Sequence alignment for CL0093

PF01650

LGMN_HUMAN/29-286--------------H-----------------WVVIVAGSNG-----WYN----YRHQADACHAYQI-------------
VPED_ARATH/46-316--------------R-----------------WAVLVAGSNE-----YYN----YRHQADICHAYQI-------------
VPEG_ARATH/59-330--------------R-----------------WAVLVAGSSG-----YWN----YRHQADICHAYQL-------------
A0CQC7_PARTE/19-285--------------N-----------------WALLVSGSNA-----FYN----YRHQADVCHSYKT-------------
A2FXM6_TRIVA/13-267--------------T-----------------WAVIFCGSRD-----FYN----YRHTADSYYMYHL-------------
O24539_VICNA/53-325--------------R-----------------WAVLVAGSNG-----YGN----YRHQADVCHAYQL-------------
HGLB_SCHMA/37-291--------------K-----------------WAVLVAGSNG-----YPN----YRHQADVCHAYHV-------------
HGLB_SCHJA/31-285--------------K-----------------WAVLVAGSNG-----FEN----YRHQADVCHAYHV-------------
VPE_VICSA/56-325--------------R-----------------WAILLAGSNG-----YWN----YRHQSDVCHAYQL-------------
A0A080VK93_PSEAI/341-579--------------L-----------------YALSLGGDGR-----QGV----FLREAD..YAGDL-------------
Q08BI0_DANRE/27-278--------------A-----------------WVLLVAGSKD-----WDN----YRHQANVCCAYQL-------------
Q0MYV8_EMIHU/33-301--------------H-----------------WAVLIAGSSG-----YGN----YRHQADVCHAYQI-------------
Q22P32_TETTS/20-285--------------N-----------------YSVLVAGSKG-----YEN----YRHQADVCHAYHT-------------
Q22P33_TETTS/20-285--------------N-----------------YSVLVAGSKG-----YEN----YRHQADVCHAYQS-------------
D0MXB3_PHYIT/25-298--------------H-----------------WAVIVSGSNG-----YSN----YRHQSDACHAYHI-------------
Q2UVF3_HAECO/29-287--------------L-----------------YALLVAGSDG-----WWN----YRHQADVSHAYHT-------------
Q4K5F2_PSEF5/335-570--------------L-----------------YSLTLAGDGK-----QSV----FLREAD..YVSNM-------------
Q4RED0_TETNG/30-283--------------N-----------------WVVIVAGSNG-----WDN----YRHQADACHAYQI-------------
Q8P9N6_XANCP/124-392--------------L-----------------YVVGFAGDAS-----DDV----FRNETL..YLKQL-------------
Q6EHZ7_TRIVA/12-258--------------R-----------------FAVLIAGSND-----FYN----YRHQADIFNMYQQ-------------
Q6FEB2_ACIAD/229-477--------------W-----------------YFLGVAGASY-----QDV----FKSEIM..RIKDQ-------------
Q6L4R2_ORYSJ/41-319--------------R-----------------WAVLIAGSNG-----FYN----YRHQADVCHAYQI-------------
Q6NYJ7_DANRE/32-288--------------H-----------------WVVIVAGSNG-----WYN----YRHQADVCHAYQI-------------
Q6PRC7_IXORI/38-293--------------L-----------------WALLVAGSNG-----YYN----YRHQADICHAYHV-------------
Q711M2_FASHE/21-278--------------N-----------------WAVLVAGSNG-----WPN----YRHHADVCHAYQV-------------
VPE1_ORYSJ/62-334--------------R-----------------WAVLVAGSSG-----YGN----YRHQADVCHAYQI-------------
Q852T1_TOBAC/49-320--------------K-----------------WAVLVAGSRG-----YWN----YRHQADVCHAYQL-------------
Q88QE3_PSEPK/400-640--------------L-----------------YSLVVAGDGQ-----QSV----FLREAD..YVSRM-------------
Q949L7_BETVU/51-321--------------R-----------------WAVLIAGSSG-----YWN----YRHQADVCHAYQV-------------
Q9LLQ4_SESIN/54-326--------------R-----------------WAVLVAGSNG-----FGN----YRHQADVCHAYQI-------------
Q9LWZ3_ORYSJ/41-304--------------K-----------------WALLIAGSKG-----YEN----YRHQADVCHAYQI-------------
Q9SBX2_MAIZE/45-317--------------R-----------------WAVLIAGSNG-----YYN----YRHQADICHAYQI-------------
Q9SMD0_SOLLC/39-316--------------K-----------------WAVLVAGSKE-----WYN----YRHQANLCHAYQL-------------
Q9XG75_TOBAC/40-306--------------K-----------------WAVLVAGSNE-----WDN----YRHQADVCHAYQL-------------

PF00656

Q7QGM9_ANOGA/35-227--------------A-----------------YVLVF..HHD.....QFK....NPKN.........-------------
ICENC_DROME/196-443--------------G-----------------VLLMV..NIM.....DYP....DQNR.........-------------
O42284_CHICK/42-279--------------R-----------------RALLI..CNT.....KFK....HLR..........-------------
CAS1A_XENLA/144-382--------------G-----------------LALII..CNE.....KFE....NLN..........-------------
CASPC_MOUSE/176-415--------------R-----------------LALII..CNK.....KFD....YLF..........-------------
CASP4_MOUSE/132-369--------------R-----------------KALII..CNT.....EFK....HLS..........-------------
CASP5_HUMAN/193-430--------------R-----------------LALII..CNT.....KFD....HLP..........-------------
CASPD_BOVIN/136-373--------------R-----------------LALII..CNT.....EFD....HMP..........-------------
CASP1_CANFA/163-400--------------R-----------------LALII..CNI.....EFD....HLS..........-------------
CASP1_FELCA/161-406--------------R-----------------LALII..CNT.....TFD....HLS..........-------------
CASP1_MOUSE/162-398--------------R-----------------LALII..CNT.....EFQ....HLS..........-------------
CASP1_HUMAN/163-400--------------R-----------------LALII..CNE.....EFD....SIP..........-------------
CASP1_PIG/163-400--------------R-----------------LALII..CNT.....EFE....NLP..........-------------
Q9I9L7_DANRE/145-379--------------R-----------------LALLI..NNV.....DFD....DKAM.........-------------
Q9DDJ2_DANRE/174-400--------------G-----------------LALLI..TNI.....QFA....NTQH.........-------------
Q6NTR7_XENLA/280-494--------------G-----------------FCLII..DCV.........................-------------
CFLAR_MOUSE/257-480--------------G-----------------ICLII..DCI.........................-------------
Q6QN97_PIG/259-484--------------G-----------------ICLII..DCV.........................-------------
CFLAR_HUMAN/252-477--------------G-----------------ICLII..DCI.........................-------------
Q9NBW3_DROME/38-248--------------P-----------------AVYIL..NHE.....QFP....QDS.......QL.-------------
Q9TZP5_CAEEL/26-261--------------C-----------------RAIII..NNV.....VFC....GME..........-------------
CASPE_MOUSE/22-256--------------R-----------------LALTL..CVT.......K.................-------------
CASPE_HUMAN/18-241--------------R-----------------LALIL..CVT.......K.................-------------
Q8I749_SUBDO/254-491--------------G-----------------ICLII..NNH.....QFY....HSDPE.....KCH-------------
CASP2_RAT/200-445--------------G-----------------LALVM..SNV.....HFT.GEKDLE..........-------------
CASP2_CHICK/171-416--------------G-----------------LALIL..SNI.....HFS.SEKDLE..........-------------
Q9GV89_HYDVU/93-318--------------G-----------------FVLII..NNE.....KFV....EEE..........-------------
Q9IB63_XENLA/144-396--------------G-----------------FCLII..NNM.....NFH.ECTGLS..........-------------
CASP9_HUMAN/161-413--------------G-----------------HCLII..NNV.....NFC.RESGLR..........-------------
Q90WU0_CHICK/148-400--------------G-----------------HCLIF..NNV.....SFS.RDSDLS..........-------------
Q9IB64_XENLA/261-494--------------G-----------------WCVVI..NNY.....DFK....EARS...QDCKYT-------------
Q6E5N8_ICTPU/119-362--------------G-----------------FCVII..NNV.....NFA....SPLK.........-------------
Q9I8J3_DANRE/238-473--------------G-----------------YCLII..NNY.....NFL....ESTN.......LL-------------
Q6PAD9_XENLA/268-495--------------G-----------------YCLII..DNS.....IFA....KGK..........-------------
Q90WU1_CHICK/237-479--------------G-----------------VCLIL..NNH.....NFA....KAREAVPELRRMK-------------
CASP8_HUMAN/234-476--------------G-----------------YCLII..NNH.....NFA....KAREKVPKLHSIR-------------
CASP8_MOUSE/236-478--------------G-----------------YCLII..NNH.....DFS....KAREDITQLRKMK-------------
Q9Y1U6_PRIPA/173-413--------------G-----------------YALII..SNE.....HFR....TMP..........-------------
CED3_CAEEL/243-494--------------G-----------------MCLII..NNE.....HFE....QMP..........-------------
Q7QKT2_ANOGA/35-260--------------G-----------------IAVVI..NNN.......R.................-------------
Q7PZJ9_ANOGA/20-250--------------G-----------------IAVVI..NDS.......E.................-------------
Q9GV88_HYDVU/84-316--------------G-----------------TLTII..NVK.....NFM....KSSN......KHE-------------
Q7Q1E0_ANOGA/62-291--------------G-----------------MALIF..SHN.....KYNVRNVSLP..........-------------
CASP1_SPOFR/61-293--------------G-----------------MAIIF..NHE.....HFD..IHSLK..........-------------
CASP1_DROME/79-313--------------G-----------------VALIF..NHE.....FFD..IPSLK..........-------------
Q7Q4X6_ANOGA/73-309--------------G-----------------LALIF..NHE.....NFD..VPQLR..........-------------
DRICE_DROME/94-328--------------G-----------------MALIF..NHE.....HFE..VPTLK..........-------------
Q9NHF9_DROME/56-302--------------G-----------------IALIL..NHK.....DVK....GQK..........-------------
Q7Q803_ANOGA/54-306--------------G-----------------VAAVF..NHR.....KFL....HAS..........-------------
Q7PV92_ANOGA/14-237--------------G-----------------IALII..NQV.....IFS....SMA..........-------------
Q86FL0_ANOST/52-286--------------G-----------------IAIII..NQV.....NFS....GMA..........-------------
Q8I6Y2_GEOCY/158-414--------------G-----------------MALII..NNR.....NFT...CGMK..........-------------
Q8ITP3_BRAFL/87-323--------------G-----------------QAIII..NNK.....DFE.KHTGMN..........-------------
O88550_RAT/68-301--------------G-----------------KCIII..NNK.....NFD.KATGMD..........-------------
Q6DCI2_XENLA/78-314--------------G-----------------RCIII..NNK.....IFD.KITGMG..........-------------
Q8JIS8_ORYLA/58-285--------------G-----------------ICLII..NNK.....NFH.KDSGMG..........-------------
CASP3_XENLA/56-280--------------G-----------------MCLII..NNK.....NFH..SSNMA..........-------------
O93417_CHICK/53-281--------------G-----------------VCVII..NNK.....NFH.RDTGLS..........-------------
Q98UI8_DANRE/48-280--------------G-----------------HCIII..NNK.....NFD.RRTGMN..........-------------
Q8JG42_TAKRU/51-279--------------G-----------------HCIII..NNK.....NFD.RRTGMN..........-------------
Q8ITP2_BRAFL/151-396--------------G-----------------LCLVF..DNE.....EFH.WTTKMN..........-------------
Q9IB66_XENLA/58-298--------------G-----------------LALIF..NHE.....DFY.WQLRLG..........-------------
Q9I8S9_ONCMY/57-297--------------G-----------------LALIF..NQE.....HFF.WHLRMP..........-------------
O93415_CHICK/57-299--------------G-----------------VALIF..NHE.....HFF.WHLRLP..........-------------
CASP6_MOUSE/28-270--------------G-----------------VALIF..NHE.....RFF.WHLTLP..........-------------
PCP_DICDI/188-404--------------R-----------------ISFII..GNS.....KYS....QHR..........-------------
Q7AKE1_STRCO/9-268--------------S-----------------RVVLV..GVA.....DYD.....HL....P.....-------------
A0A063TRB6_BORBO/552-800--------------.-----------------HAMIV..GIN.....EFG....EASL.........-------------
Q7NPG1_GLOVI/7-278--------------.-----------------KALIV..AIN.....DYP....GTTN.........-------------
Q87Z21_PSESM/2-224--------------K-----------------KALVI..GID.....NYP.....TA..........-------------
Q82I86_STRAW/5-276--------------.-----------------HALLV..GID.....DYP....SQTAT........-------------
P74453_SYNY3/40-299--------------K-----------------WALLLAAGQG.....NGA....NGDR.R.......-------------
Q8YS65_NOSS1/4-245--------------N-----------------WAIAI..GVN.....QYD....YLE..........-------------
Q9DDL2_DANRE/323-560--------------K-----------------VALLI..GNM.....NYL....HHR..........-------------
Q98CE0_RHILO/5-237--------------R-----------------VALVM..ADN.....DYR....LVR..........-------------
Q6N0T4_RHOPA/30-250--------------R-----------------VALVI..GNS.....KYP....DADK.........-------------
Q89XG2_BRADU/27-247--------------R-----------------YALVI..GNA.....KYP....DADA.........-------------
Q89XE4_BRADU/58-278--------------R-----------------LALVI..GNG.....HYP....DANA.........-------------
Q6NBN5_RHOPA/57-277--------------R-----------------LALVI..GNA.....HYP....DAAS.........-------------
Q98JS7_RHILO/35-253--------------R-----------------AAIVV..GNS.....EYP.....FA..........-------------
Q985X8_RHILO/35-256--------------R-----------------LAFVI..GNA.....AYP.....SG..........-------------
Q6N5Q1_RHOPA/33-253--------------R-----------------IALVI..GNG.....AYA.....KA..........-------------
Q89KP2_BRADU/86-307--------------R-----------------IALVV..GNG.....AYA.....KS..........-------------
Q89IK1_BRADU/30-253--------------R-----------------VALVI..GNG.....AYA....STA..........-------------
Q98G71_RHILO/26-252--------------R-----------------VALVI..GNG.....TYA....EAG..........-------------
Q6AKF4_DESPS/28-248--------------R-----------------IALII..GNS.....DYR.....IR..........-------------
Q98IJ6_RHILO/11-238--------------R-----------------IALVL..GNS.....QYQ....HAA..........-------------
Q89MV1_BRADU/176-400--------------R-----------------IALVV..GNS.....AYK....NIT..........-------------
Q89HT8_BRADU/51-272--------------R-----------------VALVI..GNS.....NYQ....NAP..........-------------
Q89FZ4_BRADU/32-256--------------R-----------------LALVI..GQS.....AYR....TVP..........-------------
Q6N329_RHOPA/73-298--------------R-----------------VALVI..GQS.....AYR....AVP..........-------------
Q98IJ9_RHILO/30-261--------------R-----------------VALVI..GNS.....KYV....NAV..........-------------
Q89HP3_BRADU/336-569--------------R-----------------MALII..GNG.....AYA....HVK..........-------------
Q7RFI8_PLAYO/964-1364--------------K-----------------KAVVI..GCN......YM.....GEKDSIN.....-------------
Q74F93_GEOSL/6-270--------------.-----------------.ALAL..GLNAVDPKHYG.....GWA...G.....-------------
MCA9_ARATH/10-321--------------R-----------------LAVLV..GCN......YP.....NTR...N.....-------------
MCA8_ARATH/3-378--------------K-----------------KALLI..GIN......YP.....GTA...V.....-------------
MCA7_ARATH/3-401--------------K-----------------RALLI..GIN......YP....GTTE.........-------------
Q70VV0_PICAB/3-415--------------K-----------------KAVLV..GCN......YP....GTKA.........-------------
Q9ZSP8_HEVBR/3-415--------------K-----------------KAVLI..GIN......YP....GTKA.........-------------
MCA4_ARATH/3-416--------------K-----------------KAVLI..GIN......YP....GTKA.........-------------
MCA5_ARATH/3-408--------------K-----------------KAVLI..GIN......YP....GTKA.........-------------
MCA6_ARATH/3-366--------------K-----------------KALLI..GIN......YV....GTKA.........-------------
MCA1_ARATH/80-362--------------K-----------------RAVIC..GIS......YR.....FSR...H.....-------------
MCA2_ARATH/116-414--------------K-----------------RAVIV..GVS......YK....NTKD.........-------------
MCA1_SCHPO/130-422--------------R-----------------KALLI..GIN......YL.....NTQ...N.....-------------
MCA1_YARLI/168-458--------------K-----------------KALLI..GCN......YI....GSKN.........-------------
MCA1_DEBHA/146-437--------------K-----------------KALLV..GIN......YT.....GSK...N.....-------------
MCA1_ASHGO/154-449--------------R-----------------KALLI..GIN.....YFN....SSA..........-------------
MCA1_KLULA/138-430--------------R-----------------KALLI..GIN......YF.....GSA...N.....-------------
MCA1_CANGA/98-389--------------R-----------------KALLI..GIN......YI.....GSK...N.....-------------
B5VS82_YEAS6/157-450--------------R-----------------KALII..GIN......YI.....GSK...N.....-------------
Q386I9_TRYB2/84-341--------------.-----------------RALFI..GID......YK....GTPA.........-------------
Q38D34_TRYB2/63-322--------------.-----------------KALFI..GIN......YT....GSSA.........-------------
Q8T8E6_9TRYP/84-343--------------.-----------------RALFI..GIN......YY.....GTS...A.....-------------

PF14538

W1QFK7_OGAPD/56-210-----------KKTT-----------------TAALVMCLNLGIPPPDI....QKPAD...YPVLEA-------------
L8WVZ0_THACA/73-224-----------LRTA-----------------RAALVVCLNIGVDPPDV....VKTQP...CATLEC-------------
A2EZ34_TRIVA/89-236-----------.KVD-----------------CVYLMCSQSNLFPQPDSDY..FSRKP.....MLYM-------------
Q6C6R4_YARLI/86-238-----------QRTV-----------------SAAIVVCLNLGVDPPDV....IKTDP...CSRLEA-------------
M2WI96_DOTSN/172-328-----------LKTV-----------------SALLAVCLNVGVDPPDV....IKTNP...CARLEC-------------
K2S4T3_MACPH/104-258-----------LKTV-----------------SAVLALCLNIGVDPPDV....IKTNP...CAKLEC-------------
C4LXC3_ENTHI/42-194-----------VRTP-----------------HLIICCCLNIGTEPPGY....KKPKV...SSNTFG-------------
T1G0Q6_HELRO/62-216-----------MKTV-----------------SVALVLCLNIGVDPPDT....VKISP...CARQQC-------------
B0CNS4_LACBS/34-185-----------LKTA-----------------TAALVLCLNIDVDPPDI....IKTNP...CANLEC-------------
F0ZAV4_DICPU/115-266-----------MKTV-----------------SVALVLCLNIGVDPPDV....IKTYP...CARMEC-------------
U9UGJ5_RHIID/52-203-----------LKTV-----------------SGALVLCLNIGVDPPDV....VKPSP...CAKLEC-------------
Q5KIS3_CRYNJ/92-243-----------LKTV-----------------TAGLFICLNLGVDPPDI....VKTNP...CAKTEC-------------
B0WBU4_CULQU/30-181-----------....-----------------..LTSAHLNTAIQT.......VDVAGWELTERTNA-------------
A5DWK2_LODEL/143-295-----------QKTI-----------------SAVLVLCLNLGVDPPDV....MKTYP...CAKFEA-------------
G0VGR8_NAUCC/79-231-----------QKTV-----------------SAALLLCLNLGVDPPDL....VKTHP...CARMES-------------
I3J5N7_ORENI/57-208-----------MKTV-----------------SVALVLCLNVGVDPPDV....VKTSP...CARLEC-------------
A2DYM2_TRIVA/68-215-----------HQVA-----------------CAYLLCSSSIYFPPPDSEY..FTDKP.....TIYM-------------
D8TLK8_VOLCA/11-162-----------LKTT-----------------SVALVLCLNIGVDPPDV....IKISP...CARLEC-------------
G4M000_SCHMA/43-194-----------IKTL-----------------TVALVICLNIDIDPPDV....QKIPP...FSRVEA-------------
C1MUE6_MICPC/45-196-----------MKTT-----------------SVALVLCLNIGVDPPDV....LKISP...CARMQC-------------
Q387I9_TRYB2/89-240-----------....-----------------.LLLILCLNNGNDPPDF....SRIDP...CARLEC-------------
C4M2F5_ENTHI/38-189-----------IKTI-----------------HLILTLCLNIGTDSPDQ....IKQKD...SASKEC-------------
G4TT65_PIRID/72-223-----------LKTG-----------------NGAIVVCLNLDVDPPDV....VKTQP...CAVLEG-------------
G0NWW0_CAEBE/64-218-----------LRTA-----------------SVAIVMCLHLGVDPPEAPS..RKDAP....ARLLS-------------
A2DJF0_TRIVA/83-228-----------VPEG-----------------VHIHLNTLTRLIPG..........KP.QNRKFIHT-------------
K3WJU9_PYTUL/84-235-----------MKTM-----------------DVGLVMCLNIGTDPPDI....VKSSP...CARKEC-------------
A2G590_TRIVA/30-180-----------TKTK-----------------AALCLLCLFDGLHTPTIRR..LSRKPRLICNKPLL-------------
B8M6V6_TALSN/189-342-----------LKTV-----------------SAALAICLNIGVDPPDV....VKTNP...CAKLEC-------------
A2FJN8_TRIVA/41-191-----------VKTK-----------------GAICFLCLFDGLRTPTIRR..LSRKPRLICNRPLL-------------
A2DLR3_TRIVA/97-242-----------..IQ-----------------SVILITTKTYQFSENVSEY..LKDTP.....IIFG-------------
E5SIN8_TRISP/44-195-----------MKTV-----------------SVALVLCLNIGIDPPDT....VKPKP...CARTEC-------------
I1G727_AMPQE/53-204-----------LKTW-----------------SVALALCLNIGVDPPDV....VKTTP...CARKEC-------------
U1MN31_ASCSU/95-246-----------MKTV-----------------SVALVLCLNIGVDPPDV....QKPNP...CARQEC-------------
I1L744_SOYBN/123-274-----------MKTG-----------------CVALVLCLNISVDPPDV....IKISP...CARMEC-------------
E4XFS5_OIKDI/48-228-----------FKAR-----------------GIITCLCLNIDVDPEDWREDLAKDVP...VARREG-------------
D2VMD1_NAEGR/144-294-----------LKTV-----------------HVALVVCLNIGVDPPDV....VKVQP...CAKLEC-------------
A9TBL2_PHYPA/91-242-----------MKTG-----------------WVALCMCLNIGVDPPDV....IKISP...CARLEC-------------
B7PLB3_IXOSC/92-247-----------MKTV-----------------SVALVMCLNIGVDPPDV....VKTQP...CARLQC-------------
A0A0D2USM0_CAPO3/727-878-----------MKTV-----------------CVALVLCLNIGVDPPDI....VKTSP...CARLEC-------------
B8CBK6_THAPS/256-409-----------MKTV-----------------GICLILALNVGTDPPDL....NKPNP...CAKLQC-------------
A4I1A2_LEIIN/114-279-----------VRIT-----------------QAVLLMYLHIGSDPPGF....PRVEP...CAKMEC-------------
F4RLY3_MELLP/215-367-----------.RTV-----------------CAALFLCLRLGFDPPDV....VKTSP...APKLEA-------------
K4DUJ2_TRYCR/62-218-----------VKST-----------------QVILFLCLNIGSDPPDY....PRIEP...CARLEC-------------
H1VVG4_COLHI/158-309-----------LKTV-----------------SAALAVCLNISVEPPDQ....LKTNP...GAKLEA-------------
M7XEP3_RHOT1/113-265-----------IRTA-----------------SAVLVVCLRIGYDPPDI....IKTDP...CAKLEC-------------
A2GCD5_TRIVA/98-247-----------EPIE-----------------CVVVNVAHLEQFPKPSSDF..AKQIP.....SIFA-------------
D8RG53_SELML/72-223-----------MKTV-----------------SVALVVCLNIGVDPPDI....IKVSP...CARMEC-------------
A2F9H3_TRIVA/31-181-----------NKTK-----------------SAICFLCLFDGLRIPSIRR..LVRKPRNICDRPLL-------------
L0PHF8_PNEJ8/131-282-----------LKTV-----------------SAALCICINIGVDPPDI....VKTSP...CAKLEC-------------
RTOR2_ARATH/94-246-----------MKTG-----------------CVALVMCLHITVDPPDV....IKISP...CARLEC-------------
M5E8T5_MALS4/58-209-----------LRTV-----------------TAALVMCLNIGVDPPDV....SKTNP...CSKLIC-------------
B3RPQ9_TRIAD/43-194-----------MKTV-----------------SVALVLCLNVGVDPPDL....IKPTP...CARLEC-------------
I4Y9Q8_WALSC/76-227-----------LKTI-----------------TCAIVLCLNLGVDPPDV....VKTEP...CAVLET-------------
A2E4G0_TRIVA/101-242-----------....-----------------.VIFSMTRPIQYKLLQSDY..INSRP.....PIFA-------------
A0A068XPC4_HYMMI/269-417-----------IKTI-----------------NVALVLCLNIEIDPPDV....QKIPP...YSRVEA-------------
U4LGP0_PYROM/223-374-----------LKTV-----------------SAALVLCLNLGVDPPDI....VKTNP...CAKLEC-------------
A2F8U1_TRIVA/65-210-----------..TT-----------------QGIVVMCIPNLLQPPHL....RGTNS......VYC-------------
D8T9J0_SELML/50-197-----------MKTG-----------------CVALVLCLNIGIDPPDV....IKISP...CARMEC-------------
A9V5A2_MONBE/628-777-----------SKTL-----------------TLGLILCLNIGVTPPDV....VRTHP...CAKLEA-------------
F0XXV0_AURAN/12-164-----------MKTV-----------------SVALVLCLNIGTDPPDA....VAASP...RARREC-------------
A2E336_TRIVA/54-202-----------.SKS-----------------SIFIVLPFLEQTQENQTEY..CKLYP.....FYVY-------------
B4R5C8_DROSI/214-365-----------MKTA-----------------SVALVLCLNIGVDPPDV....VKIQP...CSRLEC-------------
J4H2X1_FIBRA/92-243-----------LKTA-----------------NAALVLCLNIDVDPPDV....VKTNP...CATLEC-------------
A2EU18_TRIVA/81-227-----------LGTI-----------------.VYMISSRNQIVQQTES....LHNKK.....LIMA-------------
A2DYB3_TRIVA/12-162-----------NKTK-----------------AVLSFLCLFDGLRNPSIRR..LVRKPRTVIQRPLL-------------
S2KE38_MUCC1/106-257-----------IKTV-----------------SGLLVVCLNIGTDPPDI....VKTNP...CAKLEC-------------
G7E3R0_MIXOS/173-325-----------LKTA-----------------VASLLLCLRIGFDPPDA....VKTDP...CAKTEC-------------

PF03415

Q8A866_BACTN/37-399--------------V-----------------YIAGDN..SLSRFASEDLNEMIEGMQSVDDNHNNL-------------
Q9WZB1_THEMA/121-462--------------V-----------------WMAADN..NLYYYSEDDLSEMRNASGSV.....SV-------------
Q8XM44_CLOPE/59-508--------------V-----------------YADCDN..NLEEYILNDIEEMKEGYKNNPNL..NI-------------
Q9X1S5_THEMA/586-937--------------V-----------------WMCADN..NLESFALNDLSEMLNSNENV.....SV-------------
Q9WYY6_THEMA/5-301--------------S-----------------WI...............................NV-------------
Q8TIY6_METAC/66-593--------------V-----------------YMVGSDLESSNGYASKDIFEIIDGASMLNGNETEI-------------

PF12770

A0LJ53_SYNFM/581-921-----------RRRA-----------------GELHDLLI..-------P.AKARELI.........-------------
A0LQE8_SYNFM/635-947-----------RPAS-----------------RKLFTAVLG.-------P.ISRD..L.......EQ-------------
A1BCK0_CHLPD/513-826-----------EETG-----------------ETLYRELWE.-------PVLDLL..........QD-------------
A1BEL3_CHLPD/43-361-----------KPIG-----------------SALWSALGDG-------VELQQA..........KH-------------
A1BEL6_CHLPD/46-364-----------QALG-----------------SALWQVLDAD-------EKLQHA..........KK-------------
A4HBL7_LEIBR/1053-1432-----------QEPL-----------------RVLYQACIH.-------P.......IIGYVRALDS-------------
A8L4T6_FRASN/741-1051-----------EKAS-----------------RWLGRAVMD.-------PVLRLL............-------------
A9WBC0_CHLAA/673-929-----------RVLL-----------------QRLYRTLIE.-------P.................-------------
A9WER9_CHLAA/54-394-----------TRYG-----------------QELFRRLFP.-------TRLSHQFRVSQRTAAQQQ-------------
A9WF91_CHLAA/60-360-----------VAYG-----------------TALGTMLLSD-------PDLLAQFQAARAIARRGR-------------
B0C874_ACAM1/207-507-----------LESA-----------------QQLYQWMVQ.-------P.LAAE..L.......EK-------------
B2IXC0_NOSP7/1396-1691-----------LRPS-----------------QQLYRWIIA.-------P.LEAD..L.......QA-------------
B2IZZ4_NOSP7/695-973-----------QEVA-----------------KTLAEMLAF.-------PKLLEG..........LP-------------
B2JAK0_NOSP7/526-830-----------DIEL-----------------NKLYKILL..-------PQVIQEGLI........Q-------------
B2JAM9_NOSP7/866-1190-----------EKVA-----------------TKLSQMLLQ.-------P.VAQE............-------------
B4JKU3_DROGR/1402-1700-----------PACL-----------------HTLYNLLLA.-------P.......FDDLLPSVAS-------------
C3Z401_BRAFL/1278-1602-----------KPPL-----------------RALYDLLIS.-------P.......MEDVLPRMNG-------------
F0SR63_RUBBR/137-574-----------QLSI-----------------ERIKTVVWD.-------P.......VHEALSSDDG-------------
Q01RE6_SOLUE/865-1136-----------QVVA-----------------TRLHEQLVR.-------P.FGKE..I.........-------------
Q024J7_SOLUE/541-814-----------IPAG-----------------DRLYQLLIQ.-------P.LRAW..I.........-------------
Q025F1_SOLUE/607-877-----------RTAA-----------------AALYRKLLG.-------PAAAEL............-------------
Q028B5_SOLUE/667-935-----------QKLA-----------------VSLYRELLE.-------P.AAEQ..L.........-------------
Q02DA1_SOLUE/510-786-----------QRDA-----------------RQLYDWLIA.-------P.LAER..L.........-------------
Q10YT7_TRIEI/1003-1309-----------KDTA-----------------RELDQKLMQ.-------P.VRQL..L.........-------------
Q10YU6_TRIEI/544-838-----------KFQS-----------------NQLYNWLIK.-------P.FEGYLEIDL...KDDA-------------
Q112V9_TRIEI/62-390-----------TKVG-----------------EALFEALFD.-------AQLREYFLAYYQDILKQQ-------------
Q113D1_TRIEI/130-430-----------NSQA-----------------KKIRGWLLK.-------..LQEK..L.........-------------
Q113U8_TRIEI/3002-3297-----------LSPA-----------------KKLYDWFIT.-------P.ISAE..L.......EA-------------
Q115J8_TRIEI/1466-1777-----------EKLG-----------------EILHIKEILQ-------PILESE............-------------
Q117G6_TRIEI/881-1206-----------KKTA-----------------RELDEKLMQ.-------P.VRQL..I.........-------------
Q119J2_TRIEI/1474-1770-----------LSNA-----------------KKLYKWLIA.-------P.ISQE..L.......VA-------------
Q16H64_AEDAE/1315-1614-----------PSCL-----------------HVLYNLLLA.-------P.......FEDLLPDIST-------------
Q2G6U6_NOVAD/692-1020-----------LDKS-----------------RALYKTLFG.-------A.VEDL..L.........-------------
Q2S6G2_SALRD/540-844-----------LRPL-----------------RALHDHLYA.-------P.VAAH..L.........-------------
Q2W535_MAGSA/875-1218-----------LDVG-----------------QQVHKLIWQ.-------P.LERA..L.........-------------
Q38C46_TRYB2/1044-1397-----------VEPL-----------------KTLYNIFIE.-------P.......IAAYIRSSDP-------------
Q3AQG5_CHLCH/44-362-----------QAIG-----------------SILWRLLDAD-------EALANA..........KQ-------------
Q5LLA3_RUEPO/680-970-----------RIFG-----------------ELLFETLLP.-------QEVRRLYDV.........-------------
Q7NCT1_GLOVI/600-923-----------HKLA-----------------RLLHQKLLA.-------P.LGSQ............-------------
Q7NF67_GLOVI/550-854-----------KAAA-----------------RRLDRALME.-------P.VRAK..L.........-------------
Q7NFD7_GLOVI/666-979-----------RKLA-----------------RTIDERTMR.-------P.VRTR..L.........-------------
Q7NIF7_GLOVI/691-997-----------RALA-----------------RQLDSLLMQ.-------P.LRAR..L.........-------------
Q7NJE3_GLOVI/660-988-----------DKLA-----------------RQLHQKLLA.-------P.LQGN............-------------
Q7NLR0_GLOVI/653-961-----------KPLA-----------------RRLDQQLIA.-------P.IRRK..L.........-------------
Q7NVB0_CHRVO/67-386-----------QDTA-----------------RALADLFGQV-------PGLTAD..MAGHEVGDDG-------------
Q82I85_STRAW/1175-1481-----------ERLC-----------------GWAWYAAMR.-------P.......LFAEFPEPRA-------------
Q82L10_STRAW/969-1256-----------TGTL-----------------AWLWDVLAE.-------PVLDA...LGFTGPPESG-------------
Q8DGG5_THEEB/541-835-----------QRAA-----------------QALTEQVIT.-------P.IRPW..L.........-------------
Q8DH74_THEEB/570-891-----------KPSL-----------------KAAYGRLLA.-------P.LEPF..L.........-------------
Q8DHI1_THEEB/67-394-----------GASG-----------------NQITNIGTQQ-------PNLLKE..........VR-------------
Q8DIE5_THEEB/1127-1420-----------LPAA-----------------QQLYQWLIA.-------P.LRPQ..L.......DA-------------
Q8YZU5_NOSS1/56-340-----------TKDA-----------------ENIYDAIIS.-------P.IEKY..L.......TE-------------
TTC28_HUMAN/1390-1713-----------KPPL-----------------RALYDLLIA.-------P.......MEGGLMHSSG-------------

PF03568

G7E6G1_MIXOS/1513-1914-----------EQAD-----------------ALILIRHVPHRI.....P-VILRLPLDRMGK.REN...ED..EDE...
A8PX94_MALGO/1441-1824-----------SDAR-----------------ELIVARYGDAYD.....P-CVFVLPLHRQSY.RDA...ED..DDD...
M7XLD2_RHOT1/1703-2100-----------...D-----------------ALIISRHRHTDE.....P-IVFKLPLDRLAR.REG...EE..ED....
U5HB45_USTV1/1850-2253-----------.ERD-----------------ALILVHHQANRQ.....P-LVFRLPLDRITR.RED...KE..EDE...
F4RLY9_MELLP/91-479-----------QDRD-----------------SLFLVQHHNATD.....P-LVLKLPMNRQNR.REG...EE..D.....
T1IUX7_STRMM/1624-1980-----------...Q-----------------PLVLTKFQKRMK.....P-IVARVPTATYKPVEGG...TC........
A7RYA6_NEMVE/1651-2034-----------...S-----------------YLMVTRLRNGSA.....P-VVLRL..ALPDD.SEG...TESSGNDHCE
T1FT05_HELRO/413-770-----------...D-----------------QLILTRFVHGET.....P-LNIPLPHVDVDE.RR..............
W4Y9R2_STRPU/1031-1383-----------.ASS-----------------QLVITRIQKGQQ.....P-IVVRL......P.MNG...GD........
G3N6G2_GASAC/1731-2077-----------EMGD-----------------SVLLSRLEKGSV.....P-VTVHTTTSK.QR.HSI...S.........
H3DAQ7_TETNG/1711-2057-----------QMGE-----------------SIMLSRFERGSA.....P-VTVHIPTSK.QQ.RPV...S.........
I3KSG7_ORENI/1715-2061-----------EMGN-----------------SIMLTRLEKSSA.....P-VTVYIDTSK.QK.HPI...S.........
H2L8K9_ORYLA/1692-2038-----------ELEN-----------------SVILTRLEKGSA.....P-VTLHISTSK.QQ.IKI...H.........
M3ZIW2_XIPMA/1768-2114-----------EMGE-----------------SLMLTRLEKDSS.....P-ITLHISTSR.QE.LTV...R.........
ESPL1_MOUSE/1716-2065-----------TLSN-----------------TLLLTRLEKDNP.....P-ITVKIPTAQ.NK.LPL...S.........
F7BUI1_CALJA/1724-2073-----------TVGN-----------------TLLLTRLEKDSP.....P-VTVQIPTAQ.NK.LPL...S.........
G3VPI8_SARHA/1713-2063-----------TVGD-----------------TLLLTRLEKNTP.....P-VTIQIPTAQTKK.MPL...S.........
U3IXX7_ANAPL/1332-1679-----------SMGD-----------------TLLLTRLERGST.....P-ITIHIPTAL.TK.APL...S.........
G1KFP0_ANOCA/1819-2167-----------AIGN-----------------TLLLTKLEKDAD.....P-VTIQIQTMH.AQ.VSL...S.........
H3B3H1_LATCH/1699-2055-----------AVGD-----------------TLLVSRLEKGCT.....P-VTVQIPTAQ.SE.MPL...S.........
F6VXN8_XENTR/1732-2080-----------.PGD-----------------TILLTRLVRGRP.....P-VTVQIPTAH.LK.VSI...S.........
Q6ZHH8_ORYSJ/455-870-----------YFPA-----------------WMMLSRFDSTNK.....P-ITMLLPVDAISKETQH...EDSCTKELDN
W5GJD2_WHEAT/891-1304-----------.FPA-----------------WMLLSRFDSTNK.....P-TTMLLPVDSISKEAHN...EDSSIKELDN
K3Z105_SETIT/1078-1484-----------YFPA-----------------WMLLSRFDSTGE.....P-TTMLLPVDAISGSQS....EDSSIKDLGN
C5XYE8_SORBI/457-870-----------..PA-----------------WMLLSRFDSTNE.....P-TTLLLPVDAISAEMQF...DDSCIKDLGN
C5XSY3_SORBI/1425-1832-----------..RA-----------------WILLSRFDSTSE.....P-TTLLLPVDAISE.MQF...EDSCIKDLGN
K3Y3B2_SETIT/1404-1817-----------.FPA-----------------WMLISRFHSTNK.....P-TAMLLPVGAILEEMQS...EGSSIKDLGN
M0UBW7_MUSAM/65-479-----------.FPA-----------------WILLSRLLANSQ.....P-VVMLLPVNLLHEEVQL...EDISDQKFSD
ESP1_ARATH/1641-2060-----------PVCA-----------------WVLISRLNPESQ.....P-VATLLPVDSIVEDMS....DDSANLSSTE
M4DS49_BRARP/1599-2019-----------PVCA-----------------WVLVSRLTLKSQ.....P-VATLLPVDSVLEDMSD...DDSATISSTE
B9GZR1_POPTR/1674-2094-----------CISA-----------------WMLLSRLKFKSQ.....P-IMMLLPVNKVLEETSD...DDCAMSCTGE
B9SSN4_RICCO/1627-2045-----------RVCA-----------------WMLLSRLNSKSH.....P-IMMLLPVDLISEETSD...DDAPNPGSEE
I1MDQ8_SOYBN/1648-2063-----------.VQA-----------------WMLVSRLSFKNE.....P-VVMLLPLDSILQASC....EGDLSTGSGT
K4B224_SOLLC/1600-2023-----------PIQS-----------------WVLLSRMSSTSQ.....P-ITVLLPVHSILNEAA....DDVAEFTSSF
W1NKX2_AMBTC/1-423-----------....-----------------.MLLSRLNLMRQ.....P-VVLLLPVDSVLEDVQ....QDNWTTSVGT
K7H1P7_CAEJA/245-604-----------ADNK-----------------QIYLIKLHADRE.....P-IIM..PIAHYSQ.......AS........
E3LM18_CAERE/731-1090-----------ADDK-----------------KIYMIKLHADRE.....P-IIM..PLAHYSQ.......AV........
G5ED39_CAEEL/727-1081-----------ADDK-----------------TIYLVKLHADRD.....P-IIM..PLAHYSQ.......AV........
Q23491_CAEEL/749-1101-----------ADDK-----------------TIYLVKLHADRD.....P-IIM..PLAHYHQ.......AI........
S3CR95_OPHP1/1758-2208-----------ENKH-----------------DLCITKLQAGQS.....P-FVIRLPLERAIS.RDA...DN..E.....
F0XAD9_GROCL/1636-2054-----------ENNQ-----------------DLCITKLQAGSS.....P-FVLRLPLERAVS.RDA...DT..E.....
G2R9B0_THITE/1619-2058-----------DGNH-----------------DLCITKLQAGES.....P-FVIRLPLERASS.RDA...DS..D.....
Q2H6Q9_CHAGB/1612-2026-----------EGNH-----------------DLCITKLQAGQS.....P-FVIRLPLERASS.REA...DS..D.....
G0SHM3_CHATD/1723-2150-----------DGGH-----------------DLCITRLQAGQA.....P-FVLRLPLERASS.RDSSVDET..D.....
G4UQF5_NEUT9/1626-2085-----------DNKH-----------------DLCITKLQAGCT.....P-FVLRLPLDRASS.RDA...DN..E.....
G4N8I2_MAGO7/1627-2057-----------DNKH-----------------DLCISRLQAGHS.....P-FVIRLPLERATS.RDT...DN..E.....
J3P7L5_GAGT3/1606-2054-----------DNKH-----------------DLCVSRLQAGHS.....P-FVIRLPLERGSS.RDS...AN..D.....
R8BFS3_TOGMI/72-487-----------ENKH-----------------DLCITKMQADQS.....P-FIIRLPLERANS.RDA...DN..E.....
N4UZ87_COLOR/1637-2043-----------DNRK-----------------DLCITKLRAGQS.....P-FILRLPLERVAS.RDG...ED..E.....
G2X6M8_VERDV/1704-2113-----------ENRH-----------------DLCITKLQADHT.....P-FVLRLPLERAVS.RDA...DT..E.....
G0RRT6_HYPJQ/1566-1971-----------DNRH-----------------DLCITKFQAGQG.....P-FILRLPLERANS.RDA...DS..E.....
M1WFQ9_CLAP2/1438-1889-----------DNRH-----------------DLSITKLQAGHS.....P-FILRLPLERANG.RDA...HS..E.....
J5K578_BEAB2/1584-1996-----------DNHH-----------------DLCLTKFQAGHS.....P-FILRLPLERANS.RDA...DC..E.....
C7YYU1_NECH7/1580-1992-----------DNHH-----------------DLCITKFQAGHS.....P-FILRLPLERANS.RDA...DS..E.....
M7T4Q8_EUTLA/44-499-----------DSQH-----------------DLCITKLQAGHS.....P-FAIRLPLDRASS.RDS...DS..E.....
L8G205_PSED2/1652-2056-----------ESRD-----------------ELVLAKFEAGHS.....P-FILRVPLERNSS.RDA...DE..E.....
N1JFH1_BLUG1/1598-2001-----------ENQH-----------------ELSLTKLQAYQS.....P-FILRLPLGRNNS.IDA...DE..E.....
K1X2E6_MARBU/1659-2061-----------ESRQ-----------------ELSITKLQAGHS.....P-FVLRLPLGRHNS.MDA...DE..E.....
S3D029_GLAL2/1639-2043-----------DSHN-----------------ELVITRLQAGQS.....P-FVLRLPLGRHNS.MDA...DE..D.....
M7TX51_BOTF1/1640-2041-----------ENRQ-----------------ELSITKLQTGHS.....P-FVLRLPLGRNNS.MDA...DE..E.....
BIMB_EMENI/1609-2004-----------ADRA-----------------EFVVSRLHRGCS.....P-FLLRLPLRRGNS..ED...EE..E.....
Q2USV7_ASPOR/1630-2030-----------ADRS-----------------EFIVSRLHQGRS.....P-FLLRLPLKRGNS.EEE...DE........
G7XGU8_ASPKW/1627-2026-----------TDRT-----------------EFVVSRLQKGRS.....P-FLLRLPLKRGSS..ED...EE..E.....
S8BGE7_PENO1/1622-2018-----------ADCS-----------------EFYVSRLQKNRP.....P-FLLRLPLRRGNS.DED...EE..E.....
B6GZP8_PENCW/1602-1998-----------ADRT-----------------EFVVSRLQKDGS.....P-FLLRLPLHRGNS.EDD...DE..E.....
Q4WUU6_ASPFU/1638-2039-----------ADCT-----------------EFIISRLRKDHS.....P-FLLRLPLKRGNA..ED...DE..D.....
B6QNB5_PENMQ/1619-2016-----------PDRT-----------------EFIISRMSHGSS.....P-FLLRLPLKRSEE.DNQ...DE..D.....
V5GCB2_BYSSN/1684-2084-----------ADRT-----------------DIVISKMHKGRA.....P-FLLRLPLKRGDSEDEE...EE..E.....
F0UL09_AJEC8/1642-2044-----------GDHK-----------------EFIISKLRSGRP.....P-FLLRLPLKRGNL.EEM...DE..D.....
C5FSW7_ARTOC/1655-2058-----------PSQD-----------------EFIISKLRSGQH.....P-LILRLPLKRGGE.DDM...DE..E.....
H6C6Q4_EXODN/1587-1987-----------DDRS-----------------ELLVARLNAGRS.....P-FIVRIPLTRPEA.SET...ET..E.....
U1G8A9_ENDPU/1638-2036-----------DDSS-----------------EMIISKIRQNYS.....P-FLLRLPLDRSAG.EDL...DE..E.....
K2R7J5_MACPH/1619-2043-----------EARD-----------------ELYITRYVPYQS.....P-FILRLPMARHNS.RDM...DE..E.....
R7YNT5_CONA1/1696-2117-----------EAGS-----------------DLYVTRYQANQT.....P-FILRLPMARQSS.QLM..DDE..D.....
E4ZTB4_LEPMJ/1652-2063-----------ESRD-----------------ELYITRFESGMS.....P-FVLRLPLARHAS.REM...DE..E.....
N1QAI8_PSEFD/1492-1912-----------QTCD-----------------ELYIVRYRHGQS.....P-LVLRLPFSRHRS.EDS...EE..G.....
N1QHR1_SPHMS/1187-1599-----------EKCD-----------------ELYVARYRSGQT.....P-LLIRLPFSRQKS.EDD...DE..G.....
N1PZ16_DOTSN/1513-1936-----------ESCE-----------------ELYVAKYRGAQS.....P-LVLRIPFSRQKS.DEA...EQ..E.....
D5GKQ4_TUBMM/1633-2033-----------ESRE-----------------ELYLSRFQAGQS.....Q-LMVRLPLTRHNS.RDD...YE..D.....
U4LG69_PYROM/1616-2019-----------ENKK-----------------ELYITRFQAGQS.....Q-LMVRLPLNRHNN.RDE...YS..D.....
S8C8B1_DACHA/1639-2040-----------ESRE-----------------ELFFTRYEAGQI.....P-FMIRVPLMISEE.MSM...DE..E.....
Q6CCJ0_YARLI/1210-1588-----------PTSG-----------------DLIVCQYACNQE.....P-FLLRLPLHRHNS.RDV...DE..H.....
S9X830_SCHCR/1385-1771-----------ESKE-----------------ELFITKFAHKSS.....P-LIFRLPFKRHNA.RDA...DE..E.....
CUT1_SCHPO/1383-1770-----------NSGE-----------------DLFISKIRKGHS.....P-LIFRLPLQRHNS.RDA...DE..E.....
B6K0I6_SCHJY/1359-1747-----------ESKE-----------------DLFLSKVRKNQN.....P-LVVRLPLQRHNS.RDA...DE..E.....
M7PDE3_PNEMU/1489-1882-----------ESKN-----------------DLYITRLQRQLS.....P-LVLRLPLNRSNS.RDA...DQ..D.....
G8BT64_TETPH/1165-1563-----------PLTN-----------------HLLLSKIDSSSN.K...T-IHVRLPLNRINS.REL...DT..Q.....
I2H0Y5_TETBL/1280-1677-----------PITG-----------------HLIISKSFSYNN.K...K-LHIRISLDRARS.RDL...DA..N.....
S6EFD3_ZYGB2/1145-1542-----------PSND-----------------SLLLSKIDSKFG.K...N-VQLRMPLNRAYA.RDL...DC..H.....
C5DU01_ZYGRC/1141-1538-----------PANE-----------------NLLINKLESKSG.R...M-IHLRVPLDRTYT.RDL...DS..H.....
G8ZWZ1_TORDC/1158-1555-----------PVTK-----------------NLLLSKIETCHD.R...N-VHIRMPLNRTHT.RDL...DC..M.....
G0WDN6_NAUDC/1191-1589-----------SITG-----------------NLLLSKIDPVTK.K...L-NHLSIPLNRGNA.RDL...DT..L.....
G0VFB3_NAUCC/1164-1562-----------SITG-----------------NLLLSKLSATNG.H...K-SHLSIPLNRANL.RDL...DA..Y.....
H2B1L5_KAZAF/1161-1559-----------PVTG-----------------NLLLSKIDTVKK.R...R-ILLNIPLNGSNA.RDL...DS..L.....
ESP1_YEAST/1175-1571-----------PITG-----------------NLLLSKLEPRRK.R...R-THLRLPLIRSNS.RDL...DE..V.....
J7RG90_KAZNA/1160-1562-----------PLTE-----------------NLVLTKYEGQSH.R...R-TTLRISLKENRS.KDT...HC..G.....
Q75EJ0_ASHGO/1152-1552-----------KYNG-----------------DLLLSKVVSTTG.K...H-FHLRLPLNRHES.RDL...SQ..E.....
C5DHM1_LACTC/1178-1575-----------EITG-----------------DLLLSKMDSGRD.S...K-VCLRLPLNRSNS.RDM...DE..I.....
Q6CQQ7_KLULA/1118-1516-----------QLTG-----------------DLLITRFDTVRN.K...H-LHLRLPLNRHNS.RDL...SE..E.....
Q6FTE1_CANGA/1151-1548-----------KLTN-----------------TLIIRRISNLDS.K...N-IMAKIPIDRNVS.RDL...DA..D.....
K0K8V1_WICCF/1175-1568-----------AFNG-----------------DLIISRLTRDST.V...P-SVLRLPLSRHSS.RTI...DE..E.....
A5DNR9_PICGU/1178-1576-----------PNSD-----------------SLLLTRLTHLGS.....P-FVVRLPLSRMKQ.RGK...NT........
A3GFF5_PICST/1168-1555-----------PYSG-----------------DILLSRYIKGKH.....P-WFLRLPISR..Y.HDR...SPRTS.....
Q6BTB7_DEBHA/1338-1753-----------PYTG-----------------DLLLSKSLKDSYNT...P-FFLRIPLSKRGT.EDG...SP........
Q5A8X8_CANAL/1101-1536-----------QNTG-----------------DLLISKLTKGSP.N...P-IFMRLPLSRF.....P...SS........
C5MEH0_CANTT/925-1303-----------QQTG-----------------DLLLSKRTKDS..N...P-VFIRLPLNRF.K.NGV...SP........
M3HH45_CANMX/1423-1797-----------PKTG-----------------DLLLSKITKNT..Q...P-LFVRLPLNRL.H.NDP...SF........
G8B5X7_CANPC/1052-1424-----------ERTG-----------------DLLISKIRAGN..L...P-TFIRLSVTRF.K.QRE...SV..G.....
A5DVQ7_LODEL/1109-1530-----------EHTG-----------------DLLLSKCSRGS..L...P-IFIRLSLERY.I.DRE...GI..D.....
G3AGZ6_SPAPN/1149-1535-----------SHSG-----------------DLLLSKIDRGK..D...P-VFLRLPVKRF.Q.SRV...NQPDK.....
G8YBL5_PICSO/1309-1719-----------PISG-----------------DLILSKLMSDFN.E...P-FFLRIGSSRFSS.VTK...SQ..K.....
C4XY11_CLAL4/1177-1564-----------ELSG-----------------NLIITKFESGQT.L...P-FVFKLPFRKN...........NGS.....
G3B782_CANTC/1213-1609-----------.GSD-----------------ELVLARLSKESD.YK..P-ICLRLPLKRMMD.HGS...TA..S.....
W1QIM9_OGAPD/1167-1527-----------...G-----------------CLLLTRYGPKQD.....P-VFIKLPLERHLIGRHA.............
C4QYS2_PICPG/1259-1619-----------SVTG-----------------DMLLSYFSSAED.....S-VIIRIPFQ.....PNT.............
K5WME3_PHACS/1732-2136-----------EDRN-----------------TMFVTRQRPRRE.....P-LIFCIPLK..DR.REN...VD..DT..E.
M2R2K9_CERS8/1618-2024-----------EDKN-----------------TMFISRQRHNSQ.....P-LVFCLPLK..GR.REN...VE..DE..Q.
F8PLA9_SERL3/1278-1688-----------EDKN-----------------TMFVCRQRARSD.....P-LIFCVPLK..GR.RET...DD..DE....
S8E105_FOMPI/1678-2083-----------EDKN-----------------MLFVSRQRTGRE.....P-LVFCLPLR..GR.RED...EG..DE....
J4GX56_FIBRA/504-917-----------EDKS-----------------YIFVSRQRAGQQ.....S-MVFCLPLK..ER.RD....TE..DN..E.
A8NBE9_COPC7/1839-2276-----------.DKG-----------------TLLVSRQECGES.GVE.P-LVFSVPLK..GR.RDN...GG..GEDEE.
B0E1W0_LACBS/104-540-----------DDKS-----------------TLFISRREGGVE.GSQ.P-LVFCVPLK..GR.RDN...GD..DNDED.
D8Q1W5_SCHCM/1450-1878-----------EDKR-----------------TLFLSRQEGGEQ..SE.P-LVFCIPLQ..GR.RDN.......DDDEE.
V2X3W8_MONRO/1588-2040-----------DDRK-----------------TLFISRQRGGRE.TKDRP-LMFCIPLQ..GR.RES...PD..DDSEH.
J0DCK6_AURDE/1634-2046-----------EDKK-----------------SMFVSRQRPKEE.....P-LVFCVPLERHNR.RDE...DD..EDDEE.
Q5KMS4_CRYNJ/188-600-----------DDRN-----------------TMFISRHQNGYE.....P-IVFCLPVDRQGR.REG...DD..D.....
R9AIE1_WALI9/1639-2036-----------DDKK-----------------TMFVVKYRKNLE.....P-LVVSLPLDNRQNKREGGGEEG........
I4YB88_WALSC/1631-2030-----------DDKK-----------------TMFVVKFRKNSE.....P-LLVSLPLDNRQNKREGGGEEG........
G4T5A4_PIRID/1472-1874-----------.ARN-----------------TLIVARNRQDK......C-DLFKLPLKRGAR.REH...DE..EPE...

PF01364

KGP83_PORGN/244-595MLVV....A..GAKF.................KEALKPWLTWKAQK......GFYLDVHYTDEAEVGT............
D1JG83_9ARCH/891-1295FAYT....K..IPKL.................SLTAAQIAA...........ARKAPVIDINKNPEEII...........
A2U064_9FLAO/401-768YLVI....T..NSDL.................ANEAQRLVDYHQTN.....SNLVGKVVLLDEIYNEFS...........
Q7MTE2_PORGI/239-573MIVI....V..AKKY.................EGDIKDFVDWKNQR......GLRTEVKVAEDIASPV............
D3HWT0_9BACT/400-777MVII....IPTSQKL.................LAQAQRLKAFHEAH.....DSLSVRIVPADELFNEFS...........
Q5S3Q9_9FLAO/543-910YLIV....T..PRIL.................KSQADRLADFHRNY.....SKLNVKVVTLDAIYNEFS...........
A9DMD5_9FLAO/555-923YIII....T..PDAF.................VSQAERLADFHRNN.....SGMIVKVVTLASIYNEFN...........
B0VGA8_CLOAI/228-563ILLIYGNNT..DPIF.................TAKLNEFVAWKRQK......GYDVNFVSTAETGGA.............
B7B5I7_9PORP/382-753MIII....A..QPNF.................TTQAERLAEAHRTK.....DNLTVRVVTPESIYNEFS...........
B8FFM0_DESAA/254-600FVIV....T..TGDL.................KDAFKNFIDIRNL.......DHTVKLALLNDIKKEF............
A3U7G6_CROAH/540-908YLML....V..DNTL.................ISEANRLAQYRRDR.....DGLNVKVVQLQTIYNEFS...........
D2QSX9_SPILD/414-786LLIV....T..PAAW.................RDQADRLAQFRRDH.....DQLSVLVVTTQQALNEFG...........
A3HW99_9BACT/398-769YILV....G..HHALEIP..........ADQFQNPLQSYAEHRAS.PL..GGGYKTLTIFMEEIYDQYG...........
B0VHP2_CLOAI/234-563ILVI....K..HSMF.................DATIQPWVDWKRQL......GFTVDVVDVTTAGS..............
A8ZUB1_DESOH/278-656YVLI....T..SQAIIDD...........VSIDPSVADFIAHRQAQ......GLTTAVVSIDSVLADDN...........
B0VIM2_CLOAI/182-528MLII....T..HSQL.................TNYQQDYIAWKKSI......GFDVYTANKSDIGS..............
Q2Z0E1_9BACT/643-1013YVMI....A..YDGF.................YDEALRLKNHRESAA...GGGYDVRLVRLSDVYSEFS...........
B3QXR8_CHLT3/734-1131YIII....T..SDEFINSS........NFEKTSNPVRQYKEYRESYLKAIGETGNVLVVTTQAVYDEFN...........
C2MCN4_9PORP/405-781YLMI....T..TEAL.................RPAAERLASYHREH.....SGLRVQVVTQQELFDEYN...........
A4A325_9PLAN/24-399TLVV....C..PEPL.................VPALRPWLDFRAAQ......GRQIGLITETA.................
A7NR84_ROSCS/499-867VLYI....A..PAPF.................HAALTPLVDLRRAQ......GYSVAVVDVQHLYDGWS...........
Q11Q36_CYTH3/558-932MIIV....T..HPDF.................QSQAQRLANFRTTN.....DGLRVYVCTTEQIYNEFG...........
Q7MX16_PORGI/272-637YLVI....Y..DDMFNVN...........QQPHDEIKRLCEHRAFY.....NGFDVAAVSIKDVLNSFPS..........
A0B5K7_METTP/796-1154FSHT....K..VPKL.................SLASMQVAA...........AKRAIVMDVAKDPQYVD...........
D0MH89_RHOM4/586-975LAII....T..ADTF.................RVYAEQLAEHRRD......QGLRVVVATVEQIYNEFS...........
A8UH97_9FLAO/539-910YIIL....A..PSQF.................ISQAERLAQINRDQ.....YNLNVKVVDLQTVYNEFS...........
B8KYL6_9GAMM/364-704YLMI....V..HSTL.................RTSLEPLAEFHRNR......GRTVVVADVEAIFDQFN...........
B8FIK5_DESAA/1139-1542YLII....T..TQAL.................AAAFETLEVHRTSV.....SGMACAVETVEDIEVNYP...........
Q11US7_CYTH3/392-767YFII....Y..PEVF.................NSSALSYDQYRSS.NA..GGNYDVERCSFEKLCNLYS...........
C6W101_DYAFD/326-680YLII....T..HPLMRTP...........VNGLDVVAEYAQYRAS.EA..GGGYHTSAAYSYELFDQFN...........
A5FJM8_FLAJ1/544-914YVIV....T..PRSL.................SSQAERLANFHRTN.....SNLNVKVISLENIYQEFS...........
Q7UG73_RHOBA/51-444VVVV....A..SPEF.................DETLEPWIQMRSEE......GLRVAIAR....................
A3J247_9FLAO/540-919YLII....T..PDFL.................STQAERLADFHRNN.....SGLSVRVVTLEKIYHEFA...........
A9WIM0_CHLAA/500-869AIYI....A..PRAL.................IGELEPLLARRQAQ......GWSPLAIAVEDVYAGWS...........
B0VHE7_CLOAI/227-554MLVIYGNYT..DTNY.................LSKINEFVTWKKQR......GFIVNAVSTGVTGI..............
C6VT06_DYAFD/394-758YIII....T..TDEL.................RDGAAAFAEYRSSPA...GGSFKPLIVNIRDIYDQFN...........
C6X3N8_FLAB3/546-921YLMI....T..VPEM.................MSQAQRLAAFYQDK.....FN..VAVVDVNKIYNEFS...........
A0LQH1_SYNFM/790-1132YIVI....T..SPEL.................SGAASSLADYRRRS.....KGLTTLVVTTEQIYDAFS...........
A1ZVJ9_9BACT/406-774LVII....V..PEVF.................LSEAERLAAFRRTN.....DGLSVTVVKLSQVYNEFS...........
B0VHF1_CLOAI/214-595YLIV....A..DAEK.................ITQWTPLKTFQEIR......GKTVLIKSMSEIIAEN............
B0VIE7_CLOAI/193-598LLVI....T..TPEL.................YTALDWLVTFRQSQ......GVDVSFCDI.AIALASG...........
C6W3P4_DYAFD/414-806YMIV....S..SESL.................IEAADSIALYRSAETA..GRKFKTGIFKIRDIYNQFN...........
B2RGP6_PORG3/408-787LIIV....S..TQAL.................LPEADRLATYRREK.....NGLKVLVVLQEQVFNEFS...........
D2QJ99_SPILD/409-770YVII....T..HEALMTPLTD.....SLTGRVTNAIQSYAAYRAS.VA..GGTHDTLTITMQQLIDQYN...........
A9B5Q8_HERA2/466-850TIYL....A..PKQW.................HSLVQPLINRRQQQ......GWQPLLVDVQAIYDRWS...........
D2QFF3_SPILD/397-745YVII....T..HASL.................RQSAATYAGYRSS.AA..GGSYKPFIVESDSLYDQFN...........
B0VH03_CLOAI/589-939NIIV....A..PAEF.................LQQAQELANKYREI.....YQISSKVILVDDIYNQFN...........
D2R2P5_PIRSD/21-411TVVV....C..PREF.................VAALDPLLAHRYAQ......GHRFAYVANTG.................
C6W0Z3_DYAFD/393-758LLII....T..PAEW.................VGEANRLAGFRNSN.....DGLDVLVVTTDQVYNEYA...........
A3XQP5_LEEBM/552-929YLMI....T..PNEL.................RAQAERLAQHNRTY.....RNLNVKVVTLDAIYNEFS...........
Q2PY26_9BACT/412-780YVIV....A..PEHM.................LIEAERLAQFHRD......RGLTVQAVDVQHVYNEFS...........
Q26FX7_FLABB/537-909YLII....A..PDFL.................ENEAQRLANYHITS.....SNLNTKVVTLTDIYNEFS...........
B0VJT2_CLOAI/236-566YLIIYGNNS..DINF.................TSALNEYVLWKKQK......GADVMVASTAANEAGN............
C6BTD6_DESAD/56-402NVIV....C..TADF.................MRAARYFSYLHREF.....EGVKSVIVKVPSTNGTAE...........
D2QE53_SPILD/328-1007YLII....T..DDRRWTFQNGKPVAGNALPLDSAGKTATSHFLRLAEWKAKRGIDAKVVTVSEIVQGGSSTGLKWGDFTD
A2BK55_HYPBU/159-551MIII....VPDDTLV.................EMYAEDIAKLHREM......GLNVRIVTTSYIYENYPEAELPSDVCRP
B0VHP1_CLOAI/283-636YVII....L..PDNF.................IAPMQPFIDWKKQE......GYNVIVAPTSITGT..............
Q1Q1Y4_9BACT/620-970YIII....T..HEDF.................YDNALALASHRIDD......GLRVVTVKVGDIYDEFN...........
C7PNY3_CHIPD/396-764MLIV....T..TPSL.................RTAASKLAAWHGTH.....DGLNVRVVTVNEIYNEFA...........
Q6LFY5_PHOPR/224-617YLII....T..ADRF.................QQTVEPLAAWKRKK......GYQVHVATITEVGN..............
B3QVL4_CHLT3/688-1063YIII....Y..ATDY.................KSDAERLLAHRSSTSIWGSHALSGIAVDAQQVYNEFS...........
A9B187_HERA2/552-907YLLISYNPA.NSSSW.................SDALQPLITQRASQ......GLKPLLIDVQQIYDQFG...........
R5M3W7_9BACE/537-910MIII....SPDRKDL.................MTQAERLAQAHREK.....DGLSVLVLAAPQIYNEFS...........
B0VJY1_CLOAI/655-1014VIVI....A..PWQFT...............SVEGTLQLKSLWESE......GHTVKIVDVQDIYDEFN...........
B8G4Y1_CHLAD/584-1054FLII....A..PQSVI...............QAGALADFVDFKRRL......GFEVEVVSIEQAGQGASPN........D
A1ZEG7_9BACT/410-775YLII....T..HASLRQA..........TGGVSDPVQAYAAYRAS.TE..GGGFDTLTVNVKLLYNQFN...........
B0VF22_CLOAI/223-583MIII....T..NNDR.................ISWFSEYSAWRSAK......GVSNSIYSMEDIVSAY............
A0LKV0_SYNFM/924-1265YCIV....T..HGLF.................TDGARRIAEQKRNE......GYNPAIVDVEVLYNRYS...........
A8ZTD5_DESOH/257-648LLII....S..PPEL.................VAAADRLANWKRAQ......GILTEVRTTGQTGT..............
A9B8S0_HERA2/477-840VIIA.......PRAF.................LPALDPLR............TPTTVLVAREDLDAAWA...........
C3JBB2_9PORP/421-799LIIL....S..PEAF.................LSEAERLAEFHRSV.....DGMQVLVVGETALFNEFN...........
C9SW40_VERA1/279-917YLII....T..DDVTWDPVAIA..PGVSRPGLIKEFERLAEAKRAR......GISTRVVSITDIVAGRWGN.........
C9LI59_9BACT/509-899MVII....IPQSGKL.................LAQAERLAEAHKKQ......GLRVKVVRADQLYNEYS...........
B5ICF9_ACIB4/214-642NIII....T..SPQL.................KAAAQRLADFHNST......GVTSWVVTTTWIAKNYQPAP......NP
Y048_ARCFU/22-377EIIL....T..SEKL.................INSAYQLQEIHEKV......GIQSDIVTVEQIWDSYSPVE......DP
A3I371_9BACT/360-725LLII....T..TDEF.................SFAANKLKS.HKTN.....LGINTEVVFLKDIYNSFS...........

PF11713

A0KHZ7_AERHH/3609-3767-----------TRFT-----------------------------------------------------------------
Q2KX68_BORA1/2483-2627-----------DPYR-----------------------------------------------------------------
Q2SAY5_HAHCH/1-160-----------MNYD-----------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614-----------TRFD-----------------------------------------------------------------
Q7N726_PHOLL/2997-3151-----------TRFD-----------------------------------------------------------------
Q7VV06_BORPE/2551-2702-----------DPYA-----------------------------------------------------------------
Q7VV06_BORPE/2959-3112-----------DPYA-----------------------------------------------------------------
Q7VV06_BORPE/3397-3549-----------DRYG-----------------------------------------------------------------
Q7VV06_BORPE/3808-3959-----------DRYA-----------------------------------------------------------------
Q189K3_PEPD6/575-754-----------.RGY-----------------------------------------------------------------
Q189K5_PEPD6/577-756-----------.KNY-----------------------------------------------------------------
Q7CGR6_YERPE/772-928-----------.NHH-----------------------------------------------------------------
Q9KS12_VIBCH/3469-3626-----------TRFD-----------------------------------------------------------------

PF01650

LGMN_HUMAN/29-286------------------------------------------------IHR.NG-------------------------I
VPED_ARATH/46-316------------------------------------------------LRK.GG-------------------------L
VPEG_ARATH/59-330------------------------------------------------LRK.GG-------------------------L
A0CQC7_PARTE/19-285------------------------------------------------LIR.NG-------------------------Y
A2FXM6_TRIVA/13-267------------------------------------------------IAEVNN-------------------------L
O24539_VICNA/53-325------------------------------------------------LIK.GG-------------------------V
HGLB_SCHMA/37-291------------------------------------------------LRS.KG-------------------------I
HGLB_SCHJA/31-285------------------------------------------------LLS.KG-------------------------V
VPE_VICSA/56-325------------------------------------------------LRK.GG-------------------------S
A0A080VK93_PSEAI/341-579------------------------------------------------LGQRFA-------------------------A
Q08BI0_DANRE/27-278------------------------------------------------MKK.QG-------------------------I
Q0MYV8_EMIHU/33-301------------------------------------------------MIK.NG-------------------------I
Q22P32_TETTS/20-285------------------------------------------------LVK.KG-------------------------F
Q22P33_TETTS/20-285------------------------------------------------LLK.KG-------------------------F
D0MXB3_PHYIT/25-298------------------------------------------------VRR.HG-------------------------I
Q2UVF3_HAECO/29-287------------------------------------------------LIN.HG-------------------------V
Q4K5F2_PSEF5/335-570------------------------------------------------LASRFG-------------------------A
Q4RED0_TETNG/30-283------------------------------------------------VHR.NG-------------------------I
Q8P9N6_XANCP/124-392------------------------------------------------FEQRFD-------------------------A
Q6EHZ7_TRIVA/12-258------------------------------------------------LVK.RG-------------------------F
Q6FEB2_ACIAD/229-477------------------------------------------------FDTRFG-------------------------T
Q6L4R2_ORYSJ/41-319------------------------------------------------MRK.GG-------------------------V
Q6NYJ7_DANRE/32-288------------------------------------------------VHK.NG-------------------------I
Q6PRC7_IXORI/38-293------------------------------------------------LHN.HG-------------------------I
Q711M2_FASHE/21-278------------------------------------------------LIK.NG-------------------------F
VPE1_ORYSJ/62-334------------------------------------------------LQK.GG-------------------------V
Q852T1_TOBAC/49-320------------------------------------------------LKK.GG-------------------------L
Q88QE3_PSEPK/400-640------------------------------------------------LKVRFG-------------------------A
Q949L7_BETVU/51-321------------------------------------------------LKK.GG-------------------------L
Q9LLQ4_SESIN/54-326------------------------------------------------LKK.GG-------------------------L
Q9LWZ3_ORYSJ/41-304------------------------------------------------MKK.GG-------------------------L
Q9SBX2_MAIZE/45-317------------------------------------------------MKK.GG-------------------------L
Q9SMD0_SOLLC/39-316------------------------------------------------LKK.GG-------------------------L
Q9XG75_TOBAC/40-306------------------------------------------------LKK.GG-------------------------L

PF00656

Q7QGM9_ANOGA/35-227------------------------------------------------.NREGS-------------------------A
ICENC_DROME/196-443------------------------------------------------.RRIGA-------------------------E
O42284_CHICK/42-279------------------------------------------------.QRDGA-------------------------E
CAS1A_XENLA/144-382------------------------------------------------.ERHGA-------------------------K
CASPC_MOUSE/176-415------------------------------------------------.DRDNA-------------------------D
CASP4_MOUSE/132-369------------------------------------------------.LRYGA-------------------------N
CASP5_HUMAN/193-430------------------------------------------------.ARNGA-------------------------H
CASPD_BOVIN/136-373------------------------------------------------.PRNGA-------------------------A
CASP1_CANFA/163-400------------------------------------------------.TRDGA-------------------------E
CASP1_FELCA/161-406------------------------------------------------.LRKGA-------------------------D
CASP1_MOUSE/162-398------------------------------------------------.PRVGA-------------------------Q
CASP1_HUMAN/163-400------------------------------------------------.RRTGA-------------------------E
CASP1_PIG/163-400------------------------------------------------.RRDGA-------------------------D
Q9I9L7_DANRE/145-379------------------------------------------------.KRSGS-------------------------E
Q9DDJ2_DANRE/174-400------------------------------------------------.NRDGA-------------------------D
Q6NTR7_XENLA/280-494------------------------------------------------......-------------------------G
CFLAR_MOUSE/257-480------------------------------------------------......-------------------------G
Q6QN97_PIG/259-484------------------------------------------------......-------------------------G
CFLAR_HUMAN/252-477------------------------------------------------......-------------------------G
Q9NBW3_DROME/38-248------------------------------------------------.NRKGS-------------------------S
Q9TZP5_CAEEL/26-261------------------------------------------------.KRIGS-------------------------D
CASPE_MOUSE/22-256------------------------------------------------.AREGS-------------------------E
CASPE_HUMAN/18-241------------------------------------------------.AREGS-------------------------E
Q8I749_SUBDO/254-491------------------------------------------------SNRGGA-------------------------H
CASP2_RAT/200-445------------------------------------------------.FRSGG-------------------------D
CASP2_CHICK/171-416------------------------------------------------.YRSGG-------------------------D
Q9GV89_HYDVU/93-318------------------------------------------------.NRDGS-------------------------E
Q9IB63_XENLA/144-396------------------------------------------------.TRTGS-------------------------D
CASP9_HUMAN/161-413------------------------------------------------.TRTGS-------------------------N
Q90WU0_CHICK/148-400------------------------------------------------.TRAGS-------------------------D
Q9IB64_XENLA/261-494------------------------------------------------.DREGT-------------------------A
Q6E5N8_ICTPU/119-362------------------------------------------------.ERYGS-------------------------K
Q9I8J3_DANRE/238-473------------------------------------------------.KRTGT-------------------------D
Q6PAD9_XENLA/268-495------------------------------------------------.RREGS-------------------------D
Q90WU1_CHICK/237-479------------------------------------------------.DRNGT-------------------------H
CASP8_HUMAN/234-476------------------------------------------------.DRNGT-------------------------H
CASP8_MOUSE/236-478------------------------------------------------.DRKGT-------------------------D
Q9Y1U6_PRIPA/173-413------------------------------------------------.QRRGT-------------------------K
CED3_CAEEL/243-494------------------------------------------------.TRNGT-------------------------K
Q7QKT2_ANOGA/35-260------------------------------------------------.DRKGS-------------------------E
Q7PZJ9_ANOGA/20-250------------------------------------------------.NRDGW-------------------------E
Q9GV88_HYDVU/84-316------------------------------------------------YPRLGT-------------------------D
Q7Q1E0_ANOGA/62-291------------------------------------------------.VREGS-------------------------A
CASP1_SPOFR/61-293------------------------------------------------.SRTGT-------------------------N
CASP1_DROME/79-313------------------------------------------------.SRTGT-------------------------N
Q7Q4X6_ANOGA/73-309------------------------------------------------.SRAGT-------------------------N
DRICE_DROME/94-328------------------------------------------------.SRAGT-------------------------N
Q9NHF9_DROME/56-302------------------------------------------------.QRVGT-------------------------E
Q7Q803_ANOGA/54-306------------------------------------------------.ERKGT-------------------------D
Q7PV92_ANOGA/14-237------------------------------------------------.VRVGS-------------------------S
Q86FL0_ANOST/52-286------------------------------------------------.KREGS-------------------------D
Q8I6Y2_GEOCY/158-414------------------------------------------------.ERVGT-------------------------D
Q8ITP3_BRAFL/87-323------------------------------------------------.TRRGT-------------------------D
O88550_RAT/68-301------------------------------------------------.VRNGT-------------------------D
Q6DCI2_XENLA/78-314------------------------------------------------.ARNGT-------------------------D
Q8JIS8_ORYLA/58-285------------------------------------------------.PRNGT-------------------------D
CASP3_XENLA/56-280------------------------------------------------.VRNGT-------------------------D
O93417_CHICK/53-281------------------------------------------------.SRSGT-------------------------D
Q98UI8_DANRE/48-280------------------------------------------------.PRNGT-------------------------D
Q8JG42_TAKRU/51-279------------------------------------------------.TRNGT-------------------------D
Q8ITP2_BRAFL/151-396------------------------------------------------.RRRGS-------------------------H
Q9IB66_XENLA/58-298------------------------------------------------.SRRGT-------------------------N
Q9I8S9_ONCMY/57-297------------------------------------------------.PRNGT-------------------------N
O93415_CHICK/57-299------------------------------------------------.DRRGT-------------------------L
CASP6_MOUSE/28-270------------------------------------------------.ERRGT-------------------------N
PCP_DICDI/188-404------------------------------------------------.KLDGV-------------------------I
Q7AKE1_STRCO/9-268------------------------------------------------.PLPGI-------------------------R
A0A063TRB6_BORBO/552-800------------------------------------------------.NLQYA-------------------------V
Q7NPG1_GLOVI/7-278------------------------------------------------.DLPSC-------------------------L
Q87Z21_PSESM/2-224------------------------------------------------.PLMGC-------------------------V
Q82I86_STRAW/5-276------------------------------------------------.PLRGA-------------------------V
P74453_SYNY3/40-299------------------------------------------------.GLMGC-------------------------T
Q8YS65_NOSS1/4-245------------------------------------------------.PLNYA-------------------------K
Q9DDL2_DANRE/323-560------------------------------------------------.QLRAP-------------------------M
Q98CE0_RHILO/5-237------------------------------------------------.PLANP-------------------------I
Q6N0T4_RHOPA/30-250------------------------------------------------.PLSQA-------------------------V
Q89XG2_BRADU/27-247------------------------------------------------.PLKEP-------------------------L
Q89XE4_BRADU/58-278------------------------------------------------.PLTQS-------------------------I
Q6NBN5_RHOPA/57-277------------------------------------------------.PLLQP-------------------------I
Q98JS7_RHILO/35-253------------------------------------------------.PLTNP-------------------------R
Q985X8_RHILO/35-256------------------------------------------------.SLATP-------------------------A
Q6N5Q1_RHOPA/33-253------------------------------------------------.PLSTA-------------------------A
Q89KP2_BRADU/86-307------------------------------------------------.PLATT-------------------------A
Q89IK1_BRADU/30-253------------------------------------------------.QLPNP-------------------------P
Q98G71_RHILO/26-252------------------------------------------------.TLANP-------------------------V
Q6AKF4_DESPS/28-248------------------------------------------------.SLKNP-------------------------V
Q98IJ6_RHILO/11-238------------------------------------------------.PLANP-------------------------A
Q89MV1_BRADU/176-400------------------------------------------------.PLDNP-------------------------S
Q89HT8_BRADU/51-272------------------------------------------------.QLQNP-------------------------D
Q89FZ4_BRADU/32-256------------------------------------------------.ELPNA-------------------------A
Q6N329_RHOPA/73-298------------------------------------------------.ALPNP-------------------------V
Q98IJ9_RHILO/30-261------------------------------------------------.ALPNP-------------------------A
Q89HP3_BRADU/336-569------------------------------------------------.ALPNP-------------------------P
Q7RFI8_PLAYO/964-1364------------------------------------------------.QLHGS-------------------------A
Q74F93_GEOSL/6-270------------------------------------------------.KLNAC-------------------------E
MCA9_ARATH/10-321------------------------------------------------.ELHGC-------------------------I
MCA8_ARATH/3-378------------------------------------------------.ELRGC-------------------------V
MCA7_ARATH/3-401------------------------------------------------.ELQGC-------------------------V
Q70VV0_PICAB/3-415------------------------------------------------.ELKGC-------------------------V
Q9ZSP8_HEVBR/3-415------------------------------------------------.ELKGC-------------------------I
MCA4_ARATH/3-416------------------------------------------------.ELRGC-------------------------V
MCA5_ARATH/3-408------------------------------------------------.ELRGC-------------------------V
MCA6_ARATH/3-366------------------------------------------------.ELRGC-------------------------V
MCA1_ARATH/80-362------------------------------------------------.ELKGC-------------------------I
MCA2_ARATH/116-414------------------------------------------------.ELKGC-------------------------I
MCA1_SCHPO/130-422------------------------------------------------.ELQGC-------------------------I
MCA1_YARLI/168-458------------------------------------------------.ALRGC-------------------------I
MCA1_DEBHA/146-437------------------------------------------------.QLRGC-------------------------I
MCA1_ASHGO/154-449------------------------------------------------.ELRGC-------------------------I
MCA1_KLULA/138-430------------------------------------------------.ELRGC-------------------------I
MCA1_CANGA/98-389------------------------------------------------.ALRGC-------------------------I
B5VS82_YEAS6/157-450------------------------------------------------.QLRGC-------------------------I
Q386I9_TRYB2/84-341------------------------------------------------.ELRGC-------------------------Q
Q38D34_TRYB2/63-322------------------------------------------------.QLGGC-------------------------V
Q8T8E6_9TRYP/84-343------------------------------------------------.ALSGC-------------------------C

PF14538

W1QFK7_OGAPD/56-210------------------------------------------------FVDPTT.....YSDPKKA.L...........Q
L8WVZ0_THACA/73-224------------------------------------------------WVDPFS...M.P..SNKA.L...........E
A2EZ34_TRIVA/89-236------------------------------------------------WRNMSN......................ILPS
Q6C6R4_YARLI/86-238------------------------------------------------WVDPQT...ISD..SKKA.T...........E
M2WI96_DOTSN/172-328------------------------------------------------WVDPVPPDSS.NQNSNNT.N...........A
K2S4T3_MACPH/104-258------------------------------------------------WIDPTV...S.TGTSGHTPM...........N
C4LXC3_ENTHI/42-194------------------------------------------------WINTKE........HKKREI..........GY
T1G0Q6_HELRO/62-216------------------------------------------------WIGLLDVNGG.N..VQKP.I...........E
B0CNS4_LACBS/34-185------------------------------------------------WVDPHT...L.P..AQKA.L...........E
F0ZAV4_DICPU/115-266------------------------------------------------WIDPAS...Q.P..PQKS.L...........D
U9UGJ5_RHIID/52-203------------------------------------------------WVDPFA...L.P..PAKA.L...........D
Q5KIS3_CRYNJ/92-243------------------------------------------------WIDPTQ...L.P..APKA.I...........D
B0WBU4_CULQU/30-181------------------------------------------------WINLLC...LED...................D
A5DWK2_LODEL/143-295------------------------------------------------WCDPTT...FTD..TKKA.L...........E
G0VGR8_NAUCC/79-231------------------------------------------------WVDPLN...FQD..SKKA.I...........E
I3J5N7_ORENI/57-208------------------------------------------------WIDPLS...M.S..PQKA.L...........E
A2DYM2_TRIVA/68-215------------------------------------------------WRNMSK......................TLPS
D8TLK8_VOLCA/11-162------------------------------------------------WVDPMS...A.Q..PAKA.L...........E
G4M000_SCHMA/43-194------------------------------------------------WVDPTDANSLHA.......L...........G
C1MUE6_MICPC/45-196------------------------------------------------WINPLS...M.Q..PQKA.L...........D
Q387I9_TRYB2/89-240------------------------------------------------WEEPYI.............ARMPHIVTGGGSE
C4M2F5_ENTHI/38-189------------------------------------------------WIDTAG.....K..TNRKLV...........Y
G4TT65_PIRID/72-223------------------------------------------------WVDPRK...L.G..SAKA.L...........E
G0NWW0_CAEBE/64-218------------------------------------------------WVDPYK......CGAHKAAL............
A2DJF0_TRIVA/83-228------------------------------------------------WEDLSV......................VNTV
K3WJU9_PYTUL/84-235------------------------------------------------WVEPSS...M.P..PQKA.L...........E
A2G590_TRIVA/30-180------------------------------------------------TFDPTV.......................FAP
B8M6V6_TALSN/189-342------------------------------------------------WVDPTS...T.TGGQNKM.M...........E
A2FJN8_TRIVA/41-191------------------------------------------------TFDPSV.......................FAP
A2DLR3_TRIVA/97-242------------------------------------------------WQNIYQ......................MQAS
E5SIN8_TRISP/44-195------------------------------------------------WIDPQC...M.P..MQKA.L...........E
I1G727_AMPQE/53-204------------------------------------------------WIDPLS...R.G..SQKA.M...........E
U1MN31_ASCSU/95-246------------------------------------------------WIDPHG...M.N..PQKA.I...........A
I1L744_SOYBN/123-274------------------------------------------------WIDPFS...M.A..PQKA.L...........E
E4XFS5_OIKDI/48-228------------------------------------------------NINAWD.............VNDNFDNELPPQD
D2VMD1_NAEGR/144-294------------------------------------------------WVDPQT.....H..PQKA.L...........E
A9TBL2_PHYPA/91-242------------------------------------------------WIDPFS...T.A..SVKA.L...........E
B7PLB3_IXOSC/92-247------------------------------------------------WLGEDAGIRRSP..PQKA.L...........E
A0A0D2USM0_CAPO3/727-878------------------------------------------------WMDPFS...V.P..PQRA.L...........E
B8CBK6_THAPS/256-409------------------------------------------------WLDPTS...I.S..RAKA.K...........E
A4I1A2_LEIIN/114-279------------------------------------------------WVDPMV.....AHVAKSAHRSGRGSGAGGGSD
F4RLY3_MELLP/215-367------------------------------------------------WVDPKM...Y....PKESVL...........E
K4DUJ2_TRYCR/62-218------------------------------------------------WIDPHV.............AQISRFALEGGSD
H1VVG4_COLHI/158-309------------------------------------------------WTDPTT...P.P..PQKA.L...........E
M7XEP3_RHOT1/113-265------------------------------------------------WVDPFA...I.A..KDKA.M...........E
A2GCD5_TRIVA/98-247------------------------------------------------WQNTNN......................SFSS
D8RG53_SELML/72-223------------------------------------------------WIDPSS...L.A..PQKA.L...........D
A2F9H3_TRIVA/31-181------------------------------------------------TFDPTY.......................YAP
L0PHF8_PNEJ8/131-282------------------------------------------------WIDPFS...L.P..SQKS.L...........E
RTOR2_ARATH/94-246------------------------------------------------WIDPFS...MFP..PRRA.L...........E
M5E8T5_MALS4/58-209------------------------------------------------WMDPES...L.D..ASKA.L...........P
B3RPQ9_TRIAD/43-194------------------------------------------------WLDPLT...M.N..PNKS.L...........E
I4Y9Q8_WALSC/76-227------------------------------------------------WVDPTN...M.P..PPKA.L...........E
A2E4G0_TRIVA/101-242------------------------------------------------WSLSTS.........................S
A0A068XPC4_HYMMI/269-417------------------------------------------------WVDPAD........AGYRVV...........E
U4LGP0_PYROM/223-374------------------------------------------------WVDTLS...Q.P..ASKA.L...........E
A2F8U1_TRIVA/65-210------------------------------------------------WSKTST.....ESTSNPQ.............Q
D8T9J0_SELML/50-197------------------------------------------------WIEPSA..........KA.I...........D
A9V5A2_MONBE/628-777------------------------------------------------WIDPEE........KPKA.I...........E
F0XXV0_AURAN/12-164------------------------------------------------WLEPFA...GPS..RQKA.L...........E
A2E336_TRIVA/54-202------------------------------------------------WIQISN...TTQTLLSSVIL...........K
B4R5C8_DROSI/214-365------------------------------------------------WIDPSS...V.S..PPKA.M...........E
J4H2X1_FIBRA/92-243------------------------------------------------WVDPHT...L.P..AQKA.L...........D
A2EU18_TRIVA/81-227------------------------------------------------WSNIKN......................MSDT
A2DYB3_TRIVA/12-162------------------------------------------------TFDPTY.......................YAP
S2KE38_MUCC1/106-257------------------------------------------------WIDPFL...L.I..PQKS.L...........E
G7E3R0_MIXOS/173-325------------------------------------------------WIDPFS...L.N..KDKV.M...........D

PF03415

Q8A866_BACTN/37-399------------------------------------------------LVYMDK-......................GSN
Q9WZB1_THEMA/121-462------------------------------------------------VVVYDG-I.....................GIG
Q8XM44_CLOPE/59-508------------------------------------------------IVLVDR-IPGYSNDSKVLGSNFEDTRLYKIGE
Q9X1S5_THEMA/586-937------------------------------------------------VVIFDG-F.....................FHS
Q9WYY6_THEMA/5-301------------------------------------------------FALVDY-R.....................SSS
Q8TIY6_METAC/66-593------------------------------------------------LIAYGG-AAAEGWEGMTI...........AEL

PF12770

A0LJ53_SYNFM/581-921---------------------SS-------------------------AK...VLLVVPTG......SLYTIPFEM..LV
A0LQE8_SYNFM/635-947---------------------AG-------------------------AT...TLLLSLDG......ALRYIPFSC..LY
A1BCK0_CHLPD/513-826---------------------MG-------------------------IADDAELVWFPQG......GSGVFPVHAAWRQ
A1BEL3_CHLPD/43-361---------------------QA-------------------------GQSILPIVIESDI.....PAILQLPWEM..LW
A1BEL6_CHLPD/46-364---------------------QA-------------------------GTGILPLVIASDD.....PAILQLPWET..LY
A4HBL7_LEIBR/1053-1432---------------------QL-------------------------LFGDGMITVVPSG......QMWLVPFHA..LL
A8L4T6_FRASN/741-1051---------------------AP-------------------------YR...RAVLMPGG......LLGSAPLHAARLA
A9WBC0_CHLAA/673-929---------------------LP-------------------------IPVEGKLLIAPCA......PIHLAPFAA..LW
A9WER9_CHLAA/54-394---------------------QP-------------------------LR..LRLALDPQD.....AELQAIPWELLHFP
A9WF91_CHLAA/60-360---------------------RP-------------------------LPIRFRLFIAPSA.....AELHALRWETLCMP
B0C874_ACAM1/207-507---------------------KK-------------------------ID...TIIFSMDA......GLRSLPLAA..LH
B2IXC0_NOSP7/1396-1691---------------------RE-------------------------IN...NLVFLPDM......GLRSTPMAA..LH
B2IZZ4_NOSP7/695-973---------------------KD-------------------------IR...ALTIVPDD......ILHGFPFAA..IR
B2JAK0_NOSP7/526-830---------------------LK-------------------------AN...RIAIVTDN......TLDFIPFSA..LR
B2JAM9_NOSP7/866-1190---------------------LG-------------------------NK...RLLIVGDG......ILQYIPFAA..LP
B4JKU3_DROGR/1402-1700---------------------VS-------------------------RQGRRELILVLDS......ALYLVPFAI..LR
C3Z401_BRAFL/1278-1602---------------------PK-------------------------SPA.GQLVLVLDG......DLYLVPFAV..LK
F0SR63_RUBBR/137-574---------------------DS-------------------------VR...QVVVLPSP......LLQQIPLEV..LA
Q01RE6_SOLUE/865-1136---------------------EH-------------------------AR...RIWIEPDD......WLSLLPFRA..LR
Q024J7_SOLUE/541-814---------------------PA-------------------------GS...RVILTPDG......ALHGLNFESLPLP
Q025F1_SOLUE/607-877---------------------RG-------------------------KS...TIVVVPDG......VLWNLPFQA..LV
Q028B5_SOLUE/667-935---------------------RG-------------------------KS...TVVIAPDG......FLWQLPFQA..LE
Q02DA1_SOLUE/510-786---------------------DP-------------------------SR...TLVIEPDG......PVGTIPIQA..LM
Q10YT7_TRIEI/1003-1309---------------------GS-------------------------QK...QILISPDS......NLNLIPFEA..LV
Q10YU6_TRIEI/544-838---------------------SQ-------------------------IK...TLVFVLEG......NLRNIPMSV..LY
Q112V9_TRIEI/62-390---------------------DA-------------------------.....NLGIILEINEEAMPEVVAYPWELMCLP
Q113D1_TRIEI/130-430---------------------QE-------------------------RQHNFSYLIINDR......TTFEIPWEMLELK
Q113U8_TRIEI/3002-3297---------------------AN-------------------------ID...TLLFSMSE......SLRALPVAA..LH
Q115J8_TRIEI/1466-1777---------------------..-------------------------CQ...RLTLIPHS......FLHFLPLHILPIN
Q117G6_TRIEI/881-1206---------------------GS-------------------------KE...QILISPDS......HLNLIPFEA..LV
Q119J2_TRIEI/1474-1770---------------------YN-------------------------IN...MIVFSMDS......GLRTIPIAA..LH
Q16H64_AEDAE/1315-1614---------------------TS-------------------------RIGRRELILVLEK......ELYLVPFAI..LR
Q2G6U6_NOVAD/692-1020---------------------PQ-------------------------TR...HLVFEPDG......AMLQLPPTV..LV
Q2S6G2_SALRD/540-844---------------------PD-------------------------GQ...PLTVIPDG......PMFHVPFSMLATA
Q2W535_MAGSA/875-1218---------------------GG-------------------------RT...KVYIIPDG......MLNIAPISA..MV
Q38C46_TRYB2/1044-1397---------------------RL-------------------------LAKNGVVTIIPTD......GLWLVPFNA..LM
Q3AQG5_CHLCH/44-362---------------------RA-------------------------GQHIVPLLLSSND.....AAIQQLPWET..IY
Q5LLA3_RUEPO/680-970---------------------AR-------------------------SREHDKLFVIFTSM...IHWVFDMPWEF..AR
Q7NCT1_GLOVI/600-923---------------------LQ-------------------------AK...HLLIAPDG......QLNTLPFAA..LV
Q7NF67_GLOVI/550-854---------------------GG-------------------------RR...RLLVSPDG......ALNLIPFAA..LV
Q7NFD7_GLOVI/666-979---------------------GG-------------------------VK...HLLLSPDG......QLHTLPFGV..LV
Q7NIF7_GLOVI/691-997---------------------GD-------------------------VH...TLWIAPDA......QLNLLPFGA..LV
Q7NJE3_GLOVI/660-988---------------------PG-------------------------VK...HLFLAPDG......QLNTMPFAA..LV
Q7NLR0_GLOVI/653-961---------------------GN-------------------------TR...QILISPDG......LLNLLPIAA..LV
Q7NVB0_CHRVO/67-386---------------------NS-------------------------YT...QLRLVLSA.....AELALLPFEL..ML
Q82I85_STRAW/1175-1481---------------------GR-------------------------VP...RLVLVPMG......ALGLVPWHAAWEQ
Q82L10_STRAW/969-1256---------------------AP-------------------------WP...RLWWSPSG......VLNSFPLHAAGRH
Q8DGG5_THEEB/541-835---------------------GN-------------------------AT...HLLIAPDG......ELNTIPFQA..LV
Q8DH74_THEEB/570-891---------------------EG-------------------------ST...HLLVAPDG......QLNTLSFEA..LV
Q8DHI1_THEEB/67-394---------------------HT-------------------------YE...NLVISLGT......WLNRTRINF..LS
Q8DIE5_THEEB/1127-1420---------------------QG-------------------------IE...TLVFVLDS......GMRGIPVAA..LH
Q8YZU5_NOSS1/56-340---------------------QR-------------------------IK...TLVFIQDG......FLRDVPMAA..LY
TTC28_HUMAN/1390-1713---------------------PV-------------------------GRH.RQLILVLEG......ELYLIPFAL..LK

PF03568

G7E6G1_MIXOS/1513-1914LFDFA................AC-------------------------MHELKSIITEANA------TAQAAKTVD..TK
A8PX94_MALGO/1441-1824VLHVE................TV-------------------------MTELRQIIHSSNV------GVQG.A.KDVKAL
M7XLD2_RHOT1/1703-2100AFTFD................VA-------------------------MNELQDIIERNNS------GAQNAKLVD..GK
U5HB45_USTV1/1850-2253GLSYA................QA-------------------------SAELADIVARSNS------GAQNAKNVE..GK
F4RLY9_MELLP/91-479LFTLS................TA-------------------------LQELQNIVSCSNA------ATQRARHVS..GH
T1IUX7_STRMM/1624-1980.....................TF-------------------------LEEFERINEANRD------TMKS.........
A7RYA6_NEMVE/1651-2034AASKA......VMDLCKLFQGSV-------------------------DESFADVLRDSAE------SMNI.........
T1FT05_HELRO/413-770.....................TL-------------------------LEQFDWLLKENMN------TMKV.........
W4Y9R2_STRPU/1031-1383.....................GM-------------------------VNTLERILAESKE------TVKE.........
G3N6G2_GASAC/1731-2077.....................WM-------------------------VREMESIQVEQKL------VSSV.........
H3DAQ7_TETNG/1711-2057.....................WM-------------------------VQEMDEILVKQKV------VSCV.........
I3KSG7_ORENI/1715-2061.....................QL-------------------------VQEMDSILVEQKV------VSCV.........
H2L8K9_ORYLA/1692-2038.....................QL-------------------------LQEMDSILAEQKV------VSCV.........
M3ZIW2_XIPMA/1768-2114.....................WL-------------------------VQEMDSILVEQKV------VSCV.........
ESPL1_MOUSE/1716-2065.....................AV-------------------------LKEFDAIQKDQKE------NSSC.........
F7BUI1_CALJA/1724-2073.....................SA-------------------------LSEFDAIQKAQKE------NSSC.........
G3VPI8_SARHA/1713-2063.....................LA-------------------------LGEFDAIQKEQKE------NSSC.........
U3IXX7_ANAPL/1332-1679.....................SV-------------------------LSDFDTIQKEQKE------TISC.........
G1KFP0_ANOCA/1819-2167.....................AA-------------------------LSELDAILEKQKE------ISNF.........
H3B3H1_LATCH/1699-2055.....................SL-------------------------LCKFDSFLEEQKT------INYE.........
F6VXN8_XENTR/1732-2080.....................ST-------------------------LQEFDEIQKQQKA------VNNL.........
Q6ZHH8_ORYSJ/455-870LMRAT..DKNWQCPWGYTIIDYV-------------------------APTFRKILEENFI------SLSSATLTLNDGQ
W5GJD2_WHEAT/891-1304PTRAS..DKNWKCPWSCTIIDYV-------------------------APTFRKLLEDNFR------SLSGAIDIPKDGQ
K3Z105_SETIT/1078-1484PIGVL..DKKWQCPWGYAITDYV-------------------------APTFKKILDENFV------SLSSATLTINDVH
C5XYE8_SORBI/457-870PTRVL..DKKWQCPWGYGITDYV-------------------------APIFRNILEENFM------SLSSASLTFNDVN
C5XSY3_SORBI/1425-1832PTRVL..DKKWQCPWGYGITDDV-------------------------APIFRNILEENFM------SLSSAPLSINDVN
K3Y3B2_SETIT/1404-1817RMSVS..DKKWQCPWGYAITDHV-------------------------APTFRSILEENFM------SLSSATLTINDGQ
M0UBW7_MUSAM/65-479ADTGS..IKHWHCPWGYTVIDCI-------------------------LPSYKQLLEENFL------LLSNTTFAAADIQ
ESP1_ARATH/1641-2060ATQVKSLKGPWLCPWGTTVVDEV-------------------------APAFKSILEESHS------SSST...TEEDTI
M4DS49_BRARP/1599-2019ATQVKNLERRWLCPWGSTVVDDV-------------------------APAFKSILEESHI------SSGS...PVEDTR
B9GZR1_POPTR/1674-2094FLVSNNLDKHWHCPWGSTVVDDV-------------------------APTFRFILEENY.------.LSSSKFPLEDTK
B9SSN4_RICCO/1627-2045FPESNDLDKHWHCPWGFTVIDEV-------------------------SPAFKLILEENY.------.LSSSIFPLEDTK
I1MDQ8_SOYBN/1648-2063SPKCEEHSEKWHCPWGFTVVDDV-------------------------APTFKTILEENYL------STKS...PLEDTT
K4B224_SOLLC/1600-2023PFEVK..DKHWHCPWVSSVIDDV-------------------------APVFRDILENNY.------.LSSSVHLLEDTT
W1NKX2_AMBTC/1-423ISNNNGSSKEWSCPWNRNVLDDV-------------------------AAQFRVILEENF.------.LSSSTLFSVDTN
K7H1P7_CAEJA/245-604.....................EL-------------------------MDKFTYLLEEDER------IAKF........P
E3LM18_CAERE/731-1090.....................EL-------------------------MDKFTFMLEEDER------IAKY........P
G5ED39_CAEEL/727-1081.....................EL-------------------------MDKFTFLLDEDEM------IAKY........P
Q23491_CAEEL/749-1101.....................EV-------------------------MDKFTYLLEEDRQ------IVSN........H
S3CR95_OPHP1/1758-2208VFNFQ................QG-------------------------RAELLEIVKAIND------SCHG.A.RDMSVK
F0XAD9_GROCL/1636-2054VFSFQ................QG-------------------------RSELLEIIAATNA------SCHD.A.RDMTVK
G2R9B0_THITE/1619-2058VFDFQ................QG-------------------------RAELLEIIKLVNK------TCHD.S.RDMTVK
Q2H6Q9_CHAGB/1612-2026AFDFQ................QG-------------------------RSELLEIIKLINK------TCHD.S.RDMTAK
G0SHM3_CHATD/1723-2150VFDFH................TG-------------------------RAELLEIIKEINR------TCHD.S.RDMAAK
G4UQF5_NEUT9/1626-2085VFNYQ................QG-------------------------RAELLEIIRLANE------TCHD.A.RDFTVK
G4N8I2_MAGO7/1627-2057SFNYQ................TG-------------------------RAELLEIIELANA------SCHD.A.RDMSAK
J3P7L5_GAGT3/1606-2054SFNYH................QG-------------------------RAELQEIIGLADG------SAHR.A.KDMAKK
R8BFS3_TOGMI/72-487IFNFQ................QG-------------------------RTEILEVIRLANE------TCHD.A.RDLSIK
N4UZ87_COLOR/1637-2043LFDFQ................HG-------------------------YEELMDIIDATNE------SCHS.A.RTYTSN
G2X6M8_VERDV/1704-2113VFDFE................QG-------------------------HGELLEVIRLINE------SCHDEG.RDWSAK
G0RRT6_HYPJQ/1566-1971VFNFE................HG-------------------------REELLELIKLANE------SSHS.A.RDFTAK
M1WFQ9_CLAP2/1438-1889VFNFE................HG-------------------------REELIDIIRLANE------TSHS.A.RDFSAK
J5K578_BEAB2/1584-1996VYNFE................HG-------------------------KEELLDIIELANE------TSHS.A.RDFSLK
C7YYU1_NECH7/1580-1992VFNFE................HG-------------------------REEMLEIIRLANE------TSHS.ASRDFSAK
M7T4Q8_EUTLA/44-499ILSFQ................DG-------------------------RSELLDIIKSANR------TCHD.A.RDMSQK
L8G205_PSED2/1652-2056VFGFD................QG-------------------------KAELHEIIDLANA------SAHG.G.RDVSGR
N1JFH1_BLUG1/1598-2001VFGFE................QG-------------------------RAELREIVRLANE------SAHD.A.GNRTDR
K1X2E6_MARBU/1659-2061VFGFE................QG-------------------------HAELRDIIDMANE------SAHD.A.LCRNGR
S3D029_GLAL2/1639-2043VFGFE................QG-------------------------RCELQEIIDLANE------SAHS.A.RDMSSK
M7TX51_BOTF1/1640-2041VFGFE................QG-------------------------KSELINIIDLAKA------NSQS.G.PSRTGR
BIMB_EMENI/1609-2004QFTFE................DG-------------------------RDEMKELIRLANE------SAHA.A.KLQVDR
Q2USV7_ASPOR/1630-2030QFTFD................DG-------------------------REEMQELIKLANE------SSHA.A.KAQTDR
G7XGU8_ASPKW/1627-2026QYTFE................DG-------------------------KGDMQELIRLANE------SAHA.A.KHQTDR
S8BGE7_PENO1/1622-2018QFTFE................DG-------------------------KEEMRELIKLANQ------SAHA.A.KAQTTK
B6GZP8_PENCW/1602-1998QFTFE................DG-------------------------KEEMQELIKLANE------SAHA.A.KAQTDK
Q4WUU6_ASPFU/1638-2039QFTFE................DG-------------------------RREMQEIIRLANE------TAHA.A.KLQKDR
B6QNB5_PENMQ/1619-2016DFTFD................WG-------------------------KNEMKEIIALANA------SAHD.A.KTRIDK
V5GCB2_BYSSN/1684-2084EFTFD................EG-------------------------KRELQDIIKLANI------SAHD.A.RSRTDR
F0UL09_AJEC8/1642-2044EFDFG................EG-------------------------KKELLEIIRLANE------SAHN.A.RASIDK
C5FSW7_ARTOC/1655-2058TFSFQ................EG-------------------------KAELLEIIRLANA------SAHN.T.GSYVGK
H6C6Q4_EXODN/1587-1987DLDFD................KA-------------------------KAELQDIIAQANS------SSHD.PRGCSADK
U1G8A9_ENDPU/1638-2036PFRFH................TA-------------------------YSELGDIISNANL------TAHD.M.KAGSNR
K2R7J5_MACPH/1619-2043IFGFE................EG-------------------------KAELREIIDLSNF------STRN.A.PDLSKK
R7YNT5_CONA1/1696-2117VFDFT................AG-------------------------KVELNEIIELSDF------STHH.Q.RDMSVK
E4ZTB4_LEPMJ/1652-2063EFSFE................DG-------------------------KRDFDEIIELSDF------STRT.A.KDMTSR
N1QAI8_PSEFD/1492-1912QFHFN................AG-------------------------RAELQDIIQLSDY------TCHN.S.IDTSIK
N1QHR1_SPHMS/1187-1599LFDFE................AG-------------------------KAELREIIELSNY------SCHS.S.IETNAK
N1PZ16_DOTSN/1513-1936LFLFE................DG-------------------------KSELEEIINLSNF------SCHN.N.LDTSAK
D5GKQ4_TUBMM/1633-2033RWEYE................SM-------------------------LEELNEIVKGANI------SAHN.A.KDMTSK
U4LG69_PYROM/1616-2019LIEYD................AA-------------------------IKELRDIIEKSNQ------STHQ.A.KYMENK
S8C8B1_DACHA/1639-2040QFGFE................KG-------------------------LASFRDIVNRANV------STHS.A.KDMITK
Q6CCJ0_YARLI/1210-1588PFLFS................DG-------------------------LDELKSIISESDT------MTRT.G...TAFP
S9X830_SCHCR/1385-1771ILSFE................KA-------------------------QSAFEKIIGKSNE------TAQN.G.KDYTTK
CUT1_SCHPO/1383-1770ILVFT................KA-------------------------QTELFRIISKSNQ------MAQN.G.KHYTRR
B6K0I6_SCHJY/1359-1747IFLFQ................SA-------------------------YDELQSIIDRSNQ------ITRE.G.KDYKTR
M7PDE3_PNEMU/1489-1882TLTYD................NV-------------------------FNELNEIIFRSNE------TAQI.A.KNISTS
G8BT64_TETPH/1165-1563CYTFQ................DA-------------------------SDELNSIIKASNR------STSLEVTSNVSTK
I2H0Y5_TETBL/1280-1677SISFK................QF-------------------------KNELDTIIKLNND------TTSLSVTSKIKTK
S6EFD3_ZYGB2/1145-1542KLTFG................EA-------------------------KEELESIIQENNR------STSIEVTSAIKTK
C5DU01_ZYGRC/1141-1538RMTFY................EA-------------------------RNELISIVQESNA------TTSAEVTSAIKTR
G8ZWZ1_TORDC/1158-1555TLTFD................DA-------------------------RRELFNIIEKSNA------STSVEVTSSITTK
G0WDN6_NAUDC/1191-1589YLSFK................DA-------------------------SMELQNIIEESNR------STSFEVTNLIKTK
G0VFB3_NAUCC/1164-1562SLTFV................EA-------------------------VKELAYIIDESNS------TTSVEVTSSIKTK
H2B1L5_KAZAF/1161-1559HLSFK................EA-------------------------RKELQNIIDESDK------TTSAEVTSKITTS
ESP1_YEAST/1175-1571HLSFP................EA-------------------------TKKLLSIINESNQ------TTSVEVTNKIKTR
J7RG90_KAZNA/1160-1562HLSFS................AA-------------------------LEEMNTIVEENNK------TTSTEVTTQITTP
Q75EJ0_ASHGO/1152-1552TLTFA................LL-------------------------MEELNDIIEKNNR------TTSIEVTSVIKTK
C5DHM1_LACTC/1178-1575ELSFD................NA-------------------------VNELTQIIKESNK------TTSVEVTSNISTK
Q6CQQ7_KLULA/1118-1516VLGFE................AA-------------------------LDELNHIISSNNC------TTSIEVTSVITTK
Q6FTE1_CANGA/1151-1548SLTFQ................QA-------------------------SESLQKIINDSNE------SVSKNVTETIKDK
K0K8V1_WICCF/1175-1568SFSFT................DA-------------------------MRDLNQIIQESNA------TTSKERIASIKTA
A5DNR9_PICGU/1178-1576.VSID................QV-------------------------FSKLQAIVEASNK------STQVTTTSQIKTK
A3GFF5_PICST/1168-1555VISFQ................EM-------------------------ETQFKEIIRQSDL------STKSSTTSKIHTK
Q6BTB7_DEBHA/1338-1753GLSFI................EM-------------------------TNSLKSIIKQSDI------STRPETTSKIKSK
Q5A8X8_CANAL/1101-1536.LGFQ................QL-------------------------MQNFEKIIDDSNL------STKRKTTSKILTV
C5MEH0_CANTT/925-1303.MNFE................TM-------------------------KKELENIIEESNL------STKKATTSKIITV
M3HH45_CANMX/1423-1797.KTFD................VI-------------------------KNELEHVIRESNL------STKKAVTSKVVTV
G8B5X7_CANPC/1052-1424TLRFD................EM-------------------------KREFKRIFQENRK------STLYSTTSLVKTT
A5DVQ7_LODEL/1109-1530VMNFE................RL-------------------------KQEFNRIFEENRK------LTHNSTTSMIKTV
G3AGZ6_SPAPN/1149-1535IVGFK................EI-------------------------KARFASIIQESDQ------STKKEVTSRVNTK
G8YBL5_PICSO/1309-1719LTSFG................EI-------------------------KSYLKSIISRSNS------TTSPEMTSQVQTR
C4XY11_CLAL4/1177-1564FKSFA................DI-------------------------SACLQRIIEDSNG------STKKSVTTSVKTK
G3B782_CANTC/1213-1609SLSFT................GA-------------------------LDKLNAIIKRSDD------SIKPQTTSKIRTK
W1QIM9_OGAPD/1167-1527..SFG................SA-------------------------VQELEAIIQESDR------TTRIEVTSLVKTR
C4QYS2_PICPG/1259-1619..SWK................VF-------------------------KDRFNDIIEASAQ------TTNQERTTNVRTK
K5WME3_PHACS/1732-2136FLTFD................DA-------------------------IAELKEIIRLSDE------GTRQAQHVTK.DR
M2R2K9_CERS8/1618-2024HLTFD................DA-------------------------LEELKEIIRLSDE------GTRQAANVHKDDR
F8PLA9_SERL3/1278-1688HLTFD................DA-------------------------LNELKEIIRLSDQ------GTRQAAHVKKDDQ
S8E105_FOMPI/1678-2083RLTFA................DA-------------------------MDELKEIMRLNDE------GTRGAASVKKNDR
J4GX56_FIBRA/504-917HLSFH................DA-------------------------MTELEEILHLNDE------GTRQAASVQKNSK
A8NBE9_COPC7/1839-2276HLTFE................DA-------------------------MQEFNDIIRLSDE------GTKSAIHVRSDDE
B0E1W0_LACBS/104-540HLGFD................DA-------------------------IGELREIVRLSDE------GTKTAVNIKSDDE
D8Q1W5_SCHCM/1450-1878YLSFD................DA-------------------------LSEMGEIIRLSNE------STKSAVNIR.NDP
V2X3W8_MONRO/1588-2040QLTFE................DA-------------------------IEEFSDIIRLSNE------TTKVAASI.RNDQ
J0DCK6_AURDE/1634-2046RLTYH................DA-------------------------MAELAAIIRESNE------ATARGQGTQGMPK
Q5KMS4_CRYNJ/188-600IWTFD................AA-------------------------VEELETIVKASNE------GARRAKHIT..TS
R9AIE1_WALI9/1639-2036AFTYM................DA-------------------------MNELESVIEESDD------SIKSASDGNVKSD
I4YB88_WALSC/1631-2030AFTYR................DA-------------------------IDELQSIIEESDK------SIKSASDGQVITD
G4T5A4_PIRID/1472-1874VLPLG................SV-------------------------VKELDDIIASSVR------NGRKAAEVAGKGR

PF01364

KGP83_PORGN/244-595..........TN---------AS.........................IKAFIHKKYNDGLAASA...APVF....LALV
D1JG83_9ARCH/891-1295..PMEA....EE---------TL.........................KESVLDYKIK...........PDY....LIVV
A2U064_9FLAO/401-768..SGSK....DI---------TG.........................IRDFIKHLYTTN.SSPS..TQLKY....VCFF
Q7MTE2_PORGI/239-573..........TA---------NA.........................IQQFVKQEYEKEGNDLT...Y.......VLLI
D3HWT0_9BACT/400-777..GGTP....DA---------AA.........................YRRYLKMMYDRA.STAS..TMPKY....LLLF
Q5S3Q9_9FLAO/543-910..TSKQ....DI---------GA.........................IRNLVRYIYENA.P.EG..KKINY....LCLF
A9DMD5_9FLAO/555-923..TGNP....DI---------GA.........................IRNFIKYVYDNA.STVD..NRVKY....VCMF
B0VGA8_CLOAI/228-563..........ST---------QA.........................IKNYIQTQYDNPSTRPD...F.......IILL
B7B5I7_9PORP/382-753..SGTP....DA---------TA.........................YRRFMKMFYDRQ.TSEA..DAPKY....LLLF
B8FFM0_DESAA/254-600..PATG....DD---------VS.........................IKDFLTYAYNNW....A..LRPKW....VILG
A3U7G6_CROAH/540-908..SGQQ....DI---------SA.........................IRNFVKYVYDNA.SSPA..SRLKY....VCLF
D2QSX9_SPILD/414-786..SGQP....DP---------TA.........................IRDMVRYFYQQQ.P..T...KLRY....VLLF
A3HW99_9BACT/398-769..YGEE....GP---------TA.........................LFEFLRTYYPAH.Q.......PTH....LLLA
B0VHP2_CLOAI/234-563..........TA---------AN.........................IKTYIQNQYNLNDGLM....F.......VQLV
A8ZUB1_DESOH/278-656.YTGRN....DA---------ET.........................LRNFIIYAYENLNTEY............VLLG
B0VIM2_CLOAI/182-528..........TV---------QD.........................IKNFIANHYQTYKCDY............LFLW
Q2Z0E1_9BACT/643-1013..WGLV....DP---------SA.........................IRDYLKYLSDNSVVPPT...H.......ALLV
B3QXR8_CHLT3/734-1131..YGIK....SP---------HA.........................IRDFLDYAYHEWAVAPT...Y.......VLLL
C2MCN4_9PORP/405-781..GGTP....DA---------TA.........................YRLMLWDYKRRY.EAEH..GAESYH.PLLLLM
A4A325_9PLAN/24-399..........SK---------ER.........................IRAAIRETAKSGS........LRW....VVLV
A7NR84_ROSCS/499-867..DGQV....DP---------DA.........................IRAFLQFARPQA................VTLV
Q11Q36_CYTH3/558-932..SGKK....DL---------TA.........................IRDFVKMVYDRG.S.AG..SQLKY....LLLF
Q7MX16_PORGI/272-637NATSYI....NE---------TK.........................LKNFIRSVYNQSNAKRTLDGKLGY....VLLI
A0B5K7_METTP/796-1154..PGEV....EE---------WL.........................RESVGEKKLR...........PEY....LLVV
D0MH89_RHOM4/586-975..GGVP....DM---------RA.........................VRDYLKFLYDRA.PDES..SLLRY....ALLF
A8UH97_9FLAO/539-910..TGSQ....DI---------AA.........................LRNFVKYVYDNA.SIPS..KRLKY....LCLF
B8KYL6_9GAMM/364-704..NGIH....AP---------DA.........................LRRFVQYARSHWQKPAP..AM.......LLLV
B8FIK5_DESAA/1139-1542...GLD....SQ---------EK.........................IRNCIRDYVENQGTTF............VALG
Q11US7_CYTH3/392-767..YGEY....SS---------IA.........................IKRYCSEIIQVN.S......KEKY....LLIL
C6W101_DYAFD/326-680..AGQP....GP---------QG.........................IRNAIRWLCDHG.N.......LQF....VLLA
A5FJM8_FLAJ1/544-914..SGKQ....DI---------AA.........................IRNCIRYIYNNA.SSSD..KRVKY....LNLF
Q7UG73_RHOBA/51-444..........PA---------DN.........................ASDTHQQIWNVGGADTR...Y.......IVLV
A3J247_9FLAO/540-919..SGKQ....DV---------AA.........................IRNFIKYVYWNA.SASD..KRVKY....VNLF
A9WIM0_CHLAA/500-869..GGEP....DP---------RA.........................IRDFLRYAAATWSPAPE...A.......VILV
B0VHE7_CLOAI/227-554..........TN---------TN.........................IKSYIQTAYNNPATRPD...Y.......IVLI
C6VT06_DYAFD/394-758..YGEP....SP---------VG.........................IKRFMSYMLSD..SK......DKY....LFLI
C6X3N8_FLAB3/546-921..SGSK....DI---------TA.........................IRDFTTRL.....NTTS..GKLQY....LFIL
A0LQH1_SYNFM/790-1132..WGIV....TP---------YA.........................IRDFLAQASSWNPAPK....F.......VVFA
A1ZVJ9_9BACT/406-774..SGKQ....DV---------TA.........................LRDFARMLYLRD.S..Q...VFKY....LLLF
B0VHF1_CLOAI/214-595..QGID....TQ---------DK.........................LRNYIISLYTTN........PLRY....VFLA
B0VIE7_CLOAI/193-598..TGTD....NA---------EK.........................LRNYLQNTYAST........PFSY....LLLV
C6W3P4_DYAFD/414-806..YGEP....SP---------IA.........................IRRFVDFMISDLKKDNLG.RLDKY....LLLL
B2RGP6_PORG3/408-787..GGTP....DA---------TA.........................YRLFAKMFYDRW.KANA..PVGETFPMQMLLF
D2QJ99_SPILD/409-770..YGER....SP---------LA.........................IQQFMNQMRQQN.P..E...HLRY....LLLI
A9B5Q8_HERA2/466-850..SGNV....DP---------LA.........................IRDFMRYLASTWPQAPQ...S.......LVLV
D2QFF3_SPILD/397-745..YGEK....SP---------LA.........................LRRFADYLVANT.A.......VKH....LLLV
B0VH03_CLOAI/589-939..GGHI....DP---------AA.........................IRLALKYYYFNL...PA..PRITS....LTLL
D2R2P5_PIRSD/21-411..........SA---------AE.........................IRTAVRRVAATSLEQGG...KLRY....VLLV
C6W0Z3_DYAFD/393-758..SGSS....DI---------TA.........................IRDFARNLYQKT.P..G...KLKY....LLLF
A3XQP5_LEEBM/552-929..SGKQ....DI---------GA.........................IRNLVRYVYENA.SSAE..NRLKY....LCLF
Q2PY26_9BACT/412-780..GGVQ....DL---------TA.........................IKDMMRMLWSNA.SSPS..DKPEY....LLLF
Q26FX7_FLABB/537-909..EGEQ....DI---------AA.........................IRNFVKYVYDNA.SSPA..NRVRY....LNMF
B0VJT2_CLOAI/236-566..........TT---------TS.........................IKNYIQTKYNNPETRPD...F.......VVLI
C6BTD6_DESAD/56-402..SEAK....VV---------AG.........................IQSQVAKLNKDGKLMS............VLIL
D2QE53_SPILD/328-1007CGNGLKA..RDL---------AE........................LIRNFVKYAYKSW........KTRY....LLIG
A2BK55_HYPBU/159-551GETAPEYNESLA---------AK.........................IISFLREAVDAGVNY.............VLII
B0VHP1_CLOAI/283-636..........TT---------TS.........................IKAYMQNLWNSATSENPAPSY.......LLIV
Q1Q1Y4_9BACT/620-970..DGIF....SP---------QA.........................IRDFLSYTYNNWQEPAP..AY.......VVLI
C7PNY3_CHIPD/396-764..SGTP....DP---------TA.........................IRDFVKMCHDRG.G.......LQY....LLLF
Q6LFY5_PHOPR/224-617..........TQ---------AQ.........................IKAYIKDAYSNGTM.......TSY....VLLV
B3QVL4_CHLT3/688-1063..GGKQ....DF---------TA.........................IRDFLKFLYDNA.SSLD..DAPKY....VLLF
A9B187_HERA2/552-907..DGRV....DQ---------QA.........................IADFIKYAYHNWQAPAP..SF.......VVLV
R5M3W7_9BACE/537-910..SGTP....DG---------TA.........................YRRLMKMLYDRF.PNKA..ESPKY....LLFF
B0VJY1_CLOAI/655-1014..AGIT....GA---------EP.........................IRDFLRYAYNNW...SS..PQLSS....VILL
B8G4Y1_CHLAD/584-1054IA........LV---------KN.........................IRNFEIGRYQTYGSRFR...Y.......LMLI
A1ZEG7_9BACT/410-775..YGEY....SP---------LA.........................IKKFARYMYDKG.N.......PKF....LFLI
B0VF22_CLOAI/223-583..PGVD....NA---------EK.........................LRNFIINAYQTWANSSQ...PLEY....VILG
A0LKV0_SYNFM/924-1265..AGVP....EP---------NA.........................LRRFLRCARVHSGGALR...Y.......VLLV
A8ZTD5_DESOH/257-648..........TA---------AE.........................IQAFIQDAYDTWSIPPS...Y.......VLLV
A9B8S0_HERA2/477-840..FGHV....SP---------MA.........................IRTFLQHAAATWPSPPT...S.......VLLV
C3JBB2_9PORP/421-799..AGTP....DA---------TA.........................YRLMAKYFYDRW.MAAH..PGEKQSAQQLLLF
C9SW40_VERA1/279-917FRAGSR....DL---------QE........................VIRRFLKDVRTRW........GVNW....LLLG
C9LI59_9BACT/509-899..SGTP....DV---------AA.........................YRRYMKMLYDRA.QSNA..DMPRY....LLLF
B5ICF9_ACIB4/214-642PVNGYA....NA---------TTDPYGLLGGQALPLEKNMIIGYNYTLAKKIIAFLQNESYGSN.....VEY....ITIF
Y048_ARCFU/22-377LVSGYS....TE---------QVYDSYN..............YTLALKIISFLRTVNASY................VTIL
A3I371_9BACT/360-725..YGNK....DI---------TG.........................IRNFIAKIYQES....K...SLKN....VLIL

PF11713

A0KHZ7_AERHH/3609-3767------------------------------------------------SQVIIQT..EDDP---------------VAAK
Q2KX68_BORA1/2483-2627------------------------------------------------KRTVVVV..GDDL---------------QALQ
Q2SAY5_HAHCH/1-160------------------------------------------------KQLIIVLLTEPKD---------------NLRS
Q7N1Z0_PHOLL/2456-2614------------------------------------------------GQIILQM..EDDP---------------IAAR
Q7N726_PHOLL/2997-3151------------------------------------------------GQIIIQM..ENDP---------------IVAK
Q7VV06_BORPE/2551-2702------------------------------------------------NRVIVQL..AQDD---------------VATQ
Q7VV06_BORPE/2959-3112------------------------------------------------LRSIVQL..GTDA---------------ATAR
Q7VV06_BORPE/3397-3549------------------------------------------------HRTIVQL..GSDA---------------LTET
Q7VV06_BORPE/3808-3959------------------------------------------------HRVIVQL..GSDT---------------VTES
Q189K3_PEPD6/575-754------------------------------------------------IHYIVQL..QGDK---------------ISYE
Q189K5_PEPD6/577-756------------------------------------------------VHYIIQL..QGDD---------------ISYE
Q7CGR6_YERPE/772-928------------------------------------------------LQFIVLL..QDDS---------------LSKR
Q9KS12_VIBCH/3469-3626------------------------------------------------GQIIVQM..ENDP---------------VVAK

PF01650

LGMN_HUMAN/29-286PDE-----------------------------------------------------------------------------
VPED_ARATH/46-316KDE-----------------------------------------------------------------------------
VPEG_ARATH/59-330KEE-----------------------------------------------------------------------------
A0CQC7_PARTE/19-285NPE-----------------------------------------------------------------------------
A2FXM6_TRIVA/13-267DKD-----------------------------------------------------------------------------
O24539_VICNA/53-325KEE-----------------------------------------------------------------------------
HGLB_SCHMA/37-291KPE-----------------------------------------------------------------------------
HGLB_SCHJA/31-285KPE-----------------------------------------------------------------------------
VPE_VICSA/56-325KEE-----------------------------------------------------------------------------
A0A080VK93_PSEAI/341-579RGV-----------------------------------------------------------------------------
Q08BI0_DANRE/27-278PDE-----------------------------------------------------------------------------
Q0MYV8_EMIHU/33-301DPD-----------------------------------------------------------------------------
Q22P32_TETTS/20-285APE-----------------------------------------------------------------------------
Q22P33_TETTS/20-285QPE-----------------------------------------------------------------------------
D0MXB3_PHYIT/25-298PAE-----------------------------------------------------------------------------
Q2UVF3_HAECO/29-287KPD-----------------------------------------------------------------------------
Q4K5F2_PSEF5/335-570YGQ-----------------------------------------------------------------------------
Q4RED0_TETNG/30-283PDE-----------------------------------------------------------------------------
Q8P9N6_XANCP/124-392RGR-----------------------------------------------------------------------------
Q6EHZ7_TRIVA/12-258DDQ-----------------------------------------------------------------------------
Q6FEB2_ACIAD/229-477FGR-----------------------------------------------------------------------------
Q6L4R2_ORYSJ/41-319EEQ-----------------------------------------------------------------------------
Q6NYJ7_DANRE/32-288PDE-----------------------------------------------------------------------------
Q6PRC7_IXORI/38-293PDE-----------------------------------------------------------------------------
Q711M2_FASHE/21-278APE-----------------------------------------------------------------------------
VPE1_ORYSJ/62-334KEE-----------------------------------------------------------------------------
Q852T1_TOBAC/49-320KDE-----------------------------------------------------------------------------
Q88QE3_PSEPK/400-640RGQ-----------------------------------------------------------------------------
Q949L7_BETVU/51-321KDE-----------------------------------------------------------------------------
Q9LLQ4_SESIN/54-326RDE-----------------------------------------------------------------------------
Q9LWZ3_ORYSJ/41-304KDQ-----------------------------------------------------------------------------
Q9SBX2_MAIZE/45-317KDE-----------------------------------------------------------------------------
Q9SMD0_SOLLC/39-316KDE-----------------------------------------------------------------------------
Q9XG75_TOBAC/40-306KDE-----------------------------------------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227NDM-----------------------------------------------------------------------------
ICENC_DROME/196-443KDS-----------------------------------------------------------------------------
O42284_CHICK/42-279VDV-----------------------------------------------------------------------------
CAS1A_XENLA/144-382VDL-----------------------------------------------------------------------------
CASPC_MOUSE/176-415TDI-----------------------------------------------------------------------------
CASP4_MOUSE/132-369FDI-----------------------------------------------------------------------------
CASP5_HUMAN/193-430YDI-----------------------------------------------------------------------------
CASPD_BOVIN/136-373LDI-----------------------------------------------------------------------------
CASP1_CANFA/163-400LDI-----------------------------------------------------------------------------
CASP1_FELCA/161-406LDV-----------------------------------------------------------------------------
CASP1_MOUSE/162-398VDL-----------------------------------------------------------------------------
CASP1_HUMAN/163-400VDI-----------------------------------------------------------------------------
CASP1_PIG/163-400VDI-----------------------------------------------------------------------------
Q9I9L7_DANRE/145-379KDE-----------------------------------------------------------------------------
Q9DDJ2_DANRE/174-400RDE-----------------------------------------------------------------------------
Q6NTR7_XENLA/280-494NDA-----------------------------------------------------------------------------
CFLAR_MOUSE/257-480NDT-----------------------------------------------------------------------------
Q6QN97_PIG/259-484NDT-----------------------------------------------------------------------------
CFLAR_HUMAN/252-477NET-----------------------------------------------------------------------------
Q9NBW3_DROME/38-248NDV-----------------------------------------------------------------------------
Q9TZP5_CAEEL/26-261KDK-----------------------------------------------------------------------------
CASPE_MOUSE/22-256VDM-----------------------------------------------------------------------------
CASPE_HUMAN/18-241EDL-----------------------------------------------------------------------------
Q8I749_SUBDO/254-491IDV-----------------------------------------------------------------------------
CASP2_RAT/200-445VDH-----------------------------------------------------------------------------
CASP2_CHICK/171-416VDC-----------------------------------------------------------------------------
Q9GV89_HYDVU/93-318VDV-----------------------------------------------------------------------------
Q9IB63_XENLA/144-396IDR-----------------------------------------------------------------------------
CASP9_HUMAN/161-413IDC-----------------------------------------------------------------------------
Q90WU0_CHICK/148-400IDC-----------------------------------------------------------------------------
Q9IB64_XENLA/261-494KDA-----------------------------------------------------------------------------
Q6E5N8_ICTPU/119-362LDE-----------------------------------------------------------------------------
Q9I8J3_DANRE/238-473MDK-----------------------------------------------------------------------------
Q6PAD9_XENLA/268-495KDA-----------------------------------------------------------------------------
Q90WU1_CHICK/237-479VDA-----------------------------------------------------------------------------
CASP8_HUMAN/234-476LDA-----------------------------------------------------------------------------
CASP8_MOUSE/236-478CDK-----------------------------------------------------------------------------
Q9Y1U6_PRIPA/173-413ADV-----------------------------------------------------------------------------
CED3_CAEEL/243-494ADK-----------------------------------------------------------------------------
Q7QKT2_ANOGA/35-260KDV-----------------------------------------------------------------------------
Q7PZJ9_ANOGA/20-250KDL-----------------------------------------------------------------------------
Q9GV88_HYDVU/84-316VDA-----------------------------------------------------------------------------
Q7Q1E0_ANOGA/62-291IDC-----------------------------------------------------------------------------
CASP1_SPOFR/61-293VDS-----------------------------------------------------------------------------
CASP1_DROME/79-313VDA-----------------------------------------------------------------------------
Q7Q4X6_ANOGA/73-309VDC-----------------------------------------------------------------------------
DRICE_DROME/94-328VDC-----------------------------------------------------------------------------
Q9NHF9_DROME/56-302RDR-----------------------------------------------------------------------------
Q7Q803_ANOGA/54-306ADC-----------------------------------------------------------------------------
Q7PV92_ANOGA/14-237KDR-----------------------------------------------------------------------------
Q86FL0_ANOST/52-286RDR-----------------------------------------------------------------------------
Q8I6Y2_GEOCY/158-414KDA-----------------------------------------------------------------------------
Q8ITP3_BRAFL/87-323LDA-----------------------------------------------------------------------------
O88550_RAT/68-301KDA-----------------------------------------------------------------------------
Q6DCI2_XENLA/78-314IDA-----------------------------------------------------------------------------
Q8JIS8_ORYLA/58-285NDA-----------------------------------------------------------------------------
CASP3_XENLA/56-280VDA-----------------------------------------------------------------------------
O93417_CHICK/53-281ADA-----------------------------------------------------------------------------
Q98UI8_DANRE/48-280VDA-----------------------------------------------------------------------------
Q8JG42_TAKRU/51-279VDA-----------------------------------------------------------------------------
Q8ITP2_BRAFL/151-396VDA-----------------------------------------------------------------------------
Q9IB66_XENLA/58-298TDS-----------------------------------------------------------------------------
Q9I8S9_ONCMY/57-297ADR-----------------------------------------------------------------------------
O93415_CHICK/57-299ADR-----------------------------------------------------------------------------
CASP6_MOUSE/28-270ADR-----------------------------------------------------------------------------
PCP_DICDI/188-404NDV-----------------------------------------------------------------------------
Q7AKE1_STRCO/9-268NNL-----------------------------------------------------------------------------
A0A063TRB6_BORBO/552-800NDA-----------------------------------------------------------------------------
Q7NPG1_GLOVI/7-278EDA-----------------------------------------------------------------------------
Q87Z21_PSESM/2-224NDA-----------------------------------------------------------------------------
Q82I86_STRAW/5-276TDV-----------------------------------------------------------------------------
P74453_SYNY3/40-299TDR-----------------------------------------------------------------------------
Q8YS65_NOSS1/4-245RDA-----------------------------------------------------------------------------
Q9DDL2_DANRE/323-560ADV-----------------------------------------------------------------------------
Q98CE0_RHILO/5-237HDG-----------------------------------------------------------------------------
Q6N0T4_RHOPA/30-250SDA-----------------------------------------------------------------------------
Q89XG2_BRADU/27-247NDA-----------------------------------------------------------------------------
Q89XE4_BRADU/58-278NDA-----------------------------------------------------------------------------
Q6NBN5_RHOPA/57-277NDA-----------------------------------------------------------------------------
Q98JS7_RHILO/35-253NDA-----------------------------------------------------------------------------
Q985X8_RHILO/35-256NDA-----------------------------------------------------------------------------
Q6N5Q1_RHOPA/33-253NDG-----------------------------------------------------------------------------
Q89KP2_BRADU/86-307NDA-----------------------------------------------------------------------------
Q89IK1_BRADU/30-253HDA-----------------------------------------------------------------------------
Q98G71_RHILO/26-252NDA-----------------------------------------------------------------------------
Q6AKF4_DESPS/28-248NDA-----------------------------------------------------------------------------
Q98IJ6_RHILO/11-238RDA-----------------------------------------------------------------------------
Q89MV1_BRADU/176-400KDA-----------------------------------------------------------------------------
Q89HT8_BRADU/51-272NDA-----------------------------------------------------------------------------
Q89FZ4_BRADU/32-256NDA-----------------------------------------------------------------------------
Q6N329_RHOPA/73-298NDA-----------------------------------------------------------------------------
Q98IJ9_RHILO/30-261NDA-----------------------------------------------------------------------------
Q89HP3_BRADU/336-569NDA-----------------------------------------------------------------------------
Q7RFI8_PLAYO/964-1364NDA-----------------------------------------------------------------------------
Q74F93_GEOSL/6-270ADA-----------------------------------------------------------------------------
MCA9_ARATH/10-321NDV-----------------------------------------------------------------------------
MCA8_ARATH/3-378NDV-----------------------------------------------------------------------------
MCA7_ARATH/3-401NDV-----------------------------------------------------------------------------
Q70VV0_PICAB/3-415NDV-----------------------------------------------------------------------------
Q9ZSP8_HEVBR/3-415NDV-----------------------------------------------------------------------------
MCA4_ARATH/3-416NDV-----------------------------------------------------------------------------
MCA5_ARATH/3-408NDV-----------------------------------------------------------------------------
MCA6_ARATH/3-366NDV-----------------------------------------------------------------------------
MCA1_ARATH/80-362NDA-----------------------------------------------------------------------------
MCA2_ARATH/116-414NDA-----------------------------------------------------------------------------
MCA1_SCHPO/130-422NDV-----------------------------------------------------------------------------
MCA1_YARLI/168-458NDV-----------------------------------------------------------------------------
MCA1_DEBHA/146-437NDV-----------------------------------------------------------------------------
MCA1_ASHGO/154-449NDV-----------------------------------------------------------------------------
MCA1_KLULA/138-430NDS-----------------------------------------------------------------------------
MCA1_CANGA/98-389NDA-----------------------------------------------------------------------------
B5VS82_YEAS6/157-450NDA-----------------------------------------------------------------------------
Q386I9_TRYB2/84-341ADA-----------------------------------------------------------------------------
Q38D34_TRYB2/63-322NDV-----------------------------------------------------------------------------
Q8T8E6_9TRYP/84-343NDV-----------------------------------------------------------------------------

PF14538

W1QFK7_OGAPD/56-210AIG-----------------------------------------------------------------------------
L8WVZ0_THACA/73-224AIG-----------------------------------------------------------------------------
A2EZ34_TRIVA/89-236DFS-----------------------------------------------------------------------------
Q6C6R4_YARLI/86-238QIG-----------------------------------------------------------------------------
M2WI96_DOTSN/172-328QIG-----------------------------------------------------------------------------
K2S4T3_MACPH/104-258NIG-----------------------------------------------------------------------------
C4LXC3_ENTHI/42-194EIT-----------------------------------------------------------------------------
T1G0Q6_HELRO/62-216IIG-----------------------------------------------------------------------------
B0CNS4_LACBS/34-185AIG-----------------------------------------------------------------------------
F0ZAV4_DICPU/115-266LIG-----------------------------------------------------------------------------
U9UGJ5_RHIID/52-203AIG-----------------------------------------------------------------------------
Q5KIS3_CRYNJ/92-243AIG-----------------------------------------------------------------------------
B0WBU4_CULQU/30-181STA-----------------------------------------------------------------------------
A5DWK2_LODEL/143-295NIG-----------------------------------------------------------------------------
G0VGR8_NAUCC/79-231QIG-----------------------------------------------------------------------------
I3J5N7_ORENI/57-208TIG-----------------------------------------------------------------------------
A2DYM2_TRIVA/68-215DFS-----------------------------------------------------------------------------
D8TLK8_VOLCA/11-162HIG-----------------------------------------------------------------------------
G4M000_SCHMA/43-194NIG-----------------------------------------------------------------------------
C1MUE6_MICPC/45-196AIG-----------------------------------------------------------------------------
Q387I9_TRYB2/89-240RIA-----------------------------------------------------------------------------
C4M2F5_ENTHI/38-189DIA-----------------------------------------------------------------------------
G4TT65_PIRID/72-223AIG-----------------------------------------------------------------------------
G0NWW0_CAEBE/64-218EVA-----------------------------------------------------------------------------
A2DJF0_TRIVA/83-228EAV-----------------------------------------------------------------------------
K3WJU9_PYTUL/84-235TIG-----------------------------------------------------------------------------
A2G590_TRIVA/30-180SSS-----------------------------------------------------------------------------
B8M6V6_TALSN/189-342QIG-----------------------------------------------------------------------------
A2FJN8_TRIVA/41-191SSQ-----------------------------------------------------------------------------
A2DLR3_TRIVA/97-242DIS-----------------------------------------------------------------------------
E5SIN8_TRISP/44-195SIG-----------------------------------------------------------------------------
I1G727_AMPQE/53-204LIA-----------------------------------------------------------------------------
U1MN31_ASCSU/95-246KIA-----------------------------------------------------------------------------
I1L744_SOYBN/123-274SIG-----------------------------------------------------------------------------
E4XFS5_OIKDI/48-228VIY-----------------------------------------------------------------------------
D2VMD1_NAEGR/144-294AIG-----------------------------------------------------------------------------
A9TBL2_PHYPA/91-242AIA-----------------------------------------------------------------------------
B7PLB3_IXOSC/92-247AIG-----------------------------------------------------------------------------
A0A0D2USM0_CAPO3/727-878QIG-----------------------------------------------------------------------------
B8CBK6_THAPS/256-409RIG-----------------------------------------------------------------------------
A4I1A2_LEIIN/114-279SIA-----------------------------------------------------------------------------
F4RLY3_MELLP/215-367TIA-----------------------------------------------------------------------------
K4DUJ2_TRYCR/62-218SIA-----------------------------------------------------------------------------
H1VVG4_COLHI/158-309NIG-----------------------------------------------------------------------------
M7XEP3_RHOT1/113-265RIG-----------------------------------------------------------------------------
A2GCD5_TRIVA/98-247EYP-----------------------------------------------------------------------------
D8RG53_SELML/72-223TIG-----------------------------------------------------------------------------
A2F9H3_TRIVA/31-181DSR-----------------------------------------------------------------------------
L0PHF8_PNEJ8/131-282AIG-----------------------------------------------------------------------------
RTOR2_ARATH/94-246AIG-----------------------------------------------------------------------------
M5E8T5_MALS4/58-209AIG-----------------------------------------------------------------------------
B3RPQ9_TRIAD/43-194AVG-----------------------------------------------------------------------------
I4Y9Q8_WALSC/76-227TIG-----------------------------------------------------------------------------
A2E4G0_TRIVA/101-242IDP-----------------------------------------------------------------------------
A0A068XPC4_HYMMI/269-417MIG-----------------------------------------------------------------------------
U4LGP0_PYROM/223-374SIG-----------------------------------------------------------------------------
A2F8U1_TRIVA/65-210EIA-----------------------------------------------------------------------------
D8T9J0_SELML/50-197VIG-----------------------------------------------------------------------------
A9V5A2_MONBE/628-777LIS-----------------------------------------------------------------------------
F0XXV0_AURAN/12-164TIG-----------------------------------------------------------------------------
A2E336_TRIVA/54-202EIN-----------------------------------------------------------------------------
B4R5C8_DROSI/214-365LIG-----------------------------------------------------------------------------
J4H2X1_FIBRA/92-243IIG-----------------------------------------------------------------------------
A2EU18_TRIVA/81-227EFP-----------------------------------------------------------------------------
A2DYB3_TRIVA/12-162QTK-----------------------------------------------------------------------------
S2KE38_MUCC1/106-257AIG-----------------------------------------------------------------------------
G7E3R0_MIXOS/173-325AIG-----------------------------------------------------------------------------

PF03415

Q8A866_BACTN/37-399PKL-----------------------------------------------------------------------------
Q9WZB1_THEMA/121-462DGM-----------------------------------------------------------------------------
Q8XM44_CLOPE/59-508NSA-----------------------------------------------------------------------------
Q9X1S5_THEMA/586-937DWI-----------------------------------------------------------------------------
Q9WYY6_THEMA/5-301DTL-----------------------------------------------------------------------------
Q8TIY6_METAC/66-593EDL-----------------------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921RPA--ATKT...............SRKTQYLIEN...QAIL..YLSSASL.-----------------------------
A0LQE8_SYNFM/635-947DGR--.......................KYLIER...YTPVVFTPASRDR.-----------------------------
A1BCK0_CHLPD/513-826DSD--GS....................KRWLIDR...FTVR..YAPDFQV.-----------------------------
A1BEL3_CHLPD/43-361HPE--Y......................GFLALH...KEFT..........-----------------------------
A1BEL6_CHLPD/46-364HPD--Y......................GFLARH...EGFT..........-----------------------------
A4HBL7_LEIBR/1053-1432NVK--AG....................DRYFVEE...AAVQ..MAFS....-----------------------------
A8L4T6_FRASN/741-1051ETV--GG...................AGTYALDR...LTLV..YAPSVRA.-----------------------------
A9WBC0_CHLAA/673-929NGN--.......................NYLMER...YLIE..QIPTGA..-----------------------------
A9WER9_CHLAA/54-394ATD--NQS..................QLIPLTTS...DQIL..........-----------------------------
A9WF91_CHLAA/60-360DG.--.......................EPLLMG...EEVY..........-----------------------------
B0C874_ACAM1/207-507DGQ--.......................QFLVEQ...YNLA..LIPSFS..-----------------------------
B2IXC0_NOSP7/1396-1691DGK--.......................GFLVEK...YSIG..LMPSIS..-----------------------------
B2IZZ4_NOSP7/695-973YKE--.......................KYLIEH...YAIS..IAYESKG.-----------------------------
B2JAK0_NOSP7/526-830TND--G......................QYLIEK...YEIF..YLPSVTAQ-----------------------------
B2JAM9_NOSP7/866-1190NPT--QT...................KLQPLLVE...HEIV..NAPSAST.-----------------------------
B4JKU3_DROGR/1402-1700AAG--DD....................GEYLSER...CALL..TAPSLQA.-----------------------------
C3Z401_BRAFL/1278-1602GSS--S.....................NECLYER...YGLV..VTPSIQA.-----------------------------
F0SR63_RUBBR/137-574GDD--................................YVVS..YCPSATL.-----------------------------
Q01RE6_SOLUE/865-1136DDR--G......................FWLAEQ...HPIG..VISGLAD.-----------------------------
Q024J7_SOLUE/541-814GDT--P......................RYLIQE...VTLS..LAPSLAL.-----------------------------
Q025F1_SOLUE/607-877RPD--G......................AHLLER...QTVF..YAPSLTF.-----------------------------
Q028B5_SOLUE/667-935TEP--E......................RYLMED...RAIF..YTPSLSVL-----------------------------
Q02DA1_SOLUE/510-786DPA--F......................HYVGER...FAIT..IAAGLAD.-----------------------------
Q10YT7_TRIEI/1003-1309DEN--N......................RFLVEN...YSFT..YLSSGRD.-----------------------------
Q10YU6_TRIEI/544-838DSK--R.....................ERYLVER...YAIA..VAPSLE..-----------------------------
Q112V9_TRIEI/62-390EKY--NQ...................GQIYFATN...RKLS..FYRRRYQ.-----------------------------
Q113D1_TRIEI/130-430NN.--.......................DYLGAS.................-----------------------------
Q113U8_TRIEI/3002-3297DGE--.......................QFLIEK...YSLS..LIPSIS..-----------------------------
Q115J8_TRIEI/1466-1777NPE--NSQE................NPEKKYLQDYFNQGVS..YAPSCQI.-----------------------------
Q117G6_TRIEI/881-1206DEN--N......................QYLVEN...YSIT..YLSSGRD.-----------------------------
Q119J2_TRIEI/1474-1770DGQ--.......................QFLVEK...YSLG..LIPSFT..-----------------------------
Q16H64_AEDAE/1315-1614SGD--ES....................GEYLSER...CSLL..TVPSLHT.-----------------------------
Q2G6U6_NOVAD/692-1020SGD--KGIEAYKARMESPDGDPFDFTGVEWLGRG...REVS..IAVSPRG.-----------------------------
Q2S6G2_SALRD/540-844APG--GRYD...............HEQARFVLHE...RPTA..LDLSASLA-----------------------------
Q2W535_MAGSA/875-1218EPN--R......................KYLIER...IDLH..VLNSSRD.-----------------------------
Q38C46_TRYB2/1044-1397SRN--G......................NFVIED...FAFQ..LGFS....-----------------------------
Q3AQG5_CHLCH/44-362HPD--Y......................GFLARH...EGFT..........-----------------------------
Q5LLA3_RUEPO/680-970DPE--R.....................GTYLATE....DVH..FIRNV...-----------------------------
Q7NCT1_GLOVI/600-923GQD--G......................HPLLQD...HTLT..YLVSGRE.-----------------------------
Q7NF67_GLOVI/550-854DEH--G......................RFLVER...FTIQ..YLGSGRD.-----------------------------
Q7NFD7_GLOVI/666-979DEQ--G......................HYLIEK...YTLS..YLNAGRD.-----------------------------
Q7NIF7_GLOVI/691-997DEQ--G......................RYLLER...FELV..YLSSGRD.-----------------------------
Q7NJE3_GLOVI/660-988AQD--G......................RSLLQR...YALT..YLVSGRE.-----------------------------
Q7NLR0_GLOVI/653-961DER--N......................RYLVEN...YTIS..YLSSGRD.-----------------------------
Q7NVB0_CHRVO/67-386SPP--GQP.................GAGQHLLLQ............AQRP.-----------------------------
Q82I85_STRAW/1175-1481GDD--GR....................RRYALQA...AEIS..YAASARL.-----------------------------
Q82L10_STRAW/969-1256GSG--EA...................ADAAVLDR...VASS..YTPTLRAL-----------------------------
Q8DGG5_THEEB/541-835DAQ--G......................RYLVES...YWIT..LLTSGRE.-----------------------------
Q8DH74_THEEB/570-891DRQ--D......................RYLVQS...YTIT..LLTSGRD.-----------------------------
Q8DHI1_THEEB/67-394EAQ--LNE..................QSAFSREQASFFGLGNFILPPP...-----------------------------
Q8DIE5_THEEB/1127-1420DGK--.......................GFLVER...FSMA..LVPSLR..-----------------------------
Q8YZU5_NOSS1/56-340DKK--E.....................SRYLTEK...YAVA..TTSSLQ..-----------------------------
TTC28_HUMAN/1390-1713GSS--S.....................NEYLYER...FGLL..AVPSIRS.-----------------------------

PF03568

G7E6G1_MIXOS/1513-1914ETR..K----------------------SWWQIR---QALD---------------------------------------
A8PX94_MALGO/1441-1824EAR..K----------------------VWWTHR---RALD---------------------------------------
M7XLD2_RHOT1/1703-2100EQR..A----------------------AWWAER---KELD---------------------------------------
U5HB45_USTV1/1850-2253EAR..I----------------------AWWAER---KELD---------------------------------------
F4RLY9_MELLP/91-479DEK..V----------------------TWWTER---KELD---------------------------------------
T1IUX7_STRMM/1624-1980DNR..N----------------------VWWDKR---RKLN---------------------------------------
A7RYA6_NEMVE/1651-2034SST..K----------------------EWCQRR---SNLD---------------------------------------
T1FT05_HELRO/413-770TNK..K----------------------EWWDRR---QSLD---------------------------------------
W4Y9R2_STRPU/1031-1383TDK..R----------------------VWWTTR---QRLD---------------------------------------
G3N6G2_GASAC/1731-2077SEK..V----------------------KWWEGR---RVLD---------------------------------------
H3DAQ7_TETNG/1711-2057SEK..A----------------------KWWEGR---RALD---------------------------------------
I3KSG7_ORENI/1715-2061SEK..A----------------------KWWEGR---RALD---------------------------------------
H2L8K9_ORYLA/1692-2038AEK..A----------------------LWWEGR---RALD---------------------------------------
M3ZIW2_XIPMA/1768-2114AEK..A----------------------KWWEGR---RALD---------------------------------------
ESPL1_MOUSE/1716-2065TEK..R----------------------VWWTGR---LALD---------------------------------------
F7BUI1_CALJA/1724-2073TDK..R----------------------EWWTGR---LALD---------------------------------------
G3VPI8_SARHA/1713-2063TEK..S----------------------KWWATR---LKLD---------------------------------------
U3IXX7_ANAPL/1332-1679TNK..R----------------------EWWLCR---SELD---------------------------------------
G1KFP0_ANOCA/1819-2167TEK..E----------------------DWWTGR---IALD---------------------------------------
H3B3H1_LATCH/1699-2055TDK..K----------------------IWWEGR---ADLD---------------------------------------
F6VXN8_XENTR/1732-2080TDK..K----------------------EWWEGR---MELD---------------------------------------
Q6ZHH8_ORYSJ/455-870ANH..V----------------------KWWSHR---MKLN---------------------------------------
W5GJD2_WHEAT/891-1304ANA..V----------------------RWWSDR---MKLN---------------------------------------
K3Z105_SETIT/1078-1484ADH..V----------------------RWWSHR---MKLN---------------------------------------
C5XYE8_SORBI/457-870ADR..V----------------------RWWSHR---IRLN---------------------------------------
C5XSY3_SORBI/1425-1832ADH..V----------------------RWWSHR---KKLN---------------------------------------
K3Y3B2_SETIT/1404-1817ANC..V----------------------RWWAHR---MKLN---------------------------------------
M0UBW7_MUSAM/65-479MKN..A----------------------SWWSQR---TMLN---------------------------------------
ESP1_ARATH/1641-2060ESR..G----------------------LWWKKR---KKLN---------------------------------------
M4DS49_BRARP/1599-2019EHR..N----------------------SWWKKR---KTLD---------------------------------------
B9GZR1_POPTR/1674-2094ENR..N----------------------LWWTKR---KELD---------------------------------------
B9SSN4_RICCO/1627-2045ENR..T----------------------LWWMRR---KKLD---------------------------------------
I1MDQ8_SOYBN/1648-2063QNR..M----------------------LWWKRR---KNLD---------------------------------------
K4B224_SOLLC/1600-2023ENR..S----------------------SWWKWR---KQLD---------------------------------------
W1NKX2_AMBTC/1-423ENR..S----------------------IWWNWR---TKLN---------------------------------------
K7H1P7_CAEJA/245-604GDMSPT----------------------TFWERR---KGVD---------------------------------------
E3LM18_CAERE/731-1090GEMTPE----------------------EFWKRR---KVVD---------------------------------------
G5ED39_CAEEL/727-1081GDITPE----------------------EFWKRR---KIVD---------------------------------------
Q23491_CAEEL/749-1101EKYKFE----------------------ECWDRR---KIVD---------------------------------------
S3CR95_OPHP1/1758-2208GAK..S----------------------DWWSER---EELD---------------------------------------
F0XAD9_GROCL/1636-2054GAK..S----------------------AWWTER---TALD---------------------------------------
G2R9B0_THITE/1619-2058GAK..S----------------------AWWAER---EALD---------------------------------------
Q2H6Q9_CHAGB/1612-2026GAK..G----------------------AWWTER---EALD---------------------------------------
G0SHM3_CHATD/1723-2150GER..E----------------------KWWAER---EALD---------------------------------------
G4UQF5_NEUT9/1626-2085GAK..T----------------------AWWADR---EALD---------------------------------------
G4N8I2_MAGO7/1627-2057GAK..T----------------------AWWSHR---EELD---------------------------------------
J3P7L5_GAGT3/1606-2054RLK..S----------------------EWWAER---EELD---------------------------------------
R8BFS3_TOGMI/72-487GAK..S----------------------AWWADR---AALD---------------------------------------
N4UZ87_COLOR/1637-2043GAK..E----------------------AWWKRR---EELD---------------------------------------
G2X6M8_VERDV/1704-2113GAK..A----------------------AWWQER---EALD---------------------------------------
G0RRT6_HYPJQ/1566-1971GER..G----------------------AWWAER---QALD---------------------------------------
M1WFQ9_CLAP2/1438-1889NER..N----------------------AWWAER---EALD---------------------------------------
J5K578_BEAB2/1584-1996GER..N----------------------AWWAER---ETLD---------------------------------------
C7YYU1_NECH7/1580-1992GAK..S----------------------AWWAER---EALD---------------------------------------
M7T4Q8_EUTLA/44-499EAK..S----------------------VWWTER---EELD---------------------------------------
L8G205_PSED2/1652-2056EGK..I----------------------AWWAER---DELN---------------------------------------
N1JFH1_BLUG1/1598-2001KSK..L----------------------MWWEER---EALD---------------------------------------
K1X2E6_MARBU/1659-2061EAK..T----------------------AWWEER---EALD---------------------------------------
S3D029_GLAL2/1639-2043EAR..I----------------------QWWEER---DELD---------------------------------------
M7TX51_BOTF1/1640-2041EAK..L----------------------AWWAER---AELD---------------------------------------
BIMB_EMENI/1609-2004QMK..K----------------------EWWKNR---EALD---------------------------------------
Q2USV7_ASPOR/1630-2030QMK..K----------------------DWWKNR---EALD---------------------------------------
G7XGU8_ASPKW/1627-2026QMK..K----------------------DWWKNR---EALD---------------------------------------
S8BGE7_PENO1/1622-2018QMK..K----------------------EWWTNR---EALD---------------------------------------
B6GZP8_PENCW/1602-1998LSK..K----------------------EWWKTR---EALD---------------------------------------
Q4WUU6_ASPFU/1638-2039HSK..K----------------------EWWRNR---EALN---------------------------------------
B6QNB5_PENMQ/1619-2016NSK..K----------------------QWWATR---ESLD---------------------------------------
V5GCB2_BYSSN/1684-2084QSR..K----------------------EWWANR---EALD---------------------------------------
F0UL09_AJEC8/1642-2044SAK..R----------------------EWWATR---QSLD---------------------------------------
C5FSW7_ARTOC/1655-2058KEK..K----------------------EWWANR---ENLD---------------------------------------
H6C6Q4_EXODN/1587-1987SLR..K----------------------AWYNER---KALD---------------------------------------
U1G8A9_ENDPU/1638-2036QAK..K----------------------LWWATR---EALD---------------------------------------
K2R7J5_MACPH/1619-2043GAK..T----------------------EWWAER---EALD---------------------------------------
R7YNT5_CONA1/1696-2117GAK..T----------------------GWWAER---EALD---------------------------------------
E4ZTB4_LEPMJ/1652-2063EAR..Q----------------------QWWTER---EALD---------------------------------------
N1QAI8_PSEFD/1492-1912GAK..T----------------------KWWSER---EALD---------------------------------------
N1QHR1_SPHMS/1187-1599GAK..T----------------------NWWSER---EALD---------------------------------------
N1PZ16_DOTSN/1513-1936GAK..T----------------------NWWAER---EALD---------------------------------------
D5GKQ4_TUBMM/1633-2033GAR..T----------------------EWWKQR---ESLD---------------------------------------
U4LG69_PYROM/1616-2019NDR..A----------------------TWWTER---QQLD---------------------------------------
S8C8B1_DACHA/1639-2040DVR..A----------------------KWWSER---EVLD---------------------------------------
Q6CCJ0_YARLI/1210-1588GGS..E----------------------AWWAKR---HELD---------------------------------------
S9X830_SCHCR/1385-1771QEK..E----------------------SWWKQR---RELD---------------------------------------
CUT1_SCHPO/1383-1770EDK..E----------------------TWWKER---RHLD---------------------------------------
B6K0I6_SCHJY/1359-1747EEK..E----------------------RWWKER---RELD---------------------------------------
M7PDE3_PNEMU/1489-1882AHK..V----------------------VWWKER---QELD---------------------------------------
G8BT64_TETPH/1165-1563EEK..K----------------------QWWKSR---YDLD---------------------------------------
I2H0Y5_TETBL/1280-1677EDR..K----------------------SWWKQR---HDLD---------------------------------------
S6EFD3_ZYGB2/1145-1542EER..K----------------------AWWETR---YRLD---------------------------------------
C5DU01_ZYGRC/1141-1538EER..R----------------------MWWETR---YDLD---------------------------------------
G8ZWZ1_TORDC/1158-1555DER..K----------------------KWWQTR---YELD---------------------------------------
G0WDN6_NAUDC/1191-1589EQR..K----------------------EWWDLR---HELD---------------------------------------
G0VFB3_NAUCC/1164-1562EDR..K----------------------TWWKSR---YELD---------------------------------------
H2B1L5_KAZAF/1161-1559DAR..K----------------------AWWRKR---YDLD---------------------------------------
ESP1_YEAST/1175-1571EER..K----------------------SWWTTR---YDLD---------------------------------------
J7RG90_KAZNA/1160-1562EGR..K----------------------KWWQSR---YQLD---------------------------------------
Q75EJ0_ASHGO/1152-1552EDR..R----------------------EWWEER---YSLD---------------------------------------
C5DHM1_LACTC/1178-1575DAR..K----------------------RWWQYR---YELD---------------------------------------
Q6CQQ7_KLULA/1118-1516EQR..K----------------------NWWDER---YALN---------------------------------------
Q6FTE1_CANGA/1151-1548NDV..R----------------------NWWKRR---YDLD---------------------------------------
K0K8V1_WICCF/1175-1568EDR..Q----------------------QWHQER---FELD---------------------------------------
A5DNR9_PICGU/1178-1576DDR..K----------------------KWWSTR---FGLD---------------------------------------
A3GFF5_PICST/1168-1555EER..K----------------------NWWRLR---FSLD---------------------------------------
Q6BTB7_DEBHA/1338-1753EDR..K----------------------NWWKLR---FSLD---------------------------------------
Q5A8X8_CANAL/1101-1536EDR..K----------------------QWWRSR---FTLD---------------------------------------
C5MEH0_CANTT/925-1303EDR..K----------------------QWWRSR---FTLD---------------------------------------
M3HH45_CANMX/1423-1797DDR..K----------------------SWWRSR---FTLD---------------------------------------
G8B5X7_CANPC/1052-1424QDR..K----------------------KWWKTR---FTLD---------------------------------------
A5DVQ7_LODEL/1109-1530DDR..K----------------------GWWKQR---FTLD---------------------------------------
G3AGZ6_SPAPN/1149-1535AQR..Q----------------------KWWKLR---FELD---------------------------------------
G8YBL5_PICSO/1309-1719DDR..K----------------------TWWKIR---FALD---------------------------------------
C4XY11_CLAL4/1177-1564EDR..R----------------------NWWKMR---FELD---------------------------------------
G3B782_CANTC/1213-1609EDR..T----------------------NWWRLR---FSLD---------------------------------------
W1QIM9_OGAPD/1167-1527ADR..A----------------------NWWAQR---KSLD---------------------------------------
C4QYS2_PICPG/1259-1619ADR..Q----------------------DWWKER---RELD---------------------------------------
K5WME3_PHACS/1732-2136VSR..S----------------------AWWADR---AALD---------------------------------------
M2R2K9_CERS8/1618-2024KAR..A----------------------AWWTDR---RALD---------------------------------------
F8PLA9_SERL3/1278-1688KAR..T----------------------AWWADR---SALD---------------------------------------
S8E105_FOMPI/1678-2083AAR..A----------------------AWWAAR---GALD---------------------------------------
J4GX56_FIBRA/504-917SAR..A----------------------TWWAGR---SALD---------------------------------------
A8NBE9_COPC7/1839-2276EAR..S----------------------NWWRQR---NELD---------------------------------------
B0E1W0_LACBS/104-540EAR..A----------------------NWWKLR---GDLD---------------------------------------
D8Q1W5_SCHCM/1450-1878EAR..Q----------------------NWWKER---AGLD---------------------------------------
V2X3W8_MONRO/1588-2040AAR..A----------------------KWWKER---GTLD---------------------------------------
J0DCK6_AURDE/1634-2046EAR..V----------------------AWWAAR---NELD---------------------------------------
Q5KMS4_CRYNJ/188-600EGK..A----------------------EWWAER---RALD---------------------------------------
R9AIE1_WALI9/1639-2036DEK..V----------------------AWWNKR---KTLD---------------------------------------
I4YB88_WALSC/1631-2030DDK..V----------------------DWWNCR---KHLD---------------------------------------
G4T5A4_PIRID/1472-1874NAK..A----------------------RWWAER---SELD---------------------------------------

PF01364

KGP83_PORGN/244-595GDT--...................................DVISGEKG................................
D1JG83_9ARCH/891-1295GGT--GSVPFVDTELVQNLTVTYDNYSLVEDYLPQDFIDALNDPKIQEKITLLAQEGY......................
A2U064_9FLAO/401-768GDS--SYD...................YKDR..IAANNNI..VPVKLSTIS.............................
Q7MTE2_PORGI/239-573GDH--...................................KDIPAKI.................................
D3HWT0_9BACT/400-777GDG--VWDNR..............MLTPECR..NLNPDDY..LLCFESENS.............................
Q5S3Q9_9FLAO/543-910GDA--SFD...................YKDR..VKNNTNL..VPNLQSLGS.............................
A9DMD5_9FLAO/555-923GDA--SYD...................YKDR..IEGNTNI..VPVYQAFDS.............................
B0VGA8_CLOAI/228-563GDT--................................NGSYTIPTYTEQ...............................
B7B5I7_9PORP/382-753GDG--SFDNR..............KLTSAWK..SVDMSNM..LLTYQTENS.............................
B8FFM0_DESAA/254-600GDV--...................................DKIPTHHTACATWN..........................
A3U7G6_CROAH/540-908GEG--SVD...................YKDR..LQNNNLI..IPTYQRLRS.............................
D2QSX9_SPILD/414-786GDA--TFNYR..............NIGGLVS..PAQLANM..VPVYESRES.............................
A3HW99_9BACT/398-769GRS--LTMYSTAR.........QNGVNYFYRNNPSAFSFQNLVPPGG.................................
B0VHP2_CLOAI/234-563GDA--...................................PQIPTLT.................................
A8ZUB1_DESOH/278-656GDT--...................................GIIPPRTLWCE.............................
B0VIM2_CLOAI/182-528GDV--................................NGTYAIPTNFIVSP.............................
Q2Z0E1_9BACT/643-1013GDS--SLD..................YRHY....LTTGIECFVPTYYTG...............................
B3QXR8_CHLT3/734-1131GDA--.............................SYSTSNDYVPTMHVQT..............................
C2MCN4_9PORP/405-781GDG--AYDNR..............KVSQDWSARDFQLTEF..LLTYQGENS.............................
A4A325_9PLAN/24-399GDV--..........................PGDQPTPEAPGVPTHLMDAVVN...........................
A7NR84_ROSCS/499-867GDG--SSDP................FDYTD....RGAKNVNLIPPYLAMV..............................
Q11Q36_CYTH3/558-932GKP--TYD...................YKNH..TGIGGNF..VPTYESRES.............................
Q7MX16_PORGI/272-637GKP--LSKYL..............ADTDNTKVPTSFIHNVSLIPSHPT................................
A0B5K7_METTP/796-1154GDP--GSLPFPT..........TGVKQELE...........GDP....................................
D0MH89_RHOM4/586-975GDG--HYNY.................RELWQ..KPTLKNW..VPPYETVDS.............................
A8UH97_9FLAO/539-910GDG--SYD...................YKDR..IRNNTNL..VPSWYSTNS.............................
B8KYL6_9GAMM/364-704GDA--S.......................WERATPTGNSRNLVPTEQVM...............................
B8FIK5_DESAA/1139-1542GDD--...................................TVVPARMCYIA.............................
Q11US7_CYTH3/392-767GKG--VVPSMSNFINNVGSVVYRKNPSFYWTNTDFKNHFVNLVPPFG.................................
C6W101_DYAFD/326-680GRS--IDPQK...............ARKMK.....DSWQTDMVPNAG.................................
A5FJM8_FLAJ1/544-914GDA--SFD...................YKNR..IANNNNI..VPIYQALRS.............................
Q7UG73_RHOBA/51-444GDT--.........................PDYDTPRNQPHQIPTWMIPAPVT...........................
A3J247_9FLAO/540-919GDA--SYD...................YKNR..LFNNTNI..VPVFHGFNPLASET........................
A9WIM0_CHLAA/500-869GDG--SSD..................PRDY....LRRGWPTLIPPYLAEV..............................
B0VHE7_CLOAI/227-554GDT--..................................DGTIAVTS.................................
C6VT06_DYAFD/394-758GKS--I.......................TQNEKMVRELPGEVPTIG.................................
C6X3N8_FLAB3/546-921GDT--SYD...................FRGK..NNPGSDI..VPSYQSEES.............................
A0LQH1_SYNFM/790-1132GEG--SFD...................YKN....VKGYRDALVPPLMAD...............................
A1ZVJ9_9BACT/406-774GDA--SFD...................YKDR..VANNTNF..VPIYESRES.............................
B0VHF1_CLOAI/214-595GDT--DVIPHRGFYV.....SVNNSDEGTD..................................................
B0VIE7_CLOAI/193-598GDY--..........................D.TVPVAYVTPEPNGQ.................................
C6W3P4_DYAFD/414-806GIS--V.......................TRNDRINKELLNEVPTFS.................................
B2RGP6_PORG3/408-787GDG--AHDNR..............KVSVAWQKPYLQQTEF..LLTFQAVNS.............................
D2QJ99_SPILD/409-770GRA--RSTPG...............VRNNP.....SQSGLDMVMTAG.................................
A9B5Q8_HERA2/466-850GDG--TID..................PLNY....LGRNNPNMIPPLPAYT..............................
D2QFF3_SPILD/397-745GRA--NSYPY...............TVKTA.....TD...DLVPTMG.................................
B0VH03_CLOAI/589-939GIG--TMDWR...............NFSGF....SAPKNK..LIVWQ.................................
D2R2P5_PIRSD/21-411GDA--E.......................PGSGTNIELRRRCVPTYHVDAKVN...........................
C6W0Z3_DYAFD/393-758GDA--TYDYR..............NLLRNQS..PAQRAAW..VPVYESRES.............................
A3XQP5_LEEBM/552-929GDT--SFD...................YKDR..IDNNNNL..VPTFNTYYS.............................
Q2PY26_9BACT/412-780GDC--SYD...................MKGR..LSPDQNQ..IPAFQSQAS.............................
Q26FX7_FLABB/537-909GDA--SFD...................YKDR..ISIRENI..VPSFHTAEA.............................
B0VJT2_CLOAI/236-566GDT--................................SGSYTIPANSA................................
C6BTD6_DESAD/56-402GNR--...................................DIVPPARFD...............................
D2QE53_SPILD/328-1007GDT--DIVPMRNMVSYVSDKGNYGWDFVYVSDPVPPIRKCFKIPGQSIAKLRHDSSTGAFALRTVPDPQNPGKTKQVFDD
A2BK55_HYPBU/159-551GGA--...................................AEVPPVYVCSPILS..........................
B0VHP1_CLOAI/283-636GDV--...................................AQVPTNNG................................
Q1Q1Y4_9BACT/620-970GDA--YQDYN..............DNLASGTINYVPSQIIETDELGE.................................
C7PNY3_CHIPD/396-764GDA--SYD...................YKNR..IAGNTNM..IPTWQSTIS.............................
Q6LFY5_PHOPR/224-617GDH--...................................EDIPGYEIVGHP............................
B3QVL4_CHLT3/688-1063GDG--DWD...................FRS....IKNDDYEKLVTYQSDEV.............................
A9B187_HERA2/552-907GDG--TADPH...............DYADI....IGQPVTNFIPPYLADV..............................
R5M3W7_9BACE/537-910GDC--SYDNR..............MLTSSWK..NYRPENF..LLSYQSETS.............................
B0VJY1_CLOAI/655-1014GEG--VDDT................RDNSP....SRIYNL..IPVKKTWT..............................
B8G4Y1_CHLAD/584-1054GTN--...................................QVLPYAQVEAGADKDYSQAP....................
A1ZEG7_9BACT/410-775GKG--LSIDQS.............ATSLNPRIIP.AHRGQDLIPPFG.................................
B0VF22_CLOAI/223-583GDD--EIVPERGA........YGQVGDTVD..................................................
A0LKV0_SYNFM/924-1265GDD--TFD..................PKDH....LGRGLVSFIPSLNGMD..............................
A8ZTD5_DESOH/257-648GDV--...................................EFIPTHR.................................
A9B8S0_HERA2/477-840GDG--TTD..................PRDV....LGYGQPPLIPPYLAEV..............................
C3JBB2_9PORP/421-799GDG--AADNR..............KVSVHWESIGLQNTPF..LLTYQSSNS.............................
C9SW40_VERA1/279-917GDT--SIVPVRRVAGALEGGIEPPLTVNPPANNKSFWTGSHLRIHAVNPGTWWGASTDNLLVRPDTGALIRYDAAGTSSS
C9LI59_9BACT/509-899GDC--FWDNR...............MLTTT...KLNAADF..LLAYEAGPGDGQT.........................
B5ICF9_ACIB4/214-642GNA--R......................AVPPSYYWTDQYMYLLAYYGLS..............................
Y048_ARCFU/22-377GDA--...................................DIVPPSYYAK..............................
A3I371_9BACT/360-725GKG--TFD...................YKGK..LGGRPNI..VPTYSSRNS.............................

PF11713

A0KHZ7_AERHH/3609-3767AAA-----------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627SAE-----------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160FGR-----------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614AAA-----------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151AAL-----------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702AAQ-----------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112AAA-----------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549AAR-----------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959AAR-----------------------------------------------------------------------------
Q189K3_PEPD6/575-754AAC-----------------------------------------------------------------------------
Q189K5_PEPD6/577-756ATC-----------------------------------------------------------------------------
Q7CGR6_YERPE/772-928VGE-----------------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626AAA-----------------------------------------------------------------------------

PF01650

LGMN_HUMAN/29-286--------------------------------------------------------------------------------
VPED_ARATH/46-316--------------------------------------------------------------------------------
VPEG_ARATH/59-330--------------------------------------------------------------------------------
A0CQC7_PARTE/19-285--------------------------------------------------------------------------------
A2FXM6_TRIVA/13-267--------------------------------------------------------------------------------
O24539_VICNA/53-325--------------------------------------------------------------------------------
HGLB_SCHMA/37-291--------------------------------------------------------------------------------
HGLB_SCHJA/31-285--------------------------------------------------------------------------------
VPE_VICSA/56-325--------------------------------------------------------------------------------
A0A080VK93_PSEAI/341-579--------------------------------------------------------------------------------
Q08BI0_DANRE/27-278--------------------------------------------------------------------------------
Q0MYV8_EMIHU/33-301--------------------------------------------------------------------------------
Q22P32_TETTS/20-285--------------------------------------------------------------------------------
Q22P33_TETTS/20-285--------------------------------------------------------------------------------
D0MXB3_PHYIT/25-298--------------------------------------------------------------------------------
Q2UVF3_HAECO/29-287--------------------------------------------------------------------------------
Q4K5F2_PSEF5/335-570--------------------------------------------------------------------------------
Q4RED0_TETNG/30-283--------------------------------------------------------------------------------
Q8P9N6_XANCP/124-392--------------------------------------------------------------------------------
Q6EHZ7_TRIVA/12-258--------------------------------------------------------------------------------
Q6FEB2_ACIAD/229-477--------------------------------------------------------------------------------
Q6L4R2_ORYSJ/41-319--------------------------------------------------------------------------------
Q6NYJ7_DANRE/32-288--------------------------------------------------------------------------------
Q6PRC7_IXORI/38-293--------------------------------------------------------------------------------
Q711M2_FASHE/21-278--------------------------------------------------------------------------------
VPE1_ORYSJ/62-334--------------------------------------------------------------------------------
Q852T1_TOBAC/49-320--------------------------------------------------------------------------------
Q88QE3_PSEPK/400-640--------------------------------------------------------------------------------
Q949L7_BETVU/51-321--------------------------------------------------------------------------------
Q9LLQ4_SESIN/54-326--------------------------------------------------------------------------------
Q9LWZ3_ORYSJ/41-304--------------------------------------------------------------------------------
Q9SBX2_MAIZE/45-317--------------------------------------------------------------------------------
Q9SMD0_SOLLC/39-316--------------------------------------------------------------------------------
Q9XG75_TOBAC/40-306--------------------------------------------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227--------------------------------------------------------------------------------
ICENC_DROME/196-443--------------------------------------------------------------------------------
O42284_CHICK/42-279--------------------------------------------------------------------------------
CAS1A_XENLA/144-382--------------------------------------------------------------------------------
CASPC_MOUSE/176-415--------------------------------------------------------------------------------
CASP4_MOUSE/132-369--------------------------------------------------------------------------------
CASP5_HUMAN/193-430--------------------------------------------------------------------------------
CASPD_BOVIN/136-373--------------------------------------------------------------------------------
CASP1_CANFA/163-400--------------------------------------------------------------------------------
CASP1_FELCA/161-406--------------------------------------------------------------------------------
CASP1_MOUSE/162-398--------------------------------------------------------------------------------
CASP1_HUMAN/163-400--------------------------------------------------------------------------------
CASP1_PIG/163-400--------------------------------------------------------------------------------
Q9I9L7_DANRE/145-379--------------------------------------------------------------------------------
Q9DDJ2_DANRE/174-400--------------------------------------------------------------------------------
Q6NTR7_XENLA/280-494--------------------------------------------------------------------------------
CFLAR_MOUSE/257-480--------------------------------------------------------------------------------
Q6QN97_PIG/259-484--------------------------------------------------------------------------------
CFLAR_HUMAN/252-477--------------------------------------------------------------------------------
Q9NBW3_DROME/38-248--------------------------------------------------------------------------------
Q9TZP5_CAEEL/26-261--------------------------------------------------------------------------------
CASPE_MOUSE/22-256--------------------------------------------------------------------------------
CASPE_HUMAN/18-241--------------------------------------------------------------------------------
Q8I749_SUBDO/254-491--------------------------------------------------------------------------------
CASP2_RAT/200-445--------------------------------------------------------------------------------
CASP2_CHICK/171-416--------------------------------------------------------------------------------
Q9GV89_HYDVU/93-318--------------------------------------------------------------------------------
Q9IB63_XENLA/144-396--------------------------------------------------------------------------------
CASP9_HUMAN/161-413--------------------------------------------------------------------------------
Q90WU0_CHICK/148-400--------------------------------------------------------------------------------
Q9IB64_XENLA/261-494--------------------------------------------------------------------------------
Q6E5N8_ICTPU/119-362--------------------------------------------------------------------------------
Q9I8J3_DANRE/238-473--------------------------------------------------------------------------------
Q6PAD9_XENLA/268-495--------------------------------------------------------------------------------
Q90WU1_CHICK/237-479--------------------------------------------------------------------------------
CASP8_HUMAN/234-476--------------------------------------------------------------------------------
CASP8_MOUSE/236-478--------------------------------------------------------------------------------
Q9Y1U6_PRIPA/173-413--------------------------------------------------------------------------------
CED3_CAEEL/243-494--------------------------------------------------------------------------------
Q7QKT2_ANOGA/35-260--------------------------------------------------------------------------------
Q7PZJ9_ANOGA/20-250--------------------------------------------------------------------------------
Q9GV88_HYDVU/84-316--------------------------------------------------------------------------------
Q7Q1E0_ANOGA/62-291--------------------------------------------------------------------------------
CASP1_SPOFR/61-293--------------------------------------------------------------------------------
CASP1_DROME/79-313--------------------------------------------------------------------------------
Q7Q4X6_ANOGA/73-309--------------------------------------------------------------------------------
DRICE_DROME/94-328--------------------------------------------------------------------------------
Q9NHF9_DROME/56-302--------------------------------------------------------------------------------
Q7Q803_ANOGA/54-306--------------------------------------------------------------------------------
Q7PV92_ANOGA/14-237--------------------------------------------------------------------------------
Q86FL0_ANOST/52-286--------------------------------------------------------------------------------
Q8I6Y2_GEOCY/158-414--------------------------------------------------------------------------------
Q8ITP3_BRAFL/87-323--------------------------------------------------------------------------------
O88550_RAT/68-301--------------------------------------------------------------------------------
Q6DCI2_XENLA/78-314--------------------------------------------------------------------------------
Q8JIS8_ORYLA/58-285--------------------------------------------------------------------------------
CASP3_XENLA/56-280--------------------------------------------------------------------------------
O93417_CHICK/53-281--------------------------------------------------------------------------------
Q98UI8_DANRE/48-280--------------------------------------------------------------------------------
Q8JG42_TAKRU/51-279--------------------------------------------------------------------------------
Q8ITP2_BRAFL/151-396--------------------------------------------------------------------------------
Q9IB66_XENLA/58-298--------------------------------------------------------------------------------
Q9I8S9_ONCMY/57-297--------------------------------------------------------------------------------
O93415_CHICK/57-299--------------------------------------------------------------------------------
CASP6_MOUSE/28-270--------------------------------------------------------------------------------
PCP_DICDI/188-404--------------------------------------------------------------------------------
Q7AKE1_STRCO/9-268--------------------------------------------------------------------------------
A0A063TRB6_BORBO/552-800--------------------------------------------------------------------------------
Q7NPG1_GLOVI/7-278--------------------------------------------------------------------------------
Q87Z21_PSESM/2-224--------------------------------------------------------------------------------
Q82I86_STRAW/5-276--------------------------------------------------------------------------------
P74453_SYNY3/40-299--------------------------------------------------------------------------------
Q8YS65_NOSS1/4-245--------------------------------------------------------------------------------
Q9DDL2_DANRE/323-560--------------------------------------------------------------------------------
Q98CE0_RHILO/5-237--------------------------------------------------------------------------------
Q6N0T4_RHOPA/30-250--------------------------------------------------------------------------------
Q89XG2_BRADU/27-247--------------------------------------------------------------------------------
Q89XE4_BRADU/58-278--------------------------------------------------------------------------------
Q6NBN5_RHOPA/57-277--------------------------------------------------------------------------------
Q98JS7_RHILO/35-253--------------------------------------------------------------------------------
Q985X8_RHILO/35-256--------------------------------------------------------------------------------
Q6N5Q1_RHOPA/33-253--------------------------------------------------------------------------------
Q89KP2_BRADU/86-307--------------------------------------------------------------------------------
Q89IK1_BRADU/30-253--------------------------------------------------------------------------------
Q98G71_RHILO/26-252--------------------------------------------------------------------------------
Q6AKF4_DESPS/28-248--------------------------------------------------------------------------------
Q98IJ6_RHILO/11-238--------------------------------------------------------------------------------
Q89MV1_BRADU/176-400--------------------------------------------------------------------------------
Q89HT8_BRADU/51-272--------------------------------------------------------------------------------
Q89FZ4_BRADU/32-256--------------------------------------------------------------------------------
Q6N329_RHOPA/73-298--------------------------------------------------------------------------------
Q98IJ9_RHILO/30-261--------------------------------------------------------------------------------
Q89HP3_BRADU/336-569--------------------------------------------------------------------------------
Q7RFI8_PLAYO/964-1364--------------------------------------------------------------------------------
Q74F93_GEOSL/6-270--------------------------------------------------------------------------------
MCA9_ARATH/10-321--------------------------------------------------------------------------------
MCA8_ARATH/3-378--------------------------------------------------------------------------------
MCA7_ARATH/3-401--------------------------------------------------------------------------------
Q70VV0_PICAB/3-415--------------------------------------------------------------------------------
Q9ZSP8_HEVBR/3-415--------------------------------------------------------------------------------
MCA4_ARATH/3-416--------------------------------------------------------------------------------
MCA5_ARATH/3-408--------------------------------------------------------------------------------
MCA6_ARATH/3-366--------------------------------------------------------------------------------
MCA1_ARATH/80-362--------------------------------------------------------------------------------
MCA2_ARATH/116-414--------------------------------------------------------------------------------
MCA1_SCHPO/130-422--------------------------------------------------------------------------------
MCA1_YARLI/168-458--------------------------------------------------------------------------------
MCA1_DEBHA/146-437--------------------------------------------------------------------------------
MCA1_ASHGO/154-449--------------------------------------------------------------------------------
MCA1_KLULA/138-430--------------------------------------------------------------------------------
MCA1_CANGA/98-389--------------------------------------------------------------------------------
B5VS82_YEAS6/157-450--------------------------------------------------------------------------------
Q386I9_TRYB2/84-341--------------------------------------------------------------------------------
Q38D34_TRYB2/63-322--------------------------------------------------------------------------------
Q8T8E6_9TRYP/84-343--------------------------------------------------------------------------------

PF14538

W1QFK7_OGAPD/56-210--------------------------------------------------------------------------------
L8WVZ0_THACA/73-224--------------------------------------------------------------------------------
A2EZ34_TRIVA/89-236--------------------------------------------------------------------------------
Q6C6R4_YARLI/86-238--------------------------------------------------------------------------------
M2WI96_DOTSN/172-328--------------------------------------------------------------------------------
K2S4T3_MACPH/104-258--------------------------------------------------------------------------------
C4LXC3_ENTHI/42-194--------------------------------------------------------------------------------
T1G0Q6_HELRO/62-216--------------------------------------------------------------------------------
B0CNS4_LACBS/34-185--------------------------------------------------------------------------------
F0ZAV4_DICPU/115-266--------------------------------------------------------------------------------
U9UGJ5_RHIID/52-203--------------------------------------------------------------------------------
Q5KIS3_CRYNJ/92-243--------------------------------------------------------------------------------
B0WBU4_CULQU/30-181--------------------------------------------------------------------------------
A5DWK2_LODEL/143-295--------------------------------------------------------------------------------
G0VGR8_NAUCC/79-231--------------------------------------------------------------------------------
I3J5N7_ORENI/57-208--------------------------------------------------------------------------------
A2DYM2_TRIVA/68-215--------------------------------------------------------------------------------
D8TLK8_VOLCA/11-162--------------------------------------------------------------------------------
G4M000_SCHMA/43-194--------------------------------------------------------------------------------
C1MUE6_MICPC/45-196--------------------------------------------------------------------------------
Q387I9_TRYB2/89-240--------------------------------------------------------------------------------
C4M2F5_ENTHI/38-189--------------------------------------------------------------------------------
G4TT65_PIRID/72-223--------------------------------------------------------------------------------
G0NWW0_CAEBE/64-218--------------------------------------------------------------------------------
A2DJF0_TRIVA/83-228--------------------------------------------------------------------------------
K3WJU9_PYTUL/84-235--------------------------------------------------------------------------------
A2G590_TRIVA/30-180--------------------------------------------------------------------------------
B8M6V6_TALSN/189-342--------------------------------------------------------------------------------
A2FJN8_TRIVA/41-191--------------------------------------------------------------------------------
A2DLR3_TRIVA/97-242--------------------------------------------------------------------------------
E5SIN8_TRISP/44-195--------------------------------------------------------------------------------
I1G727_AMPQE/53-204--------------------------------------------------------------------------------
U1MN31_ASCSU/95-246--------------------------------------------------------------------------------
I1L744_SOYBN/123-274--------------------------------------------------------------------------------
E4XFS5_OIKDI/48-228--------------------------------------------------------------------------------
D2VMD1_NAEGR/144-294--------------------------------------------------------------------------------
A9TBL2_PHYPA/91-242--------------------------------------------------------------------------------
B7PLB3_IXOSC/92-247--------------------------------------------------------------------------------
A0A0D2USM0_CAPO3/727-878--------------------------------------------------------------------------------
B8CBK6_THAPS/256-409--------------------------------------------------------------------------------
A4I1A2_LEIIN/114-279--------------------------------------------------------------------------------
F4RLY3_MELLP/215-367--------------------------------------------------------------------------------
K4DUJ2_TRYCR/62-218--------------------------------------------------------------------------------
H1VVG4_COLHI/158-309--------------------------------------------------------------------------------
M7XEP3_RHOT1/113-265--------------------------------------------------------------------------------
A2GCD5_TRIVA/98-247--------------------------------------------------------------------------------
D8RG53_SELML/72-223--------------------------------------------------------------------------------
A2F9H3_TRIVA/31-181--------------------------------------------------------------------------------
L0PHF8_PNEJ8/131-282--------------------------------------------------------------------------------
RTOR2_ARATH/94-246--------------------------------------------------------------------------------
M5E8T5_MALS4/58-209--------------------------------------------------------------------------------
B3RPQ9_TRIAD/43-194--------------------------------------------------------------------------------
I4Y9Q8_WALSC/76-227--------------------------------------------------------------------------------
A2E4G0_TRIVA/101-242--------------------------------------------------------------------------------
A0A068XPC4_HYMMI/269-417--------------------------------------------------------------------------------
U4LGP0_PYROM/223-374--------------------------------------------------------------------------------
A2F8U1_TRIVA/65-210--------------------------------------------------------------------------------
D8T9J0_SELML/50-197--------------------------------------------------------------------------------
A9V5A2_MONBE/628-777--------------------------------------------------------------------------------
F0XXV0_AURAN/12-164--------------------------------------------------------------------------------
A2E336_TRIVA/54-202--------------------------------------------------------------------------------
B4R5C8_DROSI/214-365--------------------------------------------------------------------------------
J4H2X1_FIBRA/92-243--------------------------------------------------------------------------------
A2EU18_TRIVA/81-227--------------------------------------------------------------------------------
A2DYB3_TRIVA/12-162--------------------------------------------------------------------------------
S2KE38_MUCC1/106-257--------------------------------------------------------------------------------
G7E3R0_MIXOS/173-325--------------------------------------------------------------------------------

PF03415

Q8A866_BACTN/37-399--------------------------------------------------------------------------------
Q9WZB1_THEMA/121-462--------------------------------------------------------------------------------
Q8XM44_CLOPE/59-508--------------------------------------------------------------------------------
Q9X1S5_THEMA/586-937--------------------------------------------------------------------------------
Q9WYY6_THEMA/5-301--------------------------------------------------------------------------------
Q8TIY6_METAC/66-593--------------------------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921---------------------------------------------------------------------------..LKT
A0LQE8_SYNFM/635-947---------------------------------------------------------------------------..LRD
A1BCK0_CHLPD/513-826---------------------------------------------------------------------------..LLS
A1BEL3_CHLPD/43-361---------------------------------------------------------------------------..LSR
A1BEL6_CHLPD/46-364---------------------------------------------------------------------------..LSR
A4HBL7_LEIBR/1053-1432---------------------------------------------------------------------------..ATQ
A8L4T6_FRASN/741-1051---------------------------------------------------------------------------..LAA
A9WBC0_CHLAA/673-929---------------------------------------------------------------------------..LLG
A9WER9_CHLAA/54-394---------------------------------------------------------------------------..FSR
A9WF91_CHLAA/60-360---------------------------------------------------------------------------..FSR
B0C874_ACAM1/207-507---------------------------------------------------------------------------..LTD
B2IXC0_NOSP7/1396-1691---------------------------------------------------------------------------..LTN
B2IZZ4_NOSP7/695-973---------------------------------------------------------------------------..RRS
B2JAK0_NOSP7/526-830---------------------------------------------------------------------------LLIED
B2JAM9_NOSP7/866-1190---------------------------------------------------------------------------..ISV
B4JKU3_DROGR/1402-1700---------------------------------------------------------------------------..LRG
C3Z401_BRAFL/1278-1602---------------------------------------------------------------------------..LSM
F0SR63_RUBBR/137-574---------------------------------------------------------------------------..LVE
Q01RE6_SOLUE/865-1136---------------------------------------------------------------------------..LAP
Q024J7_SOLUE/541-814---------------------------------------------------------------------------..LAG
Q025F1_SOLUE/607-877---------------------------------------------------------------------------..LRQ
Q028B5_SOLUE/667-935---------------------------------------------------------------------------YEMEK
Q02DA1_SOLUE/510-786---------------------------------------------------------------------------..YQR
Q10YT7_TRIEI/1003-1309---------------------------------------------------------------------------..LLT
Q10YU6_TRIEI/544-838---------------------------------------------------------------------------..LLP
Q112V9_TRIEI/62-390---------------------------------------------------------------------------..LEE
Q113D1_TRIEI/130-430---------------------------------------------------------------------------..LVT
Q113U8_TRIEI/3002-3297---------------------------------------------------------------------------..LMD
Q115J8_TRIEI/1466-1777---------------------------------------------------------------------------..LQK
Q117G6_TRIEI/881-1206---------------------------------------------------------------------------..LLQ
Q119J2_TRIEI/1474-1770---------------------------------------------------------------------------..LTD
Q16H64_AEDAE/1315-1614---------------------------------------------------------------------------..LRQ
Q2G6U6_NOVAD/692-1020---------------------------------------------------------------------------..FLD
Q2S6G2_SALRD/540-844---------------------------------------------------------------------------TDTSA
Q2W535_MAGSA/875-1218---------------------------------------------------------------------------..L..
Q38C46_TRYB2/1044-1397---------------------------------------------------------------------------..ATQ
Q3AQG5_CHLCH/44-362---------------------------------------------------------------------------..FSR
Q5LLA3_RUEPO/680-970---------------------------------------------------------------------------..LTQ
Q7NCT1_GLOVI/600-923---------------------------------------------------------------------------..LPR
Q7NF67_GLOVI/550-854---------------------------------------------------------------------------..LLR
Q7NFD7_GLOVI/666-979---------------------------------------------------------------------------..LTR
Q7NIF7_GLOVI/691-997---------------------------------------------------------------------------..LIR
Q7NJE3_GLOVI/660-988---------------------------------------------------------------------------..LPR
Q7NLR0_GLOVI/653-961---------------------------------------------------------------------------..LLR
Q7NVB0_CHRVO/67-386---------------------------------------------------------------------------..ICL
Q82I85_STRAW/1175-1481---------------------------------------------------------------------------..LCE
Q82L10_STRAW/969-1256---------------------------------------------------------------------------LFSRA
Q8DGG5_THEEB/541-835---------------------------------------------------------------------------..LLR
Q8DH74_THEEB/570-891---------------------------------------------------------------------------..LLR
Q8DHI1_THEEB/67-394---------------------------------------------------------------------------..ISE
Q8DIE5_THEEB/1127-1420---------------------------------------------------------------------------..LTD
Q8YZU5_NOSS1/56-340---------------------------------------------------------------------------..LTD
TTC28_HUMAN/1390-1713---------------------------------------------------------------------------..LSV

PF03568

G7E6G1_MIXOS/1513-1914--------------------------------------------------------------------------------
A8PX94_MALGO/1441-1824--------------------------------------------------------------------------------
M7XLD2_RHOT1/1703-2100--------------------------------------------------------------------------------
U5HB45_USTV1/1850-2253--------------------------------------------------------------------------------
F4RLY9_MELLP/91-479--------------------------------------------------------------------------------
T1IUX7_STRMM/1624-1980--------------------------------------------------------------------------------
A7RYA6_NEMVE/1651-2034--------------------------------------------------------------------------------
T1FT05_HELRO/413-770--------------------------------------------------------------------------------
W4Y9R2_STRPU/1031-1383--------------------------------------------------------------------------------
G3N6G2_GASAC/1731-2077--------------------------------------------------------------------------------
H3DAQ7_TETNG/1711-2057--------------------------------------------------------------------------------
I3KSG7_ORENI/1715-2061--------------------------------------------------------------------------------
H2L8K9_ORYLA/1692-2038--------------------------------------------------------------------------------
M3ZIW2_XIPMA/1768-2114--------------------------------------------------------------------------------
ESPL1_MOUSE/1716-2065--------------------------------------------------------------------------------
F7BUI1_CALJA/1724-2073--------------------------------------------------------------------------------
G3VPI8_SARHA/1713-2063--------------------------------------------------------------------------------
U3IXX7_ANAPL/1332-1679--------------------------------------------------------------------------------
G1KFP0_ANOCA/1819-2167--------------------------------------------------------------------------------
H3B3H1_LATCH/1699-2055--------------------------------------------------------------------------------
F6VXN8_XENTR/1732-2080--------------------------------------------------------------------------------
Q6ZHH8_ORYSJ/455-870--------------------------------------------------------------------------------
W5GJD2_WHEAT/891-1304--------------------------------------------------------------------------------
K3Z105_SETIT/1078-1484--------------------------------------------------------------------------------
C5XYE8_SORBI/457-870--------------------------------------------------------------------------------
C5XSY3_SORBI/1425-1832--------------------------------------------------------------------------------
K3Y3B2_SETIT/1404-1817--------------------------------------------------------------------------------
M0UBW7_MUSAM/65-479--------------------------------------------------------------------------------
ESP1_ARATH/1641-2060--------------------------------------------------------------------------------
M4DS49_BRARP/1599-2019--------------------------------------------------------------------------------
B9GZR1_POPTR/1674-2094--------------------------------------------------------------------------------
B9SSN4_RICCO/1627-2045--------------------------------------------------------------------------------
I1MDQ8_SOYBN/1648-2063--------------------------------------------------------------------------------
K4B224_SOLLC/1600-2023--------------------------------------------------------------------------------
W1NKX2_AMBTC/1-423--------------------------------------------------------------------------------
K7H1P7_CAEJA/245-604--------------------------------------------------------------------------------
E3LM18_CAERE/731-1090--------------------------------------------------------------------------------
G5ED39_CAEEL/727-1081--------------------------------------------------------------------------------
Q23491_CAEEL/749-1101--------------------------------------------------------------------------------
S3CR95_OPHP1/1758-2208--------------------------------------------------------------------------------
F0XAD9_GROCL/1636-2054--------------------------------------------------------------------------------
G2R9B0_THITE/1619-2058--------------------------------------------------------------------------------
Q2H6Q9_CHAGB/1612-2026--------------------------------------------------------------------------------
G0SHM3_CHATD/1723-2150--------------------------------------------------------------------------------
G4UQF5_NEUT9/1626-2085--------------------------------------------------------------------------------
G4N8I2_MAGO7/1627-2057--------------------------------------------------------------------------------
J3P7L5_GAGT3/1606-2054--------------------------------------------------------------------------------
R8BFS3_TOGMI/72-487--------------------------------------------------------------------------------
N4UZ87_COLOR/1637-2043--------------------------------------------------------------------------------
G2X6M8_VERDV/1704-2113--------------------------------------------------------------------------------
G0RRT6_HYPJQ/1566-1971--------------------------------------------------------------------------------
M1WFQ9_CLAP2/1438-1889--------------------------------------------------------------------------------
J5K578_BEAB2/1584-1996--------------------------------------------------------------------------------
C7YYU1_NECH7/1580-1992--------------------------------------------------------------------------------
M7T4Q8_EUTLA/44-499--------------------------------------------------------------------------------
L8G205_PSED2/1652-2056--------------------------------------------------------------------------------
N1JFH1_BLUG1/1598-2001--------------------------------------------------------------------------------
K1X2E6_MARBU/1659-2061--------------------------------------------------------------------------------
S3D029_GLAL2/1639-2043--------------------------------------------------------------------------------
M7TX51_BOTF1/1640-2041--------------------------------------------------------------------------------
BIMB_EMENI/1609-2004--------------------------------------------------------------------------------
Q2USV7_ASPOR/1630-2030--------------------------------------------------------------------------------
G7XGU8_ASPKW/1627-2026--------------------------------------------------------------------------------
S8BGE7_PENO1/1622-2018--------------------------------------------------------------------------------
B6GZP8_PENCW/1602-1998--------------------------------------------------------------------------------
Q4WUU6_ASPFU/1638-2039--------------------------------------------------------------------------------
B6QNB5_PENMQ/1619-2016--------------------------------------------------------------------------------
V5GCB2_BYSSN/1684-2084--------------------------------------------------------------------------------
F0UL09_AJEC8/1642-2044--------------------------------------------------------------------------------
C5FSW7_ARTOC/1655-2058--------------------------------------------------------------------------------
H6C6Q4_EXODN/1587-1987--------------------------------------------------------------------------------
U1G8A9_ENDPU/1638-2036--------------------------------------------------------------------------------
K2R7J5_MACPH/1619-2043--------------------------------------------------------------------------------
R7YNT5_CONA1/1696-2117--------------------------------------------------------------------------------
E4ZTB4_LEPMJ/1652-2063--------------------------------------------------------------------------------
N1QAI8_PSEFD/1492-1912--------------------------------------------------------------------------------
N1QHR1_SPHMS/1187-1599--------------------------------------------------------------------------------
N1PZ16_DOTSN/1513-1936--------------------------------------------------------------------------------
D5GKQ4_TUBMM/1633-2033--------------------------------------------------------------------------------
U4LG69_PYROM/1616-2019--------------------------------------------------------------------------------
S8C8B1_DACHA/1639-2040--------------------------------------------------------------------------------
Q6CCJ0_YARLI/1210-1588--------------------------------------------------------------------------------
S9X830_SCHCR/1385-1771--------------------------------------------------------------------------------
CUT1_SCHPO/1383-1770--------------------------------------------------------------------------------
B6K0I6_SCHJY/1359-1747--------------------------------------------------------------------------------
M7PDE3_PNEMU/1489-1882--------------------------------------------------------------------------------
G8BT64_TETPH/1165-1563--------------------------------------------------------------------------------
I2H0Y5_TETBL/1280-1677--------------------------------------------------------------------------------
S6EFD3_ZYGB2/1145-1542--------------------------------------------------------------------------------
C5DU01_ZYGRC/1141-1538--------------------------------------------------------------------------------
G8ZWZ1_TORDC/1158-1555--------------------------------------------------------------------------------
G0WDN6_NAUDC/1191-1589--------------------------------------------------------------------------------
G0VFB3_NAUCC/1164-1562--------------------------------------------------------------------------------
H2B1L5_KAZAF/1161-1559--------------------------------------------------------------------------------
ESP1_YEAST/1175-1571--------------------------------------------------------------------------------
J7RG90_KAZNA/1160-1562--------------------------------------------------------------------------------
Q75EJ0_ASHGO/1152-1552--------------------------------------------------------------------------------
C5DHM1_LACTC/1178-1575--------------------------------------------------------------------------------
Q6CQQ7_KLULA/1118-1516--------------------------------------------------------------------------------
Q6FTE1_CANGA/1151-1548--------------------------------------------------------------------------------
K0K8V1_WICCF/1175-1568--------------------------------------------------------------------------------
A5DNR9_PICGU/1178-1576--------------------------------------------------------------------------------
A3GFF5_PICST/1168-1555--------------------------------------------------------------------------------
Q6BTB7_DEBHA/1338-1753--------------------------------------------------------------------------------
Q5A8X8_CANAL/1101-1536--------------------------------------------------------------------------------
C5MEH0_CANTT/925-1303--------------------------------------------------------------------------------
M3HH45_CANMX/1423-1797--------------------------------------------------------------------------------
G8B5X7_CANPC/1052-1424--------------------------------------------------------------------------------
A5DVQ7_LODEL/1109-1530--------------------------------------------------------------------------------
G3AGZ6_SPAPN/1149-1535--------------------------------------------------------------------------------
G8YBL5_PICSO/1309-1719--------------------------------------------------------------------------------
C4XY11_CLAL4/1177-1564--------------------------------------------------------------------------------
G3B782_CANTC/1213-1609--------------------------------------------------------------------------------
W1QIM9_OGAPD/1167-1527--------------------------------------------------------------------------------
C4QYS2_PICPG/1259-1619--------------------------------------------------------------------------------
K5WME3_PHACS/1732-2136--------------------------------------------------------------------------------
M2R2K9_CERS8/1618-2024--------------------------------------------------------------------------------
F8PLA9_SERL3/1278-1688--------------------------------------------------------------------------------
S8E105_FOMPI/1678-2083--------------------------------------------------------------------------------
J4GX56_FIBRA/504-917--------------------------------------------------------------------------------
A8NBE9_COPC7/1839-2276--------------------------------------------------------------------------------
B0E1W0_LACBS/104-540--------------------------------------------------------------------------------
D8Q1W5_SCHCM/1450-1878--------------------------------------------------------------------------------
V2X3W8_MONRO/1588-2040--------------------------------------------------------------------------------
J0DCK6_AURDE/1634-2046--------------------------------------------------------------------------------
Q5KMS4_CRYNJ/188-600--------------------------------------------------------------------------------
R9AIE1_WALI9/1639-2036--------------------------------------------------------------------------------
I4YB88_WALSC/1631-2030--------------------------------------------------------------------------------
G4T5A4_PIRID/1472-1874--------------------------------------------------------------------------------

PF01364

KGP83_PORGN/244-595................................................................................
D1JG83_9ARCH/891-1295.......................................................................LNSPNNPIL
A2U064_9FLAO/401-768..............................................................................FN
Q7MTE2_PORGI/239-573................................................................................
D3HWT0_9BACT/400-777..............................................................................FN
Q5S3Q9_9FLAO/543-910..............................................................................FT
A9DMD5_9FLAO/555-923..............................................................................FN
B0VGA8_CLOAI/228-563................................................................................
B7B5I7_9PORP/382-753...............................................................................L
B8FFM0_DESAA/254-600...........................................................................DPGDE
A3U7G6_CROAH/540-908..............................................................................FS
D2QSX9_SPILD/414-786..............................................................................LH
A3HW99_9BACT/398-769................................................................................
B0VHP2_CLOAI/234-563................................................................................
A8ZUB1_DESOH/278-656..............................................................................AG
B0VIM2_CLOAI/182-528...............................................................................E
Q2Z0E1_9BACT/643-1013................................................................................
B3QXR8_CHLT3/734-1131................................................................................
C2MCN4_9PORP/405-781...............................................................................T
A4A325_9PLAN/24-399.............................................................................VHF
A7NR84_ROSCS/499-867...............................................................................D
Q11Q36_CYTH3/558-932..............................................................................LK
Q7MX16_PORGI/272-637................................................................................
A0B5K7_METTP/796-1154................................................................................
D0MH89_RHOM4/586-975..............................................................................YH
A8UH97_9FLAO/539-910..............................................................................FS
B8KYL6_9GAMM/364-704................................................................................
B8FIK5_DESAA/1139-1542..............................................................................YA
Q11US7_CYTH3/392-767................................................................................
C6W101_DYAFD/326-680................................................................................
A5FJM8_FLAJ1/544-914..............................................................................NS
Q7UG73_RHOBA/51-444.............................................................................SRF
A3J247_9FLAO/540-919.........................................................................NNISNFS
A9WIM0_CHLAA/500-869...............................................................................D
B0VHE7_CLOAI/227-554................................................................................
C6VT06_DYAFD/394-758................................................................................
C6X3N8_FLAB3/546-921..............................................................................RD
A0LQH1_SYNFM/790-1132................................................................................
A1ZVJ9_9BACT/406-774..............................................................................LH
B0VHF1_CLOAI/214-595................................................................................
B0VIE7_CLOAI/193-598................................................................................
C6W3P4_DYAFD/414-806................................................................................
B2RGP6_PORG3/408-787...............................................................................T
D2QJ99_SPILD/409-770................................................................................
A9B5Q8_HERA2/466-850...............................................................................D
D2QFF3_SPILD/397-745................................................................................
B0VH03_CLOAI/589-939................................................................................
D2R2P5_PIRSD/21-411.............................................................................VKF
C6W0Z3_DYAFD/393-758..............................................................................LN
A3XQP5_LEEBM/552-929..............................................................................FS
Q2PY26_9BACT/412-780..............................................................................FS
Q26FX7_FLABB/537-909..............................................................................TS
B0VJT2_CLOAI/236-566................................................................................
C6BTD6_DESAD/56-402................................................................................
D2QE53_SPILD/328-1007TQPFRTLCNATSGKIISFNLNASAQQPGWYFTKESEFMDAKKTTGFTRLAKPETDDLGKIYMILEGPDASVSSTYGFYWL
A2BK55_HYPBU/159-551............................................................................ELVS
B0VHP1_CLOAI/283-636................................................................................
Q1Q1Y4_9BACT/620-970................................................................................
C7PNY3_CHIPD/396-764..............................................................................TD
Q6LFY5_PHOPR/224-617..............................................................................YH
B3QVL4_CHLT3/688-1063..............................................................................LE
A9B187_HERA2/552-907...............................................................................D
R5M3W7_9BACE/537-910..............................................................................LE
B0VJY1_CLOAI/655-1014................................................................................
B8G4Y1_CHLAD/584-1054.....................................................................WNSNCRNPQGT
A1ZEG7_9BACT/410-775................................................................................
B0VF22_CLOAI/223-583................................................................................
A0LKV0_SYNFM/924-1265................................................................................
A8ZTD5_DESOH/257-648................................................................................
A9B8S0_HERA2/477-840...............................................................................D
C3JBB2_9PORP/421-799...............................................................................L
C9SW40_VERA1/279-917TSPGW........................................YFTTADDYATRSATPTNFVRVEGPSSLVNAGLQFI
C9LI59_9BACT/509-899...........................................................................DISIG
B5ICF9_ACIB4/214-642...............................................................................D
Y048_ARCFU/22-377...............................................................................L
A3I371_9BACT/360-725..............................................................................LD

PF11713

A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626--------------------------------------------------------------------------------

PF01650

LGMN_HUMAN/29-286QIVVM--------------MY--DD.IA---YSEDNPTPGI---------------------------------------
VPED_ARATH/46-316NIIVF--------------MY--DD.IA---FSSENPRPGV---------------------------------------
VPEG_ARATH/59-330NIVVF--------------MY--DD.IA---NNYENPRPGT---------------------------------------
A0CQC7_PARTE/19-285NVIVF--------------AY--DD.IA---QNRQNIYKGA---------------------------------------
A2FXM6_TRIVA/13-267KIILM--------------CY--DD.IV---NDAENPFKGQ---------------------------------------
O24539_VICNA/53-325NIVVF--------------MY--DD.IA---YNEMNPRPGV---------------------------------------
HGLB_SCHMA/37-291HIITM--------------MY--DD.IA---YNLMNPFPGK---------------------------------------
HGLB_SCHJA/31-285HIITF--------------MY--DD.IA---HNKENPFPGK---------------------------------------
VPE_VICSA/56-325NIIVF--------------MY--DD.IA---SNEENPRPGV---------------------------------------
A0A080VK93_PSEAI/341-579.IRLV--------------NH--RDHFG---DR...PLAT.---------------------------------------
Q08BI0_DANRE/27-278QIVVM--------------IY--DD.IA---NNPNNPFPGS---------------------------------------
Q0MYV8_EMIHU/33-301KIITL--------------AV--DD.VA---NDDMNPFPGK---------------------------------------
Q22P32_TETTS/20-285NIIVF--------------LY--ND.VA---FDKSNPFKGK---------------------------------------
Q22P33_TETTS/20-285NIIVF--------------LY--ND.VA---NNKQNPFKGK---------------------------------------
D0MXB3_PHYIT/25-298NVVLM--------------MY--DD.VA---WHESNPYRGQ---------------------------------------
Q2UVF3_HAECO/29-287NIIVM--------------MK--DD.IA---NHERNPYKGK---------------------------------------
Q4K5F2_PSEF5/335-570.IRLV--------------NH--RDHLM---NR...PMAT.---------------------------------------
Q4RED0_TETNG/30-283QIVVM--------------MY--DD.LA---ENRMNPTPGK---------------------------------------
Q8P9N6_XANCP/124-392VITLV--------------NH--PDNLG---ERPYAPLAT.---------------------------------------
Q6EHZ7_TRIVA/12-258HITMM--------------AY--DD.IA---LSSENPFRGK---------------------------------------
Q6FEB2_ACIAD/229-477SMMLV--------------NN--PD...---TRTQIPIAS.---------------------------------------
Q6L4R2_ORYSJ/41-319NIVVM--------------MY--DD.IA---HNPDNPRPGL---------------------------------------
Q6NYJ7_DANRE/32-288QIVVM--------------MY--DD.LA---ESPDNPTKGV---------------------------------------
Q6PRC7_IXORI/38-293RIVVM--------------MY--DD.IA---HDPSNPTPGI---------------------------------------
Q711M2_FASHE/21-278NIVTI--------------MY--ND.VA---YSRQNPYRGK---------------------------------------
VPE1_ORYSJ/62-334NIVVF--------------MY--DD.IA---HNILNPRPGT---------------------------------------
Q852T1_TOBAC/49-320NIIVF--------------MY--DD.IA---HNFENPRPGV---------------------------------------
Q88QE3_PSEPK/400-640.VTLV--------------NH--RDHMA---TR...PMAT.---------------------------------------
Q949L7_BETVU/51-321NIIVF--------------MY--DD.IA---YDEENPRPGV---------------------------------------
Q9LLQ4_SESIN/54-326NIIVF--------------MY--DD.IA---MNELNPRKGV---------------------------------------
Q9LWZ3_ORYSJ/41-304NIVVM--------------MY--DD.IA---YNPENPHKGV---------------------------------------
Q9SBX2_MAIZE/45-317NIVVF--------------MY--DD.IA---HSPENPRPGV---------------------------------------
Q9SMD0_SOLLC/39-316HIIVF--------------MY--DD.IA---NNPENPRPGV---------------------------------------
Q9XG75_TOBAC/40-306NIIVF--------------MY--DD.IA---YNKNNPRPGI---------------------------------------

PF00656

Q7QGM9_ANOGA/35-227KQIKE--------------FC..QH......YRCDR...LD---------------------------------------
ICENC_DROME/196-443KSLIH--------------LF..QE.LN...FTIFP.....---------------------------------------
O42284_CHICK/42-279KEMTK--------------LL..EG.LG...YNVEC.....---------------------------------------
CAS1A_XENLA/144-382DGMTK--------------LL..NE.LG...YQVHP.....---------------------------------------
CASPC_MOUSE/176-415LNMQE--------------LL..EN.LG...YSVVL.....---------------------------------------
CASP4_MOUSE/132-369IGMKG--------------LL..ED.LG...YDVVV.....---------------------------------------
CASP5_HUMAN/193-430VGMKR--------------LL..QG.LG...YTVVD.....---------------------------------------
CASPD_BOVIN/136-373LGMKQ--------------LL..EG.LG...YTVEV.....---------------------------------------
CASP1_CANFA/163-400AGMES--------------LL..EG.LG...YSVVV.....---------------------------------------
CASP1_FELCA/161-406AGMRR--------------LL..TD.LG...YSVHI.....---------------------------------------
CASP1_MOUSE/162-398REMKL--------------LL..ED.LG...YTVKV.....---------------------------------------
CASP1_HUMAN/163-400TGMTM--------------LL..QN.LG...YSVDV.....---------------------------------------
CASP1_PIG/163-400RDMKI--------------LL..ED.LG...YSVDV.....---------------------------------------
Q9I9L7_DANRE/145-379ENMEK--------------LL..KE.LD...YQVVK.....---------------------------------------
Q9DDJ2_DANRE/174-400ENAEW--------------LL..RS.LG...FAVMK.....---------------------------------------
Q6NTR7_XENLA/280-494SLLEN--------------TF..KS.LR...FTVRT.....---------------------------------------
CFLAR_MOUSE/257-480KYLQE--------------TF..TS.LG...YHIQL.....---------------------------------------
Q6QN97_PIG/259-484DVLRD--------------TF..SS.LG...YEVQY.....---------------------------------------
CFLAR_HUMAN/252-477ELLRD--------------TF..TS.LG...YEVQK.....---------------------------------------
Q9NBW3_DROME/38-248NALRK--------------TF..ES.LK...CRVEV.....---------------------------------------
Q9TZP5_CAEEL/26-261KKLSK--------------LF..ER.LG...YQSTS.....---------------------------------------
CASPE_MOUSE/22-256EALER--------------MF..RY.LK...FESTM.....---------------------------------------
CASPE_HUMAN/18-241DALEH--------------MF..RQ.LR...FESTM.....---------------------------------------
Q8I749_SUBDO/254-491HNLTQ--------------TF..KY.LR...YKVEV.....---------------------------------------
CASP2_RAT/200-445TTLVT--------------LF..KL.LG...YNVHV.....---------------------------------------
CASP2_CHICK/171-416ASLEL--------------LF..KH.LG...YQVTV.....---------------------------------------
Q9GV89_HYDVU/93-318QALNS--------------FF..KGTLG...WCVKS.....---------------------------------------
Q9IB63_XENLA/144-396DKLAN--------------RM..RS.FH...FEVTV.....---------------------------------------
CASP9_HUMAN/161-413EKLRR--------------RF..SS.LH...FMVEV.....---------------------------------------
Q90WU0_CHICK/148-400EKLEK--------------RF..RS.LC...FHVRT.....---------------------------------------
Q9IB64_XENLA/261-494EEITR--------------IF..NA.RG...YITEE.....---------------------------------------
Q6E5N8_ICTPU/119-362DSLKE--------------VF..QW.LG...FNVCV.....---------------------------------------
Q9I8J3_DANRE/238-473DRLAK--------------LF..SR.MH...FQIEV.....---------------------------------------
Q6PAD9_XENLA/268-495GALRD--------------VF..KW.LG...LDVEI.....---------------------------------------
Q90WU1_CHICK/237-479DALRK--------------VF..SN.LH...FTVAE.....---------------------------------------
CASP8_HUMAN/234-476GALTT--------------TF..EE.LH...FEIKP.....---------------------------------------
CASP8_MOUSE/236-478EALSK--------------TF..KE.LH...FEIVS.....---------------------------------------
Q9Y1U6_PRIPA/173-413IALKN--------------LF.ISK.LG...YEVEV.....---------------------------------------
CED3_CAEEL/243-494DNLTN--------------LF..RC.MG...YTVIC.....---------------------------------------
Q7QKT2_ANOGA/35-260KALQA--------------VL..SH.LQ...FDVRL.....---------------------------------------
Q7PZJ9_ANOGA/20-250EAVET--------------VL..QR.LK...CDVRT.....---------------------------------------
Q9GV88_HYDVU/84-316ESLCD--------------LF..LK.LG...FKIDR.....---------------------------------------
Q7Q1E0_ANOGA/62-291KRLKE--------------TL..EL.FR...FDVKV.....---------------------------------------
CASP1_SPOFR/61-293DNLSK--------------VL..KT.LG...FKVTV.....---------------------------------------
CASP1_DROME/79-313QELKK--------------AF..EN.LG...FAVSV.....---------------------------------------
Q7Q4X6_ANOGA/73-309ENLTA--------------SL..KG.LD...FEVHV.....---------------------------------------
DRICE_DROME/94-328ENLTR--------------VL..KQ.LD...FEVTV.....---------------------------------------
Q9NHF9_DROME/56-302DDMEA--------------TL..QG.FG...FDVRT.....---------------------------------------
Q7Q803_ANOGA/54-306DNIRQ--------------VL..IY.LQ...FEVRV.....---------------------------------------
Q7PV92_ANOGA/14-237TDIST--------------VL..QR.IG...FEVRV.....---------------------------------------
Q86FL0_ANOST/52-286DSIGA--------------VL..ES.IG...FDVRV.....---------------------------------------
Q8I6Y2_GEOCY/158-414ENLYG--------------LF..NW.LG...MATIR.....---------------------------------------
Q8ITP3_BRAFL/87-323NNLYR--------------IF..SK.LG...FETKV.....---------------------------------------
O88550_RAT/68-301EALFK--------------CF..RS.LG...FEVTV.....---------------------------------------
Q6DCI2_XENLA/78-314RELLR--------------CF..KG.LG...FDVNV.....---------------------------------------
Q8JIS8_ORYLA/58-285AAAWK--------------SF..MK.LG...YEIQM.....---------------------------------------
CASP3_XENLA/56-280LKLHE--------------TF..TG.LG...YEVMV.....---------------------------------------
O93417_CHICK/53-281ASVRE--------------VF..MK.LG...YKVKL.....---------------------------------------
Q98UI8_DANRE/48-280GNVMN--------------VF..RK.LG...YIVKV.....---------------------------------------
Q8JG42_TAKRU/51-279ANAMK--------------VF..LS.LG...YKVKV.....---------------------------------------
Q8ITP2_BRAFL/151-396GNLKV--------------MF..EG.LG...FSVEV.....---------------------------------------
Q9IB66_XENLA/58-298MNLNR--------------IL..TD.LG...FDVQN.....---------------------------------------
Q9I8S9_ONCMY/57-297SNLVK--------------RF..ED.LN...FEVQA.....---------------------------------------
O93415_CHICK/57-299NNLKR--------------SL..TD.LG...FEVRI.....---------------------------------------
CASP6_MOUSE/28-270DNLTR--------------RF..SD.LG...FEVKC.....---------------------------------------
PCP_DICDI/188-404NSFYC--------------AL.....LG.CSFHSDN...IV---------------------------------------
Q7AKE1_STRCO/9-268AALAE--------------FF.TSP.QG...WGLPP..EHC---------------------------------------
A0A063TRB6_BORBO/552-800NAIAR--------------ELRERT.RG...LYRDV..RIE---------------------------------------
Q7NPG1_GLOVI/7-278RKFIE--------------VLKSPS.YG...LRTQQ..LRT---------------------------------------
Q87Z21_PSESM/2-224VAIAE--------------LLENDG.NGDPNFSVIK..LVS---------------------------------------
Q82I86_STRAW/5-276EEAAR--------------LV..TELVG...ERADL.....---------------------------------------
P74453_SYNY3/40-299QLLGE--------------VL.TGR.YG...FDQAK..IAG---------------------------------------
Q8YS65_NOSS1/4-245ELIQQ--------------FL.IKE.AG...FDQVI....L---------------------------------------
Q9DDL2_DANRE/323-560HELTN--------------LL..RQ.LD...FKVVS.....---------------------------------------
Q98CE0_RHILO/5-237EAMEA--------------AL..KK.LG...FEVIL.....---------------------------------------
Q6N0T4_RHOPA/30-250RELAD--------------DL..KR.AG...FDAEL.....---------------------------------------
Q89XG2_BRADU/27-247RDVAD--------------EL..KR.DG...FSVEI.....---------------------------------------
Q89XE4_BRADU/58-278RALSS--------------TL..RK.NG...FDVDM.....---------------------------------------
Q6NBN5_RHOPA/57-277RLLSA--------------SL..RH.EG...YDVDM.....---------------------------------------
Q98JS7_RHILO/35-253KLIAN--------------TL..TE.LK...FDVLL.....---------------------------------------
Q985X8_RHILO/35-256GLIAQ--------------TL..QA.AG...FDVVG.....---------------------------------------
Q6N5Q1_RHOPA/33-253GLIAQ--------------TL..QA.AG...FDVSG.....---------------------------------------
Q89KP2_BRADU/86-307GLIAQ--------------TL..QA.AG...FDVVG.....---------------------------------------
Q89IK1_BRADU/30-253EDVAS--------------SL..RR.SG...FEVLQ.....---------------------------------------
Q98G71_RHILO/26-252LDIAD--------------KL..RS.IG...FEVIE.....---------------------------------------
Q6AKF4_DESPS/28-248KDFSR--------------TL..SA.LG...FETII.....---------------------------------------
Q98IJ6_RHILO/11-238QAMAE--------------RL..QN.LG...FEVVS.....---------------------------------------
Q89MV1_BRADU/176-400SLMAE--------------TL..ST.LG...FTLVG...GR---------------------------------------
Q89HT8_BRADU/51-272ESMAK--------------FL..NS.AG...FEVVA.....---------------------------------------
Q89FZ4_BRADU/32-256KGMTE--------------LL..GN.AG...FTVTT.....---------------------------------------
Q6N329_RHOPA/73-298KAIAA--------------LL..GE.AG...FEVTE.....---------------------------------------
Q98IJ9_RHILO/30-261HLIAS--------------TL..RN.AG...FDVIE.....---------------------------------------
Q89HP3_BRADU/336-569RAVAK--------------SL..RD.IG...FTVSE.....---------------------------------------
Q7RFI8_PLAYO/964-1364YVFSR--------------AL.VKY.FN...FLPEN..ILL---------------------------------------
Q74F93_GEOSL/6-270EDMAA--------------IA.AER..G...FAVTT..LMT---------------------------------------
MCA9_ARATH/10-321LAMKE--------------TI.LSR.FG...FKQDD..IEV---------------------------------------
MCA8_ARATH/3-378HRMQK--------------CL.IEL.YG...FANKD..IVI---------------------------------------
MCA7_ARATH/3-401HRMHK--------------CL.VDR.FG...FAEEDITVLI---------------------------------------
Q70VV0_PICAB/3-415NRMYK--------------CL.VER.YG...FEEENIRVLI---------------------------------------
Q9ZSP8_HEVBR/3-415KRMYR--------------CL.VDR.YG...FSEEDITVLI---------------------------------------
MCA4_ARATH/3-416RRMYK--------------CL.VER.YG...FSEENITVLI---------------------------------------
MCA5_ARATH/3-408RRVHK--------------SL.VDR.FG...FSERNITELI---------------------------------------
MCA6_ARATH/3-366RRMRI--------------SL.VER.YG...FSEENIKMLI---------------------------------------
MCA1_ARATH/80-362KCMRH--------------LL.INK.FK...FSPDS..ILM---------------------------------------
MCA2_ARATH/116-414NCMKF--------------ML.MKR.FQ...FPESC..ILM---------------------------------------
MCA1_SCHPO/130-422MSMSQ--------------LL.IQR.YG...YKQED..MVI---------------------------------------
MCA1_YARLI/168-458HNLQR--------------YL.VQR.AG...YKPDD..MVI---------------------------------------
MCA1_DEBHA/146-437KNMSN--------------FL.NQH.FG...YSYDD..MVI---------------------------------------
MCA1_ASHGO/154-449QNIKN--------------FL.ISR.YG...YREEN..MVI---------------------------------------
MCA1_KLULA/138-430HNMFN--------------FL.TQR.YG...YKAED..IVM---------------------------------------
MCA1_CANGA/98-389HNIFN--------------YL.TTY.CG...YRPED..IVM---------------------------------------
B5VS82_YEAS6/157-450HNIFN--------------FL.TNG.YG...YSSDD..IVI---------------------------------------
Q386I9_TRYB2/84-341VMMAG--------------TM..EK.IG...IPITERCVLM---------------------------------------
Q38D34_TRYB2/63-322MHMLQ--------------TL..QR.IE...FPISE..CCI---------------------------------------
Q8T8E6_9TRYP/84-343KQMLA--------------TL..QK.KG...LPINE..AVI---------------------------------------

PF14538

W1QFK7_OGAPD/56-210KNLQS..............NY--ESCEG---VSSRI..KYK---------------------------------------
L8WVZ0_THACA/73-224RNLQH..............QF--EN...---LNPRM..NYK---------------------------------------
A2EZ34_TRIVA/89-236AYLQD..............YM--HE.KY---SNYRKVLRMF---------------------------------------
Q6C6R4_YARLI/86-238KQLQM..............QY--EV...---LSMRT..RYK---------------------------------------
M2WI96_DOTSN/172-328KNLQS..............QY--EN...---LSLRT..RYK---------------------------------------
K2S4T3_MACPH/104-258KALQT..............QY--EQ...---LSMRT..RYK---------------------------------------
C4LXC3_ENTHI/42-194NQLGI..............QY--QR..Y---CTPTV..STE---------------------------------------
T1G0Q6_HELRO/62-216AALQK..............QY--ER...---WQPKA..RYK---------------------------------------
B0CNS4_LACBS/34-185NNLQH..............QF--EG...---LSLKI..GYK---------------------------------------
F0ZAV4_DICPU/115-266KTLQA..............QY--EK...---WQSKA..RYK---------------------------------------
U9UGJ5_RHIID/52-203KNLQA..............QY--EQ...---LSIRT..RYR---------------------------------------
Q5KIS3_CRYNJ/92-243RNLHQ..............QF--ET...---LNPKV..KYK---------------------------------------
B0WBU4_CULQU/30-181KLLRSERRHFQSFDREHSHYF--RS...---.......RFR---------------------------------------
A5DWK2_LODEL/143-295KNLQS..............QY--ET...---LSLRT..RYK---------------------------------------
G0VGR8_NAUCC/79-231KNLQS..............QY--ET...---LSLRC..RYK---------------------------------------
I3J5N7_ORENI/57-208ANLQK..............QY--EN...---WQPRA..RYK---------------------------------------
A2DYM2_TRIVA/68-215SYVQE..............YF--HD.KY---VSIKKQLRFF---------------------------------------
D8TLK8_VOLCA/11-162KNLQA..............QY--ER...---WQPRA..KYK---------------------------------------
G4M000_SCHMA/43-194KNLQA..............QY--ER...---WQPRA..RYK---------------------------------------
C1MUE6_MICPC/45-196KALQA..............QY--ER...---WQPRA..KYK---------------------------------------
Q387I9_TRYB2/89-240ALLQR..............QY--HS...---..QLQGAVSS---------------------------------------
C4M2F5_ENTHI/38-189ANLTD..............QY--RS...---WQNGS..KIE---------------------------------------
G4TT65_PIRID/72-223KNLCQ..............QF--QS...---LNPRI..KYK---------------------------------------
G0NWW0_CAEBE/64-218MSTQR..............AY--EK...---WQPKSKTRYK---------------------------------------
A2DJF0_TRIVA/83-228RTLQG..............FF--PSQYF---KHAKW..STQ---------------------------------------
K3WJU9_PYTUL/84-235KTLQS..............QY--ER...---WQARA..RYR---------------------------------------
A2G590_TRIVA/30-180NAIQD..............LY--SA...---...SMKCPAE---------------------------------------
B8M6V6_TALSN/189-342KKLQE..............QY--EN...---LSLRT..RYK---------------------------------------
A2FJN8_TRIVA/41-191NAIQN..............LY--MN...---...SLKCSAD---------------------------------------
A2DLR3_TRIVA/97-242SNIQT..............CY--RS.LY---LHLRQHLVFS---------------------------------------
E5SIN8_TRISP/44-195TALQR..............QY--QW...---WQPRA..RYK---------------------------------------
I1G727_AMPQE/53-204NSLQK..............QY--ER...---WQPRA..RYK---------------------------------------
U1MN31_ASCSU/95-246SALQK..............NY--ER...---WQPRA..RYK---------------------------------------
I1L744_SOYBN/123-274KTLSS..............QY--ER...---WQPKA..RYK---------------------------------------
E4XFS5_OIKDI/48-228RNVQDTLKSNFIELAPRVLQT--NTFNW---KQLHHSDAYK---------------------------------------
D2VMD1_NAEGR/144-294SNLKL..............QY--ER...---WQPRA..RYK---------------------------------------
A9TBL2_PHYPA/91-242KNLQT..............QY--ER...---WQPRA..RYK---------------------------------------
B7PLB3_IXOSC/92-247AALQK..............QY--ER...---WQSRA..RYK---------------------------------------
A0A0D2USM0_CAPO3/727-878LRLEQ..............QY--SR...---WQNKA..RYK---------------------------------------
B8CBK6_THAPS/256-409ERLEQ..............QY--AK...---WQQRSKLKYR---------------------------------------
A4I1A2_LEIIN/114-279ETLER..............QY--RS...---.VLRDDVGVM---------------------------------------
F4RLY3_MELLP/215-367KRLQD..............QF--ESLAP---PHARV..KFK---------------------------------------
K4DUJ2_TRYCR/62-218EILER..............QY--RS...---..QQRDAVFK---------------------------------------
H1VVG4_COLHI/158-309KALQA..............QY--ET...---LAIRT..RYK---------------------------------------
M7XEP3_RHOT1/113-265KNLQQ..............QF--ENLA.---ATPKT..RYK---------------------------------------
A2GCD5_TRIVA/98-247TTIQT..............YF--KN.TY---HQIRQKIRFF---------------------------------------
D8RG53_SELML/72-223KNLQS..............QY--AL...---WQPRA..RYK---------------------------------------
A2F9H3_TRIVA/31-181KAIED..............MY--NN...---...AIKCPCD---------------------------------------
L0PHF8_PNEJ8/131-282KNLQQ..............QY--ET...---LSMRT..RYK---------------------------------------
RTOR2_ARATH/94-246QNLSI..............QY--ER...---WLARA..RYK---------------------------------------
M5E8T5_MALS4/58-209RNLQV..............QF--ET...---LSMKT..RYK---------------------------------------
B3RPQ9_TRIAD/43-194NSLQK..............QY--ER...---WQPKA..RYK---------------------------------------
I4Y9Q8_WALSC/76-227RNLQQ..............RF--ES...---LSQRT..RVK---------------------------------------
A2E4G0_TRIVA/101-242KSLYS..............VY--KS.AY---QNLRNQIRFA---------------------------------------
A0A068XPC4_HYMMI/269-417KNLQS..............QY--ER...---WQPKG..CYR---------------------------------------
U4LGP0_PYROM/223-374KNLQI..............QY--ET...---LSIRT..RYK---------------------------------------
A2F8U1_TRIVA/65-210KAIVT..............QY--QQ...---CMPKM..ALA---------------------------------------
D8T9J0_SELML/50-197QTLQS..............QY--KR...---WQPKA..LYN---------------------------------------
A9V5A2_MONBE/628-777QRLTS..............QY--LR...---WQPKA..KFR---------------------------------------
F0XXV0_AURAN/12-164AALQA..............QY--ER...---WQSRA..RYR---------------------------------------
A2E336_TRIVA/54-202AGFSD..............IF--PR...---.......HSI---------------------------------------
B4R5C8_DROSI/214-365SNLQM..............QY--ER...---WQPRA..RYK---------------------------------------
J4H2X1_FIBRA/92-243MNLAH..............QF--EG...---LSPKI..TFK---------------------------------------
A2EU18_TRIVA/81-227GIIQK..............FF--KA.GY---KIRNYKPTFY---------------------------------------
A2DYB3_TRIVA/12-162HVVQD..............VY--RA...---...AIQCPCE---------------------------------------
S2KE38_MUCC1/106-257KSLHN..............QY--ET...---INGRT..RFK---------------------------------------
G7E3R0_MIXOS/173-325RNLQL..............QY--ENLA.---GTSKT..RYK---------------------------------------

PF03415

Q8A866_BACTN/37-399IRLRK------------------DKDVV---VQDVIATYDA---------------------------------------
Q9WZB1_THEMA/121-462LVLDE------------------SGNF.---.QAVVGTMGI---------------------------------------
Q8XM44_CLOPE/59-508ERISG------------------KSEF.---.PEITTTSNY---------------------------------------
Q9X1S5_THEMA/586-937YVLNE------------------EGEW.---.EG..GPADA---------------------------------------
Q9WYY6_THEMA/5-301YRVEE------------------.....---.GLIPLETFD---------------------------------------
Q8TIY6_METAC/66-593RKDSE------------------DGVIG---NEEIHRRAYP---------------------------------------

PF12770

A0LJ53_SYNFM/581-921LREAA--------------AI--RKAGA---DY.....PLL---------------------------------------
A0LQE8_SYNFM/635-947SPSLS--------------WQ--VAG..---.........F---------------------------------------
A1BCK0_CHLPD/513-826GESGV--------------GC--ASGSL---.........L---------------------------------------
A1BEL3_CHLPD/43-361S.SPA--------------IK--VHMPD---IETGPLRILL---------------------------------------
A1BEL6_CHLPD/46-364T.IPS--------------IK--TGVSD---IEPGPLRILL---------------------------------------
A4HBL7_LEIBR/1053-1432AAFAA--------------LS--AVRVQ---QQDLHREVVA---------------------------------------
A8L4T6_FRASN/741-1051TRIAP--------------GP--ARSGD---L.......LL---------------------------------------
A9WBC0_CHLAA/673-929IPVPA--------------GP--SGPA.---.........L---------------------------------------
A9WER9_CHLAA/54-394YIDSE--------------QF--ALFEP---IDHHPIRLLL---------------------------------------
A9WF91_CHLAA/60-360YLTSN--------------DV--QPIRA---RSRNALRVLI---------------------------------------
B0C874_ACAM1/207-507TRFAP--------------IQ--GKQV.---.........L---------------------------------------
B2IXC0_NOSP7/1396-1691TLYKD--------------IK--KSQV.---.........L---------------------------------------
B2IZZ4_NOSP7/695-973PSNSI--------------IS--KQKA.---.........L---------------------------------------
B2JAK0_NOSP7/526-830DERVS--------------NV--QLPDI---NNNETQRNIF---------------------------------------
B2JAM9_NOSP7/866-1190VRNET--------------KN--RNVAV---KK......LA---------------------------------------
B4JKU3_DROGR/1402-1700RSRSR--------------RD--RGRPP---T.......AL---------------------------------------
C3Z401_BRAFL/1278-1602NQQGH--------------PQ--SRPSD---VL.....PGL---------------------------------------
F0SR63_RUBBR/137-574LCNRV--------------DG--QASGL---.........L---------------------------------------
Q01RE6_SOLUE/865-1136TGEAA--------------IS--AASRM---.........L---------------------------------------
Q024J7_SOLUE/541-814KPPDS--------------HP--AHRL.---.........L---------------------------------------
Q025F1_SOLUE/607-877DRRSG--------------GP--AGREL---.........L---------------------------------------
Q028B5_SOLUE/667-935MRPAH--------------RA--SQPR.---.........L---------------------------------------
Q02DA1_SOLUE/510-786RTVAG--------------PV--ESGAR---A........L---------------------------------------
Q10YT7_TRIEI/1003-1309FTSTP--------------RN--TSPA.---.........V---------------------------------------
Q10YU6_TRIEI/544-838PKPLL--------------KQ--QIRV.---.........L---------------------------------------
Q112V9_TRIEI/62-390SNKLS--------------IK--INQDE---QLK....IAL---------------------------------------
Q113D1_TRIEI/130-430VRWQD--------------IT--NPEDL---DNVNGFINLE---------------------------------------
Q113U8_TRIEI/3002-3297TNYRP--------------LQ--GTQV.---.........L---------------------------------------
Q115J8_TRIEI/1466-1777VRERN--------------NQ--EFQSL---.........F---------------------------------------
Q117G6_TRIEI/881-1206LTTKA--------------RK--TSPA.---.........L---------------------------------------
Q119J2_TRIEI/1474-1770TRYLG--------------LD--GSQV.---.........L---------------------------------------
Q16H64_AEDAE/1315-1614KSRTK--------------TR--EPGLN---S.......AL---------------------------------------
Q2G6U6_NOVAD/692-1020IRKLA--------------AS--TAPRN---Y........L---------------------------------------
Q2S6G2_SALRD/540-844TRGDA--------------AS--SSSDL---.........A---------------------------------------
Q2W535_MAGSA/875-1218LPSSI--------------PA--AKGGY---.........L---------------------------------------
Q38C46_TRYB2/1044-1397CRLAA--------------LS--AKRVQ---QRCLFQNLVL---------------------------------------
Q3AQG5_CHLCH/44-362T.IPS--------------VQ--KALPD---AAKGPLRILL---------------------------------------
Q5LLA3_RUEPO/680-970TPVEK--------------LS--PRES.---LK.....ILI---------------------------------------
Q7NCT1_GLOVI/600-923LAQAS--------------SA--PRSAP---.........L---------------------------------------
Q7NF67_GLOVI/550-854LA.RP--------------AT--LRHPP---.........L---------------------------------------
Q7NFD7_GLOVI/666-979LQERA--------------SD--PREAP---.........L---------------------------------------
Q7NIF7_GLOVI/691-997LSDLP--------------VP--PRQGP---.........L---------------------------------------
Q7NJE3_GLOVI/660-988LEQAA--------------PA--PRSGP---.........L---------------------------------------
Q7NLR0_GLOVI/653-961LGRSQ--------------PA--AQSA.---.........L---------------------------------------
Q7NVB0_CHRVO/67-386TREIR--------------RV--TDDAV---SWPVHPRILV---------------------------------------
Q82I85_STRAW/1175-1481VAARP--------------AV--AHSGA---A........L---------------------------------------
Q82L10_STRAW/969-1256RRRAA--------------PG--RRRT.---.........L---------------------------------------
Q8DGG5_THEEB/541-835IL.SR--------------PV--TANPP---.........L---------------------------------------
Q8DH74_THEEB/570-891LQ.QR--------------GK--PANPP---.........L---------------------------------------
Q8DHI1_THEEB/67-394IHRIS--------------VQ--TDFVQ---LWRYPWHDWT---------------------------------------
Q8DIE5_THEEB/1127-1420TRYRS--------------IQ--RERI.---.........L---------------------------------------
Q8YZU5_NOSS1/56-340LKPLS--------------SQ--VNRA.---.........L---------------------------------------
TTC28_HUMAN/1390-1713QSKSH--------------LR--KNPP.---TYSSSTSMAA---------------------------------------

PF03568

G7E6G1_MIXOS/1513-1914VRLGE--------------LL--ANLEQ---RWLGAYK.CM---------------------------------------
A8PX94_MALGO/1441-1824AQLGS--------------LL--QLVQD---AWFSGLH.GL---------------------------------------
M7XLD2_RHOT1/1703-2100QRLGN--------------LL--QTVED---AWLGAFK.SV---------------------------------------
U5HB45_USTV1/1850-2253ARLKG--------------LL--QSMED---SWLGAFK.CI---------------------------------------
F4RLY9_MELLP/91-479GRMRR--------------LV--ENIEN---HWLGGCK.GF---------------------------------------
T1IUX7_STRMM/1624-1980LQLKD--------------FV--EDLEN---VWIGHWK.GL---------------------------------------
A7RYA6_NEMVE/1651-2034DSLKN--------------VL--ERLER---SWLGKWR.GV---------------------------------------
T1FT05_HELRO/413-770EKLDE--------------LL--ESFEK---EWFSCWI.GG---------------------------------------
W4Y9R2_STRPU/1031-1383EEMQG--------------LT--KDMEN---NLLSYWK.GL---------------------------------------
G3N6G2_GASAC/1731-2077SRVER--------------LL--KEMEE---.FLGCWW.SF---------------------------------------
H3DAQ7_TETNG/1711-2057SRVEG--------------LL--KEMEE---.LLGCWR.SL---------------------------------------
I3KSG7_ORENI/1715-2061SRVEQ--------------LL--KDMER---.LLGCWR.TF---------------------------------------
H2L8K9_ORYLA/1692-2038SRVEH--------------LL--KEMEE---.VLGCWK.SF---------------------------------------
M3ZIW2_XIPMA/1768-2114CRLQQ--------------LL--KEMEK---.MLGCWQ.SF---------------------------------------
ESPL1_MOUSE/1716-2065QRMEA--------------LI--TALEE---QVLGCWR.GL---------------------------------------
F7BUI1_CALJA/1724-2073HRMEV--------------LI--ASLEK---SVLGCWK.GL---------------------------------------
G3VPI8_SARHA/1713-2063RRMED--------------LI--TSLEK---HILGCWK.MM---------------------------------------
U3IXX7_ANAPL/1332-1679RRMKS--------------LI--DTLET---EVLGCWK.GV---------------------------------------
G1KFP0_ANOCA/1819-2167KRMKA--------------LT--ESLET---HILGCWK.GA---------------------------------------
H3B3H1_LATCH/1699-2055KRMKL--------------LM--DSMEV---YCLSCWK.GM---------------------------------------
F6VXN8_XENTR/1732-2080CRMKA--------------LI--RLLEE---QILGCWK.VL---------------------------------------
Q6ZHH8_ORYSJ/455-870NHLDK--------------ML--KDMEE---SWLGPWK.CL---------------------------------------
W5GJD2_WHEAT/891-1304NDLNE--------------IL--ENMEK---LWLGPWK.YL---------------------------------------
K3Z105_SETIT/1078-1484NCLDN--------------ML--KDMEE---SWFGPWK.CL---------------------------------------
C5XYE8_SORBI/457-870NYLAN--------------TL--KDIED---SWFGPWK.CL---------------------------------------
C5XSY3_SORBI/1425-1832NYLAN--------------TL--KDIEN---SWFGPWK.CL---------------------------------------
K3Y3B2_SETIT/1404-1817NYLDK--------------LL--KDMEE---LWLGPWK.CL---------------------------------------
M0UBW7_MUSAM/65-479NRLNK--------------LL--KSMEI---SWLGPWG.CL---------------------------------------
ESP1_ARATH/1641-2060HRLGI--------------FL--RNLEA---SWLGPWR.CL---------------------------------------
M4DS49_BRARP/1599-2019HHLKK--------------FL--RNLEA---SWLGPWR.CL---------------------------------------
B9GZR1_POPTR/1674-2094HRLGK--------------LL--RKIED---SWLGPWR.CV---------------------------------------
B9SSN4_RICCO/1627-2045FQLGK--------------LL--RKMED---LWLGPWR.CV---------------------------------------
I1MDQ8_SOYBN/1648-2063HCLDK--------------LL--RNLEE---SWFGSWK.CL---------------------------------------
K4B224_SOLLC/1600-2023KRLAN--------------FL--RNLED---SWLGPWR.CL---------------------------------------
W1NKX2_AMBTC/1-423DRLGT--------------LL--RSVED---SWFGPWS.FL---------------------------------------
K7H1P7_CAEJA/245-604ARLAS--------------FV--GEVEK---NFLGVSA.HL---------------------------------------
E3LM18_CAERE/731-1090ARMKL--------------FL--EEVQN---NFLNVAA.NL---------------------------------------
G5ED39_CAEEL/727-1081GRMMT--------------FV--DEVQK---HFLGVAA.SL---------------------------------------
Q23491_CAEEL/749-1101CQMKK--------------CV--ENTQK---HFLGAAA.SL---------------------------------------
S3CR95_OPHP1/1758-2208ARLKE--------------LL--DNVEQ---IWLGGFR.GI---------------------------------------
F0XAD9_GROCL/1636-2054EQLRE--------------LL--DNVEQ---VWLGGFR.GI---------------------------------------
G2R9B0_THITE/1619-2058DRLKE--------------LL--MNMEH---VWLGGFK.GI---------------------------------------
Q2H6Q9_CHAGB/1612-2026ERLKE--------------LL--GSIEQ---IWLGGFR.GI---------------------------------------
G0SHM3_CHATD/1723-2150QRLKE--------------LL--MNIEH---VWLGGFR.GV---------------------------------------
G4UQF5_NEUT9/1626-2085NRMKD--------------LL--TNIEQ---IWLGGFR.GI---------------------------------------
G4N8I2_MAGO7/1627-2057ERLKN--------------LL--DNVEQ---VWLGGFK.GI---------------------------------------
J3P7L5_GAGT3/1606-2054KRLGE--------------LL--ENVEQ---VWLGGFK.GI---------------------------------------
R8BFS3_TOGMI/72-487DRMKD--------------LL--ENIEN---IWLGGFK.GI---------------------------------------
N4UZ87_COLOR/1637-2043VRFKD--------------LL--DNVEE---VWLGGFK.GI---------------------------------------
G2X6M8_VERDV/1704-2113KRMKQ--------------LL--DNIEQ---IWLGGFK.GI---------------------------------------
G0RRT6_HYPJQ/1566-1971SRLKK--------------LL--VTIET---TWLGGFK.GI---------------------------------------
M1WFQ9_CLAP2/1438-1889TRLKE--------------LL--LTIET---TWLGGFK.GI---------------------------------------
J5K578_BEAB2/1584-1996TRLKE--------------CL--TQIET---TWLGGFK.GI---------------------------------------
C7YYU1_NECH7/1580-1992ERLRD--------------LL--STIET---TWLGGFK.GI---------------------------------------
M7T4Q8_EUTLA/44-499ERLKN--------------LL--TDIEK---MWLGGFK.GI---------------------------------------
L8G205_PSED2/1652-2056VRLKE--------------LL--DNVEK---VWLGGFK.GI---------------------------------------
N1JFH1_BLUG1/1598-2001ARMCA--------------LL--TNIEK---VWLGGFR.GI---------------------------------------
K1X2E6_MARBU/1659-2061ARLKD--------------LL--ENIEK---VWLGGFT.GI---------------------------------------
S3D029_GLAL2/1639-2043SRMKE--------------LL--ENIEK---VWLGGFT.GI---------------------------------------
M7TX51_BOTF1/1640-2041SRLKD--------------LL--ENIEK---VWLGGFA.GI---------------------------------------
BIMB_EMENI/1609-2004RRMEN--------------LL--QNIEN---VWFGGFR.GI---------------------------------------
Q2USV7_ASPOR/1630-2030RRMET--------------LL--QNIEN---VWFGGFR.GI---------------------------------------
G7XGU8_ASPKW/1627-2026RRMEA--------------LL--QHIET---VWFGGFR.GI---------------------------------------
S8BGE7_PENO1/1622-2018QRMES--------------LL--HNVEN---VWFGGFR.GI---------------------------------------
B6GZP8_PENCW/1602-1998RRMEN--------------VL--QNIEN---IWFGGFR.GV---------------------------------------
Q4WUU6_ASPFU/1638-2039QRLQN--------------LL--QNIEN---VWFGGFR.GI---------------------------------------
B6QNB5_PENMQ/1619-2016RRLET--------------LL--DNMEN---IWLGGFR.GI---------------------------------------
V5GCB2_BYSSN/1684-2084RRLET--------------LL--CNVEN---IWLGGFR.GV---------------------------------------
F0UL09_AJEC8/1642-2044NRLRD--------------LL--SNIET---VWFGGFR.GI---------------------------------------
C5FSW7_ARTOC/1655-2058KQLGD--------------LL--QNIET---VWFGGFR.GI---------------------------------------
H6C6Q4_EXODN/1587-1987QQLAT--------------LL--DNMEN---VWFGGFR.GL---------------------------------------
U1G8A9_ENDPU/1638-2036ARLAS--------------LL--ENIET---LWLGGFR.GV---------------------------------------
K2R7J5_MACPH/1619-2043ARLGD--------------LL--ANIEN---IWLGGFR.GI---------------------------------------
R7YNT5_CONA1/1696-2117NRLKE--------------LL--VNIEN---IWLGGFR.GI---------------------------------------
E4ZTB4_LEPMJ/1652-2063TRLHE--------------LL--VNMEN---IWLGGFK.GV---------------------------------------
N1QAI8_PSEFD/1492-1912KRLHE--------------LL--MNMEK---HWLGGFK.GV---------------------------------------
N1QHR1_SPHMS/1187-1599RRLQG--------------LL--INIEN---IWLGGFR.GV---------------------------------------
N1PZ16_DOTSN/1513-1936RRLHE--------------LL--INMEN---LWLGGFR.GI---------------------------------------
D5GKQ4_TUBMM/1633-2033TQLKD--------------LL--SVIEY---HWLGGFK.GV---------------------------------------
U4LG69_PYROM/1616-2019DQLRD--------------LL--SGIEK---GWLGGFK.GI---------------------------------------
S8C8B1_DACHA/1639-2040NELHD--------------LL--LNIEN---NWLRGYK.GI---------------------------------------
Q6CCJ0_YARLI/1210-1588ARLKQ--------------LL--HDAEF---CWFGGFL.GI---------------------------------------
S9X830_SCHCR/1385-1771NSLAK--------------LL--RYVEL---SWLGGFK.GI---------------------------------------
CUT1_SCHPO/1383-1770QCLQQ--------------LL--ENIEI---SWLGGFK.GI---------------------------------------
B6K0I6_SCHJY/1359-1747CTLAA--------------LL--NNIES---CWLGGFK.GI---------------------------------------
M7PDE3_PNEMU/1489-1882AKLKQ--------------LL--INVEH---CWLGGFK.GI---------------------------------------
G8BT64_TETPH/1165-1563KRMEG--------------LI--TKIDN---SWFSGFS.SF---------------------------------------
I2H0Y5_TETBL/1280-1677KKLQD--------------LL--LQLEI---TWLSGLK.GI---------------------------------------
S6EFD3_ZYGB2/1145-1542RRLES--------------LL--SSIEH---YWFSSLK.GL---------------------------------------
C5DU01_ZYGRC/1141-1538RRLEL--------------LI--TNMEH---YWFNGLK.GI---------------------------------------
G8ZWZ1_TORDC/1158-1555HRLQE--------------LL--NNIEV---CWFNGMK.GL---------------------------------------
G0WDN6_NAUDC/1191-1589GRLQT--------------LL--QNIEY---SWFNGFK.GI---------------------------------------
G0VFB3_NAUCC/1164-1562NRLSS--------------LL--HNIET---SWFAGLK.GL---------------------------------------
H2B1L5_KAZAF/1161-1559KRLQN--------------LL--EKVEA---TWFNGFR.GF---------------------------------------
ESP1_YEAST/1175-1571KRMQQ--------------LL--NNIEN---SWFNGVQ.GF---------------------------------------
J7RG90_KAZNA/1160-1562KRLEQ--------------LL--EKICN---FWINGFA.GY---------------------------------------
Q75EJ0_ASHGO/1152-1552KRMCD--------------LM--RRIED---SWICGFC.GF---------------------------------------
C5DHM1_LACTC/1178-1575SKLQS--------------LL--SKIES---SWFSGFK.TF---------------------------------------
Q6CQQ7_KLULA/1118-1516NRLQT--------------LL--TKIED---SWFCGFK.GV---------------------------------------
Q6FTE1_CANGA/1151-1548ELLGN--------------LI--ERIEK---TWLNGLS.GI---------------------------------------
K0K8V1_WICCF/1175-1568EKLAG--------------FL--DKIEY---CWIGGFK.GM---------------------------------------
A5DNR9_PICGU/1178-1576LQFES--------------LL--DLVRK---TWIGGFS.GL---------------------------------------
A3GFF5_PICST/1168-1555LKMKD--------------LL--DHISD---YWFGGFK.GL---------------------------------------
Q6BTB7_DEBHA/1338-1753LELKN--------------LL--DHVEN---DWLGGFK.GI---------------------------------------
Q5A8X8_CANAL/1101-1536FQLQD--------------IL--HHVES---KWFGGFISGI---------------------------------------
C5MEH0_CANTT/925-1303YELQD--------------IL--NHVEQ---YWIGGFV.GI---------------------------------------
M3HH45_CANMX/1423-1797YQMQD--------------IF--EYVER---FWFGGFT.GL---------------------------------------
G8B5X7_CANPC/1052-1424YELQD--------------LI--SHVER---FWFGGFR.GI---------------------------------------
A5DVQ7_LODEL/1109-1530YELKD--------------LC--QHVED---FWLGGFK.GI---------------------------------------
G3AGZ6_SPAPN/1149-1535YRLQE--------------LL--NEVQN---YWIGGFG.GI---------------------------------------
G8YBL5_PICSO/1309-1719LELQE--------------LL--TCLET---DFFCAFR.GF---------------------------------------
C4XY11_CLAL4/1177-1564QRLKN--------------LL--DDVED---ELLKGFK.GV---------------------------------------
G3B782_CANTC/1213-1609MKLKE--------------VL--ELIEY---QWLGAFR.GI---------------------------------------
W1QIM9_OGAPD/1167-1527RRLKQ--------------LL--WEIDS---HWFGCFK.GV---------------------------------------
C4QYS2_PICPG/1259-1619LRLQK--------------ML--ESFEN---DHLGALK.GI---------------------------------------
K5WME3_PHACS/1732-2136ERMKA--------------LL--ANIEF---CWLGAFK.TI---------------------------------------
M2R2K9_CERS8/1618-2024QRMRE--------------LL--ENIEF---CWLGAFK.TI---------------------------------------
F8PLA9_SERL3/1278-1688KRMQE--------------LL--ENIEY---CWLGAFK.TI---------------------------------------
S8E105_FOMPI/1678-2083QRLRD--------------LL--GNIEF---CWLGAFK.TV---------------------------------------
J4GX56_FIBRA/504-917ARLRD--------------LL--QNIEF---CWFGAFK.AI---------------------------------------
A8NBE9_COPC7/1839-2276VRLKD--------------LL--ENIEF---CWLGAFK.TI---------------------------------------
B0E1W0_LACBS/104-540TRLRE--------------LL--ENIEF---CWLGAFK.TI---------------------------------------
D8Q1W5_SCHCM/1450-1878TRLKE--------------LL--QSIEF---CWLGGFK.TI---------------------------------------
V2X3W8_MONRO/1588-2040TRLQE--------------LL--ENIEF---CWLGAFK.TI---------------------------------------
J0DCK6_AURDE/1634-2046QRLKQ--------------LL--DNIEY---CWLGAFK.SV---------------------------------------
Q5KMS4_CRYNJ/188-600KRMEE--------------LC--VNLEF---VWLGAFK.TI---------------------------------------
R9AIE1_WALI9/1639-2036SRMRQ--------------LV--KNIEF---CWLGVFK.SL---------------------------------------
I4YB88_WALSC/1631-2030SRMRQ--------------FV--KNIEF---CWLGVFK.SL---------------------------------------
G4T5A4_PIRID/1472-1874DRLKT--------------LL--ENMEY---CWFGGFK.TI---------------------------------------

PF01364

KGP83_PORGN/244-595.KKTK--------------KV--TDLYY---SAVD.............................................
D1JG83_9ARCH/891-1295TLMGF--------------DI--YRDYN---IQLD.............................................
A2U064_9FLAO/401-768LASS.--------------YV--TDDFF---VMLDDNEGTM.......................................
Q7MTE2_PORGI/239-573..TPG--------------IK--SDQVY---GQIVG............................................
D3HWT0_9BACT/400-777KVTC.--------------YV--DDGWF---GLLDDGEGTN.......................................
Q5S3Q9_9FLAO/543-910LSDS.--------------FV--SDEFF---GMMDPDEGRM.......................................
A9DMD5_9FLAO/555-923LTRG.--------------FM--TDDFY---GMMDPDEGLL.......................................
B0VGA8_CLOAI/228-563MSTYG--------------GE--GDYPY---TFLAG............................................
B7B5I7_9PORP/382-753SSQS.--------------YV--IDDYF---GFLDDADNKK.......................................
B8FFM0_DESAA/254-600PHHGL--------------MA--SDHFY---ADIS.............................................
A3U7G6_CROAH/540-908LLSS.--------------FA--SDDYF---GMIDPNEGTF.......................................
D2QSX9_SPILD/414-786PVLS.--------------YS--SDDYF---GFMDSHEGEWPE.....................................
A3HW99_9BACT/398-769.....--------------YP--TADNN---FVVGLDPS.........................................
B0VHP2_CLOAI/234-563..YSG--------------GG--SDPSY---ALLAG............................................
A8ZUB1_DESOH/278-656RYEDY--------------IP--SDLYY---QCLDGDFNFDGDEEWGE..........................RTDGED
B0VIM2_CLOAI/182-528YPTEN--------------DA--DDNYY---TMLEG............................................
Q2Z0E1_9BACT/643-1013.GVLY--------------WP--TDVWF---VGFDAV...........................................
B3QXR8_CHLT3/734-1131LRFGA--------------TA--ADVWY---AMVDGLDESG.......................................
C2MCN4_9PORP/405-781NVYS.--------------YS--TDDYF---GLLTEGLRGV.......................................
A4A325_9PLAN/24-399GSEPT--------------LV--TDNYY---ADVD.............................................
A7NR84_ROSCS/499-867PWLGE--------------TA--CETCY---AQLDGERPT........................................
Q11Q36_CYTH3/558-932ELQS.--------------YN--SDDYF---GFMDNTEGYWDE.....................................
Q7MX16_PORGI/272-637.FGSI--------------CA--SDYFF---SCVSP............................................
A0B5K7_METTP/796-1154..ISY--------------DV--YRDYR---IEMD.............................................
D0MH89_RHOM4/586-975PINS.--------------YT--SDDYF---GLLDDDEGLWPDY..................................GA
A8UH97_9FLAO/539-910LTNS.--------------FV--SDDFY---AMLDSNEGSM.......................................
B8KYL6_9GAMM/364-704VQGHF--------------AA--SDNRL---VSVEG............................................
B8FIK5_DESAA/1139-1542YYEEE--------------TP--ADLYY---SDLDGDWDANGNGVY...............................GEV
Q11US7_CYTH3/392-767.....--------------EP--GSDLM---FSVD.............................................
C6W101_DYAFD/326-680.....--------------WP--GSDIA---LATTKG...........................................
A5FJM8_FLAJ1/544-914VGESG--------------FA--SDDFF---GLMDSNEGVV.......................................
Q7UG73_RHOBA/51-444GSTST--------------LP--TDLPY---GDRD.............................................
A3J247_9FLAO/540-919LYSS.--------------FM--SDDFY---GLMDDGEGQM.......................................
A9WIM0_CHLAA/500-869PWLGE--------------TA--CEVCF---AQLDGDDPTA.......................................
B0VHE7_CLOAI/227-554...NN--------------TY--VDYQY---TWLAG............................................
C6VT06_DYAFD/394-758.....--------------YP--GSDIL---LVEGIAGA.........................................
C6X3N8_FLAB3/546-921YELS.--------------FV--TDDYY---TMTKPQPVTSI......................................
A0LQH1_SYNFM/790-1132TPNGL--------------AP--SDARL---ADFAG............................................
A1ZVJ9_9BACT/406-774PILS.--------------HS--SDDYF---GFLEASEGEWTE.....................................
B0VHF1_CLOAI/214-595...AD--------------IP--ADMYY---ACLDGNWNTDGDSY................................WGE
B0VIE7_CLOAI/193-598...ET--------------VP--TDFFY---SDLSSNWDTDNDGKRGEY........................STGYMNE
C6W3P4_DYAFD/414-806.....--------------FP--GSDLL---LIEGLQGT.........................................
B2RGP6_PORG3/408-787NVNS.--------------YV--TDDYF---GLLDDQPASV.......................................
D2QJ99_SPILD/409-770.....--------------YP--GSDGL---LTAG.............................................
A9B5Q8_HERA2/466-850PWLGE--------------IA--CDTCF---VQLDGANPL........................................
D2QFF3_SPILD/397-745.....--------------YP--GSDIL---LSAGLGGF.........................................
B0VH03_CLOAI/589-939..GSY--------------IV--SDDYF---GMFN.............................................
D2R2P5_PIRSD/21-411GSEPT--------------IP--SDNWF---ADLD.............................................
C6W0Z3_DYAFD/393-758PVYT.--------------YS--SDDYF---GFMDEAEGDWNE.....................................
A3XQP5_LEEBM/552-929QSQS.--------------YM--SDDFF---GSLDPEEGVIENNS.................................PA
Q2PY26_9BACT/412-780LYSS.--------------FV--TDDYL---GFMDDNEGIQ.......................................
Q26FX7_FLABB/537-909LTQS.--------------YV--TDDFF---TYMNPNEGNV.......................................
B0VJT2_CLOAI/236-566..ANS--------------GV--TDYNY---TFLAG............................................
C6BTD6_DESAD/56-402SGNEV--------------HL--SDYGY---GG...............................................
D2QE53_SPILD/328-1007GNDRN--------------IP--TDFYY---ASVDGSCYSVLGRYDFDPLASGRYG..........MFALNPVNKEEEPL
A2BK55_HYPBU/159-551PREAA--------------IP--SDYYY---SDPD.............................................
B0VHP1_CLOAI/283-636.NAGS--------------HP--TDLTY---VRLQG............................................
Q1Q1Y4_9BACT/620-970.....--------------TP--SDNWF---VLVSG............................................
C7PNY3_CHIPD/396-764PVYA.--------------YP--SDDFF---GFLDDADDINDN.....................................
Q6LFY5_PHOPR/224-617GKNHR--------------WH--TDYEY---TLVDG............................................
B3QVL4_CHLT3/688-1063LVNDV--------------SI--ADDFF---GSVDGDEIP........................................
A9B187_HERA2/552-907PWLRE--------------TA--ADNRY---VTVAG............................................
R5M3W7_9BACE/537-910ETSS.--------------YV--TDDYF---GFLDDGEGEN.......................................
B0VJY1_CLOAI/655-1014YKHGA--------------TA--SDPWY---GCIVG............................................
B8G4Y1_CHLAD/584-1054EPGSG--------------WR--TDWYY---ADLTSNWDTNGNGCLGDGIFGD................PAAQQRNGYTS
A1ZEG7_9BACT/410-775.....--------------YP--PSDVM---YTAGFNPI.........................................
B0VF22_CLOAI/223-583...AR--------------MP--TDIYF---SNLDGNWNANQNQIW...............................GET
A0LKV0_SYNFM/924-1265EIFGR--------------VP--SENRY---ADLN.............................................
A8ZTD5_DESOH/257-648..GDG--------------CG--TDLYY---ATVDG............................................
A9B8S0_HERA2/477-840LWLGE--------------TA--CEACY---GQLDGADPL........................................
C3JBB2_9PORP/421-799NIYS.--------------YT--TDDYF---GYLRDGEDHL.......................................
C9SW40_VERA1/279-917YAWNT--------------LP--TDFYY---ASLTSWVVRTRPVRFGPVTFQMPYVYTPPHDWDAIGNGVYGQFRLDGSD
C9LI59_9BACT/509-899TLYS.--------------YV--TDDYF---GMLDDGEGNS.......................................
B5ICF9_ACIB4/214-642MYDAW--------------IP--TDAFY---AQPNYNSTY........................................
Y048_ARCFU/22-377IFYEP--------------FP--TDFFY---ASPD.............................................
A3I371_9BACT/360-725PLKS.--------------YS--SDDYY---ALIDFGQGMWEE.....................................

PF11713

A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626--------------------------------------------------------------------------------

PF01650

LGMN_HUMAN/29-286--------------------------------------------------------------------------------
VPED_ARATH/46-316--------------------------------------------------------------------------------
VPEG_ARATH/59-330--------------------------------------------------------------------------------
A0CQC7_PARTE/19-285--------------------------------------------------------------------------------
A2FXM6_TRIVA/13-267--------------------------------------------------------------------------------
O24539_VICNA/53-325--------------------------------------------------------------------------------
HGLB_SCHMA/37-291--------------------------------------------------------------------------------
HGLB_SCHJA/31-285--------------------------------------------------------------------------------
VPE_VICSA/56-325--------------------------------------------------------------------------------
A0A080VK93_PSEAI/341-579--------------------------------------------------------------------------------
Q08BI0_DANRE/27-278--------------------------------------------------------------------------------
Q0MYV8_EMIHU/33-301--------------------------------------------------------------------------------
Q22P32_TETTS/20-285--------------------------------------------------------------------------------
Q22P33_TETTS/20-285--------------------------------------------------------------------------------
D0MXB3_PHYIT/25-298--------------------------------------------------------------------------------
Q2UVF3_HAECO/29-287--------------------------------------------------------------------------------
Q4K5F2_PSEF5/335-570--------------------------------------------------------------------------------
Q4RED0_TETNG/30-283--------------------------------------------------------------------------------
Q8P9N6_XANCP/124-392--------------------------------------------------------------------------------
Q6EHZ7_TRIVA/12-258--------------------------------------------------------------------------------
Q6FEB2_ACIAD/229-477--------------------------------------------------------------------------------
Q6L4R2_ORYSJ/41-319--------------------------------------------------------------------------------
Q6NYJ7_DANRE/32-288--------------------------------------------------------------------------------
Q6PRC7_IXORI/38-293--------------------------------------------------------------------------------
Q711M2_FASHE/21-278--------------------------------------------------------------------------------
VPE1_ORYSJ/62-334--------------------------------------------------------------------------------
Q852T1_TOBAC/49-320--------------------------------------------------------------------------------
Q88QE3_PSEPK/400-640--------------------------------------------------------------------------------
Q949L7_BETVU/51-321--------------------------------------------------------------------------------
Q9LLQ4_SESIN/54-326--------------------------------------------------------------------------------
Q9LWZ3_ORYSJ/41-304--------------------------------------------------------------------------------
Q9SBX2_MAIZE/45-317--------------------------------------------------------------------------------
Q9SMD0_SOLLC/39-316--------------------------------------------------------------------------------
Q9XG75_TOBAC/40-306--------------------------------------------------------------------------------

PF00656

Q7QGM9_ANOGA/35-227--------------------------------------------------------------------------------
ICENC_DROME/196-443--------------------------------------------------------------------------------
O42284_CHICK/42-279--------------------------------------------------------------------------------
CAS1A_XENLA/144-382--------------------------------------------------------------------------------
CASPC_MOUSE/176-415--------------------------------------------------------------------------------
CASP4_MOUSE/132-369--------------------------------------------------------------------------------
CASP5_HUMAN/193-430--------------------------------------------------------------------------------
CASPD_BOVIN/136-373--------------------------------------------------------------------------------
CASP1_CANFA/163-400--------------------------------------------------------------------------------
CASP1_FELCA/161-406--------------------------------------------------------------------------------
CASP1_MOUSE/162-398--------------------------------------------------------------------------------
CASP1_HUMAN/163-400--------------------------------------------------------------------------------
CASP1_PIG/163-400--------------------------------------------------------------------------------
Q9I9L7_DANRE/145-379--------------------------------------------------------------------------------
Q9DDJ2_DANRE/174-400--------------------------------------------------------------------------------
Q6NTR7_XENLA/280-494--------------------------------------------------------------------------------
CFLAR_MOUSE/257-480--------------------------------------------------------------------------------
Q6QN97_PIG/259-484--------------------------------------------------------------------------------
CFLAR_HUMAN/252-477--------------------------------------------------------------------------------
Q9NBW3_DROME/38-248--------------------------------------------------------------------------------
Q9TZP5_CAEEL/26-261--------------------------------------------------------------------------------
CASPE_MOUSE/22-256--------------------------------------------------------------------------------
CASPE_HUMAN/18-241--------------------------------------------------------------------------------
Q8I749_SUBDO/254-491--------------------------------------------------------------------------------
CASP2_RAT/200-445--------------------------------------------------------------------------------
CASP2_CHICK/171-416--------------------------------------------------------------------------------
Q9GV89_HYDVU/93-318--------------------------------------------------------------------------------
Q9IB63_XENLA/144-396--------------------------------------------------------------------------------
CASP9_HUMAN/161-413--------------------------------------------------------------------------------
Q90WU0_CHICK/148-400--------------------------------------------------------------------------------
Q9IB64_XENLA/261-494--------------------------------------------------------------------------------
Q6E5N8_ICTPU/119-362--------------------------------------------------------------------------------
Q9I8J3_DANRE/238-473--------------------------------------------------------------------------------
Q6PAD9_XENLA/268-495--------------------------------------------------------------------------------
Q90WU1_CHICK/237-479--------------------------------------------------------------------------------
CASP8_HUMAN/234-476--------------------------------------------------------------------------------
CASP8_MOUSE/236-478--------------------------------------------------------------------------------
Q9Y1U6_PRIPA/173-413--------------------------------------------------------------------------------
CED3_CAEEL/243-494--------------------------------------------------------------------------------
Q7QKT2_ANOGA/35-260--------------------------------------------------------------------------------
Q7PZJ9_ANOGA/20-250--------------------------------------------------------------------------------
Q9GV88_HYDVU/84-316--------------------------------------------------------------------------------
Q7Q1E0_ANOGA/62-291--------------------------------------------------------------------------------
CASP1_SPOFR/61-293--------------------------------------------------------------------------------
CASP1_DROME/79-313--------------------------------------------------------------------------------
Q7Q4X6_ANOGA/73-309--------------------------------------------------------------------------------
DRICE_DROME/94-328--------------------------------------------------------------------------------
Q9NHF9_DROME/56-302--------------------------------------------------------------------------------
Q7Q803_ANOGA/54-306--------------------------------------------------------------------------------
Q7PV92_ANOGA/14-237--------------------------------------------------------------------------------
Q86FL0_ANOST/52-286--------------------------------------------------------------------------------
Q8I6Y2_GEOCY/158-414--------------------------------------------------------------------------------
Q8ITP3_BRAFL/87-323--------------------------------------------------------------------------------
O88550_RAT/68-301--------------------------------------------------------------------------------
Q6DCI2_XENLA/78-314--------------------------------------------------------------------------------
Q8JIS8_ORYLA/58-285--------------------------------------------------------------------------------
CASP3_XENLA/56-280--------------------------------------------------------------------------------
O93417_CHICK/53-281--------------------------------------------------------------------------------
Q98UI8_DANRE/48-280--------------------------------------------------------------------------------
Q8JG42_TAKRU/51-279--------------------------------------------------------------------------------
Q8ITP2_BRAFL/151-396--------------------------------------------------------------------------------
Q9IB66_XENLA/58-298--------------------------------------------------------------------------------
Q9I8S9_ONCMY/57-297--------------------------------------------------------------------------------
O93415_CHICK/57-299--------------------------------------------------------------------------------
CASP6_MOUSE/28-270--------------------------------------------------------------------------------
PCP_DICDI/188-404--------------------------------------------------------------------------------
Q7AKE1_STRCO/9-268--------------------------------------------------------------------------------
A0A063TRB6_BORBO/552-800--------------------------------------------------------------------------------
Q7NPG1_GLOVI/7-278--------------------------------------------------------------------------------
Q87Z21_PSESM/2-224--------------------------------------------------------------------------------
Q82I86_STRAW/5-276--------------------------------------------------------------------------------
P74453_SYNY3/40-299--------------------------------------------------------------------------------
Q8YS65_NOSS1/4-245--------------------------------------------------------------------------------
Q9DDL2_DANRE/323-560--------------------------------------------------------------------------------
Q98CE0_RHILO/5-237--------------------------------------------------------------------------------
Q6N0T4_RHOPA/30-250--------------------------------------------------------------------------------
Q89XG2_BRADU/27-247--------------------------------------------------------------------------------
Q89XE4_BRADU/58-278--------------------------------------------------------------------------------
Q6NBN5_RHOPA/57-277--------------------------------------------------------------------------------
Q98JS7_RHILO/35-253--------------------------------------------------------------------------------
Q985X8_RHILO/35-256--------------------------------------------------------------------------------
Q6N5Q1_RHOPA/33-253--------------------------------------------------------------------------------
Q89KP2_BRADU/86-307--------------------------------------------------------------------------------
Q89IK1_BRADU/30-253--------------------------------------------------------------------------------
Q98G71_RHILO/26-252--------------------------------------------------------------------------------
Q6AKF4_DESPS/28-248--------------------------------------------------------------------------------
Q98IJ6_RHILO/11-238--------------------------------------------------------------------------------
Q89MV1_BRADU/176-400--------------------------------------------------------------------------------
Q89HT8_BRADU/51-272--------------------------------------------------------------------------------
Q89FZ4_BRADU/32-256--------------------------------------------------------------------------------
Q6N329_RHOPA/73-298--------------------------------------------------------------------------------
Q98IJ9_RHILO/30-261--------------------------------------------------------------------------------
Q89HP3_BRADU/336-569--------------------------------------------------------------------------------
Q7RFI8_PLAYO/964-1364--------------------------------------------------------------------------------
Q74F93_GEOSL/6-270--------------------------------------------------------------------------------
MCA9_ARATH/10-321--------------------------------------------------------------------------------
MCA8_ARATH/3-378--------------------------------------------------------------------------------
MCA7_ARATH/3-401--------------------------------------------------------------------------------
Q70VV0_PICAB/3-415--------------------------------------------------------------------------------
Q9ZSP8_HEVBR/3-415--------------------------------------------------------------------------------
MCA4_ARATH/3-416--------------------------------------------------------------------------------
MCA5_ARATH/3-408--------------------------------------------------------------------------------
MCA6_ARATH/3-366--------------------------------------------------------------------------------
MCA1_ARATH/80-362--------------------------------------------------------------------------------
MCA2_ARATH/116-414--------------------------------------------------------------------------------
MCA1_SCHPO/130-422--------------------------------------------------------------------------------
MCA1_YARLI/168-458--------------------------------------------------------------------------------
MCA1_DEBHA/146-437--------------------------------------------------------------------------------
MCA1_ASHGO/154-449--------------------------------------------------------------------------------
MCA1_KLULA/138-430--------------------------------------------------------------------------------
MCA1_CANGA/98-389--------------------------------------------------------------------------------
B5VS82_YEAS6/157-450--------------------------------------------------------------------------------
Q386I9_TRYB2/84-341--------------------------------------------------------------------------------
Q38D34_TRYB2/63-322--------------------------------------------------------------------------------
Q8T8E6_9TRYP/84-343--------------------------------------------------------------------------------

PF14538

W1QFK7_OGAPD/56-210--------------------------------------------------------------------------------
L8WVZ0_THACA/73-224--------------------------------------------------------------------------------
A2EZ34_TRIVA/89-236--------------------------------------------------------------------------------
Q6C6R4_YARLI/86-238--------------------------------------------------------------------------------
M2WI96_DOTSN/172-328--------------------------------------------------------------------------------
K2S4T3_MACPH/104-258--------------------------------------------------------------------------------
C4LXC3_ENTHI/42-194--------------------------------------------------------------------------------
T1G0Q6_HELRO/62-216--------------------------------------------------------------------------------
B0CNS4_LACBS/34-185--------------------------------------------------------------------------------
F0ZAV4_DICPU/115-266--------------------------------------------------------------------------------
U9UGJ5_RHIID/52-203--------------------------------------------------------------------------------
Q5KIS3_CRYNJ/92-243--------------------------------------------------------------------------------
B0WBU4_CULQU/30-181--------------------------------------------------------------------------------
A5DWK2_LODEL/143-295--------------------------------------------------------------------------------
G0VGR8_NAUCC/79-231--------------------------------------------------------------------------------
I3J5N7_ORENI/57-208--------------------------------------------------------------------------------
A2DYM2_TRIVA/68-215--------------------------------------------------------------------------------
D8TLK8_VOLCA/11-162--------------------------------------------------------------------------------
G4M000_SCHMA/43-194--------------------------------------------------------------------------------
C1MUE6_MICPC/45-196--------------------------------------------------------------------------------
Q387I9_TRYB2/89-240--------------------------------------------------------------------------------
C4M2F5_ENTHI/38-189--------------------------------------------------------------------------------
G4TT65_PIRID/72-223--------------------------------------------------------------------------------
G0NWW0_CAEBE/64-218--------------------------------------------------------------------------------
A2DJF0_TRIVA/83-228--------------------------------------------------------------------------------
K3WJU9_PYTUL/84-235--------------------------------------------------------------------------------
A2G590_TRIVA/30-180--------------------------------------------------------------------------------
B8M6V6_TALSN/189-342--------------------------------------------------------------------------------
A2FJN8_TRIVA/41-191--------------------------------------------------------------------------------
A2DLR3_TRIVA/97-242--------------------------------------------------------------------------------
E5SIN8_TRISP/44-195--------------------------------------------------------------------------------
I1G727_AMPQE/53-204--------------------------------------------------------------------------------
U1MN31_ASCSU/95-246--------------------------------------------------------------------------------
I1L744_SOYBN/123-274--------------------------------------------------------------------------------
E4XFS5_OIKDI/48-228--------------------------------------------------------------------------------
D2VMD1_NAEGR/144-294--------------------------------------------------------------------------------
A9TBL2_PHYPA/91-242--------------------------------------------------------------------------------
B7PLB3_IXOSC/92-247--------------------------------------------------------------------------------
A0A0D2USM0_CAPO3/727-878--------------------------------------------------------------------------------
B8CBK6_THAPS/256-409--------------------------------------------------------------------------------
A4I1A2_LEIIN/114-279--------------------------------------------------------------------------------
F4RLY3_MELLP/215-367--------------------------------------------------------------------------------
K4DUJ2_TRYCR/62-218--------------------------------------------------------------------------------
H1VVG4_COLHI/158-309--------------------------------------------------------------------------------
M7XEP3_RHOT1/113-265--------------------------------------------------------------------------------
A2GCD5_TRIVA/98-247--------------------------------------------------------------------------------
D8RG53_SELML/72-223--------------------------------------------------------------------------------
A2F9H3_TRIVA/31-181--------------------------------------------------------------------------------
L0PHF8_PNEJ8/131-282--------------------------------------------------------------------------------
RTOR2_ARATH/94-246--------------------------------------------------------------------------------
M5E8T5_MALS4/58-209--------------------------------------------------------------------------------
B3RPQ9_TRIAD/43-194--------------------------------------------------------------------------------
I4Y9Q8_WALSC/76-227--------------------------------------------------------------------------------
A2E4G0_TRIVA/101-242--------------------------------------------------------------------------------
A0A068XPC4_HYMMI/269-417--------------------------------------------------------------------------------
U4LGP0_PYROM/223-374--------------------------------------------------------------------------------
A2F8U1_TRIVA/65-210--------------------------------------------------------------------------------
D8T9J0_SELML/50-197--------------------------------------------------------------------------------
A9V5A2_MONBE/628-777--------------------------------------------------------------------------------
F0XXV0_AURAN/12-164--------------------------------------------------------------------------------
A2E336_TRIVA/54-202--------------------------------------------------------------------------------
B4R5C8_DROSI/214-365--------------------------------------------------------------------------------
J4H2X1_FIBRA/92-243--------------------------------------------------------------------------------
A2EU18_TRIVA/81-227--------------------------------------------------------------------------------
A2DYB3_TRIVA/12-162--------------------------------------------------------------------------------
S2KE38_MUCC1/106-257--------------------------------------------------------------------------------
G7E3R0_MIXOS/173-325--------------------------------------------------------------------------------

PF03415

Q8A866_BACTN/37-399--------------------------------------------------------------------------------
Q9WZB1_THEMA/121-462--------------------------------------------------------------------------------
Q8XM44_CLOPE/59-508--------------------------------------------------------------------------------
Q9X1S5_THEMA/586-937--------------------------------------------------------------------------------
Q9WYY6_THEMA/5-301--------------------------------------------------------------------------------
Q8TIY6_METAC/66-593--------------------------------------------------------------------------------

PF12770

A0LJ53_SYNFM/581-921---VFANP----SYP......TAPIPHGMTVPLSKRTDAG........................................
A0LQE8_SYNFM/635-947---GVADK----VSD......HF.........................................................
A1BCK0_CHLPD/513-826---LVANP----C...................................................................
A1BEL3_CHLPD/43-361---FSSLP----DDLDE..TDQ..........................................................
A1BEL6_CHLPD/46-364---FSSLP----DNLGE..KNQ..........................................................
A4HBL7_LEIBR/1053-1432---VQGDA----DHD......AA.........................................................
A8L4T6_FRASN/741-1051---AVADP----ASS......GA.........................................................
A9WBC0_CHLAA/673-929---VIGAS----AD..................................................................
A9WER9_CHLAA/54-394---IFSEP----TDL......DR.........................................................
A9WF91_CHLAA/60-360---AIANP----HGI.................................................................
B0C874_ACAM1/207-507---GMGIT----QEV.....EGQ.........................................................
B2IXC0_NOSP7/1396-1691---AMGVS----QST.....QGQ.........................................................
B2IZZ4_NOSP7/695-973---VVGVS----NGNK....QF..........................................................
B2JAK0_NOSP7/526-830---LIGNP----LFS......NPYTV......................................................
B2JAM9_NOSP7/866-1190---VLADP----VFS......KDDDRLKPDVTQSVQNRG.........................................
B4JKU3_DROGR/1402-1700---VVGGP----RVP.......A.........................................................
C3Z401_BRAFL/1278-1602---VLGNP----KLP.......P.........................................................
F0SR63_RUBBR/137-574---AVGDP----KFR......VDDASPPESVAGVRVNKVVEGSVAESAGVKPGDVIVAIDGRRLESPEELLSAVQSIAGK
Q01RE6_SOLUE/865-1136---VVSAP----AAG......AR.........................................................
Q024J7_SOLUE/541-814---LLGDP----ITN......DP.........................................................
Q025F1_SOLUE/607-877---AMGNP----GA..................................................................
Q028B5_SOLUE/667-935---MAVDA----....................................................................
Q02DA1_SOLUE/510-786---VVADP----TLG......RE.........................................................
Q10YT7_TRIEI/1003-1309---LLGYP----TYS......EKDQVTI....................................................
Q10YU6_TRIEI/544-838---TTGTD----KEAPSYRQRGY.........................................................
Q112V9_TRIEI/62-390---VVSKP----TAD.................................................................
Q113D1_TRIEI/130-430---VTEKK----CCG......KI.........................................................
Q113U8_TRIEI/3002-3297---AMGAS----EFI......AK.........................................................
Q115J8_TRIEI/1466-1777---AIQTP----T...................................................................
Q117G6_TRIEI/881-1206---LLGDP----NYE......KKDKIAT....................................................
Q119J2_TRIEI/1474-1770---AMGAS----KFSP...NTNE.........................................................
Q16H64_AEDAE/1315-1614---VVGGP----KIP.......S.........................................................
Q2G6U6_NOVAD/692-1020---GLGHN----AKP......AARPVT.....................................................
Q2S6G2_SALRD/540-844---AFGVS----SFD......SLRPPPPSL..................................................
Q2W535_MAGSA/875-1218---INAGP----DYN......TEEVTGKATLEKARS............................................
Q38C46_TRYB2/1044-1397---VQKQA----DAT......EQ.........................................................
Q3AQG5_CHLCH/44-362---FSSLP----DDLTE..KEQ..........................................................
Q5LLA3_RUEPO/680-970---ATSEP----RDQ......RR.........................................................
Q7NCT1_GLOVI/600-923---VLGGP----DFA......RAAAGLSPATQQRAGP...........................................
Q7NF67_GLOVI/550-854---LIANP----DFD......RADAVVDRLA.................................................
Q7NFD7_GLOVI/666-979---VVAGP----DYG......RSPAALQAP..................................................
Q7NIF7_GLOVI/691-997---LVAAP----DFD......NAGPPAVNAA.................................................
Q7NJE3_GLOVI/660-988---VLGGP----DFA......RAAAGPPLASRPAAERRAT........................................
Q7NLR0_GLOVI/653-961---IVANP----NFD......NAEVARTRSAGE...............................................
Q7NVB0_CHRVO/67-386---VLASP----....................................................................
Q82I85_STRAW/1175-1481---VVGNP----T...................................................................
Q82L10_STRAW/969-1256---AVAMP----QTA......GQ.........................................................
Q8DGG5_THEEB/541-835---IIADP----SFD......RSST.......................................................
Q8DH74_THEEB/570-891---VVGNP----TFS......QGSGRALAGS.................................................
Q8DHI1_THEEB/67-394---PIRQH----SNL.......D.........................................................
Q8DIE5_THEEB/1127-1420---AMGAS----EFL......DQ.........................................................
Q8YZU5_NOSS1/56-340---VLALS----QES.................................................................
TTC28_HUMAN/1390-1713---VIGNP----KLP.......S.........................................................

PF03568

G7E6G1_MIXOS/1513-1914---LLPPR..LHIDA-----------------------------------------------------------------
A8PX94_MALGO/1441-1824---LAPWP.....SP-----------------------------------------------------------------
M7XLD2_RHOT1/1703-2100---FYDAR...LHSG-----------------------------------------------------------------
U5HB45_USTV1/1850-2253---FSDTQ...DIGA-----------------------------------------------------------------
F4RLY9_MELLP/91-479---LRCSN.....SI-----------------------------------------------------------------
T1IUX7_STRMM/1624-1980---LLGRP....ISR-----------------------------------------------------------------
A7RYA6_NEMVE/1651-2034---ILGRH....SMP-----------------------------------------------------------------
T1FT05_HELRO/413-770---LMGRL....VDA-----------------------------------------------------------------
W4Y9R2_STRPU/1031-1383---LQGSY....TDQ-----------------------------------------------------------------
G3N6G2_GASAC/1731-2077---LLPPS....LDP-----------------------------------------------------------------
H3DAQ7_TETNG/1711-2057---LLPLS....SDA-----------------------------------------------------------------
I3KSG7_ORENI/1715-2061---LLPLS....LDA-----------------------------------------------------------------
H2L8K9_ORYLA/1692-2038---LLPLT....KDP-----------------------------------------------------------------
M3ZIW2_XIPMA/1768-2114---FLPLA....QDP-----------------------------------------------------------------
ESPL1_MOUSE/1716-2065---LLPCS....ADP-----------------------------------------------------------------
F7BUI1_CALJA/1724-2073---LLPSS....EEP-----------------------------------------------------------------
G3VPI8_SARHA/1713-2063---LVPFT....GNP-----------------------------------------------------------------
U3IXX7_ANAPL/1332-1679---LLPAS....QEP-----------------------------------------------------------------
G1KFP0_ANOCA/1819-2167---LLPTC....EDP-----------------------------------------------------------------
H3B3H1_LATCH/1699-2055---LLPSS....KDP-----------------------------------------------------------------
F6VXN8_XENTR/1732-2080---LSCPC....SSD-----------------------------------------------------------------
Q6ZHH8_ORYSJ/455-870---LLGYD....LTD-----------------------------------------------------------------
W5GJD2_WHEAT/891-1304---LLGHQ....SAD-----------------------------------------------------------------
K3Z105_SETIT/1078-1484---LLGHQ....LSD-----------------------------------------------------------------
C5XYE8_SORBI/457-870---LLGHR....LSD-----------------------------------------------------------------
C5XSY3_SORBI/1425-1832---LLGHR....LSD-----------------------------------------------------------------
K3Y3B2_SETIT/1404-1817---LLGHQ....PSN-----------------------------------------------------------------
M0UBW7_MUSAM/65-479---LLGER....SVP-----------------------------------------------------------------
ESP1_ARATH/1641-2060---LLGEW....SNY-----------------------------------------------------------------
M4DS49_BRARP/1599-2019---LLGDL....SNF-----------------------------------------------------------------
B9GZR1_POPTR/1674-2094---LLGDW....FNY-----------------------------------------------------------------
B9SSN4_RICCO/1627-2045---LLGEL....SDS-----------------------------------------------------------------
I1MDQ8_SOYBN/1648-2063---LLGEW....LNC-----------------------------------------------------------------
K4B224_SOLLC/1600-2023---LLGEL....SEC-----------------------------------------------------------------
W1NKX2_AMBTC/1-423---LLGEL....FDD-----------------------------------------------------------------
K7H1P7_CAEJA/245-604---LRPSD....RLG-----------------------------------------------------------------
E3LM18_CAERE/731-1090---LMPSG....RLG-----------------------------------------------------------------
G5ED39_CAEEL/727-1081---LMPSG....QLG-----------------------------------------------------------------
Q23491_CAEEL/749-1101---LLPSG....RLG-----------------------------------------------------------------
S3CR95_OPHP1/1758-2208---FSQHV....RRP-----------------------------------------------------------------
F0XAD9_GROCL/1636-2054---FSQHT....RRA-----------------------------------------------------------------
G2R9B0_THITE/1619-2058---FSQHV....RRP-----------------------------------------------------------------
Q2H6Q9_CHAGB/1612-2026---FSQHV....RRP-----------------------------------------------------------------
G0SHM3_CHATD/1723-2150---FSQHG....RRP-----------------------------------------------------------------
G4UQF5_NEUT9/1626-2085---FSQHQTQGGKRK-----------------------------------------------------------------
G4N8I2_MAGO7/1627-2057---FSQQK....RCS-----------------------------------------------------------------
J3P7L5_GAGT3/1606-2054---FSQQR....RSP-----------------------------------------------------------------
R8BFS3_TOGMI/72-487---FSQHQ....RRS-----------------------------------------------------------------
N4UZ87_COLOR/1637-2043---FSQHR....HRP-----------------------------------------------------------------
G2X6M8_VERDV/1704-2113---FSQHP....RRD-----------------------------------------------------------------
G0RRT6_HYPJQ/1566-1971---FSQHR....RLG-----------------------------------------------------------------
M1WFQ9_CLAP2/1438-1889---FSQHQ....RRP-----------------------------------------------------------------
J5K578_BEAB2/1584-1996---FSQHR....RRS-----------------------------------------------------------------
C7YYU1_NECH7/1580-1992---FSQHE....RRP-----------------------------------------------------------------
M7T4Q8_EUTLA/44-499---FTQHH....KRS-----------------------------------------------------------------
L8G205_PSED2/1652-2056---FSQHT....IQP-----------------------------------------------------------------
N1JFH1_BLUG1/1598-2001---FSQHV....RRP-----------------------------------------------------------------
K1X2E6_MARBU/1659-2061---FSQHT....RRP-----------------------------------------------------------------
S3D029_GLAL2/1639-2043---FSQQS....RHP-----------------------------------------------------------------
M7TX51_BOTF1/1640-2041---FSQFT....RKS-----------------------------------------------------------------
BIMB_EMENI/1609-2004---FSPIP....LCE-----------------------------------------------------------------
Q2USV7_ASPOR/1630-2030---FSPVP....HDT-----------------------------------------------------------------
G7XGU8_ASPKW/1627-2026---FSPVP....HET-----------------------------------------------------------------
S8BGE7_PENO1/1622-2018---FSPLA....KHS-----------------------------------------------------------------
B6GZP8_PENCW/1602-1998---FSPLS....RET-----------------------------------------------------------------
Q4WUU6_ASPFU/1638-2039---FSPMA....HEG-----------------------------------------------------------------
B6QNB5_PENMQ/1619-2016---FDTFP....RNS-----------------------------------------------------------------
V5GCB2_BYSSN/1684-2084---FSPAS....RNV-----------------------------------------------------------------
F0UL09_AJEC8/1642-2044---FSQSP....RNI-----------------------------------------------------------------
C5FSW7_ARTOC/1655-2058---FSQIP....RND-----------------------------------------------------------------
H6C6Q4_EXODN/1587-1987---LSAPE....IDD-----------------------------------------------------------------
U1G8A9_ENDPU/1638-2036---FSDQY....HDE-----------------------------------------------------------------
K2R7J5_MACPH/1619-2043---FKKKG.....DR-----------------------------------------------------------------
R7YNT5_CONA1/1696-2117---FSQHT....RRQ-----------------------------------------------------------------
E4ZTB4_LEPMJ/1652-2063---FSQHE....RQT-----------------------------------------------------------------
N1QAI8_PSEFD/1492-1912---FSQHE....HDS-----------------------------------------------------------------
N1QHR1_SPHMS/1187-1599---FSQHD....RND-----------------------------------------------------------------
N1PZ16_DOTSN/1513-1936---LSQHG....QNL-----------------------------------------------------------------
D5GKQ4_TUBMM/1633-2033---FCQYA....LHK-----------------------------------------------------------------
U4LG69_PYROM/1616-2019---FSQYP....KNP-----------------------------------------------------------------
S8C8B1_DACHA/1639-2040---FGGYK....RHP-----------------------------------------------------------------
Q6CCJ0_YARLI/1210-1588---LGETV......G-----------------------------------------------------------------
S9X830_SCHCR/1385-1771---FSNHI....LDA-----------------------------------------------------------------
CUT1_SCHPO/1383-1770---FNPHK....IDT-----------------------------------------------------------------
B6K0I6_SCHJY/1359-1747---FSSKR....PHK-----------------------------------------------------------------
M7PDE3_PNEMU/1489-1882---FFQSN....INQ-----------------------------------------------------------------
G8BT64_TETPH/1165-1563---FDPC....PVNK-----------------------------------------------------------------
I2H0Y5_TETBL/1280-1677---FDDT....IIDE-----------------------------------------------------------------
S6EFD3_ZYGB2/1145-1542---FSPI....TTKP-----------------------------------------------------------------
C5DU01_ZYGRC/1141-1538---FCPE....VINT-----------------------------------------------------------------
G8ZWZ1_TORDC/1158-1555---FGPE....IIEA-----------------------------------------------------------------
G0WDN6_NAUDC/1191-1589---FDTT....KINE-----------------------------------------------------------------
G0VFB3_NAUCC/1164-1562---FDQS....VVDP-----------------------------------------------------------------
H2B1L5_KAZAF/1161-1559---FSHD....LIDE-----------------------------------------------------------------
ESP1_YEAST/1175-1571---FSPE....VVDN-----------------------------------------------------------------
J7RG90_KAZNA/1160-1562---FSPH....LIDQ-----------------------------------------------------------------
Q75EJ0_ASHGO/1152-1552---FSQK....QLDK-----------------------------------------------------------------
C5DHM1_LACTC/1178-1575---FAQE....IIEQ-----------------------------------------------------------------
Q6CQQ7_KLULA/1118-1516---FNPR....IVDQ-----------------------------------------------------------------
Q6FTE1_CANGA/1151-1548---LNGL....YCDK-----------------------------------------------------------------
K0K8V1_WICCF/1175-1568---FDCT....KIDK-----------------------------------------------------------------
A5DNR9_PICGU/1178-1576---FGA.....AIDV-----------------------------------------------------------------
A3GFF5_PICST/1168-1555---FFN.....YDED-----------------------------------------------------------------
Q6BTB7_DEBHA/1338-1753---FDDP....FVHK-----------------------------------------------------------------
Q5A8X8_CANAL/1101-1536---FTNDNDVENESK-----------------------------------------------------------------
C5MEH0_CANTT/925-1303---FEN.....YQQD-----------------------------------------------------------------
M3HH45_CANMX/1423-1797---FNC.....EEDP-----------------------------------------------------------------
G8B5X7_CANPC/1052-1424---FEP.......VG-----------------------------------------------------------------
A5DVQ7_LODEL/1109-1530---FASN....NLNS-----------------------------------------------------------------
G3AGZ6_SPAPN/1149-1535---FSN.....FQTG-----------------------------------------------------------------
G8YBL5_PICSO/1309-1719---FSTR....RLPQ-----------------------------------------------------------------
C4XY11_CLAL4/1177-1564---FFFT....DRQS-----------------------------------------------------------------
G3B782_CANTC/1213-1609---FGNH....DEES-----------------------------------------------------------------
W1QIM9_OGAPD/1167-1527---FGRLV....FEN-----------------------------------------------------------------
C4QYS2_PICPG/1259-1619---FSPKN....FEP-----------------------------------------------------------------
K5WME3_PHACS/1732-2136---LNDST...DIPG-----------------------------------------------------------------
M2R2K9_CERS8/1618-2024---LGPPR...AIPT-----------------------------------------------------------------
F8PLA9_SERL3/1278-1688---LSEPT...KIPR-----------------------------------------------------------------
S8E105_FOMPI/1678-2083---LSAPV...QTRP-----------------------------------------------------------------
J4GX56_FIBRA/504-917---LSAPH...EYAS-----------------------------------------------------------------
A8NBE9_COPC7/1839-2276---LGPRP...DLTP-----------------------------------------------------------------
B0E1W0_LACBS/104-540---LSPRS...EATP-----------------------------------------------------------------
D8Q1W5_SCHCM/1450-1878---LGSRL...NLTP-----------------------------------------------------------------
V2X3W8_MONRO/1588-2040---LSKNT...YLSQ-----------------------------------------------------------------
J0DCK6_AURDE/1634-2046---LNDPL...ALAA-----------------------------------------------------------------
Q5KMS4_CRYNJ/188-600---LSPRN...RFSK-----------------------------------------------------------------
R9AIE1_WALI9/1639-2036---FIKPT...ATSE-----------------------------------------------------------------
I4YB88_WALSC/1631-2030---FLKPT...AKSE-----------------------------------------------------------------
G4T5A4_PIRID/1472-1874---FSKRL...NMTR-----------------------------------------------------------------

PF01364

KGP83_PORGN/244-595...GDYFPE..MYTF-----------------------------------------------------------------
D1JG83_9ARCH/891-1295...DDDFLE..VATG-----------------------------------------------------------------
A2U064_9FLAO/401-768..STSHTVD..VASS-----------------------------------------------------------------
Q7MTE2_PORGI/239-573...NDHYNE..VFIG-----------------------------------------------------------------
D3HWT0_9BACT/400-777.LEEADRLD..IGVG-----------------------------------------------------------------
Q5S3Q9_9FLAO/543-910..TGTEGCD..IAVG-----------------------------------------------------------------
A9DMD5_9FLAO/555-923..TISDRLD..IALG-----------------------------------------------------------------
B0VGA8_CLOAI/228-563...NDYLGD..AFIG-----------------------------------------------------------------
B7B5I7_9PORP/382-753.SLQNKKLC..LGIG-----------------------------------------------------------------
B8FFM0_DESAA/254-600...GDILPE..LLVG-----------------------------------------------------------------
A3U7G6_CROAH/540-908..QNFDKLD..IAIG-----------------------------------------------------------------
D2QSX9_SPILD/414-786NQNGDYSLD..VGIG-----------------------------------------------------------------
A3HW99_9BACT/398-769...QPLVPA..MAVG-----------------------------------------------------------------
B0VHP2_CLOAI/234-563...NDNYYD..IFVG-----------------------------------------------------------------
A8ZUB1_DESOH/278-656GGDVDLMAE..IFVG-----------------------------------------------------------------
B0VIM2_CLOAI/182-528...DDYFPE..MIAG-----------------------------------------------------------------
Q2Z0E1_9BACT/643-1013...NRYEPG..MALG-----------------------------------------------------------------
B3QXR8_CHLT3/734-1131..QLDLLPD..MQIS-----------------------------------------------------------------
C2MCN4_9PORP/405-781.GVGAQPLS..VGIG-----------------------------------------------------------------
A4A325_9PLAN/24-399...DDLLPD..VAIG-----------------------------------------------------------------
A7NR84_ROSCS/499-867...DDRLPD..VWLG-----------------------------------------------------------------
Q11Q36_CYTH3/558-932TPLDDNTLN..IGVG-----------------------------------------------------------------
Q7MX16_PORGI/272-637...LDTVGD..LFIG-----------------------------------------------------------------
A0B5K7_METTP/796-1154...DDNYTE..VATG-----------------------------------------------------------------
D0MH89_RHOM4/586-975GAYSTERLD..LGIG-----------------------------------------------------------------
A8UH97_9FLAO/539-910..NNSDRMD..IAVG-----------------------------------------------------------------
B8KYL6_9GAMM/364-704...DDYLPD..LAVG-----------------------------------------------------------------
B8FIK5_DESAA/1139-1542DDDLDFAPD..VFVG-----------------------------------------------------------------
Q11US7_CYTH3/392-767...NKYAAQ..IHTG-----------------------------------------------------------------
C6W101_DYAFD/326-680....SRMPL..VPIG-----------------------------------------------------------------
A5FJM8_FLAJ1/544-914.AFPFGGID..IAVG-----------------------------------------------------------------
Q7UG73_RHOBA/51-444...GDRVSD..AAIG-----------------------------------------------------------------
A3J247_9FLAO/540-919.LGSFDGID..IAVG-----------------------------------------------------------------
A9WIM0_CHLAA/500-869..ETLFQAD..LWIG-----------------------------------------------------------------
B0VHE7_CLOAI/227-554...NDNLGD..VMIG-----------------------------------------------------------------
C6VT06_DYAFD/394-758...PVNAPA..IPVG-----------------------------------------------------------------
C6X3N8_FLAB3/546-921.SVASTLPD..FPVG-----------------------------------------------------------------
A0LQH1_SYNFM/790-1132...EDGLAD..VALG-----------------------------------------------------------------
A1ZVJ9_9BACT/406-774TSLGDHTLE..IGIG-----------------------------------------------------------------
B0VHF1_CLOAI/214-595MYEADLTPE..LAIG-----------------------------------------------------------------
B0VIE7_CLOAI/193-598DYGIDFTPE..VFVG-----------------------------------------------------------------
C6W3P4_DYAFD/414-806...PRDVPA..IPVG-----------------------------------------------------------------
B2RGP6_PORG3/408-787.NIGWRNYN..MAVG-----------------------------------------------------------------
D2QJ99_SPILD/409-770...PDGVPA..IPTG-----------------------------------------------------------------
A9B5Q8_HERA2/466-850...DDPMPD..LQIG-----------------------------------------------------------------
D2QFF3_SPILD/397-745...PPNTPA..IPTG-----------------------------------------------------------------
B0VH03_CLOAI/589-939...TSYYPE..LAIG-----------------------------------------------------------------
D2R2P5_PIRSD/21-411...DDSIPD..LAIG-----------------------------------------------------------------
C6W0Z3_DYAFD/393-758HATGDHTVD..IGVG-----------------------------------------------------------------
A3XQP5_LEEBM/552-929GSGGSDRLD..IAVG-----------------------------------------------------------------
Q2PY26_9BACT/412-780..LTRKTLD..LCIG-----------------------------------------------------------------
Q26FX7_FLABB/537-909..ATNNLMD..LAVG-----------------------------------------------------------------
B0VJT2_CLOAI/236-566...NDQLGD..CFIG-----------------------------------------------------------------
C6BTD6_DESAD/56-402...SDSAPENMLPVG-----------------------------------------------------------------
D2QE53_SPILD/328-1007LNSYKTTQD..IWVG-----------------------------------------------------------------
A2BK55_HYPBU/159-551...YDNYLE..LAVG-----------------------------------------------------------------
B0VHP1_CLOAI/283-636...TDYMPE..MYFG-----------------------------------------------------------------
Q1Q1Y4_9BACT/620-970...NDILPD..MHIG-----------------------------------------------------------------
C7PNY3_CHIPD/396-764GRV..NLLD..VAIG-----------------------------------------------------------------
Q6LFY5_PHOPR/224-617...DDKYSD..VVIG-----------------------------------------------------------------
B3QVL4_CHLT3/688-1063...DDMVPD..IAVG-----------------------------------------------------------------
A9B187_HERA2/552-907...NDTLPD..LFLG-----------------------------------------------------------------
R5M3W7_9BACE/537-910.LSD.AMLD..IGIG-----------------------------------------------------------------
B0VJY1_CLOAI/655-1014...TDIVPD..ISIA-----------------------------------------------------------------
B8G4Y1_CHLAD/584-1054DSRNVFNLT..VAVG-----------------------------------------------------------------
A1ZEG7_9BACT/410-775...SPQTPM..IPTG-----------------------------------------------------------------
B0VF22_CLOAI/223-583NDNTDLIPE..VHIG-----------------------------------------------------------------
A0LKV0_SYNFM/924-1265...DDGVPD..LAIG-----------------------------------------------------------------
A8ZTD5_DESOH/257-648...DDYFPD..LSLG-----------------------------------------------------------------
A9B8S0_HERA2/477-840...SDLLPD..LPVG-----------------------------------------------------------------
C3JBB2_9PORP/421-799.TNGRKQLS..IGIG-----------------------------------------------------------------
C9SW40_VERA1/279-917IDGVNLQTE..LSVG-----------------------------------------------------------------
C9LI59_9BACT/509-899.MAQTDKLD..LGIG-----------------------------------------------------------------
B5ICF9_ACIB4/214-642...FSYEPQ..FFIG-----------------------------------------------------------------
Y048_ARCFU/22-377...YDLKPD..FAVG-----------------------------------------------------------------
A3I371_9BACT/360-725TLAGDESLQ..IGIG-----------------------------------------------------------------

PF11713

A0KHZ7_AERHH/3609-3767--------------------------------------------------------------------------------
Q2KX68_BORA1/2483-2627--------------------------------------------------------------------------------
Q2SAY5_HAHCH/1-160--------------------------------------------------------------------------------
Q7N1Z0_PHOLL/2456-2614--------------------------------------------------------------------------------
Q7N726_PHOLL/2997-3151--------------------------------------------------------------------------------
Q7VV06_BORPE/2551-2702--------------------------------------------------------------------------------
Q7VV06_BORPE/2959-3112--------------------------------------------------------------------------------
Q7VV06_BORPE/3397-3549--------------------------------------------------------------------------------
Q7VV06_BORPE/3808-3959--------------------------------------------------------------------------------
Q189K3_PEPD6/575-754--------------------------------------------------------------------------------
Q189K5_PEPD6/577-756--------------------------------------------------------------------------------
Q7CGR6_YERPE/772-928--------------------------------------------------------------------------------
Q9KS12_VIBCH/3469-3626--------------------------------------------------------------------------------

PF01650

LGMN_HUMAN/29-286--------------------------------------------------------------VINR--------------
VPED_ARATH/46-316--------------------------------------------------------------IINK--------------
VPEG_ARATH/59-330--------------------------------------------------------------IINS--------------
A0CQC7_PARTE/19-285--------------------------------------------------------------IYNQ--------------
A2FXM6_TRIVA/13-267--------------------------------------------------------------IFRS--------------
O24539_VICNA/53-325--------------------------------------------------------------IINH--------------
HGLB_SCHMA/37-291--------------------------------------------------------------LFND--------------
HGLB_SCHJA/31-285--------------------------------------------------------------IFND--------------
VPE_VICSA/56-325--------------------------------------------------------------IINK--------------
A0A080VK93_PSEAI/341-579--------------------------------------------------------------....--------------
Q08BI0_DANRE/27-278--------------------------------------------------------------IRSV--------------
Q0MYV8_EMIHU/33-301--------------------------------------------------------------LFNK--------------
Q22P32_TETTS/20-285--------------------------------------------------------------LFNK--------------
Q22P33_TETTS/20-285--------------------------------------------------------------LFNQ--------------
D0MXB3_PHYIT/25-298--------------------------------------------------------------LYNK--------------
Q2UVF3_HAECO/29-287--------------------------------------------------------------IFND--------------
Q4K5F2_PSEF5/335-570--------------------------------------------------------------....--------------
Q4RED0_TETNG/30-283--------------------------------------------------------------LINR--------------
Q8P9N6_XANCP/124-392--------------------------------------------------------------....--------------
Q6EHZ7_TRIVA/12-258--------------------------------------------------------------VFHT--------------
Q6FEB2_ACIAD/229-477--------------------------------------------------------------....--------------
Q6L4R2_ORYSJ/41-319--------------------------------------------------------------IFNH--------------
Q6NYJ7_DANRE/32-288--------------------------------------------------------------VINR--------------
Q6PRC7_IXORI/38-293--------------------------------------------------------------IINH--------------
Q711M2_FASHE/21-278--------------------------------------------------------------IFHD--------------
VPE1_ORYSJ/62-334--------------------------------------------------------------IINH--------------
Q852T1_TOBAC/49-320--------------------------------------------------------------IINS--------------
Q88QE3_PSEPK/400-640--------------------------------------------------------------....--------------
Q949L7_BETVU/51-321--------------------------------------------------------------LINS--------------
Q9LLQ4_SESIN/54-326--------------------------------------------------------------IINH--------------
Q9LWZ3_ORYSJ/41-304--------------------------------------------------------------IINK--------------
Q9SBX2_MAIZE/45-317--------------------------------------------------------------IINH--------------
Q9SMD0_SOLLC/39-316--------------------------------------------------------------IINN--------------
Q9XG75_TOBAC/40-306--------------------------------------------------------------IINS--------------

PF00656

Q7QGM9_ANOGA/35-227--------------------------------------------------------------INEN..............
ICENC_DROME/196-443--------------------------------------------------------------.YGN..............
O42284_CHICK/42-279--------------------------------------------------------------.HED..............
CAS1A_XENLA/144-382--------------------------------------------------------------.HTN..............
CASPC_MOUSE/176-415--------------------------------------------------------------.KEN..............
CASP4_MOUSE/132-369--------------------------------------------------------------.KEE..............
CASP5_HUMAN/193-430--------------------------------------------------------------.EKN..............
CASPD_BOVIN/136-373--------------------------------------------------------------.EEK..............
CASP1_CANFA/163-400--------------------------------------------------------------.KRK..............
CASP1_FELCA/161-406--------------------------------------------------------------.KEE..............
CASP1_MOUSE/162-398--------------------------------------------------------------.KEN..............
CASP1_HUMAN/163-400--------------------------------------------------------------.KKN..............
CASP1_PIG/163-400--------------------------------------------------------------.REN..............
Q9I9L7_DANRE/145-379--------------------------------------------------------------.RPN..............
Q9DDJ2_DANRE/174-400--------------------------------------------------------------.YRN..............
Q6NTR7_XENLA/280-494--------------------------------------------------------------.DRY..............
CFLAR_MOUSE/257-480--------------------------------------------------------------.FLF..............
Q6QN97_PIG/259-484--------------------------------------------------------------.FLY..............
CFLAR_HUMAN/252-477--------------------------------------------------------------.FLH..............
Q9NBW3_DROME/38-248--------------------------------------------------------------.ISN..............
Q9TZP5_CAEEL/26-261--------------------------------------------------------------.YDN..............
CASPE_MOUSE/22-256--------------------------------------------------------------.KRD..............
CASPE_HUMAN/18-241--------------------------------------------------------------.KRD..............
Q8I749_SUBDO/254-491--------------------------------------------------------------.VEN..............
CASP2_RAT/200-445--------------------------------------------------------------.LYD..............
CASP2_CHICK/171-416--------------------------------------------------------------.FHD..............
Q9GV89_HYDVU/93-318--------------------------------------------------------------.CNN..............
Q9IB63_XENLA/144-396--------------------------------------------------------------.KDN..............
CASP9_HUMAN/161-413--------------------------------------------------------------.KGD..............
Q90WU0_CHICK/148-400--------------------------------------------------------------.LRN..............
Q9IB64_XENLA/261-494--------------------------------------------------------------.HRD..............
Q6E5N8_ICTPU/119-362--------------------------------------------------------------.HKN..............
Q9I8J3_DANRE/238-473--------------------------------------------------------------.RND..............
Q6PAD9_XENLA/268-495--------------------------------------------------------------.VEN..............
Q90WU1_CHICK/237-479--------------------------------------------------------------.YKD..............
CASP8_HUMAN/234-476--------------------------------------------------------------.HDD..............
CASP8_MOUSE/236-478--------------------------------------------------------------.YDD..............
Q9Y1U6_PRIPA/173-413--------------------------------------------------------------.HEN..............
CED3_CAEEL/243-494--------------------------------------------------------------.KDN..............
Q7QKT2_ANOGA/35-260--------------------------------------------------------------.LSD..............
Q7PZJ9_ANOGA/20-250--------------------------------------------------------------.FCD..............
Q9GV88_HYDVU/84-316--------------------------------------------------------------.LNN..............
Q7Q1E0_ANOGA/62-291--------------------------------------------------------------.YPD..............
CASP1_SPOFR/61-293--------------------------------------------------------------.FPN..............
CASP1_DROME/79-313--------------------------------------------------------------.HKD..............
Q7Q4X6_ANOGA/73-309--------------------------------------------------------------.FKD..............
DRICE_DROME/94-328--------------------------------------------------------------.YKD..............
Q9NHF9_DROME/56-302--------------------------------------------------------------.FDD..............
Q7Q803_ANOGA/54-306--------------------------------------------------------------.YDD..............
Q7PV92_ANOGA/14-237--------------------------------------------------------------.MDD..............
Q86FL0_ANOST/52-286--------------------------------------------------------------.FNN..............
Q8I6Y2_GEOCY/158-414--------------------------------------------------------------.KDN..............
Q8ITP3_BRAFL/87-323--------------------------------------------------------------.FDN..............
O88550_RAT/68-301--------------------------------------------------------------.YND..............
Q6DCI2_XENLA/78-314--------------------------------------------------------------.YNN..............
Q8JIS8_ORYLA/58-285--------------------------------------------------------------.YND..............
CASP3_XENLA/56-280--------------------------------------------------------------.CND..............
O93417_CHICK/53-281--------------------------------------------------------------.NND..............
Q98UI8_DANRE/48-280--------------------------------------------------------------.YND..............
Q8JG42_TAKRU/51-279--------------------------------------------------------------.HND..............
Q8ITP2_BRAFL/151-396--------------------------------------------------------------.LKD..............
Q9IB66_XENLA/58-298--------------------------------------------------------------.YYN..............
Q9I8S9_ONCMY/57-297--------------------------------------------------------------.FDN..............
O93415_CHICK/57-299--------------------------------------------------------------.FDD..............
CASP6_MOUSE/28-270--------------------------------------------------------------.FND..............
PCP_DICDI/188-404--------------------------------------------------------------WLID..............
Q7AKE1_STRCO/9-268--------------------------------------------------------------TVVT..............
A0A063TRB6_BORBO/552-800--------------------------------------------------------------LLTT..............
Q7NPG1_GLOVI/7-278--------------------------------------------------------------LYDA..............
Q87Z21_PSESM/2-224--------------------------------------------------------------NEQD..............
Q82I86_STRAW/5-276--------------------------------------------------------------.LFL..............
P74453_SYNY3/40-299--------------------------------------------------------------LDPQ..............
Q8YS65_NOSS1/4-245--------------------------------------------------------------FSDD..............
Q9DDL2_DANRE/323-560--------------------------------------------------------------.LLD..............
Q98CE0_RHILO/5-237--------------------------------------------------------------.ETN..............
Q6N0T4_RHOPA/30-250--------------------------------------------------------------.GED..............
Q89XG2_BRADU/27-247--------------------------------------------------------------.GEN..............
Q89XE4_BRADU/58-278--------------------------------------------------------------.VED..............
Q6NBN5_RHOPA/57-277--------------------------------------------------------------.IED..............
Q98JS7_RHILO/35-253--------------------------------------------------------------.FYD..............
Q985X8_RHILO/35-256--------------------------------------------------------------.ARD..............
Q6N5Q1_RHOPA/33-253--------------------------------------------------------------.ARD..............
Q89KP2_BRADU/86-307--------------------------------------------------------------.ARD..............
Q89IK1_BRADU/30-253--------------------------------------------------------------.GID..............
Q98G71_RHILO/26-252--------------------------------------------------------------.GND..............
Q6AKF4_DESPS/28-248--------------------------------------------------------------.KVN..............
Q98IJ6_RHILO/11-238--------------------------------------------------------------.GFD..............
Q89MV1_BRADU/176-400--------------------------------------------------------------AQLD..............
Q89HT8_BRADU/51-272--------------------------------------------------------------.ATD..............
Q89FZ4_BRADU/32-256--------------------------------------------------------------.AAN..............
Q6N329_RHOPA/73-298--------------------------------------------------------------.ASD..............
Q98IJ9_RHILO/30-261--------------------------------------------------------------.GVD..............
Q89HP3_BRADU/336-569--------------------------------------------------------------.GVD..............
Q7RFI8_PLAYO/964-1364--------------------------------------------------------------LIDSFPSNAYIYDDFDMN
Q74F93_GEOSL/6-270--------------------------------------------------------------KA................
MCA9_ARATH/10-321--------------------------------------------------------------LTDE..............
MCA8_ARATH/3-378--------------------------------------------------------------MIDT..............
MCA7_ARATH/3-401--------------------------------------------------------------DTDE..............
Q70VV0_PICAB/3-415--------------------------------------------------------------DTDD..............
Q9ZSP8_HEVBR/3-415--------------------------------------------------------------DIDE..............
MCA4_ARATH/3-416--------------------------------------------------------------DTDE..............
MCA5_ARATH/3-408--------------------------------------------------------------DTDE..............
MCA6_ARATH/3-366--------------------------------------------------------------DTDS..............
MCA1_ARATH/80-362--------------------------------------------------------------LTEE..............
MCA2_ARATH/116-414--------------------------------------------------------------LTEE..............
MCA1_SCHPO/130-422--------------------------------------------------------------MTDT..............
MCA1_YARLI/168-458--------------------------------------------------------------LTDD..............
MCA1_DEBHA/146-437--------------------------------------------------------------LTDD..............
MCA1_ASHGO/154-449--------------------------------------------------------------LTDD..............
MCA1_KLULA/138-430--------------------------------------------------------------LNDD..............
MCA1_CANGA/98-389--------------------------------------------------------------LTDD..............
B5VS82_YEAS6/157-450--------------------------------------------------------------LTDD..............
Q386I9_TRYB2/84-341--------------------------------------------------------------DTDD..............
Q38D34_TRYB2/63-322--------------------------------------------------------------LVDD..............
Q8T8E6_9TRYP/84-343--------------------------------------------------------------LVDE..............

PF14538

W1QFK7_OGAPD/56-210--------------------------------------------------------------QSLD--------------
L8WVZ0_THACA/73-224--------------------------------------------------------------PYLD--------------
A2EZ34_TRIVA/89-236--------------------------------------------------------------FQVA--------------
Q6C6R4_YARLI/86-238--------------------------------------------------------------QSLD--------------
M2WI96_DOTSN/172-328--------------------------------------------------------------VILD--------------
K2S4T3_MACPH/104-258--------------------------------------------------------------LCLD--------------
C4LXC3_ENTHI/42-194--------------------------------------------------------------GLWD--------------
T1G0Q6_HELRO/62-216--------------------------------------------------------------LSLD--------------
B0CNS4_LACBS/34-185--------------------------------------------------------------YILD--------------
F0ZAV4_DICPU/115-266--------------------------------------------------------------QCLD--------------
U9UGJ5_RHIID/52-203--------------------------------------------------------------QYLD--------------
Q5KIS3_CRYNJ/92-243--------------------------------------------------------------AFLD--------------
B0WBU4_CULQU/30-181--------------------------------------------------------------SLPD--------------
A5DWK2_LODEL/143-295--------------------------------------------------------------QSLD--------------
G0VGR8_NAUCC/79-231--------------------------------------------------------------QSLD--------------
I3J5N7_ORENI/57-208--------------------------------------------------------------QSLD--------------
A2DYM2_TRIVA/68-215--------------------------------------------------------------FQVA--------------
D8TLK8_VOLCA/11-162--------------------------------------------------------------MHLD--------------
G4M000_SCHMA/43-194--------------------------------------------------------------QCLD--------------
C1MUE6_MICPC/45-196--------------------------------------------------------------LQLD--------------
Q387I9_TRYB2/89-240--------------------------------------------------------------MAVE--------------
C4M2F5_ENTHI/38-189--------------------------------------------------------------PCCD--------------
G4TT65_PIRID/72-223--------------------------------------------------------------PFLD--------------
G0NWW0_CAEBE/64-218--------------------------------------------------------------ICCD--------------
A2DJF0_TRIVA/83-228--------------------------------------------------------------TSRS--------------
K3WJU9_PYTUL/84-235--------------------------------------------------------------QCLD--------------
A2G590_TRIVA/30-180--------------------------------------------------------------IFVD--------------
B8M6V6_TALSN/189-342--------------------------------------------------------------QYLD--------------
A2FJN8_TRIVA/41-191--------------------------------------------------------------IVVD--------------
A2DLR3_TRIVA/97-242--------------------------------------------------------------YVIG--------------
E5SIN8_TRISP/44-195--------------------------------------------------------------QALD--------------
I1G727_AMPQE/53-204--------------------------------------------------------------QLLD--------------
U1MN31_ASCSU/95-246--------------------------------------------------------------NAND--------------
I1L744_SOYBN/123-274--------------------------------------------------------------CQLD--------------
E4XFS5_OIKDI/48-228--------------------------------------------------------------QKIF--------------
D2VMD1_NAEGR/144-294--------------------------------------------------------------QCLD--------------
A9TBL2_PHYPA/91-242--------------------------------------------------------------VSLD--------------
B7PLB3_IXOSC/92-247--------------------------------------------------------------LSLD--------------
A0A0D2USM0_CAPO3/727-878--------------------------------------------------------------PSLD--------------
B8CBK6_THAPS/256-409--------------------------------------------------------------RAID--------------
A4I1A2_LEIIN/114-279--------------------------------------------------------------RVVE--------------
F4RLY3_MELLP/215-367--------------------------------------------------------------TYPD--------------
K4DUJ2_TRYCR/62-218--------------------------------------------------------------RAVD--------------
H1VVG4_COLHI/158-309--------------------------------------------------------------QYLD--------------
M7XEP3_RHOT1/113-265--------------------------------------------------------------QYLD--------------
A2GCD5_TRIVA/98-247--------------------------------------------------------------FSIA--------------
D8RG53_SELML/72-223--------------------------------------------------------------LALD--------------
A2F9H3_TRIVA/31-181--------------------------------------------------------------FAVD--------------
L0PHF8_PNEJ8/131-282--------------------------------------------------------------QYLD--------------
RTOR2_ARATH/94-246--------------------------------------------------------------VELD--------------
M5E8T5_MALS4/58-209--------------------------------------------------------------QYLD--------------
B3RPQ9_TRIAD/43-194--------------------------------------------------------------QSLD--------------
I4Y9Q8_WALSC/76-227--------------------------------------------------------------QYLD--------------
A2E4G0_TRIVA/101-242--------------------------------------------------------------ANCP--------------
A0A068XPC4_HYMMI/269-417--------------------------------------------------------------QCLD--------------
U4LGP0_PYROM/223-374--------------------------------------------------------------QYLD--------------
A2F8U1_TRIVA/65-210--------------------------------------------------------------ARVN--------------
D8T9J0_SELML/50-197--------------------------------------------------------------LRLD--------------
A9V5A2_MONBE/628-777--------------------------------------------------------------QAPD--------------
F0XXV0_AURAN/12-164--------------------------------------------------------------QLLD--------------
A2E336_TRIVA/54-202--------------------------------------------------------------ISNE--------------
B4R5C8_DROSI/214-365--------------------------------------------------------------KCND--------------
J4H2X1_FIBRA/92-243--------------------------------------------------------------PLLD--------------
A2EU18_TRIVA/81-227--------------------------------------------------------------SMLN--------------
A2DYB3_TRIVA/12-162--------------------------------------------------------------MIVD--------------
S2KE38_MUCC1/106-257--------------------------------------------------------------LSLD--------------
G7E3R0_MIXOS/173-325--------------------------------------------------------------FYPD--------------

PF03415

Q8A866_BACTN/37-399--------------------------------------------------------------Q.NS--------------
Q9WZB1_THEMA/121-462--------------------------------------------------------------DFNS--------------
Q8XM44_CLOPE/59-508--------------------------------------------------------------EANM--------------
Q9X1S5_THEMA/586-937--------------------------------------------------------------EIDS--------------
Q9WYY6_THEMA/5-301--------------------------------------------------------------EINS--------------
Q8TIY6_METAC/66-593--------------------------------------------------------------HANM--------------

PF12770

A0LJ53_SYNFM/581-921...................................ESASAGSGFMELRTAGYTEMMKGIF..QELP--------------
A0LQE8_SYNFM/635-947..............................................................RALP--------------
A1BCK0_CHLPD/513-826..............................................................GDLD--------------
A1BEL3_CHLPD/43-361..............................................................LQIE--------------
A1BEL6_CHLPD/46-364..............................................................LEIE--------------
A4HBL7_LEIBR/1053-1432...................................................DTLFCTAFP..PNTD--------------
A8L4T6_FRASN/741-1051..............................................................DPLP--------------
A9WBC0_CHLAA/673-929..............................................................GMLA--------------
A9WER9_CHLAA/54-394.......................................................WQLSP..FDRP--------------
A9WF91_CHLAA/60-360..............................................................ERFG--------------
B0C874_ACAM1/207-507..............................................................SPLP--------------
B2IXC0_NOSP7/1396-1691..............................................................EPLP--------------
B2IZZ4_NOSP7/695-973..............................................................SFLK--------------
B2JAK0_NOSP7/526-830.................................................IFNGRKHQLNF..SRLP--------------
B2JAM9_NOSP7/866-1190....................................KNPNFTELNTLAMRRSSCDSNFSF..PRLE--------------
B4JKU3_DROGR/1402-1700....................................................ALAERWGWAGAESP--------------
C3Z401_BRAFL/1278-1602....................................................SVLERWSY..DPLP--------------
F0SR63_RUBBR/137-574DRPAAVEIWSHGQTRTAQIPSPAAGQPFGIQYHRIPANRLLEAERRVNDRVSELQRKAVW..NELP--------------
Q01RE6_SOLUE/865-1136.........................................................SRL..PYLE--------------
Q024J7_SOLUE/541-814..........................................................AF..PALT--------------
Q025F1_SOLUE/607-877..............................................................ANLP--------------
Q028B5_SOLUE/667-935..............................................................VQLP--------------
Q02DA1_SOLUE/510-786.......................................................MAKAF..PPLP--------------
Q10YT7_TRIEI/1003-1309...............................................KSKGRFGVSDLGL..SGLP--------------
Q10YU6_TRIEI/544-838..............................................................DDLP--------------
Q112V9_TRIEI/62-390..............................................................SGLS--------------
Q113D1_TRIEI/130-430......................................................VAYLNT..KDLP--------------
Q113U8_TRIEI/3002-3297..............................................................NPLP--------------
Q115J8_TRIEI/1466-1777..............................................................PDLY--------------
Q117G6_TRIEI/881-1206...............................................ERGFNKTSSNIVL..GRLL--------------
Q119J2_TRIEI/1474-1770..............................................................TPLP--------------
Q16H64_AEDAE/1315-1614....................................................SLSETWGW..SESP--------------
Q2G6U6_NOVAD/692-1020................................................AVADECDWPLAT..WQNP--------------
Q2S6G2_SALRD/540-844.............................................PSSRADTTAASSLSL..PPLP--------------
Q2W535_MAGSA/875-1218......................................RSAGNDVQSSVRGMSGMRGLKF..DPLP--------------
Q38C46_TRYB2/1044-1397....................................................LMSHLLFP..LDAH--------------
Q3AQG5_CHLCH/44-362..............................................................LQIE--------------
Q5LLA3_RUEPO/680-970..............................................................VSAT--------------
Q7NCT1_GLOVI/600-923......................................DYGAETRLEENLRSPALTGFTV..RPLP--------------
Q7NF67_GLOVI/550-854...........................................AAGKIDTRAGKFDALGF..AALP--------------
Q7NFD7_GLOVI/666-979............................................STAPSTRSGSLGQLQV..GPLP--------------
Q7NIF7_GLOVI/691-997...........................................HRSAPSLRSADLAELRV..EGLP--------------
Q7NJE3_GLOVI/660-988...................................GESTGAAAARWGENLRSAALTGFTV..RPLP--------------
Q7NLR0_GLOVI/653-961..........................................ERKRSAEPVAADLGKLRY..DPLP--------------
Q7NVB0_CHRVO/67-386..............................................................PGLP--------------
Q82I85_STRAW/1175-1481..............................................................GDLH--------------
Q82L10_STRAW/969-1256..............................................................APLA--------------
Q8DGG5_THEEB/541-835.................................................MHALDGRGLTF..TPLP--------------
Q8DH74_THEEB/570-891............................................QRGVNPRSLDLRSLTF..TELP--------------
Q8DHI1_THEEB/67-394....................................................VVFSPMVYQSLKSP--------------
Q8DIE5_THEEB/1127-1420..............................................................SPLP--------------
Q8YZU5_NOSS1/56-340.....................................................KIDNKVF..PELA--------------
TTC28_HUMAN/1390-1713....................................................AVMDRWLW..GPMP--------------

PF03568

G7E6G1_MIXOS/1513-1914--------------------------------------------------------------SLLA--------------
A8PX94_MALGO/1441-1824--------------------------------------------------------------SAMY--------------
M7XLD2_RHOT1/1703-2100--------------------------------------------------------------EAFA--------------
U5HB45_USTV1/1850-2253--------------------------------------------------------------DALH--------------
F4RLY9_MELLP/91-479--------------------------------------------------------------PDRD--------------
T1IUX7_STRMM/1624-1980--------------------------------------------------------------DDQQ--------------
A7RYA6_NEMVE/1651-2034--------------------------------------------------------------GVEE--------------
T1FT05_HELRO/413-770--------------------------------------------------------------KNEE--------------
W4Y9R2_STRPU/1031-1383--------------------------------------------------------------KAEK--------------
G3N6G2_GASAC/1731-2077--------------------------------------------------------------ELSK--------------
H3DAQ7_TETNG/1711-2057--------------------------------------------------------------ELSK--------------
I3KSG7_ORENI/1715-2061--------------------------------------------------------------ELSK--------------
H2L8K9_ORYLA/1692-2038--------------------------------------------------------------KLSI--------------
M3ZIW2_XIPMA/1768-2114--------------------------------------------------------------QLSD--------------
ESPL1_MOUSE/1716-2065--------------------------------------------------------------SLAQ--------------
F7BUI1_CALJA/1724-2073--------------------------------------------------------------SPAQ--------------
G3VPI8_SARHA/1713-2063--------------------------------------------------------------SLTQ--------------
U3IXX7_ANAPL/1332-1679--------------------------------------------------------------ALAK--------------
G1KFP0_ANOCA/1819-2167--------------------------------------------------------------SLVE--------------
H3B3H1_LATCH/1699-2055--------------------------------------------------------------EVEE--------------
F6VXN8_XENTR/1732-2080--------------------------------------------------------------AVIE--------------
Q6ZHH8_ORYSJ/455-870--------------------------------------------------------------QHIE--------------
W5GJD2_WHEAT/891-1304--------------------------------------------------------------QHSE--------------
K3Z105_SETIT/1078-1484--------------------------------------------------------------QHME--------------
C5XYE8_SORBI/457-870--------------------------------------------------------------EHIE--------------
C5XSY3_SORBI/1425-1832--------------------------------------------------------------EHIE--------------
K3Y3B2_SETIT/1404-1817--------------------------------------------------------------EHIE--------------
M0UBW7_MUSAM/65-479--------------------------------------------------------------DRIE--------------
ESP1_ARATH/1641-2060--------------------------------------------------------------KLPD--------------
M4DS49_BRARP/1599-2019--------------------------------------------------------------KLPD--------------
B9GZR1_POPTR/1674-2094--------------------------------------------------------------SRLD--------------
B9SSN4_RICCO/1627-2045--------------------------------------------------------------KHLD--------------
I1MDQ8_SOYBN/1648-2063--------------------------------------------------------------KNFD--------------
K4B224_SOLLC/1600-2023--------------------------------------------------------------ELLD--------------
W1NKX2_AMBTC/1-423--------------------------------------------------------------TCLN--------------
K7H1P7_CAEJA/245-604--------------------------------------------------------------PASD--------------
E3LM18_CAERE/731-1090--------------------------------------------------------------ENAA--------------
G5ED39_CAEEL/727-1081--------------------------------------------------------------PKAA--------------
Q23491_CAEEL/749-1101--------------------------------------------------------------PNAT--------------
S3CR95_OPHP1/1758-2208--------------------------------------------------------------TIFA--------------
F0XAD9_GROCL/1636-2054--------------------------------------------------------------EPFG--------------
G2R9B0_THITE/1619-2058--------------------------------------------------------------DLLE--------------
Q2H6Q9_CHAGB/1612-2026--------------------------------------------------------------ELLA--------------
G0SHM3_CHATD/1723-2150--------------------------------------------------------------ELLE--------------
G4UQF5_NEUT9/1626-2085--------------------------------------------------------------ELMN--------------
G4N8I2_MAGO7/1627-2057--------------------------------------------------------------ELLA--------------
J3P7L5_GAGT3/1606-2054--------------------------------------------------------------DLLA--------------
R8BFS3_TOGMI/72-487--------------------------------------------------------------ALLA--------------
N4UZ87_COLOR/1637-2043--------------------------------------------------------------ELLA--------------
G2X6M8_VERDV/1704-2113--------------------------------------------------------------DLLS--------------
G0RRT6_HYPJQ/1566-1971--------------------------------------------------------------DLLA--------------
M1WFQ9_CLAP2/1438-1889--------------------------------------------------------------DLLA--------------
J5K578_BEAB2/1584-1996--------------------------------------------------------------DLLA--------------
C7YYU1_NECH7/1580-1992--------------------------------------------------------------DLLA--------------
M7T4Q8_EUTLA/44-499--------------------------------------------------------------DLLA--------------
L8G205_PSED2/1652-2056--------------------------------------------------------------DLLA--------------
N1JFH1_BLUG1/1598-2001--------------------------------------------------------------DLLA--------------
K1X2E6_MARBU/1659-2061--------------------------------------------------------------ELLA--------------
S3D029_GLAL2/1639-2043--------------------------------------------------------------DLLA--------------
M7TX51_BOTF1/1640-2041--------------------------------------------------------------DLLA--------------
BIMB_EMENI/1609-2004--------------------------------------------------------------KSLA--------------
Q2USV7_ASPOR/1630-2030--------------------------------------------------------------TSLT--------------
G7XGU8_ASPKW/1627-2026--------------------------------------------------------------RSLA--------------
S8BGE7_PENO1/1622-2018--------------------------------------------------------------DAFA--------------
B6GZP8_PENCW/1602-1998--------------------------------------------------------------TALA--------------
Q4WUU6_ASPFU/1638-2039--------------------------------------------------------------AALS--------------
B6QNB5_PENMQ/1619-2016--------------------------------------------------------------KVLT--------------
V5GCB2_BYSSN/1684-2084--------------------------------------------------------------DLLS--------------
F0UL09_AJEC8/1642-2044--------------------------------------------------------------PLLS--------------
C5FSW7_ARTOC/1655-2058--------------------------------------------------------------ALLG--------------
H6C6Q4_EXODN/1587-1987--------------------------------------------------------------NALL--------------
U1G8A9_ENDPU/1638-2036--------------------------------------------------------------ELLS--------------
K2R7J5_MACPH/1619-2043--------------------------------------------------------------SLLS--------------
R7YNT5_CONA1/1696-2117--------------------------------------------------------------DLLG--------------
E4ZTB4_LEPMJ/1652-2063--------------------------------------------------------------SLLA--------------
N1QAI8_PSEFD/1492-1912--------------------------------------------------------------EQVD--------------
N1QHR1_SPHMS/1187-1599--------------------------------------------------------------SGLS--------------
N1PZ16_DOTSN/1513-1936--------------------------------------------------------------ERLD--------------
D5GKQ4_TUBMM/1633-2033--------------------------------------------------------------EYMA--------------
U4LG69_PYROM/1616-2019--------------------------------------------------------------KLFS--------------
S8C8B1_DACHA/1639-2040--------------------------------------------------------------ELIA--------------
Q6CCJ0_YARLI/1210-1588--------------------------------------------------------------SGCE--------------
S9X830_SCHCR/1385-1771--------------------------------------------------------------SLFL--------------
CUT1_SCHPO/1383-1770--------------------------------------------------------------SLFA--------------
B6K0I6_SCHJY/1359-1747--------------------------------------------------------------ESFM--------------
M7PDE3_PNEMU/1489-1882--------------------------------------------------------------GSFV--------------
G8BT64_TETPH/1165-1563--------------------------------------------------------------QYFT--------------
I2H0Y5_TETBL/1280-1677--------------------------------------------------------------KYFN--------------
S6EFD3_ZYGB2/1145-1542--------------------------------------------------------------DVLK--------------
C5DU01_ZYGRC/1141-1538--------------------------------------------------------------ELLE--------------
G8ZWZ1_TORDC/1158-1555--------------------------------------------------------------DILQ--------------
G0WDN6_NAUDC/1191-1589--------------------------------------------------------------SAFK--------------
G0VFB3_NAUCC/1164-1562--------------------------------------------------------------SLFE--------------
H2B1L5_KAZAF/1161-1559--------------------------------------------------------------DAFE--------------
ESP1_YEAST/1175-1571--------------------------------------------------------------SLFE--------------
J7RG90_KAZNA/1160-1562--------------------------------------------------------------SHFA--------------
Q75EJ0_ASHGO/1152-1552--------------------------------------------------------------NHFA--------------
C5DHM1_LACTC/1178-1575--------------------------------------------------------------KDLE--------------
Q6CQQ7_KLULA/1118-1516--------------------------------------------------------------QQFE--------------
Q6FTE1_CANGA/1151-1548--------------------------------------------------------------DALL--------------
K0K8V1_WICCF/1175-1568--------------------------------------------------------------SRRD--------------
A5DNR9_PICGU/1178-1576--------------------------------------------------------------KTIE--------------
A3GFF5_PICST/1168-1555--------------------------------------------------------------AVFQ--------------
Q6BTB7_DEBHA/1338-1753--------------------------------------------------------------PFLS--------------
Q5A8X8_CANAL/1101-1536--------------------------------------------------------------NVFH--------------
C5MEH0_CANTT/925-1303--------------------------------------------------------------NVFL--------------
M3HH45_CANMX/1423-1797--------------------------------------------------------------MIFQ--------------
G8B5X7_CANPC/1052-1424--------------------------------------------------------------STFG--------------
A5DVQ7_LODEL/1109-1530--------------------------------------------------------------HLYS--------------
G3AGZ6_SPAPN/1149-1535--------------------------------------------------------------TVYD--------------
G8YBL5_PICSO/1309-1719--------------------------------------------------------------QTLH--------------
C4XY11_CLAL4/1177-1564--------------------------------------------------------------QEYN--------------
G3B782_CANTC/1213-1609--------------------------------------------------------------IQFQ--------------
W1QIM9_OGAPD/1167-1527--------------------------------------------------------------AVVE--------------
C4QYS2_PICPG/1259-1619--------------------------------------------------------------NVLE--------------
K5WME3_PHACS/1732-2136--------------------------------------------------------------NLLD--------------
M2R2K9_CERS8/1618-2024--------------------------------------------------------------ADLT--------------
F8PLA9_SERL3/1278-1688--------------------------------------------------------------DIIS--------------
S8E105_FOMPI/1678-2083--------------------------------------------------------------EDLN--------------
J4GX56_FIBRA/504-917--------------------------------------------------------------TVFL--------------
A8NBE9_COPC7/1839-2276--------------------------------------------------------------ELLS--------------
B0E1W0_LACBS/104-540--------------------------------------------------------------EMIL--------------
D8Q1W5_SCHCM/1450-1878--------------------------------------------------------------EAID--------------
V2X3W8_MONRO/1588-2040--------------------------------------------------------------EGIA--------------
J0DCK6_AURDE/1634-2046--------------------------------------------------------------DVIE--------------
Q5KMS4_CRYNJ/188-600--------------------------------------------------------------ADLS--------------
R9AIE1_WALI9/1639-2036--------------------------------------------------------------SALN--------------
I4YB88_WALSC/1631-2030--------------------------------------------------------------NALN--------------
G4T5A4_PIRID/1472-1874--------------------------------------------------------------ESLM--------------

PF01364

KGP83_PORGN/244-595--------------------------------------------------------------RMSA--------------
D1JG83_9ARCH/891-1295--------------------------------------------------------------RIIG--------------
A2U064_9FLAO/401-768--------------------------------------------------------------RIPV--------------
Q7MTE2_PORGI/239-573--------------------------------------------------------------RFSC--------------
D3HWT0_9BACT/400-777--------------------------------------------------------------RFPV--------------
Q5S3Q9_9FLAO/543-910--------------------------------------------------------------RILA--------------
A9DMD5_9FLAO/555-923