQY....HDE-----------------------------------------------
K2R7J5_MACPH/1619-2043---------------------FKKKG.....DR-----------------------------------------------
R7YNT5_CONA1/1696-2117---------------------FSQHT....RRQ-----------------------------------------------
E4ZTB4_LEPMJ/1652-2063---------------------FSQHE....RQT-----------------------------------------------
N1QAI8_PSEFD/1492-1912---------------------FSQHE....HDS-----------------------------------------------
N1QHR1_SPHMS/1187-1599---------------------FSQHD....RND-----------------------------------------------
N1PZ16_DOTSN/1513-1936---------------------LSQHG....QNL-----------------------------------------------
D5GKQ4_TUBMM/1633-2033---------------------FCQYA....LHK-----------------------------------------------
U4LG69_PYROM/1616-2019---------------------FSQYP....KNP-----------------------------------------------
S8C8B1_DACHA/1639-2040---------------------FGGYK....RHP-----------------------------------------------
Q6CCJ0_YARLI/1210-1588---------------------LGETV......G-----------------------------------------------
S9X830_SCHCR/1385-1771---------------------FSNHI....LDA-----------------------------------------------
CUT1_SCHPO/1383-1770---------------------FNPHK....IDT-----------------------------------------------
B6K0I6_SCHJY/1359-1747---------------------FSSKR....PHK-----------------------------------------------
M7PDE3_PNEMU/1489-1882---------------------FFQSN....INQ-----------------------------------------------
G8BT64_TETPH/1165-1563---------------------FDPC....PVNK-----------------------------------------------
I2H0Y5_TETBL/1280-1677---------------------FDDT....IIDE-----------------------------------------------
S6EFD3_ZYGB2/1145-1542---------------------FSPI....TTKP-----------------------------------------------
C5DU01_ZYGRC/1141-1538---------------------FCPE....VINT-----------------------------------------------
G8ZWZ1_TORDC/1158-1555---------------------FGPE....IIEA-----------------------------------------------
G0WDN6_NAUDC/1191-1589---------------------FDTT....KINE-----------------------------------------------
G0VFB3_NAUCC/1164-1562---------------------FDQS....VVDP-----------------------------------------------
H2B1L5_KAZAF/1161-1559---------------------FSHD....LIDE-----------------------------------------------
ESP1_YEAST/1175-1571---------------------FSPE....VVDN-----------------------------------------------
J7RG90_KAZNA/1160-1562---------------------FSPH....LIDQ-----------------------------------------------
Q75EJ0_ASHGO/1152-1552---------------------FSQK....QLDK-----------------------------------------------
C5DHM1_LACTC/1178-1575---------------------FAQE....IIEQ-----------------------------------------------
Q6CQQ7_KLULA/1118-1516---------------------FNPR....IVDQ-----------------------------------------------
Q6FTE1_CANGA/1151-1548---------------------LNGL....YCDK-----------------------------------------------
K0K8V1_WICCF/1175-1568---------------------FDCT....KIDK-----------------------------------------------
A5DNR9_PICGU/1178-1576---------------------FGA.....AIDV-----------------------------------------------
A3GFF5_PICST/1168-1555---------------------FFN.....YDED-----------------------------------------------
Q6BTB7_DEBHA/1338-1753---------------------FDDP....FVHK-----------------------------------------------
Q5A8X8_CANAL/1101-1536---------------------FTNDNDVENESK-----------------------------------------------
C5MEH0_CANTT/925-1303---------------------FEN.....YQQD-----------------------------------------------
M3HH45_CANMX/1423-1797---------------------FNC.....EEDP-----------------------------------------------
G8B5X7_CANPC/1052-1424---------------------FEP.......VG-----------------------------------------------
A5DVQ7_LODEL/1109-1530---------------------FASN....NLNS-----------------------------------------------
G3AGZ6_SPAPN/1149-1535---------------------FSN.....FQTG-----------------------------------------------
G8YBL5_PICSO/1309-1719---------------------FSTR....RLPQ-----------------------------------------------
C4XY11_CLAL4/1177-1564---------------------FFFT....DRQS-----------------------------------------------
G3B782_CANTC/1213-1609---------------------FGNH....DEES-----------------------------------------------
W1QIM9_OGAPD/1167-1527---------------------FGRLV....FEN-----------------------------------------------
C4QYS2_PICPG/1259-1619---------------------FSPKN....FEP-----------------------------------------------
K5WME3_PHACS/1732-2136---------------------LNDST...DIPG-----------------------------------------------
M2R2K9_CERS8/1618-2024---------------------LGPPR...AIPT-----------------------------------------------
F8PLA9_SERL3/1278-1688---------------------LSEPT...KIPR-----------------------------------------------
S8E105_FOMPI/1678-2083---------------------LSAPV...QTRP-----------------------------------------------
A8NBE9_COPC7/1839-2276---------------------LGPRP...DLTP-----------------------------------------------
B0E1W0_LACBS/104-540---------------------LSPRS...EATP-----------------------------------------------
D8Q1W5_SCHCM/1450-1878---------------------LGSRL...NLTP-----------------------------------------------
V2X3W8_MONRO/1588-2040---------------------LSKNT...YLSQ-----------------------------------------------
J0DCK6_AURST/1634-2046---------------------LNDPL...ALAA-----------------------------------------------
R9AIE1_WALI9/1639-2036---------------------FIKPT...ATSE-----------------------------------------------
I4YB88_WALMC/1631-2030---------------------FLKPT...AKSE-----------------------------------------------
G4T5A4_PIRID/1472-1874---------------------FSKRL...NMTR-----------------------------------------------

PF01364

KGP83_PORGN/244-595.....................GDYFPE..MYTF-----------------------------------------------
D1JG83_9ARCH/891-1295.....................DDDFLE..VATG-----------------------------------------------
A2U064_9FLAO/401-768....................STSHTVD..VASS-----------------------------------------------
Q7MTE2_PORGI/239-573.....................NDHYNE..VFIG-----------------------------------------------
D3HWT0_9BACT/400-777...................LEEADRLD..IGVG-----------------------------------------------
Q5S3Q9_9FLAO/543-910....................TGTEGCD..IAVG-----------------------------------------------
A9DMD5_9FLAO/555-923....................TISDRLD..IALG-----------------------------------------------
B0VGA8_CLOAI/228-563.....................NDYLGD..AFIG-----------------------------------------------
B7B5I7_9PORP/382-753...................SLQNKKLC..LGIG-----------------------------------------------
B8FFM0_DESAA/254-600.....................GDILPE..LLVG-----------------------------------------------
A3U7G6_CROAH/540-908....................QNFDKLD..IAIG-----------------------------------------------
D2QSX9_SPILD/414-786..................NQNGDYSLD..VGIG-----------------------------------------------
A3HW99_9BACT/398-769.....................QPLVPA..MAVG-----------------------------------------------
B0VHP2_CLOAI/234-563.....................NDNYYD..IFVG-----------------------------------------------
A8ZUB1_DESOH/278-656............RTDGEDGGDVDLMAE..IFVG-----------------------------------------------
B0VIM2_CLOAI/182-528.....................DDYFPE..MIAG-----------------------------------------------
Q2Z0E1_9BACT/643-1013.....................NRYEPG..MALG-----------------------------------------------
B3QXR8_CHLT3/734-1131....................QLDLLPD..MQIS-----------------------------------------------
C2MCN4_9PORP/405-781...................GVGAQPLS..VGIG-----------------------------------------------
A4A325_9PLAN/24-399.....................DDLLPD..VAIG-----------------------------------------------
A7NR84_ROSCS/499-867.....................DDRLPD..VWLG-----------------------------------------------
Q11Q36_CYTH3/558-932..................TPLDDNTLN..IGVG-----------------------------------------------
Q7MX16_PORGI/272-637.....................LDTVGD..LFIG-----------------------------------------------
A0B5K7_METTP/796-1154.....................DDNYTE..VATG-----------------------------------------------
D0MH89_RHOM4/586-975................GAGAYSTERLD..LGIG-----------------------------------------------
A8UH97_9FLAO/539-910....................NNSDRMD..IAVG-----------------------------------------------
B8KYL6_9GAMM/364-704.....................DDYLPD..LAVG-----------------------------------------------
B8FIK5_DESAA/1139-1542...............GEVDDDLDFAPD..VFVG-----------------------------------------------
Q11US7_CYTH3/392-767.....................NKYAAQ..IHTG-----------------------------------------------
C6W101_DYAFD/326-680......................SRMPL..VPIG-----------------------------------------------
A5FJM8_FLAJ1/544-914...................AFPFGGID..IAVG-----------------------------------------------
Q7UG73_RHOBA/51-444.....................GDRVSD..AAIG-----------------------------------------------
A3J247_9FLAO/540-919...................LGSFDGID..IAVG-----------------------------------------------
A9WIM0_CHLAA/500-869....................ETLFQAD..LWIG-----------------------------------------------
B0VHE7_CLOAI/227-554.....................NDNLGD..VMIG-----------------------------------------------
C6VT06_DYAFD/394-758.....................PVNAPA..IPVG-----------------------------------------------
C6X3N8_FLAB3/546-921...................SVASTLPD..FPVG-----------------------------------------------
A0LQH1_SYNFM/790-1132.....................EDGLAD..VALG-----------------------------------------------
A1ZVJ9_9BACT/406-774..................TSLGDHTLE..IGIG-----------------------------------------------
B0VHF1_CLOAI/214-595...............WGEMYEADLTPE..LAIG-----------------------------------------------
B0VIE7_CLOAI/193-598...........STGYMNEDYGIDFTPE..VFVG-----------------------------------------------
C6W3P4_DYAFD/414-806.....................PRDVPA..IPVG-----------------------------------------------
B2RGP6_PORG3/408-787...................NIGWRNYN..MAVG-----------------------------------------------
D2QJ99_SPILD/409-770.....................PDGVPA..IPTG-----------------------------------------------
A9B5Q8_HERA2/466-850.....................DDPMPD..LQIG-----------------------------------------------
D2QFF3_SPILD/397-745.....................PPNTPA..IPTG-----------------------------------------------
B0VH03_CLOAI/589-939.....................TSYYPE..LAIG-----------------------------------------------
D2R2P5_PIRSD/21-411.....................DDSIPD..LAIG-----------------------------------------------
C6W0Z3_DYAFD/393-758..................HATGDHTVD..IGVG-----------------------------------------------
A3XQP5_LEEBM/552-929................PAGSGGSDRLD..IAVG-----------------------------------------------
Q2PY26_9BACT/412-780....................LTRKTLD..LCIG-----------------------------------------------
Q26FX7_FLABB/537-909....................ATNNLMD..LAVG-----------------------------------------------
B0VJT2_CLOAI/236-566.....................NDQLGD..CFIG-----------------------------------------------
C6BTD6_DESAD/56-402.....................SDSAPENMLPVG-----------------------------------------------
D2QE53_SPILD/328-1007....MFALNPVNKEEEPLLNSYKTTQD..IWVG-----------------------------------------------
A2BK55_HYPBU/159-551.....................YDNYLE..LAVG-----------------------------------------------
B0VHP1_CLOAI/283-636.....................TDYMPE..MYFG-----------------------------------------------
Q1Q1Y4_9BACT/620-970.....................NDILPD..MHIG-----------------------------------------------
C7PNY3_CHIPD/396-764..................GRV..NLLD..VAIG-----------------------------------------------
Q6LFY5_PHOPR/224-617.....................DDKYSD..VVIG-----------------------------------------------
B3QVL4_CHLT3/688-1063.....................DDMVPD..IAVG-----------------------------------------------
A9B187_HERA2/552-907.....................NDTLPD..LFLG-----------------------------------------------
R5M3W7_9BACE/537-910...................LSD.AMLD..IGIG-----------------------------------------------
B0VJY1_CLOAI/655-1014.....................TDIVPD..ISIA-----------------------------------------------
B8G4Y1_CHLAD/584-1054.......PAAQQRNGYTSDSRNVFNLT..VAVG-----------------------------------------------
A1ZEG7_9BACT/410-775.....................SPQTPM..IPTG-----------------------------------------------
B0VF22_CLOAI/223-583...............GETNDNTDLIPE..VHIG-----------------------------------------------
A0LKV0_SYNFM/924-1265.....................DDGVPD..LAIG-----------------------------------------------
A8ZTD5_DESOH/257-648.....................DDYFPD..LSLG-----------------------------------------------
A9B8S0_HERA2/477-840.....................SDLLPD..LPVG-----------------------------------------------
C3JBB2_POREA/421-799...................TNGRKQLS..IGIG-----------------------------------------------
C9SW40_VERA1/279-917WDAIGNGVYGQFRLDGSDIDGVNLQTE..LSVG-----------------------------------------------
C9LI59_9BACT/509-899...................MAQTDKLD..LGIG-----------------------------------------------
B5ICF9_ACIB4/214-642.....................FSYEPQ..FFIG-----------------------------------------------
Y048_ARCFU/22-377.....................YDLKPD..FAVG-----------------------------------------------
A3I371_9BACT/360-725..................TLAGDESLQ..IGIG-----------------------------------------------

PF11713

MARTX_VIBCH/3469-3626---------------------..........PS-----------------------------------------------
A0KHZ7_AERHH/3609-3767---------------------..........PA-----------------------------------------------
Q2KX68_BORA1/2483-2627---------------------..........VN-----------------------------------------------
Q2SAY5_HAHCH/1-160---------------------.........GLG-----------------------------------------------
Q7N1Z0_PHOLL/2456-2614---------------------..........LA-----------------------------------------------
Q7N726_PHOLL/2997-3151---------------------..........PA-----------------------------------------------
Q7VV06_BORPE/2551-2702---------------------..........RA-----------------------------------------------
Q7VV06_BORPE/2959-3112---------------------..........AG-----------------------------------------------
Q7VV06_BORPE/3397-3549---------------------..........AA-----------------------------------------------
Q7VV06_BORPE/3808-3959---------------------..........DT-----------------------------------------------
Q189K3_PEPD6/575-754---------------------EIQEIDKYKIPS-----------------------------------------------
Q189K5_PEPD6/577-756---------------------SILELNKYRIPE-----------------------------------------------
Q7CGR6_YERPE/772-928---------------------..........QN-----------------------------------------------

PF01650

LGMN_HUMAN/29-286---------------------KGIGSGKVLKSG-----------------------------------------------
VPED_ARATH/46-316---------------------T.GGNGKVVKSG-----------------------------------------------
VPEG_ARATH/59-330---------------------K.GGSGKVVDSG-----------------------------------------------
A0CQC7_PARTE/19-285---------------------P.D.GHKFINST-----------------------------------------------
A2FXM6_TRIVA/13-267---------------------...SQGPALQST-----------------------------------------------
O24539_VICNA/53-325---------------------R.GGSGKVINSK-----------------------------------------------
HGLB_SCHMA/37-291---------------------...AGGKVLKSG-----------------------------------------------
HGLB_SCHJA/31-285---------------------...AGGKVLKSG-----------------------------------------------
VPE_VICSA/56-325---------------------T.GGSGKVVDSG-----------------------------------------------
A0A080VK93_PSEAI/341-579---------------------..........SG-----------------------------------------------
Q08BI0_DANRE/27-278---------------------...AGGKIIRSK-----------------------------------------------
Q0MYV8_EMIHU/33-301---------------------D.G..GKVLQST-----------------------------------------------
Q22P32_TETTS/20-285---------------------ANIGTGRVLEST-----------------------------------------------
Q22P33_TETTS/20-285---------------------AKIGTGRVLEST-----------------------------------------------
D0MXB3_PHYIT/25-298---------------------...FNKNVLNST-----------------------------------------------
Q2UVF3_HAECO/29-287---------------------K.GGNGRVIHST-----------------------------------------------
Q4K5F2_PSEF5/335-570---------------------..........SG-----------------------------------------------
Q4RED0_TETNG/30-283---------------------..K..GKVIQSG-----------------------------------------------
Q8P9N6_XANCP/124-392---------------------.........MDR-----------------------------------------------
Q6EHZ7_TRIVA/12-258---------------------.......TLKST-----------------------------------------------
Q6FEB2_ACIAD/229-477---------------------.........MNR-----------------------------------------------
Q6L4R2_ORYSJ/41-319---------------------TGSGSGKVVASG-----------------------------------------------
Q6NYJ7_DANRE/32-288---------------------K.GGSGKVLKSG-----------------------------------------------
Q6PRC7_IXORI/38-293---------------------K.GGSGKVIASG-----------------------------------------------
Q711M2_FASHE/21-278---------------------..KAGYKVLQTG-----------------------------------------------
VPE1_ORYSJ/62-334---------------------T.GGSGKVIDSK-----------------------------------------------
Q852T1_TOBAC/49-320---------------------S.GGSGKVVESG-----------------------------------------------
Q88QE3_PSEPK/400-640---------------------..........SG-----------------------------------------------
Q949L7_BETVU/51-321---------------------T.GGSGKVVNSG-----------------------------------------------
Q9LLQ4_SESIN/54-326---------------------K.GGSGKVVDSK-----------------------------------------------
Q9LWZ3_ORYSJ/41-304---------------------TGAGSGKVISSG-----------------------------------------------
Q9SBX2_MAIZE/45-317---------------------R.GGSGKVVDSG-----------------------------------------------
Q9SMD0_SOLLC/39-316---------------------T.GGSGKVVNSG-----------------------------------------------
Q9XG75_TOBAC/40-306---------------------T.GGSGKVVENG-----------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227-----------------------------KDFT-----------------------------------------------
DRONC_DROME/196-443-----------------------------SYVQ-----------------------------------------------
O42284_CHICK/42-279-----------------------------KDHL-----------------------------------------------
CAS1A_XENLA/144-382-----------------------------EEHA-----------------------------------------------
CASPC_MOUSE/176-415-----------------------------PEHQ-----------------------------------------------
CASP4_MOUSE/132-369-----------------------------SEHQ-----------------------------------------------
CASP5_HUMAN/193-430-----------------------------PEHK-----------------------------------------------
CASPD_BOVIN/136-373-----------------------------EEHK-----------------------------------------------
CASP1_CANLF/163-400-----------------------------PEHK-----------------------------------------------
CASP1_FELCA/161-406-----------------------------PEHK-----------------------------------------------
CASP1_MOUSE/162-398-----------------------------PEHK-----------------------------------------------
CASP1_HUMAN/163-400-----------------------------PEHK-----------------------------------------------
CASP1_PIG/163-400-----------------------------PEHK-----------------------------------------------
Q9I9L7_DANRE/145-379-----------------------------EEHK-----------------------------------------------
Q9DDJ2_DANRE/174-400-----------------------------REHE-----------------------------------------------
Q6NTR7_XENLA/280-494-----------------------------EQHK-----------------------------------------------
CFLAR_MOUSE/257-480-----------------------------AQHQ-----------------------------------------------
Q6QN97_PIG/259-484-----------------------------PQHQ-----------------------------------------------
CFLAR_HUMAN/252-477-----------------------------PEHR-----------------------------------------------
Q9NBW3_DROME/38-248-----------------------------KRFT-----------------------------------------------
Q9TZP5_CAEEL/26-261-----------------------------SNHG-----------------------------------------------
CASPE_MOUSE/22-256-----------------------------IDNW-----------------------------------------------
CASPE_HUMAN/18-241-----------------------------IDSR-----------------------------------------------
Q8I749_SUBDO/254-491-----------------------------EDHP-----------------------------------------------
CASP2_RAT/200-445-----------------------------PAHR-----------------------------------------------
CASP2_CHICK/171-416-----------------------------PDHQ-----------------------------------------------
Q9GV89_HYDVU/93-318-----------------------------VKCF-----------------------------------------------
Q9IB63_XENLA/144-396-----------------------------QDHS-----------------------------------------------
CASP9_HUMAN/161-413-----------------------------QDHG-----------------------------------------------
Q90WU0_CHICK/148-400-----------------------------LDHS-----------------------------------------------
Q9IB64_XENLA/261-494-----------------------------KDHA-----------------------------------------------
Q6E5N8_ICTPU/119-362-----------------------------QQHH-----------------------------------------------
Q9I8J3_DANRE/238-473-----------------------------RNHA-----------------------------------------------
Q6PAD9_XENLA/268-495-----------------------------KDHS-----------------------------------------------
Q90WU1_CHICK/237-479-----------------------------MDHN-----------------------------------------------
CASP8_HUMAN/234-476-----------------------------MDHS-----------------------------------------------
CASP8_MOUSE/236-478-----------------------------ADHK-----------------------------------------------
Q9Y1U6_PRIPA/173-413-----------------------------TKHS-----------------------------------------------
CED3_CAEEL/243-494-----------------------------ESHG-----------------------------------------------
Q7QKT2_ANOGA/35-260-----------------------------EDHT-----------------------------------------------
Q7PZJ9_ANOGA/20-250-----------------------------EDHT-----------------------------------------------
Q9GV88_HYDVU/84-316-----------------------------EDYS-----------------------------------------------
Q7Q1E0_ANOGA/62-291-----------------------------MDHS-----------------------------------------------
CASP1_SPOFR/61-293-----------------------------MDHS-----------------------------------------------
CASP1_DROME/79-313-----------------------------LDHT-----------------------------------------------
Q7Q4X6_ANOGA/73-309-----------------------------MDHS-----------------------------------------------
DRICE_DROME/94-328-----------------------------QNHS-----------------------------------------------
Q9NHF9_DROME/56-302-----------------------------EDHS-----------------------------------------------
Q7Q803_ANOGA/54-306-----------------------------EDHK-----------------------------------------------
Q7PV92_ANOGA/14-237-----------------------------EDHS-----------------------------------------------
Q86FL0_ANOST/52-286-----------------------------EDHL-----------------------------------------------
Q8I6Y2_GEOCY/158-414-----------------------------RDHS-----------------------------------------------
Q8ITP3_BRAFL/87-323-----------------------------EDHR-----------------------------------------------
O88550_RAT/68-301-----------------------------EDHS-----------------------------------------------
Q6DCI2_XENLA/78-314-----------------------------QDHK-----------------------------------------------
Q8JIS8_ORYLA/58-285-----------------------------QDHS-----------------------------------------------
CASP3_XENLA/56-280-----------------------------EDHS-----------------------------------------------
O93417_CHICK/53-281-----------------------------EDHS-----------------------------------------------
Q98UI8_DANRE/48-280-----------------------------DDHS-----------------------------------------------
Q8JG42_TAKRU/51-279-----------------------------EDHS-----------------------------------------------
Q8ITP2_BRAFL/151-396-----------------------------YDHS-----------------------------------------------
Q9IB66_XENLA/58-298-----------------------------TDHS-----------------------------------------------
Q9I8S9_ONCMY/57-297-----------------------------ANHA-----------------------------------------------
O93415_CHICK/57-299-----------------------------DDYS-----------------------------------------------
CASP6_MOUSE/28-270-----------------------------SSHI-----------------------------------------------
PCP_DICDI/188-404-----------------------------VQSF-----------------------------------------------
Q7AKE1_STRCO/9-268-----------------------------A...-----------------------------------------------
A0A063TRB6_BORBO/552-800-----------------------------QQLD-----------------------------------------------
Q7NPG1_GLOVI/7-278-----------------------------VSRS-----------------------------------------------
Q87Z21_PSESM/2-224-----------------------------....-----------------------------------------------
Q82I86_STRAW/5-276-----------------------------QLGA-----------------------------------------------
P74453_SYNY3/40-299-----------------------------VQ..-----------------------------------------------
Q8YS65_NOSS1/4-245-----------------------------LSMG-----------------------------------------------
Q9DDL2_DANRE/323-560-----------------------------LDRG-----------------------------------------------
Q98CE0_RHILO/5-237-----------------------------EDAK-----------------------------------------------
Q6N0T4_RHOPA/30-250-----------------------------TK..-----------------------------------------------
Q89XG2_BRADU/27-247-----------------------------IK..-----------------------------------------------
Q89XE4_BRADU/58-278-----------------------------IK..-----------------------------------------------
Q6NBN5_RHOPA/57-277-----------------------------AG..-----------------------------------------------
Q98JS7_RHILO/35-253-----------------------------AHLI-----------------------------------------------
Q985X8_RHILO/35-256-----------------------------ATAA-----------------------------------------------
Q6N5Q1_RHOPA/33-253-----------------------------AEDS-----------------------------------------------
Q89KP2_BRADU/86-307-----------------------------AQAS-----------------------------------------------
Q89IK1_BRADU/30-253-----------------------------ASRA-----------------------------------------------
Q98G71_RHILO/26-252-----------------------------LEGA-----------------------------------------------
Q6AKF4_DESPS/28-248-----------------------------I...-----------------------------------------------
Q98IJ6_RHILO/11-238-----------------------------VRGA-----------------------------------------------
Q89MV1_BRADU/176-400-----------------------------AQGA-----------------------------------------------
Q89HT8_BRADU/51-272-----------------------------VSAR-----------------------------------------------
Q89FZ4_BRADU/32-256-----------------------------VSAS-----------------------------------------------
Q6N329_RHOPA/73-298-----------------------------VVAK-----------------------------------------------
Q98IJ9_RHILO/30-261-----------------------------SYNA-----------------------------------------------
Q89HP3_BRADU/336-569-----------------------------AARA-----------------------------------------------
Q7RFI8_PLAYO/964-1364-----------------------------SV..-----------------------------------------------
Q74F93_GEOSL/6-270-----------------------------LG..-----------------------------------------------
MCA9_ARATH/10-321-----------------------------AQAG-----------------------------------------------
MCA8_ARATH/3-378-----------------------------GQ..-----------------------------------------------
MCA7_ARATH/3-401-----------------------------AKSG-----------------------------------------------
Q70VV0_PICAB/3-415-----------------------------SRAG-----------------------------------------------
Q9ZSP8_HEVBR/3-415-----------------------------AE..-----------------------------------------------
MCA4_ARATH/3-416-----------------------------ADSG-----------------------------------------------
MCA5_ARATH/3-408-----------------------------AK..-----------------------------------------------
MCA6_ARATH/3-366-----------------------------AK..-----------------------------------------------
MCA1_ARATH/80-362-----------------------------CT..-----------------------------------------------
MCA2_ARATH/116-414-----------------------------CK..-----------------------------------------------
MCA1_SCHPO/130-422-----------------------------AQ..-----------------------------------------------
MCA1_YARLI/168-458-----------------------------AQ..-----------------------------------------------
MCA1_DEBHA/146-437-----------------------------AR..-----------------------------------------------
MCA1_ASHGO/154-449-----------------------------AQ..-----------------------------------------------
MCA1_KLULA/138-430-----------------------------AR..-----------------------------------------------
MCA1_CANGA/98-389-----------------------------AQ..-----------------------------------------------
B5VS82_YEAS6/157-450-----------------------------AQ..-----------------------------------------------
Q386I9_TRYB2/84-341-----------------------------AK..-----------------------------------------------
Q38D34_TRYB2/63-322-----------------------------VR..-----------------------------------------------
Q8T8E6_9TRYP/84-343-----------------------------AK..-----------------------------------------------

PF14538

W1QFK7_OGAPD/56-210--------------------------------------------------------------------------------
L8WVZ0_THACA/73-224--------------------------------------------------------------------------------
A2EZ34_TRIVA/89-236--------------------------------------------------------------------------------
Q6C6R4_YARLI/86-238--------------------------------------------------------------------------------
M2WI96_DOTSN/172-328--------------------------------------------------------------------------------
K2S4T3_MACPH/104-258--------------------------------------------------------------------------------
C4LXC3_ENTHI/42-194--------------------------------------------------------------------------------
T1G0Q6_HELRO/62-216--------------------------------------------------------------------------------
B0CNS4_LACBS/34-185--------------------------------------------------------------------------------
F0ZAV4_DICPU/115-266--------------------------------------------------------------------------------
U9UGJ5_RHIID/52-203--------------------------------------------------------------------------------
Q5KIS3_CRYNJ/92-243--------------------------------------------------------------------------------
B0WBU4_CULQU/30-181--------------------------------------------------------------------------------
A5DWK2_LODEL/143-295--------------------------------------------------------------------------------
G0VGR8_NAUCC/79-231--------------------------------------------------------------------------------
I3J5N7_ORENI/57-208--------------------------------------------------------------------------------
A2DYM2_TRIVA/68-215--------------------------------------------------------------------------------
D8TLK8_VOLCA/11-162--------------------------------------------------------------------------------
G4M000_SCHMA/43-194--------------------------------------------------------------------------------
C1MUE6_MICPC/45-196--------------------------------------------------------------------------------
Q387I9_TRYB2/89-240--------------------------------------------------------------------------------
C4M2F5_ENTHI/38-189--------------------------------------------------------------------------------
G4TT65_PIRID/72-223--------------------------------------------------------------------------------
G0NWW0_CAEBE/64-218--------------------------------------------------------------------------------
A2DJF0_TRIVA/83-228--------------------------------------------------------------------------------
K3WJU9_PYTUL/84-235--------------------------------------------------------------------------------
A2G590_TRIVA/30-180--------------------------------------------------------------------------------
B8M6V6_TALSN/189-342--------------------------------------------------------------------------------
A2FJN8_TRIVA/41-191--------------------------------------------------------------------------------