Sequence alignment for CL0093

PF01650

VPEG_ARATH/59-330----------------------------------RWAVLVAGSSG-----YWN----YRHQADICHAYQLLR--------
A0CQC7_PARTE/19-285----------------------------------NWALLVSGSNA-----FYN----YRHQADVCHSYKTLI--------
A2FXM6_TRIVA/13-267----------------------------------TWAVIFCGSRD-----FYN----YRHTADSYYMYHLIA--------
O24539_VICNA/53-325----------------------------------RWAVLVAGSNG-----YGN----YRHQADVCHAYQLLI--------
HGLB_SCHMA/37-291----------------------------------KWAVLVAGSNG-----YPN----YRHQADVCHAYHVLR--------
HGLB_SCHJA/31-285----------------------------------KWAVLVAGSNG-----FEN----YRHQADVCHAYHVLL--------
VPE_VICSA/56-325----------------------------------RWAILLAGSNG-----YWN----YRHQSDVCHAYQLLR--------
A0A022P416_PSEAI/341-579----------------------------------LYALSLGGDGR-----QGV----FLREAD..YAGDLLG--------
Q08BI0_DANRE/27-278----------------------------------AWVLLVAGSKD-----WDN----YRHQANVCCAYQLMK--------
Q0MYV8_EMIHU/33-301----------------------------------HWAVLIAGSSG-----YGN----YRHQADVCHAYQIMI--------
Q22P32_TETTS/20-285----------------------------------NYSVLVAGSKG-----YEN----YRHQADVCHAYHTLV--------
Q22P33_TETTS/20-285----------------------------------NYSVLVAGSKG-----YEN----YRHQADVCHAYQSLL--------
D0MXB3_PHYIT/25-298----------------------------------HWAVIVSGSNG-----YSN----YRHQSDACHAYHIVR--------
Q2UVF3_HAECO/29-287----------------------------------LYALLVAGSDG-----WWN----YRHQADVSHAYHTLI--------
Q4K5F2_PSEF5/335-570----------------------------------LYSLTLAGDGK-----QSV----FLREAD..YVSNMLA--------
Q4RED0_TETNG/30-283----------------------------------NWVVIVAGSNG-----WDN----YRHQADACHAYQIVH--------
Q4UU48_XANC8/124-392----------------------------------LYVVGFAGDAS-----DDV----FRNETL..YLKQLFE--------
Q6EHZ7_TRIVA/12-258----------------------------------RFAVLIAGSND-----FYN----YRHQADIFNMYQQLV--------
N9BI26_ACIBI/229-477----------------------------------WYFLGVAGASY-----QDV----FKSEIM..RIKDQFD--------
Q6L4R2_ORYSJ/41-319----------------------------------RWAVLIAGSNG-----FYN----YRHQADVCHAYQIMR--------
Q6NYJ7_DANRE/32-288----------------------------------HWVVIVAGSNG-----WYN----YRHQADVCHAYQIVH--------
Q6PRC7_IXORI/38-293----------------------------------LWALLVAGSNG-----YYN----YRHQADICHAYHVLH--------
Q711M2_FASHE/21-278----------------------------------NWAVLVAGSNG-----WPN----YRHHADVCHAYQVLI--------
Q84LM2_ORYSJ/62-334----------------------------------RWAVLVAGSSG-----YGN----YRHQADVCHAYQILQ--------
Q852T1_TOBAC/49-320----------------------------------KWAVLVAGSRG-----YWN----YRHQADVCHAYQLLK--------
Q86TV2_HUMAN/29-286----------------------------------HWVVIVAGSNG-----WYN----YRHQADACHAYQIIH--------
Q88QE3_PSEPK/400-640----------------------------------LYSLVVAGDGQ-----QSV----FLREAD..YVSRMLK--------
Q8LGK2_ARATH/46-316----------------------------------RWAVLVAGSNE-----YYN----YRHQADICHAYQILR--------
Q949L7_BETVU/51-321----------------------------------RWAVLIAGSSG-----YWN----YRHQADVCHAYQVLK--------
Q9LLQ4_SESIN/54-326----------------------------------RWAVLVAGSNG-----FGN----YRHQADVCHAYQILK--------
Q9LWZ3_ORYSJ/41-304----------------------------------KWALLIAGSKG-----YEN----YRHQADVCHAYQIMK--------
Q9SBX2_MAIZE/45-317----------------------------------RWAVLIAGSNG-----YYN----YRHQADICHAYQIMK--------
Q9SMD0_SOLLC/39-316----------------------------------KWAVLVAGSKE-----WYN----YRHQANLCHAYQLLK--------
Q9XG75_TOBAC/40-306----------------------------------KWAVLVAGSNE-----WDN----YRHQADVCHAYQLLK--------

PF00656

Q7QGM9_ANOGA/35-227----------------------------------AYVLVF..HHD.....QFK....NPKN..........N--------
ICENC_DROME/196-443----------------------------------GVLLMV..NIM.....DYP....DQNR..........R--------
O42284_CHICK/42-279----------------------------------RRALLI..CNT.....KFK....HLR...........Q--------
CAS1A_XENLA/144-382----------------------------------GLALII..CNE.....KFE....NLN...........E--------
CASPC_MOUSE/176-415----------------------------------RLALII..CNK.....KFD....YLF...........D--------
CASP4_MOUSE/132-369----------------------------------RKALII..CNT.....EFK....HLS...........L--------
CASP5_HUMAN/193-430----------------------------------RLALII..CNT.....KFD....HLP...........A--------
CASPD_BOVIN/136-373----------------------------------RLALII..CNT.....EFD....HMP...........P--------
CASP1_CANFA/163-400----------------------------------RLALII..CNI.....EFD....HLS...........T--------
CASP1_FELCA/161-406----------------------------------RLALII..CNT.....TFD....HLS...........L--------
CASP1_MOUSE/162-398----------------------------------RLALII..CNT.....EFQ....HLS...........P--------
CASP1_HUMAN/163-400----------------------------------RLALII..CNE.....EFD....SIP...........R--------
CASP1_PIG/163-400----------------------------------RLALII..CNT.....EFE....NLP...........R--------
Q9I9L7_DANRE/145-379----------------------------------RLALLI..NNV.....DFD....DKAM..........K--------
Q9DDJ2_DANRE/174-400----------------------------------GLALLI..TNI.....QFA....NTQH..........N--------
Q6NTR7_XENLA/280-494----------------------------------GFCLII..DCV...........................--------
CFLAR_MOUSE/257-480----------------------------------GICLII..DCI...........................--------
Q6QN97_PIG/259-484----------------------------------GICLII..DCV...........................--------
A0A024R3Z7_HUMAN/252-477----------------------------------GICLII..DCI...........................--------
Q9NBW3_DROME/38-248----------------------------------PAVYIL..NHE.....QFP....QDS.......QL..N--------
Q9TZP5_CAEEL/26-261----------------------------------CRAIII..NNV.....VFC....GME...........K--------
CASPE_MOUSE/22-256----------------------------------RLALTL..CVT.......K..................A--------
B2CIS9_HUMAN/18-241----------------------------------RLALIL..CVT.......K..................A--------
Q8I749_SUBDO/254-491----------------------------------GICLII..NNH.....QFY....HSDPE.....KCHSN--------
CASP2_RAT/200-445----------------------------------GLALVM..SNV.....HFT.GEKDLE...........F--------
CASP2_CHICK/171-416----------------------------------GLALIL..SNI.....HFS.SEKDLE...........Y--------
Q9GV89_HYDVU/93-318----------------------------------GFVLII..NNE.....KFV....EEE...........N--------
Q9IB63_XENLA/144-396----------------------------------GFCLII..NNM.....NFH.ECTGLS...........T--------
CASP9_HUMAN/161-413----------------------------------GHCLII..NNV.....NFC.RESGLR...........T--------
Q90WU0_CHICK/148-400----------------------------------GHCLIF..NNV.....SFS.RDSDLS...........T--------
Q9IB64_XENLA/261-494----------------------------------GWCVVI..NNY.....DFK....EARS...QDCKYT.D--------
Q6E5N8_ICTPU/119-362----------------------------------GFCVII..NNV.....NFA....SPLK..........E--------
Q9I8J3_DANRE/238-473----------------------------------GYCLII..NNY.....NFL....ESTN.......LL.K--------
Q6PAD9_XENLA/268-495----------------------------------GYCLII..DNS.....IFA....KGK...........R--------
Q90WU1_CHICK/237-479----------------------------------GVCLIL..NNH.....NFA....KAREAVPELRRMK.D--------
CASP8_HUMAN/234-476----------------------------------GYCLII..NNH.....NFA....KAREKVPKLHSIR.D--------
CASP8_MOUSE/236-478----------------------------------GYCLII..NNH.....DFS....KAREDITQLRKMK.D--------
Q9Y1U6_PRIPA/173-413----------------------------------GYALII..SNE.....HFR....TMP...........Q--------
CED3_CAEEL/243-494----------------------------------GMCLII..NNE.....HFE....QMP...........T--------
Q7QKT2_ANOGA/35-260----------------------------------GIAVVI..NNN.......R..................D--------
Q7PZJ9_ANOGA/20-250----------------------------------GIAVVI..NDS.......E..................N--------
Q9GV88_HYDVU/84-316----------------------------------GTLTII..NVK.....NFM....KSSN......KHEYP--------
Q7Q1E0_ANOGA/62-291----------------------------------GMALIF..SHN.....KYNVRNVSLP...........V--------
CASP1_SPOFR/61-293----------------------------------GMAIIF..NHE.....HFD..IHSLK...........S--------
CASP1_DROME/79-313----------------------------------GVALIF..NHE.....FFD..IPSLK...........S--------
Q7Q4X6_ANOGA/73-309----------------------------------GLALIF..NHE.....NFD..VPQLR...........S--------
ICE_DROME/94-328----------------------------------GMALIF..NHE.....HFE..VPTLK...........S--------
Q9NHF9_DROME/56-302----------------------------------GIALIL..NHK.....DVK....GQK...........Q--------
Q7Q803_ANOGA/54-306----------------------------------GVAAVF..NHR.....KFL....HAS...........E--------
Q7PV92_ANOGA/14-237----------------------------------GIALII..NQV.....IFS....SMA...........V--------
Q86FL0_ANOST/52-286----------------------------------GIAIII..NQV.....NFS....GMA...........K--------
Q8I6Y2_GEOCY/158-414----------------------------------GMALII..NNR.....NFT...CGMK...........E--------
Q8ITP3_BRAFL/87-323----------------------------------GQAIII..NNK.....DFE.KHTGMN...........T--------
O88550_RAT/68-301----------------------------------GKCIII..NNK.....NFD.KATGMD...........V--------
Q6DCI2_XENLA/78-314----------------------------------GRCIII..NNK.....IFD.KITGMG...........A--------
Q8JIS8_ORYLA/58-285----------------------------------GICLII..NNK.....NFH.KDSGMG...........P--------
CASP3_XENLA/56-280----------------------------------GMCLII..NNK.....NFH..SSNMA...........V--------
O93417_CHICK/53-281----------------------------------GVCVII..NNK.....NFH.RDTGLS...........S--------
Q98UI8_DANRE/48-280----------------------------------GHCIII..NNK.....NFD.RRTGMN...........P--------
Q8JG42_TAKRU/51-279----------------------------------GHCIII..NNK.....NFD.RRTGMN...........T--------
Q8ITP2_BRAFL/151-396----------------------------------GLCLVF..DNE.....EFH.WTTKMN...........R--------
Q9IB66_XENLA/58-298----------------------------------GLALIF..NHE.....DFY.WQLRLG...........S--------
Q9I8S9_ONCMY/57-297----------------------------------GLALIF..NQE.....HFF.WHLRMP...........P--------
O93415_CHICK/57-299----------------------------------GVALIF..NHE.....HFF.WHLRLP...........D--------
CASP6_MOUSE/28-270----------------------------------GVALIF..NHE.....RFF.WHLTLP...........E--------
PCP_DICDI/188-404----------------------------------RISFII..GNS.....KYS....QHR...........K--------
Q53839_STRCH/9-268----------------------------------SRVVLV..GVA.....DYD.....HL....P......P--------
A0A038IA40_BORBO/552-800----------------------------------.HAMIV..GIN.....EFG....EASL..........N--------
Q7NPG1_GLOVI/7-278----------------------------------.KALIV..AIN.....DYP....GTTN..........D--------
Q87Z21_PSESM/2-224----------------------------------KKALVI..GID.....NYP.....TA...........P--------
Q82I86_STRAW/5-276----------------------------------.HALLV..GID.....DYP....SQTAT.........P--------
F7URG9_SYNYG/40-299----------------------------------KWALLLAAGQG.....NGA....NGDR.R........G--------
Q8YS65_NOSS1/4-245----------------------------------NWAIAI..GVN.....QYD....YLE...........P--------
Q9DDL2_DANRE/323-560----------------------------------KVALLI..GNM.....NYL....HHR...........Q--------
Q98CE0_RHILO/5-237----------------------------------RVALVM..ADN.....DYR....LVR...........P--------
Q6N0T4_RHOPA/30-250----------------------------------RVALVI..GNS.....KYP....DADK..........P--------
Q89XG2_BRADU/27-247----------------------------------RYALVI..GNA.....KYP....DADA..........P--------
A0A038FP67_9BRAD/58-278----------------------------------RLALVI..GNG.....HYP....DANA..........P--------
Q6NBN5_RHOPA/57-277----------------------------------RLALVI..GNA.....HYP....DAAS..........P--------
Q98JS7_RHILO/35-253----------------------------------RAAIVV..GNS.....EYP.....FA...........P--------
Q985X8_RHILO/35-256----------------------------------RLAFVI..GNA.....AYP.....SG...........S--------
Q6N5Q1_RHOPA/33-253----------------------------------RIALVI..GNG.....AYA.....KA...........P--------
Q89KP2_BRADU/86-307----------------------------------RIALVV..GNG.....AYA.....KS...........P--------
Q89IK1_BRADU/30-253----------------------------------RVALVI..GNG.....AYA....STA...........Q--------
Q98G71_RHILO/26-252----------------------------------RVALVI..GNG.....TYA....EAG...........T--------
Q6AKF4_DESPS/28-248----------------------------------RIALII..GNS.....DYR.....IR...........S--------
Q98IJ6_RHILO/11-238----------------------------------RIALVL..GNS.....QYQ....HAA...........P--------
Q89MV1_BRADU/176-400----------------------------------RIALVV..GNS.....AYK....NIT...........P--------
Q89HT8_BRADU/51-272----------------------------------RVALVI..GNS.....NYQ....NAP...........Q--------
Q89FZ4_BRADU/32-256----------------------------------RLALVI..GQS.....AYR....TVP...........E--------
Q6N329_RHOPA/73-298----------------------------------RVALVI..GQS.....AYR....AVP...........A--------
Q98IJ9_RHILO/30-261----------------------------------RVALVI..GNS.....KYV....NAV...........A--------
Q89HP3_BRADU/336-569----------------------------------RMALII..GNG.....AYA....HVK...........A--------
Q7RFI8_PLAYO/964-1364----------------------------------KKAVVI..GCN......YM.....GEKDSIN......Q--------
D7AGH8_GEOSK/6-270----------------------------------..ALAL..GLNAVDPKHYG.....GWA...G......K--------
MCA9_ARATH/10-321----------------------------------RLAVLV..GCN......YP.....NTR...N......E--------
MCA8_ARATH/3-378----------------------------------KKALLI..GIN......YP.....GTA...V......E--------
MCA7_ARATH/3-401----------------------------------KRALLI..GIN......YP....GTTE..........E--------
Q70VV0_PICAB/3-415----------------------------------KKAVLV..GCN......YP....GTKA..........E--------
Q9ZSP8_HEVBR/3-415----------------------------------KKAVLI..GIN......YP....GTKA..........E--------
MCA4_ARATH/3-416----------------------------------KKAVLI..GIN......YP....GTKA..........E--------
MCA5_ARATH/3-408----------------------------------KKAVLI..GIN......YP....GTKA..........E--------
MCA6_ARATH/3-366----------------------------------KKALLI..GIN......YV....GTKA..........E--------
MCA1_ARATH/80-362----------------------------------KRAVIC..GIS......YR.....FSR...H......E--------
MCA2_ARATH/116-414----------------------------------KRAVIV..GVS......YK....NTKD..........E--------
MCA1_SCHPO/130-422----------------------------------RKALLI..GIN......YL.....NTQ...N......E--------
MCA1_YARLI/168-458----------------------------------KKALLI..GCN......YI....GSKN..........A--------
MCA1_DEBHA/146-437----------------------------------KKALLV..GIN......YT.....GSK...N......Q--------
M9MZN6_ASHG1/154-449----------------------------------RKALLI..GIN.....YFN....SSA...........E--------
MCA1_KLULA/138-430----------------------------------RKALLI..GIN......YF.....GSA...N......E--------
MCA1_CANGA/98-389----------------------------------RKALLI..GIN......YI.....GSK...N......A--------
B5VS82_YEAS6/157-450----------------------------------RKALII..GIN......YI.....GSK...N......Q--------
D0A6D7_TRYB9/84-341----------------------------------.RALFI..GID......YK....GTPA..........E--------
Q38D34_TRYB2/63-322----------------------------------.KALFI..GIN......YT....GSSA..........Q--------
Q8T8E6_9TRYP/84-343----------------------------------.RALFI..GIN......YY.....GTS...A......A--------

PF14538

W1QFK7_OGAPD/56-210--------K-----------------------KTTTAALVMCLNLGIPPPDI....QKPAD...YPVLEAFV--------
L8WVZ0_THACA/73-224--------L-----------------------RTARAALVVCLNIGVDPPDV....VKTQP...CATLECWV--------
A2EZ34_TRIVA/89-236--------.-----------------------KVDCVYLMCSQSNLFPQPDSDY..FSRKP.....MLYMWR--------
Q6C6R4_YARLI/86-238--------Q-----------------------RTVSAAIVVCLNLGVDPPDV....IKTDP...CSRLEAWV--------
M2WI96_MYCP1/172-328--------L-----------------------KTVSALLAVCLNVGVDPPDV....IKTNP...CARLECWV--------
K2S4T3_MACPH/104-258--------L-----------------------KTVSAVLALCLNIGVDPPDV....IKTNP...CAKLECWI--------
C4LXC3_ENTHI/42-194--------V-----------------------RTPHLIICCCLNIGTEPPGY....KKPKV...SSNTFGWI--------
T1G0Q6_HELRO/62-216--------M-----------------------KTVSVALVLCLNIGVDPPDT....VKISP...CARQQCWI--------
B0CNS4_LACBS/34-185--------L-----------------------KTATAALVLCLNIDVDPPDI....IKTNP...CANLECWV--------
F0ZAV4_DICPU/115-266--------M-----------------------KTVSVALVLCLNIGVDPPDV....IKTYP...CARMECWI--------
U9UGJ5_RHIID/52-203--------L-----------------------KTVSGALVLCLNIGVDPPDV....VKPSP...CAKLECWV--------
Q5KIS3_CRYNJ/92-243--------L-----------------------KTVTAGLFICLNLGVDPPDI....VKTNP...CAKTECWI--------
B0WBU4_CULQU/30-181--------.-----------------------.....LTSAHLNTAIQT.......VDVAGWELTERTNAWI--------
A5DWK2_LODEL/143-295--------Q-----------------------KTISAVLVLCLNLGVDPPDV....MKTYP...CAKFEAWC--------
G0VGR8_NAUCC/79-231--------Q-----------------------KTVSAALLLCLNLGVDPPDL....VKTHP...CARMESWV--------
I3J5N7_ORENI/57-208--------M-----------------------KTVSVALVLCLNVGVDPPDV....VKTSP...CARLECWI--------
A2DYM2_TRIVA/68-215--------H-----------------------QVACAYLLCSSSIYFPPPDSEY..FTDKP.....TIYMWR--------
D8TLK8_VOLCA/11-162--------L-----------------------KTTSVALVLCLNIGVDPPDV....IKISP...CARLECWV--------
G4M000_SCHMA/43-194--------I-----------------------KTLTVALVICLNIDIDPPDV....QKIPP...FSRVEAWV--------
C1MUE6_MICPC/45-196--------M-----------------------KTTSVALVLCLNIGVDPPDV....LKISP...CARMQCWI--------
Q387I9_TRYB2/89-240--------.-----------------------....LLLILCLNNGNDPPDF....SRIDP...CARLECWE--------
C4M2F5_ENTHI/38-189--------I-----------------------KTIHLILTLCLNIGTDSPDQ....IKQKD...SASKECWI--------
G4TT65_PIRID/72-223--------L-----------------------KTGNGAIVVCLNLDVDPPDV....VKTQP...CAVLEGWV--------
G0NWW0_CAEBE/64-218--------L-----------------------RTASVAIVMCLHLGVDPPEAPS..RKDAP....ARLLSWV--------
A2DJF0_TRIVA/83-228--------V-----------------------PEGVHIHLNTLTRLIPG..........KP.QNRKFIHTWE--------
K3WJU9_PYTUL/84-235--------M-----------------------KTMDVGLVMCLNIGTDPPDI....VKSSP...CARKECWV--------
A2G590_TRIVA/30-180--------T-----------------------KTKAALCLLCLFDGLHTPTIRR..LSRKPRLICNKPLLTF--------
B8M6V6_TALSN/189-342--------L-----------------------KTVSAALAICLNIGVDPPDV....VKTNP...CAKLECWV--------
A2FJN8_TRIVA/41-191--------V-----------------------KTKGAICFLCLFDGLRTPTIRR..LSRKPRLICNRPLLTF--------
A2DLR3_TRIVA/97-242--------.-----------------------.IQSVILITTKTYQFSENVSEY..LKDTP.....IIFGWQ--------
E5SIN8_TRISP/44-195--------M-----------------------KTVSVALVLCLNIGIDPPDT....VKPKP...CARTECWI--------
I1G727_AMPQE/53-204--------L-----------------------KTWSVALALCLNIGVDPPDV....VKTTP...CARKECWI--------
U1MN31_ASCSU/95-246--------M-----------------------KTVSVALVLCLNIGVDPPDV....QKPNP...CARQECWI--------
I1L744_SOYBN/123-274--------M-----------------------KTGCVALVLCLNISVDPPDV....IKISP...CARMECWI--------
E4XFS5_OIKDI/48-228--------F-----------------------KARGIITCLCLNIDVDPEDWREDLAKDVP...VARREGNI--------
D2VMD1_NAEGR/144-294--------L-----------------------KTVHVALVVCLNIGVDPPDV....VKVQP...CAKLECWV--------
A9TBL2_PHYPA/91-242--------M-----------------------KTGWVALCMCLNIGVDPPDV....IKISP...CARLECWI--------
B7PLB3_IXOSC/92-247--------M-----------------------KTVSVALVMCLNIGVDPPDV....VKTQP...CARLQCWL--------
E9CIT6_CAPO3/727-878--------M-----------------------KTVCVALVLCLNIGVDPPDI....VKTSP...CARLECWM--------
B8CBK6_THAPS/256-409--------M-----------------------KTVGICLILALNVGTDPPDL....NKPNP...CAKLQCWL--------
A4I1A2_LEIIN/114-279--------V-----------------------RITQAVLLMYLHIGSDPPGF....PRVEP...CAKMECWV--------
F4RLY3_MELLP/215-367--------.-----------------------RTVCAALFLCLRLGFDPPDV....VKTSP...APKLEAWV--------
K4DUJ2_TRYCR/62-218--------V-----------------------KSTQVILFLCLNIGSDPPDY....PRIEP...CARLECWI--------
H1VVG4_COLHI/158-309--------L-----------------------KTVSAALAVCLNISVEPPDQ....LKTNP...GAKLEAWT--------
M7XEP3_RHOT1/113-265--------I-----------------------RTASAVLVVCLRIGYDPPDI....IKTDP...CAKLECWV--------
A2GCD5_TRIVA/98-247--------E-----------------------PIECVVVNVAHLEQFPKPSSDF..AKQIP.....SIFAWQ--------
D8RG53_SELML/72-223--------M-----------------------KTVSVALVVCLNIGVDPPDI....IKVSP...CARMECWI--------
A2F9H3_TRIVA/31-181--------N-----------------------KTKSAICFLCLFDGLRIPSIRR..LVRKPRNICDRPLLTF--------
L0PHF8_PNEJ8/131-282--------L-----------------------KTVSAALCICINIGVDPPDI....VKTSP...CAKLECWI--------
RTOR2_ARATH/94-246--------M-----------------------KTGCVALVMCLHITVDPPDV....IKISP...CARLECWI--------
M5E8T5_MALS4/58-209--------L-----------------------RTVTAALVMCLNIGVDPPDV....SKTNP...CSKLICWM--------
B3RPQ9_TRIAD/43-194--------M-----------------------KTVSVALVLCLNVGVDPPDL....IKPTP...CARLECWL--------
I4Y9Q8_WALSC/76-227--------L-----------------------KTITCAIVLCLNLGVDPPDV....VKTEP...CAVLETWV--------
A2E4G0_TRIVA/101-242--------.-----------------------....VIFSMTRPIQYKLLQSDY..INSRP.....PIFAWS--------
U6ISX1_HYMMI/269-417--------I-----------------------KTINVALVLCLNIEIDPPDV....QKIPP...YSRVEAWV--------
U4LGP0_PYROM/223-374--------L-----------------------KTVSAALVLCLNLGVDPPDI....VKTNP...CAKLECWV--------
A2F8U1_TRIVA/65-210--------.-----------------------.TTQGIVVMCIPNLLQPPHL....RGTNS......VYCWS--------
D8T9J0_SELML/50-197--------M-----------------------KTGCVALVLCLNIGIDPPDV....IKISP...CARMECWI--------
A9V5A2_MONBE/628-777--------S-----------------------KTLTLGLILCLNIGVTPPDV....VRTHP...CAKLEAWI--------
F0XXV0_AURAN/12-164--------M-----------------------KTVSVALVLCLNIGTDPPDA....VAASP...RARRECWL--------
A2E336_TRIVA/54-202--------.-----------------------SKSSIFIVLPFLEQTQENQTEY..CKLYP.....FYVYWI--------
B4R5C8_DROSI/214-365--------M-----------------------KTASVALVLCLNIGVDPPDV....VKIQP...CSRLECWI--------
J4H2X1_FIBRA/92-243--------L-----------------------KTANAALVLCLNIDVDPPDV....VKTNP...CATLECWV--------
A2EU18_TRIVA/81-227--------L-----------------------GTI.VYMISSRNQIVQQTES....LHNKK.....LIMAWS--------
A2DYB3_TRIVA/12-162--------N-----------------------KTKAVLSFLCLFDGLRNPSIRR..LVRKPRTVIQRPLLTF--------
S2KE38_MUCC1/106-257--------I-----------------------KTVSGLLVVCLNIGTDPPDI....VKTNP...CAKLECWI--------
G7E3R0_MIXOS/173-325--------L-----------------------KTAVASLLLCLRIGFDPPDA....VKTDP...CAKTECWI--------

PF03415

Q8A866_BACTN/37-399----------------------------------VYIAGDN..SLSRFASEDLNEMIEGMQSVDDNHNNLLV--------
Q9WZB1_THEMA/121-462----------------------------------VWMAADN..NLYYYSEDDLSEMRNASGSV.....SVVV--------
Q8XM44_CLOPE/59-508----------------------------------VYADCDN..NLEEYILNDIEEMKEGYKNNPNL..NIIV--------
Q9X1S5_THEMA/586-937----------------------------------VWMCADN..NLESFALNDLSEMLNSNENV.....SVVV--------
Q9WYY6_THEMA/5-301----------------------------------SWI...............................NVFA--------
Q8TIY6_METAC/66-593----------------------------------VYMVGSDLESSNGYASKDIFEIIDGASMLNGNETEILI--------

PF13900

F6VPI7_MACMU/1-48--------------------------------------VAKAGVL-----------------------------------
H2P8I3_PONAB/10-56--------------------------------------VAQAGVQ-----------------------------------
F7H1D9_MACMU/6-53--------------------------------------VTQAGAQ-----------------------------------
F7HNL8_MACMU/6-53--------------------------------------CRQARVE-----------------------------------
F6ZY08_MACMU/15-62--------------------------------------VAQAGVQ-----------------------------------
C9JL97_HUMAN/112-159--------------------------------------SHQAGAQ-----------------------------------
F7HUC2_MACMU/8-55--------------------------------------VVQAGVQ-----------------------------------
F7E5F2_MACMU/5-52--------------------------------------VAQSGVQ-----------------------------------
H2PFS8_PONAB/309-356--------------------------------------SAQTGVQ-----------------------------------
H9KYL1_CALJA/1-48--------------------------------------LAQAGVQ-----------------------------------
F7H0L3_MACMU/5-52--------------------------------------VAQAGVQ-----------------------------------
F6X1U8_MACMU/6-53--------------------------------------VAQAGVQ-----------------------------------
F7GV92_MACMU/20-67--------------------------------------VAQAGVQ-----------------------------------
F7GPL2_MACMU/68-115--------------------------------------VAQAGVQ-----------------------------------
F8WCX3_HUMAN/9-56--------------------------------------CHQAGVQ-----------------------------------
G1QLW6_NOMLE/814-862--------------------------------------DTQAGVQ-----------------------------------
F7H7M8_MACMU/103-150--------------------------------------VAQAGVQ-----------------------------------
F7HJ06_MACMU/6-53--------------------------------------VAQAGVQ-----------------------------------
F7GKP6_MACMU/5-52--------------------------------------HAQAGVQ-----------------------------------
F7BBK8_MACMU/3-51--------------------------------------FAQAGVQ-----------------------------------
F7BBH6_MACMU/6-53--------------------------------------VAQAGVQ-----------------------------------
F7H0K2_MACMU/5-52--------------------------------------VTQAGVQ-----------------------------------
F7FTH6_MACMU/13-60--------------------------------------CCPGWMQ-----------------------------------
F6Y5H5_MACMU/6-53--------------------------------------VPEAGVQ-----------------------------------
F7IGY2_CALJA/5-52--------------------------------------VTQTGVQ-----------------------------------
F7F1B5_MACMU/6-53--------------------------------------VAQAGVQ-----------------------------------
F6ZIE8_MACMU/13-60--------------------------------------VAQAGVQ-----------------------------------
H7C2Z3_HUMAN/35-82--------------------------------------VVQAGVQ-----------------------------------
F6Q4C2_MACMU/10-57--------------------------------------VTQAGVQ-----------------------------------
F6WIB8_MACMU/57-104--------------------------------------VTQAGVQ-----------------------------------
F6RPD7_MACMU/5-52--------------------------------------VGQAGVQ-----------------------------------
F7AN02_MACMU/1-48--------------------------------------VAQAGVQ-----------------------------------
F6UHP4_MACMU/22-69--------------------------------------VAQTGVQ-----------------------------------
F6QIB6_MACMU/6-53--------------------------------------VAQAGVQ-----------------------------------
F7INS6_CALJA/10-56--------------------------------------VTQAGMQ-----------------------------------
F7DA23_MACMU/81-128--------------------------------------VTHAGVQ-----------------------------------
G3S992_GORGO/2-49--------------------------------------VTEAGVQ-----------------------------------
F7GMK7_MACMU/6-53--------------------------------------VAQAGVQ-----------------------------------
F7BBW7_MACMU/19-66--------------------------------------CHQAGVQ-----------------------------------
G7P901_MACFA/6-53--------------------------------------VAQAGVQ-----------------------------------
F6VUI9_CALJA/8-55--------------------------------------VTQAGVQ-----------------------------------
F7HNT1_MACMU/10-57--------------------------------------CHQAGVQ-----------------------------------
H2PFT0_PONAB/200-246--------------------------------------VTQAGVR-----------------------------------
F7BEX5_MACMU/6-53--------------------------------------VTQAGVQ-----------------------------------
F7IH17_CALJA/8-55--------------------------------------VAPAGVQ-----------------------------------
F7CY78_MACMU/1-49--------------------------------------IAQAGVQ-----------------------------------
F6QIR0_MACMU/9-56--------------------------------------VAQAGVQ-----------------------------------
E9PIS2_HUMAN/138-185--------------------------------------VAQAGVQ-----------------------------------
G7P0P9_MACFA/3-50--------------------------------------VTQACVP-----------------------------------
F8WCK5_HUMAN/303-350--------------------------------------CRQAGVQ-----------------------------------
F7A4Y6_MACMU/6-53--------------------------------------VGQAGVQ-----------------------------------
F5H189_HUMAN/75-122--------------------------------------VAQAGVH-----------------------------------
F7GMG4_MACMU/12-59--------------------------------------CHQARMQ-----------------------------------
F7EDZ5_MACMU/6-53--------------------------------------VTQHGVQ-----------------------------------
H2NMK9_PONAB/15-62--------------------------------------VAQAGVQ-----------------------------------
F7GNA8_MACMU/17-64--------------------------------------VAQAGVQ-----------------------------------
M0QYB7_HUMAN/5-52--------------------------------------ATQAGVQ-----------------------------------
F7GHR0_MACMU/69-116--------------------------------------VAQAGVQ-----------------------------------
F6TK80_MACMU/14-61--------------------------------------VTQAGIQ-----------------------------------
F7HQG2_MACMU/6-51--------------------------------------VAQAGTQ-----------------------------------
F7HL81_MACMU/1-48--------------------------------------VAQAGVQ-----------------------------------
G3S4W3_GORGO/73-116--------------------------------------VAQAGVQ-----------------------------------
G7PKJ6_MACFA/16-62--------------------------------------VAQSGVP-----------------------------------
F7CF12_MACMU/16-63--------------------------------------VAQARVQ-----------------------------------
F7H314_MACMU/5-52--------------------------------------VAPAGVH-----------------------------------
F7GNJ7_MACMU/23-70--------------------------------------VTQAGVQ-----------------------------------
F7H7L6_MACMU/21-68--------------------------------------VTRDGVQ-----------------------------------
H2PFS9_PONAB/301-348--------------------------------------VAQAGVQ-----------------------------------
F6QZW4_MACMU/4-51--------------------------------------VSQAGVQ-----------------------------------
F6VSA3_MACMU/58-105--------------------------------------VSQAGVQ-----------------------------------
F7GWG7_MACMU/6-53--------------------------------------VAQAGVQ-----------------------------------
G8F501_MACFA/41-88--------------------------------------AAQARIQ-----------------------------------
H2PCJ4_PONAB/71-117--------------------------------------VAQAGVQ-----------------------------------
F7GRV2_MACMU/10-57--------------------------------------VTQAGVQ-----------------------------------
F7DN54_MACMU/18-65--------------------------------------VAQAGVQ-----------------------------------
F7C2M9_MACMU/203-250--------------------------------------VPQAGVQ-----------------------------------
F6UHM5_MACMU/4-51--------------------------------------VAQAGVQ-----------------------------------
F7E6B4_MACMU/16-63--------------------------------------VTQAGVQ-----------------------------------
F6RPF6_MACMU/5-52--------------------------------------VVQARVQ-----------------------------------
F6T9Z0_MACMU/31-78--------------------------------------VAQAGMQ-----------------------------------
F7D1W6_MACMU/11-57--------------------------------------VAQAGVQ-----------------------------------
F6UMN3_MACMU/5-52--------------------------------------VTQVGVQ-----------------------------------
K7EME6_HUMAN/91-138--------------------------------------CCQAGIQ-----------------------------------
F8WD42_HUMAN/7-54--------------------------------------VAQAGVQ-----------------------------------
H2PFS8_PONAB/209-255--------------------------------------VTQARVQ-----------------------------------
F6W1Z8_MACMU/11-58--------------------------------------VTQAGVQ-----------------------------------
F7ILB0_CALJA/1-48--------------------------------------VTQAGVQ-----------------------------------
F6VHU0_MACMU/21-68--------------------------------------VAQTGVQ-----------------------------------
F6WI78_MACMU/73-120--------------------------------------VSQAGVQ-----------------------------------
H7BZB2_HUMAN/19-65--------------------------------------VAQAGVQ-----------------------------------
F6ZI73_MACMU/64-111--------------------------------------VTQTGVQ-----------------------------------
F6Z663_MACMU/5-53--------------------------------------VPQAGVP-----------------------------------
F7AS31_MACMU/5-53--------------------------------------VIQAGVQ-----------------------------------
F6VXW3_MACMU/74-121--------------------------------------VAQAGVQ-----------------------------------
F6RES6_MACMU/10-57--------------------------------------CCPGWMQ-----------------------------------
F6SY12_MACMU/53-100--------------------------------------FAQAGVQ-----------------------------------
F6Y1U7_MACMU/8-55--------------------------------------VSQAEVQ-----------------------------------
F6RRM6_MACMU/17-64--------------------------------------VAQAGVQ-----------------------------------
F7AVL2_CALJA/49-96--------------------------------------VAQAGVH-----------------------------------
F7HXT7_CALJA/4-48--------------------------------------VPQAGVQ-----------------------------------
F6ZZ11_MACMU/5-52--------------------------------------VAQAGVQ-----------------------------------
F7GGU7_MACMU/13-60--------------------------------------VTQVGVQ-----------------------------------

PF12770

A0LJ53_SYNFM/581-921--------R-----------------------RRAGELHDLLI..P.--------AKARELI.......-----------
A0LQE8_SYNFM/635-947--------R-----------------------PASRKLFTAVLG.P.--------ISRD..L.......-----------
A0YK41_LYNSP/3523-3818--------L-----------------------PYAQQFYQWLIA.P.--------LQAE..L.......-----------
A0YW51_LYNSP/1488-1787--------K-----------------------VSGKKLYDWLIL.P.--------LKAE..L.......-----------
A0YZ16_LYNSP/128-434--------L-----------------------KPAQQLYQWIIQ.P.--------FETT..L.......-----------
A1BCK0_CHLPD/513-826--------E-----------------------ETGETLYRELWE.PV--------LDLL..........-----------
A1BEL3_CHLPD/43-361--------K-----------------------PIGSALWSALGDGVE--------LQQA..........-----------
A1BEL6_CHLPD/46-364--------Q-----------------------ALGSALWQVLDADEK--------LQHA..........-----------
A3WDM2_9SPHN/678-1006--------V-----------------------ERARELYLTLFG.P.--------VEAE..M.......-----------
A4HBL7_LEIBR/1053-1432--------Q-----------------------EPLRVLYQACIH.P.--------......IIGYVRAL-----------
A8L4T6_FRASN/741-1051--------E-----------------------KASRWLGRAVMD.PV--------LRLL..........-----------
A8YIK9_MICAE/645-974--------K-----------------------ESARQLDETLMQ.P.--------IRQL..L.......-----------
A9WBC0_CHLAA/673-929--------R-----------------------VLLQRLYRTLIE.P.--------..............-----------
A9WER9_CHLAA/54-394--------T-----------------------RYGQELFRRLFP.TR--------LSHQFRVSQRTAAQ-----------
A9WF91_CHLAA/60-360--------V-----------------------AYGTALGTMLLSDPD--------LLAQFQAARAIARR-----------
B0C874_ACAM1/207-507--------L-----------------------ESAQQLYQWMVQ.P.--------LAAE..L.......-----------
B2IXC0_NOSP7/1396-1691--------L-----------------------RPSQQLYRWIIA.P.--------LEAD..L.......-----------
B2IZZ4_NOSP7/695-973--------Q-----------------------EVAKTLAEMLAF.PK--------LLEG..........-----------
B2JAK0_NOSP7/526-830--------D-----------------------IELNKLYKILL..PQ--------VIQEGLI.......-----------
B2JAM9_NOSP7/866-1190--------E-----------------------KVATKLSQMLLQ.P.--------VAQE..........-----------
B3QB04_RHOPT/774-1131--------L-----------------------KLSYELYTLLLQ.P.--------VESG..........-----------
B4JKU3_DROGR/1402-1700--------P-----------------------ACLHTLYNLLLA.P.--------......FDDLLPSV-----------
B4VHH6_9CYAN/1150-1443--------L-----------------------KPAQQLYQWLIA.P.--------IASE..L.......-----------
B4VJ14_9CYAN/646-949--------Q-----------------------QSARALDKVIMA.P.--------IREK..L.......-----------
B4VJ30_9CYAN/3784-4081--------L-----------------------EPAQQLYEWLIA.P.--------LEAE..L.......-----------
B4VLG1_9CYAN/97-405--------V-----------------------ALGQELYNALFQ.GS--------LRDSWMMA....QA-----------
B4VLY5_9CYAN/1558-1850--------L-----------------------APAQQLYQWIIA.P.--------IEDQ..L.......-----------
B4VPE9_9CYAN/1179-1471--------L-----------------------PSAQQLYQWLIA.P.--------LEEE..L.......-----------
B4VQD3_9CYAN/1443-1735--------I-----------------------TPGQQLYQWLVA.P.--------LEEN..L.......-----------
B4VQK8_9CYAN/1658-1953--------L-----------------------DGAKQLYQWLVA.P.--------LETE..L.......-----------
B4VTQ2_9CYAN/1746-2036--------L-----------------------APGKQLYDWLIT.P.--------LEAD..L.......-----------
B4VXN8_9CYAN/1368-1663--------L-----------------------DSAQQLYQWLIE.P.--------LADD..L.......-----------
B4VXQ8_9CYAN/1752-2046--------L-----------------------APAQQLYNWMIA.P.--------LESE..L.......-----------
B4VYA5_9CYAN/647-942--------L-----------------------PAAQQLYQWLIA.P.--------LESD..L.......-----------
B4WMI9_9SYNE/695-1035--------S-----------------------AIARQLDEKLIA.P.--------LRPF..L.......-----------
B6C3H2_9GAMM/45-361--------Q-----------------------HLLRRVGKELLA.P.--------VAEH..L.......-----------
B8G8X7_CHLAD/58-398--------S-----------------------RYGQELFSRLFP.GR--------LATSFNTTRLIAIQ-----------
B8GD94_CHLAD/102-415--------R-----------------------RVGRRLFRALTHDPR--------GAEALKMVRNFALA-----------
C3Z401_BRAFL/1278-1602--------K-----------------------PPLRALYDLLIS.P.--------......MEDVLPRM-----------
F0SR63_PLABD/137-574--------Q-----------------------LSIERIKTVVWD.P.--------......VHEALSSD-----------
F7UL61_SYNYG/155-456--------R-----------------------EASQQLYQWIIA.P.--------YAET..L.......-----------
F7ULD2_SYNYG/1449-1747--------Q-----------------------GQASQLYDWFIK.P.--------IKLI..L.......-----------
F7UQF5_SYNYG/591-904--------I-----------------------NQGAQLYSQLIPDPT--------VIAG..........-----------
Q01RE6_SOLUE/865-1136--------Q-----------------------VVATRLHEQLVR.P.--------FGKE..I.......-----------
Q024J7_SOLUE/541-814--------I-----------------------PAGDRLYQLLIQ.P.--------LRAW..I.......-----------
Q025F1_SOLUE/607-877--------R-----------------------TAAAALYRKLLG.PA--------AAEL..........-----------
Q028B5_SOLUE/667-935--------Q-----------------------KLAVSLYRELLE.P.--------AAEQ..L.......-----------
Q02DA1_SOLUE/510-786--------Q-----------------------RDARQLYDWLIA.P.--------LAER..L.......-----------
Q10YT7_TRIEI/1003-1309--------K-----------------------DTARELDQKLMQ.P.--------VRQL..L.......-----------
Q10YU6_TRIEI/544-838--------K-----------------------FQSNQLYNWLIK.P.--------FEGYLEIDL...KD-----------
Q112V9_TRIEI/62-390--------T-----------------------KVGEALFEALFD.AQ--------LREYFLAYYQDILK-----------
Q113D1_TRIEI/130-430--------N-----------------------SQAKKIRGWLLK...--------LQEK..L.......-----------
Q113U8_TRIEI/3002-3297--------L-----------------------SPAKKLYDWFIT.P.--------ISAE..L.......-----------
Q115J8_TRIEI/1466-1777--------E-----------------------KLGEILHIKEILQPI--------LESE..........-----------
Q117G6_TRIEI/881-1206--------K-----------------------KTARELDEKLMQ.P.--------VRQL..I.......-----------
Q119J2_TRIEI/1474-1770--------L-----------------------SNAKKLYKWLIA.P.--------ISQE..L.......-----------
Q16H64_AEDAE/1315-1614--------P-----------------------SCLHVLYNLLLA.P.--------......FEDLLPDI-----------
Q2G6U6_NOVAD/692-1020--------L-----------------------DKSRALYKTLFG.A.--------VEDL..L.......-----------
Q2S6G2_SALRD/540-844--------L-----------------------RPLRALHDHLYA.P.--------VAAH..L.......-----------
Q2W535_MAGSA/875-1218--------L-----------------------DVGQQVHKLIWQ.P.--------LERA..L.......-----------
Q38C46_TRYB2/1044-1397--------V-----------------------EPLKTLYNIFIE.P.--------......IAAYIRSS-----------
Q3AQG5_CHLCH/44-362--------Q-----------------------AIGSILWRLLDADEA--------LANA..........-----------
Q4C5K3_CROWT/405-717--------P-----------------------EKLGYFWETLLL.PQ--------VLEK..........-----------
Q4S217_TETNG/1205-1537--------K-----------------------PPLRALYDLLIA.P.--------......MEVGLMHS-----------
F7URX2_SYNYG/165-457--------R-----------------------ATGKKLYDWLIA.P.--------VANE..L.......-----------
Q5LLA3_RUEPO/680-970--------R-----------------------IFGELLFETLLP.QE--------VRRLYDV.......-----------
Q64CV3_9ARCH/59-374--------R-----------------------QIGKQLFTLLNGDRQ--------TLLR..AL.....K-----------
Q7NCT1_GLOVI/600-923--------H-----------------------KLARLLHQKLLA.P.--------LGSQ..........-----------
Q7NF67_GLOVI/550-854--------K-----------------------AAARRLDRALME.P.--------VRAK..L.......-----------
Q7NFD7_GLOVI/666-979--------R-----------------------KLARTIDERTMR.P.--------VRTR..L.......-----------
Q7NIF7_GLOVI/691-997--------R-----------------------ALARQLDSLLMQ.P.--------LRAR..L.......-----------
Q7NJE3_GLOVI/660-988--------D-----------------------KLARQLHQKLLA.P.--------LQGN..........-----------
Q7NLR0_GLOVI/653-961--------K-----------------------PLARRLDQQLIA.P.--------IRRK..L.......-----------
Q7NVB0_CHRVO/67-386--------Q-----------------------DTARALADLFGQVPG--------LTAD..MAGHEVGD-----------
Q82I85_STRAW/1175-1481--------E-----------------------RLCGWAWYAAMR.P.--------......LFAEFPEP-----------
Q82L10_STRAW/969-1256--------T-----------------------GTLAWLWDVLAE.PV--------LDA...LGFTGPPE-----------
Q8DGG5_THEEB/541-835--------Q-----------------------RAAQALTEQVIT.P.--------IRPW..L.......-----------
Q8DH74_THEEB/570-891--------K-----------------------PSLKAAYGRLLA.P.--------LEPF..L.......-----------
Q8DHI1_THEEB/67-394--------G-----------------------ASGNQITNIGTQQPN--------LLKE..........-----------
Q8DIE5_THEEB/1127-1420--------L-----------------------PAAQQLYQWLIA.P.--------LRPQ..L.......-----------
Q8YZU5_NOSS1/56-340--------T-----------------------KDAENIYDAIIS.P.--------IEKY..L.......-----------
TTC28_HUMAN/1390-1713--------K-----------------------PPLRALYDLLIA.P.--------......MEGGLMHS-----------

PF03568

T1IUX7_STRMM/1624-1980--------.-----------------------..QPLVLTKFQKRMK.....PIVARV..PTATYKPVE-----------
G8BT64_TETPH/1165-1563--------P-----------------------LTNHLLLSKIDSSSN.K...TIHVRL..PLNRINS.R-----------
S6EFD3_ZYGB2/1145-1542--------P-----------------------SNDSLLLSKIDSKFG.K...NVQLRM..PLNRAYA.R-----------
Q2LZN6_DROPS/172-538--------.-----------------------SDGSIYLSLLRHCRS.PELGPICLRF...........-----------
A5DNR9_PICGU/1178-1576--------P-----------------------NSDSLLLTRLTHLGS.....PFVVRL..PLSRMKQ.R-----------
H2VRL7_CAEJA/706-1062--------A-----------------------DNKHIYLIKLHADRE.....PIIM....PIAHYSQ..-----------
G4N8I2_MAGO7/1627-2057--------D-----------------------NKHDLCISRLQAGHS.....PFVIRL..PLERATS.R-----------
J3P7L5_GAGT3/1606-2054--------D-----------------------NKHDLCVSRLQAGHS.....PFVIRL..PLERGSS.R-----------
Q6ZHH8_ORYSJ/455-870--------Y-----------------------FPAWMMLSRFDSTNK.....PITMLL..PVDAISKET-----------
G3N6G2_GASAC/1731-2077--------E-----------------------MGDSVLLSRLEKGSV.....PVTVHT..TTSK.QR.H-----------
I7LUG5_TETTS/2027-2414--------.-----------------------..RAIQISKFNHLNQNY....................-----------
M7T4Q8_EUTLA/44-499--------D-----------------------SQHDLCITKLQAGHS.....PFAIRL..PLDRASS.R-----------
A3GFF5_PICST/1168-1555--------P-----------------------YSGDILLSRYIKGKH.....PWFLRL..PISR..Y.H-----------
N4UZ87_COLOR/1637-2043--------D-----------------------NRKDLCITKLRAGQS.....PFILRL..PLERVAS.R-----------
Q5A8X8_CANAL/1101-1536--------Q-----------------------NTGDLLISKLTKGSP.N...PIFMRL..PLSRF....-----------
W1QIM9_OGAPD/1167-1527--------.-----------------------..GCLLLTRYGPKQD.....PVFIKL..PLERHLIGR-----------
Q75EJ0_ASHGO/1152-1552--------K-----------------------YNGDLLLSKVVSTTG.K...HFHLRL..PLNRHES.R-----------
C5MEH0_CANTT/925-1303--------Q-----------------------QTGDLLLSKRTKDS..N...PVFIRL..PLNRF.K.N-----------
M7XLD2_RHOT1/1703-2100--------.-----------------------..DALIISRHRHTDE.....PIVFKL..PLDRLAR.R-----------
G0RRT6_HYPJQ/1566-1971--------D-----------------------NRHDLCITKFQAGQG.....PFILRL..PLERANS.R-----------
BIMB_EMENI/1609-2004--------A-----------------------DRAEFVVSRLHRGCS.....PFLLRL..PLRRGNS..-----------
G3B782_CANTC/1213-1609--------.-----------------------GSDELVLARLSKESD.YK..PICLRL..PLKRMMD.H-----------
G2X6M8_VERDV/1704-2113--------E-----------------------NRHDLCITKLQADHT.....PFVLRL..PLERAVS.R-----------
S8BGE7_PENO1/1622-2018--------A-----------------------DCSEFYVSRLQKNRP.....PFLLRL..PLRRGNS.D-----------
G2R9B0_THITE/1619-2058--------D-----------------------GNHDLCITKLQAGES.....PFVIRL..PLERASS.R-----------
B6GZP8_PENCW/1602-1998--------A-----------------------DRTEFVVSRLQKDGS.....PFLLRL..PLHRGNS.E-----------
K5WME3_PHACS/1732-2136--------E-----------------------DRNTMFVTRQRPRRE.....PLIFCI..PLK..DR.R-----------
ESP1_ARATH/1641-2060--------P-----------------------VCAWVLISRLNPESQ.....PVATLL..PVDSIVEDM-----------
M7PDE3_PNEMU/1489-1882--------E-----------------------SKNDLYITRLQRQLS.....PLVLRL..PLNRSNS.R-----------
S9X830_SCHCR/1385-1771--------E-----------------------SKEELFITKFAHKSS.....PLIFRL..PFKRHNA.R-----------
H6C6Q4_EXODN/1587-1987--------D-----------------------DRSELLVARLNAGRS.....PFIVRI..PLTRPEA.S-----------
L8G205_PSED2/1652-2056--------E-----------------------SRDELVLAKFEAGHS.....PFILRV..PLERNSS.R-----------
Q23491_CAEEL/749-1101--------A-----------------------DDKTIYLVKLHADRD.....PIIM....PLAHYHQ..-----------
C1H4J8_PARBA/1619-2021--------N-----------------------DRNELIISKLRSGKP.....PFLLRL..PLKRGTS.E-----------
G0WDN6_NAUDC/1191-1589--------S-----------------------ITGNLLLSKIDPVTK.K...LNHLSI..PLNRGNA.R-----------
C5DU01_ZYGRC/1141-1538--------P-----------------------ANENLLINKLESKSG.R...MIHLRV..PLDRTYT.R-----------
M0UBW7_MUSAM/65-479--------.-----------------------FPAWILLSRLLANSQ.....PVVMLL..PVNLLHEEV-----------
B9GZR1_POPTR/1674-2094--------C-----------------------ISAWMLLSRLKFKSQ.....PIMMLL..PVNKVLEET-----------
K3Z105_SETIT/1078-1484--------Y-----------------------FPAWMLLSRFDSTGE.....PTTMLL..PVDAISGSQ-----------
J3KEJ6_COCIM/1641-2042--------.-----------------------.HNEFVISKLRAGQA.....PFMLCL..PLKRSDS.D-----------
C5FSW7_ARTOC/1655-2058--------P-----------------------SQDEFIISKLRSGQH.....PLILRL..PLKRGGE.D-----------
B6QNB5_PENMQ/1619-2016--------P-----------------------DRTEFIISRMSHGSS.....PFLLRL..PLKRSEE.D-----------
K7H1P7_CAEJA/245-604--------A-----------------------DNKQIYLIKLHADRE.....PIIM....PIAHYSQ..-----------
C5XYE8_SORBI/457-870--------.-----------------------.PAWMLLSRFDSTNE.....PTTLLL..PVDAISAEM-----------
Q6CQQ7_KLULA/1118-1516--------Q-----------------------LTGDLLITRFDTVRN.K...HLHLRL..PLNRHNS.R-----------
N1JFH1_BLUG1/1598-2001--------E-----------------------NQHELSLTKLQAYQS.....PFILRL..PLGRNNS.I-----------
H3DAQ7_TETNG/1711-2057--------Q-----------------------MGESIMLSRFERGSA.....PVTVHI..PTSK.QQ.R-----------
ESPL1_MOUSE/1716-2065--------T-----------------------LSNTLLLTRLEKDNP.....PITVKI..PTAQ.NK.L-----------
M2R2K9_CERS8/1618-2024--------E-----------------------DKNTMFISRQRHNSQ.....PLVFCL..PLK..GR.R-----------
A8NBE9_COPC7/1839-2276--------.-----------------------DKGTLLVSRQECGES.GVE.PLVFSV..PLK..GR.R-----------
J9JSJ3_ACYPI/139-490--------.-----------------------...ELFISRYQCGQKHKNIKPLTVKVDKPKTSLGQ..-----------
K4B224_SOLLC/1600-2023--------P-----------------------IQSWVLLSRMSSTSQ.....PITVLL..PVHSILNEA-----------
J0DCK6_AURDE/1634-2046--------E-----------------------DKKSMFVSRQRPKEE.....PLVFCV..PLERHNR.R-----------
W1NKX2_AMBTC/1-423--------.-----------------------....MLLSRLNLMRQ.....PVVLLL..PVDSVLEDV-----------
T1K7Z5_TETUR/1001-1362--------.-----------------------...DLLLSRWQKNKK.....TVMIKI..KGNP.....-----------
G0VFB3_NAUCC/1164-1562--------S-----------------------ITGNLLLSKLSATNG.H...KSHLSI..PLNRANL.R-----------
J7RG90_KAZNA/1160-1562--------P-----------------------LTENLVLTKYEGQSH.R...RTTLRI..SLKENRS.K-----------
M3HH45_CANMX/1423-1797--------P-----------------------KTGDLLLSKITKNT..Q...PLFVRL..PLNRL.H.N-----------
Q2H6Q9_CHAGB/1612-2026--------E-----------------------GNHDLCITKLQAGQS.....PFVIRL..PLERASS.R-----------
S8E105_FOMPI/1678-2083--------E-----------------------DKNMLFVSRQRTGRE.....PLVFCL..PLR..GR.R-----------
Q6CCJ0_YARLI/1210-1588--------P-----------------------TSGDLIVCQYACNQE.....PFLLRL..PLHRHNS.R-----------
G8YBL5_PICSO/1309-1719--------P-----------------------ISGDLILSKLMSDFN.E...PFFLRI..GSSRFSS.V-----------
I1MDQ8_SOYBN/1648-2063--------.-----------------------VQAWMLVSRLSFKNE.....PVVMLL..PLDSILQAS-----------
G7E6G1_MIXOS/1513-1914--------E-----------------------QADALILIRHVPHRI.....PVILRL..PLDRMGK.R-----------
G8B5X7_CANPC/1052-1424--------E-----------------------RTGDLLISKIRAGN..L...PTFIRL..SVTRF.K.Q-----------
E9ETV5_METAR/1601-2008--------D-----------------------SSRDLSITKLQAGHS.....PFILRL..PLERANS.R-----------
Q5KMS4_CRYNJ/188-600--------D-----------------------DRNTMFISRHQNGYE.....PIVFCL..PVDRQGR.R-----------
W5GJD2_WHEAT/891-1304--------.-----------------------FPAWMLLSRFDSTNK.....PTTMLL..PVDSISKEA-----------
M3ZIW2_XIPMA/1768-2114--------E-----------------------MGESLMLTRLEKDSS.....PITLHI..STSR.QE.L-----------
Q2USV7_ASPOR/1630-2030--------A-----------------------DRSEFIVSRLHQGRS.....PFLLRL..PLKRGNS.E-----------
M7TX51_BOTF1/1640-2041--------E-----------------------NRQELSITKLQTGHS.....PFVLRL..PLGRNNS.M-----------
D5GKQ4_TUBMM/1633-2033--------E-----------------------SREELYLSRFQAGQS.....QLMVRL..PLTRHNS.R-----------
A7RYA6_NEMVE/1651-2034--------.-----------------------..SYLMVTRLRNGSA.....PVVLRL....ALPDD.S-----------
J4GX56_FIBRA/504-917--------E-----------------------DKSYIFVSRQRAGQQ.....SMVFCL..PLK..ER.R-----------
K1X2E6_MARBU/1659-2061--------E-----------------------SRQELSITKLQAGHS.....PFVLRL..PLGRHNS.M-----------
E3LM18_CAERE/731-1090--------A-----------------------DDKKIYMIKLHADRE.....PIIM....PLAHYSQ..-----------
I2H0Y5_TETBL/1280-1677--------P-----------------------ITGHLIISKSFSYNN.K...KLHIRI..SLDRARS.R-----------
CUT1_SCHPO/1383-1770--------N-----------------------SGEDLFISKIRKGHS.....PLIFRL..PLQRHNS.R-----------
A5DVQ7_LODEL/1109-1530--------E-----------------------HTGDLLLSKCSRGS..L...PIFIRL..SLERY.I.D-----------
C4QYS2_PICPG/1259-1619--------S-----------------------VTGDMLLSYFSSAED.....SVIIRI..PFQ.....P-----------
S3CR95_OPHP1/1758-2208--------E-----------------------NKHDLCITKLQAGQS.....PFVIRL..PLERAIS.R-----------
H2B1L5_KAZAF/1161-1559--------P-----------------------VTGNLLLSKIDTVKK.R...RILLNI..PLNGSNA.R-----------
G1KFP0_ANOCA/1819-2167--------A-----------------------IGNTLLLTKLEKDAD.....PVTIQI..QTMH.AQ.V-----------
J3PN83_PUCT1/868-1252--------.-----------------------..DSLFLIQHNQTCD.....PLGVKL..PLDRFNR.R-----------
V5GCB2_BYSSN/1684-2084--------A-----------------------DRTDIVISKMHKGRA.....PFLLRL..PLKRGDSED-----------
K0K8V1_WICCF/1175-1568--------A-----------------------FNGDLIISRLTRDST.V...PSVLRL..PLSRHSS.R-----------
F0XAD9_GROCL/1636-2054--------E-----------------------NNQDLCITKLQAGSS.....PFVLRL..PLERAVS.R-----------
J5K578_BEAB2/1584-1996--------D-----------------------NHHDLCLTKFQAGHS.....PFILRL..PLERANS.R-----------
B4MLS6_DROWI/172-538--------S-----------------------SKGSIYLAMLRHCRS.PELEPTCLKV...........-----------
Q6FTE1_CANGA/1151-1548--------K-----------------------LTNTLIIRRISNLDS.K...NIMAKI..PIDRNVS.R-----------
F4PZT4_DICFS/1615-2074--------.-----------------------.RKSIVLTRLFGNQP.....PTIIKIQMPVYQVELEQ-----------
K2R7J5_MACPH/1619-2043--------E-----------------------ARDELYITRYVPYQS.....PFILRL..PMARHNS.R-----------
C7YYU1_NECH7/1580-1992--------D-----------------------NHHDLCITKFQAGHS.....PFILRL..PLERANS.R-----------
B4LBF1_DROVI/170-541--------.-----------------------ANGDIYVSLLRHCRS.PELAATCLRL...........-----------
K3Y3B2_SETIT/1404-1817--------.-----------------------FPAWMLISRFHSTNK.....PTAMLL..PVGAILEEM-----------
G4UQF5_NEUT9/1626-2085--------D-----------------------NKHDLCITKLQAGCT.....PFVLRL..PLDRASS.R-----------
B9SSN4_RICCO/1627-2045--------R-----------------------VCAWMLLSRLNSKSH.....PIMMLL..PVDLISEET-----------
N1QAI8_MYCFI/1492-1912--------Q-----------------------TCDELYIVRYRHGQS.....PLVLRL..PFSRHRS.E-----------
F4RLY9_MELLP/91-479--------Q-----------------------DRDSLFLVQHHNATD.....PLVLKL..PMNRQNR.R-----------
R9AIE1_WALI9/1639-2036--------D-----------------------DKKTMFVVKYRKNLE.....PLVVSL..PLDNRQNKR-----------
G3VPI8_SARHA/1713-2063--------T-----------------------VGDTLLLTRLEKNTP.....PVTIQI..PTAQTKK.M-----------
R8BFS3_TOGMI/72-487--------E-----------------------NKHDLCITKMQADQS.....PFIIRL..PLERANS.R-----------
G4T5A4_PIRID/1472-1874--------.-----------------------ARNTLIVARNRQDK......CDLFKL..PLKRGAR.R-----------
B0E1W0_LACBS/104-540--------D-----------------------DKSTLFISRREGGVE.GSQ.PLVFCV..PLK..GR.R-----------
N1QHR1_SPHMS/1187-1599--------E-----------------------KCDELYVARYRSGQT.....PLLIRL..PFSRQKS.E-----------
C4XY11_CLAL4/1177-1564--------E-----------------------LSGNLIITKFESGQT.L...PFVFKL..PFRKN....-----------
S8C8B1_DACHA/1639-2040--------E-----------------------SREELFFTRYEAGQI.....PFMIRV..PLMISEE.M-----------
E4ZTB4_LEPMJ/1652-2063--------E-----------------------SRDELYITRFESGMS.....PFVLRL..PLARHAS.R-----------
M4DS49_BRARP/1599-2019--------P-----------------------VCAWVLVSRLTLKSQ.....PVATLL..PVDSVLEDM-----------
F8PLA9_SERL3/1278-1688--------E-----------------------DKNTMFVCRQRARSD.....PLIFCV..PLK..GR.R-----------
V2X3W8_MONRO/1588-2040--------D-----------------------DRKTLFISRQRGGRE.TKDRPLMFCI..PLQ..GR.R-----------
B6K0I6_SCHJY/1359-1747--------E-----------------------SKEDLFLSKVRKNQN.....PLVVRL..PLQRHNS.R-----------
G5ED39_CAEEL/727-1081--------A-----------------------DDKTIYLVKLHADRD.....PIIM....PLAHYSQ..-----------
Q9VRN6_DROME/171-538--------A-----------------------SDGAIYLTLLRHCRS.SQLGPICLKI...........-----------
C5XSY3_SORBI/1425-1832--------.-----------------------.RAWILLSRFDSTSE.....PTTLLL..PVDAISE.M-----------
I4YB88_WALSC/1631-2030--------D-----------------------DKKTMFVVKFRKNSE.....PLLVSL..PLDNRQNKR-----------
S2JJU0_MUCC1/1578-1988--------.-----------------------.NSDLYLVQLRAKEQ.....PFAVKL..PLNRASQ.R-----------
T1FT05_HELRO/413-770--------.-----------------------..DQLILTRFVHGET.....PLNIPL..PHVDVDE.R-----------
C5DHM1_LACTC/1178-1575--------E-----------------------ITGDLLLSKMDSGRD.S...KVCLRL..PLNRSNS.R-----------
G0SHM3_CHATD/1723-2150--------D-----------------------GGHDLCITRLQAGQA.....PFVLRL..PLERASS.R-----------
A8PX94_MALGO/1441-1824--------S-----------------------DARELIVARYGDAYD.....PCVFVL..PLHRQSY.R-----------
S3D029_GLAL2/1639-2043--------D-----------------------SHNELVITRLQAGQS.....PFVLRL..PLGRHNS.M-----------
H3B3H1_LATCH/1699-2055--------A-----------------------VGDTLLVSRLEKGCT.....PVTVQI..PTAQ.SE.M-----------
B4J0F9_DROGR/174-539--------.-----------------------...DIYLSLLLHCRS.PQLPATCLRF...........-----------
W4Y9R2_STRPU/1031-1383--------.-----------------------ASSQLVITRIQKGQQ.....PIVVRL........P.M-----------
Q4WUU6_ASPFU/1638-2039--------A-----------------------DCTEFIISRLRKDHS.....PFLLRL..PLKRGNA..-----------
U1G8A9_ENDPU/1638-2036--------D-----------------------DSSEMIISKIRQNYS.....PFLLRL..PLDRSAG.E-----------
Q6BTB7_DEBHA/1338-1753--------P-----------------------YTGDLLLSKSLKDSYNT...PFFLRI..PLSKRGT.E-----------
G7XGU8_ASPKW/1627-2026--------T-----------------------DRTEFVVSRLQKGRS.....PFLLRL..PLKRGSS..-----------
F6VXN8_XENTR/1732-2080--------.-----------------------PGDTILLTRLVRGRP.....PVTVQI..PTAH.LK.V-----------
H2L8K9_ORYLA/1692-2038--------E-----------------------LENSVILTRLEKGSA.....PVTLHI..STSK.QQ.I-----------
R7YNT5_CONA1/1696-2117--------E-----------------------AGSDLYVTRYQANQT.....PFILRL..PMARQSS.Q-----------
I3KSG7_ORENI/1715-2061--------E-----------------------MGNSIMLTRLEKSSA.....PVTVYI..DTSK.QK.H-----------
F7BUI1_CALJA/1724-2073--------T-----------------------VGNTLLLTRLEKDSP.....PVTVQI..PTAQ.NK.L-----------
U5HB45_USTV1/1850-2253--------.-----------------------ERDALILVHHQANRQ.....PLVFRL..PLDRITR.R-----------
D8Q1W5_SCHCM/1450-1878--------E-----------------------DKRTLFLSRQEGGEQ..SE.PLVFCI..PLQ..GR.R-----------
U3IXX7_ANAPL/1332-1679--------S-----------------------MGDTLLLTRLERGST.....PITIHI..PTAL.TK.A-----------
N1PZ16_MYCP1/1513-1936--------E-----------------------SCEELYVAKYRGAQS.....PLVLRI..PFSRQKS.D-----------
G3AGZ6_SPAPN/1149-1535--------S-----------------------HSGDLLLSKIDRGK..D...PVFLRL..PVKRF.Q.S-----------
F0UL09_AJEC8/1642-2044--------G-----------------------DHKEFIISKLRSGRP.....PFLLRL..PLKRGNL.E-----------
U4LG69_PYROM/1616-2019--------E-----------------------NKKELYITRFQAGQS.....QLMVRL..PLNRHNN.R-----------
M1WFQ9_CLAP2/1438-1889--------D-----------------------NRHDLSITKLQAGHS.....PFILRL..PLERANG.R-----------
G8ZWZ1_TORDC/1158-1555--------P-----------------------VTKNLLLSKIETCHD.R...NVHIRM..PLNRTHT.R-----------
ESP1_YEAST/1175-1571--------P-----------------------ITGNLLLSKLEPRRK.R...RTHLRL..PLIRSNS.R-----------

PF01364

KGP83_PORGN/244-595MLVV....A..GAKF.................KEALKPWLTWKAQK......GFYLDVHYTDEAEVGT............
D1JG83_9ARCH/891-1295FAYT....K..IPKL.................SLTAAQIAA...........ARKAPVIDINKNPEEII...........
A2U064_9FLAO/401-768YLVI....T..NSDL.................ANEAQRLVDYHQTN.....SNLVGKVVLLDEIYNEFS...........
Q7MTE2_PORGI/239-573MIVI....V..AKKY.................EGDIKDFVDWKNQR......GLRTEVKVAEDIASPV............
D3HWT0_9BACT/400-777MVII....IPTSQKL.................LAQAQRLKAFHEAH.....DSLSVRIVPADELFNEFS...........
Q5S3Q9_9FLAO/543-910YLIV....T..PRIL.................KSQADRLADFHRNY.....SKLNVKVVTLDAIYNEFS...........
A9DMD5_9FLAO/555-923YIII....T..PDAF.................VSQAERLADFHRNN.....SGMIVKVVTLASIYNEFN...........
B0VGA8_CLOAI/228-563ILLIYGNNT..DPIF.................TAKLNEFVAWKRQK......GYDVNFVSTAETGGA.............
B7B5I7_9PORP/382-753MIII....A..QPNF.................TTQAERLAEAHRTK.....DNLTVRVVTPESIYNEFS...........
B8FFM0_DESAA/254-600FVIV....T..TGDL.................KDAFKNFIDIRNL.......DHTVKLALLNDIKKEF............
A3U7G6_CROAH/540-908YLML....V..DNTL.................ISEANRLAQYRRDR.....DGLNVKVVQLQTIYNEFS...........
D2QSX9_SPILD/414-786LLIV....T..PAAW.................RDQADRLAQFRRDH.....DQLSVLVVTTQQALNEFG...........
A3HW99_9BACT/398-769YILV....G..HHALEIP..........ADQFQNPLQSYAEHRAS.PL..GGGYKTLTIFMEEIYDQYG...........
B0VHP2_CLOAI/234-563ILVI....K..HSMF.................DATIQPWVDWKRQL......GFTVDVVDVTTAGS..............
A8ZUB1_DESOH/278-656YVLI....T..SQAIIDD...........VSIDPSVADFIAHRQAQ......GLTTAVVSIDSVLADDN...........
B0VIM2_CLOAI/182-528MLII....T..HSQL.................TNYQQDYIAWKKSI......GFDVYTANKSDIGS..............
Q2Z0E1_9BACT/643-1013YVMI....A..YDGF.................YDEALRLKNHRESAA...GGGYDVRLVRLSDVYSEFS...........
B3QXR8_CHLT3/734-1131YIII....T..SDEFINSS........NFEKTSNPVRQYKEYRESYLKAIGETGNVLVVTTQAVYDEFN...........
C2MCN4_9PORP/405-781YLMI....T..TEAL.................RPAAERLASYHREH.....SGLRVQVVTQQELFDEYN...........
A4A325_9PLAN/24-399TLVV....C..PEPL.................VPALRPWLDFRAAQ......GRQIGLITETA.................
A7NR84_ROSCS/499-867VLYI....A..PAPF.................HAALTPLVDLRRAQ......GYSVAVVDVQHLYDGWS...........
Q11Q36_CYTH3/558-932MIIV....T..HPDF.................QSQAQRLANFRTTN.....DGLRVYVCTTEQIYNEFG...........
Q7MX16_PORGI/272-637YLVI....Y..DDMFNVN...........QQPHDEIKRLCEHRAFY.....NGFDVAAVSIKDVLNSFPS..........
A0B5K7_METTP/796-1154FSHT....K..VPKL.................SLASMQVAA...........AKRAIVMDVAKDPQYVD...........
D0MH89_RHOM4/586-975LAII....T..ADTF.................RVYAEQLAEHRRD......QGLRVVVATVEQIYNEFS...........
A8UH97_9FLAO/539-910YIIL....A..PSQF.................ISQAERLAQINRDQ.....YNLNVKVVDLQTVYNEFS...........
B8KYL6_9GAMM/364-704YLMI....V..HSTL.................RTSLEPLAEFHRNR......GRTVVVADVEAIFDQFN...........
B8FIK5_DESAA/1139-1542YLII....T..TQAL.................AAAFETLEVHRTSV.....SGMACAVETVEDIEVNYP...........
Q11US7_CYTH3/392-767YFII....Y..PEVF.................NSSALSYDQYRSS.NA..GGNYDVERCSFEKLCNLYS...........
C6W101_DYAFD/326-680YLII....T..HPLMRTP...........VNGLDVVAEYAQYRAS.EA..GGGYHTSAAYSYELFDQFN...........
A5FJM8_FLAJ1/544-914YVIV....T..PRSL.................SSQAERLANFHRTN.....SNLNVKVISLENIYQEFS...........
Q7UG73_RHOBA/51-444VVVV....A..SPEF.................DETLEPWIQMRSEE......GLRVAIAR....................
A3J247_9FLAO/540-919YLII....T..PDFL.................STQAERLADFHRNN.....SGLSVRVVTLEKIYHEFA...........
A9WIM0_CHLAA/500-869AIYI....A..PRAL.................IGELEPLLARRQAQ......GWSPLAIAVEDVYAGWS...........
B0VHE7_CLOAI/227-554MLVIYGNYT..DTNY.................LSKINEFVTWKKQR......GFIVNAVSTGVTGI..............
C6VT06_DYAFD/394-758YIII....T..TDEL.................RDGAAAFAEYRSSPA...GGSFKPLIVNIRDIYDQFN...........
C6X3N8_FLAB3/546-921YLMI....T..VPEM.................MSQAQRLAAFYQDK.....FN..VAVVDVNKIYNEFS...........
A0LQH1_SYNFM/790-1132YIVI....T..SPEL.................SGAASSLADYRRRS.....KGLTTLVVTTEQIYDAFS...........
A1ZVJ9_9BACT/406-774LVII....V..PEVF.................LSEAERLAAFRRTN.....DGLSVTVVKLSQVYNEFS...........
B0VHF1_CLOAI/214-595YLIV....A..DAEK.................ITQWTPLKTFQEIR......GKTVLIKSMSEIIAEN............
B0VIE7_CLOAI/193-598LLVI....T..TPEL.................YTALDWLVTFRQSQ......GVDVSFCDI.AIALASG...........
C6W3P4_DYAFD/414-806YMIV....S..SESL.................IEAADSIALYRSAETA..GRKFKTGIFKIRDIYNQFN...........
B2RGP6_PORG3/408-787LIIV....S..TQAL.................LPEADRLATYRREK.....NGLKVLVVLQEQVFNEFS...........
D2QJ99_SPILD/409-770YVII....T..HEALMTPLTD.....SLTGRVTNAIQSYAAYRAS.VA..GGTHDTLTITMQQLIDQYN...........
A9B5Q8_HERA2/466-850TIYL....A..PKQW.................HSLVQPLINRRQQQ......GWQPLLVDVQAIYDRWS...........
D2QFF3_SPILD/397-745YVII....T..HASL.................RQSAATYAGYRSS.AA..GGSYKPFIVESDSLYDQFN...........
B0VH03_CLOAI/589-939NIIV....A..PAEF.................LQQAQELANKYREI.....YQISSKVILVDDIYNQFN...........
D2R2P5_PIRSD/21-411TVVV....C..PREF.................VAALDPLLAHRYAQ......GHRFAYVANTG.................
C6W0Z3_DYAFD/393-758LLII....T..PAEW.................VGEANRLAGFRNSN.....DGLDVLVVTTDQVYNEYA...........
A3XQP5_LEEBM/552-929YLMI....T..PNEL.................RAQAERLAQHNRTY.....RNLNVKVVTLDAIYNEFS...........
C9RIY0_FIBSS/581-957YLII....T..PDVF.................LAQAESLAVFRSSEKS..ASQLVTAVVSAENIYRHYT...........
Q2PY26_9BACT/412-780YVIV....A..PEHM.................LIEAERLAQFHRD......RGLTVQAVDVQHVYNEFS...........
Q26FX7_FLABB/537-909YLII....A..PDFL.................ENEAQRLANYHITS.....SNLNTKVVTLTDIYNEFS...........
B0VJT2_CLOAI/236-566YLIIYGNNS..DINF.................TSALNEYVLWKKQK......GADVMVASTAANEAGN............
C6BTD6_DESAD/56-402NVIV....C..TADF.................MRAARYFSYLHREF.....EGVKSVIVKVPSTNGTAE...........
D2QE53_SPILD/328-1007YLII....T..DDRRWTFQNGKPVAGNALPLDSAGKTATSHFLRLAEWKAKRGIDAKVVTVSEIVQGGSSTGLKWGDFTD
A2BK55_HYPBU/159-551MIII....VPDDTLV.................EMYAEDIAKLHREM......GLNVRIVTTSYIYENYPEAELPSDVCRP
B0VHP1_CLOAI/283-636YVII....L..PDNF.................IAPMQPFIDWKKQE......GYNVIVAPTSITGT..............
Q1Q1Y4_9BACT/620-970YIII....T..HEDF.................YDNALALASHRIDD......GLRVVTVKVGDIYDEFN...........
C7PNY3_CHIPD/396-764MLIV....T..TPSL.................RTAASKLAAWHGTH.....DGLNVRVVTVNEIYNEFA...........
Q6LFY5_PHOPR/224-617YLII....T..ADRF.................QQTVEPLAAWKRKK......GYQVHVATITEVGN..............
B3QVL4_CHLT3/688-1063YIII....Y..ATDY.................KSDAERLLAHRSSTSIWGSHALSGIAVDAQQVYNEFS...........
A9B187_HERA2/552-907YLLISYNPA.NSSSW.................SDALQPLITQRASQ......GLKPLLIDVQQIYDQFG...........
B3C566_9BACE/537-910MIII....SPDRKDL.................MTQAERLAQAHREK.....DGLSVLVLAAPQIYNEFS...........
B0VJY1_CLOAI/655-1014VIVI....A..PWQFT...............SVEGTLQLKSLWESE......GHTVKIVDVQDIYDEFN...........
B8G4Y1_CHLAD/584-1054FLII....A..PQSVI...............QAGALADFVDFKRRL......GFEVEVVSIEQAGQGASPN........D
A1ZEG7_9BACT/410-775YLII....T..HASLRQA..........TGGVSDPVQAYAAYRAS.TE..GGGFDTLTVNVKLLYNQFN...........
B0VF22_CLOAI/223-583MIII....T..NNDR.................ISWFSEYSAWRSAK......GVSNSIYSMEDIVSAY............
A0LKV0_SYNFM/924-1265YCIV....T..HGLF.................TDGARRIAEQKRNE......GYNPAIVDVEVLYNRYS...........
A8ZTD5_DESOH/257-648LLII....S..PPEL.................VAAADRLANWKRAQ......GILTEVRTTGQTGT..............
A9B8S0_HERA2/477-840VIIA.......PRAF.................LPALDPLR............TPTTVLVAREDLDAAWA...........
C3JBB2_9PORP/421-799LIIL....S..PEAF.................LSEAERLAEFHRSV.....DGMQVLVVGETALFNEFN...........
C9SW40_VERA1/279-917YLII....T..DDVTWDPVAIA..PGVSRPGLIKEFERLAEAKRAR......GISTRVVSITDIVAGRWGN.........
C9LI59_9BACT/509-899MVII....IPQSGKL.................LAQAERLAEAHKKQ......GLRVKVVRADQLYNEYS...........
B5ICF9_ACIB4/214-642NIII....T..SPQL.................KAAAQRLADFHNST......GVTSWVVTTTWIAKNYQPAP......NP
Y048_ARCFU/22-377EIIL....T..SEKL.................INSAYQLQEIHEKV......GIQSDIVTVEQIWDSYSPVE......DP
A3I371_9BACT/360-725LLII....T..TDEF.................SFAANKLKS.HKTN.....LGINTEVVFLKDIYNSFS...........

PF11713

A0KHZ7_AERHH/3609-3767--------T-----------------------RFTSQVIIQT..ED----------------------------------
Q2KX68_BORA1/2483-2627--------D-----------------------PYRKRTVVVV..GD----------------------------------
Q2SAY5_HAHCH/1-160--------M-----------------------NYDKQLIIVLLTEP----------------------------------
Q7N1Z0_PHOLL/2456-2614--------T-----------------------RFDGQIILQM..ED----------------------------------
Q7N726_PHOLL/2997-3151--------T-----------------------RFDGQIIIQM..EN----------------------------------
Q7VV06_BORPE/2551-2702--------D-----------------------PYANRVIVQL..AQ----------------------------------
Q7VV06_BORPE/2959-3112--------D-----------------------PYALRSIVQL..GT----------------------------------
Q7VV06_BORPE/3397-3549--------D-----------------------RYGHRTIVQL..GS----------------------------------
Q7VV06_BORPE/3808-3959--------D-----------------------RYAHRVIVQL..GS----------------------------------
Q189K3_PEPD6/575-754--------.-----------------------RGYIHYIVQL..QG----------------------------------
Q189K5_PEPD6/577-756--------.-----------------------KNYVHYIIQL..QG----------------------------------
Q7CGR6_YERPE/772-928--------.-----------------------NHHLQFIVLL..QD----------------------------------
Q9KS12_VIBCH/3469-3626--------T-----------------------RFDGQIIVQM..EN----------------------------------

PF01650

VPEG_ARATH/59-330----------K.----------------------------------GG-------------------------LKEENIV
A0CQC7_PARTE/19-285----------R.----------------------------------NG-------------------------YNPENVI
A2FXM6_TRIVA/13-267----------EV----------------------------------NN-------------------------LDKDKII
O24539_VICNA/53-325----------K.----------------------------------GG-------------------------VKEENIV
HGLB_SCHMA/37-291----------S.----------------------------------KG-------------------------IKPEHII
HGLB_SCHJA/31-285----------S.----------------------------------KG-------------------------VKPEHII
VPE_VICSA/56-325----------K.----------------------------------GG-------------------------SKEENII
A0A022P416_PSEAI/341-579----------QR----------------------------------FA-------------------------ARGV.IR
Q08BI0_DANRE/27-278----------K.----------------------------------QG-------------------------IPDEQIV
Q0MYV8_EMIHU/33-301----------K.----------------------------------NG-------------------------IDPDKII
Q22P32_TETTS/20-285----------K.----------------------------------KG-------------------------FAPENII
Q22P33_TETTS/20-285----------K.----------------------------------KG-------------------------FQPENII
D0MXB3_PHYIT/25-298----------R.----------------------------------HG-------------------------IPAENVV
Q2UVF3_HAECO/29-287----------N.----------------------------------HG-------------------------VKPDNII
Q4K5F2_PSEF5/335-570----------SR----------------------------------FG-------------------------AYGQ.IR
Q4RED0_TETNG/30-283----------R.----------------------------------NG-------------------------IPDEQIV
Q4UU48_XANC8/124-392----------QR----------------------------------FD-------------------------ARGRVIT
Q6EHZ7_TRIVA/12-258----------K.----------------------------------RG-------------------------FDDQHIT
N9BI26_ACIBI/229-477----------TR----------------------------------FG-------------------------TFGRSMM
Q6L4R2_ORYSJ/41-319----------K.----------------------------------GG-------------------------VEEQNIV
Q6NYJ7_DANRE/32-288----------K.----------------------------------NG-------------------------IPDEQIV
Q6PRC7_IXORI/38-293----------N.----------------------------------HG-------------------------IPDERIV
Q711M2_FASHE/21-278----------K.----------------------------------NG-------------------------FAPENIV
Q84LM2_ORYSJ/62-334----------K.----------------------------------GG-------------------------VKEENIV
Q852T1_TOBAC/49-320----------K.----------------------------------GG-------------------------LKDENII
Q86TV2_HUMAN/29-286----------R.----------------------------------NG-------------------------IPDEQIV
Q88QE3_PSEPK/400-640----------VR----------------------------------FG-------------------------ARGQ.VT
Q8LGK2_ARATH/46-316----------K.----------------------------------GG-------------------------LKDENII
Q949L7_BETVU/51-321----------K.----------------------------------GG-------------------------LKDENII
Q9LLQ4_SESIN/54-326----------K.----------------------------------GG-------------------------LRDENII
Q9LWZ3_ORYSJ/41-304----------K.----------------------------------GG-------------------------LKDQNIV
Q9SBX2_MAIZE/45-317----------K.----------------------------------GG-------------------------LKDENIV
Q9SMD0_SOLLC/39-316----------K.----------------------------------GG-------------------------LKDEHII
Q9XG75_TOBAC/40-306----------K.----------------------------------GG-------------------------LKDENII

PF00656

Q7QGM9_ANOGA/35-227----------RE----------------------------------GS-------------------------ANDMKQI
ICENC_DROME/196-443----------RI----------------------------------GA-------------------------EKDSKSL
O42284_CHICK/42-279----------RD----------------------------------GA-------------------------EVDVKEM
CAS1A_XENLA/144-382----------RH----------------------------------GA-------------------------KVDLDGM
CASPC_MOUSE/176-415----------RD----------------------------------NA-------------------------DTDILNM
CASP4_MOUSE/132-369----------RY----------------------------------GA-------------------------NFDIIGM
CASP5_HUMAN/193-430----------RN----------------------------------GA-------------------------HYDIVGM
CASPD_BOVIN/136-373----------RN----------------------------------GA-------------------------ALDILGM
CASP1_CANFA/163-400----------RD----------------------------------GA-------------------------ELDIAGM
CASP1_FELCA/161-406----------RK----------------------------------GA-------------------------DLDVAGM
CASP1_MOUSE/162-398----------RV----------------------------------GA-------------------------QVDLREM
CASP1_HUMAN/163-400----------RT----------------------------------GA-------------------------EVDITGM
CASP1_PIG/163-400----------RD----------------------------------GA-------------------------DVDIRDM
Q9I9L7_DANRE/145-379----------RS----------------------------------GS-------------------------EKDEENM
Q9DDJ2_DANRE/174-400----------RD----------------------------------GA-------------------------DRDEENA
Q6NTR7_XENLA/280-494----------..----------------------------------..-------------------------GNDASLL
CFLAR_MOUSE/257-480----------..----------------------------------..-------------------------GNDTKYL
Q6QN97_PIG/259-484----------..----------------------------------..-------------------------GNDTDVL
A0A024R3Z7_HUMAN/252-477----------..----------------------------------..-------------------------GNETELL
Q9NBW3_DROME/38-248----------RK----------------------------------GS-------------------------SNDVNAL
Q9TZP5_CAEEL/26-261----------RI----------------------------------GS-------------------------DKDKKKL
CASPE_MOUSE/22-256----------RE----------------------------------GS-------------------------EVDMEAL
B2CIS9_HUMAN/18-241----------RE----------------------------------GS-------------------------EEDLDAL
Q8I749_SUBDO/254-491----------RG----------------------------------GA-------------------------HIDVHNL
CASP2_RAT/200-445----------RS----------------------------------GG-------------------------DVDHTTL
CASP2_CHICK/171-416----------RS----------------------------------GG-------------------------DVDCASL
Q9GV89_HYDVU/93-318----------RD----------------------------------GS-------------------------EVDVQAL
Q9IB63_XENLA/144-396----------RT----------------------------------GS-------------------------DIDRDKL
CASP9_HUMAN/161-413----------RT----------------------------------GS-------------------------NIDCEKL
Q90WU0_CHICK/148-400----------RA----------------------------------GS-------------------------DIDCEKL
Q9IB64_XENLA/261-494----------RE----------------------------------GT-------------------------AKDAEEI
Q6E5N8_ICTPU/119-362----------RY----------------------------------GS-------------------------KLDEDSL
Q9I8J3_DANRE/238-473----------RT----------------------------------GT-------------------------DMDKDRL
Q6PAD9_XENLA/268-495----------RE----------------------------------GS-------------------------DKDAGAL
Q90WU1_CHICK/237-479----------RN----------------------------------GT-------------------------HVDADAL
CASP8_HUMAN/234-476----------RN----------------------------------GT-------------------------HLDAGAL
CASP8_MOUSE/236-478----------RK----------------------------------GT-------------------------DCDKEAL
Q9Y1U6_PRIPA/173-413----------RR----------------------------------GT-------------------------KADVIAL
CED3_CAEEL/243-494----------RN----------------------------------GT-------------------------KADKDNL
Q7QKT2_ANOGA/35-260----------RK----------------------------------GS-------------------------EKDVKAL
Q7PZJ9_ANOGA/20-250----------RD----------------------------------GW-------------------------EKDLEAV
Q9GV88_HYDVU/84-316----------RL----------------------------------GT-------------------------DVDAESL
Q7Q1E0_ANOGA/62-291----------RE----------------------------------GS-------------------------AIDCKRL
CASP1_SPOFR/61-293----------RT----------------------------------GT-------------------------NVDSDNL
CASP1_DROME/79-313----------RT----------------------------------GT-------------------------NVDAQEL
Q7Q4X6_ANOGA/73-309----------RA----------------------------------GT-------------------------NVDCENL
ICE_DROME/94-328----------RA----------------------------------GT-------------------------NVDCENL
Q9NHF9_DROME/56-302----------RV----------------------------------GT-------------------------ERDRDDM
Q7Q803_ANOGA/54-306----------RK----------------------------------GT-------------------------DADCDNI
Q7PV92_ANOGA/14-237----------RV----------------------------------GS-------------------------SKDRTDI
Q86FL0_ANOST/52-286----------RE----------------------------------GS-------------------------DRDRDSI
Q8I6Y2_GEOCY/158-414----------RV----------------------------------GT-------------------------DKDAENL
Q8ITP3_BRAFL/87-323----------RR----------------------------------GT-------------------------DLDANNL
O88550_RAT/68-301----------RN----------------------------------GT-------------------------DKDAEAL
Q6DCI2_XENLA/78-314----------RN----------------------------------GT-------------------------DIDAREL
Q8JIS8_ORYLA/58-285----------RN----------------------------------GT-------------------------DNDAAAA
CASP3_XENLA/56-280----------RN----------------------------------GT-------------------------DVDALKL
O93417_CHICK/53-281----------RS----------------------------------GT-------------------------DADAASV
Q98UI8_DANRE/48-280----------RN----------------------------------GT-------------------------DVDAGNV
Q8JG42_TAKRU/51-279----------RN----------------------------------GT-------------------------DVDAANA
Q8ITP2_BRAFL/151-396----------RR----------------------------------GS-------------------------HVDAGNL
Q9IB66_XENLA/58-298----------RR----------------------------------GT-------------------------NTDSMNL
Q9I8S9_ONCMY/57-297----------RN----------------------------------GT-------------------------NADRSNL
O93415_CHICK/57-299----------RR----------------------------------GT-------------------------LADRNNL
CASP6_MOUSE/28-270----------RR----------------------------------GT-------------------------NADRDNL
PCP_DICDI/188-404----------LD----------------------------------GV-------------------------INDVNSF
Q53839_STRCH/9-268----------LP----------------------------------GI-------------------------RNNLAAL
A0A038IA40_BORBO/552-800----------LQ----------------------------------YA-------------------------VNDANAI
Q7NPG1_GLOVI/7-278----------LP----------------------------------SC-------------------------LEDARKF
Q87Z21_PSESM/2-224----------LM----------------------------------GC-------------------------VNDAVAI
Q82I86_STRAW/5-276----------LR----------------------------------GA-------------------------VTDVEEA
F7URG9_SYNYG/40-299----------LM----------------------------------GC-------------------------TTDRQLL
Q8YS65_NOSS1/4-245----------LN----------------------------------YA-------------------------KRDAELI
Q9DDL2_DANRE/323-560----------LR----------------------------------AP-------------------------MADVHEL
Q98CE0_RHILO/5-237----------LA----------------------------------NP-------------------------IHDGEAM
Q6N0T4_RHOPA/30-250----------LS----------------------------------QA-------------------------VSDAREL
Q89XG2_BRADU/27-247----------LK----------------------------------EP-------------------------LNDARDV
A0A038FP67_9BRAD/58-278----------LT----------------------------------QS-------------------------INDARAL
Q6NBN5_RHOPA/57-277----------LL----------------------------------QP-------------------------INDARLL
Q98JS7_RHILO/35-253----------LT----------------------------------NP-------------------------RNDAKLI
Q985X8_RHILO/35-256----------LA----------------------------------TP-------------------------ANDAGLI
Q6N5Q1_RHOPA/33-253----------LS----------------------------------TA-------------------------ANDGGLI
Q89KP2_BRADU/86-307----------LA----------------------------------TT-------------------------ANDAGLI
Q89IK1_BRADU/30-253----------LP----------------------------------NP-------------------------PHDAEDV
Q98G71_RHILO/26-252----------LA----------------------------------NP-------------------------VNDALDI
Q6AKF4_DESPS/28-248----------LK----------------------------------NP-------------------------VNDAKDF
Q98IJ6_RHILO/11-238----------LA----------------------------------NP-------------------------ARDAQAM
Q89MV1_BRADU/176-400----------LD----------------------------------NP-------------------------SKDASLM
Q89HT8_BRADU/51-272----------LQ----------------------------------NP-------------------------DNDAESM
Q89FZ4_BRADU/32-256----------LP----------------------------------NA-------------------------ANDAKGM
Q6N329_RHOPA/73-298----------LP----------------------------------NP-------------------------VNDAKAI
Q98IJ9_RHILO/30-261----------LP----------------------------------NP-------------------------ANDAHLI
Q89HP3_BRADU/336-569----------LP----------------------------------NP-------------------------PNDARAV
Q7RFI8_PLAYO/964-1364----------LH----------------------------------GS-------------------------ANDAYVF
D7AGH8_GEOSK/6-270----------LN----------------------------------AC-------------------------EADAEDM
MCA9_ARATH/10-321----------LH----------------------------------GC-------------------------INDVLAM
MCA8_ARATH/3-378----------LR----------------------------------GC-------------------------VNDVHRM
MCA7_ARATH/3-401----------LQ----------------------------------GC-------------------------VNDVHRM
Q70VV0_PICAB/3-415----------LK----------------------------------GC-------------------------VNDVNRM
Q9ZSP8_HEVBR/3-415----------LK----------------------------------GC-------------------------INDVKRM
MCA4_ARATH/3-416----------LR----------------------------------GC-------------------------VNDVRRM
MCA5_ARATH/3-408----------LR----------------------------------GC-------------------------VNDVRRV
MCA6_ARATH/3-366----------LR----------------------------------GC-------------------------VNDVRRM
MCA1_ARATH/80-362----------LK----------------------------------GC-------------------------INDAKCM
MCA2_ARATH/116-414----------LK----------------------------------GC-------------------------INDANCM
MCA1_SCHPO/130-422----------LQ----------------------------------GC-------------------------INDVMSM
MCA1_YARLI/168-458----------LR----------------------------------GC-------------------------INDVHNL
MCA1_DEBHA/146-437----------LR----------------------------------GC-------------------------INDVKNM
M9MZN6_ASHG1/154-449----------LR----------------------------------GC-------------------------INDVQNI
MCA1_KLULA/138-430----------LR----------------------------------GC-------------------------INDSHNM
MCA1_CANGA/98-389----------LR----------------------------------GC-------------------------INDAHNI
B5VS82_YEAS6/157-450----------LR----------------------------------GC-------------------------INDAHNI
D0A6D7_TRYB9/84-341----------LR----------------------------------GC-------------------------QADAVMM
Q38D34_TRYB2/63-322----------LG----------------------------------GC-------------------------VNDVMHM
Q8T8E6_9TRYP/84-343----------LS----------------------------------GC-------------------------CNDVKQM

PF14538

W1QFK7_OGAPD/56-210----------DP----------------------------------TT.....YSDPKKA.L...........QAIGKNL
L8WVZ0_THACA/73-224----------DP----------------------------------FS...M.P..SNKA.L...........EAIGRNL
A2EZ34_TRIVA/89-236----------NM----------------------------------SN......................ILPSDFSAYL
Q6C6R4_YARLI/86-238----------DP----------------------------------QT...ISD..SKKA.T...........EQIGKQL
M2WI96_MYCP1/172-328----------DP----------------------------------VPPDSS.NQNSNNT.N...........AQIGKNL
K2S4T3_MACPH/104-258----------DP----------------------------------TV...S.TGTSGHTPM...........NNIGKAL
C4LXC3_ENTHI/42-194----------NT----------------------------------KE........HKKREI..........GYEITNQL
T1G0Q6_HELRO/62-216----------GL----------------------------------LDVNGG.N..VQKP.I...........EIIGAAL
B0CNS4_LACBS/34-185----------DP----------------------------------HT...L.P..AQKA.L...........EAIGNNL
F0ZAV4_DICPU/115-266----------DP----------------------------------AS...Q.P..PQKS.L...........DLIGKTL
U9UGJ5_RHIID/52-203----------DP----------------------------------FA...L.P..PAKA.L...........DAIGKNL
Q5KIS3_CRYNJ/92-243----------DP----------------------------------TQ...L.P..APKA.I...........DAIGRNL
B0WBU4_CULQU/30-181----------NL----------------------------------LC...LED...................DSTAKLL
A5DWK2_LODEL/143-295----------DP----------------------------------TT...FTD..TKKA.L...........ENIGKNL
G0VGR8_NAUCC/79-231----------DP----------------------------------LN...FQD..SKKA.I...........EQIGKNL
I3J5N7_ORENI/57-208----------DP----------------------------------LS...M.S..PQKA.L...........ETIGANL
A2DYM2_TRIVA/68-215----------NM----------------------------------SK......................TLPSDFSSYV
D8TLK8_VOLCA/11-162----------DP----------------------------------MS...A.Q..PAKA.L...........EHIGKNL
G4M000_SCHMA/43-194----------DP----------------------------------TDANSLHA.......L...........GNIGKNL
C1MUE6_MICPC/45-196----------NP----------------------------------LS...M.Q..PQKA.L...........DAIGKAL
Q387I9_TRYB2/89-240----------EP----------------------------------YI.............ARMPHIVTGGGSERIAALL
C4M2F5_ENTHI/38-189----------DT----------------------------------AG.....K..TNRKLV...........YDIAANL
G4TT65_PIRID/72-223----------DP----------------------------------RK...L.G..SAKA.L...........EAIGKNL
G0NWW0_CAEBE/64-218----------DP----------------------------------YK......CGAHKAAL............EVAMST
A2DJF0_TRIVA/83-228----------DL----------------------------------SV......................VNTVEAVRTL
K3WJU9_PYTUL/84-235----------EP----------------------------------SS...M.P..PQKA.L...........ETIGKTL
A2G590_TRIVA/30-180----------DP----------------------------------TV.......................FAPSSSNAI
B8M6V6_TALSN/189-342----------DP----------------------------------TS...T.TGGQNKM.M...........EQIGKKL
A2FJN8_TRIVA/41-191----------DP----------------------------------SV.......................FAPSSQNAI
A2DLR3_TRIVA/97-242----------NI----------------------------------YQ......................MQASDISSNI
E5SIN8_TRISP/44-195----------DP----------------------------------QC...M.P..MQKA.L...........ESIGTAL
I1G727_AMPQE/53-204----------DP----------------------------------LS...R.G..SQKA.M...........ELIANSL
U1MN31_ASCSU/95-246----------DP----------------------------------HG...M.N..PQKA.I...........AKIASAL
I1L744_SOYBN/123-274----------DP----------------------------------FS...M.A..PQKA.L...........ESIGKTL
E4XFS5_OIKDI/48-228----------NA----------------------------------WD.............VNDNFDNELPPQDVIYRNV
D2VMD1_NAEGR/144-294----------DP----------------------------------QT.....H..PQKA.L...........EAIGSNL
A9TBL2_PHYPA/91-242----------DP----------------------------------FS...T.A..SVKA.L...........EAIAKNL
B7PLB3_IXOSC/92-247----------GE----------------------------------DAGIRRSP..PQKA.L...........EAIGAAL
E9CIT6_CAPO3/727-878----------DP----------------------------------FS...V.P..PQRA.L...........EQIGLRL
B8CBK6_THAPS/256-409----------DP----------------------------------TS...I.S..RAKA.K...........ERIGERL
A4I1A2_LEIIN/114-279----------DP----------------------------------MV.....AHVAKSAHRSGRGSGAGGGSDSIAETL
F4RLY3_MELLP/215-367----------DP----------------------------------KM...Y....PKESVL...........ETIAKRL
K4DUJ2_TRYCR/62-218----------DP----------------------------------HV.............AQISRFALEGGSDSIAEIL
H1VVG4_COLHI/158-309----------DP----------------------------------TT...P.P..PQKA.L...........ENIGKAL
M7XEP3_RHOT1/113-265----------DP----------------------------------FA...I.A..KDKA.M...........ERIGKNL
A2GCD5_TRIVA/98-247----------NT----------------------------------NN......................SFSSEYPTTI
D8RG53_SELML/72-223----------DP----------------------------------SS...L.A..PQKA.L...........DTIGKNL
A2F9H3_TRIVA/31-181----------DP----------------------------------TY.......................YAPDSRKAI
L0PHF8_PNEJ8/131-282----------DP----------------------------------FS...L.P..SQKS.L...........EAIGKNL
RTOR2_ARATH/94-246----------DP----------------------------------FS...MFP..PRRA.L...........EAIGQNL
M5E8T5_MALS4/58-209----------DP----------------------------------ES...L.D..ASKA.L...........PAIGRNL
B3RPQ9_TRIAD/43-194----------DP----------------------------------LT...M.N..PNKS.L...........EAVGNSL
I4Y9Q8_WALSC/76-227----------DP----------------------------------TN...M.P..PPKA.L...........ETIGRNL
A2E4G0_TRIVA/101-242----------LS----------------------------------TS.........................SIDPKSL
U6ISX1_HYMMI/269-417----------DP----------------------------------AD........AGYRVV...........EMIGKNL
U4LGP0_PYROM/223-374----------DT----------------------------------LS...Q.P..ASKA.L...........ESIGKNL
A2F8U1_TRIVA/65-210----------KT----------------------------------ST.....ESTSNPQ.............QEIAKAI
D8T9J0_SELML/50-197----------EP----------------------------------SA..........KA.I...........DVIGQTL
A9V5A2_MONBE/628-777----------DP----------------------------------EE........KPKA.I...........ELISQRL
F0XXV0_AURAN/12-164----------EP----------------------------------FA...GPS..RQKA.L...........ETIGAAL
A2E336_TRIVA/54-202----------QI----------------------------------SN...TTQTLLSSVIL...........KEINAGF
B4R5C8_DROSI/214-365----------DP----------------------------------SS...V.S..PPKA.M...........ELIGSNL
J4H2X1_FIBRA/92-243----------DP----------------------------------HT...L.P..AQKA.L...........DIIGMNL
A2EU18_TRIVA/81-227----------NI----------------------------------KN......................MSDTEFPGII
A2DYB3_TRIVA/12-162----------DP----------------------------------TY.......................YAPQTKHVV
S2KE38_MUCC1/106-257----------DP----------------------------------FL...L.I..PQKS.L...........EAIGKSL
G7E3R0_MIXOS/173-325----------DP----------------------------------FS...L.N..KDKV.M...........DAIGRNL

PF03415

Q8A866_BACTN/37-399----------YM----------------------------------DK-......................GSNPKLIRL
Q9WZB1_THEMA/121-462----------VY----------------------------------DG-I.....................GIGDGMLVL
Q8XM44_CLOPE/59-508----------LV----------------------------------DR-IPGYSNDSKVLGSNFEDTRLYKIGENSAERI
Q9X1S5_THEMA/586-937----------IF----------------------------------DG-F.....................FHSDWIYVL
Q9WYY6_THEMA/5-301----------LV----------------------------------DY-R.....................SSSDTLYRV
Q8TIY6_METAC/66-593----------AY----------------------------------GG-AAAEGWEGMTI...........AELEDLRKD

PF13900

F6VPI7_MACMU/1-48-------------------------------------------------------------------------WHDLGSL
H2P8I3_PONAB/10-56-------------------------------------------------------------------------WHDLGSL
F7H1D9_MACMU/6-53-------------------------------------------------------------------------WCDLDSL
F7HNL8_MACMU/6-53-------------------------------------------------------------------------WRDLGSL
F6ZY08_MACMU/15-62-------------------------------------------------------------------------WHDLGSL
C9JL97_HUMAN/112-159-------------------------------------------------------------------------WCDLGSL
F7HUC2_MACMU/8-55-------------------------------------------------------------------------WHDLGSL
F7E5F2_MACMU/5-52-------------------------------------------------------------------------WRDLSSL
H2PFS8_PONAB/309-356-------------------------------------------------------------------------WCNLSSL
H9KYL1_CALJA/1-48-------------------------------------------------------------------------WHDFSSL
F7H0L3_MACMU/5-52-------------------------------------------------------------------------CGDLGSL
F6X1U8_MACMU/6-53-------------------------------------------------------------------------WCDLSSL
F7GV92_MACMU/20-67-------------------------------------------------------------------------WRDLSSL
F7GPL2_MACMU/68-115-------------------------------------------------------------------------WPDLSSL
F8WCX3_HUMAN/9-56-------------------------------------------------------------------------WHDLSSL
G1QLW6_NOMLE/814-862-------------------------------------------------------------------------WHDLGSL
F7H7M8_MACMU/103-150-------------------------------------------------------------------------WCNLGSQ
F7HJ06_MACMU/6-53-------------------------------------------------------------------------WRNLGSL
F7GKP6_MACMU/5-52-------------------------------------------------------------------------WCNLSSL
F7BBK8_MACMU/3-51-------------------------------------------------------------------------WHDLSSL
F7BBH6_MACMU/6-53-------------------------------------------------------------------------QRDLGSL
F7H0K2_MACMU/5-52-------------------------------------------------------------------------WHNLSSL
F7FTH6_MACMU/13-60-------------------------------------------------------------------------WHNLGSL
F6Y5H5_MACMU/6-53-------------------------------------------------------------------------WSDLSSL
F7IGY2_CALJA/5-52-------------------------------------------------------------------------WQDLSSP
F7F1B5_MACMU/6-53-------------------------------------------------------------------------WHDLGSL
F6ZIE8_MACMU/13-60-------------------------------------------------------------------------WRSLGSL
H7C2Z3_HUMAN/35-82-------------------------------------------------------------------------CCDLGSL
F6Q4C2_MACMU/10-57-------------------------------------------------------------------------WHHLGSL
F6WIB8_MACMU/57-104-------------------------------------------------------------------------WHNLGSL
F6RPD7_MACMU/5-52-------------------------------------------------------------------------WHDLGSL
F7AN02_MACMU/1-48-------------------------------------------------------------------------WRNLGSL
F6UHP4_MACMU/22-69-------------------------------------------------------------------------WHDLGSP
F6QIB6_MACMU/6-53-------------------------------------------------------------------------WQDLGSL
F7INS6_CALJA/10-56-------------------------------------------------------------------------WRNLSSL
F7DA23_MACMU/81-128-------------------------------------------------------------------------RCNLGSL
G3S992_GORGO/2-49-------------------------------------------------------------------------WHDLGSL
F7GMK7_MACMU/6-53-------------------------------------------------------------------------WHNLGSL
F7BBW7_MACMU/19-66-------------------------------------------------------------------------WHDLGSL
G7P901_MACFA/6-53-------------------------------------------------------------------------WWDFGSL
F6VUI9_CALJA/8-55-------------------------------------------------------------------------WHDLSSL
F7HNT1_MACMU/10-57-------------------------------------------------------------------------WRNLGSL
H2PFT0_PONAB/200-246-------------------------------------------------------------------------WHDLGSL
F7BEX5_MACMU/6-53-------------------------------------------------------------------------WHSLGSL
F7IH17_CALJA/8-55-------------------------------------------------------------------------WLNLRSL
F7CY78_MACMU/1-49-------------------------------------------------------------------------RRDLCSL
F6QIR0_MACMU/9-56-------------------------------------------------------------------------WCNLGSL
E9PIS2_HUMAN/138-185-------------------------------------------------------------------------WCDLSSL
G7P0P9_MACFA/3-50-------------------------------------------------------------------------WYNLSSL
F8WCK5_HUMAN/303-350-------------------------------------------------------------------------WHDLGSL
F7A4Y6_MACMU/6-53-------------------------------------------------------------------------WHDLGSL
F5H189_HUMAN/75-122-------------------------------------------------------------------------WNDLSSL
F7GMG4_MACMU/12-59-------------------------------------------------------------------------WHNLSSL
F7EDZ5_MACMU/6-53-------------------------------------------------------------------------WHDLSSV
H2NMK9_PONAB/15-62-------------------------------------------------------------------------WPDVGSL
F7GNA8_MACMU/17-64-------------------------------------------------------------------------WDDLGSP
M0QYB7_HUMAN/5-52-------------------------------------------------------------------------WHNLGSL
F7GHR0_MACMU/69-116-------------------------------------------------------------------------WHDLGSL
F6TK80_MACMU/14-61-------------------------------------------------------------------------WHDLGSL
F7HQG2_MACMU/6-51-------------------------------------------------------------------------WRDLGSL
F7HL81_MACMU/1-48-------------------------------------------------------------------------WCNLDSL
G3S4W3_GORGO/73-116-------------------------------------------------------------------------WRDLCSL
G7PKJ6_MACFA/16-62-------------------------------------------------------------------------WSHL.RL
F7CF12_MACMU/16-63-------------------------------------------------------------------------WHDLGSL
F7H314_MACMU/5-52-------------------------------------------------------------------------WHDLGSL
F7GNJ7_MACMU/23-70-------------------------------------------------------------------------WRDLGSM
F7H7L6_MACMU/21-68-------------------------------------------------------------------------WHDLGSL
H2PFS9_PONAB/301-348-------------------------------------------------------------------------WHDLGSL
F6QZW4_MACMU/4-51-------------------------------------------------------------------------WRDLSSL
F6VSA3_MACMU/58-105-------------------------------------------------------------------------WRNLGSL
F7GWG7_MACMU/6-53-------------------------------------------------------------------------WRNLSSL
G8F501_MACFA/41-88-------------------------------------------------------------------------WLNLSSL
H2PCJ4_PONAB/71-117-------------------------------------------------------------------------WYDLGSL
F7GRV2_MACMU/10-57-------------------------------------------------------------------------WGDLCSL
F7DN54_MACMU/18-65-------------------------------------------------------------------------WHHLSSP
F7C2M9_MACMU/203-250-------------------------------------------------------------------------WCHLGSL
F6UHM5_MACMU/4-51-------------------------------------------------------------------------WCDLGSL
F7E6B4_MACMU/16-63-------------------------------------------------------------------------WHNFSSL
F6RPF6_MACMU/5-52-------------------------------------------------------------------------WRNLGSL
F6T9Z0_MACMU/31-78-------------------------------------------------------------------------WRDLGSP
F7D1W6_MACMU/11-57-------------------------------------------------------------------------WRDLGSP
F6UMN3_MACMU/5-52-------------------------------------------------------------------------WHDLGSL
K7EME6_HUMAN/91-138-------------------------------------------------------------------------WCYIGSL
F8WD42_HUMAN/7-54-------------------------------------------------------------------------WEDLSSL
H2PFS8_PONAB/209-255-------------------------------------------------------------------------WHDFGH.
F6W1Z8_MACMU/11-58-------------------------------------------------------------------------WCDLSSL
F7ILB0_CALJA/1-48-------------------------------------------------------------------------WRDLGSP
F6VHU0_MACMU/21-68-------------------------------------------------------------------------WQDLGSL
F6WI78_MACMU/73-120-------------------------------------------------------------------------WCDLGSL
H7BZB2_HUMAN/19-65-------------------------------------------------------------------------WAQ.SRL
F6ZI73_MACMU/64-111-------------------------------------------------------------------------WHDLGSL
F6Z663_MACMU/5-53-------------------------------------------------------------------------WRNLGSL
F7AS31_MACMU/5-53-------------------------------------------------------------------------WHDLSSL
F6VXW3_MACMU/74-121-------------------------------------------------------------------------WRDIGLP
F6RES6_MACMU/10-57-------------------------------------------------------------------------WCNLGSL
F6SY12_MACMU/53-100-------------------------------------------------------------------------WCNLSLL
F6Y1U7_MACMU/8-55-------------------------------------------------------------------------WCHLGSL
F6RRM6_MACMU/17-64-------------------------------------------------------------------------WHHLGSL
F7AVL2_CALJA/49-96-------------------------------------------------------------------------WCDLGSL
F7HXT7_CALJA/4-48-------------------------------------------------------------------------WRDL...
F6ZZ11_MACMU/5-52-------------------------------------------------------------------------WPDLSSL
F7GGU7_MACMU/13-60-------------------------------------------------------------------------WHNLGSL

PF12770

A0LJ53_SYNFM/581-921----------..----------------------------------SSAK.----------------------..VLLVV
A0LQE8_SYNFM/635-947----------EQ----------------------------------AGAT.----------------------..TLLLS
A0YK41_LYNSP/3523-3818----------EA----------------------------------QEIN.----------------------..NLVFI
A0YW51_LYNSP/1488-1787----------EK----------------------------------HQVK.----------------------..TLIFS
A0YZ16_LYNSP/128-434----------KE----------------------------------KGID.----------------------..TLLLC
A1BCK0_CHLPD/513-826----------QD----------------------------------MGIAD----------------------DAELVWF
A1BEL3_CHLPD/43-361----------KH----------------------------------QAGQS----------------------ILPIVIE
A1BEL6_CHLPD/46-364----------KK----------------------------------QAGTG----------------------ILPLVIA
A3WDM2_9SPHN/678-1006----------..----------------------------------ASIK.----------------------..HLIFE
A4HBL7_LEIBR/1053-1432----------DS----------------------------------QLLFG----------------------DGMITVV
A8L4T6_FRASN/741-1051----------..----------------------------------APYR.----------------------..RAVLM
A8YIK9_MICAE/645-974----------..----------------------------------GNTK.----------------------..TILLS
A9WBC0_CHLAA/673-929----------..----------------------------------LPIPV----------------------EGKLLIA
A9WER9_CHLAA/54-394----------QQ----------------------------------QPLR.----------------------.LRLALD
A9WF91_CHLAA/60-360----------GR----------------------------------RPLPI----------------------RFRLFIA
B0C874_ACAM1/207-507----------EK----------------------------------KKID.----------------------..TIIFS
B2IXC0_NOSP7/1396-1691----------QA----------------------------------REIN.----------------------..NLVFL
B2IZZ4_NOSP7/695-973----------LP----------------------------------KDIR.----------------------..ALTIV
B2JAK0_NOSP7/526-830----------.Q----------------------------------LKAN.----------------------..RIAIV
B2JAM9_NOSP7/866-1190----------..----------------------------------LGNK.----------------------..RLLIV
B3QB04_RHOPT/774-1131----------.W----------------------------------KPAK.----------------------..KLIVV
B4JKU3_DROGR/1402-1700----------AS----------------------------------VSRQG----------------------RRELILV
B4VHH6_9CYAN/1150-1443----------EA----------------------------------AEID.----------------------..TLLFS
B4VJ14_9CYAN/646-949----------..----------------------------------GNSR.----------------------..HILIA
B4VJ30_9CYAN/3784-4081----------EA----------------------------------QGIQ.----------------------..NLVFI
B4VLG1_9CYAN/97-405----------IA----------------------------------QNQRT----------------------VLRLRLG
B4VLY5_9CYAN/1558-1850----------QT----------------------------------QGIQ.----------------------..NLSFI
B4VPE9_9CYAN/1179-1471----------QD----------------------------------REIN.----------------------..NLAFI
B4VQD3_9CYAN/1443-1735----------QT----------------------------------QEID.----------------------..NLAFI
B4VQK8_9CYAN/1658-1953----------QE----------------------------------TGIE.----------------------..NLVFI
B4VTQ2_9CYAN/1746-2036----------QA----------------------------------QGIQ.----------------------..NLVFV
B4VXN8_9CYAN/1368-1663----------EA----------------------------------RQIQ.----------------------..GLMFA
B4VXQ8_9CYAN/1752-2046----------EE----------------------------------QGID.----------------------..TLIFS
B4VYA5_9CYAN/647-942----------DA----------------------------------LDID.----------------------..TLIFC
B4WMI9_9SYNE/695-1035----------..----------------------------------NNKE.----------------------..QLLLS
B6C3H2_9GAMM/45-361----------..----------------------------------GEAK.----------------------..RLLLV
B8G8X7_CHLAD/58-398----------QQ----------------------------------QPLR.----------------------.LRLAID
B8GD94_CHLAD/102-415----------VD----------------------------------RPLLI----------------------ACHFNAH
C3Z401_BRAFL/1278-1602----------NG----------------------------------PKSPA----------------------.GQLVLV
F0SR63_PLABD/137-574----------DG----------------------------------DSVR.----------------------..QVVVL
F7UL61_SYNYG/155-456----------EA----------------------------------QGID.----------------------..TLLFC
F7ULD2_SYNYG/1449-1747----------EN----------------------------------KKIE.----------------------..NISFI
F7UQF5_SYNYG/591-904----------..----------------------------------...K.----------------------..RLLIV
Q01RE6_SOLUE/865-1136----------..----------------------------------EHAR.----------------------..RIWIE
Q024J7_SOLUE/541-814----------..----------------------------------PAGS.----------------------..RVILT
Q025F1_SOLUE/607-877----------..----------------------------------RGKS.----------------------..TIVVV
Q028B5_SOLUE/667-935----------..----------------------------------RGKS.----------------------..TVVIA
Q02DA1_SOLUE/510-786----------..----------------------------------DPSR.----------------------..TLVIE
Q10YT7_TRIEI/1003-1309----------..----------------------------------GSQK.----------------------..QILIS
Q10YU6_TRIEI/544-838----------DA----------------------------------SQIK.----------------------..TLVFV
Q112V9_TRIEI/62-390----------QQ----------------------------------DA...----------------------..NLGII
Q113D1_TRIEI/130-430----------..----------------------------------QERQH----------------------NFSYLII
Q113U8_TRIEI/3002-3297----------EA----------------------------------ANID.----------------------..TLLFS
Q115J8_TRIEI/1466-1777----------..----------------------------------..CQ.----------------------..RLTLI
Q117G6_TRIEI/881-1206----------..----------------------------------GSKE.----------------------..QILIS
Q119J2_TRIEI/1474-1770----------VA----------------------------------YNIN.----------------------..MIVFS
Q16H64_AEDAE/1315-1614----------ST----------------------------------TSRIG----------------------RRELILV
Q2G6U6_NOVAD/692-1020----------..----------------------------------PQTR.----------------------..HLVFE
Q2S6G2_SALRD/540-844----------..----------------------------------PDGQ.----------------------..PLTVI
Q2W535_MAGSA/875-1218----------..----------------------------------GGRT.----------------------..KVYII
Q38C46_TRYB2/1044-1397----------DP----------------------------------RLLAK----------------------NGVVTII
Q3AQG5_CHLCH/44-362----------KQ----------------------------------RAGQH----------------------IVPLLLS
Q4C5K3_CROWT/405-717----------TP----------------------------------KHCD.----------------------..ELILI
Q4S217_TETNG/1205-1537----------TG----------------------------------PVGRH----------------------.RQLVLV
F7URX2_SYNYG/165-457----------KA----------------------------------NAID.----------------------..TLIFC
Q5LLA3_RUEPO/680-970----------..----------------------------------ARSRE----------------------HDKLFVI
Q64CV3_9ARCH/59-374----------EA----------------------------------EGYSE----------------------TLQLIVK
Q7NCT1_GLOVI/600-923----------..----------------------------------LQAK.----------------------..HLLIA
Q7NF67_GLOVI/550-854----------..----------------------------------GGRR.----------------------..RLLVS
Q7NFD7_GLOVI/666-979----------..----------------------------------GGVK.----------------------..HLLLS
Q7NIF7_GLOVI/691-997----------..----------------------------------GDVH.----------------------..TLWIA
Q7NJE3_GLOVI/660-988----------..----------------------------------PGVK.----------------------..HLFLA
Q7NLR0_GLOVI/653-961----------..----------------------------------GNTR.----------------------..QILIS
Q7NVB0_CHRVO/67-386----------DG----------------------------------NSYT.----------------------..QLRLV
Q82I85_STRAW/1175-1481----------RA----------------------------------GRVP.----------------------..RLVLV
Q82L10_STRAW/969-1256----------SG----------------------------------APWP.----------------------..RLWWS
Q8DGG5_THEEB/541-835----------..----------------------------------GNAT.----------------------..HLLIA
Q8DH74_THEEB/570-891----------..----------------------------------EGST.----------------------..HLLVA
Q8DHI1_THEEB/67-394----------VR----------------------------------HTYE.----------------------..NLVIS
Q8DIE5_THEEB/1127-1420----------DA----------------------------------QGIE.----------------------..TLVFV
Q8YZU5_NOSS1/56-340----------TE----------------------------------QRIK.----------------------..TLVFI
TTC28_HUMAN/1390-1713----------SG----------------------------------PVGRH----------------------.RQLILV

PF03568

T1IUX7_STRMM/1624-1980----------GG...TC.............................TFLEE......................FERINEA
G8BT64_TETPH/1165-1563----------EL...DT..Q.....CYTFQ................DASDE......................LNSIIKA
S6EFD3_ZYGB2/1145-1542----------DL...DC..H.....KLTFG................EAKEE......................LESIIQE
Q2LZN6_DROPS/172-538----------.....HN..SGLAEVFKQYS................TLVDR......................FRRVVTV
A5DNR9_PICGU/1178-1576----------GK...NT.........VSID................QVFSK......................LQAIVEA
H2VRL7_CAEJA/706-1062----------.....AS.............................ELMDK......................FTHLLDE
G4N8I2_MAGO7/1627-2057----------DT...DN..E.....SFNYQ................TGRAE......................LLEIIEL
J3P7L5_GAGT3/1606-2054----------DS...AN..D.....SFNYH................QGRAE......................LQEIIGL
Q6ZHH8_ORYSJ/455-870----------QH...EDSCTKELDNLMRAT..DKNWQCPWGYTIIDYVAPT......................FRKILEE
G3N6G2_GASAC/1731-2077----------SI...S..............................WMVRE......................MESIQVE
I7LUG5_TETTS/2027-2414----------.....SNFRINSQSQTNLFS................DYIND......................IKRILQN
M7T4Q8_EUTLA/44-499----------DS...DS..E.....ILSFQ................DGRSE......................LLDIIKS
A3GFF5_PICST/1168-1555----------DR...SPRTS.....VISFQ................EMETQ......................FKEIIRQ
N4UZ87_COLOR/1637-2043----------DG...ED..E.....LFDFQ................HGYEE......................LMDIIDA
Q5A8X8_CANAL/1101-1536----------.P...SS.........LGFQ................QLMQN......................FEKIIDD
W1QIM9_OGAPD/1167-1527----------HA...............SFG................SAVQE......................LEAIIQE
Q75EJ0_ASHGO/1152-1552----------DL...SQ..E.....TLTFA................LLMEE......................LNDIIEK
C5MEH0_CANTT/925-1303----------GV...SP.........MNFE................TMKKE......................LENIIEE
M7XLD2_RHOT1/1703-2100----------EG...EE..ED....AFTFD................VAMNE......................LQDIIER
G0RRT6_HYPJQ/1566-1971----------DA...DS..E.....VFNFE................HGREE......................LLELIKL
BIMB_EMENI/1609-2004----------ED...EE..E.....QFTFE................DGRDE......................MKELIRL
G3B782_CANTC/1213-1609----------GS...TA..S.....SLSFT................GALDK......................LNAIIKR
G2X6M8_VERDV/1704-2113----------DA...DT..E.....VFDFE................QGHGE......................LLEVIRL
S8BGE7_PENO1/1622-2018----------ED...EE..E.....QFTFE................DGKEE......................MRELIKL
G2R9B0_THITE/1619-2058----------DA...DS..D.....VFDFQ................QGRAE......................LLEIIKL
B6GZP8_PENCW/1602-1998----------DD...DE..E.....QFTFE................DGKEE......................MQELIKL
K5WME3_PHACS/1732-2136----------EN...VD..DT..E.FLTFD................DAIAE......................LKEIIRL
ESP1_ARATH/1641-2060----------S....DDSANLSSTEATQVKSLKGPWLCPWGTTVVDEVAPA......................FKSILEE
M7PDE3_PNEMU/1489-1882----------DA...DQ..D.....TLTYD................NVFNE......................LNEIIFR
S9X830_SCHCR/1385-1771----------DA...DE..E.....ILSFE................KAQSA......................FEKIIGK
H6C6Q4_EXODN/1587-1987----------ET...ET..E.....DLDFD................KAKAE......................LQDIIAQ
L8G205_PSED2/1652-2056----------DA...DE..E.....VFGFD................QGKAE......................LHEIIDL
Q23491_CAEEL/749-1101----------.....AI.............................EVMDK......................FTYLLEE
C1H4J8_PARBA/1619-2021----------HM...DE..E.....EFNFA................DGKRE......................LLEVIQL
G0WDN6_NAUDC/1191-1589----------DL...DT..L.....YLSFK................DASME......................LQNIIEE
C5DU01_ZYGRC/1141-1538----------DL...DS..H.....RMTFY................EARNE......................LISIVQE
M0UBW7_MUSAM/65-479----------QL...EDISDQKFSDADTGS..IKHWHCPWGYTVIDCILPS......................YKQLLEE
B9GZR1_POPTR/1674-2094----------SD...DDCAMSCTGEFLVSNNLDKHWHCPWGSTVVDDVAPT......................FRFILEE
K3Z105_SETIT/1078-1484----------S....EDSSIKDLGNPIGVL..DKKWQCPWGYAITDYVAPT......................FKKILDE
J3KEJ6_COCIM/1641-2042----------DD...DE..E.....TFSFD................DGKAE......................LLEIIKL
C5FSW7_ARTOC/1655-2058----------DM...DE..E.....TFSFQ................EGKAE......................LLEIIRL
B6QNB5_PENMQ/1619-2016----------NQ...DE..D.....DFTFD................WGKNE......................MKEIIAL
K7H1P7_CAEJA/245-604----------.....AS.............................ELMDK......................FTYLLEE
C5XYE8_SORBI/457-870----------QF...DDSCIKDLGNPTRVL..DKKWQCPWGYGITDYVAPI......................FRNILEE
Q6CQQ7_KLULA/1118-1516----------DL...SE..E.....VLGFE................AALDE......................LNHIISS
N1JFH1_BLUG1/1598-2001----------DA...DE..E.....VFGFE................QGRAE......................LREIVRL
H3DAQ7_TETNG/1711-2057----------PV...S..............................WMVQE......................MDEILVK
ESPL1_MOUSE/1716-2065----------PL...S..............................AVLKE......................FDAIQKD
M2R2K9_CERS8/1618-2024----------EN...VE..DE..Q.HLTFD................DALEE......................LKEIIRL
A8NBE9_COPC7/1839-2276----------DN...GG..GEDEE.HLTFE................DAMQE......................FNDIIRL
J9JSJ3_ACYPI/139-490----------.....KT........................................................IFEVLKK
K4B224_SOLLC/1600-2023----------A....DDVAEFTSSFPFEVK..DKHWHCPWVSSVIDDVAPV......................FRDILEN
J0DCK6_AURDE/1634-2046----------DE...DD..EDDEE.RLTYH................DAMAE......................LAAIIRE
W1NKX2_AMBTC/1-423----------Q....QDNWTTSVGTISNNNGSSKEWSCPWNRNVLDDVAAQ......................FRVILEE
T1K7Z5_TETUR/1001-1362----------.....DKFTR..........................NFMDE......................FYEIIQL
G0VFB3_NAUCC/1164-1562----------DL...DA..Y.....SLTFV................EAVKE......................LAYIIDE
J7RG90_KAZNA/1160-1562----------DT...HC..G.....HLSFS................AALEE......................MNTIVEE
M3HH45_CANMX/1423-1797----------DP...SF.........KTFD................VIKNE......................LEHVIRE
Q2H6Q9_CHAGB/1612-2026----------EA...DS..D.....AFDFQ................QGRSE......................LLEIIKL
S8E105_FOMPI/1678-2083----------ED...EG..DE....RLTFA................DAMDE......................LKEIMRL
Q6CCJ0_YARLI/1210-1588----------DV...DE..H.....PFLFS................DGLDE......................LKSIISE
G8YBL5_PICSO/1309-1719----------TK...SQ..K.....LTSFG................EIKSY......................LKSIISR
I1MDQ8_SOYBN/1648-2063----------C....EGDLSTGSGTSPKCEEHSEKWHCPWGFTVVDDVAPT......................FKTILEE
G7E6G1_MIXOS/1513-1914----------EN...ED..EDE...LFDFA................ACMHE......................LKSIITE
G8B5X7_CANPC/1052-1424----------RE...SV..G.....TLRFD................EMKRE......................FKRIFQE
E9ETV5_METAR/1601-2008----------DA...DA..E.....VFNFE................HGREE......................LLDIIKL
Q5KMS4_CRYNJ/188-600----------EG...DD..D.....IWTFD................AAVEE......................LETIVKA
W5GJD2_WHEAT/891-1304----------HN...EDSSIKELDNPTRAS..DKNWKCPWSCTIIDYVAPT......................FRKLLED
M3ZIW2_XIPMA/1768-2114----------TV...R..............................WLVQE......................MDSILVE
Q2USV7_ASPOR/1630-2030----------EE...DE........QFTFD................DGREE......................MQELIKL
M7TX51_BOTF1/1640-2041----------DA...DE..E.....VFGFE................QGKSE......................LINIIDL
D5GKQ4_TUBMM/1633-2033----------DD...YE..D.....RWEYE................SMLEE......................LNEIVKG
A7RYA6_NEMVE/1651-2034----------EG...TESSGNDHCEAASKA......VMDLCKLFQGSVDES......................FADVLRD
J4GX56_FIBRA/504-917----------D....TE..DN..E.HLSFH................DAMTE......................LEEILHL
K1X2E6_MARBU/1659-2061----------DA...DE..E.....VFGFE................QGHAE......................LRDIIDM
E3LM18_CAERE/731-1090----------.....AV.............................ELMDK......................FTFMLEE
I2H0Y5_TETBL/1280-1677----------DL...DA..N.....SISFK................QFKNE......................LDTIIKL
CUT1_SCHPO/1383-1770----------DA...DE..E.....ILVFT................KAQTE......................LFRIISK
A5DVQ7_LODEL/1109-1530----------RE...GI..D.....VMNFE................RLKQE......................FNRIFEE
C4QYS2_PICPG/1259-1619----------NT...............SWK................VFKDR......................FNDIIEA
S3CR95_OPHP1/1758-2208----------DA...DN..E.....VFNFQ................QGRAE......................LLEIVKA
H2B1L5_KAZAF/1161-1559----------DL...DS..L.....HLSFK................EARKE......................LQNIIDE
G1KFP0_ANOCA/1819-2167----------SL...S..............................AALSE......................LDAILEK
J3PN83_PUCT1/868-1252----------EGG..DE........LFTLK................VALEE......................LQAIVSK
V5GCB2_BYSSN/1684-2084----------EE...EE..E.....EFTFD................EGKRE......................LQDIIKL
K0K8V1_WICCF/1175-1568----------TI...DE..E.....SFSFT................DAMRD......................LNQIIQE
F0XAD9_GROCL/1636-2054----------DA...DT..E.....VFSFQ................QGRSE......................LLEIIAA
J5K578_BEAB2/1584-1996----------DA...DC..E.....VYNFE................HGKEE......................LLDIIEL
B4MLS6_DROWI/172-538----------.....TN..ERLVEVFQEYS................TLVER......................FRRVVNV
Q6FTE1_CANGA/1151-1548----------DL...DA..D.....SLTFQ................QASES......................LQKIIND
F4PZT4_DICFS/1615-2074----------NDNNESEEEEEEQDESDEEE................DEKEEEGDPEIILPFIDKLRNDIKTLTIENLANN
K2R7J5_MACPH/1619-2043----------DM...DE..E.....IFGFE................EGKAE......................LREIIDL
C7YYU1_NECH7/1580-1992----------DA...DS..E.....VFNFE................HGREE......................MLEIIRL
B4LBF1_DROVI/170-541----------.....NS..DAMASLFKAYG................TLVER......................FRRVVTV
K3Y3B2_SETIT/1404-1817----------QS...EGSSIKDLGNRMSVS..DKKWQCPWGYAITDHVAPT......................FRSILEE
G4UQF5_NEUT9/1626-2085----------DA...DN..E.....VFNYQ................QGRAE......................LLEIIRL
B9SSN4_RICCO/1627-2045----------SD...DDAPNPGSEEFPESNDLDKHWHCPWGFTVIDEVSPA......................FKLILEE
N1QAI8_MYCFI/1492-1912----------DS...EE..G.....QFHFN................AGRAE......................LQDIIQL
F4RLY9_MELLP/91-479----------EG...EE..D.....LFTLS................TALQE......................LQNIVSC
R9AIE1_WALI9/1639-2036----------EGGGEEG........AFTYM................DAMNE......................LESVIEE
G3VPI8_SARHA/1713-2063----------PL...S..............................LALGE......................FDAIQKE
R8BFS3_TOGMI/72-487----------DA...DN..E.....IFNFQ................QGRTE......................ILEVIRL
G4T5A4_PIRID/1472-1874----------EH...DE..EPE...VLPLG................SVVKE......................LDDIIAS
B0E1W0_LACBS/104-540----------DN...GD..DNDED.HLGFD................DAIGE......................LREIVRL
N1QHR1_SPHMS/1187-1599----------DD...DE..G.....LFDFE................AGKAE......................LREIIEL
C4XY11_CLAL4/1177-1564----------.......NGS.....FKSFA................DISAC......................LQRIIED
S8C8B1_DACHA/1639-2040----------SM...DE..E.....QFGFE................KGLAS......................FRDIVNR
E4ZTB4_LEPMJ/1652-2063----------EM...DE..E.....EFSFE................DGKRD......................FDEIIEL
M4DS49_BRARP/1599-2019----------SD...DDSATISSTEATQVKNLERRWLCPWGSTVVDDVAPA......................FKSILEE
F8PLA9_SERL3/1278-1688----------ET...DD..DE....HLTFD................DALNE......................LKEIIRL
V2X3W8_MONRO/1588-2040----------ES...PD..DDSEH.QLTFE................DAIEE......................FSDIIRL
B6K0I6_SCHJY/1359-1747----------DA...DE..E.....IFLFQ................SAYDE......................LQSIIDR
G5ED39_CAEEL/727-1081----------.....AV.............................ELMDK......................FTFLLDE
Q9VRN6_DROME/171-538----------.....SN..ENTANLFREYS................TLVER......................FRRVVTV
C5XSY3_SORBI/1425-1832----------QF...EDSCIKDLGNPTRVL..DKKWQCPWGYGITDDVAPI......................FRNILEE
I4YB88_WALSC/1631-2030----------EGGGEEG........AFTYR................DAIDE......................LQSIIEE
S2JJU0_MUCC1/1578-1988----------PS...DEATED....TVQYS................DAVNE......................LRAIIQG
T1FT05_HELRO/413-770----------R...................................TLLEQ......................FDWLLKE
C5DHM1_LACTC/1178-1575----------DM...DE..I.....ELSFD................NAVNE......................LTQIIKE
G0SHM3_CHATD/1723-2150----------DSSVDET..D.....VFDFH................TGRAE......................LLEIIKE
A8PX94_MALGO/1441-1824----------DA...ED..DDD...VLHVE................TVMTE......................LRQIIHS
S3D029_GLAL2/1639-2043----------DA...DE..D.....VFGFE................QGRCE......................LQEIIDL
H3B3H1_LATCH/1699-2055----------PL...S..............................SLLCK......................FDSFLEE
B4J0F9_DROGR/174-539----------.....SS..DALSDLFREYA................TLVER......................FRRVVTV
W4Y9R2_STRPU/1031-1383----------NG...GD.............................GMVNT......................LERILAE
Q4WUU6_ASPFU/1638-2039----------ED...DE..D.....QFTFE................DGRRE......................MQEIIRL
U1G8A9_ENDPU/1638-2036----------DL...DE..E.....PFRFH................TAYSE......................LGDIISN
Q6BTB7_DEBHA/1338-1753----------DG...SP........GLSFI................EMTNS......................LKSIIKQ
G7XGU8_ASPKW/1627-2026----------ED...EE..E.....QYTFE................DGKGD......................MQELIRL
F6VXN8_XENTR/1732-2080----------SI...S..............................STLQE......................FDEIQKQ
H2L8K9_ORYLA/1692-2038----------KI...H..............................QLLQE......................MDSILAE
R7YNT5_CONA1/1696-2117----------LM..DDE..D.....VFDFT................AGKVE......................LNEIIEL
I3KSG7_ORENI/1715-2061----------PI...S..............................QLVQE......................MDSILVE
F7BUI1_CALJA/1724-2073----------PL...S..............................SALSE......................FDAIQKA
U5HB45_USTV1/1850-2253----------ED...KE..EDE...GLSYA................QASAE......................LADIVAR
D8Q1W5_SCHCM/1450-1878----------DN.......DDDEE.YLSFD................DALSE......................MGEIIRL
U3IXX7_ANAPL/1332-1679----------PL...S..............................SVLSD......................FDTIQKE
N1PZ16_MYCP1/1513-1936----------EA...EQ..E.....LFLFE................DGKSE......................LEEIINL
G3AGZ6_SPAPN/1149-1535----------RV...NQPDK.....IVGFK................EIKAR......................FASIIQE
F0UL09_AJEC8/1642-2044----------EM...DE..D.....EFDFG................EGKKE......................LLEIIRL
U4LG69_PYROM/1616-2019----------DE...YS..D.....LIEYD................AAIKE......................LRDIIEK
M1WFQ9_CLAP2/1438-1889----------DA...HS..E.....VFNFE................HGREE......................LIDIIRL
G8ZWZ1_TORDC/1158-1555----------DL...DC..M.....TLTFD................DARRE......................LFNIIEK
ESP1_YEAST/1175-1571----------DL...DE..V.....HLSFP................EATKK......................LLSIINE

PF01364

KGP83_PORGN/244-595..........TN----------------------------------AS.........................IKAFIHK
D1JG83_9ARCH/891-1295..PMEA....EE----------------------------------TL.........................KESVLDY
A2U064_9FLAO/401-768..SGSK....DI----------------------------------TG.........................IRDFIKH
Q7MTE2_PORGI/239-573..........TA----------------------------------NA.........................IQQFVKQ
D3HWT0_9BACT/400-777..GGTP....DA----------------------------------AA.........................YRRYLKM
Q5S3Q9_9FLAO/543-910..TSKQ....DI----------------------------------GA.........................IRNLVRY
A9DMD5_9FLAO/555-923..TGNP....DI----------------------------------GA.........................IRNFIKY
B0VGA8_CLOAI/228-563..........ST----------------------------------QA.........................IKNYIQT
B7B5I7_9PORP/382-753..SGTP....DA----------------------------------TA.........................YRRFMKM
B8FFM0_DESAA/254-600..PATG....DD----------------------------------VS.........................IKDFLTY
A3U7G6_CROAH/540-908..SGQQ....DI----------------------------------SA.........................IRNFVKY
D2QSX9_SPILD/414-786..SGQP....DP----------------------------------TA.........................IRDMVRY
A3HW99_9BACT/398-769..YGEE....GP----------------------------------TA.........................LFEFLRT
B0VHP2_CLOAI/234-563..........TA----------------------------------AN.........................IKTYIQN
A8ZUB1_DESOH/278-656.YTGRN....DA----------------------------------ET.........................LRNFIIY
B0VIM2_CLOAI/182-528..........TV----------------------------------QD.........................IKNFIAN
Q2Z0E1_9BACT/643-1013..WGLV....DP----------------------------------SA.........................IRDYLKY
B3QXR8_CHLT3/734-1131..YGIK....SP----------------------------------HA.........................IRDFLDY
C2MCN4_9PORP/405-781..GGTP....DA----------------------------------TA.........................YRLMLWD
A4A325_9PLAN/24-399..........SK----------------------------------ER.........................IRAAIRE
A7NR84_ROSCS/499-867..DGQV....DP----------------------------------DA.........................IRAFLQF
Q11Q36_CYTH3/558-932..SGKK....DL----------------------------------TA.........................IRDFVKM
Q7MX16_PORGI/272-637NATSYI....NE----------------------------------TK.........................LKNFIRS
A0B5K7_METTP/796-1154..PGEV....EE----------------------------------WL.........................RESVGEK
D0MH89_RHOM4/586-975..GGVP....DM----------------------------------RA.........................VRDYLKF
A8UH97_9FLAO/539-910..TGSQ....DI----------------------------------AA.........................LRNFVKY
B8KYL6_9GAMM/364-704..NGIH....AP----------------------------------DA.........................LRRFVQY
B8FIK5_DESAA/1139-1542...GLD....SQ----------------------------------EK.........................IRNCIRD
Q11US7_CYTH3/392-767..YGEY....SS----------------------------------IA.........................IKRYCSE
C6W101_DYAFD/326-680..AGQP....GP----------------------------------QG.........................IRNAIRW
A5FJM8_FLAJ1/544-914..SGKQ....DI----------------------------------AA.........................IRNCIRY
Q7UG73_RHOBA/51-444..........PA----------------------------------DN.........................ASDTHQQ
A3J247_9FLAO/540-919..SGKQ....DV----------------------------------AA.........................IRNFIKY
A9WIM0_CHLAA/500-869..GGEP....DP----------------------------------RA.........................IRDFLRY
B0VHE7_CLOAI/227-554..........TN----------------------------------TN.........................IKSYIQT
C6VT06_DYAFD/394-758..YGEP....SP----------------------------------VG.........................IKRFMSY
C6X3N8_FLAB3/546-921..SGSK....DI----------------------------------TA.........................IRDFTTR
A0LQH1_SYNFM/790-1132..WGIV....TP----------------------------------YA.........................IRDFLAQ
A1ZVJ9_9BACT/406-774..SGKQ....DV----------------------------------TA.........................LRDFARM
B0VHF1_CLOAI/214-595..QGID....TQ----------------------------------DK.........................LRNYIIS
B0VIE7_CLOAI/193-598..TGTD....NA----------------------------------EK.........................LRNYLQN
C6W3P4_DYAFD/414-806..YGEP....SP----------------------------------IA.........................IRRFVDF
B2RGP6_PORG3/408-787..GGTP....DA----------------------------------TA.........................YRLFAKM
D2QJ99_SPILD/409-770..YGER....SP----------------------------------LA.........................IQQFMNQ
A9B5Q8_HERA2/466-850..SGNV....DP----------------------------------LA.........................IRDFMRY
D2QFF3_SPILD/397-745..YGEK....SP----------------------------------LA.........................LRRFADY
B0VH03_CLOAI/589-939..GGHI....DP----------------------------------AA.........................IRLALKY
D2R2P5_PIRSD/21-411..........SA----------------------------------AE.........................IRTAVRR
C6W0Z3_DYAFD/393-758..SGSS....DI----------------------------------TA.........................IRDFARN
A3XQP5_LEEBM/552-929..SGKQ....DI----------------------------------GA.........................IRNLVRY
C9RIY0_FIBSS/581-957..GGAL....SP----------------------------------IA.........................IRNYIAY
Q2PY26_9BACT/412-780..GGVQ....DL----------------------------------TA.........................IKDMMRM
Q26FX7_FLABB/537-909..EGEQ....DI----------------------------------AA.........................IRNFVKY
B0VJT2_CLOAI/236-566..........TT----------------------------------TS.........................IKNYIQT
C6BTD6_DESAD/56-402..SEAK....VV----------------------------------AG.........................IQSQVAK
D2QE53_SPILD/328-1007CGNGLKA..RDL----------------------------------AE........................LIRNFVKY
A2BK55_HYPBU/159-551GETAPEYNESLA----------------------------------AK.........................IISFLRE
B0VHP1_CLOAI/283-636..........TT----------------------------------TS.........................IKAYMQN
Q1Q1Y4_9BACT/620-970..DGIF....SP----------------------------------QA.........................IRDFLSY
C7PNY3_CHIPD/396-764..SGTP....DP----------------------------------TA.........................IRDFVKM
Q6LFY5_PHOPR/224-617..........TQ----------------------------------AQ.........................IKAYIKD
B3QVL4_CHLT3/688-1063..GGKQ....DF----------------------------------TA.........................IRDFLKF
A9B187_HERA2/552-907..DGRV....DQ----------------------------------QA.........................IADFIKY
B3C566_9BACE/537-910..SGTP....DG----------------------------------TA.........................YRRLMKM
B0VJY1_CLOAI/655-1014..AGIT....GA----------------------------------EP.........................IRDFLRY
B8G4Y1_CHLAD/584-1054IA........LV----------------------------------KN.........................IRNFEIG
A1ZEG7_9BACT/410-775..YGEY....SP----------------------------------LA.........................IKKFARY
B0VF22_CLOAI/223-583..PGVD....NA----------------------------------EK.........................LRNFIIN
A0LKV0_SYNFM/924-1265..AGVP....EP----------------------------------NA.........................LRRFLRC
A8ZTD5_DESOH/257-648..........TA----------------------------------AE.........................IQAFIQD
A9B8S0_HERA2/477-840..FGHV....SP----------------------------------MA.........................IRTFLQH
C3JBB2_9PORP/421-799..AGTP....DA----------------------------------TA.........................YRLMAKY
C9SW40_VERA1/279-917FRAGSR....DL----------------------------------QE........................VIRRFLKD
C9LI59_9BACT/509-899..SGTP....DV----------------------------------AA.........................YRRYMKM
B5ICF9_ACIB4/214-642PVNGYA....NA----------------------------------TTDPYGLLGGQALPLEKNMIIGYNYTLAKKIIAF
Y048_ARCFU/22-377LVSGYS....TE----------------------------------QVYDSYN..............YTLALKIISFLRT
A3I371_9BACT/360-725..YGNK....DI----------------------------------TG.........................IRNFIAK

PF11713

A0KHZ7_AERHH/3609-3767----------DP--------------------------------------------------------------------
Q2KX68_BORA1/2483-2627----------DL--------------------------------------------------------------------
Q2SAY5_HAHCH/1-160----------KD--------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614----------DP--------------------------------------------------------------------
Q7N726_PHOLL/2997-3151----------DP--------------------------------------------------------------------
Q7VV06_BORPE/2551-2702----------DD--------------------------------------------------------------------
Q7VV06_BORPE/2959-3112----------DA--------------------------------------------------------------------
Q7VV06_BORPE/3397-3549----------DA--------------------------------------------------------------------
Q7VV06_BORPE/3808-3959----------DT--------------------------------------------------------------------
Q189K3_PEPD6/575-754----------DK--------------------------------------------------------------------
Q189K5_PEPD6/577-756----------DD--------------------------------------------------------------------
Q7CGR6_YERPE/772-928----------DS--------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626----------DP--------------------------------------------------------------------

PF01650

VPEG_ARATH/59-330VF--------------MY--DD.IA---NNYENPRPGTIINS--------------------------------------
A0CQC7_PARTE/19-285VF--------------AY--DD.IA---QNRQNIYKGAIYNQ--------------------------------------
A2FXM6_TRIVA/13-267LM--------------CY--DD.IV---NDAENPFKGQIFRS--------------------------------------
O24539_VICNA/53-325VF--------------MY--DD.IA---YNEMNPRPGVIINH--------------------------------------
HGLB_SCHMA/37-291TM--------------MY--DD.IA---YNLMNPFPGKLFND--------------------------------------
HGLB_SCHJA/31-285TF--------------MY--DD.IA---HNKENPFPGKIFND--------------------------------------
VPE_VICSA/56-325VF--------------MY--DD.IA---SNEENPRPGVIINK--------------------------------------
A0A022P416_PSEAI/341-579LV--------------NH--RDHFG---DR...PLAT.....--------------------------------------
Q08BI0_DANRE/27-278VM--------------IY--DD.IA---NNPNNPFPGSIRSV--------------------------------------
Q0MYV8_EMIHU/33-301TL--------------AV--DD.VA---NDDMNPFPGKLFNK--------------------------------------
Q22P32_TETTS/20-285VF--------------LY--ND.VA---FDKSNPFKGKLFNK--------------------------------------
Q22P33_TETTS/20-285VF--------------LY--ND.VA---NNKQNPFKGKLFNQ--------------------------------------
D0MXB3_PHYIT/25-298LM--------------MY--DD.VA---WHESNPYRGQLYNK--------------------------------------
Q2UVF3_HAECO/29-287VM--------------MK--DD.IA---NHERNPYKGKIFND--------------------------------------
Q4K5F2_PSEF5/335-570LV--------------NH--RDHLM---NR...PMAT.....--------------------------------------
Q4RED0_TETNG/30-283VM--------------MY--DD.LA---ENRMNPTPGKLINR--------------------------------------
Q4UU48_XANC8/124-392LV--------------NH--PDNLG---ERPYAPLAT.....--------------------------------------
Q6EHZ7_TRIVA/12-258MM--------------AY--DD.IA---LSSENPFRGKVFHT--------------------------------------
N9BI26_ACIBI/229-477LV--------------NN--PD...---TRTQIPIAS.....--------------------------------------
Q6L4R2_ORYSJ/41-319VM--------------MY--DD.IA---HNPDNPRPGLIFNH--------------------------------------
Q6NYJ7_DANRE/32-288VM--------------MY--DD.LA---ESPDNPTKGVVINR--------------------------------------
Q6PRC7_IXORI/38-293VM--------------MY--DD.IA---HDPSNPTPGIIINH--------------------------------------
Q711M2_FASHE/21-278TI--------------MY--ND.VA---YSRQNPYRGKIFHD--------------------------------------
Q84LM2_ORYSJ/62-334VF--------------MY--DD.IA---HNILNPRPGTIINH--------------------------------------
Q852T1_TOBAC/49-320VF--------------MY--DD.IA---HNFENPRPGVIINS--------------------------------------
Q86TV2_HUMAN/29-286VM--------------MY--DD.IA---YSEDNPTPGIVINR--------------------------------------
Q88QE3_PSEPK/400-640LV--------------NH--RDHMA---TR...PMAT.....--------------------------------------
Q8LGK2_ARATH/46-316VF--------------MY--DD.IA---FSSENPRPGVIINK--------------------------------------
Q949L7_BETVU/51-321VF--------------MY--DD.IA---YDEENPRPGVLINS--------------------------------------
Q9LLQ4_SESIN/54-326VF--------------MY--DD.IA---MNELNPRKGVIINH--------------------------------------
Q9LWZ3_ORYSJ/41-304VM--------------MY--DD.IA---YNPENPHKGVIINK--------------------------------------
Q9SBX2_MAIZE/45-317VF--------------MY--DD.IA---HSPENPRPGVIINH--------------------------------------
Q9SMD0_SOLLC/39-316VF--------------MY--DD.IA---NNPENPRPGVIINN--------------------------------------
Q9XG75_TOBAC/40-306VF--------------MY--DD.IA---YNKNNPRPGIIINS--------------------------------------

PF00656

Q7QGM9_ANOGA/35-227KE--------------FC..QH......YRCDR...LDINEN......................................
ICENC_DROME/196-443IH--------------LF..QE.LN...FTIFP......YGN......................................
O42284_CHICK/42-279TK--------------LL..EG.LG...YNVEC......HED......................................
CAS1A_XENLA/144-382TK--------------LL..NE.LG...YQVHP......HTN......................................
CASPC_MOUSE/176-415QE--------------LL..EN.LG...YSVVL......KEN......................................
CASP4_MOUSE/132-369KG--------------LL..ED.LG...YDVVV......KEE......................................
CASP5_HUMAN/193-430KR--------------LL..QG.LG...YTVVD......EKN......................................
CASPD_BOVIN/136-373KQ--------------LL..EG.LG...YTVEV......EEK......................................
CASP1_CANFA/163-400ES--------------LL..EG.LG...YSVVV......KRK......................................
CASP1_FELCA/161-406RR--------------LL..TD.LG...YSVHI......KEE......................................
CASP1_MOUSE/162-398KL--------------LL..ED.LG...YTVKV......KEN......................................
CASP1_HUMAN/163-400TM--------------LL..QN.LG...YSVDV......KKN......................................
CASP1_PIG/163-400KI--------------LL..ED.LG...YSVDV......REN......................................
Q9I9L7_DANRE/145-379EK--------------LL..KE.LD...YQVVK......RPN......................................
Q9DDJ2_DANRE/174-400EW--------------LL..RS.LG...FAVMK......YRN......................................
Q6NTR7_XENLA/280-494EN--------------TF..KS.LR...FTVRT......DRY......................................
CFLAR_MOUSE/257-480QE--------------TF..TS.LG...YHIQL......FLF......................................
Q6QN97_PIG/259-484RD--------------TF..SS.LG...YEVQY......FLY......................................
A0A024R3Z7_HUMAN/252-477RD--------------TF..TS.LG...YEVQK......FLH......................................
Q9NBW3_DROME/38-248RK--------------TF..ES.LK...CRVEV......ISN......................................
Q9TZP5_CAEEL/26-261SK--------------LF..ER.LG...YQSTS......YDN......................................
CASPE_MOUSE/22-256ER--------------MF..RY.LK...FESTM......KRD......................................
B2CIS9_HUMAN/18-241EH--------------MF..RQ.LR...FESTM......KRD......................................
Q8I749_SUBDO/254-491TQ--------------TF..KY.LR...YKVEV......VEN......................................
CASP2_RAT/200-445VT--------------LF..KL.LG...YNVHV......LYD......................................
CASP2_CHICK/171-416EL--------------LF..KH.LG...YQVTV......FHD......................................
Q9GV89_HYDVU/93-318NS--------------FF..KGTLG...WCVKS......CNN......................................
Q9IB63_XENLA/144-396AN--------------RM..RS.FH...FEVTV......KDN......................................
CASP9_HUMAN/161-413RR--------------RF..SS.LH...FMVEV......KGD......................................
Q90WU0_CHICK/148-400EK--------------RF..RS.LC...FHVRT......LRN......................................
Q9IB64_XENLA/261-494TR--------------IF..NA.RG...YITEE......HRD......................................
Q6E5N8_ICTPU/119-362KE--------------VF..QW.LG...FNVCV......HKN......................................
Q9I8J3_DANRE/238-473AK--------------LF..SR.MH...FQIEV......RND......................................
Q6PAD9_XENLA/268-495RD--------------VF..KW.LG...LDVEI......VEN......................................
Q90WU1_CHICK/237-479RK--------------VF..SN.LH...FTVAE......YKD......................................
CASP8_HUMAN/234-476TT--------------TF..EE.LH...FEIKP......HDD......................................
CASP8_MOUSE/236-478SK--------------TF..KE.LH...FEIVS......YDD......................................
Q9Y1U6_PRIPA/173-413KN--------------LF.ISK.LG...YEVEV......HEN......................................
CED3_CAEEL/243-494TN--------------LF..RC.MG...YTVIC......KDN......................................
Q7QKT2_ANOGA/35-260QA--------------VL..SH.LQ...FDVRL......LSD......................................
Q7PZJ9_ANOGA/20-250ET--------------VL..QR.LK...CDVRT......FCD......................................
Q9GV88_HYDVU/84-316CD--------------LF..LK.LG...FKIDR......LNN......................................
Q7Q1E0_ANOGA/62-291KE--------------TL..EL.FR...FDVKV......YPD......................................
CASP1_SPOFR/61-293SK--------------VL..KT.LG...FKVTV......FPN......................................
CASP1_DROME/79-313KK--------------AF..EN.LG...FAVSV......HKD......................................
Q7Q4X6_ANOGA/73-309TA--------------SL..KG.LD...FEVHV......FKD......................................
ICE_DROME/94-328TR--------------VL..KQ.LD...FEVTV......YKD......................................
Q9NHF9_DROME/56-302EA--------------TL..QG.FG...FDVRT......FDD......................................
Q7Q803_ANOGA/54-306RQ--------------VL..IY.LQ...FEVRV......YDD......................................
Q7PV92_ANOGA/14-237ST--------------VL..QR.IG...FEVRV......MDD......................................
Q86FL0_ANOST/52-286GA--------------VL..ES.IG...FDVRV......FNN......................................
Q8I6Y2_GEOCY/158-414YG--------------LF..NW.LG...MATIR......KDN......................................
Q8ITP3_BRAFL/87-323YR--------------IF..SK.LG...FETKV......FDN......................................
O88550_RAT/68-301FK--------------CF..RS.LG...FEVTV......YND......................................
Q6DCI2_XENLA/78-314LR--------------CF..KG.LG...FDVNV......YNN......................................
Q8JIS8_ORYLA/58-285WK--------------SF..MK.LG...YEIQM......YND......................................
CASP3_XENLA/56-280HE--------------TF..TG.LG...YEVMV......CND......................................
O93417_CHICK/53-281RE--------------VF..MK.LG...YKVKL......NND......................................
Q98UI8_DANRE/48-280MN--------------VF..RK.LG...YIVKV......YND......................................
Q8JG42_TAKRU/51-279MK--------------VF..LS.LG...YKVKV......HND......................................
Q8ITP2_BRAFL/151-396KV--------------MF..EG.LG...FSVEV......LKD......................................
Q9IB66_XENLA/58-298NR--------------IL..TD.LG...FDVQN......YYN......................................
Q9I8S9_ONCMY/57-297VK--------------RF..ED.LN...FEVQA......FDN......................................
O93415_CHICK/57-299KR--------------SL..TD.LG...FEVRI......FDD......................................
CASP6_MOUSE/28-270TR--------------RF..SD.LG...FEVKC......FND......................................
PCP_DICDI/188-404YC--------------AL.....LG.CSFHSDN...IVWLID......................................
Q53839_STRCH/9-268AE--------------FF.TSP.QG...WGLPP..EHCTVVT......................................
A0A038IA40_BORBO/552-800AR--------------ELRERT.RG...LYRDV..RIELLTT......................................
Q7NPG1_GLOVI/7-278IE--------------VLKSPS.YG...LRTQQ..LRTLYDA......................................
Q87Z21_PSESM/2-224AE--------------LLENDG.NGDPNFSVIK..LVSNEQD......................................
Q82I86_STRAW/5-276AR--------------LV..TELVG...ERADL......LFL......................................
F7URG9_SYNYG/40-299GE--------------VL.TGR.YG...FDQAK..IAGLDPQ......................................
Q8YS65_NOSS1/4-245QQ--------------FL.IKE.AG...FDQVI....LFSDD......................................
Q9DDL2_DANRE/323-560TN--------------LL..RQ.LD...FKVVS......LLD......................................
Q98CE0_RHILO/5-237EA--------------AL..KK.LG...FEVIL......ETN......................................
Q6N0T4_RHOPA/30-250AD--------------DL..KR.AG...FDAEL......GED......................................
Q89XG2_BRADU/27-247AD--------------EL..KR.DG...FSVEI......GEN......................................
A0A038FP67_9BRAD/58-278SS--------------TL..RK.NG...FDVDM......VED......................................
Q6NBN5_RHOPA/57-277SA--------------SL..RH.EG...YDVDM......IED......................................
Q98JS7_RHILO/35-253AN--------------TL..TE.LK...FDVLL......FYD......................................
Q985X8_RHILO/35-256AQ--------------TL..QA.AG...FDVVG......ARD......................................
Q6N5Q1_RHOPA/33-253AQ--------------TL..QA.AG...FDVSG......ARD......................................
Q89KP2_BRADU/86-307AQ--------------TL..QA.AG...FDVVG......ARD......................................
Q89IK1_BRADU/30-253AS--------------SL..RR.SG...FEVLQ......GID......................................
Q98G71_RHILO/26-252AD--------------KL..RS.IG...FEVIE......GND......................................
Q6AKF4_DESPS/28-248SR--------------TL..SA.LG...FETII......KVN......................................
Q98IJ6_RHILO/11-238AE--------------RL..QN.LG...FEVVS......GFD......................................
Q89MV1_BRADU/176-400AE--------------TL..ST.LG...FTLVG...GRAQLD......................................
Q89HT8_BRADU/51-272AK--------------FL..NS.AG...FEVVA......ATD......................................
Q89FZ4_BRADU/32-256TE--------------LL..GN.AG...FTVTT......AAN......................................
Q6N329_RHOPA/73-298AA--------------LL..GE.AG...FEVTE......ASD......................................
Q98IJ9_RHILO/30-261AS--------------TL..RN.AG...FDVIE......GVD......................................
Q89HP3_BRADU/336-569AK--------------SL..RD.IG...FTVSE......GVD......................................
Q7RFI8_PLAYO/964-1364SR--------------AL.VKY.FN...FLPEN..ILLLIDSFPSNAYIYDDFDMNRTKYINEKNNYTYNEEKKEKKYLF
D7AGH8_GEOSK/6-270AA--------------IA.AER..G...FAVTT..LMTKA........................................
MCA9_ARATH/10-321KE--------------TI.LSR.FG...FKQDD..IEVLTDE......................................
MCA8_ARATH/3-378QK--------------CL.IEL.YG...FANKD..IVIMIDT......................................
MCA7_ARATH/3-401HK--------------CL.VDR.FG...FAEEDITVLIDTDE......................................
Q70VV0_PICAB/3-415YK--------------CL.VER.YG...FEEENIRVLIDTDD......................................
Q9ZSP8_HEVBR/3-415YR--------------CL.VDR.YG...FSEEDITVLIDIDE......................................
MCA4_ARATH/3-416YK--------------CL.VER.YG...FSEENITVLIDTDE......................................
MCA5_ARATH/3-408HK--------------SL.VDR.FG...FSERNITELIDTDE......................................
MCA6_ARATH/3-366RI--------------SL.VER.YG...FSEENIKMLIDTDS......................................
MCA1_ARATH/80-362RH--------------LL.INK.FK...FSPDS..ILMLTEE......................................
MCA2_ARATH/116-414KF--------------ML.MKR.FQ...FPESC..ILMLTEE......................................
MCA1_SCHPO/130-422SQ--------------LL.IQR.YG...YKQED..MVIMTDT......................................
MCA1_YARLI/168-458QR--------------YL.VQR.AG...YKPDD..MVILTDD......................................
MCA1_DEBHA/146-437SN--------------FL.NQH.FG...YSYDD..MVILTDD......................................
M9MZN6_ASHG1/154-449KN--------------FL.ISR.YG...YREEN..MVILTDD......................................
MCA1_KLULA/138-430FN--------------FL.TQR.YG...YKAED..IVMLNDD......................................
MCA1_CANGA/98-389FN--------------YL.TTY.CG...YRPED..IVMLTDD......................................
B5VS82_YEAS6/157-450FN--------------FL.TNG.YG...YSSDD..IVILTDD......................................
D0A6D7_TRYB9/84-341AG--------------TM..EK.IG...IPITERCVLMDTDD......................................
Q38D34_TRYB2/63-322LQ--------------TL..QR.IE...FPISE..CCILVDD......................................
Q8T8E6_9TRYP/84-343LA--------------TL..QK.KG...LPINE..AVILVDE......................................

PF14538

W1QFK7_OGAPD/56-210QS..............NY--ESCEG---VSSRI..KYKQSLD--------------------------------------
L8WVZ0_THACA/73-224QH..............QF--EN...---LNPRM..NYKPYLD--------------------------------------
A2EZ34_TRIVA/89-236QD..............YM--HE.KY---SNYRKVLRMFFQVA--------------------------------------
Q6C6R4_YARLI/86-238QM..............QY--EV...---LSMRT..RYKQSLD--------------------------------------
M2WI96_MYCP1/172-328QS..............QY--EN...---LSLRT..RYKVILD--------------------------------------
K2S4T3_MACPH/104-258QT..............QY--EQ...---LSMRT..RYKLCLD--------------------------------------
C4LXC3_ENTHI/42-194GI..............QY--QR..Y---CTPTV..STEGLWD--------------------------------------
T1G0Q6_HELRO/62-216QK..............QY--ER...---WQPKA..RYKLSLD--------------------------------------
B0CNS4_LACBS/34-185QH..............QF--EG...---LSLKI..GYKYILD--------------------------------------
F0ZAV4_DICPU/115-266QA..............QY--EK...---WQSKA..RYKQCLD--------------------------------------
U9UGJ5_RHIID/52-203QA..............QY--EQ...---LSIRT..RYRQYLD--------------------------------------
Q5KIS3_CRYNJ/92-243HQ..............QF--ET...---LNPKV..KYKAFLD--------------------------------------
B0WBU4_CULQU/30-181RSERRHFQSFDREHSHYF--RS...---.......RFRSLPD--------------------------------------
A5DWK2_LODEL/143-295QS..............QY--ET...---LSLRT..RYKQSLD--------------------------------------
G0VGR8_NAUCC/79-231QS..............QY--ET...---LSLRC..RYKQSLD--------------------------------------
I3J5N7_ORENI/57-208QK..............QY--EN...---WQPRA..RYKQSLD--------------------------------------
A2DYM2_TRIVA/68-215QE..............YF--HD.KY---VSIKKQLRFFFQVA--------------------------------------
D8TLK8_VOLCA/11-162QA..............QY--ER...---WQPRA..KYKMHLD--------------------------------------
G4M000_SCHMA/43-194QA..............QY--ER...---WQPRA..RYKQCLD--------------------------------------
C1MUE6_MICPC/45-196QA..............QY--ER...---WQPRA..KYKLQLD--------------------------------------
Q387I9_TRYB2/89-240QR..............QY--HS...---..QLQGAVSSMAVE--------------------------------------
C4M2F5_ENTHI/38-189TD..............QY--RS...---WQNGS..KIEPCCD--------------------------------------
G4TT65_PIRID/72-223CQ..............QF--QS...---LNPRI..KYKPFLD--------------------------------------
G0NWW0_CAEBE/64-218QR..............AY--EK...---WQPKSKTRYKICCD--------------------------------------
A2DJF0_TRIVA/83-228QG..............FF--PSQYF---KHAKW..STQTSRS--------------------------------------
K3WJU9_PYTUL/84-235QS..............QY--ER...---WQARA..RYRQCLD--------------------------------------
A2G590_TRIVA/30-180QD..............LY--SA...---...SMKCPAEIFVD--------------------------------------
B8M6V6_TALSN/189-342QE..............QY--EN...---LSLRT..RYKQYLD--------------------------------------
A2FJN8_TRIVA/41-191QN..............LY--MN...---...SLKCSADIVVD--------------------------------------
A2DLR3_TRIVA/97-242QT..............CY--RS.LY---LHLRQHLVFSYVIG--------------------------------------
E5SIN8_TRISP/44-195QR..............QY--QW...---WQPRA..RYKQALD--------------------------------------
I1G727_AMPQE/53-204QK..............QY--ER...---WQPRA..RYKQLLD--------------------------------------
U1MN31_ASCSU/95-246QK..............NY--ER...---WQPRA..RYKNAND--------------------------------------
I1L744_SOYBN/123-274SS..............QY--ER...---WQPKA..RYKCQLD--------------------------------------
E4XFS5_OIKDI/48-228QDTLKSNFIELAPRVLQT--NTFNW---KQLHHSDAYKQKIF--------------------------------------
D2VMD1_NAEGR/144-294KL..............QY--ER...---WQPRA..RYKQCLD--------------------------------------
A9TBL2_PHYPA/91-242QT..............QY--ER...---WQPRA..RYKVSLD--------------------------------------
B7PLB3_IXOSC/92-247QK..............QY--ER...---WQSRA..RYKLSLD--------------------------------------
E9CIT6_CAPO3/727-878EQ..............QY--SR...---WQNKA..RYKPSLD--------------------------------------
B8CBK6_THAPS/256-409EQ..............QY--AK...---WQQRSKLKYRRAID--------------------------------------
A4I1A2_LEIIN/114-279ER..............QY--RS...---.VLRDDVGVMRVVE--------------------------------------
F4RLY3_MELLP/215-367QD..............QF--ESLAP---PHARV..KFKTYPD--------------------------------------
K4DUJ2_TRYCR/62-218ER..............QY--RS...---..QQRDAVFKRAVD--------------------------------------
H1VVG4_COLHI/158-309QA..............QY--ET...---LAIRT..RYKQYLD--------------------------------------
M7XEP3_RHOT1/113-265QQ..............QF--ENLA.---ATPKT..RYKQYLD--------------------------------------
A2GCD5_TRIVA/98-247QT..............YF--KN.TY---HQIRQKIRFFFSIA--------------------------------------
D8RG53_SELML/72-223QS..............QY--AL...---WQPRA..RYKLALD--------------------------------------
A2F9H3_TRIVA/31-181ED..............MY--NN...---...AIKCPCDFAVD--------------------------------------
L0PHF8_PNEJ8/131-282QQ..............QY--ET...---LSMRT..RYKQYLD--------------------------------------
RTOR2_ARATH/94-246SI..............QY--ER...---WLARA..RYKVELD--------------------------------------
M5E8T5_MALS4/58-209QV..............QF--ET...---LSMKT..RYKQYLD--------------------------------------
B3RPQ9_TRIAD/43-194QK..............QY--ER...---WQPKA..RYKQSLD--------------------------------------
I4Y9Q8_WALSC/76-227QQ..............RF--ES...---LSQRT..RVKQYLD--------------------------------------
A2E4G0_TRIVA/101-242YS..............VY--KS.AY---QNLRNQIRFAANCP--------------------------------------
U6ISX1_HYMMI/269-417QS..............QY--ER...---WQPKG..CYRQCLD--------------------------------------
U4LGP0_PYROM/223-374QI..............QY--ET...---LSIRT..RYKQYLD--------------------------------------
A2F8U1_TRIVA/65-210VT..............QY--QQ...---CMPKM..ALAARVN--------------------------------------
D8T9J0_SELML/50-197QS..............QY--KR...---WQPKA..LYNLRLD--------------------------------------
A9V5A2_MONBE/628-777TS..............QY--LR...---WQPKA..KFRQAPD--------------------------------------
F0XXV0_AURAN/12-164QA..............QY--ER...---WQSRA..RYRQLLD--------------------------------------
A2E336_TRIVA/54-202SD..............IF--PR...---.......HSIISNE--------------------------------------
B4R5C8_DROSI/214-365QM..............QY--ER...---WQPRA..RYKKCND--------------------------------------
J4H2X1_FIBRA/92-243AH..............QF--EG...---LSPKI..TFKPLLD--------------------------------------
A2EU18_TRIVA/81-227QK..............FF--KA.GY---KIRNYKPTFYSMLN--------------------------------------
A2DYB3_TRIVA/12-162QD..............VY--RA...---...AIQCPCEMIVD--------------------------------------
S2KE38_MUCC1/106-257HN..............QY--ET...---INGRT..RFKLSLD--------------------------------------
G7E3R0_MIXOS/173-325QL..............QY--ENLA.---GTSKT..RYKFYPD--------------------------------------

PF03415

Q8A866_BACTN/37-399RK------------------DKDVV---VQDVIATYDAQ.NS--------------------------------------
Q9WZB1_THEMA/121-462DE------------------SGNF.---.QAVVGTMGIDFNS--------------------------------------
Q8XM44_CLOPE/59-508SG------------------KSEF.---.PEITTTSNYEANM--------------------------------------
Q9X1S5_THEMA/586-937NE------------------EGEW.---.EG..GPADAEIDS--------------------------------------
Q9WYY6_THEMA/5-301EE------------------.....---.GLIPLETFDEINS--------------------------------------
Q8TIY6_METAC/66-593SE------------------DGVIG---NEEIHRRAYPHANM--------------------------------------

PF13900

F6VPI7_MACMU/1-48QP------------------------------------------------------------------------------
H2P8I3_PONAB/10-56QP------------------------------------------------------------------------------
F7H1D9_MACMU/6-53QP------------------------------------------------------------------------------
F7HNL8_MACMU/6-53QP------------------------------------------------------------------------------
F6ZY08_MACMU/15-62QP------------------------------------------------------------------------------
C9JL97_HUMAN/112-159QP------------------------------------------------------------------------------
F7HUC2_MACMU/8-55QP------------------------------------------------------------------------------
F7E5F2_MACMU/5-52QP------------------------------------------------------------------------------
H2PFS8_PONAB/309-356QP------------------------------------------------------------------------------
H9KYL1_CALJA/1-48QP------------------------------------------------------------------------------
F7H0L3_MACMU/5-52QP------------------------------------------------------------------------------
F6X1U8_MACMU/6-53QA------------------------------------------------------------------------------
F7GV92_MACMU/20-67QP------------------------------------------------------------------------------
F7GPL2_MACMU/68-115QA------------------------------------------------------------------------------
F8WCX3_HUMAN/9-56QL------------------------------------------------------------------------------
G1QLW6_NOMLE/814-862QP------------------------------------------------------------------------------
F7H7M8_MACMU/103-150QP------------------------------------------------------------------------------
F7HJ06_MACMU/6-53QP------------------------------------------------------------------------------
F7GKP6_MACMU/5-52QL------------------------------------------------------------------------------
F7BBK8_MACMU/3-51QT------------------------------------------------------------------------------
F7BBH6_MACMU/6-53QP------------------------------------------------------------------------------
F7H0K2_MACMU/5-52HP------------------------------------------------------------------------------
F7FTH6_MACMU/13-60QP------------------------------------------------------------------------------
F6Y5H5_MACMU/6-53QA------------------------------------------------------------------------------
F7IGY2_CALJA/5-52QP------------------------------------------------------------------------------
F7F1B5_MACMU/6-53RL------------------------------------------------------------------------------
F6ZIE8_MACMU/13-60QP------------------------------------------------------------------------------
H7C2Z3_HUMAN/35-82QP------------------------------------------------------------------------------
F6Q4C2_MACMU/10-57QP------------------------------------------------------------------------------
F6WIB8_MACMU/57-104QL------------------------------------------------------------------------------
F6RPD7_MACMU/5-52QP------------------------------------------------------------------------------
F7AN02_MACMU/1-48QP------------------------------------------------------------------------------
F6UHP4_MACMU/22-69QP------------------------------------------------------------------------------
F6QIB6_MACMU/6-53QT------------------------------------------------------------------------------
F7INS6_CALJA/10-56QP------------------------------------------------------------------------------
F7DA23_MACMU/81-128KP------------------------------------------------------------------------------
G3S992_GORGO/2-49QP------------------------------------------------------------------------------
F7GMK7_MACMU/6-53QP------------------------------------------------------------------------------
F7BBW7_MACMU/19-66QP------------------------------------------------------------------------------
G7P901_MACFA/6-53QC------------------------------------------------------------------------------
F6VUI9_CALJA/8-55QP------------------------------------------------------------------------------
F7HNT1_MACMU/10-57QP------------------------------------------------------------------------------
H2PFT0_PONAB/200-246QP------------------------------------------------------------------------------
F7BEX5_MACMU/6-53QP------------------------------------------------------------------------------
F7IH17_CALJA/8-55QT------------------------------------------------------------------------------
F7CY78_MACMU/1-49QP------------------------------------------------------------------------------
F6QIR0_MACMU/9-56QS------------------------------------------------------------------------------
E9PIS2_HUMAN/138-185QP------------------------------------------------------------------------------
G7P0P9_MACFA/3-50QP------------------------------------------------------------------------------
F8WCK5_HUMAN/303-350QS------------------------------------------------------------------------------
F7A4Y6_MACMU/6-53QP------------------------------------------------------------------------------
F5H189_HUMAN/75-122QP------------------------------------------------------------------------------
F7GMG4_MACMU/12-59QP------------------------------------------------------------------------------
F7EDZ5_MACMU/6-53QP------------------------------------------------------------------------------
H2NMK9_PONAB/15-62QA------------------------------------------------------------------------------
F7GNA8_MACMU/17-64QP------------------------------------------------------------------------------
M0QYB7_HUMAN/5-52QP------------------------------------------------------------------------------
F7GHR0_MACMU/69-116QA------------------------------------------------------------------------------
F6TK80_MACMU/14-61QP------------------------------------------------------------------------------
F7HQG2_MACMU/6-51HA------------------------------------------------------------------------------
F7HL81_MACMU/1-48QP------------------------------------------------------------------------------
G3S4W3_GORGO/73-116..------------------------------------------------------------------------------
G7PKJ6_MACFA/16-62QP------------------------------------------------------------------------------
F7CF12_MACMU/16-63QP------------------------------------------------------------------------------
F7H314_MACMU/5-52QP------------------------------------------------------------------------------
F7GNJ7_MACMU/23-70QP------------------------------------------------------------------------------
F7H7L6_MACMU/21-68QP------------------------------------------------------------------------------
H2PFS9_PONAB/301-348QP------------------------------------------------------------------------------
F6QZW4_MACMU/4-51QP------------------------------------------------------------------------------
F6VSA3_MACMU/58-105QP------------------------------------------------------------------------------
F7GWG7_MACMU/6-53QL------------------------------------------------------------------------------
G8F501_MACFA/41-88QP------------------------------------------------------------------------------
H2PCJ4_PONAB/71-117QC------------------------------------------------------------------------------
F7GRV2_MACMU/10-57QP------------------------------------------------------------------------------
F7DN54_MACMU/18-65QP------------------------------------------------------------------------------
F7C2M9_MACMU/203-250QP------------------------------------------------------------------------------
F6UHM5_MACMU/4-51QP------------------------------------------------------------------------------
F7E6B4_MACMU/16-63QP------------------------------------------------------------------------------
F6RPF6_MACMU/5-52QP------------------------------------------------------------------------------
F6T9Z0_MACMU/31-78QP------------------------------------------------------------------------------
F7D1W6_MACMU/11-57QP------------------------------------------------------------------------------
F6UMN3_MACMU/5-52QP------------------------------------------------------------------------------
K7EME6_HUMAN/91-138QP------------------------------------------------------------------------------
F8WD42_HUMAN/7-54QP------------------------------------------------------------------------------
H2PFS8_PONAB/209-255QP------------------------------------------------------------------------------
F6W1Z8_MACMU/11-58QP------------------------------------------------------------------------------
F7ILB0_CALJA/1-48QP------------------------------------------------------------------------------
F6VHU0_MACMU/21-68QL------------------------------------------------------------------------------
F6WI78_MACMU/73-120QP------------------------------------------------------------------------------
H7BZB2_HUMAN/19-65TT------------------------------------------------------------------------------
F6ZI73_MACMU/64-111QA------------------------------------------------------------------------------
F6Z663_MACMU/5-53QP------------------------------------------------------------------------------
F7AS31_MACMU/5-53QP------------------------------------------------------------------------------
F6VXW3_MACMU/74-121QP------------------------------------------------------------------------------
F6RES6_MACMU/10-57QP------------------------------------------------------------------------------
F6SY12_MACMU/53-100QP------------------------------------------------------------------------------
F6Y1U7_MACMU/8-55QP------------------------------------------------------------------------------
F6RRM6_MACMU/17-64QA------------------------------------------------------------------------------
F7AVL2_CALJA/49-96QP------------------------------------------------------------------------------
F7HXT7_CALJA/4-48QP------------------------------------------------------------------------------
F6ZZ11_MACMU/5-52QA------------------------------------------------------------------------------
F7GGU7_MACMU/13-60QP------------------------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921PT------------------G......SLYTIPFE----M..--------------------------------------
A0LQE8_SYNFM/635-947LD------------------G......ALRYIPFS----C..--------------------------------------
A0YK41_LYNSP/3523-3818MD------------------E......GLRSLPLA----A..--------------------------------------
A0YW51_LYNSP/1488-1787MD------------------T......GLRTLPIA----A..--------------------------------------
A0YZ16_LYNSP/128-434TG------------------P......GLRTLPLG----V..--------------------------------------
A1BCK0_CHLPD/513-826PQ------------------G......GSGVFPVH----AAW--------------------------------------
A1BEL3_CHLPD/43-361SD------------------I.....PAILQLPWE----M..--------------------------------------
A1BEL6_CHLPD/46-364SD------------------D.....PAILQLPWE----T..--------------------------------------
A3WDM2_9SPHN/678-1006PD------------------G......PMLQLPPQ----V..--------------------------------------
A4HBL7_LEIBR/1053-1432PS------------------G......QMWLVPFH----A..--------------------------------------
A8L4T6_FRASN/741-1051PG------------------G......LLGSAPLH----AAR--------------------------------------
A8YIK9_MICAE/645-974PD------------------A......ALNLIPFE----A..--------------------------------------
A9WBC0_CHLAA/673-929PC------------------A......PIHLAPFA----A..--------------------------------------
A9WER9_CHLAA/54-394PQ------------------D.....AELQAIPWE----LLH--------------------------------------
A9WF91_CHLAA/60-360PS------------------A.....AELHALRWE----TLC--------------------------------------
B0C874_ACAM1/207-507MD------------------A......GLRSLPLA----A..--------------------------------------
B2IXC0_NOSP7/1396-1691PD------------------M......GLRSTPMA----A..--------------------------------------
B2IZZ4_NOSP7/695-973PD------------------D......ILHGFPFA----A..--------------------------------------
B2JAK0_NOSP7/526-830TD------------------N......TLDFIPFS----A..--------------------------------------
B2JAM9_NOSP7/866-1190GD------------------G......ILQYIPFA----A..--------------------------------------
B3QB04_RHOPT/774-1131TN------------------G......ALGLLPLS----LLP--------------------------------------
B4JKU3_DROGR/1402-1700LD------------------S......ALYLVPFA----I..--------------------------------------
B4VHH6_9CYAN/1150-1443MD------------------A......GLRTIPMP----V..--------------------------------------
B4VJ14_9CYAN/646-949PD------------------G......ALSLIPFE----A..--------------------------------------
B4VJ30_9CYAN/3784-4081MD------------------S......GLRSLPVA----A..--------------------------------------
B4VLG1_9CYAN/97-405LK------------------G.....NRLPRLPWE----V..--------------------------------------
B4VLY5_9CYAN/1558-1850MD------------------G......GLRSIPLL----A..--------------------------------------
B4VPE9_9CYAN/1179-1471MD------------------Q......GLRSLPVA----A..--------------------------------------
B4VQD3_9CYAN/1443-1735MD------------------E......GLRSLPVA----A..--------------------------------------
B4VQK8_9CYAN/1658-1953LD------------------E......GLRSLPIA----A..--------------------------------------
B4VTQ2_9CYAN/1746-2036MD------------------R......GLRSMPVA----A..--------------------------------------
B4VXN8_9CYAN/1368-1663MD------------------S......GLRSLPIA----A..--------------------------------------
B4VXQ8_9CYAN/1752-2046MD------------------A......GLRTIPMA----A..--------------------------------------
B4VYA5_9CYAN/647-942MD------------------G......GLRQLPMA----A..--------------------------------------
B4WMI9_9SYNE/695-1035PD------------------S......QLNLIPFD----A..--------------------------------------
B6C3H2_9GAMM/45-361TH------------------G......GLHLLPLE----AAP--------------------------------------
B8G8X7_CHLAD/58-398PQ------------------D.....AILQAIPWE----LLY--------------------------------------
B8GD94_CHLAD/102-415AA------------------AD....VALASLPWE----L..--------------------------------------
C3Z401_BRAFL/1278-1602LD------------------G......DLYLVPFA----V..--------------------------------------
F0SR63_PLABD/137-574PS------------------P......LLQQIPLE----V..--------------------------------------
F7UL61_SYNYG/155-456LG------------------N......GVRGLPMA----A..--------------------------------------
F7ULD2_SYNYG/1449-1747LD------------------R......GLRSLPMA----T..--------------------------------------
F7UQF5_SYNYG/591-904PD------------------G......VLQYLPFG----ALV--------------------------------------
Q01RE6_SOLUE/865-1136PD------------------D......WLSLLPFR----A..--------------------------------------
Q024J7_SOLUE/541-814PD------------------G......ALHGLNFE----SLP--------------------------------------
Q025F1_SOLUE/607-877PD------------------G......VLWNLPFQ----A..--------------------------------------
Q028B5_SOLUE/667-935PD------------------G......FLWQLPFQ----A..--------------------------------------
Q02DA1_SOLUE/510-786PD------------------G......PVGTIPIQ----A..--------------------------------------
Q10YT7_TRIEI/1003-1309PD------------------S......NLNLIPFE----A..--------------------------------------
Q10YU6_TRIEI/544-838LE------------------G......NLRNIPMS----V..--------------------------------------
Q112V9_TRIEI/62-390LE------------------INEEAMPEVVAYPWE----LMC--------------------------------------
Q113D1_TRIEI/130-430ND------------------R......TTFEIPWE----MLE--------------------------------------
Q113U8_TRIEI/3002-3297MS------------------E......SLRALPVA----A..--------------------------------------
Q115J8_TRIEI/1466-1777PH------------------S......FLHFLPLH----ILP--------------------------------------
Q117G6_TRIEI/881-1206PD------------------S......HLNLIPFE----A..--------------------------------------
Q119J2_TRIEI/1474-1770MD------------------S......GLRTIPIA----A..--------------------------------------
Q16H64_AEDAE/1315-1614LE------------------K......ELYLVPFA----I..--------------------------------------
Q2G6U6_NOVAD/692-1020PD------------------G......AMLQLPPT----V..--------------------------------------
Q2S6G2_SALRD/540-844PD------------------G......PMFHVPFS----MLA--------------------------------------
Q2W535_MAGSA/875-1218PD------------------G......MLNIAPIS----A..--------------------------------------
Q38C46_TRYB2/1044-1397PT------------------D......GLWLVPFN----A..--------------------------------------
Q3AQG5_CHLCH/44-362SN------------------D.....AAIQQLPWE----T..--------------------------------------
Q4C5K3_CROWT/405-717PH------------------Q......YLHIFPIH----A..--------------------------------------
Q4S217_TETNG/1205-1537LE------------------G......ELYLIPFA----L..--------------------------------------
F7URX2_SYNYG/165-457VG------------------P......KLRSLPFA----A..--------------------------------------
Q5LLA3_RUEPO/680-970FT------------------SM...IHWVFDMPWE----F..--------------------------------------
Q64CV3_9ARCH/59-374AE------------------G......PASNLPFE----L..--------------------------------------
Q7NCT1_GLOVI/600-923PD------------------G......QLNTLPFA----A..--------------------------------------
Q7NF67_GLOVI/550-854PD------------------G......ALNLIPFA----A..--------------------------------------
Q7NFD7_GLOVI/666-979PD------------------G......QLHTLPFG----V..--------------------------------------
Q7NIF7_GLOVI/691-997PD------------------A......QLNLLPFG----A..--------------------------------------
Q7NJE3_GLOVI/660-988PD------------------G......QLNTMPFA----A..--------------------------------------
Q7NLR0_GLOVI/653-961PD------------------G......LLNLLPIA----A..--------------------------------------
Q7NVB0_CHRVO/67-386LS------------------A.....AELALLPFE----L..--------------------------------------
Q82I85_STRAW/1175-1481PM------------------G......ALGLVPWH----AAW--------------------------------------
Q82L10_STRAW/969-1256PS------------------G......VLNSFPLH----AAG--------------------------------------
Q8DGG5_THEEB/541-835PD------------------G......ELNTIPFQ----A..--------------------------------------
Q8DH74_THEEB/570-891PD------------------G......QLNTLSFE----A..--------------------------------------
Q8DHI1_THEEB/67-394LG------------------T......WLNRTRIN----F..--------------------------------------
Q8DIE5_THEEB/1127-1420LD------------------S......GMRGIPVA----A..--------------------------------------
Q8YZU5_NOSS1/56-340QD------------------G......FLRDVPMA----A..--------------------------------------
TTC28_HUMAN/1390-1713LE------------------G......ELYLIPFA----L..--------------------------------------

PF03568

T1IUX7_STRMM/1624-1980NR------------------D------TMKS....----...--------------------------------------
G8BT64_TETPH/1165-1563SN------------------R------STSLEVTS----NVS--------------------------------------
S6EFD3_ZYGB2/1145-1542NN------------------R------STSIEVTS----AIK--------------------------------------
Q2LZN6_DROPS/172-538DP------------------L------NVKS....----...--------------------------------------
A5DNR9_PICGU/1178-1576SN------------------K------STQVTTTS----QIK--------------------------------------
H2VRL7_CAEJA/706-1062DE------------------L------ICSC....----...--------------------------------------
G4N8I2_MAGO7/1627-2057AN------------------A------SCHD.A.R----DMS--------------------------------------
J3P7L5_GAGT3/1606-2054AD------------------G------SAHR.A.K----DMA--------------------------------------
Q6ZHH8_ORYSJ/455-870NF------------------I------SLSSATLT----LND--------------------------------------
G3N6G2_GASAC/1731-2077QK------------------L------VSSV....----...--------------------------------------
I7LUG5_TETTS/2027-2414NE------------------S------DMRN...D----EKK--------------------------------------
M7T4Q8_EUTLA/44-499AN------------------R------TCHD.A.R----DMS--------------------------------------
A3GFF5_PICST/1168-1555SD------------------L------STKSSTTS----KIH--------------------------------------
N4UZ87_COLOR/1637-2043TN------------------E------SCHS.A.R----TYT--------------------------------------
Q5A8X8_CANAL/1101-1536SN------------------L------STKRKTTS----KIL--------------------------------------
W1QIM9_OGAPD/1167-1527SD------------------R------TTRIEVTS----LVK--------------------------------------
Q75EJ0_ASHGO/1152-1552NN------------------R------TTSIEVTS----VIK--------------------------------------
C5MEH0_CANTT/925-1303SN------------------L------STKKATTS----KII--------------------------------------
M7XLD2_RHOT1/1703-2100NN------------------S------GAQNAKLV----D..--------------------------------------
G0RRT6_HYPJQ/1566-1971AN------------------E------SSHS.A.R----DFT--------------------------------------
BIMB_EMENI/1609-2004AN------------------E------SAHA.A.K----LQV--------------------------------------
G3B782_CANTC/1213-1609SD------------------D------SIKPQTTS----KIR--------------------------------------
G2X6M8_VERDV/1704-2113IN------------------E------SCHDEG.R----DWS--------------------------------------
S8BGE7_PENO1/1622-2018AN------------------Q------SAHA.A.K----AQT--------------------------------------
G2R9B0_THITE/1619-2058VN------------------K------TCHD.S.R----DMT--------------------------------------
B6GZP8_PENCW/1602-1998AN------------------E------SAHA.A.K----AQT--------------------------------------
K5WME3_PHACS/1732-2136SD------------------E------GTRQAQHV----TK.--------------------------------------
ESP1_ARATH/1641-2060SH------------------S------SSST...T----EED--------------------------------------
M7PDE3_PNEMU/1489-1882SN------------------E------TAQI.A.K----NIS--------------------------------------
S9X830_SCHCR/1385-1771SN------------------E------TAQN.G.K----DYT--------------------------------------
H6C6Q4_EXODN/1587-1987AN------------------S------SSHD.PRG----CSA--------------------------------------
L8G205_PSED2/1652-2056AN------------------A------SAHG.G.R----DVS--------------------------------------
Q23491_CAEEL/749-1101DR------------------Q------IVSN....----...--------------------------------------
C1H4J8_PARBA/1619-2021AN------------------K------SAHD.A.K----ARV--------------------------------------
G0WDN6_NAUDC/1191-1589SN------------------R------STSFEVTN----LIK--------------------------------------
C5DU01_ZYGRC/1141-1538SN------------------A------TTSAEVTS----AIK--------------------------------------
M0UBW7_MUSAM/65-479NF------------------L------LLSNTTFA----AAD--------------------------------------
B9GZR1_POPTR/1674-2094NY------------------.------.LSSSKFP----LED--------------------------------------
K3Z105_SETIT/1078-1484NF------------------V------SLSSATLT----IND--------------------------------------
J3KEJ6_COCIM/1641-2042AN------------------R------SAHD.T.R----ARV--------------------------------------
C5FSW7_ARTOC/1655-2058AN------------------A------SAHN.T.G----SYV--------------------------------------
B6QNB5_PENMQ/1619-2016AN------------------A------SAHD.A.K----TRI--------------------------------------
K7H1P7_CAEJA/245-604DE------------------R------IAKF....----...--------------------------------------
C5XYE8_SORBI/457-870NF------------------M------SLSSASLT----FND--------------------------------------
Q6CQQ7_KLULA/1118-1516NN------------------C------TTSIEVTS----VIT--------------------------------------
N1JFH1_BLUG1/1598-2001AN------------------E------SAHD.A.G----NRT--------------------------------------
H3DAQ7_TETNG/1711-2057QK------------------V------VSCV....----...--------------------------------------
ESPL1_MOUSE/1716-2065QK------------------E------NSSC....----...--------------------------------------
M2R2K9_CERS8/1618-2024SD------------------E------GTRQAANV----HKD--------------------------------------
A8NBE9_COPC7/1839-2276SD------------------E------GTKSAIHV----RSD--------------------------------------
J9JSJ3_ACYPI/139-490SL------------------E------DTND....----...--------------------------------------
K4B224_SOLLC/1600-2023NY------------------.------.LSSSVHL----LED--------------------------------------
J0DCK6_AURDE/1634-2046SN------------------E------ATARGQGT----QGM--------------------------------------
W1NKX2_AMBTC/1-423NF------------------.------.LSSSTLF----SVD--------------------------------------
T1K7Z5_TETUR/1001-1362SN------------------A------SIRK....----...--------------------------------------
G0VFB3_NAUCC/1164-1562SN------------------S------TTSVEVTS----SIK--------------------------------------
J7RG90_KAZNA/1160-1562NN------------------K------TTSTEVTT----QIT--------------------------------------
M3HH45_CANMX/1423-1797SN------------------L------STKKAVTS----KVV--------------------------------------
Q2H6Q9_CHAGB/1612-2026IN------------------K------TCHD.S.R----DMT--------------------------------------
S8E105_FOMPI/1678-2083ND------------------E------GTRGAASV----KKN--------------------------------------
Q6CCJ0_YARLI/1210-1588SD------------------T------MTRT.G..----.TA--------------------------------------
G8YBL5_PICSO/1309-1719SN------------------S------TTSPEMTS----QVQ--------------------------------------
I1MDQ8_SOYBN/1648-2063NY------------------L------STKS...P----LED--------------------------------------
G7E6G1_MIXOS/1513-1914AN------------------A------TAQAAKTV----D..--------------------------------------
G8B5X7_CANPC/1052-1424NR------------------K------STLYSTTS----LVK--------------------------------------
E9ETV5_METAR/1601-2008AN------------------E------TSHS.A.R----DFS--------------------------------------
Q5KMS4_CRYNJ/188-600SN------------------E------GARRAKHI----T..--------------------------------------
W5GJD2_WHEAT/891-1304NF------------------R------SLSGAIDI----PKD--------------------------------------
M3ZIW2_XIPMA/1768-2114QK------------------V------VSCV....----...--------------------------------------
Q2USV7_ASPOR/1630-2030AN------------------E------SSHA.A.K----AQT--------------------------------------
M7TX51_BOTF1/1640-2041AK------------------A------NSQS.G.P----SRT--------------------------------------
D5GKQ4_TUBMM/1633-2033AN------------------I------SAHN.A.K----DMT--------------------------------------
A7RYA6_NEMVE/1651-2034SA------------------E------SMNI....----...--------------------------------------
J4GX56_FIBRA/504-917ND------------------E------GTRQAASV----QKN--------------------------------------
K1X2E6_MARBU/1659-2061AN------------------E------SAHD.A.L----CRN--------------------------------------
E3LM18_CAERE/731-1090DE------------------R------IAKY....----...--------------------------------------
I2H0Y5_TETBL/1280-1677NN------------------D------TTSLSVTS----KIK--------------------------------------
CUT1_SCHPO/1383-1770SN------------------Q------MAQN.G.K----HYT--------------------------------------
A5DVQ7_LODEL/1109-1530NR------------------K------LTHNSTTS----MIK--------------------------------------
C4QYS2_PICPG/1259-1619SA------------------Q------TTNQERTT----NVR--------------------------------------
S3CR95_OPHP1/1758-2208IN------------------D------SCHG.A.R----DMS--------------------------------------
H2B1L5_KAZAF/1161-1559SD------------------K------TTSAEVTS----KIT--------------------------------------
G1KFP0_ANOCA/1819-2167QK------------------E------ISNF....----...--------------------------------------
J3PN83_PUCT1/868-1252SN------------------A------ATQRARHV----T..--------------------------------------
V5GCB2_BYSSN/1684-2084AN------------------I------SAHD.A.R----SRT--------------------------------------
K0K8V1_WICCF/1175-1568SN------------------A------TTSKERIA----SIK--------------------------------------
F0XAD9_GROCL/1636-2054TN------------------A------SCHD.A.R----DMT--------------------------------------
J5K578_BEAB2/1584-1996AN------------------E------TSHS.A.R----DFS--------------------------------------
B4MLS6_DROWI/172-538DP------------------I------LAKN....----...--------------------------------------
Q6FTE1_CANGA/1151-1548SN------------------E------SVSKNVTE----TIK--------------------------------------
F4PZT4_DICFS/1615-2074HD------------------M------VTGTKAAM----DQK--------------------------------------
K2R7J5_MACPH/1619-2043SN------------------F------STRN.A.P----DLS--------------------------------------
C7YYU1_NECH7/1580-1992AN------------------E------TSHS.ASR----DFS--------------------------------------
B4LBF1_DROVI/170-541DP------------------L------TVKA....----...--------------------------------------
K3Y3B2_SETIT/1404-1817NF------------------M------SLSSATLT----IND--------------------------------------
G4UQF5_NEUT9/1626-2085AN------------------E------TCHD.A.R----DFT--------------------------------------
B9SSN4_RICCO/1627-2045NY------------------.------.LSSSIFP----LED--------------------------------------
N1QAI8_MYCFI/1492-1912SD------------------Y------TCHN.S.I----DTS--------------------------------------
F4RLY9_MELLP/91-479SN------------------A------ATQRARHV----S..--------------------------------------
R9AIE1_WALI9/1639-2036SD------------------D------SIKSASDG----NVK--------------------------------------
G3VPI8_SARHA/1713-2063QK------------------E------NSSC....----...--------------------------------------
R8BFS3_TOGMI/72-487AN------------------E------TCHD.A.R----DLS--------------------------------------
G4T5A4_PIRID/1472-1874SV------------------R------NGRKAAEV----AGK--------------------------------------
B0E1W0_LACBS/104-540SD------------------E------GTKTAVNI----KSD--------------------------------------
N1QHR1_SPHMS/1187-1599SN------------------Y------SCHS.S.I----ETN--------------------------------------
C4XY11_CLAL4/1177-1564SN------------------G------STKKSVTT----SVK--------------------------------------
S8C8B1_DACHA/1639-2040AN------------------V------STHS.A.K----DMI--------------------------------------
E4ZTB4_LEPMJ/1652-2063SD------------------F------STRT.A.K----DMT--------------------------------------
M4DS49_BRARP/1599-2019SH------------------I------SSGS...P----VED--------------------------------------
F8PLA9_SERL3/1278-1688SD------------------Q------GTRQAAHV----KKD--------------------------------------
V2X3W8_MONRO/1588-2040SN------------------E------TTKVAASI----.RN--------------------------------------
B6K0I6_SCHJY/1359-1747SN------------------Q------ITRE.G.K----DYK--------------------------------------
G5ED39_CAEEL/727-1081DE------------------M------IAKY....----...--------------------------------------
Q9VRN6_DROME/171-538DP------------------L------NMKG....----...--------------------------------------
C5XSY3_SORBI/1425-1832NF------------------M------SLSSAPLS----IND--------------------------------------
I4YB88_WALSC/1631-2030SD------------------K------SIKSASDG----QVI--------------------------------------
S2JJU0_MUCC1/1578-1988SD------------------E------TITNSA..----NCH--------------------------------------
T1FT05_HELRO/413-770NM------------------N------TMKV....----...--------------------------------------
C5DHM1_LACTC/1178-1575SN------------------K------TTSVEVTS----NIS--------------------------------------
G0SHM3_CHATD/1723-2150IN------------------R------TCHD.S.R----DMA--------------------------------------
A8PX94_MALGO/1441-1824SN------------------V------GVQG.A.K----DVK--------------------------------------
S3D029_GLAL2/1639-2043AN------------------E------SAHS.A.R----DMS--------------------------------------
H3B3H1_LATCH/1699-2055QK------------------T------INYE....----...--------------------------------------
B4J0F9_DROGR/174-539DP------------------V------AVKT....----...--------------------------------------
W4Y9R2_STRPU/1031-1383SK------------------E------TVKE....----...--------------------------------------
Q4WUU6_ASPFU/1638-2039AN------------------E------TAHA.A.K----LQK--------------------------------------
U1G8A9_ENDPU/1638-2036AN------------------L------TAHD.M.K----AGS--------------------------------------
Q6BTB7_DEBHA/1338-1753SD------------------I------STRPETTS----KIK--------------------------------------
G7XGU8_ASPKW/1627-2026AN------------------E------SAHA.A.K----HQT--------------------------------------
F6VXN8_XENTR/1732-2080QK------------------A------VNNL....----...--------------------------------------
H2L8K9_ORYLA/1692-2038QK------------------V------VSCV....----...--------------------------------------
R7YNT5_CONA1/1696-2117SD------------------F------STHH.Q.R----DMS--------------------------------------
I3KSG7_ORENI/1715-2061QK------------------V------VSCV....----...--------------------------------------
F7BUI1_CALJA/1724-2073QK------------------E------NSSC....----...--------------------------------------
U5HB45_USTV1/1850-2253SN------------------S------GAQNAKNV----E..--------------------------------------
D8Q1W5_SCHCM/1450-1878SN------------------E------STKSAVNI----R.N--------------------------------------
U3IXX7_ANAPL/1332-1679QK------------------E------TISC....----...--------------------------------------
N1PZ16_MYCP1/1513-1936SN------------------F------SCHN.N.L----DTS--------------------------------------
G3AGZ6_SPAPN/1149-1535SD------------------Q------STKKEVTS----RVN--------------------------------------
F0UL09_AJEC8/1642-2044AN------------------E------SAHN.A.R----ASI--------------------------------------
U4LG69_PYROM/1616-2019SN------------------Q------STHQ.A.K----YME--------------------------------------
M1WFQ9_CLAP2/1438-1889AN------------------E------TSHS.A.R----DFS--------------------------------------
G8ZWZ1_TORDC/1158-1555SN------------------A------STSVEVTS----SIT--------------------------------------
ESP1_YEAST/1175-1571SN------------------Q------TTSVEVTN----KIK--------------------------------------

PF01364

KGP83_PORGN/244-595KY------------------NDGLAASA...APVF....LAL--------------------------------------
D1JG83_9ARCH/891-1295KI------------------K...........PDY....LIV--------------------------------------
A2U064_9FLAO/401-768LY------------------TTN.SSPS..TQLKY....VCF--------------------------------------
Q7MTE2_PORGI/239-573EY------------------EKEGNDLT...Y.......VLL--------------------------------------
D3HWT0_9BACT/400-777MY------------------DRA.STAS..TMPKY....LLL--------------------------------------
Q5S3Q9_9FLAO/543-910IY------------------ENA.P.EG..KKINY....LCL--------------------------------------
A9DMD5_9FLAO/555-923VY------------------DNA.STVD..NRVKY....VCM--------------------------------------
B0VGA8_CLOAI/228-563QY------------------DNPSTRPD...F.......IIL--------------------------------------
B7B5I7_9PORP/382-753FY------------------DRQ.TSEA..DAPKY....LLL--------------------------------------
B8FFM0_DESAA/254-600AY------------------NNW....A..LRPKW....VIL--------------------------------------
A3U7G6_CROAH/540-908VY------------------DNA.SSPA..SRLKY....VCL--------------------------------------
D2QSX9_SPILD/414-786FY------------------QQQ.P..T...KLRY....VLL--------------------------------------
A3HW99_9BACT/398-769YY------------------PAH.Q.......PTH....LLL--------------------------------------
B0VHP2_CLOAI/234-563QY------------------NLNDGLM....F.......VQL--------------------------------------
A8ZUB1_DESOH/278-656AY------------------ENLNTEY............VLL--------------------------------------
B0VIM2_CLOAI/182-528HY------------------QTYKCDY............LFL--------------------------------------
Q2Z0E1_9BACT/643-1013LS------------------DNSVVPPT...H.......ALL--------------------------------------
B3QXR8_CHLT3/734-1131AY------------------HEWAVAPT...Y.......VLL--------------------------------------
C2MCN4_9PORP/405-781YK------------------RRY.EAEH..GAESYH.PLLLL--------------------------------------
A4A325_9PLAN/24-399TA------------------KSGS........LRW....VVL--------------------------------------
A7NR84_ROSCS/499-867AR------------------PQA................VTL--------------------------------------
Q11Q36_CYTH3/558-932VY------------------DRG.S.AG..SQLKY....LLL--------------------------------------
Q7MX16_PORGI/272-637VY------------------NQSNAKRTLDGKLGY....VLL--------------------------------------
A0B5K7_METTP/796-1154KL------------------R...........PEY....LLV--------------------------------------
D0MH89_RHOM4/586-975LY------------------DRA.PDES..SLLRY....ALL--------------------------------------
A8UH97_9FLAO/539-910VY------------------DNA.SIPS..KRLKY....LCL--------------------------------------
B8KYL6_9GAMM/364-704AR------------------SHWQKPAP..AM.......LLL--------------------------------------
B8FIK5_DESAA/1139-1542YV------------------ENQGTTF............VAL--------------------------------------
Q11US7_CYTH3/392-767II------------------QVN.S......KEKY....LLI--------------------------------------
C6W101_DYAFD/326-680LC------------------DHG.N.......LQF....VLL--------------------------------------
A5FJM8_FLAJ1/544-914IY------------------NNA.SSSD..KRVKY....LNL--------------------------------------
Q7UG73_RHOBA/51-444IW------------------NVGGADTR...Y.......IVL--------------------------------------
A3J247_9FLAO/540-919VY------------------WNA.SASD..KRVKY....VNL--------------------------------------
A9WIM0_CHLAA/500-869AA------------------ATWSPAPE...A.......VIL--------------------------------------
B0VHE7_CLOAI/227-554AY------------------NNPATRPD...Y.......IVL--------------------------------------
C6VT06_DYAFD/394-758ML------------------SD..SK......DKY....LFL--------------------------------------
C6X3N8_FLAB3/546-921L.------------------....NTTS..GKLQY....LFI--------------------------------------
A0LQH1_SYNFM/790-1132AS------------------SWNPAPK....F.......VVF--------------------------------------
A1ZVJ9_9BACT/406-774LY------------------LRD.S..Q...VFKY....LLL--------------------------------------
B0VHF1_CLOAI/214-595LY------------------TTN........PLRY....VFL--------------------------------------
B0VIE7_CLOAI/193-598TY------------------AST........PFSY....LLL--------------------------------------
C6W3P4_DYAFD/414-806MI------------------SDLKKDNLG.RLDKY....LLL--------------------------------------
B2RGP6_PORG3/408-787FY------------------DRW.KANA..PVGETFPMQMLL--------------------------------------
D2QJ99_SPILD/409-770MR------------------QQN.P..E...HLRY....LLL--------------------------------------
A9B5Q8_HERA2/466-850LA------------------STWPQAPQ...S.......LVL--------------------------------------
D2QFF3_SPILD/397-745LV------------------ANT.A.......VKH....LLL--------------------------------------
B0VH03_CLOAI/589-939YY------------------FNL...PA..PRITS....LTL--------------------------------------
D2R2P5_PIRSD/21-411VA------------------ATSLEQGG...KLRY....VLL--------------------------------------
C6W0Z3_DYAFD/393-758LY------------------QKT.P..G...KLKY....LLL--------------------------------------
A3XQP5_LEEBM/552-929VY------------------ENA.SSAE..NRLKY....LCL--------------------------------------
C9RIY0_FIBSS/581-957A.------------------....RSVC..PDLRF....VLL--------------------------------------
Q2PY26_9BACT/412-780LW------------------SNA.SSPS..DKPEY....LLL--------------------------------------
Q26FX7_FLABB/537-909VY------------------DNA.SSPA..NRVRY....LNM--------------------------------------
B0VJT2_CLOAI/236-566KY------------------NNPETRPD...F.......VVL--------------------------------------
C6BTD6_DESAD/56-402LN------------------KDGKLMS............VLI--------------------------------------
D2QE53_SPILD/328-1007AY------------------KSW........KTRY....LLI--------------------------------------
A2BK55_HYPBU/159-551AV------------------DAGVNY.............VLI--------------------------------------
B0VHP1_CLOAI/283-636LW------------------NSATSENPAPSY.......LLI--------------------------------------
Q1Q1Y4_9BACT/620-970TY------------------NNWQEPAP..AY.......VVL--------------------------------------
C7PNY3_CHIPD/396-764CH------------------DRG.G.......LQY....LLL--------------------------------------
Q6LFY5_PHOPR/224-617AY------------------SNGTM.......TSY....VLL--------------------------------------
B3QVL4_CHLT3/688-1063LY------------------DNA.SSLD..DAPKY....VLL--------------------------------------
A9B187_HERA2/552-907AY------------------HNWQAPAP..SF.......VVL--------------------------------------
B3C566_9BACE/537-910LY------------------DRF.PNKA..ESPKY....LLF--------------------------------------
B0VJY1_CLOAI/655-1014AY------------------NNW...SS..PQLSS....VIL--------------------------------------
B8G4Y1_CHLAD/584-1054RY------------------QTYGSRFR...Y.......LML--------------------------------------
A1ZEG7_9BACT/410-775MY------------------DKG.N.......PKF....LFL--------------------------------------
B0VF22_CLOAI/223-583AY------------------QTWANSSQ...PLEY....VIL--------------------------------------
A0LKV0_SYNFM/924-1265AR------------------VHSGGALR...Y.......VLL--------------------------------------
A8ZTD5_DESOH/257-648AY------------------DTWSIPPS...Y.......VLL--------------------------------------
A9B8S0_HERA2/477-840AA------------------ATWPSPPT...S.......VLL--------------------------------------
C3JBB2_9PORP/421-799FY------------------DRW.MAAH..PGEKQSAQQLLL--------------------------------------
C9SW40_VERA1/279-917VR------------------TRW........GVNW....LLL--------------------------------------
C9LI59_9BACT/509-899LY------------------DRA.QSNA..DMPRY....LLL--------------------------------------
B5ICF9_ACIB4/214-642LQ------------------NESYGSN.....VEY....ITI--------------------------------------
Y048_ARCFU/22-377VN------------------ASY................VTI--------------------------------------
A3I371_9BACT/360-725IY------------------QES....K...SLKN....VLI--------------------------------------

PF11713

A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626--------------------------------------------------------------------------------

PF01650

VPEG_ARATH/59-330--------------------------------------------PH.....G.....KDVYQG.VPKDYTGDDVNVDNLF
A0CQC7_PARTE/19-285--------------------------------------------PNEDG.FS.....ENVYDG.CVIDYSKTDVNPANFL
A2FXM6_TRIVA/13-267--------------------------------------------LD.....H.....LNVYPGRANVKYTAGKVTATNFY
O24539_VICNA/53-325--------------------------------------------PQ.....G.....PNVYDG.VPKDYNGDFVTAENFY
HGLB_SCHMA/37-291--------------------------------------------YN.....H.....KDWYEG.VVIDYRGKNVNSKTFL
HGLB_SCHJA/31-285--------------------------------------------YR.....H.....KDYYKG.VVIDYKGKKVNPKTFL
VPE_VICSA/56-325--------------------------------------------PD.....G.....DDVYAG.VPKDYTGAEVHADNFY
A0A022P416_PSEAI/341-579--------------------------------------------.......R.....ESLSRA.......VRTLAER...
Q08BI0_DANRE/27-278--------------------------------------------VD.....Q.....TNVYKS.VPLDYTGNKVKSKNFL
Q0MYV8_EMIHU/33-301--------------------------------------------PTGDGTPG.....TDVYAG.CKIDYSGSMVTPETFV
Q22P32_TETTS/20-285--------------------------------------------PL.....G.....DDVYEG.CKIDYQGEDVTPKNYM
Q22P33_TETTS/20-285--------------------------------------------PN.....G.....QDVYAG.CKIDYQGNDVTPKNYM
D0MXB3_PHYIT/25-298--------------------------------------------PTTKNASHGAVQPVDVYKG.CNIDFRGVEVTPETFL
Q2UVF3_HAECO/29-287--------------------------------------------PS.....L.....TDVYEG.VVIDYKDKSVTPSNFL
Q4K5F2_PSEF5/335-570--------------------------------------------.......R.....ENLRRA.......AQTLAER...
Q4RED0_TETNG/30-283--------------------------------------------PS.....G.....SDVYKG.VPKDYTGDDVTPENFL
Q4UU48_XANC8/124-392--------------------------------------------.......Y.....DNLYDT.......LAAIGKR...
Q6EHZ7_TRIVA/12-258--------------------------------------------LK.....H.....VNIYPGSSKINYAHNSVTADQFY
N9BI26_ACIBI/229-477--------------------------------------------.......R.....TSIAMA.......LNRIGQQ...
Q6L4R2_ORYSJ/41-319--------------------------------------------PS.....G.....PDVYAG.VPKDYTGDDVNVNNFL
Q6NYJ7_DANRE/32-288--------------------------------------------PN.....G.....SDVYKG.VLKDYIGDDVTPENFL
Q6PRC7_IXORI/38-293--------------------------------------------LN.....G.....SNVYAG.VPKDYTGDLVTPKNFL
Q711M2_FASHE/21-278--------------------------------------------YK.....H.....KDVYEG.VKIDYSGLQTSVNTFA
Q84LM2_ORYSJ/62-334--------------------------------------------PK.....G.....GDVYAG.VPKDYTGHQVTTENFF
Q852T1_TOBAC/49-320--------------------------------------------PN.....G.....DDVYKG.VPKDYTGHHVTANNFL
Q86TV2_HUMAN/29-286--------------------------------------------PN.....G.....TDVYQG.VPKDYTGEDVTPQNFL
Q88QE3_PSEPK/400-640--------------------------------------------.......R.....ENLSRA.......AATLAER...
Q8LGK2_ARATH/46-316--------------------------------------------PD.....G.....EDVYKG.VPKDYTKEAVNVQNFY
Q949L7_BETVU/51-321--------------------------------------------PY.....G.....HDVYAG.VPKDYTGEDVTVNNFF
Q9LLQ4_SESIN/54-326--------------------------------------------PT.....G.....GDVYAG.VPKDYTGEQVTAENLY
Q9LWZ3_ORYSJ/41-304--------------------------------------------PN.....G.....PNVYAG.VPKDYNGNDVNKNNFL
Q9SBX2_MAIZE/45-317--------------------------------------------PQ.....G.....GDVYAG.VPKDYTGRDVNVDNFF
Q9SMD0_SOLLC/39-316--------------------------------------------PH.....G.....HDVYKG.VPKDYTGKDCNAQNFY
Q9XG75_TOBAC/40-306--------------------------------------------PH.....G.....HDVYKG.VPKDYTGKDCNADNFF

PF00656

Q7QGM9_ANOGA/35-227............................................KT-----K-----AEVTRK-----------------
ICENC_DROME/196-443............................................VN-----Q-----DQFFKL-----------------
O42284_CHICK/42-279............................................KT-----S-----QEMTTV-----------------
CAS1A_XENLA/144-382............................................LT-----K-----TEMVKV-----------------
CASPC_MOUSE/176-415............................................LT-----A-----QEMETE-----------------
CASP4_MOUSE/132-369............................................LT-----A-----EGMESE-----------------
CASP5_HUMAN/193-430............................................LT-----A-----RDMESV-----------------
CASPD_BOVIN/136-373............................................LT-----A-----RDMESV-----------------
CASP1_CANFA/163-400............................................LT-----A-----KGMESV-----------------
CASP1_FELCA/161-406............................................LT-----A-----KDMESE-----------------
CASP1_MOUSE/162-398............................................LT-----A-----LEMVKE-----------------
CASP1_HUMAN/163-400............................................LT-----A-----SDMTTE-----------------
CASP1_PIG/163-400............................................LT-----A-----SDMAIE-----------------
Q9I9L7_DANRE/145-379............................................LS-----A-----KEMDEA-----------------
Q9DDJ2_DANRE/174-400............................................LS-----G-----KDIRRA-----------------
Q6NTR7_XENLA/280-494............................................CN-----V-----EHLESI-----------------
CFLAR_MOUSE/257-480............................................PK-----S-----HDITQI-----------------
Q6QN97_PIG/259-484............................................LK-----V-----EQISKI-----------------
A0A024R3Z7_HUMAN/252-477............................................LS-----M-----HGISQI-----------------
Q9NBW3_DROME/38-248............................................PA-----L-----PDVKNK-----------------
Q9TZP5_CAEEL/26-261............................................LK-----S-----SEILET-----------------
CASPE_MOUSE/22-256............................................PT-----A-----QQFLEE-----------------
B2CIS9_HUMAN/18-241............................................PT-----A-----EQFQEE-----------------
Q8I749_SUBDO/254-491............................................IS-----S-----SEMNKV-----------------
CASP2_RAT/200-445............................................QT-----A-----QEMQEK-----------------
CASP2_CHICK/171-416............................................QS-----A-----EEMESA-----------------
Q9GV89_HYDVU/93-318............................................LK-----R-----EDIINI-----------------
Q9IB63_XENLA/144-396............................................LT-----G-----QAMHDH-----------------
CASP9_HUMAN/161-413............................................LT-----A-----KKMVLA-----------------
Q90WU0_CHICK/148-400............................................LK-----A-----QEIDVE-----------------
Q9IB64_XENLA/261-494............................................LT-----A-----ANIQKT-----------------
Q6E5N8_ICTPU/119-362............................................QT-----A-----EQMKDL-----------------
Q9I8J3_DANRE/238-473............................................LE-----A-----WAIKDE-----------------
Q6PAD9_XENLA/268-495............................................LG-----S-----EEIRDR-----------------
Q90WU1_CHICK/237-479............................................CT-----A-----EEIRNI-----------------
CASP8_HUMAN/234-476............................................CT-----V-----EQIYEI-----------------
CASP8_MOUSE/236-478............................................CT-----A-----NEIHEI-----------------
Q9Y1U6_PRIPA/173-413............................................LT-----G-----KELHNN-----------------
CED3_CAEEL/243-494............................................LT-----G-----RGMLLT-----------------
Q7QKT2_ANOGA/35-260............................................KT-----T-----VEIRHA-----------------
Q7PZJ9_ANOGA/20-250............................................KT-----K-----HEIRDA-----------------
Q9GV88_HYDVU/84-316............................................PK-----S-----TDVLNI-----------------
Q7Q1E0_ANOGA/62-291............................................FK-----L-----EEIKSV-----------------
CASP1_SPOFR/61-293............................................LK-----S-----EEINKF-----------------
CASP1_DROME/79-313............................................CK-----L-----RDILKH-----------------
Q7Q4X6_ANOGA/73-309............................................LK-----L-----RDLQKE-----------------
ICE_DROME/94-328............................................CR-----Y-----KDILRT-----------------
Q9NHF9_DROME/56-302............................................LT-----F-----SEINDT-----------------
Q7Q803_ANOGA/54-306............................................LT-----R-----KEIKQV-----------------
Q7PV92_ANOGA/14-237............................................PN-----R-----KQLLSA-----------------
Q86FL0_ANOST/52-286............................................LD-----K-----KDLLDE-----------------
Q8I6Y2_GEOCY/158-414............................................LT-----G-----KAMTRE-----------------
Q8ITP3_BRAFL/87-323............................................LP-----C-----RKILSV-----------------
O88550_RAT/68-301............................................CS-----C-----AKMQDL-----------------
Q6DCI2_XENLA/78-314............................................KS-----C-----EEMENL-----------------
Q8JIS8_ORYLA/58-285............................................QT-----V-----DQMKKL-----------------
CASP3_XENLA/56-280............................................QK-----S-----SDIIGR-----------------
O93417_CHICK/53-281............................................LS-----S-----RDIFKL-----------------
Q98UI8_DANRE/48-280............................................QT-----V-----AQIMQV-----------------
Q8JG42_TAKRU/51-279............................................QT-----V-----NQMKQL-----------------
Q8ITP2_BRAFL/151-396............................................KE-----I-----TEIRQI-----------------
Q9IB66_XENLA/58-298............................................LR-----T-----MDVLEK-----------------
Q9I8S9_ONCMY/57-297............................................LK-----V-----EEVLDQ-----------------
O93415_CHICK/57-299............................................LK-----A-----EDVLKK-----------------
CASP6_MOUSE/28-270............................................LR-----A-----EELLLK-----------------
PCP_DICDI/188-404............................................SD-----L-----RTFYDK-----------------
Q53839_STRCH/9-268..................................NP........CQ-----S-----SEFIDP-----------------
A0A038IA40_BORBO/552-800............................................PQ-----Q-----TSRASL-----------------
Q7NPG1_GLOVI/7-278...........................................EAT-----I-----KNVTDG-----------------
Q87Z21_PSESM/2-224............................................VT-----S-----ESLINA-----------------
Q82I86_STRAW/5-276............................................RD-----G-----EATVAA-----------------
F7URG9_SYNYG/40-299........................................GITLSA-----L-----EILFDE-----------------
Q8YS65_NOSS1/4-245..................................SPNFGVSSTRPT-----R-----THLRRV-----------------
Q9DDL2_DANRE/323-560............................................LN-----W-----QEMHSA-----------------
Q98CE0_RHILO/5-237............................................RD-----L-----RRMRRA-----------------
Q6N0T4_RHOPA/30-250............................................LS-----G-----DAMRRA-----------------
Q89XG2_BRADU/27-247............................................LT-----G-----DGMRRA-----------------
A0A038FP67_9BRAD/58-278............................................AT-----K-----DDMVRA-----------------
Q6NBN5_RHOPA/57-277............................................AS-----R-----DEILRA-----------------
Q98JS7_RHILO/35-253.............................................V-----K-----KSAEKD-----------------
Q985X8_RHILO/35-256............................................VD-----Q-----ESLRGA-----------------
Q6N5Q1_RHOPA/33-253............................................LD-----G-----DTLRGA-----------------
Q89KP2_BRADU/86-307............................................LD-----G-----DTLRKS-----------------
Q89IK1_BRADU/30-253............................................LR-----Q-----ADMQDL-----------------
Q98G71_RHILO/26-252............................................LG-----K-----RELERS-----------------
Q6AKF4_DESPS/28-248............................................AD-----Q-----EGFEES-----------------
Q98IJ6_RHILO/11-238............................................LT-----K-----QQTQVT-----------------
Q89MV1_BRADU/176-400............................................LD-----K-----GAMDIA-----------------
Q89HT8_BRADU/51-272............................................LT-----Q-----NDMLRV-----------------
Q89FZ4_BRADU/32-256............................................LA-----Q-----NEMRTA-----------------
Q6N329_RHOPA/73-298............................................LG-----Q-----TELRTK-----------------
Q98IJ9_RHILO/30-261............................................QD-----N-----AGMHGL-----------------
Q89HP3_BRADU/336-569............................................LD-----R-----AAMQKM-----------------
Q7RFI8_PLAYO/964-1364NLFNKKNIYDNKEVSNDYENNNSCVDVDIKNVDLSSKNIDFSLWPT-----R-----INILKA-----------------
D7AGH8_GEOSK/6-270............................................AT-----R-----AKVIDA-----------------
MCA9_ARATH/10-321..................................PESKVK....PT-----G-----ANIKAA-----------------
MCA8_ARATH/3-378..................................DKSCIQ....PT-----G-----KNICDE-----------------
MCA7_ARATH/3-401........................................SYTQPT-----G-----KNIRQA-----------------
Q70VV0_PICAB/3-415........................................SYPQPT-----G-----ANVRRA-----------------
Q9ZSP8_HEVBR/3-415........................................SYIQPT-----G-----KNIRRV-----------------
MCA4_ARATH/3-416........................................SSTQPT-----G-----KNIRRA-----------------
MCA5_ARATH/3-408........................................SSTKPT-----G-----KNIRRA-----------------
MCA6_ARATH/3-366........................................SSIKPT-----G-----KNIRQA-----------------
MCA1_ARATH/80-362..................................ETDPYRI...PT-----K-----QNMRMA-----------------
MCA2_ARATH/116-414.....................................EADPMRWPT-----K-----NNITMA-----------------
MCA1_SCHPO/130-422..................................ASNQRAI...PT-----R-----QNMLDA-----------------
MCA1_YARLI/168-458.....................................QRDQRSIPT-----K-----QNILQA-----------------
MCA1_DEBHA/146-437..................................QNQRARI...PT-----K-----ENIIRA-----------------
M9MZN6_ASHG1/154-449.....................................QHDPVRIPT-----K-----ANILRA-----------------
MCA1_KLULA/138-430..................................TTDPVRV...PT-----K-----ANMLRA-----------------
MCA1_CANGA/98-389..................................QREMVKI...PL-----K-----ENIIRA-----------------
B5VS82_YEAS6/157-450..................................QNDLVRV...PT-----R-----ANMIRA-----------------
D0A6D7_TRYB9/84-341.....................................PRFNAIKPT-----R-----ANILQH-----------------
Q38D34_TRYB2/63-322...................................RRFPNFTAMPT-----R-----ENIIKY-----------------
Q8T8E6_9TRYP/84-343..................................DNFPGRTDQ.PT-----R-----DNIVRY-----------------

PF14538

W1QFK7_OGAPD/56-210--------------------------------------------PS-----V-----EDLKRL-----------------
L8WVZ0_THACA/73-224--------------------------------------------PS-----V-----EDTRKW-----------------
A2EZ34_TRIVA/89-236--------------------------------------------PT-----I-----DKLSN.-----------------
Q6C6R4_YARLI/86-238--------------------------------------------PN-----V-----EDIKRF-----------------
M2WI96_MYCP1/172-328--------------------------------------------PT-----I-----EELKKY-----------------
K2S4T3_MACPH/104-258--------------------------------------------PT-----V-----DETRRY-----------------
C4LXC3_ENTHI/42-194--------------------------------------------PS-----I-----EKVKKA-----------------
T1G0Q6_HELRO/62-216--------------------------------------------PT-----T-----DDIKKL-----------------
B0CNS4_LACBS/34-185--------------------------------------------PS-----V-----EDLRRF-----------------
F0ZAV4_DICPU/115-266--------------------------------------------PT-----V-----EEVKKL-----------------
U9UGJ5_RHIID/52-203--------------------------------------------PS-----V-----DEMKKF-----------------
Q5KIS3_CRYNJ/92-243--------------------------------------------PS-----I-----EDTKKN-----------------
B0WBU4_CULQU/30-181--------------------------------------------VC-----V-----TDLRSA-----------------
A5DWK2_LODEL/143-295--------------------------------------------PC-----V-----EDVKRF-----------------
G0VGR8_NAUCC/79-231--------------------------------------------PC-----V-----EDVKRF-----------------
I3J5N7_ORENI/57-208--------------------------------------------PT-----V-----DEVKKL-----------------
A2DYM2_TRIVA/68-215--------------------------------------------PS-----I-----EKLQN.-----------------
D8TLK8_VOLCA/11-162--------------------------------------------PT-----V-----EDVKKL-----------------
G4M000_SCHMA/43-194--------------------------------------------PT-----L-----DDVKKL-----------------
C1MUE6_MICPC/45-196--------------------------------------------PT-----V-----EDVKKL-----------------
Q387I9_TRYB2/89-240--------------------------------------------VE-----L-----EDAKKR-----------------
C4M2F5_ENTHI/38-189--------------------------------------------PT-----Y-----EDVRRL-----------------
G4TT65_PIRID/72-223--------------------------------------------PS-----I-----DEARRF-----------------
G0NWW0_CAEBE/64-218--------------------------------------------PP-----I-----DDVRKV-----------------
A2DJF0_TRIVA/83-228--------------------------------------------QV-----E-----LNFSSP-----------------
K3WJU9_PYTUL/84-235--------------------------------------------PT-----V-----DETKQL-----------------
A2G590_TRIVA/30-180--------------------------------------------PP-----G-----NKISEV-----------------
B8M6V6_TALSN/189-342--------------------------------------------PS-----V-----DETKKF-----------------
A2FJN8_TRIVA/41-191--------------------------------------------PP-----V-----KDALDM-----------------
A2DLR3_TRIVA/97-242--------------------------------------------LS-----Q-----TKIDT.-----------------
E5SIN8_TRISP/44-195--------------------------------------------PT-----V-----DDVRRL-----------------
I1G727_AMPQE/53-204--------------------------------------------PT-----T-----DEVRKL-----------------
U1MN31_ASCSU/95-246--------------------------------------------PT-----V-----EDVRRL-----------------
I1L744_SOYBN/123-274--------------------------------------------PT-----V-----DEVKKL-----------------
E4XFS5_OIKDI/48-228--------------------------------------------QN-----I-----DNMVRI-----------------
D2VMD1_NAEGR/144-294--------------------------------------------PT-----V-----EDVKKT-----------------
A9TBL2_PHYPA/91-242--------------------------------------------PT-----V-----EDVKKL-----------------
B7PLB3_IXOSC/92-247--------------------------------------------PT-----V-----EEVKKL-----------------
E9CIT6_CAPO3/727-878--------------------------------------------PT-----V-----DDIKRL-----------------
B8CBK6_THAPS/256-409--------------------------------------------PT-----V-----EIVKDL-----------------
A4I1A2_LEIIN/114-279--------------------------------------------AS-----L-----EVSKSA-----------------
F4RLY3_MELLP/215-367--------------------------------------------VY-----S-----EEFKKT-----------------
K4DUJ2_TRYCR/62-218--------------------------------------------AH-----L-----EEAKHL-----------------
H1VVG4_COLHI/158-309--------------------------------------------PS-----V-----EETKKF-----------------
M7XEP3_RHOT1/113-265--------------------------------------------PP-----I-----EDAKKF-----------------
A2GCD5_TRIVA/98-247--------------------------------------------PN-----A-----DRLNN.-----------------
D8RG53_SELML/72-223--------------------------------------------PT-----A-----DEVKKL-----------------
A2F9H3_TRIVA/31-181--------------------------------------------PS-----A-----QTVLTL-----------------
L0PHF8_PNEJ8/131-282--------------------------------------------PS-----I-----EETKKF-----------------
RTOR2_ARATH/94-246--------------------------------------------PT-----K-----DDVRKL-----------------
M5E8T5_MALS4/58-209--------------------------------------------PI-----V-----EETKRF-----------------
B3RPQ9_TRIAD/43-194--------------------------------------------PT-----V-----EEVKKL-----------------
I4Y9Q8_WALSC/76-227--------------------------------------------PS-----V-----EEMRKL-----------------
A2E4G0_TRIVA/101-242--------------------------------------------PS-----S-----EKLAQ.-----------------
U6ISX1_HYMMI/269-417--------------------------------------------PN-----L-----EEVKKI-----------------
U4LGP0_PYROM/223-374--------------------------------------------PF-----V-----EDTKKF-----------------
A2F8U1_TRIVA/65-210--------------------------------------------PT-----I-----NDFKNS-----------------
D8T9J0_SELML/50-197--------------------------------------------ST-----V-----DEVKKL-----------------
A9V5A2_MONBE/628-777--------------------------------------------PT-----L-----DEVKRL-----------------
F0XXV0_AURAN/12-164--------------------------------------------PT-----A-----DELRRL-----------------
A2E336_TRIVA/54-202--------------------------------------------KY-----F-----TRIPCY-----------------
B4R5C8_DROSI/214-365--------------------------------------------PT-----V-----DDVKKL-----------------
J4H2X1_FIBRA/92-243--------------------------------------------PA-----Y-----DDLRKY-----------------
A2EU18_TRIVA/81-227--------------------------------------------PT-----A-----NSVSY.-----------------
A2DYB3_TRIVA/12-162--------------------------------------------PS-----A-----QNVLAM-----------------
S2KE38_MUCC1/106-257--------------------------------------------PS-----V-----EETKKV-----------------
G7E3R0_MIXOS/173-325--------------------------------------------PT-----V-----EDTKKL-----------------

PF03415

Q8A866_BACTN/37-399--------------------------------------------VD-----V-----DVMKNV-----------------
Q9WZB1_THEMA/121-462--------------------------------------------GS-----Y-----TNLEAW-----------------
Q8XM44_CLOPE/59-508--------------------------------------------GD-----A-----NTLKKF-----------------
Q9X1S5_THEMA/586-937--------------------------------------------GN-----I-----SELINY-----------------
Q9WYY6_THEMA/5-301--------------------------------------------GD-----P-----VVLSSF-----------------
Q8TIY6_METAC/66-593--------------------------------------------GD-----D-----AGLETF-----------------

PF13900

F6VPI7_MACMU/1-48--------------------------------------------PP-----------PGFKRF-----------------
H2P8I3_PONAB/10-56--------------------------------------------LP-----------PRFK.F-----------------
F7H1D9_MACMU/6-53--------------------------------------------PP-----------PEFKRF-----------------
F7HNL8_MACMU/6-53--------------------------------------------PP-----------PGFKQF-----------------
F6ZY08_MACMU/15-62--------------------------------------------PS-----------PELKQF-----------------
C9JL97_HUMAN/112-159--------------------------------------------PP-----------PRFKRF-----------------
F7HUC2_MACMU/8-55--------------------------------------------LS-----------HGFKQF-----------------
F7E5F2_MACMU/5-52--------------------------------------------LP-----------LAFKLF-----------------
H2PFS8_PONAB/309-356--------------------------------------------PP-----------PKFRQF-----------------
H9KYL1_CALJA/1-48--------------------------------------------PP-----------PWFKQF-----------------
F7H0L3_MACMU/5-52--------------------------------------------PP-----------PGFKRF-----------------
F6X1U8_MACMU/6-53--------------------------------------------LP-----------LRFTPF-----------------
F7GV92_MACMU/20-67--------------------------------------------PS-----------PRFKQF-----------------
F7GPL2_MACMU/68-115--------------------------------------------PP-----------PGFTPF-----------------
F8WCX3_HUMAN/9-56--------------------------------------------LP-----------PTFKRF-----------------
G1QLW6_NOMLE/814-862--------------------------------------------PP-----------PRFKKF-----------------
F7H7M8_MACMU/103-150--------------------------------------------PP-----------PRFQRF-----------------
F7HJ06_MACMU/6-53--------------------------------------------LP-----------PGLKRF-----------------
F7GKP6_MACMU/5-52--------------------------------------------PP-----------PGFKQF-----------------
F7BBK8_MACMU/3-51--------------------------------------------LP-----------PGFKQF-----------------
F7BBH6_MACMU/6-53--------------------------------------------LP-----------PKFKRF-----------------
F7H0K2_MACMU/5-52--------------------------------------------PP-----------PRFKRF-----------------
F7FTH6_MACMU/13-60--------------------------------------------LP-----------PGFKRF-----------------
F6Y5H5_MACMU/6-53--------------------------------------------PP-----------PVFTPF-----------------
F7IGY2_CALJA/5-52--------------------------------------------PP-----------PGNEQF-----------------
F7F1B5_MACMU/6-53--------------------------------------------PP-----------LGFKRF-----------------
F6ZIE8_MACMU/13-60--------------------------------------------LP-----------PGYRQF-----------------
H7C2Z3_HUMAN/35-82--------------------------------------------LP-----------AGFKRF-----------------
F6Q4C2_MACMU/10-57--------------------------------------------LP-----------PGFRQF-----------------
F6WIB8_MACMU/57-104--------------------------------------------LP-----------PQFKQF-----------------
F6RPD7_MACMU/5-52--------------------------------------------PS-----------PGLKRF-----------------
F7AN02_MACMU/1-48--------------------------------------------LP-----------PGFKRF-----------------
F6UHP4_MACMU/22-69--------------------------------------------LP-----------FRFKQF-----------------
F6QIB6_MACMU/6-53--------------------------------------------PS-----------PEFKRF-----------------
F7INS6_CALJA/10-56--------------------------------------------PP-----------PSFKRF-----------------
F7DA23_MACMU/81-128--------------------------------------------PP-----------PGFKQF-----------------
G3S992_GORGO/2-49--------------------------------------------PP-----------PRLKQF-----------------
F7GMK7_MACMU/6-53--------------------------------------------LP-----------PRFKRF-----------------
F7BBW7_MACMU/19-66--------------------------------------------LP-----------PGFKRF-----------------
G7P901_MACFA/6-53--------------------------------------------PP-----------PGFKQF-----------------
F6VUI9_CALJA/8-55--------------------------------------------LP-----------PGFKRF-----------------
F7HNT1_MACMU/10-57--------------------------------------------VP-----------PGFKQF-----------------
H2PFT0_PONAB/200-246--------------------------------------------LP-----------PGFK.F-----------------
F7BEX5_MACMU/6-53--------------------------------------------LP-----------PEFTQS-----------------
F7IH17_CALJA/8-55--------------------------------------------LP-----------PWFKQF-----------------
F7CY78_MACMU/1-49--------------------------------------------PP-----------PEFKRF-----------------
F6QIR0_MACMU/9-56--------------------------------------------LP-----------SGFTPF-----------------
E9PIS2_HUMAN/138-185--------------------------------------------AP-----------PGFKRF-----------------
G7P0P9_MACFA/3-50--------------------------------------------LP-----------PRFKRF-----------------
F8WCK5_HUMAN/303-350--------------------------------------------PH-----------PRFKRF-----------------
F7A4Y6_MACMU/6-53--------------------------------------------PP-----------PRCKRF-----------------
F5H189_HUMAN/75-122--------------------------------------------LP-----------PWFKQF-----------------
F7GMG4_MACMU/12-59--------------------------------------------PP-----------PRFKQF-----------------
F7EDZ5_MACMU/6-53--------------------------------------------LP-----------PGFKQF-----------------
H2NMK9_PONAB/15-62--------------------------------------------LP-----------PRFKQF-----------------
F7GNA8_MACMU/17-64--------------------------------------------LP-----------PRFKQF-----------------
M0QYB7_HUMAN/5-52--------------------------------------------TP-----------PGLKQF-----------------
F7GHR0_MACMU/69-116--------------------------------------------PR-----------PGFMPF-----------------
F6TK80_MACMU/14-61--------------------------------------------LP-----------PGFTLF-----------------
F7HQG2_MACMU/6-51--------------------------------------------LP-----------PRFTPF-----------------
F7HL81_MACMU/1-48--------------------------------------------LH-----------PRFKQL-----------------
G3S4W3_GORGO/73-116--------------------------------------------..-----------PGFKRF-----------------
G7PKJ6_MACFA/16-62--------------------------------------------LP-----------PGFKRF-----------------
F7CF12_MACMU/16-63--------------------------------------------PP-----------PGFKQF-----------------
F7H314_MACMU/5-52--------------------------------------------LP-----------PRFKQF-----------------
F7GNJ7_MACMU/23-70--------------------------------------------PP-----------PGFKRF-----------------
F7H7L6_MACMU/21-68--------------------------------------------PP-----------PGFKQF-----------------
H2PFS9_PONAB/301-348--------------------------------------------PP-----------PRFKQF-----------------
F6QZW4_MACMU/4-51--------------------------------------------PP-----------PRFKQF-----------------
F6VSA3_MACMU/58-105--------------------------------------------LS-----------PRFTPF-----------------
F7GWG7_MACMU/6-53--------------------------------------------PR-----------FGFKQI-----------------
G8F501_MACFA/41-88--------------------------------------------LH-----------PRLKQF-----------------
H2PCJ4_PONAB/71-117--------------------------------------------LP-----------PRFK.F-----------------
F7GRV2_MACMU/10-57--------------------------------------------LP-----------PGFKQF-----------------
F7DN54_MACMU/18-65--------------------------------------------LP-----------PGFKQF-----------------
F7C2M9_MACMU/203-250--------------------------------------------PP-----------PRFKQF-----------------
F6UHM5_MACMU/4-51--------------------------------------------PP-----------SGFKRF-----------------
F7E6B4_MACMU/16-63--------------------------------------------LP-----------PGFKRF-----------------
F6RPF6_MACMU/5-52--------------------------------------------PP-----------LRFKRF-----------------
F6T9Z0_MACMU/31-78--------------------------------------------PP-----------PGFKQF-----------------
F7D1W6_MACMU/11-57--------------------------------------------PP-----------PGFKRF-----------------
F6UMN3_MACMU/5-52--------------------------------------------LP-----------PRFKRF-----------------
K7EME6_HUMAN/91-138--------------------------------------------LP-----------PGFKQF-----------------
F8WD42_HUMAN/7-54--------------------------------------------SP-----------SGFKQF-----------------
H2PFS8_PONAB/209-255--------------------------------------------PP-----------PGFKRF-----------------
F6W1Z8_MACMU/11-58--------------------------------------------LP-----------PEFKRL-----------------
F7ILB0_CALJA/1-48--------------------------------------------PP-----------PGFRQF-----------------
F6VHU0_MACMU/21-68--------------------------------------------LP-----------PGFKRF-----------------
F6WI78_MACMU/73-120--------------------------------------------PP-----------PGFKPF-----------------
H7BZB2_HUMAN/19-65--------------------------------------------AS-----------PGCKQF-----------------
F6ZI73_MACMU/64-111--------------------------------------------LP-----------PGFTPF-----------------
F6Z663_MACMU/5-53--------------------------------------------LP-----------ARFKQF-----------------
F7AS31_MACMU/5-53--------------------------------------------PP-----------PVFKRF-----------------
F6VXW3_MACMU/74-121--------------------------------------------PP-----------PRFKRF-----------------
F6RES6_MACMU/10-57--------------------------------------------PP-----------PGFKQF-----------------
F6SY12_MACMU/53-100--------------------------------------------LP-----------PRFKSF-----------------
F6Y1U7_MACMU/8-55--------------------------------------------PP-----------PGFKRF-----------------
F6RRM6_MACMU/17-64--------------------------------------------PP-----------PGFRRF-----------------
F7AVL2_CALJA/49-96--------------------------------------------LP-----------PGFKRF-----------------
F7HXT7_CALJA/4-48--------------------------------------------PA-----------PRFKLF-----------------
F6ZZ11_MACMU/5-52--------------------------------------------PP-----------PGFNLF-----------------
F7GGU7_MACMU/13-60--------------------------------------------PP-----------PGFKRF-----------------

PF12770

A0LJ53_SYNFM/581-921--------------------------------------------LV-----------RPA--ATKT..............
A0LQE8_SYNFM/635-947--------------------------------------------LY-----------DGR--..................
A0YK41_LYNSP/3523-3818--------------------------------------------LH-----------DGE--..................
A0YW51_LYNSP/1488-1787--------------------------------------------LY-----------DGE--..................
A0YZ16_LYNSP/128-434--------------------------------------------LH-----------DGQ--..................
A1BCK0_CHLPD/513-826--------------------------------------------RQ-----------DSD--GS................
A1BEL3_CHLPD/43-361--------------------------------------------LW-----------HPE--Y.................
A1BEL6_CHLPD/46-364--------------------------------------------LY-----------HPD--Y.................
A3WDM2_9SPHN/678-1006--------------------------------------------LI-----------ASQ--EGVDAYLERTADAQTDEE
A4HBL7_LEIBR/1053-1432--------------------------------------------LL-----------NVK--AG................
A8L4T6_FRASN/741-1051--------------------------------------------LA-----------ETV--GG................
A8YIK9_MICAE/645-974--------------------------------------------LV-----------DEN--N.................
A9WBC0_CHLAA/673-929--------------------------------------------LW-----------NGN--..................
A9WER9_CHLAA/54-394--------------------------------------------FP-----------ATD--NQS...............
A9WF91_CHLAA/60-360--------------------------------------------MP-----------DG.--..................
B0C874_ACAM1/207-507--------------------------------------------LH-----------DGQ--..................
B2IXC0_NOSP7/1396-1691--------------------------------------------LH-----------DGK--..................
B2IZZ4_NOSP7/695-973--------------------------------------------IR-----------YKE--..................
B2JAK0_NOSP7/526-830--------------------------------------------LR-----------TND--G.................
B2JAM9_NOSP7/866-1190--------------------------------------------LP-----------NPT--QT................
B3QB04_RHOPT/774-1131--------------------------------------------IA-----------PAE--AAPDADPL..........
B4JKU3_DROGR/1402-1700--------------------------------------------LR-----------AAG--DD................
B4VHH6_9CYAN/1150-1443--------------------------------------------LH-----------DGE--..................
B4VJ14_9CYAN/646-949--------------------------------------------LV-----------DES--N.................
B4VJ30_9CYAN/3784-4081--------------------------------------------LH-----------DGQ--..................
B4VLG1_9CYAN/97-405--------------------------------------------LH-----------AGD--..................
B4VLY5_9CYAN/1558-1850--------------------------------------------LY-----------DGE--..................
B4VPE9_9CYAN/1179-1471--------------------------------------------LH-----------DGN--..................
B4VQD3_9CYAN/1443-1735--------------------------------------------LH-----------DGE--..................
B4VQK8_9CYAN/1658-1953--------------------------------------------IH-----------DGN--..................
B4VTQ2_9CYAN/1746-2036--------------------------------------------LH-----------NEE--..................
B4VXN8_9CYAN/1368-1663--------------------------------------------LH-----------DGD--..................
B4VXQ8_9CYAN/1752-2046--------------------------------------------LH-----------DGN--..................
B4VYA5_9CYAN/647-942--------------------------------------------LH-----------DGK--..................
B4WMI9_9SYNE/695-1035--------------------------------------------LI-----------DNE--D.................
B6C3H2_9GAMM/45-361--------------------------------------------FP-----------AGN--GA................
B8G8X7_CHLAD/58-398--------------------------------------------LP-----------ALD--AQS...............
B8GD94_CHLAD/102-415--------------------------------------------LW-----------ADE--P.................
C3Z401_BRAFL/1278-1602--------------------------------------------LK-----------GSS--S.................
F0SR63_PLABD/137-574--------------------------------------------LA-----------GDD--..................
F7UL61_SYNYG/155-456--------------------------------------------LF-----------DGE--..................
F7ULD2_SYNYG/1449-1747--------------------------------------------MY-----------DRQ--S.................
F7UQF5_SYNYG/591-904--------------------------------------------TD-----------NPP--GQ................
Q01RE6_SOLUE/865-1136--------------------------------------------LR-----------DDR--G.................
Q024J7_SOLUE/541-814--------------------------------------------LP-----------GDT--P.................
Q025F1_SOLUE/607-877--------------------------------------------LV-----------RPD--G.................
Q028B5_SOLUE/667-935--------------------------------------------LE-----------TEP--E.................
Q02DA1_SOLUE/510-786--------------------------------------------LM-----------DPA--F.................
Q10YT7_TRIEI/1003-1309--------------------------------------------LV-----------DEN--N.................
Q10YU6_TRIEI/544-838--------------------------------------------LY-----------DSK--R.................
Q112V9_TRIEI/62-390--------------------------------------------LP-----------EKY--NQ................
Q113D1_TRIEI/130-430--------------------------------------------LK-----------NN.--..................
Q113U8_TRIEI/3002-3297--------------------------------------------LH-----------DGE--..................
Q115J8_TRIEI/1466-1777--------------------------------------------IN-----------NPE--NSQE..............
Q117G6_TRIEI/881-1206--------------------------------------------LV-----------DEN--N.................
Q119J2_TRIEI/1474-1770--------------------------------------------LH-----------DGQ--..................
Q16H64_AEDAE/1315-1614--------------------------------------------LR-----------SGD--ES................
Q2G6U6_NOVAD/692-1020--------------------------------------------LV-----------SGD--KGIEAYKARMES..PDGD
Q2S6G2_SALRD/540-844--------------------------------------------TA-----------APG--GRYD..............
Q2W535_MAGSA/875-1218--------------------------------------------MV-----------EPN--R.................
Q38C46_TRYB2/1044-1397--------------------------------------------LM-----------SRN--G.................
Q3AQG5_CHLCH/44-362--------------------------------------------IY-----------HPD--Y.................
Q4C5K3_CROWT/405-717--------------------------------------------VY-----------NPE--N.................
Q4S217_TETNG/1205-1537--------------------------------------------LK-----------GSS--S.................
F7URX2_SYNYG/165-457--------------------------------------------LY-----------DGE--..................
Q5LLA3_RUEPO/680-970--------------------------------------------AR-----------DPE--R.................
Q64CV3_9ARCH/59-374--------------------------------------------LY-----------HN.--..................
Q7NCT1_GLOVI/600-923--------------------------------------------LV-----------GQD--G.................
Q7NF67_GLOVI/550-854--------------------------------------------LV-----------DEH--G.................
Q7NFD7_GLOVI/666-979--------------------------------------------LV-----------DEQ--G.................
Q7NIF7_GLOVI/691-997--------------------------------------------LV-----------DEQ--G.................
Q7NJE3_GLOVI/660-988--------------------------------------------LV-----------AQD--G.................
Q7NLR0_GLOVI/653-961--------------------------------------------LV-----------DER--N.................
Q7NVB0_CHRVO/67-386--------------------------------------------ML-----------SPP--GQP...............
Q82I85_STRAW/1175-1481--------------------------------------------EQ-----------GDD--GR................
Q82L10_STRAW/969-1256--------------------------------------------RH-----------GSG--EA................
Q8DGG5_THEEB/541-835--------------------------------------------LV-----------DAQ--G.................
Q8DH74_THEEB/570-891--------------------------------------------LV-----------DRQ--D.................
Q8DHI1_THEEB/67-394--------------------------------------------LS-----------EAQ--LNE...............
Q8DIE5_THEEB/1127-1420--------------------------------------------LH-----------DGK--..................
Q8YZU5_NOSS1/56-340--------------------------------------------LY-----------DKK--E.................
TTC28_HUMAN/1390-1713--------------------------------------------LK-----------GSS--S.................

PF03568

T1IUX7_STRMM/1624-1980--------------------------------------------..-----------DNR..N-----------------
G8BT64_TETPH/1165-1563--------------------------------------------TK-----------EEK..K-----------------
S6EFD3_ZYGB2/1145-1542--------------------------------------------TK-----------EER..K-----------------
Q2LZN6_DROPS/172-538--------------------------------------------.K-----------EAK..Q-----------------
A5DNR9_PICGU/1178-1576--------------------------------------------TK-----------DDR..K-----------------
H2VRL7_CAEJA/706-1062--------------------------------------------.P-----------GNMSAT-----------------
G4N8I2_MAGO7/1627-2057--------------------------------------------AK-----------GAK..T-----------------
J3P7L5_GAGT3/1606-2054--------------------------------------------KK-----------RLK..S-----------------
Q6ZHH8_ORYSJ/455-870--------------------------------------------GQ-----------ANH..V-----------------
G3N6G2_GASAC/1731-2077--------------------------------------------..-----------SEK..V-----------------
I7LUG5_TETTS/2027-2414--------------------------------------------RK-----------SQVDPN-----------------
M7T4Q8_EUTLA/44-499--------------------------------------------QK-----------EAK..S-----------------
A3GFF5_PICST/1168-1555--------------------------------------------TK-----------EER..K-----------------
N4UZ87_COLOR/1637-2043--------------------------------------------SN-----------GAK..E-----------------
Q5A8X8_CANAL/1101-1536--------------------------------------------TV-----------EDR..K-----------------
W1QIM9_OGAPD/1167-1527--------------------------------------------TR-----------ADR..A-----------------
Q75EJ0_ASHGO/1152-1552--------------------------------------------TK-----------EDR..R-----------------
C5MEH0_CANTT/925-1303--------------------------------------------TV-----------EDR..K-----------------
M7XLD2_RHOT1/1703-2100--------------------------------------------GK-----------EQR..A-----------------
G0RRT6_HYPJQ/1566-1971--------------------------------------------AK-----------GER..G-----------------
BIMB_EMENI/1609-2004--------------------------------------------DR-----------QMK..K-----------------
G3B782_CANTC/1213-1609--------------------------------------------TK-----------EDR..T-----------------
G2X6M8_VERDV/1704-2113--------------------------------------------AK-----------GAK..A-----------------
S8BGE7_PENO1/1622-2018--------------------------------------------TK-----------QMK..K-----------------
G2R9B0_THITE/1619-2058--------------------------------------------VK-----------GAK..S-----------------
B6GZP8_PENCW/1602-1998--------------------------------------------DK-----------LSK..K-----------------
K5WME3_PHACS/1732-2136--------------------------------------------DR-----------VSR..S-----------------
ESP1_ARATH/1641-2060--------------------------------------------TI-----------ESR..G-----------------
M7PDE3_PNEMU/1489-1882--------------------------------------------TS-----------AHK..V-----------------
S9X830_SCHCR/1385-1771--------------------------------------------TK-----------QEK..E-----------------
H6C6Q4_EXODN/1587-1987--------------------------------------------DK-----------SLR..K-----------------
L8G205_PSED2/1652-2056--------------------------------------------GR-----------EGK..I-----------------
Q23491_CAEEL/749-1101--------------------------------------------.H-----------EKYKFE-----------------
C1H4J8_PARBA/1619-2021--------------------------------------------DK-----------NSK..K-----------------
G0WDN6_NAUDC/1191-1589--------------------------------------------TK-----------EQR..K-----------------
C5DU01_ZYGRC/1141-1538--------------------------------------------TR-----------EER..R-----------------
M0UBW7_MUSAM/65-479--------------------------------------------IQ-----------MKN..A-----------------
B9GZR1_POPTR/1674-2094--------------------------------------------TK-----------ENR..N-----------------
K3Z105_SETIT/1078-1484--------------------------------------------VH-----------ADH..V-----------------
J3KEJ6_COCIM/1641-2042--------------------------------------------DK-----------KAK..K-----------------
C5FSW7_ARTOC/1655-2058--------------------------------------------GK-----------KEK..K-----------------
B6QNB5_PENMQ/1619-2016--------------------------------------------DK-----------NSK..K-----------------
K7H1P7_CAEJA/245-604--------------------------------------------.P-----------GDMSPT-----------------
C5XYE8_SORBI/457-870--------------------------------------------VN-----------ADR..V-----------------
Q6CQQ7_KLULA/1118-1516--------------------------------------------TK-----------EQR..K-----------------
N1JFH1_BLUG1/1598-2001--------------------------------------------DR-----------KSK..L-----------------
H3DAQ7_TETNG/1711-2057--------------------------------------------..-----------SEK..A-----------------
ESPL1_MOUSE/1716-2065--------------------------------------------..-----------TEK..R-----------------
M2R2K9_CERS8/1618-2024--------------------------------------------DR-----------KAR..A-----------------
A8NBE9_COPC7/1839-2276--------------------------------------------DE-----------EAR..S-----------------
J9JSJ3_ACYPI/139-490--------------------------------------------.R-----------QNKDPS-----------------
K4B224_SOLLC/1600-2023--------------------------------------------TT-----------ENR..S-----------------
J0DCK6_AURDE/1634-2046--------------------------------------------PK-----------EAR..V-----------------
W1NKX2_AMBTC/1-423--------------------------------------------TN-----------ENR..S-----------------
T1K7Z5_TETUR/1001-1362--------------------------------------------..-----------QDS..Q-----------------
G0VFB3_NAUCC/1164-1562--------------------------------------------TK-----------EDR..K-----------------
J7RG90_KAZNA/1160-1562--------------------------------------------TP-----------EGR..K-----------------
M3HH45_CANMX/1423-1797--------------------------------------------TV-----------DDR..K-----------------
Q2H6Q9_CHAGB/1612-2026--------------------------------------------AK-----------GAK..G-----------------
S8E105_FOMPI/1678-2083--------------------------------------------DR-----------AAR..A-----------------
Q6CCJ0_YARLI/1210-1588--------------------------------------------FP-----------GGS..E-----------------
G8YBL5_PICSO/1309-1719--------------------------------------------TR-----------DDR..K-----------------
I1MDQ8_SOYBN/1648-2063--------------------------------------------TT-----------QNR..M-----------------
G7E6G1_MIXOS/1513-1914--------------------------------------------TK-----------ETR..K-----------------
G8B5X7_CANPC/1052-1424--------------------------------------------TT-----------QDR..K-----------------
E9ETV5_METAR/1601-2008--------------------------------------------AK-----------GER..S-----------------
Q5KMS4_CRYNJ/188-600--------------------------------------------TS-----------EGK..A-----------------
W5GJD2_WHEAT/891-1304--------------------------------------------GQ-----------ANA..V-----------------
M3ZIW2_XIPMA/1768-2114--------------------------------------------..-----------AEK..A-----------------
Q2USV7_ASPOR/1630-2030--------------------------------------------DR-----------QMK..K-----------------
M7TX51_BOTF1/1640-2041--------------------------------------------GR-----------EAK..L-----------------
D5GKQ4_TUBMM/1633-2033--------------------------------------------SK-----------GAR..T-----------------
A7RYA6_NEMVE/1651-2034--------------------------------------------..-----------SST..K-----------------
J4GX56_FIBRA/504-917--------------------------------------------SK-----------SAR..A-----------------
K1X2E6_MARBU/1659-2061--------------------------------------------GR-----------EAK..T-----------------
E3LM18_CAERE/731-1090--------------------------------------------.P-----------GEMTPE-----------------
I2H0Y5_TETBL/1280-1677--------------------------------------------TK-----------EDR..K-----------------
CUT1_SCHPO/1383-1770--------------------------------------------RR-----------EDK..E-----------------
A5DVQ7_LODEL/1109-1530--------------------------------------------TV-----------DDR..K-----------------
C4QYS2_PICPG/1259-1619--------------------------------------------TK-----------ADR..Q-----------------
S3CR95_OPHP1/1758-2208--------------------------------------------VK-----------GAK..S-----------------
H2B1L5_KAZAF/1161-1559--------------------------------------------TS-----------DAR..K-----------------
G1KFP0_ANOCA/1819-2167--------------------------------------------..-----------TEK..E-----------------
J3PN83_PUCT1/868-1252--------------------------------------------GR-----------QDK..I-----------------
V5GCB2_BYSSN/1684-2084--------------------------------------------DR-----------QSR..K-----------------
K0K8V1_WICCF/1175-1568--------------------------------------------TA-----------EDR..Q-----------------
F0XAD9_GROCL/1636-2054--------------------------------------------VK-----------GAK..S-----------------
J5K578_BEAB2/1584-1996--------------------------------------------LK-----------GER..N-----------------
B4MLS6_DROWI/172-538--------------------------------------------.K-----------ETK..R-----------------
Q6FTE1_CANGA/1151-1548--------------------------------------------DK-----------NDV..R-----------------
F4PZT4_DICFS/1615-2074--------------------------------------------TK-----------KDSTIQ-----------------
K2R7J5_MACPH/1619-2043--------------------------------------------KK-----------GAK..T-----------------
C7YYU1_NECH7/1580-1992--------------------------------------------AK-----------GAK..S-----------------
B4LBF1_DROVI/170-541--------------------------------------------.Q-----------EAK..A-----------------
K3Y3B2_SETIT/1404-1817--------------------------------------------GQ-----------ANC..V-----------------
G4UQF5_NEUT9/1626-2085--------------------------------------------VK-----------GAK..T-----------------
B9SSN4_RICCO/1627-2045--------------------------------------------TK-----------ENR..T-----------------
N1QAI8_MYCFI/1492-1912--------------------------------------------IK-----------GAK..T-----------------
F4RLY9_MELLP/91-479--------------------------------------------GH-----------DEK..V-----------------
R9AIE1_WALI9/1639-2036--------------------------------------------SD-----------DEK..V-----------------
G3VPI8_SARHA/1713-2063--------------------------------------------..-----------TEK..S-----------------
R8BFS3_TOGMI/72-487--------------------------------------------IK-----------GAK..S-----------------
G4T5A4_PIRID/1472-1874--------------------------------------------GR-----------NAK..A-----------------
B0E1W0_LACBS/104-540--------------------------------------------DE-----------EAR..A-----------------
N1QHR1_SPHMS/1187-1599--------------------------------------------AK-----------GAK..T-----------------
C4XY11_CLAL4/1177-1564--------------------------------------------TK-----------EDR..R-----------------
S8C8B1_DACHA/1639-2040--------------------------------------------TK-----------DVR..A-----------------
E4ZTB4_LEPMJ/1652-2063--------------------------------------------SR-----------EAR..Q-----------------
M4DS49_BRARP/1599-2019--------------------------------------------TR-----------EHR..N-----------------
F8PLA9_SERL3/1278-1688--------------------------------------------DQ-----------KAR..T-----------------
V2X3W8_MONRO/1588-2040--------------------------------------------DQ-----------AAR..A-----------------
B6K0I6_SCHJY/1359-1747--------------------------------------------TR-----------EEK..E-----------------
G5ED39_CAEEL/727-1081--------------------------------------------.P-----------GDITPE-----------------
Q9VRN6_DROME/171-538--------------------------------------------.K-----------EAK..Q-----------------
C5XSY3_SORBI/1425-1832--------------------------------------------VN-----------ADH..V-----------------
I4YB88_WALSC/1631-2030--------------------------------------------TD-----------DDK..V-----------------
S2JJU0_MUCC1/1578-1988--------------------------------------------QA-----------GEI..E-----------------
T1FT05_HELRO/413-770--------------------------------------------..-----------TNK..K-----------------
C5DHM1_LACTC/1178-1575--------------------------------------------TK-----------DAR..K-----------------
G0SHM3_CHATD/1723-2150--------------------------------------------AK-----------GER..E-----------------
A8PX94_MALGO/1441-1824--------------------------------------------AL-----------EAR..K-----------------
S3D029_GLAL2/1639-2043--------------------------------------------SK-----------EAR..I-----------------
H3B3H1_LATCH/1699-2055--------------------------------------------..-----------TDK..K-----------------
B4J0F9_DROGR/174-539--------------------------------------------.Q-----------EAK..A-----------------
W4Y9R2_STRPU/1031-1383--------------------------------------------..-----------TDK..R-----------------
Q4WUU6_ASPFU/1638-2039--------------------------------------------DR-----------HSK..K-----------------
U1G8A9_ENDPU/1638-2036--------------------------------------------NR-----------QAK..K-----------------
Q6BTB7_DEBHA/1338-1753--------------------------------------------SK-----------EDR..K-----------------
G7XGU8_ASPKW/1627-2026--------------------------------------------DR-----------QMK..K-----------------
F6VXN8_XENTR/1732-2080--------------------------------------------..-----------TDK..K-----------------
H2L8K9_ORYLA/1692-2038--------------------------------------------..-----------AEK..A-----------------
R7YNT5_CONA1/1696-2117--------------------------------------------VK-----------GAK..T-----------------
I3KSG7_ORENI/1715-2061--------------------------------------------..-----------SEK..A-----------------
F7BUI1_CALJA/1724-2073--------------------------------------------..-----------TDK..R-----------------
U5HB45_USTV1/1850-2253--------------------------------------------GK-----------EAR..I-----------------
D8Q1W5_SCHCM/1450-1878--------------------------------------------DP-----------EAR..Q-----------------
U3IXX7_ANAPL/1332-1679--------------------------------------------..-----------TNK..R-----------------
N1PZ16_MYCP1/1513-1936--------------------------------------------AK-----------GAK..T-----------------
G3AGZ6_SPAPN/1149-1535--------------------------------------------TK-----------AQR..Q-----------------
F0UL09_AJEC8/1642-2044--------------------------------------------DK-----------SAK..R-----------------
U4LG69_PYROM/1616-2019--------------------------------------------NK-----------NDR..A-----------------
M1WFQ9_CLAP2/1438-1889--------------------------------------------AK-----------NER..N-----------------
G8ZWZ1_TORDC/1158-1555--------------------------------------------TK-----------DER..K-----------------
ESP1_YEAST/1175-1571--------------------------------------------TR-----------EER..K-----------------

PF01364

KGP83_PORGN/244-595--------------------------------------------VG-----------DT.....................
D1JG83_9ARCH/891-1295--------------------------------------------VG-----------GTGSVPFVDTELVQNLTVTYDNY
A2U064_9FLAO/401-768--------------------------------------------FG-----------DSSYD..................
Q7MTE2_PORGI/239-573--------------------------------------------IG-----------DH.....................
D3HWT0_9BACT/400-777--------------------------------------------FG-----------DGVWDNR..............ML
Q5S3Q9_9FLAO/543-910--------------------------------------------FG-----------DASFD..................
A9DMD5_9FLAO/555-923--------------------------------------------FG-----------DASYD..................
B0VGA8_CLOAI/228-563--------------------------------------------LG-----------DT.....................
B7B5I7_9PORP/382-753--------------------------------------------FG-----------DGSFDNR..............KL
B8FFM0_DESAA/254-600--------------------------------------------GG-----------DV.....................
A3U7G6_CROAH/540-908--------------------------------------------FG-----------EGSVD..................
D2QSX9_SPILD/414-786--------------------------------------------FG-----------DATFNYR..............NI
A3HW99_9BACT/398-769--------------------------------------------AG-----------RSLTMYSTAR.........QNGV
B0VHP2_CLOAI/234-563--------------------------------------------VG-----------DA.....................
A8ZUB1_DESOH/278-656--------------------------------------------GG-----------DT.....................
B0VIM2_CLOAI/182-528--------------------------------------------WG-----------DV.....................
Q2Z0E1_9BACT/643-1013--------------------------------------------VG-----------DSSLD..................
B3QXR8_CHLT3/734-1131--------------------------------------------LG-----------DA.....................
C2MCN4_9PORP/405-781--------------------------------------------MG-----------DGAYDNR..............KV
A4A325_9PLAN/24-399--------------------------------------------VG-----------DV.....................
A7NR84_ROSCS/499-867--------------------------------------------VG-----------DGSSDP................F
Q11Q36_CYTH3/558-932--------------------------------------------FG-----------KPTYD..................
Q7MX16_PORGI/272-637--------------------------------------------IG-----------KPLSKYL..............AD
A0B5K7_METTP/796-1154--------------------------------------------VG-----------DPGSLPFPT..........TGVK
D0MH89_RHOM4/586-975--------------------------------------------FG-----------DGHYNY.................
A8UH97_9FLAO/539-910--------------------------------------------FG-----------DGSYD..................
B8KYL6_9GAMM/364-704--------------------------------------------VG-----------DAS....................
B8FIK5_DESAA/1139-1542--------------------------------------------GG-----------DD.....................
Q11US7_CYTH3/392-767--------------------------------------------LG-----------KGVVPSMSNFINNVGSVVYRKNP
C6W101_DYAFD/326-680--------------------------------------------AG-----------RSIDPQK...............A
A5FJM8_FLAJ1/544-914--------------------------------------------FG-----------DASFD..................
Q7UG73_RHOBA/51-444--------------------------------------------VG-----------DT.....................
A3J247_9FLAO/540-919--------------------------------------------FG-----------DASYD..................
A9WIM0_CHLAA/500-869--------------------------------------------VG-----------DGSSD..................
B0VHE7_CLOAI/227-554--------------------------------------------IG-----------DT.....................
C6VT06_DYAFD/394-758--------------------------------------------IG-----------KSI....................
C6X3N8_FLAB3/546-921--------------------------------------------LG-----------DTSYD..................
A0LQH1_SYNFM/790-1132--------------------------------------------AG-----------EGSFD..................
A1ZVJ9_9BACT/406-774--------------------------------------------FG-----------DASFD..................
B0VHF1_CLOAI/214-595--------------------------------------------AG-----------DTDVIPHRGFYV.....SVNNSD
B0VIE7_CLOAI/193-598--------------------------------------------VG-----------DY.....................
C6W3P4_DYAFD/414-806--------------------------------------------LG-----------ISV....................
B2RGP6_PORG3/408-787--------------------------------------------FG-----------DGAHDNR..............KV
D2QJ99_SPILD/409-770--------------------------------------------IG-----------RARSTPG...............V
A9B5Q8_HERA2/466-850--------------------------------------------VG-----------DGTID..................
D2QFF3_SPILD/397-745--------------------------------------------VG-----------RANSYPY...............T
B0VH03_CLOAI/589-939--------------------------------------------LG-----------IGTMDWR...............N
D2R2P5_PIRSD/21-411--------------------------------------------VG-----------DAE....................
C6W0Z3_DYAFD/393-758--------------------------------------------FG-----------DATYDYR..............NL
A3XQP5_LEEBM/552-929--------------------------------------------FG-----------DTSFD..................
C9RIY0_FIBSS/581-957--------------------------------------------AG-----------GGNYD..................
Q2PY26_9BACT/412-780--------------------------------------------FG-----------DCSYD..................
Q26FX7_FLABB/537-909--------------------------------------------FG-----------DASFD..................
B0VJT2_CLOAI/236-566--------------------------------------------IG-----------DT.....................
C6BTD6_DESAD/56-402--------------------------------------------LG-----------NR.....................
D2QE53_SPILD/328-1007--------------------------------------------GG-----------DTDIVPMRNMVSYVSDKGNYGWD
A2BK55_HYPBU/159-551--------------------------------------------IG-----------GA.....................
B0VHP1_CLOAI/283-636--------------------------------------------VG-----------DV.....................
Q1Q1Y4_9BACT/620-970--------------------------------------------IG-----------DAYQDYN..............DN
C7PNY3_CHIPD/396-764--------------------------------------------FG-----------DASYD..................
Q6LFY5_PHOPR/224-617--------------------------------------------VG-----------DH.....................
B3QVL4_CHLT3/688-1063--------------------------------------------FG-----------DGDWD..................
A9B187_HERA2/552-907--------------------------------------------VG-----------DGTADPH...............D
B3C566_9BACE/537-910--------------------------------------------FG-----------DCSYDNR..............ML
B0VJY1_CLOAI/655-1014--------------------------------------------LG-----------EGVDDT................R
B8G4Y1_CHLAD/584-1054--------------------------------------------IG-----------TN.....................
A1ZEG7_9BACT/410-775--------------------------------------------IG-----------KGLSIDQS.............AT
B0VF22_CLOAI/223-583--------------------------------------------GG-----------DDEIVPERGA........YGQVG
A0LKV0_SYNFM/924-1265--------------------------------------------VG-----------DDTFD..................
A8ZTD5_DESOH/257-648--------------------------------------------VG-----------DV.....................
A9B8S0_HERA2/477-840--------------------------------------------VG-----------DGTTD..................
C3JBB2_9PORP/421-799--------------------------------------------FG-----------DGAADNR..............KV
C9SW40_VERA1/279-917--------------------------------------------GG-----------DTSIVPVRRVAGALEGGIEPPLT
C9LI59_9BACT/509-899--------------------------------------------FG-----------DCFWDNR...............M
B5ICF9_ACIB4/214-642--------------------------------------------FG-----------NAR....................
Y048_ARCFU/22-377--------------------------------------------LG-----------DA.....................
A3I371_9BACT/360-725--------------------------------------------LG-----------KGTFD..................

PF11713

A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626--------------------------------------------------------------------------------

PF01650

VPEG_ARATH/59-330AVILGDKTAVKG.GSGKVVD------------------------------------------------------------
A0CQC7_PARTE/19-285NVLKGNYDHLPD..GHKFIN------------------------------------------------------------
A2FXM6_TRIVA/13-267KVLTGDN......SQGPALQ------------------------------------------------------------
O24539_VICNA/53-325AVILGDKSKVRG.GSGKVIN------------------------------------------------------------
HGLB_SCHMA/37-291KVLKGDKS.....AGGKVLK------------------------------------------------------------
HGLB_SCHJA/31-285QVLKGDKR.....AGGKVLK------------------------------------------------------------
VPE_VICSA/56-325AALLGNKSALTG.GSGKVVD------------------------------------------------------------
A0A022P416_PSEAI/341-579....................------------------------------------------------------------
Q08BI0_DANRE/27-278AVLRGDDS.....AGGKIIR------------------------------------------------------------
Q0MYV8_EMIHU/33-301KVLTGDAAGLDG...GKVLQ------------------------------------------------------------
Q22P32_TETTS/20-285SVLTGKKSDVANIGTGRVLE------------------------------------------------------------
Q22P33_TETTS/20-285SVLTGDKQAVAKIGTGRVLE------------------------------------------------------------
D0MXB3_PHYIT/25-298NVLTGNSSGA...FNKNVLN------------------------------------------------------------
Q2UVF3_HAECO/29-287AILQGNETAVKG.GNGRVIH------------------------------------------------------------
Q4K5F2_PSEF5/335-570....................------------------------------------------------------------
Q4RED0_TETNG/30-283AVLKGDSANAK....GKVIQ------------------------------------------------------------
Q4UU48_XANC8/124-392...................M------------------------------------------------------------
Q6EHZ7_TRIVA/12-258TVLT.............TLK------------------------------------------------------------
N9BI26_ACIBI/229-477...................M------------------------------------------------------------
Q6L4R2_ORYSJ/41-319AVLLGNRSALTGSGSGKVVA------------------------------------------------------------
Q6NYJ7_DANRE/32-288AVLKGDAASVKG.GSGKVLK------------------------------------------------------------
Q6PRC7_IXORI/38-293SILQGKK..IKG.GSGKVIA------------------------------------------------------------
Q711M2_FASHE/21-278SVLSGDEHWKK..AGYKVLQ------------------------------------------------------------
Q84LM2_ORYSJ/62-334AVLLGNKTAVTG.GSGKVID------------------------------------------------------------
Q852T1_TOBAC/49-320AVILGNKAALSG.GSGKVVE------------------------------------------------------------
Q86TV2_HUMAN/29-286AVLRGDAEAVKGIGSGKVLK------------------------------------------------------------
Q88QE3_PSEPK/400-640....................------------------------------------------------------------
Q8LGK2_ARATH/46-316NVLLGNESGVTG.GNGKVVK------------------------------------------------------------
Q949L7_BETVU/51-321AAILGNKDAITG.GSGKVVN------------------------------------------------------------
Q9LLQ4_SESIN/54-326AVILGDKSAIKG.GSGKVVD------------------------------------------------------------
Q9LWZ3_ORYSJ/41-304AVLLGKKSALTGAGSGKVIS------------------------------------------------------------
Q9SBX2_MAIZE/45-317AVLLGNKTALRG.GSGKVVD------------------------------------------------------------
Q9SMD0_SOLLC/39-316SVILGNKSALTG.GSGKVVN------------------------------------------------------------
Q9XG75_TOBAC/40-306AVILGNKSALTG.GSGKVVE------------------------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227---------MGEIS.RKDFT------------------------------------------------------------
ICENC_DROME/196-443---------LTMVTSSSYVQ------------------------------------------------------------
O42284_CHICK/42-279---------MKKFADHKDHL------------------------------------------------------------
CAS1A_XENLA/144-382---------MKEFAAQEEHA------------------------------------------------------------
CASPC_MOUSE/176-415---------LMQFAGRPEHQ------------------------------------------------------------
CASP4_MOUSE/132-369---------MKDFAALSEHQ------------------------------------------------------------
CASP5_HUMAN/193-430---------LRAFAARPEHK------------------------------------------------------------
CASPD_BOVIN/136-373---------LWKFAAREEHK------------------------------------------------------------
CASP1_CANFA/163-400---------LREFAARPEHK------------------------------------------------------------
CASP1_FELCA/161-406---------LRAFAARPEHK------------------------------------------------------------
CASP1_MOUSE/162-398---------VKEFAACPEHK------------------------------------------------------------
CASP1_HUMAN/163-400---------LEAFAHRPEHK------------------------------------------------------------
CASP1_PIG/163-400---------LKAFAARPEHK------------------------------------------------------------
Q9I9L7_DANRE/145-379---------IRDFAQREEHK------------------------------------------------------------
Q9DDJ2_DANRE/174-400---------VENFSKRREHE------------------------------------------------------------
Q6NTR7_XENLA/280-494---------LKDVANMEQHK------------------------------------------------------------
CFLAR_MOUSE/257-480---------VRRYASMAQHQ------------------------------------------------------------
Q6QN97_PIG/259-484---------LRKVARMPQHQ------------------------------------------------------------
A0A024R3Z7_HUMAN/252-477---------LGQFACMPEHR------------------------------------------------------------
Q9NBW3_DROME/38-248---------VKEWS.AKRFT------------------------------------------------------------
Q9TZP5_CAEEL/26-261---------VRQFT.QSNHG------------------------------------------------------------
CASPE_MOUSE/22-256---------LDEFQQTIDNW------------------------------------------------------------
B2CIS9_HUMAN/18-241---------LEKFQQAIDSR------------------------------------------------------------
Q8I749_SUBDO/254-491---------MLRKA.SEDHP------------------------------------------------------------
CASP2_RAT/200-445---------LQNFAQLPAHR------------------------------------------------------------
CASP2_CHICK/171-416---------LERFSKLPDHQ------------------------------------------------------------
Q9GV89_HYDVU/93-318---------VYSLS.QVKCF------------------------------------------------------------
Q9IB63_XENLA/144-396---------LQALA.DQDHS------------------------------------------------------------
CASP9_HUMAN/161-413---------LLELA.QQDHG------------------------------------------------------------
Q90WU0_CHICK/148-400---------LRKLA.RLDHS------------------------------------------------------------
Q9IB64_XENLA/261-494---------LEMYS.KKDHA------------------------------------------------------------
Q6E5N8_ICTPU/119-362---------LKKYS..QQHH------------------------------------------------------------
Q9I8J3_DANRE/238-473---------IKQFA.NRNHA------------------------------------------------------------
Q6PAD9_XENLA/268-495---------IKKFK.SKDHS------------------------------------------------------------
Q90WU1_CHICK/237-479---------VNNYR.CMDHN------------------------------------------------------------
CASP8_HUMAN/234-476---------LKIYQ.LMDHS------------------------------------------------------------
CASP8_MOUSE/236-478---------LEGYQ.SADHK------------------------------------------------------------
Q9Y1U6_PRIPA/173-413---------IKSFASSTKHS------------------------------------------------------------
CED3_CAEEL/243-494---------IRDFAKHESHG------------------------------------------------------------
Q7QKT2_ANOGA/35-260---------LKEVS.KEDHT------------------------------------------------------------
Q7PZJ9_ANOGA/20-250---------LRNVS.KEDHT------------------------------------------------------------
Q9GV88_HYDVU/84-316---------LKQAA.NEDYS------------------------------------------------------------
Q7Q1E0_ANOGA/62-291---------IGKVS.SMDHS------------------------------------------------------------
CASP1_SPOFR/61-293---------IQQTA.EMDHS------------------------------------------------------------
CASP1_DROME/79-313---------VGKAA.ELDHT------------------------------------------------------------
Q7Q4X6_ANOGA/73-309---------VERVS.QMDHS------------------------------------------------------------
ICE_DROME/94-328---------IEYAA.SQNHS------------------------------------------------------------
Q9NHF9_DROME/56-302---------LKEVA.REDHS------------------------------------------------------------
Q7Q803_ANOGA/54-306---------LDDLA.EEDHK------------------------------------------------------------
Q7PV92_ANOGA/14-237---------LKQLA.GEDHS------------------------------------------------------------
Q86FL0_ANOST/52-286---------LDKVA.HEDHL------------------------------------------------------------
Q8I6Y2_GEOCY/158-414---------FEDLA.RRDHS------------------------------------------------------------
Q8ITP3_BRAFL/87-323---------LQ.LAAREDHR------------------------------------------------------------
O88550_RAT/68-301---------LRRAS.EEDHS------------------------------------------------------------
Q6DCI2_XENLA/78-314---------LRTVA.QQDHK------------------------------------------------------------
Q8JIS8_ORYLA/58-285---------FRQMS.NQDHS------------------------------------------------------------
CASP3_XENLA/56-280---------LKKIS.EEDHS------------------------------------------------------------
O93417_CHICK/53-281---------LKNVS.EEDHS------------------------------------------------------------
Q98UI8_DANRE/48-280---------LTTVA.HDDHS------------------------------------------------------------
Q8JG42_TAKRU/51-279---------LVSAA.EEDHS------------------------------------------------------------
Q8ITP2_BRAFL/151-396---------LHSAALKYDHS------------------------------------------------------------
Q9IB66_XENLA/58-298---------IQEAS.TTDHS------------------------------------------------------------
Q9I8S9_ONCMY/57-297---------ISQAA.EANHA------------------------------------------------------------
O93415_CHICK/57-299---------VFEAS.RDDYS------------------------------------------------------------
CASP6_MOUSE/28-270---------IHEVS.TSSHI------------------------------------------------------------
PCP_DICDI/188-404---------WYTFLQLVQSF------------------------------------------------------------
Q53839_STRCH/9-268---------VQRAAAEA...------------------------------------------------------------
A0A038IA40_BORBO/552-800---------IESLRRYQQLD------------------------------------------------------------
Q7NPG1_GLOVI/7-278---------LDWLLSGVSRS------------------------------------------------------------
Q87Z21_PSESM/2-224---------ISELFSG....------------------------------------------------------------
Q82I86_STRAW/5-276---------VEDAVVRQLGA------------------------------------------------------------
F7URG9_SYNYG/40-299---------HLRQ..QVQ..------------------------------------------------------------
Q8YS65_NOSS1/4-245---------LLTLFESLSMG------------------------------------------------------------
Q9DDL2_DANRE/323-560---------VTEFLLLLDRG------------------------------------------------------------
Q98CE0_RHILO/5-237---------LDDF..REDAK------------------------------------------------------------
Q6N0T4_RHOPA/30-250---------FDRLYQRTK..------------------------------------------------------------
Q89XG2_BRADU/27-247---------FDKLYGKIK..------------------------------------------------------------
A0A038FP67_9BRAD/58-278---------VNRLKSRIK..------------------------------------------------------------
Q6NBN5_RHOPA/57-277---------VERIKARAG..------------------------------------------------------------
Q98JS7_RHILO/35-253---------LNDAI.RAHLI------------------------------------------------------------
Q985X8_RHILO/35-256---------YRDFLAKATAA------------------------------------------------------------
Q6N5Q1_RHOPA/33-253---------FRDFVKKAEDS------------------------------------------------------------
Q89KP2_BRADU/86-307---------FRDFIQKAQAS------------------------------------------------------------
Q89IK1_BRADU/30-253---------TIRFARAASRA------------------------------------------------------------
Q98G71_RHILO/26-252---------IGEFSDALEGA------------------------------------------------------------
Q6AKF4_DESPS/28-248---------VRKFGKKI...------------------------------------------------------------
Q98IJ6_RHILO/11-238---------VAQFAKQVRGA------------------------------------------------------------
Q89MV1_BRADU/176-400---------VRSFGRQAQGA------------------------------------------------------------
Q89HT8_BRADU/51-272---------VQDFSAKVSAR------------------------------------------------------------
Q89FZ4_BRADU/32-256---------ISDFAGKVSAS------------------------------------------------------------
Q6N329_RHOPA/73-298---------VGDFAATVVAK------------------------------------------------------------
Q98IJ9_RHILO/30-261---------ISKFTEESYNA------------------------------------------------------------
Q89HP3_BRADU/336-569---------TRDFLRDAARA------------------------------------------------------------
Q7RFI8_PLAYO/964-1364---------VNWLVRDSV..------------------------------------------------------------
D7AGH8_GEOSK/6-270---------IGKAAKALG..------------------------------------------------------------
MCA9_ARATH/10-321---------LRRMVDKAQAG------------------------------------------------------------
MCA8_ARATH/3-378---------LDNLIASGQ..------------------------------------------------------------
MCA7_ARATH/3-401---------LSELIKPAKSG------------------------------------------------------------
Q70VV0_PICAB/3-415---------LKTLVEGSRAG------------------------------------------------------------
Q9ZSP8_HEVBR/3-415---------LTDLVRSAE..------------------------------------------------------------
MCA4_ARATH/3-416---------LADLVESADSG------------------------------------------------------------
MCA5_ARATH/3-408---------LLNLVESAK..------------------------------------------------------------
MCA6_ARATH/3-366---------LLDLVEPAK..------------------------------------------------------------
MCA1_ARATH/80-362---------LYWLVQGCT..------------------------------------------------------------
MCA2_ARATH/116-414---------MHWLVLSCK..------------------------------------------------------------
MCA1_SCHPO/130-422---------MRWLVSDAQ..------------------------------------------------------------
MCA1_YARLI/168-458---------CQWLVKGAQ..------------------------------------------------------------
MCA1_DEBHA/146-437---------MQWLVKDAR..------------------------------------------------------------
M9MZN6_ASHG1/154-449---------MHWLVQGAQ..------------------------------------------------------------
MCA1_KLULA/138-430---------MQWLVKDAR..------------------------------------------------------------
MCA1_CANGA/98-389---------MQWLVKDAQ..------------------------------------------------------------
B5VS82_YEAS6/157-450---------MQWLVKDAQ..------------------------------------------------------------
D0A6D7_TRYB9/84-341---------MAWLVKDAK..------------------------------------------------------------
Q38D34_TRYB2/63-322---------MAWLVYDVR..------------------------------------------------------------
Q8T8E6_9TRYP/84-343---------MAWLVKDAK..------------------------------------------------------------

PF14538

W1QFK7_OGAPD/56-210---------CTTLRRSSK--------------------------------------------------------------
L8WVZ0_THACA/73-224---------CIGLRKMVG--------------------------------------------------------------
A2EZ34_TRIVA/89-236---------ANSLRTNVG--------------------------------------------------------------
Q6C6R4_YARLI/86-238---------CIGLRRGAK--------------------------------------------------------------
M2WI96_MYCP1/172-328---------TTSLRRTAH--------------------------------------------------------------
K2S4T3_MACPH/104-258---------CSTLRKNAR--------------------------------------------------------------
C4LXC3_ENTHI/42-194---------CIGARERFG--------------------------------------------------------------
T1G0Q6_HELRO/62-216---------CQSLRRNAK--------------------------------------------------------------
B0CNS4_LACBS/34-185---------CQTLRKQAK--------------------------------------------------------------
F0ZAV4_DICPU/115-266---------CLSLRRNAK--------------------------------------------------------------
U9UGJ5_RHIID/52-203---------CTNLRKSAK--------------------------------------------------------------
Q5KIS3_CRYNJ/92-243---------CISMRKTTK--------------------------------------------------------------
B0WBU4_CULQU/30-181---------CDQLKAH..--------------------------------------------------------------
A5DWK2_LODEL/143-295---------CNTLRRNAK--------------------------------------------------------------
G0VGR8_NAUCC/79-231---------CNSLRRSSK--------------------------------------------------------------
I3J5N7_ORENI/57-208---------CTSLRRNAK--------------------------------------------------------------
A2DYM2_TRIVA/68-215---------IATMRREIT--------------------------------------------------------------
D8TLK8_VOLCA/11-162---------CLSCRRNAK--------------------------------------------------------------
G4M000_SCHMA/43-194---------CLSLRRNAK--------------------------------------------------------------
C1MUE6_MICPC/45-196---------CLSCRRNAK--------------------------------------------------------------
Q387I9_TRYB2/89-240---------MANIRLDAR--------------------------------------------------------------
C4M2F5_ENTHI/38-189---------CLTFRRMAD--------------------------------------------------------------
G4TT65_PIRID/72-223---------CVNLRKTAK--------------------------------------------------------------
G0NWW0_CAEBE/64-218---------ATNLRRISG--------------------------------------------------------------
A2DJF0_TRIVA/83-228---------IRHICLQNG--------------------------------------------------------------
K3WJU9_PYTUL/84-235---------CVSMRRHAK--------------------------------------------------------------
A2G590_TRIVA/30-180---------IKTYSQNAK--------------------------------------------------------------
B8M6V6_TALSN/189-342---------CISLRRNAK--------------------------------------------------------------
A2FJN8_TRIVA/41-191---------MHKLSQNAT--------------------------------------------------------------
A2DLR3_TRIVA/97-242---------IIQLRKNCP--------------------------------------------------------------
E5SIN8_TRISP/44-195---------CISMRKNAK--------------------------------------------------------------
I1G727_AMPQE/53-204---------CIALRKNAK--------------------------------------------------------------
U1MN31_ASCSU/95-246---------CQSMRRNAK--------------------------------------------------------------
I1L744_SOYBN/123-274---------CTTCRKYAK--------------------------------------------------------------
E4XFS5_OIKDI/48-228---------TQSRMGRAE--------------------------------------------------------------
D2VMD1_NAEGR/144-294---------CVQLRKSAK--------------------------------------------------------------
A9TBL2_PHYPA/91-242---------CLSCRKNAK--------------------------------------------------------------
B7PLB3_IXOSC/92-247---------CSSLRRNSK--------------------------------------------------------------
E9CIT6_CAPO3/727-878---------CTSLRRNAK--------------------------------------------------------------
B8CBK6_THAPS/256-409---------CFRMRESAK--------------------------------------------------------------
A4I1A2_LEIIN/114-279---------LAKSRRMSR--------------------------------------------------------------
F4RLY3_MELLP/215-367---------LIGLRKYSK--------------------------------------------------------------
K4DUJ2_TRYCR/62-218---------MMSSRRKAD--------------------------------------------------------------
H1VVG4_COLHI/158-309---------CQSLRRNAK--------------------------------------------------------------
M7XEP3_RHOT1/113-265---------CTGARKTAK--------------------------------------------------------------
A2GCD5_TRIVA/98-247---------LSSIRSEVV--------------------------------------------------------------
D8RG53_SELML/72-223---------CSQCRKNAK--------------------------------------------------------------
A2F9H3_TRIVA/31-181---------LRKHCSSMP--------------------------------------------------------------
L0PHF8_PNEJ8/131-282---------CSTQRRNAK--------------------------------------------------------------
RTOR2_ARATH/94-246---------CLSCRKYAK--------------------------------------------------------------
M5E8T5_MALS4/58-209---------CTNLRRNAK--------------------------------------------------------------
B3RPQ9_TRIAD/43-194---------CLSLRRNAK--------------------------------------------------------------
I4Y9Q8_WALSC/76-227---------CASLRRNAK--------------------------------------------------------------
A2E4G0_TRIVA/101-242---------ISQIRRDIP--------------------------------------------------------------
U6ISX1_HYMMI/269-417---------CVNMRRNAR--------------------------------------------------------------
U4LGP0_PYROM/223-374---------CCSLRRNAK--------------------------------------------------------------
A2F8U1_TRIVA/65-210---------LSKIKLQNS--------------------------------------------------------------
D8T9J0_SELML/50-197---------CVQCRETAK--------------------------------------------------------------
A9V5A2_MONBE/628-777---------CLALRRRAK--------------------------------------------------------------
F0XXV0_AURAN/12-164---------CAALRRSAR--------------------------------------------------------------
A2E336_TRIVA/54-202---------LQKMRQDDQ--------------------------------------------------------------
B4R5C8_DROSI/214-365---------CTSLRRNAK--------------------------------------------------------------
J4H2X1_FIBRA/92-243---------CHSLRKTAK--------------------------------------------------------------
A2EU18_TRIVA/81-227---------LQQFRHDYP--------------------------------------------------------------
A2DYB3_TRIVA/12-162---------LRKHASSMP--------------------------------------------------------------
S2KE38_MUCC1/106-257---------CCQMRRNAK--------------------------------------------------------------
G7E3R0_MIXOS/173-325---------CVNMRKQAK--------------------------------------------------------------

PF03415

Q8A866_BACTN/37-399---------FTTAFSHYP--------------------------------------------------------------
Q9WZB1_THEMA/121-462---------LEMILNQFD--------------------------------------------------------------
Q8XM44_CLOPE/59-508---------IKFCKKNYE--------------------------------------------------------------
Q9X1S5_THEMA/586-937---------MEYASN.LE--------------------------------------------------------------
Q9WYY6_THEMA/5-301---------LNAYRG...--------------------------------------------------------------
Q8TIY6_METAC/66-593---------LSYIRENYE--------------------------------------------------------------

PF13900

F6VPI7_MACMU/1-48--------------------------------------------------------------------------------
H2P8I3_PONAB/10-56--------------------------------------------------------------------------------
F7H1D9_MACMU/6-53--------------------------------------------------------------------------------
F7HNL8_MACMU/6-53--------------------------------------------------------------------------------
F6ZY08_MACMU/15-62--------------------------------------------------------------------------------
C9JL97_HUMAN/112-159--------------------------------------------------------------------------------
F7HUC2_MACMU/8-55--------------------------------------------------------------------------------
F7E5F2_MACMU/5-52--------------------------------------------------------------------------------
H2PFS8_PONAB/309-356--------------------------------------------------------------------------------
H9KYL1_CALJA/1-48--------------------------------------------------------------------------------
F7H0L3_MACMU/5-52--------------------------------------------------------------------------------
F6X1U8_MACMU/6-53--------------------------------------------------------------------------------
F7GV92_MACMU/20-67--------------------------------------------------------------------------------
F7GPL2_MACMU/68-115--------------------------------------------------------------------------------
F8WCX3_HUMAN/9-56--------------------------------------------------------------------------------
G1QLW6_NOMLE/814-862--------------------------------------------------------------------------------
F7H7M8_MACMU/103-150--------------------------------------------------------------------------------
F7HJ06_MACMU/6-53--------------------------------------------------------------------------------
F7GKP6_MACMU/5-52--------------------------------------------------------------------------------
F7BBK8_MACMU/3-51--------------------------------------------------------------------------------
F7BBH6_MACMU/6-53--------------------------------------------------------------------------------
F7H0K2_MACMU/5-52--------------------------------------------------------------------------------
F7FTH6_MACMU/13-60--------------------------------------------------------------------------------
F6Y5H5_MACMU/6-53--------------------------------------------------------------------------------
F7IGY2_CALJA/5-52--------------------------------------------------------------------------------
F7F1B5_MACMU/6-53--------------------------------------------------------------------------------
F6ZIE8_MACMU/13-60--------------------------------------------------------------------------------
H7C2Z3_HUMAN/35-82--------------------------------------------------------------------------------
F6Q4C2_MACMU/10-57--------------------------------------------------------------------------------
F6WIB8_MACMU/57-104--------------------------------------------------------------------------------
F6RPD7_MACMU/5-52--------------------------------------------------------------------------------
F7AN02_MACMU/1-48--------------------------------------------------------------------------------
F6UHP4_MACMU/22-69--------------------------------------------------------------------------------
F6QIB6_MACMU/6-53--------------------------------------------------------------------------------
F7INS6_CALJA/10-56--------------------------------------------------------------------------------
F7DA23_MACMU/81-128--------------------------------------------------------------------------------
G3S992_GORGO/2-49--------------------------------------------------------------------------------
F7GMK7_MACMU/6-53--------------------------------------------------------------------------------
F7BBW7_MACMU/19-66--------------------------------------------------------------------------------
G7P901_MACFA/6-53--------------------------------------------------------------------------------
F6VUI9_CALJA/8-55--------------------------------------------------------------------------------
F7HNT1_MACMU/10-57--------------------------------------------------------------------------------
H2PFT0_PONAB/200-246--------------------------------------------------------------------------------
F7BEX5_MACMU/6-53--------------------------------------------------------------------------------
F7IH17_CALJA/8-55--------------------------------------------------------------------------------
F7CY78_MACMU/1-49--------------------------------------------------------------------------------
F6QIR0_MACMU/9-56--------------------------------------------------------------------------------
E9PIS2_HUMAN/138-185--------------------------------------------------------------------------------
G7P0P9_MACFA/3-50--------------------------------------------------------------------------------
F8WCK5_HUMAN/303-350--------------------------------------------------------------------------------
F7A4Y6_MACMU/6-53--------------------------------------------------------------------------------
F5H189_HUMAN/75-122--------------------------------------------------------------------------------
F7GMG4_MACMU/12-59--------------------------------------------------------------------------------
F7EDZ5_MACMU/6-53--------------------------------------------------------------------------------
H2NMK9_PONAB/15-62--------------------------------------------------------------------------------
F7GNA8_MACMU/17-64--------------------------------------------------------------------------------
M0QYB7_HUMAN/5-52--------------------------------------------------------------------------------
F7GHR0_MACMU/69-116--------------------------------------------------------------------------------
F6TK80_MACMU/14-61--------------------------------------------------------------------------------
F7HQG2_MACMU/6-51--------------------------------------------------------------------------------
F7HL81_MACMU/1-48--------------------------------------------------------------------------------
G3S4W3_GORGO/73-116--------------------------------------------------------------------------------
G7PKJ6_MACFA/16-62--------------------------------------------------------------------------------
F7CF12_MACMU/16-63--------------------------------------------------------------------------------
F7H314_MACMU/5-52--------------------------------------------------------------------------------
F7GNJ7_MACMU/23-70--------------------------------------------------------------------------------
F7H7L6_MACMU/21-68--------------------------------------------------------------------------------
H2PFS9_PONAB/301-348--------------------------------------------------------------------------------
F6QZW4_MACMU/4-51--------------------------------------------------------------------------------
F6VSA3_MACMU/58-105--------------------------------------------------------------------------------
F7GWG7_MACMU/6-53--------------------------------------------------------------------------------
G8F501_MACFA/41-88--------------------------------------------------------------------------------
H2PCJ4_PONAB/71-117--------------------------------------------------------------------------------
F7GRV2_MACMU/10-57--------------------------------------------------------------------------------
F7DN54_MACMU/18-65--------------------------------------------------------------------------------
F7C2M9_MACMU/203-250--------------------------------------------------------------------------------
F6UHM5_MACMU/4-51--------------------------------------------------------------------------------
F7E6B4_MACMU/16-63--------------------------------------------------------------------------------
F6RPF6_MACMU/5-52--------------------------------------------------------------------------------
F6T9Z0_MACMU/31-78--------------------------------------------------------------------------------
F7D1W6_MACMU/11-57--------------------------------------------------------------------------------
F6UMN3_MACMU/5-52--------------------------------------------------------------------------------
K7EME6_HUMAN/91-138--------------------------------------------------------------------------------
F8WD42_HUMAN/7-54--------------------------------------------------------------------------------
H2PFS8_PONAB/209-255--------------------------------------------------------------------------------
F6W1Z8_MACMU/11-58--------------------------------------------------------------------------------
F7ILB0_CALJA/1-48--------------------------------------------------------------------------------
F6VHU0_MACMU/21-68--------------------------------------------------------------------------------
F6WI78_MACMU/73-120--------------------------------------------------------------------------------
H7BZB2_HUMAN/19-65--------------------------------------------------------------------------------
F6ZI73_MACMU/64-111--------------------------------------------------------------------------------
F6Z663_MACMU/5-53--------------------------------------------------------------------------------
F7AS31_MACMU/5-53--------------------------------------------------------------------------------
F6VXW3_MACMU/74-121--------------------------------------------------------------------------------
F6RES6_MACMU/10-57--------------------------------------------------------------------------------
F6SY12_MACMU/53-100--------------------------------------------------------------------------------
F6Y1U7_MACMU/8-55--------------------------------------------------------------------------------
F6RRM6_MACMU/17-64--------------------------------------------------------------------------------
F7AVL2_CALJA/49-96--------------------------------------------------------------------------------
F7HXT7_CALJA/4-48--------------------------------------------------------------------------------
F6ZZ11_MACMU/5-52--------------------------------------------------------------------------------
F7GGU7_MACMU/13-60--------------------------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921...SRKTQYLIEN...QAIL..YLSSAS----------------------------------------------------
A0LQE8_SYNFM/635-947.......KYLIER...YTPVVFTPASRD----------------------------------------------------
A0YK41_LYNSP/3523-3818.......QFLIEK...YSVG..LAPSLT----------------------------------------------------
A0YW51_LYNSP/1488-1787.......KFLLED...YSLA..LIPSLS----------------------------------------------------
A0YZ16_LYNSP/128-434.......QFLVEK...YSLT..RIPAFN----------------------------------------------------
A1BCK0_CHLPD/513-826......KRWLIDR...FTVR..YAPDFQ----------------------------------------------------
A1BEL3_CHLPD/43-361.......GFLALH...KEFT........----------------------------------------------------
A1BEL6_CHLPD/46-364.......GFLARH...EGFT........----------------------------------------------------
A3WDM2_9SPHN/678-1006LFDYRGIDWLGKS...RDVS..IAVSPR----------------------------------------------------
A4HBL7_LEIBR/1053-1432......DRYFVEE...AAVQ..MAFS..----------------------------------------------------
A8L4T6_FRASN/741-1051.....AGTYALDR...LTLV..YAPSVR----------------------------------------------------
A8YIK9_MICAE/645-974.......QYLVEN...YHIT..YLTSGR----------------------------------------------------
A9WBC0_CHLAA/673-929.......NYLMER...YLIE..QIPTGA----------------------------------------------------
A9WER9_CHLAA/54-394.....QLIPLTTS...DQIL........----------------------------------------------------
A9WF91_CHLAA/60-360.......EPLLMG...EEVY........----------------------------------------------------
B0C874_ACAM1/207-507.......QFLVEQ...YNLA..LIPSFS----------------------------------------------------
B2IXC0_NOSP7/1396-1691.......GFLVEK...YSIG..LMPSIS----------------------------------------------------
B2IZZ4_NOSP7/695-973.......KYLIEH...YAIS..IAYESK----------------------------------------------------
B2JAK0_NOSP7/526-830.......QYLIEK...YEIF..YLPSVT----------------------------------------------------
B2JAM9_NOSP7/866-1190.....KLQPLLVE...HEIV..NAPSAS----------------------------------------------------
B3QB04_RHOPT/774-1131FTSYRDVPWLARS...HAVT..TVPSAA----------------------------------------------------
B4JKU3_DROGR/1402-1700......GEYLSER...CALL..TAPSLQ----------------------------------------------------
B4VHH6_9CYAN/1150-1443.......QFLIEN...YSLS..MIPTFS----------------------------------------------------
B4VJ14_9CYAN/646-949.......RYLVET...YSFT..YLTSGR----------------------------------------------------
B4VJ30_9CYAN/3784-4081.......NFLVEK...YSVG..LMPSLS----------------------------------------------------
B4VLG1_9CYAN/97-405.......RPLATG...TDVA..FSRYQL----------------------------------------------------
B4VLY5_9CYAN/1558-1850.......QFLIEK...YSAG..LMPSIS----------------------------------------------------
B4VPE9_9CYAN/1179-1471.......GFIVER...YSIG..FMPSLS----------------------------------------------------
B4VQD3_9CYAN/1443-1735.......GFLIER...YSVG..LMPSLS----------------------------------------------------
B4VQK8_9CYAN/1658-1953.......DFIVRR...YSVS..LMPSVS----------------------------------------------------
B4VTQ2_9CYAN/1746-2036.......QFLIEN...YSVG..IMPSLS----------------------------------------------------
B4VXN8_9CYAN/1368-1663.......NFLIEN...YSVN..LIPSFS----------------------------------------------------
B4VXQ8_9CYAN/1752-2046.......QFLVEK...YSIG..SIPSMS----------------------------------------------------
B4VYA5_9CYAN/647-942.......QFLIEH...YSIG..SIPSFS----------------------------------------------------
B4WMI9_9SYNE/695-1035.......SYLIET...YQIS..YLSSGR----------------------------------------------------
B6C3H2_9GAMM/45-361......MTTLSER...MAVS..VTPSAV----------------------------------------------------
B8G8X7_CHLAD/58-398.....RPQPLATS...DQVL........----------------------------------------------------
B8GD94_CHLAD/102-415.......TPLLTE...RRLS........----------------------------------------------------
C3Z401_BRAFL/1278-1602......NECLYER...YGLV..VTPSIQ----------------------------------------------------
F0SR63_PLABD/137-574................YVVS..YCPSAT----------------------------------------------------
F7UL61_SYNYG/155-456.......EYLLEK...YSLT..NIPAFN----------------------------------------------------
F7ULD2_SYNYG/1449-1747......GQYLIED...YSVG..LMPSLS----------------------------------------------------
F7UQF5_SYNYG/591-904.....PPTYLTDR...HELV..TMPSAS----------------------------------------------------
Q01RE6_SOLUE/865-1136.......FWLAEQ...HPIG..VISGLA----------------------------------------------------
Q024J7_SOLUE/541-814.......RYLIQE...VTLS..LAPSLA----------------------------------------------------
Q025F1_SOLUE/607-877.......AHLLER...QTVF..YAPSLT----------------------------------------------------
Q028B5_SOLUE/667-935.......RYLMED...RAIF..YTPSLS----------------------------------------------------
Q02DA1_SOLUE/510-786.......HYVGER...FAIT..IAAGLA----------------------------------------------------
Q10YT7_TRIEI/1003-1309.......RFLVEN...YSFT..YLSSGR----------------------------------------------------
Q10YU6_TRIEI/544-838......ERYLVER...YAIA..VAPSLE----------------------------------------------------
Q112V9_TRIEI/62-390.....GQIYFATN...RKLS..FYRRRY----------------------------------------------------
Q113D1_TRIEI/130-430.......DYLGAS...............----------------------------------------------------
Q113U8_TRIEI/3002-3297.......QFLIEK...YSLS..LIPSIS----------------------------------------------------
Q115J8_TRIEI/1466-1777....NPEKKYLQDYFNQGVS..YAPSCQ----------------------------------------------------
Q117G6_TRIEI/881-1206.......QYLVEN...YSIT..YLSSGR----------------------------------------------------
Q119J2_TRIEI/1474-1770.......QFLVEK...YSLG..LIPSFT----------------------------------------------------
Q16H64_AEDAE/1315-1614......GEYLSER...CSLL..TVPSLH----------------------------------------------------
Q2G6U6_NOVAD/692-1020PFDFTGVEWLGRG...REVS..IAVSPR----------------------------------------------------
Q2S6G2_SALRD/540-844...HEQARFVLHE...RPTA..LDLSAS----------------------------------------------------
Q2W535_MAGSA/875-1218.......KYLIER...IDLH..VLNSSR----------------------------------------------------
Q38C46_TRYB2/1044-1397.......NFVIED...FAFQ..LGFS..----------------------------------------------------
Q3AQG5_CHLCH/44-362.......GFLARH...EGFT........----------------------------------------------------
Q4C5K3_CROWT/405-717.......NLSLAETFKQGIQ..YSPSCQ----------------------------------------------------
Q4S217_TETNG/1205-1537......NEYLYER...FSLI..CVPSLC----------------------------------------------------
F7URX2_SYNYG/165-457.......KFLAEQ...YAIT..RIPGFN----------------------------------------------------
Q5LLA3_RUEPO/680-970......GTYLATE....DVH..FIRNV.----------------------------------------------------
Q64CV3_9ARCH/59-374.......DFLVPS....QIH........----------------------------------------------------
Q7NCT1_GLOVI/600-923.......HPLLQD...HTLT..YLVSGR----------------------------------------------------
Q7NF67_GLOVI/550-854.......RFLVER...FTIQ..YLGSGR----------------------------------------------------
Q7NFD7_GLOVI/666-979.......HYLIEK...YTLS..YLNAGR----------------------------------------------------
Q7NIF7_GLOVI/691-997.......RYLLER...FELV..YLSSGR----------------------------------------------------
Q7NJE3_GLOVI/660-988.......RSLLQR...YALT..YLVSGR----------------------------------------------------
Q7NLR0_GLOVI/653-961.......RYLVEN...YTIS..YLSSGR----------------------------------------------------
Q7NVB0_CHRVO/67-386....GAGQHLLLQ............AQR----------------------------------------------------
Q82I85_STRAW/1175-1481......RRYALQA...AEIS..YAASAR----------------------------------------------------
Q82L10_STRAW/969-1256.....ADAAVLDR...VASS..YTPTLR----------------------------------------------------
Q8DGG5_THEEB/541-835.......RYLVES...YWIT..LLTSGR----------------------------------------------------
Q8DH74_THEEB/570-891.......RYLVQS...YTIT..LLTSGR----------------------------------------------------
Q8DHI1_THEEB/67-394.....QSAFSREQASFFGLGNFILPPP.----------------------------------------------------
Q8DIE5_THEEB/1127-1420.......GFLVER...FSMA..LVPSLR----------------------------------------------------
Q8YZU5_NOSS1/56-340......SRYLTEK...YAVA..TTSSLQ----------------------------------------------------
TTC28_HUMAN/1390-1713......NEYLYER...FGLL..AVPSIR----------------------------------------------------

PF03568

T1IUX7_STRMM/1624-1980-------VWWDKR---RKLN------------------------------------------------------------
G8BT64_TETPH/1165-1563-------QWWKSR---YDLD------------------------------------------------------------
S6EFD3_ZYGB2/1145-1542-------AWWETR---YRLD------------------------------------------------------------
Q2LZN6_DROPS/172-538-------KYWEEL---NGFD------------------------------------------------------------
A5DNR9_PICGU/1178-1576-------KWWSTR---FGLD------------------------------------------------------------
H2VRL7_CAEJA/706-1062-------MFWERR---RFVD------------------------------------------------------------
G4N8I2_MAGO7/1627-2057-------AWWSHR---EELD------------------------------------------------------------
J3P7L5_GAGT3/1606-2054-------EWWAER---EELD------------------------------------------------------------
Q6ZHH8_ORYSJ/455-870-------KWWSHR---MKLN------------------------------------------------------------
G3N6G2_GASAC/1731-2077-------KWWEGR---RVLD------------------------------------------------------------
I7LUG5_TETTS/2027-2414-------NWWKSR---YSND------------------------------------------------------------
M7T4Q8_EUTLA/44-499-------VWWTER---EELD------------------------------------------------------------
A3GFF5_PICST/1168-1555-------NWWRLR---FSLD------------------------------------------------------------
N4UZ87_COLOR/1637-2043-------AWWKRR---EELD------------------------------------------------------------
Q5A8X8_CANAL/1101-1536-------QWWRSR---FTLD------------------------------------------------------------
W1QIM9_OGAPD/1167-1527-------NWWAQR---KSLD------------------------------------------------------------
Q75EJ0_ASHGO/1152-1552-------EWWEER---YSLD------------------------------------------------------------
C5MEH0_CANTT/925-1303-------QWWRSR---FTLD------------------------------------------------------------
M7XLD2_RHOT1/1703-2100-------AWWAER---KELD------------------------------------------------------------
G0RRT6_HYPJQ/1566-1971-------AWWAER---QALD------------------------------------------------------------
BIMB_EMENI/1609-2004-------EWWKNR---EALD------------------------------------------------------------
G3B782_CANTC/1213-1609-------NWWRLR---FSLD------------------------------------------------------------
G2X6M8_VERDV/1704-2113-------AWWQER---EALD------------------------------------------------------------
S8BGE7_PENO1/1622-2018-------EWWTNR---EALD------------------------------------------------------------
G2R9B0_THITE/1619-2058-------AWWAER---EALD------------------------------------------------------------
B6GZP8_PENCW/1602-1998-------EWWKTR---EALD------------------------------------------------------------
K5WME3_PHACS/1732-2136-------AWWADR---AALD------------------------------------------------------------
ESP1_ARATH/1641-2060-------LWWKKR---KKLN------------------------------------------------------------
M7PDE3_PNEMU/1489-1882-------VWWKER---QELD------------------------------------------------------------
S9X830_SCHCR/1385-1771-------SWWKQR---RELD------------------------------------------------------------
H6C6Q4_EXODN/1587-1987-------AWYNER---KALD------------------------------------------------------------
L8G205_PSED2/1652-2056-------AWWAER---DELN------------------------------------------------------------
Q23491_CAEEL/749-1101-------ECWDRR---KIVD------------------------------------------------------------
C1H4J8_PARBA/1619-2021-------EWWAAR---KSLD------------------------------------------------------------
G0WDN6_NAUDC/1191-1589-------EWWDLR---HELD------------------------------------------------------------
C5DU01_ZYGRC/1141-1538-------MWWETR---YDLD------------------------------------------------------------
M0UBW7_MUSAM/65-479-------SWWSQR---TMLN------------------------------------------------------------
B9GZR1_POPTR/1674-2094-------LWWTKR---KELD------------------------------------------------------------
K3Z105_SETIT/1078-1484-------RWWSHR---MKLN------------------------------------------------------------
J3KEJ6_COCIM/1641-2042-------EWWANR---EALD------------------------------------------------------------
C5FSW7_ARTOC/1655-2058-------EWWANR---ENLD------------------------------------------------------------
B6QNB5_PENMQ/1619-2016-------QWWATR---ESLD------------------------------------------------------------
K7H1P7_CAEJA/245-604-------TFWERR---KGVD------------------------------------------------------------
C5XYE8_SORBI/457-870-------RWWSHR---IRLN------------------------------------------------------------
Q6CQQ7_KLULA/1118-1516-------NWWDER---YALN------------------------------------------------------------
N1JFH1_BLUG1/1598-2001-------MWWEER---EALD------------------------------------------------------------
H3DAQ7_TETNG/1711-2057-------KWWEGR---RALD------------------------------------------------------------
ESPL1_MOUSE/1716-2065-------VWWTGR---LALD------------------------------------------------------------
M2R2K9_CERS8/1618-2024-------AWWTDR---RALD------------------------------------------------------------
A8NBE9_COPC7/1839-2276-------NWWRQR---NELD------------------------------------------------------------
J9JSJ3_ACYPI/139-490-------AIRNLR---DSAS------------------------------------------------------------
K4B224_SOLLC/1600-2023-------SWWKWR---KQLD------------------------------------------------------------
J0DCK6_AURDE/1634-2046-------AWWAAR---NELD------------------------------------------------------------
W1NKX2_AMBTC/1-423-------IWWNWR---TKLN------------------------------------------------------------
T1K7Z5_TETUR/1001-1362-------TFWSAR---TALD------------------------------------------------------------
G0VFB3_NAUCC/1164-1562-------TWWKSR---YELD------------------------------------------------------------
J7RG90_KAZNA/1160-1562-------KWWQSR---YQLD------------------------------------------------------------
M3HH45_CANMX/1423-1797-------SWWRSR---FTLD------------------------------------------------------------
Q2H6Q9_CHAGB/1612-2026-------AWWTER---EALD------------------------------------------------------------
S8E105_FOMPI/1678-2083-------AWWAAR---GALD------------------------------------------------------------
Q6CCJ0_YARLI/1210-1588-------AWWAKR---HELD------------------------------------------------------------
G8YBL5_PICSO/1309-1719-------TWWKIR---FALD------------------------------------------------------------
I1MDQ8_SOYBN/1648-2063-------LWWKRR---KNLD------------------------------------------------------------
G7E6G1_MIXOS/1513-1914-------SWWQIR---QALD------------------------------------------------------------
G8B5X7_CANPC/1052-1424-------KWWKTR---FTLD------------------------------------------------------------
E9ETV5_METAR/1601-2008-------AWWAER---EALD------------------------------------------------------------
Q5KMS4_CRYNJ/188-600-------EWWAER---RALD------------------------------------------------------------
W5GJD2_WHEAT/891-1304-------RWWSDR---MKLN------------------------------------------------------------
M3ZIW2_XIPMA/1768-2114-------KWWEGR---RALD------------------------------------------------------------
Q2USV7_ASPOR/1630-2030-------DWWKNR---EALD------------------------------------------------------------
M7TX51_BOTF1/1640-2041-------AWWAER---AELD------------------------------------------------------------
D5GKQ4_TUBMM/1633-2033-------EWWKQR---ESLD------------------------------------------------------------
A7RYA6_NEMVE/1651-2034-------EWCQRR---SNLD------------------------------------------------------------
J4GX56_FIBRA/504-917-------TWWAGR---SALD------------------------------------------------------------
K1X2E6_MARBU/1659-2061-------AWWEER---EALD------------------------------------------------------------
E3LM18_CAERE/731-1090-------EFWKRR---KVVD------------------------------------------------------------
I2H0Y5_TETBL/1280-1677-------SWWKQR---HDLD------------------------------------------------------------
CUT1_SCHPO/1383-1770-------TWWKER---RHLD------------------------------------------------------------
A5DVQ7_LODEL/1109-1530-------GWWKQR---FTLD------------------------------------------------------------
C4QYS2_PICPG/1259-1619-------DWWKER---RELD------------------------------------------------------------
S3CR95_OPHP1/1758-2208-------DWWSER---EELD------------------------------------------------------------
H2B1L5_KAZAF/1161-1559-------AWWRKR---YDLD------------------------------------------------------------
G1KFP0_ANOCA/1819-2167-------DWWTGR---IALD------------------------------------------------------------
J3PN83_PUCT1/868-1252-------SWWQER---KDLD------------------------------------------------------------
V5GCB2_BYSSN/1684-2084-------EWWANR---EALD------------------------------------------------------------
K0K8V1_WICCF/1175-1568-------QWHQER---FELD------------------------------------------------------------
F0XAD9_GROCL/1636-2054-------AWWTER---TALD------------------------------------------------------------
J5K578_BEAB2/1584-1996-------AWWAER---ETLD------------------------------------------------------------
B4MLS6_DROWI/172-538-------KYWVDL---HEFG------------------------------------------------------------
Q6FTE1_CANGA/1151-1548-------NWWKRR---YDLD------------------------------------------------------------
F4PZT4_DICFS/1615-2074-------KWFQKR---KNLE------------------------------------------------------------
K2R7J5_MACPH/1619-2043-------EWWAER---EALD------------------------------------------------------------
C7YYU1_NECH7/1580-1992-------AWWAER---EALD------------------------------------------------------------
B4LBF1_DROVI/170-541-------KYWKEV---NAFE------------------------------------------------------------
K3Y3B2_SETIT/1404-1817-------RWWAHR---MKLN------------------------------------------------------------
G4UQF5_NEUT9/1626-2085-------AWWADR---EALD------------------------------------------------------------
B9SSN4_RICCO/1627-2045-------LWWMRR---KKLD------------------------------------------------------------
N1QAI8_MYCFI/1492-1912-------KWWSER---EALD------------------------------------------------------------
F4RLY9_MELLP/91-479-------TWWTER---KELD------------------------------------------------------------
R9AIE1_WALI9/1639-2036-------AWWNKR---KTLD------------------------------------------------------------
G3VPI8_SARHA/1713-2063-------KWWATR---LKLD------------------------------------------------------------
R8BFS3_TOGMI/72-487-------AWWADR---AALD------------------------------------------------------------
G4T5A4_PIRID/1472-1874-------RWWAER---SELD------------------------------------------------------------
B0E1W0_LACBS/104-540-------NWWKLR---GDLD------------------------------------------------------------
N1QHR1_SPHMS/1187-1599-------NWWSER---EALD------------------------------------------------------------
C4XY11_CLAL4/1177-1564-------NWWKMR---FELD------------------------------------------------------------
S8C8B1_DACHA/1639-2040-------KWWSER---EVLD------------------------------------------------------------
E4ZTB4_LEPMJ/1652-2063-------QWWTER---EALD------------------------------------------------------------
M4DS49_BRARP/1599-2019-------SWWKKR---KTLD------------------------------------------------------------
F8PLA9_SERL3/1278-1688-------AWWADR---SALD------------------------------------------------------------
V2X3W8_MONRO/1588-2040-------KWWKER---GTLD------------------------------------------------------------
B6K0I6_SCHJY/1359-1747-------RWWKER---RELD------------------------------------------------------------
G5ED39_CAEEL/727-1081-------EFWKRR---KIVD------------------------------------------------------------
Q9VRN6_DROME/171-538-------KYWEEL---NGFD------------------------------------------------------------
C5XSY3_SORBI/1425-1832-------RWWSHR---KKLN------------------------------------------------------------
I4YB88_WALSC/1631-2030-------DWWNCR---KHLD------------------------------------------------------------
S2JJU0_MUCC1/1578-1988-------HWWNTR---KSLD------------------------------------------------------------
T1FT05_HELRO/413-770-------EWWDRR---QSLD------------------------------------------------------------
C5DHM1_LACTC/1178-1575-------RWWQYR---YELD------------------------------------------------------------
G0SHM3_CHATD/1723-2150-------KWWAER---EALD------------------------------------------------------------
A8PX94_MALGO/1441-1824-------VWWTHR---RALD------------------------------------------------------------
S3D029_GLAL2/1639-2043-------QWWEER---DELD------------------------------------------------------------
H3B3H1_LATCH/1699-2055-------IWWEGR---ADLD------------------------------------------------------------
B4J0F9_DROGR/174-539-------KYWKEL---NAFE------------------------------------------------------------
W4Y9R2_STRPU/1031-1383-------VWWTTR---QRLD------------------------------------------------------------
Q4WUU6_ASPFU/1638-2039-------EWWRNR---EALN------------------------------------------------------------
U1G8A9_ENDPU/1638-2036-------LWWATR---EALD------------------------------------------------------------
Q6BTB7_DEBHA/1338-1753-------NWWKLR---FSLD------------------------------------------------------------
G7XGU8_ASPKW/1627-2026-------DWWKNR---EALD------------------------------------------------------------
F6VXN8_XENTR/1732-2080-------EWWEGR---MELD------------------------------------------------------------
H2L8K9_ORYLA/1692-2038-------LWWEGR---RALD------------------------------------------------------------
R7YNT5_CONA1/1696-2117-------GWWAER---EALD------------------------------------------------------------
I3KSG7_ORENI/1715-2061-------KWWEGR---RALD------------------------------------------------------------
F7BUI1_CALJA/1724-2073-------EWWTGR---LALD------------------------------------------------------------
U5HB45_USTV1/1850-2253-------AWWAER---KELD------------------------------------------------------------
D8Q1W5_SCHCM/1450-1878-------NWWKER---AGLD------------------------------------------------------------
U3IXX7_ANAPL/1332-1679-------EWWLCR---SELD------------------------------------------------------------
N1PZ16_MYCP1/1513-1936-------NWWAER---EALD------------------------------------------------------------
G3AGZ6_SPAPN/1149-1535-------KWWKLR---FELD------------------------------------------------------------
F0UL09_AJEC8/1642-2044-------EWWATR---QSLD------------------------------------------------------------
U4LG69_PYROM/1616-2019-------TWWTER---QQLD------------------------------------------------------------
M1WFQ9_CLAP2/1438-1889-------AWWAER---EALD------------------------------------------------------------
G8ZWZ1_TORDC/1158-1555-------KWWQTR---YELD------------------------------------------------------------
ESP1_YEAST/1175-1571-------SWWTTR---YDLD------------------------------------------------------------

PF01364

KGP83_PORGN/244-595.............---.DVISGEKG.......................................................
D1JG83_9ARCH/891-1295SLVEDYLPQDFID---ALNDPKIQEKITLLAQEGY.............................................
A2U064_9FLAO/401-768.YKDR..IAANNN---I..VPVKLSTIS....................................................
Q7MTE2_PORGI/239-573.............---.KDIPAKI........................................................
D3HWT0_9BACT/400-777TPECR..NLNPDD---Y..LLCFESENS....................................................
Q5S3Q9_9FLAO/543-910.YKDR..VKNNTN---L..VPNLQSLGS....................................................
A9DMD5_9FLAO/555-923.YKDR..IEGNTN---I..VPVYQAFDS....................................................
B0VGA8_CLOAI/228-563...........NG---SYTIPTYTEQ......................................................
B7B5I7_9PORP/382-753TSAWK..SVDMSN---M..LLTYQTENS....................................................
B8FFM0_DESAA/254-600.............---.DKIPTHHTACATWN.................................................
A3U7G6_CROAH/540-908.YKDR..LQNNNL---I..IPTYQRLRS....................................................
D2QSX9_SPILD/414-786GGLVS..PAQLAN---M..VPVYESRES....................................................
A3HW99_9BACT/398-769NYFYRNNPSAFSF---QNLVPPGG........................................................
B0VHP2_CLOAI/234-563.............---.PQIPTLT........................................................
A8ZUB1_DESOH/278-656.............---.GIIPPRTLWCE....................................................
B0VIM2_CLOAI/182-528...........NG---TYAIPTNFIVSP....................................................
Q2Z0E1_9BACT/643-1013YRHY....LTTGI---ECFVPTYYTG......................................................
B3QXR8_CHLT3/734-1131........SYSTS---NDYVPTMHVQT.....................................................
C2MCN4_9PORP/405-781SQDWSARDFQLTE---F..LLTYQGENS....................................................
A4A325_9PLAN/24-399.....PGDQPTPE---APGVPTHLMDAVVN..................................................
A7NR84_ROSCS/499-867DYTD....RGAKN---VNLIPPYLAMV.....................................................
Q11Q36_CYTH3/558-932.YKNH..TGIGGN---F..VPTYESRES....................................................
Q7MX16_PORGI/272-637TDNTKVPTSFIHN---VSLIPSHPT.......................................................
A0B5K7_METTP/796-1154QELE.........---..GDP...........................................................
D0MH89_RHOM4/586-975RELWQ..KPTLKN---W..VPPYETVDS....................................................
A8UH97_9FLAO/539-910.YKDR..IRNNTN---L..VPSWYSTNS....................................................
B8KYL6_9GAMM/364-704...WERATPTGNS---RNLVPTEQVM......................................................
B8FIK5_DESAA/1139-1542.............---.TVVPARMCYIA....................................................
Q11US7_CYTH3/392-767SFYWTNTDFKNHF---VNLVPPFG........................................................
C6W101_DYAFD/326-680RKMK.....DSWQ---TDMVPNAG........................................................
A5FJM8_FLAJ1/544-914.YKNR..IANNNN---I..VPIYQALRS....................................................
Q7UG73_RHOBA/51-444....PDYDTPRNQ---PHQIPTWMIPAPVT..................................................
A3J247_9FLAO/540-919.YKNR..LFNNTN---I..VPVFHGFNPLASET...............................................
A9WIM0_CHLAA/500-869PRDY....LRRGW---PTLIPPYLAEV.....................................................
B0VHE7_CLOAI/227-554.............---DGTIAVTS........................................................
C6VT06_DYAFD/394-758...TQNEKMVREL---PGEVPTIG........................................................
C6X3N8_FLAB3/546-921.FRGK..NNPGSD---I..VPSYQSEES....................................................
A0LQH1_SYNFM/790-1132.YKN....VKGYR---DALVPPLMAD......................................................
A1ZVJ9_9BACT/406-774.YKDR..VANNTN---F..VPIYESRES....................................................
B0VHF1_CLOAI/214-595EGTD.........---................................................................
B0VIE7_CLOAI/193-598.....D.TVPVAY---VTPEPNGQ........................................................
C6W3P4_DYAFD/414-806...TRNDRINKEL---LNEVPTFS........................................................
B2RGP6_PORG3/408-787SVAWQKPYLQQTE---F..LLTFQAVNS....................................................
D2QJ99_SPILD/409-770RNNP.....SQSG---LDMVMTAG........................................................
A9B5Q8_HERA2/466-850PLNY....LGRNN---PNMIPPLPAYT.....................................................
D2QFF3_SPILD/397-745VKTA.....TD..---.DLVPTMG........................................................
B0VH03_CLOAI/589-939FSGF....SAPKN---K..LIVWQ........................................................
D2R2P5_PIRSD/21-411...PGSGTNIELR---RRCVPTYHVDAKVN..................................................
C6W0Z3_DYAFD/393-758LRNQS..PAQRAA---W..VPVYESRES....................................................
A3XQP5_LEEBM/552-929.YKDR..IDNNNN---L..VPTFNTYYS....................................................
C9RIY0_FIBSS/581-957.YRGK..ANIGEN---Y..IPPFE........................................................
Q2PY26_9BACT/412-780.MKGR..LSPDQN---Q..IPAFQSQAS....................................................
Q26FX7_FLABB/537-909.YKDR..ISIREN---I..VPSFHTAEA....................................................
B0VJT2_CLOAI/236-566...........SG---SYTIPANSA.......................................................
C6BTD6_DESAD/56-402.............---.DIVPPARFD......................................................
D2QE53_SPILD/328-1007FVYVSDPVPPIRK---CFKIPGQSIAKLRHDSSTGAFALRTVPDPQNPGKTKQVFDDTQPFRTLCNATSGKIISFNLNAS
A2BK55_HYPBU/159-551.............---.AEVPPVYVCSPILS.................................................
B0VHP1_CLOAI/283-636.............---.AQVPTNNG.......................................................
Q1Q1Y4_9BACT/620-970LASGTINYVPSQI---IETDELGE........................................................
C7PNY3_CHIPD/396-764.YKNR..IAGNTN---M..IPTWQSTIS....................................................
Q6LFY5_PHOPR/224-617.............---.EDIPGYEIVGHP...................................................
B3QVL4_CHLT3/688-1063.FRS....IKNDD---YEKLVTYQSDEV....................................................
A9B187_HERA2/552-907YADI....IGQPV---TNFIPPYLADV.....................................................
B3C566_9BACE/537-910TSSWK..NYRPEN---F..LLSYQSETS....................................................
B0VJY1_CLOAI/655-1014DNSP....SRIYN---L..IPVKKTWT.....................................................
B8G4Y1_CHLAD/584-1054.............---.QVLPYAQVEAGADKDYSQAP...........................................
A1ZEG7_9BACT/410-775SLNPRIIP.AHRG---QDLIPPFG........................................................
B0VF22_CLOAI/223-583DTVD.........---................................................................
A0LKV0_SYNFM/924-1265PKDH....LGRGL---VSFIPSLNGMD.....................................................
A8ZTD5_DESOH/257-648.............---.EFIPTHR........................................................
A9B8S0_HERA2/477-840PRDV....LGYGQ---PPLIPPYLAEV.....................................................
C3JBB2_9PORP/421-799SVHWESIGLQNTP---F..LLTYQSSNS....................................................
C9SW40_VERA1/279-917VNPPANNKSFWTG---SHLRIHAVNPGTWWGASTDNLLVRPDTGALIRYDAAGTSSSTSPGW..................
C9LI59_9BACT/509-899LTTT...KLNAAD---F..LLAYEAGPGDGQT................................................
B5ICF9_ACIB4/214-642..AVPPSYYWTDQ---YMYLLAYYGLS.....................................................
Y048_ARCFU/22-377.............---.DIVPPSYYAK.....................................................
A3I371_9BACT/360-725.YKGK..LGGRPN---I..VPTYSSRNS....................................................

PF11713

A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626--------------------------------------------------------------------------------

PF01650

VPEG_ARATH/59-330-------------------------------------------------------SGPN-DH-IF-IFYSDHGG------
A0CQC7_PARTE/19-285-------------------------------------------------------STRE-DN-IF-VYFSDHGS------
A2FXM6_TRIVA/13-267-------------------------------------------------------STAN-DN-VM-IFFDNHGG------
O24539_VICNA/53-325-------------------------------------------------------SKAE-DR-IF-IYCSDHGG------
HGLB_SCHMA/37-291-------------------------------------------------------SGKN-DD-VF-IYFTDHGA------
HGLB_SCHJA/31-285-------------------------------------------------------SGKN-DD-VF-IYFTDHGA------
VPE_VICSA/56-325-------------------------------------------------------SGPN-DH-IF-VYYTDHGG------
A0A022P416_PSEAI/341-579-------------------------------------------------------SGPE-DL-VF-IYLTSHGS------
Q08BI0_DANRE/27-278-------------------------------------------------------SKKN-DN-IL-IYMSGVGS------
Q0MYV8_EMIHU/33-301-------------------------------------------------------STKL-DR-VF-LNFVDHGG------
Q22P32_TETTS/20-285-------------------------------------------------------STEN-DN-VF-LYFSDHGA------
Q22P33_TETTS/20-285-------------------------------------------------------STSS-DN-VF-LYFADHGA------
D0MXB3_PHYIT/25-298-------------------------------------------------------STED-DR-VF-INFIDHGS------
Q2UVF3_HAECO/29-287-------------------------------------------------------STVN-DR-IF-VYFSDHGG------
Q4K5F2_PSEF5/335-570-------------------------------------------------------SGPE-DL-VF-IYLTSHGT------
Q4RED0_TETNG/30-283-------------------------------------------------------SGPN-DH-VF-VYFADHGA------
Q4UU48_XANC8/124-392-------------------------------------------------------DRKE-DA-LL-LFVTTHGT------
Q6EHZ7_TRIVA/12-258-------------------------------------------------------STTS-DN-VY-IYYDNHGG------
N9BI26_ACIBI/229-477-------------------------------------------------------NRES-DV-LF-LYMTSHGA------
Q6L4R2_ORYSJ/41-319-------------------------------------------------------SGPN-DH-VF-VYYADHGG------
Q6NYJ7_DANRE/32-288-------------------------------------------------------SGPN-DH-VF-VYFTDHGA------
Q6PRC7_IXORI/38-293-------------------------------------------------------SGPN-DH-VF-VFFADHGA------
Q711M2_FASHE/21-278-------------------------------------------------------TGPD-DN-VF-VYFTDHGA------
Q84LM2_ORYSJ/62-334-------------------------------------------------------SKPE-DH-IF-IYYSDHGG------
Q852T1_TOBAC/49-320-------------------------------------------------------SGPN-DH-IF-IFYSDHGG------
Q86TV2_HUMAN/29-286-------------------------------------------------------SGPQ-DH-VF-IYFTDHGS------
Q88QE3_PSEPK/400-640-------------------------------------------------------SGPE-DL-VF-IYLTSHGS------
Q8LGK2_ARATH/46-316-------------------------------------------------------SGPN-DN-IF-IYYADHGA------
Q949L7_BETVU/51-321-------------------------------------------------------SGPN-DH-IF-IFYSDHGG------
Q9LLQ4_SESIN/54-326-------------------------------------------------------SKPN-DR-IF-IYYSDHGG------
Q9LWZ3_ORYSJ/41-304-------------------------------------------------------SGPN-DH-IF-VYYSDHGS------
Q9SBX2_MAIZE/45-317-------------------------------------------------------SGPN-DH-IS-VFYSDHGG------
Q9SMD0_SOLLC/39-316-------------------------------------------------------SGPN-DY-IF-IYYTDHGA------
Q9XG75_TOBAC/40-306-------------------------------------------------------NGPN-DY-IF-IYYADHGA------

PF00656

Q7QGM9_ANOGA/35-227-------------------------------------------------------..KN.SC.LI-VFIMSHGS......
ICENC_DROME/196-443-------------------------------------------------------..NT.EC.FV-MVLMTHGN......
O42284_CHICK/42-279-------------------------------------------------------..TS.DS.TF-LVFMSHGM......
CAS1A_XENLA/144-382-------------------------------------------------------..DS.DS.TF-IVLMSHGD......
CASPC_MOUSE/176-415-------------------------------------------------------..SS.DS.TF-LVFMSHGI......
CASP4_MOUSE/132-369-------------------------------------------------------..TS.DS.TF-LVLMSHGT......
CASP5_HUMAN/193-430-------------------------------------------------------..SS.DS.TF-LVLMSHGI......
CASPD_BOVIN/136-373-------------------------------------------------------..SS.DS.TF-LVFMSHGI......
CASP1_CANFA/163-400-------------------------------------------------------..SS.DS.TF-LVLMSHGI......
CASP1_FELCA/161-406-------------------------------------------------------..SS.DS.TF-LVFMSHGI......
CASP1_MOUSE/162-398-------------------------------------------------------..TS.DS.TF-LVFMSHGI......
CASP1_HUMAN/163-400-------------------------------------------------------..TS.DS.TF-LVFMSHGI......
CASP1_PIG/163-400-------------------------------------------------------..SS.DS.TF-LVLMSHGI......
Q9I9L7_DANRE/145-379-------------------------------------------------------..YS.DS.AF-VVIMSHGK......
Q9DDJ2_DANRE/174-400-------------------------------------------------------..DA.DS.TF-IVIMSHGT.....R
Q6NTR7_XENLA/280-494-------------------------------------------------------..NH.DI.FV-CIIISRGT......
CFLAR_MOUSE/257-480-------------------------------------------------------..DY.DS.FA-CVLVSLGG......
Q6QN97_PIG/259-484-------------------------------------------------------..DY.DS.FV-CVLVSRGG......
A0A024R3Z7_HUMAN/252-477-------------------------------------------------------..DY.DS.FV-CVLVSRGG......
Q9NBW3_DROME/38-248-------------------------------------------------------..QD.AG.FV-LFILSHGD......
Q9TZP5_CAEEL/26-261-------------------------------------------------------.....DS.LI-ITIMSHGD......
CASPE_MOUSE/22-256-------------------------------------------------------EEPV.SC.AF-VVLMAHGE......
B2CIS9_HUMAN/18-241-------------------------------------------------------EDPV.SC.AF-VVLMAHGR......
Q8I749_SUBDO/254-491-------------------------------------------------------..QY.DS.FV-CIIMTQGG......
CASP2_RAT/200-445-------------------------------------------------------..VT.DS.CI-VALLSHGV......
CASP2_CHICK/171-416-------------------------------------------------------..DV.DS.CI-VALLSHGV......
Q9GV89_HYDVU/93-318-------------------------------------------------------..PF.SA.LF-IVILSHGS......
Q9IB63_XENLA/144-396-------------------------------------------------------..LQ.DC.CL-VVILSHGC..ETRH
CASP9_HUMAN/161-413-------------------------------------------------------..AL.DC.CV-VVILSHGC..QASH
Q90WU0_CHICK/148-400-------------------------------------------------------..AL.DC.CL-VVILSHGC..QTSH
Q9IB64_XENLA/261-494-------------------------------------------------------..EK.DS.FV-CFILSHGG......
Q6E5N8_ICTPU/119-362-------------------------------------------------------..DG.DC.FV-CCIMSHGS......
Q9I8J3_DANRE/238-473-------------------------------------------------------..SM.GA.FV-CCILSHGE......
Q6PAD9_XENLA/268-495-------------------------------------------------------..ER.DC.FV-CCILTHGE......
Q90WU1_CHICK/237-479-------------------------------------------------------..NK.DC.FV-CCILSHGK......
CASP8_HUMAN/234-476-------------------------------------------------------..NM.DC.FI-CCILSHGD......
CASP8_MOUSE/236-478-------------------------------------------------------..NK.DC.FI-CCILSHGD......
Q9Y1U6_PRIPA/173-413-------------------------------------------------------..FT.SS.AI-VCILTHGE......
CED3_CAEEL/243-494-------------------------------------------------------.....DS.AI-LVILSHGE......
Q7QKT2_ANOGA/35-260-------------------------------------------------------..NN.DC.LA-IIAMAHGY......
Q7PZJ9_ANOGA/20-250-------------------------------------------------------..KS.DC.LV-IVAMAHGN......
Q9GV88_HYDVU/84-316-------------------------------------------------------..SM.SC.CV-VALLSHGE......
Q7Q1E0_ANOGA/62-291-------------------------------------------------------..DS.DC.FL-VAILTHGE......
CASP1_SPOFR/61-293-------------------------------------------------------..DA.DC.LL-VAVLTHGE......
CASP1_DROME/79-313-------------------------------------------------------..DN.DC.LA-VAILSHGE......
Q7Q4X6_ANOGA/73-309-------------------------------------------------------..DA.DC.LL-VTILSHGE......
ICE_DROME/94-328-------------------------------------------------------..DS.DC.IL-VAILSHGE......
Q9NHF9_DROME/56-302-------------------------------------------------------..QN.DC.FV-LAVMSHGT......
Q7Q803_ANOGA/54-306-------------------------------------------------------..NS.DC.LL-VVIMTHGD......
Q7PV92_ANOGA/14-237-------------------------------------------------------..HS.DC.LV-VVVMTHGK......
Q86FL0_ANOST/52-286-------------------------------------------------------..QS.DC.LV-VVIMTHGD......
Q8I6Y2_GEOCY/158-414-------------------------------------------------------..AY.DC.VV-VAILTHGI......
Q8ITP3_BRAFL/87-323-------------------------------------------------------..DV.DC.FA-CAILSHGE......
O88550_RAT/68-301-------------------------------------------------------..NS.AC.FA-CVLLSHGE......
Q6DCI2_XENLA/78-314-------------------------------------------------------..DS.AC.FA-CIFLSHGE......
Q8JIS8_ORYLA/58-285-------------------------------------------------------..KF.AS.FA-CVILSHGE......
CASP3_XENLA/56-280-------------------------------------------------------..KR.SS.FV-CAILSHGE......
O93417_CHICK/53-281-------------------------------------------------------..KR.SS.FV-CVLLSHGD......
Q98UI8_DANRE/48-280-------------------------------------------------------..RC.AS.LV-CVLLSHGD......
Q8JG42_TAKRU/51-279-------------------------------------------------------..AC.AS.FV-CVLLSHGD......
Q8ITP2_BRAFL/151-396-------------------------------------------------------..QS.DC.FV-CVFLSHGE......
Q9IB66_XENLA/58-298-------------------------------------------------------..NA.DC.FL-CVFLSHGE......
Q9I8S9_ONCMY/57-297-------------------------------------------------------..DA.DC.FV-CVFLSHGE......
O93415_CHICK/57-299-------------------------------------------------------..NA.DC.FV-CVFLSHGE......
CASP6_MOUSE/28-270-------------------------------------------------------..DA.DC.FI-CVFLSHGE......
PCP_DICDI/188-404-------------------------------------------------------..QS.YIEVV-VYYAGHGR......
Q53839_STRCH/9-268-------------------------------------------------------...T.DT.LL-VYYSGHGH......
A0A038IA40_BORBO/552-800-------------------------------------------------------..AG.DV.FM-FYVSTHGA......
Q7NPG1_GLOVI/7-278-------------------------------------------------------ANGKQDARRI-LYFSGHGF......
Q87Z21_PSESM/2-224-------------------------------------------------------..EA.DT.AL-LYFAGHGI...IVP