Sequence alignment for CL0094

PF03410

MP44_MCV1/1-592MILLENGVRVFPKPGMGK-DIYIGLANFGFENDV--PELLGVA----HLLEHILISFDYTRFVANASTARTYMSFWCRAL
G1_VAR67/1-591MIVLPNKVRIFINDRMKK-DIYLGISNFGFENDI--DEILGIA----HLLEHLLISFDSTIFLANASTSRSYMSFWCKSI
MP44_MYXVL/1-589MIVFDNGTRVFINSSTNK-DIYVGFSGFGFEKDI--GGILGIA----HLLEHILISFDASRFVANASTARSYMSFWCTPI

PF00675

AXL1_YEAST/34-179LALIISDP---TDTSSSC-SLTVCT---GSHNDP--KDIAGLA----HLCEHMIL-------------------------
IDE_HUMAN/74-212KVLLISDP---TTDKSSA-ALDVHI---GSLSDP--PNIAGLS----HFCEHMLF-------------------------
YMXG_BACSU/12-160RIVLENNP---TVRSVAI-GVWIGT---GSRHET--PEINGIS----HFLEHMFF-------------------------
YQA4_CAEEL/37-175RVLLVSDS---KTRVSAV-ALDVKV---GHLMDP--WELPGLA----HFCEHMLF-------------------------
IDE_DROME/47-185KVLLISDP---NTDVSAA-ALSVQV---GHMSDP--TNLPGLA----HFCEHMLF-------------------------
MPPA_YEAST/29-176KVATSNT.---PGHFSAL-GLYIDA---GSRFEG--RNLKGCT----HILDRLAF-------------------------
NRDC_RAT/210-348RVEARKKT---TEKQSAA-ALCVGV---GSFADP--DDLPGLA----HFLEHMVF-------------------------
PTRA_ECOLI/54-192VVLLVSDP---QAVKSLS-ALVVPV---GSLEDP--EAYQGLA----HYLEHMSL-------------------------
QCR1_BOVIN/58-205RVASEQS.---SQPTCTV-GVWIDA---GSRYES--EKNNGAG----YFVEHLAF-------------------------
MPPB_NEUCR/50-198TVASQYSP---YAQTSTV-GMWIDA---GSRAET--DETNGTA----HFLEHLAF-------------------------
QCR2_EUGGR/64-216KVITLDN.---GGSVAQL-TFLYKD---GPVYEN--IFNAGIS----SFMKHALT-------------------------
MPPB_RAT/68-215RVASENS.---GISTCTV-GLWIDA---GSRYEN--EKNNGTA----HFLEHMAF-------------------------
MPPB_YEAST/36-184TIATEYIP---NTSSATV-GIFVDA---GSRAEN--VKNNGTA----HFLEHLAF-------------------------
QCR2_YEAST/17-163LTVSARDA---PTKISTL-AVKVHG---GSRYAT--KD..GVA----HLLNRFNF-------------------------
PQQL_HAEIN/45-188YFVLKNTE---PKERVYI-RLVINA---GSMHED--DDQKGIA----HLVEHMAF-------------------------
UCR1_CAEEL/48-195RVVTEDN.---GSATATV-GVWIET---GSRFEN--EKNNGVA----HFLERLIH-------------------------
PQQF_KLEPN/15-154QATLVHQP---QADRAAA-LARVAA---GSHHEP--SRFPGLA----HLLEHLLF-------------------------
MPPA_SOLTU/85-231KVASEAS.---VNPAASI-GLYVDC---GSIYET--PASYGAT----HLLERMAF-------------------------
SDP_EIMBO/44-183AIAVHHP.---RSNESGF-AVAANT---GSLYDP--QDVPGLA----HFLEHMLF-------------------------
QCR1_EUGGR/37-184RIASESK.---DGDTCTV-GVWIDA---GSRWET--EKNNGVA----HFLEHMNF-------------------------
MPPA_NEUCR/62-209RVASEDL.---PDAFSGV-GVYIDA---GSRYEN--DYVRGAS----HIMDRLAF-------------------------
PQQF_PSEFL/28-167RVSLRHAP---HLKRCAA-TLRVAA---GSHDVP--LAWPGLA----HFLEHLLF-------------------------
PQQL_ECOLI/46-204YMIYPHAH---PKDQVNL-WLQIHT---GSLQEE--DNELGVA----HFVEHMMF-------------------------
MPPA_HUMAN/77-227RVASQNK.---FGQFCTV-GILINS---GSRYEA--KYLSGIA----HFLEKLAF-------------------------
QCR2_BOVIN/48-194VIASLEN.---YAPASRI-GLFIKA---GSRYEN--SNNLGTS----HLLRLASS-------------------------
QCR1_YEAST/37-182VVATEHNP---SAHTASV-GVVFGS---GAANEN--PYNNGVS----NLWKNIFL-------------------------

PF02664

LUXS_HAEIN/2-162----PLLDSFKVDHTKMNAPAVR.I--AKTMLTPKGDNITVFD----LRFCIPNK-------------------------
LUXS_ECOLI/2-162----PLLDSFTVDHTRMEAPAVR.V--AKTMNTPHGDAITVFD----LRFCVPNK-------------------------
LUXS_BACSU/2-156----PSVESFELDHNAVVAPYVRHC--GVHKVGTDG.VVNKFD----IRFCQPNK-------------------------
LUXS_HELPJ/3-151----MNVESFNLDHTKVKAPYVR.I--ADRKKGVNGDLIVKYD----VRFKQPNR-------------------------
LUXS_BORBU/2-157----KKITSFTIDHTKLNPGIYV..--.SRKDTFENVIFTTID----IRIKAPNI-------------------------

PF05193

QCR1_MOUSE/210-395RLSRTDLTDYLNRHYKAP.RMVLAA--AGGVEHQ..QLLDLAQ....KHLSSVSR-------------------------
IDE_HUMAN/236-418DV.RQELLKFHSAYYSSN.LMAVCV--LGRESLD..DLTNLVV....KLFSEVEN-------------------------
IDE_HUMAN/706-889DVTLPRLKAFIPQLLSRL.HIEALL--HGNITKQ..AALGIMQ....MVEDTLIE-------------------------
YMFH_BACSU/182-363HITKDLLYECYETFYHPS.NMLLFI--VGPVDPE..AIISQVR....ENQGKKPY-------------------------
YMXG_BACSU/165-338SFNGDSLRQYMHDYYTPD.RVVISV--AGNISD...SFIKDVE....KWFGSYEA-------------------------
YQA4_CAEEL/603-787SVTLEDVHGFAIKMLQAF.HMELFV--HGNSTEK..DTLQL.S....KELSDILK-------------------------
QCR2_MOUSE/199-378KITSEELHYFVQNHFTSA.RMALVG--LG.VSHS..VLKQVAE....QFLNMRGG-------------------------
YQA4_CAEEL/200-382P..RDVLLDFYKNWYSSD.IMTCCI--VGKESL......DVLE....SYLGSFKF-------------------------
PREP1_ARATH/301-489NLTFEEFKEFHRQYYHPS.NARIWF--YGDDDPV..HRLRVLS....EYLDMFEA-------------------------
IDE_DROME/209-391DV.RDELLKFHKQWYSAN.IMCLAV--IGKESLD..ELEGMVL....EKFSEIEN-------------------------
Q9YFN7_AERPE/166-342NISKADVEEYKASVFSPE.RMSLAI--VGRISRL..EALRV.V....KLFSQLE.-------------------------
IDE_DROME/679-863LVTYDRVLNFAKEFFQRL.HTECFI--FGNVTKQ..QATDIAG....RVNTRLEA-------------------------
Q9RRH6_DEIRA/141-315RLDRPALQRHFAERYGAE.RVTLVL--SGAFDPA..EVRAWAE....RELAGWP.-------------------------
PQQL_ECOLI/206-388TVTPAQLRQFYQRWYQPN.NMTFIV--VGDIDSK..EALALIK....DNLSKLPA-------------------------
Q9X167_THEMA/162-335KISSEDLREYHRKNYNLP.DTKIIL--AGKVND...DYLSLLE....KELSELER-------------------------
Q9U6C9_TOXGO/170-352HYNPDVIRHYMLQHFSPE.NMVFVG--VN.VNHD..ELCTWLM....RAFVLRHS-------------------------
Q97N46_STRPN/177-351AETPQSSYSCFQEFLAND.RIDFFF--LGDFNEV..EIQNVLE....SFGFKGRK-------------------------
Q9JS80_CHLPN/201-385TLSHEDVRAFHQSQYSIN.RCLFYF--YGNIKPS..RHLDFLE...EKLLRQATK-------------------------
Q9I6C2_PSEAE/203-388RMTIDDLRHWYESWYAPN.NATLVV--VGDVTAD..EVKTLAK....RYFGEIPW-------------------------
Q9ANJ4_BRAJP/5-169S.............LQKD.TFKIAV--VGGVDPG..AVCKLLD....KTFGSLPS-------------------------
MPPB_SCHPO/185-372SLTREDLLQYIKDNYRSD.RMIISS--AGSISHE..ELVKLAE....KYFGHLEP-------------------------
PXM16_ARATH/666-854HLEAEDVAKFVPMLLSRT.FIECYI--AGNVENN..EAESM.V....KHIEDVLF-------------------------
MPPB_LENED/192-381SIQRDDLASYIQTNYTAD.RMVLVG--TGGVDHQ..SLVKLAE....KHFSSLP.-------------------------
Q9KUG7_VIBCH/219-398RVDVNDLKAFFLRWYGPN.NAVLTI--GGDLDVK..QTLAWVQ....KYFGSIPK-------------------------
O50511_STRCO/185-366AATLEDARAFFRTYYAPN.NAVLSV--VGDIDPE..QTLAWIE....KYFGSIAS-------------------------
Q9UVF2_YARLL/538-703K..LQEIAKFALT....R.EQRFAV--TCGQDMQ.TKNDELVR....KFAESFET-------------------------
Q49146_METEX/5-143AF.......................--.GALPE......................-------------------------
PTRA_ECOLI/681-858SITLKEVLAYRDALKSGA.RPEFMV--IGNMTEA..QATTLAR....DVQKQLGA-------------------------
MPPB_NEUCR/203-391DITRTELVNYIKNNYTAD.RMVLVG--AGGVPHE..QLVEMAD....KYFSKLPA-------------------------
Q9RRH5_DEIRA/126-298RLSAASLRAHWAR.FGQR.GSVLGV--VADADAQ..EVYELVA....GLFADWQ.-------------------------
QCR2_NEUCR/198-375YLNENSVAAFANLAYNKA.NIAVVA--DG.ASQA..GLEKWVE....PFFKGVPA-------------------------
Q985V3_RHILO/166-339SFTSKQLHDFIERQYGAE.RMVIVA--AGDIKHD..NFVREVE....KQLGGFRS-------------------------
Q9AXQ2_CUCME/257-443TITKDHLQSYIQTHYTAP.RMVIAA--SGAVKHE..DFVEQVK....KLFTKLSA-------------------------
Q9PLB7_CHLMU/208-391TVTSQDMQTWFSTHYSPE.NMAAIV--YTTAPLD..VAVPYIA....KIFSQIPK-------------------------
Q9FJT9_ARATH/639-833KVDPLKACEYFNSCFRDPSTFTVVI--VGNLDPT..IALPLIL....QYLGGIPK-------------------------
Q23295_CAEEL/192-374TINKNDLQGYINTHYRSG.RMVLAA--AGGVNHD..AIVKMAE....KYFGELKH-------------------------
CYM1_YEAST/735-911REVVDKLTELQKYIVDTN.NMNFFI--TSDSDVQAKTVESQIS....KFMERLPH-------------------------
O67308_AQUAE/184-360KFTREKLLKFYKSFYQPR.NMAVVI--VGKVNPK..EVEEEVM....KTFGKEEG-------------------------
O84812_CHLTR/225-408SVTTQDMQTWFATHYSPE.NMAAIV--YTTAPLD..TAVPYIA....SLFSEIPI-------------------------
Q9M9Z4_ARATH/748-933DLSLDDLNSFIPELRSQI.FIEALC--HGNLSED..EAVN............ISN-------------------------
SDP_EIMBO/201-391DL.VDRLKDFHTQYYCGS.NMVAVT--ISPRSLD..EQEALIR....EKFEGVSA-------------------------
P73670_SYNY3/182-362NYTANQLRCFHRTHYQPE.NMTVVM--VGDIREK..AAIAYME....EIFDHFGV-------------------------
Q9VP94_DROME/242-425SL.HKELHKFYRDHYGSN.RMVVAL--QAQLSLD..ELEELLV....RHCADIPT-------------------------
Q9Z6V1_CHLPN/209-393PVTTEKMAEWFKLHYSPE.NMCAIA--YTSAPLS..KAKKQFS....KIFSQIPR-------------------------
Q97II7_CLOAB/206-391DLSYEEALSFHEKYYHPS.NSIIYV--YGDIDIE..EVLEFIN...DNYLKDFNK-------------------------
YPD1_CAEEL/194-376SCTLEKVRDYHKKFYHLS.NMVVTV--CGMVDHD..QVLEIMNNVENEHMSTVPD-------------------------
Q9VYT3_DROME/284-473EL.HKILHEIRKEHYGAN.RMYVCL--QARLPID..ELESLVV....RHFSGIPH-------------------------
MPPA_HUMAN/232-431KINREVLHSYLRNYYTPD.RMVLAG--VG.VEHE..HLVDCAR....KYLLGVQP-------------------------
Q9ZIG1_RHOSI/193-288NMTAEALRHLYDTYYWPD.NATVSI--IGDFEPE..AALALVR....EHFGRIP.-------------------------
MPPA_YEAST/181-374SISKYYLLDYRNKFYTPE.NTVAAF--VG.VPHE..KALELTE....KYLGDWQ.-------------------------
Q9XBW5_PORGN/207-395NFKHDELRNYYKKWYRPD.LQGLVI--VGDIDVD..YVENKIK....ELFKDVPA-------------------------
Q9VFF0_DROME/203-385SIGKADLTDYIQTHYKAS.RIVLAA--AGGVKHD..DLVKLAC....SSLGGLEA-------------------------
MPPB_YEAST/189-380SITRTDLKDYITKNYKGD.RMVLAG--AGAVDHE..KLVQYAQ....KYFGHVPK-------------------------
O83069_TREPA/199-385RLTYESFKAFHKKHYHPS.NCKLFL--YGNIPTE..KQMAFIE...DKCLSKFSA-------------------------
QCR1_EUGGR/190-391SITKGMIDDFVKTHYTGP.RMALVG--SGAVDHG..QLCDLAS....KYFGALPT-------------------------
Q9M9Z4_ARATH/273-458DL.RECIVKLYKEYYHGG.LMKLVV--IGGESLD..MLESWVV....ELFGDVKN-------------------------
O61441_HAEIR/3-170H........YVANNFNAS.RCAVVG--VG.VDQN..ALVGFAQS..LELATAGKS-------------------------
O25656_HELPY/198-379NWTLKDIKKFHSLYYQPK.NAIVLV--VGDVNSQ..KVFELSK....KHFESLKN-------------------------
Y228_BORBU/711-879EI.ANKLDNLKNKIILKN.NLSALI--MGNTDD...ILKNLEN....EFFNLKES-------------------------
Q9A579_CAUCR/219-397AASLDDVKTWFKNYYGPA.NATLVL--AGDISAA..EAKAKVE....KYFGDIA.-------------------------
MPPB_BLAEM/198-380TLSQADLQAYIKNNYTAD.RMVVVG--AGNVDHA..ELCKLAE....TNFGKLPQ-------------------------
MPPA2_ARATH/235-419GLTGEVLENFVFENYTAS.RMVLAA--SG.VDHE..ELLKVVE....PLLSDLPN-------------------------
Q9PLB7_CHLMU/683-862IISYEEFEDFAHKMLTEL.SIEAFT--LGTLSSQ..DLSNVLAS..LSHFSEASL-------------------------
PXM16_ARATH/198-379T..RSELIKFYEEHYSAN.IMHLVV--YGKESLD..KIQDLVE....RMFQEIQN-------------------------
Q9PF62_XYLFA/244-422AASLADVKSWFQAHYGAA.NATLVL--AGDITVA..EARDKAA....KYFGDIPA-------------------------
Q9CE72_LACLA/168-341KENPKAVFEYYQKMLTDN.AIDIFV--LGDVDEK..RMI........ERFSDFNF-------------------------
Q22370_CAEEL/182-353SICTSTLSSFAEQHFVTG.NGVLFA--TN.AVHD..DLL.........LYGDNHA-------------------------
Q9XBW5_PORGN/690-872KVNYDQVMAFYNERFADAGDFMFFF--IGNLDEA..KMKPLIE....TYLASLPN-------------------------
Q9RWP9_DEIRA/229-413GLTYEDLRAFHAAHYHPS.NAYFFS--YGNQDLR..RVLDTIE...EQVMSHFQR-------------------------
Q9JMV9_BRAJP/168-341AFNRDMLRGYLSTHYRGP.DMVVAA--AGAVDHS..QVVAEAE....KRFASFEG-------------------------
PTRA_ECOLI/213-396PV.QQALKDFHEKYYSAN.LMKAVI--YSNKPLP..ELAKMAA....DTFGRVPN-------------------------
Q97IL0_CLOAB/163-340DFSIDELRKFYKKYYTSD.NCVIGI--VTSLKEE..EVTDIIN....NYMTLSK.-------------------------
Q17593_CAEEL/199-381P..RDALLEFYKKWYSSN.IMTCCI--IGKESLD..VLESYLR....TLEFDAIQ-------------------------
Q9A2H7_CAUCR/672-850KIKREDLAKTHAAYWRPD.NAVLVV--TGNLSPE..AGFALAE....KAFGGWKK-------------------------
Q9A531_CAUCR/720-903SASLDDLKAAVANPLAKG.DLEVVI--VGDTTVD..KAIAAVA....DTFGALPA-------------------------
MPPA_SCHPO/208-400GITATSIREYLKYFYRPE.HLTLAY--AG.IPQE..IAKEITK....ELYGHLPS-------------------------
Q9SCM5_ARATH/200-381T..RSELIKFYDEHYSAN.IMHLVV--YGKENLD..KTQGLVE....ALFQGIRN-------------------------
Q9HT96_PSEAE/190-362PLGAEQLERLRSDWYVPG.NMTLIL--VGDLDP...RLPAYLT....RTFGTLED-------------------------
Q9I6C3_PSEAE/229-405TISREQLQAFHKKAYAAG.NVVIAL--VGDLSRQ..EAEAIAA....EVSKALP.-------------------------
PREP_DROME/784-953DI.CDKLSTIASKVFNKD.NMRGAI--NTTQSYE.PSAISNYE....KFLESLP.-------------------------
Q17592_CAEEL/199-354P..RDALLQFYKKWYSSN.IMTCCI--IGKESLD..VLQ........SHLKTLEF-------------------------
Q9UVF2_YARLL/16-206ELTYEGLKKFHADHYNPS.NAKTFS--YGDISVA..DHLEALN....AKFENCEI-------------------------
STE23_YEAST/246-428NV.RDELLKFHKNFYSAN.LMKLCI--LGREDLD..TLSDWTY....DLFKDVAN-------------------------
Q9KUG7_VIBCH/686-864ALTLKDVKQFYRQHYTPH.GAQIAV--VGDISAR..EIRQQ.L....QFIADWKG-------------------------
Q9KQC8_VIBCH/661-839DVQVEELAHFVDTILSQL.HVEMFV--YGDWPAA..EAHKMAEV.LKDALRVQGQ-------------------------
Q9VV75_DROME/190-364KLSSESLLHYVAQTFAAG.RAAVVG--VG.IDNN..TLAGFAQ....TLQ..FPS-------------------------
PQQL_HAEIN/205-388TISAKRVADFYHKWYRPD.NMSVII--VGDIDTK..QVVKLLK....QNLSQENP-------------------------
MPPA_SOLTU/236-422RLNSTVLEEFVAENYTAP.RMVLAA--SG.VEHE..EFLKVAE....PLLSDLPK-------------------------
YAN2_SCHPO/193-378KLSIEKIREYHKEMYVPS.NICLIV--TGCINES..RLLSCAS....GIVKEILA-------------------------
NRDC_HUMAN/837-1020GLSLESLLSFVKEFKSQL.FVEGLV--QGNVTST..ESMDFLK....YVVDKLNF-------------------------
Q9JS80_CHLPN/718-886A..VVILQRLYTKCFSGK.RQIVIS--GSAHNYQ..QLKDN......KFYGLLD.-------------------------
Q9U7N7_PLAFA/914-1104NI....LVRIRNKIFNKK.NLMVSV--TSDYGA...................LK.-------------------------
O84831_CHLTR/201-385SLNLETVRAFYESQYTLS.RCLFYF--YGNIKPS..RHLDFLE...EKLLRRVG.-------------------------
Q9A579_CAUCR/657-835AITRDDLIAYQKAWLQPK.DATLII--VGDTTLE..QILPKLE....AQLGGWT.-------------------------
Q9FIH8_ARATH/360-598KWDVDKIRKFHERWYFPA.NATLYI--VGDIDNI.PRIVHNIE....AVFGKNGL-------------------------
Q9A531_CAUCR/246-428TAPAQRIRDFYEAYYRPE.RTVLVA--VGDFDVD..AMEAKIK....GKFGDWVG-------------------------
O84812_CHLTR/700-879TLSYEEFANFTNKLLQEL.AVESLA--LGTLSAQ..DLSNLLST..LSNFAEASS-------------------------
Q40983_PEA/925-1150NLTLQSVKDAVMNQFVGN.NMEVSI--VGDFTEE..EIESCIL....DYLGTAQ.-------------------------
Q49145_METEX/235-418ELNRTHAIDYYKRFYTPE.NAILVV--AGDVTPD..EVRRLAE....DTYGRVTP-------------------------
CYM1_YEAST/221-407DLRYGDLLDFHHKNYHPS.NAKTFT--YGNLPLV..DTLKQLN....EQFSGYGK-------------------------
Q97EV0_CLOAB/207-392DLTYDAFLDSHKKYYSPS.NSYIYL--YGDMDID..EKLKYID...EEYLKNYDR-------------------------
Q9VYT3_DROME/769-953SVILEDMREFAHQFPKEL.YIQSLI--QGNYTEE..SAHNVMN....SLLSRLNC-------------------------
QCR1_YEAST/187-370NLVVADLESFANNHFLNS.NAVVVG--TGNIKHE..DLVNSIE...SKNLSLQT.-------------------------
Q9TZ33_CAEEL/181-355AYKSQELAKFAAKHFVSG.NAVLVG--IN.VDGS..ILKSYAE....ECGVVPDG-------------------------
Q9FNU9_DACGL/238-423RLNTDVLEDFLAENYTSS.RIVLAA--SG.VDHD..ELVSIAE....PLLSDIPN-------------------------
Q40738_ORYSA/2-120N.............YTAP.RMVLAA--SG.VEHG..ELVSIAE....PLLSDLPS-------------------------
Q9VP94_DROME/724-907DITMDDIKSFKENFHKKM.YVKGLI--QGNFTED..QATDLMQ....KVLDTYKS-------------------------
O67945_AQUAE/183-355RVSREDLIRRFNQIKKGE.NVVVVL--VGDFKAE..DVLPLLE....EAFSDIP.-------------------------
Q9KRD3_VIBCH/199-378AATPDSLKAFYQQWYQPQ.LAELVI--TGNFTLE..QGQQWVE....NYFSSWKK-------------------------
Q9FIH8_ARATH/928-1156SLNLESVKDAVMSHFVGD.NMEVSI--VGDFSEE..EIERCIL....DYLGTVKA-------------------------
Q41445_SOLTU/262-449KMTRAHIQDYISTHYGAH.RMVISA--AGAVKHE..EVVELVK....KHFTKLSS-------------------------
MU138_SCHPO/668-850DVQVGDMSDFISDLLKQN.FLESLV--HGNYTEE..DAKNLIE....SAQKLIDP-------------------------
Q9ANJ2_BRAJP/2-119TL.......................--...ADA......................-------------------------
Q9PL96_CHLMU/717-886EI.TNRLQTLYKKCFVGR.RQLVIS--SSKANYQ..ALHEQ......RFFGLLDD-------------------------
Q41444_SOLTU/259-445TITRSHLKDYISTHYTAP.RMVIVA--SGPVKHE..EFVEQVK....KQFTKLST-------------------------
NRDC_HUMAN/361-548T..HARLREFWMRYYSSH.YMTLVV--QSKETLD..TLEKWVT....EIFSQIPN-------------------------
Q9U7N7_PLAFA/282-510NLTYEEFKEFYYKNYNPK.KVKVFF--FSKNNPT..ELLNFVD....QYLGQLDY-------------------------
Q97EV0_CLOAB/725-889EV.KNKLKGICDTIFNKD.NVIISV--TGNDEVY.NKFKEQ...........LPK-------------------------
QCR2_EUGGR/221-398YIDSNKLFDRWDAHYGFG.NIAVIA--TN.IEHE..AVLAAIT...DSAWVARAH-------------------------
QCR2_SCHPO/182-354S..ISEIKDFASKAYVKS.NFSVIS--SG.PDVQ..KASDLCA....KYFAVIP.-------------------------
P74016_SYNY3/241-420NIDRQAIIDFHRRYVRPD.QMILGI--VGDFDSE..TIKQTIA....ERFGNWQG-------------------------
Q9RHS7_9LACT/2-99A........................--...FAQ......................-------------------------
Q9TAP0_TOXGO/4-197NMTREHILEYINRNYTSD.RMVVAA--AGDVDHK..ELTALVE....KHFAGLPQ-------------------------
Q99UJ4_STAAM/179-355HITAETLYHTYQSMINND.QCSVYV--VGNVEPE..SVEKQIR....EKFALKPF-------------------------
MU138_SCHPO/196-378DV.RQELLKFYDKYYSAN.IMKLVI--IGREPLD..VLQDWAA....ELFSPIKN-------------------------
Q55159_SYNY3/175-359NLQAQQMRDFHAHWYQPP.AMTVTV--VGNQSVG..NLVETVA....RSFADCYR-------------------------
MPPA1_ARATH/239-423RLNGELLEEFMTENFTAA.RMVLAA--SG.VEHE..ELLKVAE....PLTSDLP.-------------------------
O50512_STRCO/190-374TIDSAAVRAFYERHVRPA.TATAVV--VGDLTGV..DLDALLA....DTLGAWTG-------------------------
PQQL_HAEIN/680-857SFDKNQLNNAYQHYILDKTDFTYFI--IGDIELN..QVKKLAE....RYLASIES-------------------------
O84831_CHLTR/717-886EI.IDRLQTLYKKCFVGR.RQLVIS--SSKANYQ..VLHDQ......RFFGLLDE-------------------------
Q9KA85_BACHD/165-338SFNEGMLRHYMDRFYTGD.YVVISV--AG.NVHD..ELIDKIK....ETFSQVK.-------------------------
P74305_SYNY3/274-453NLSRQDVTDFYEKYYIPG.NMTIAV--VGDVKVD..QVKSLAQ....KYFGRFP.-------------------------
Y2805_MYCBO/178-357VMTRAQLQSFHLRRYTPE.RMVVAA--AGNVDHD..GLVALVR....EHFGSRLV-------------------------
Q9CML5_PASMU/205-388TISRQRVADFYHKWYRAD.NMAVII--VGDIDAQ..QVTSQLK....AQIGSINS-------------------------
O87530_STRPY/183-363KITKILLETHHTYFYQPT.NMSLFI--VGDIDID..ETFLAIQ....RFQTTLSY-------------------------
MPPB_HUMAN/220-404SISRKDLVDYITTHYKGP.RIVLAA--AGGVSHD..ELLDLAK....FHFGDSLC-------------------------
Q9Z6V1_CHLPN/688-867KLSFSEFQAFASNLFNSV.HLEVMV--LGNLSEQ..QKKDYLEM..LQVFTASRS-------------------------
Y219_RICPR/168-341TFTKEHFLNFIGKHYNAE.NLYLSI--AGNIEHN..KIVMIAE....ELFASLKQ-------------------------
O51486_BORBU/686-867YFTKENILSFYKKRFTYANNFKFVF--AGDSDIQ..TIKAYSK....KYLGNLNF-------------------------
Q9A308_CAUCR/166-339AASVEALSDWRGDLYAAD.RLVIAA--TGAVEEA..ELMAAAE....RAFGDLP.-------------------------
Q9KA98_BACHD/181-363KITKDLLYTCYETFYHPS.NMLLFI--VGPVDVN..EMMTLVK....ENQGKKEF-------------------------
PQQF_PSEAE/179-352AF.QRALREFHAAHYHAG.NCQLWL--QGPQTLD..ELERLAQ....RACADLPG-------------------------
YO098_YEAST/193-378TLTNDEIRQFHKSLYSSD.NLCVIV--CGNVPTD..ELLTVMEE.WDNKLPEIPS-------------------------
PQQF_KLEPN/173-343AL.QAALGDFHRTHYVAR.RMQLWL--QGPQSLE..ALGELAA....RFAAGLAA-------------------------
YHJJ_ECOLI/199-378PVEAEKIKDFYQKWYTPD.AMTLLV--VGNVDAR..SVVDQIN....KTFGELKG-------------------------
Q9KQC8_VIBCH/196-377SI.RDEIIEFYQSHYSAK.LMTLSL--IGSQSFD..ELEAWAE....RYFAAIPN-------------------------
Q983M8_RHILO/208-384AITKDDLKALHKAVFARG.GLHVAV--VGAIDAE..TLKKKLD....MVFGDLP.-------------------------
Q9RTZ9_DEIRA/246-424NVPIGNLKAFYKTYYQPD.NAVVTL--AGNFDEG..QALTLIA....DSYGKVRR-------------------------
Y4WA_RHISN/251-435QLNREDALKFYDRYYAPN.NAILVV--AGDVDAG..RVRQLAD....ETFGTLPR-------------------------
Y4WB_RHISN/198-374AVTTSDLKAVHERIFARG.NLTIAV--VGAIDPG..TLKRDLD....RIFGGLP.-------------------------
MPPA_NEUCR/214-475YINRDVIQTYRDAFYRPE.RLVVAF--AG.VPHE..RAVKLAE....KYFGDMKA-------------------------
P73669_SYNY3/171-348HFTAQDLWEYHQAYFRPD.NLVISL--AGRLTLA..QAQDWVE....TSFGDWV.-------------------------
Q9CE73_LACLA/164-346AITADDLYKNYEVFYHPK.NMNLFL--TGPFDIE..MMSDFVR....SNQAKKD.-------------------------
Q9KRD3_VIBCH/671-849QVTAQQIEQVHQRLFSEGRNNTLVI--VGDIERS..QITPMLR....QYVASIPL-------------------------
Q9RTZ9_DEIRA/703-883AVTLAQVRDYYAKVWNGA.NAQLGV--VGDFDPQ..TIREALP....TLLGGFDS-------------------------
UCR1_CAEEL/200-386NISAQQLKEWQEDHYRPV.RMVLSA--VG.GGVS..NVSSLAD....KYFGDLSN-------------------------
Q9PF62_XYLFA/714-895SLTATDLKDFQQRWLRPD.NVRILV--TGHTTLK..SIIPQLE....AAFGDWQA-------------------------
Q40983_PEA/357-594KWDADKIRKFHERWYFPA.NATLYI--VGDIGNI.PKTVNQIE....AVFGQTGV-------------------------
MPPA_RAT/231-430KIDREVLHSYLKNYYTPD.RMVLAG--VG.VEHE..HLVECAR....KYLLGVQP-------------------------
QCR2_YEAST/166-327RVSLQDIKDFADKVYTKE.NLEVSG--EN.VVEA..DLKRFVD...ESLLSTLP.-------------------------
O51486_BORBU/206-392SFQPEDFKKFYRKWYRPE.LASVIV--VGDIDPI..EIEEKIK....KQFVSWKN-------------------------
PQQL_ECOLI/683-863QFTAADALAADRQLFSSPADITFVI--VGNVAED..KLVALIT....RYLGSIKH-------------------------
O16249_CAEEL/747-931SVTLEDVQGFAKEMLQAF.HMELFV--HGNSTEK..EAIQLSK....ELMDVLK.-------------------------
Q97LA3_CLOAB/174-348KMEFQSVKSFHDKWYKPQ.NSAICI--CGDIANS..DIENKIS....KYFSEFKN-------------------------
Q9RWP9_DEIRA/777-912D........................--VG.LDL.....TPITT....TFQGDAPV-------------------------
Q983M9_RHILO/206-390QLNRTDAVAFYDKYYRPN.NAVLIV--AGDVEPE..TVKALAE....KTYGKVAR-------------------------
Q9A2H7_CAUCR/210-390AATVDDVRAFHRTYYRPD.NAALII--VGNFDQT..KLDAMID....KYFGSLTT-------------------------
Q99UJ3_STAAM/181-363DITKDDLYLCYETFYHPS.NMVLFV--VGDVNPE..EICRIVK....QHEDARNK-------------------------
O16249_CAEEL/258-440P..RDALLQFHKKWYSSD.IMTCCI--VGKEPL......NVLE....SYLGTLEF-------------------------
PQQF_PSEFL/185-366NAFQQALQQFHREYYQAG.QMVLSL--AGPQPLE..ELRALAE....RYGSCLP.-------------------------
Q97N47_STRPN/186-364QINLTNLQENFTKFYKPV.NMSLFL--VGNFDVE..RVQ........DYFESKEL-------------------------
Q97GF6_CLOAB/170-348GFSRNFIFDFYKKYYIPN.NCFIVI--VSKLEHE..QVFDLVE....KYFGDWN.-------------------------
PREP_DROME/268-457KLAYNDLVEFHKKYYHPS.NARIYS--YGLFDAS..KTLALLD...EEYLSDQSW-------------------------
STE23_YEAST/716-898KLTFEQLINFIPTIYEGV.YFETLI--HGNIKHE..EALEV.D....SLIKSLIP-------------------------
Y228_BORBU/195-380DLTYESFLDFYKKYYTLE.NCKIFL--CGNTQTE..KNLNFIE....KYIIRPYK-------------------------
Q9CML5_PASMU/680-857SFSRQELTQFYDSVMLDKTDFTYFL--IGDLPQQ..EAEKLAQ....TYLASVEV-------------------------
MPPA_BLAEM/177-373NMTSDTIREYFATYLHPS.RMVVAG--TG.VAHA..ELVDLVS....KAF..VPS-------------------------
Q9KA97_BACHD/184-365QLSAEELYRYYEQMLHSD.RIDLFV--LG.EKGD.PSLMSTVE....DTFSKLA.-------------------------
O87529_STRPY/177-351KETAYTSYQEFHKMLNED.QIDIFI--LGDFDDY..RVVQLIH....QFP..LDN-------------------------
Y5738_STRCO/198-380ALTADRIRRFYRKHYDPT.HLVVAA--AGNVDHN..KVVRQVR....AAFEKSGA-------------------------
O25371_HELPY/185-361KIKLDDLKQQFAKVFELN.KLVVVL--GGDLKID..QTLKRLN....NALNFLP.-------------------------

PF03410

MP44_MCV1/1-592RAE.DYLAALETAVSWFFARG-----------------------------------------------------------
G1_VAR67/1-591NSA.TESDAIRTLVSWFFSNG-----------------------------------------------------------
MP44_MYXVL/1-589RGRATSVDAVRTLISWFFDKD-----------------------------------------------------------

PF00675

AXL1_YEAST/34-179-------------------SA-----------------------------------------------------------
IDE_HUMAN/74-212-------------------LG-----------------------------------------------------------
YMXG_BACSU/12-160-------------------KG-----------------------------------------------------------
YQA4_CAEEL/37-175-------------------LG-----------------------------------------------------------
IDE_DROME/47-185-------------------LG-----------------------------------------------------------
MPPA_YEAST/29-176-------------------KS-----------------------------------------------------------
NRDC_RAT/210-348-------------------MG-----------------------------------------------------------
PTRA_ECOLI/54-192-------------------MG-----------------------------------------------------------
QCR1_BOVIN/58-205-------------------KG-----------------------------------------------------------
MPPB_NEUCR/50-198-------------------KG-----------------------------------------------------------
QCR2_EUGGR/64-216-------------------KD-----------------------------------------------------------
MPPB_RAT/68-215-------------------KG-----------------------------------------------------------
MPPB_YEAST/36-184-------------------KG-----------------------------------------------------------
QCR2_YEAST/17-163-------------------QN-----------------------------------------------------------
PQQL_HAEIN/45-188-------------------NG-----------------------------------------------------------
UCR1_CAEEL/48-195-------------------KG-----------------------------------------------------------
PQQF_KLEPN/15-154-------------------YG-----------------------------------------------------------
MPPA_SOLTU/85-231-------------------KS-----------------------------------------------------------
SDP_EIMBO/44-183-------------------LG-----------------------------------------------------------
QCR1_EUGGR/37-184-------------------KG-----------------------------------------------------------
MPPA_NEUCR/62-209-------------------KS-----------------------------------------------------------
PQQF_PSEFL/28-167-------------------LG-----------------------------------------------------------
PQQL_ECOLI/46-204-------------------NG-----------------------------------------------------------
MPPA_HUMAN/77-227-------------------SS-----------------------------------------------------------
QCR2_BOVIN/48-194-------------------LT-----------------------------------------------------------
QCR1_YEAST/37-182-------------------SK-----------------------------------------------------------

PF02664

LUXS_HAEIN/2-162-------------------E------------------------------------------------------------
LUXS_ECOLI/2-162-------------------E------------------------------------------------------------
LUXS_BACSU/2-156-------------------Q------------------------------------------------------------
LUXS_HELPJ/3-151-------------------D------------------------------------------------------------
LUXS_BORBU/2-157-------------------E------------------------------------------------------------

PF05193

QCR1_MOUSE/210-395-------------------V............................................................
IDE_HUMAN/236-418-------------------KNV..........................................................
IDE_HUMAN/706-889-------------------HAHT................................K.P......................
YMFH_BACSU/182-363-------------------TD...........................................................
YMXG_BACSU/165-338-------------------.............................................................
YQA4_CAEEL/603-787-------------------SVAP................................N.S......................
QCR2_MOUSE/199-378-------------------LGLA...............................GA.KA.....................
YQA4_CAEEL/200-382-------------------DAIK................................N.T......................
PREP1_ARATH/301-489-------------------SPS.................................P.N......................
IDE_DROME/209-391-------------------KNV..........................................................
Q9YFN7_AERPE/166-342-------------------.............................................................
IDE_DROME/679-863-------------------TNAS................................K.L......................
Q9RRH6_DEIRA/141-315-------------------.............................................................
PQQL_ECOLI/206-388-------------------NK...........................................................
Q9X167_THEMA/162-335-------------------NK...........................................................
Q9U6C9_TOXGO/170-352-------------------AFEA................................N.V......................
Q97N46_STRPN/177-351-------------------GDVKVQ...........................YCQP.YSNI...................
Q9JS80_CHLPN/201-385-------------------LEKQ................................A.V......................
Q9I6C2_PSEAE/203-388-------------------R............................................................
Q9ANJ4_BRAJP/5-169-------------------NAEA................................M.P......................
MPPB_SCHPO/185-372-------------------SAEQ...............................LS.LG.....................
PXM16_ARATH/666-854-------------------N............................................................
MPPB_LENED/192-381-------------------..VS................................A.N......................
Q9KUG7_VIBCH/219-398-------------------.............................................................
O50511_STRCO/185-366-------------------H............................................................
Q9UVF2_YARLL/538-703-------------------NE...........................................................
Q49146_METEX/5-143-------------------.............................................................
PTRA_ECOLI/681-858-------------------.............................................................
MPPB_NEUCR/203-391-------------------TAP..........................................................
Q9RRH5_DEIRA/126-298-------------------.............................................................
QCR2_NEUCR/198-375-------------------TSSG................................N.L......................
Q985V3_RHILO/166-339-------------------.............................................................
Q9AXQ2_CUCME/257-443-------------------EP...........................................................
Q9PLB7_CHLMU/208-391-------------------SSK..........................................................
Q9FJT9_ARATH/639-833-------------------PPQP................................V.L......................
Q23295_CAEEL/192-374-------------------GDSS................................T.E......................
CYM1_YEAST/735-911-------------------GSC.................................L........................
O67308_AQUAE/184-360-------------------R............................................................
O84812_CHLTR/225-408-------------------SAQ..........................................................
Q9M9Z4_ARATH/748-933-------------------IFKD...............................SL.TV.....................
SDP_EIMBO/201-391-------------------GHADW..............................LG.MV.....................
P73670_SYNY3/182-362-------------------RSEC...............................PP.TT.....................
Q9VP94_DROME/242-425-------------------SQQN................................S.I......................
Q9Z6V1_CHLPN/209-393-------------------SKN..........................................................
Q97II7_CLOAB/206-391-------------------KNI..........................................................
YPD1_CAEEL/194-376-------------------H............................................................
Q9VYT3_DROME/284-473-------------------NEVK................................A.P......................
MPPA_HUMAN/232-431-------------------AW...........................................................
Q9ZIG1_RHOSI/193-288-------------------.............................................................
MPPA_YEAST/181-374-------------------.............................................................
Q9XBW5_PORGN/207-395-------------------P............................................................
Q9VFF0_DROME/203-385-------------------SVL..........................................................
MPPB_YEAST/189-380-------------------SE...........................................................
O83069_TREPA/199-385-------------------RKA..........................................................
QCR1_EUGGR/190-391-------------------G............................................................
Q9M9Z4_ARATH/273-458-------------------GS...........................................................
O61441_HAEIR/3-170-------------------GTG.................................S.N......................
O25656_HELPY/198-379-------------------LDEK...............................AI.PT.....................
Y228_BORBU/711-879-------------------LE...........................................................
Q9A579_CAUCR/219-397-------------------.............................................................
MPPB_BLAEM/198-380-------------------GSGK................................A.K......................
MPPA2_ARATH/235-419-------------------VPR..........................................................
Q9PLB7_CHLMU/683-862-------------------PY...........................................................
PXM16_ARATH/198-379-------------------TNK..........................................................
Q9PF62_XYLFA/244-422-------------------GPP..........................................................
Q9CE72_LACLA/168-341-------------------TD...........................................................
Q22370_CAEEL/182-353-------------------.............................................................
Q9XBW5_PORGN/690-872-------------------LK...........................................................
Q9RWP9_DEIRA/229-413-------------------QDLD................................V.S......................
Q9JMV9_BRAJP/168-341-------------------TPGP................................K.P......................
PTRA_ECOLI/213-396-------------------KES..........................................................
Q97IL0_CLOAB/163-340-------------------.............................................................
Q17593_CAEEL/199-381-------------------NKKA................................E.S......................
Q9A2H7_CAUCR/672-850-------------------PATP................................P.P......................
Q9A531_CAUCR/720-903-------------------RPG..........................................................
MPPA_SCHPO/208-400-------------------SSLP................................P.L......................
Q9SCM5_ARATH/200-381-------------------T............................................................
Q9HT96_PSEAE/190-362-------------------HE...........................................................
Q9I6C3_PSEAE/229-405-------------------.............................................................
PREP_DROME/784-953-------------------TFGK................................T.Q......................
Q17592_CAEEL/199-354-------------------DTIE................................N.K......................
Q9UVF2_YARLL/16-206-------------------SK...........................................................
STE23_YEAST/246-428-------------------NGR..........................................................
Q9KUG7_VIBCH/686-864-------------------.............................................................
Q9KQC8_VIBCH/661-839-------------------TYEE...............................SL.RP.....................
Q9VV75_DROME/190-364-------------------GGSK...............................AA.SA.....................
PQQL_HAEIN/205-388-------------------IT...........................................................
MPPA_SOLTU/236-422-------------------VAT..........................................................
YAN2_SCHPO/193-378-------------------NGII...............................TP.PT.....................
NRDC_HUMAN/837-1020-------------------K.PL................................E.Q......................
Q9JS80_CHLPN/718-886-------------------..Y.................................L........................
Q9U7N7_PLAFA/914-1104-------------------..HLFVNSNESL................KNLVSYFEE.NDKYINDMQ..............
O84831_CHLTR/201-385-------------------.............................................................
Q9A579_CAUCR/657-835-------------------.............................................................
Q9FIH8_ARATH/360-598-------------------DNESTPSSPSPGAFGA........MANFLVPKLPAGL.GGTFSNEKTNTAD.......QSK
Q9A531_CAUCR/246-428-------------------KG...........................................................
O84812_CHLTR/700-879-------------------PY...........................................................
Q40983_PEA/925-1150-------------------ATGN................................F.K......................
Q49145_METEX/235-418-------------------QGAR...............................PL.RT.....................
CYM1_YEAST/221-407-------------------RAR.................................K........................
Q97EV0_CLOAB/207-392-------------------IEV..........................................................
Q9VYT3_DROME/769-953-------------------K............................................................
QCR1_YEAST/187-370-------------------.............................................................
Q9TZ33_CAEEL/181-355-------------------HIIT...............................NQ.GS.....................
Q9FNU9_DACGL/238-423-------------------ATG..........................................................
Q40738_ORYSA/2-120-------------------VKR..........................................................
Q9VP94_DROME/724-907-------------------EKLD................................N.L......................
O67945_AQUAE/183-355-------------------.............................................................
Q9KRD3_VIBCH/199-378-------------------GSTE...............................KP.AS.....................
Q9FIH8_ARATH/928-1156-------------------SHDS................................A.K......................
Q41445_SOLTU/262-449-------------------NP...........................................................
MU138_SCHPO/668-850-------------------KPV..........................................................
Q9ANJ2_BRAJP/2-119-------------------.............................................................
Q9PL96_CHLMU/717-886-------------------RLG..........................................................
Q41444_SOLTU/259-445-------------------NP...........................................................
NRDC_HUMAN/361-548-------------------NGL.................................P.R......................
Q9U7N7_PLAFA/282-510-------------------SK...........................................................
Q97EV0_CLOAB/725-889-------------------I............................................................
QCR2_EUGGR/221-398-------------------NKVG................................G.V......................
QCR2_SCHPO/182-354-------------------.............................................................
P74016_SYNY3/241-420-------------------SG...........................................................
Q9RHS7_9LACT/2-99-------------------.............................................................
Q9TAP0_TOXGO/4-197-------------------PK...........................................................
Q99UJ4_STAAM/179-355-------------------D............................................................
MU138_SCHPO/196-378-------------------KAV..........................................................
Q55159_SYNY3/175-359-------------------VKSP................................S.Q......................
MPPA1_ARATH/239-423-------------------.............................................................
O50512_STRCO/190-374-------------------S............................................................
PQQL_HAEIN/680-857-------------------.............................................................
O84831_CHLTR/717-886-------------------RL...........................................................
Q9KA85_BACHD/165-338-------------------.............................................................
P74305_SYNY3/274-453-------------------.............................................................
Y2805_MYCBO/178-357-------------------RGR..........................................................
Q9CML5_PASMU/205-388-------------------HS...........................................................
O87530_STRPY/183-363-------------------PDRK................................R.V......................
MPPB_HUMAN/220-404-------------------.............................................................
Q9Z6V1_CHLPN/688-867-------------------SH...........................................................
Y219_RICPR/168-341-------------------.............................................................
O51486_BORBU/686-867-------------------KE...........................................................
Q9A308_CAUCR/166-339-------------------.............................................................
Q9KA98_BACHD/181-363-------------------KP...........................................................
PQQF_PSEAE/179-352-------------------R............................................................
YO098_YEAST/193-378-------------------NIPK................................K.R......................
PQQF_KLEPN/173-343-------------------G............................................................
YHJJ_ECOLI/199-378-------------------.............................................................
Q9KQC8_VIBCH/196-377-------------------PQ...........................................................
Q983M8_RHILO/208-384-------------------.............................................................
Q9RTZ9_DEIRA/246-424-------------------PW...........................................................
Y4WA_RHISN/251-435-------------------GP...........................................................
Y4WB_RHISN/198-374-------------------.............................................................
MPPA_NEUCR/214-475-------------------SDAPGLSRTGSETSVDSLVSESSEASSESSSSSSDSSESSGGLLSKLFSPKAKKATPNPFL
P73669_SYNY3/171-348-------------------.............................................................
Q9CE73_LACLA/164-346-------------------.............................................................
Q9KRD3_VIBCH/671-849-------------------S............................................................
Q9RTZ9_DEIRA/703-883-------------------.............................................................
UCR1_CAEEL/200-386-------------------EY...........................................................
Q9PF62_XYLFA/714-895-------------------PS...........................................................
Q40983_PEA/357-594-------------------DNEKGSVATSSAFGA.........MASFLVPKLSVGL.GGNSIERPTNTTD........QS
MPPA_RAT/231-430-------------------AWG..........................................................
QCR2_YEAST/166-327-------------------.............................................................
O51486_BORBU/206-392-------------------.............................................................
PQQL_ECOLI/683-863-------------------SD...........................................................
O16249_CAEEL/747-931-------------------SAAP...............................NS.RP.....................
Q97LA3_CLOAB/174-348-------------------D............................................................
Q9RWP9_DEIRA/777-912-------------------GHPH................................P.Q......................
Q983M9_RHILO/206-390-------------------GP...........................................................
Q9A2H7_CAUCR/210-390-------------------PA...........................................................
Q99UJ3_STAAM/181-363-------------------VN...........................................................
O16249_CAEEL/258-440-------------------DAIE................................N.K......................
PQQF_PSEFL/185-366-------------------.............................................................
Q97N47_STRPN/186-364-------------------KDSD................................F.Q......................
Q97GF6_CLOAB/170-348-------------------.............................................................
PREP_DROME/268-457-------------------VDNS................................Y.S......................
STE23_YEAST/716-898-------------------NNIH................................N.L......................
Y228_BORBU/195-380-------------------KEK..........................................................
Q9CML5_PASMU/680-857-------------------.............................................................
MPPA_BLAEM/177-373-------------------STRAPSSV.......................THSDIE.TAYVGG.................
Q9KA97_BACHD/184-365-------------------..TY................................Q.K......................
O87529_STRPY/177-351-------------------RN...........................................................
Y5738_STRCO/198-380-------------------LKD..........................................................
O25371_HELPY/185-361-------------------.............................................................

PF03410

MP44_MCV1/1-592---------ALRTDFSRVRIRNYVRELENEYYFRNE---------VFHCMDILTFLGGGDLYNGGRLSMLEQLDAVRELL
G1_VAR67/1-591---------KLKDNFSLSSIRFHIKELENEYYFRNE---------VFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDML
MP44_MYXVL/1-589---------GLKDDFPVSKIKYHIKELENEYYFRNE---------VFHCMDALTFLANGDLYNGGRLSMLDRLEDIPLIL

PF00675

AXL1_YEAST/34-179---------GSKKYPDPGLFHTLIAKNNGSQ....N---------AFTTGEQTTFY------------------------
IDE_HUMAN/74-212---------.TKKYPKENEYSQFLSEHAGSS....N---------AFTSGEHTNYY------------------------
YMXG_BACSU/12-160---------.TSTKSA.REIAESFDRIGGQV....N---------AFTSKEYTCYY------------------------
YQA4_CAEEL/37-175---------.TAKYPSEREYFKYLAANNGDS....N---------AYTDTDHTNYS------------------------
IDE_DROME/47-185---------.TEKYPHENGYTTYLSQSGGSS....N---------AATYPLMTKYH------------------------
MPPA_YEAST/29-176---------.TEHVEG.RAMAETLELLGGNY....Q---------CTSSRENLMYQ------------------------
NRDC_RAT/210-348---------.SLKYPDENGFDAFLKKHGGSD....N---------ASTDCERTVFQ------------------------
PTRA_ECOLI/54-192---------.SKKYPQADSLAEYLKMHGGSH....N---------ASTAPYRTAFY------------------------
QCR1_BOVIN/58-205---------.TKNRPG.NALEKEVESMGAHL....N---------AYSTREHTAYY------------------------
MPPB_NEUCR/50-198---------.TTKRTQ.QQLELEIENMGAHL....N---------AYTSRENTVYF------------------------
QCR2_EUGGR/64-216---------..GLTSSEYITKTFLQKAGIIVH..EP---------TVVNKSAIAFT------------------------
MPPB_RAT/68-215---------.TKKRSQ.LDLELEIENMGAHL....N---------AYTSREQTVYY------------------------
MPPB_YEAST/36-184---------.TQNRSQ.QGIELEIENIGSHL....N---------AYTSRENTVYY------------------------
QCR2_YEAST/17-163---------.TNTRSA.LKLVRESELLGGTF....K---------STLDREYITLK------------------------
PQQL_HAEIN/45-188---------.SKKYPE.NQIINALEKLGMKFARDIN---------AFTDFENTVYT------------------------
UCR1_CAEEL/48-195---------.TGKRAS.AALESELNAIGAKL....N---------SFTERDQTAVF------------------------
PQQF_KLEPN/15-154---------.GERYQDDDRLMGWVQRQGGSV....N---------ATTLARHSAFF------------------------
MPPA_SOLTU/85-231---------.TLNRSH.LRIVREIEAIGGNV....T---------ASASREHMIYT------------------------
SDP_EIMBO/44-183---------.TSKYPEPESYDSFLTESGGAN....N---------AYTDEEKTVFF------------------------
QCR1_EUGGR/37-184---------.TGKRSR.QDIEFGMEKMGAHL....N---------AYTSREHTCYY------------------------
MPPA_NEUCR/62-209---------.TSTRTA.DEMLETVEKLGGNI....Q---------CASSRESMMYQ------------------------
PQQF_PSEFL/28-167---------.TERFPVEQGLMAYVRAQGGQL....N---------ARTCERATEFF------------------------
PQQL_ECOLI/46-204---------.TKTWPG.NKVIETFESMGLRFGRDVN---------AYTSYDETVYQ------------------------
MPPA_HUMAN/77-227---------.TARFDSKDEILLTLEKHGGIC....D---------CQTSRDTTMYA------------------------
QCR2_BOVIN/48-194---------.TKGASS.FKITRGIEAVGGKL....S---------VTSTRENMAYT------------------------
QCR1_YEAST/37-182---------....ENS.....AVAAKEGLAL....S---------SNISRDFQSYI------------------------

PF02664

LUXS_HAEIN/2-162------------.ILSPKGIHTLEHLFAGFMRDHLN---------.GDSIEIIDIS------------------------
LUXS_ECOLI/2-162------------.VMPERGIHTLEHLFAGFMRNHLN---------.GNGVEIIDIS------------------------
LUXS_BACSU/2-156------------.AMKPDTIHTLEHLLAFTIRSHAE---------KYDHFDIIDIS------------------------
LUXS_HELPJ/3-151------------.HMDMPSLHSLEHLVAEIIRNHAN---------.....YVVDWS------------------------
LUXS_BORBU/2-157------------PIIENAAIHTIEHIGATLLRNNEV---------W..TEKIVYFG------------------------

PF05193

QCR1_MOUSE/210-395............YEEDAVPGLTPCRFTGSEIRHRDD.........AL.PLAHVAIA------------------------
IDE_HUMAN/236-418...........PLPEFPEHPFQEEHLKQLYKIVPIK.........D...IRNLYVT------------------------
IDE_HUMAN/706-889..........LLPSQLVRYREVQLPDRGWFVYQQRN.........EVHNNCGIEIY------------------------
YMFH_BACSU/182-363............QPEIKREEVKEQEAVFRKEKEIKM.........NV.QGPKCLVG------------------------
YMXG_BACSU/165-338............KGKATGLEKP..EFHTEKLTRKKE.........T..EQAHLCLG------------------------
YQA4_CAEEL/603-787.........RPLKRDEHNPHRELQLINGHEHVYRHF.........Q..KTHDVGCV------------------------
QCR2_MOUSE/199-378.........KYRGGEIREQNGD.......................N...LVHAAIV------------------------
YQA4_CAEEL/200-382.........RKERKIWKDSPFGPDQLAKRIEIVPIQ.........N...TGQVSIK------------------------
PREP1_ARATH/301-489..........SSKIKFQKLFSEPVRLVEKYPAGRDG.........DLKKKHMLCVN------------------------
IDE_DROME/209-391..........KVPGWPRHPYAE.ERYGQKVKIVPIK.........D...IRSLTIS------------------------
Q9YFN7_AERPE/166-342...............PGGKVREPETPEPRTTFLREE.........RGIEAAYAALT------------------------
IDE_DROME/679-863..........PILARQMLKKREYKLLAGDSYLFEKE.........NEFHKSSCAQL------------------------
Q9RRH6_DEIRA/141-315............SGTPRLPDAAPAPHWPGQVRWVTD.........PELTRTQVALA------------------------
PQQL_ECOLI/206-388............AAENRVWPTK.AENHLRFNIINDKE.......NRV.NGIALYYR------------------------
Q9X167_THEMA/162-335............PGDPLPPPPSFEHTEPRYIVRNDL.........E...QVHIAMA------------------------
Q9U6C9_TOXGO/170-352.........ASP............VYTGGDVRLETP.........S..PHAHMAIA------------------------
Q97N46_STRPN/177-351.......LQEGM...................VRKNV.........G...QSILELG------------------------
Q9JS80_CHLPN/201-385.........SVP...LQKRFKDPVRNILTYPVDHQE.........E..DKVLFGIS------------------------
Q9I6C2_PSEAE/203-388............QLPPARKPLELAEPGERRLKLYVR.........T..QLPNLIMG------------------------
Q9ANJ4_BRAJP/5-169.........VAD..........VIAAKPPQRVFIQL.........DV.PQTVVTFG------------------------
MPPB_SCHPO/185-372.........APRGLKPRFVGSE.........IRARD.........DDSPTANIAIA------------------------
PXM16_ARATH/666-854............DPKPICRPLFPSQHLTNRVVKLGE.........G....MKYFYH------------------------
MPPB_LENED/192-381.........PLALGRLSSERKP..TFVGSEARIRDD.........EL.PTAHVAIA------------------------
Q9KUG7_VIBCH/219-398............GPDVVDAPKQPARLSEDRFITLED.........RV.QQPMLLIG------------------------
O50511_STRCO/185-366............DGKQPPRDGALPDVMGGELREVVE.........EEVPARALMAA------------------------
Q9UVF2_YARLL/538-703............SPFNISSLSIPMTTPTSTLFKLPF.........Q...VNYAGIA------------------------
Q49146_METEX/5-143............AGPLKAIPPT.AINELGRRIVVDL.........DV.PQSVIRFG------------------------
PTRA_ECOLI/681-858............DGSEWCRNKDVVVDKKQSVIFEKA.........G..NSTDSALA------------------------
MPPB_NEUCR/203-391..........VSSASILSKKKP..DFIGSDIRIRDD.........TI.PTANIAIA------------------------
Q9RRH5_DEIRA/126-298............PGEDRPMPAH..FQPGLRLHLPSA.........TG.EQTHLSLV------------------------
QCR2_NEUCR/198-375.........NTA..........ASKYFGGEQRVAKN.........G...KNAIVIA------------------------
Q985V3_RHILO/166-339............KADSTIPQYA.QYVGGDFREDRDL.........M...DAQIVLG------------------------
Q9AXQ2_CUCME/257-443............TTAAQLVAKEPAIFTGSEVRIVDD.........DV.PLAQFAIA------------------------
Q9PLB7_CHLMU/208-391..........YTPQTPFTKTQDTSSLNKLFINKAVE.........P...SPQLAIY------------------------
Q9FJT9_ARATH/639-833.........NFNRDDLKGLPFTFPTKITKEFVRSPM.........VE.AQCSVQLC------------------------
Q23295_CAEEL/192-374.........FVP...........ATYSPCEVRGDIP.........DL.PMLYGAMV------------------------
CYM1_YEAST/735-911..........PNGPKTSDYPLI.GSKCKHTLIKFPF.........Q...VHYTSQA------------------------
O67308_AQUAE/184-360............PVPKVQIPTEPEQIGIRFKKLKDP.........RI.EKAYWIIG------------------------
O84812_CHLTR/225-408..........YTPQKPFPKTQD..TTALNKLFINKA.........VE.PSPQLAIY------------------------
Q9M9Z4_ARATH/748-933.........EPLPSKCRHGEQITCFPMGAKLVRDVNVK.....NKSE.TNSVVELY------------------------
SDP_EIMBO/201-391.........QCPGPMFDTVKPFDESNTGKFIHLQSF.........S..SEPSLWVA------------------------
P73670_SYNY3/182-362.........RLPNHPIQTIKRE.......TLRIPEL.........G...PSRLTMG------------------------
Q9VP94_DROME/242-425.........DVSQLNYQKAFRD..QFYKDVFLVQPV.........E..DVCKLELT------------------------
Q9Z6V1_CHLPN/209-393...........YERQEPFLPSGDTSSLKNLYINQAI.........Q..PTSNLEIY------------------------
Q97II7_CLOAB/206-391..........DADIKVNGAFSKVHEKELEYSISEGE.........SENDKTYFGMS------------------------
YPD1_CAEEL/194-376............FPKPFSFALSDIKESTVHRVECPT.........DDASRGAVEVA------------------------
Q9VYT3_DROME/284-473.........DLSSFNYKDAFKA..EFHEQVFFVKPV.........E..NETKLELT------------------------
MPPA_HUMAN/232-431...........GSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVG------------------------
Q9ZIG1_RHOSI/193-288.............................................RA.PHPIPARC------------------------
MPPA_YEAST/181-374............STHPP.ITKKVAQYTGGESCIPPAPV.....FGNLPELFHIQIG------------------------
Q9XBW5_PORGN/207-395............VNPAERIYTPVEDNDEPIVAIATD.........AEATTTQLSIS------------------------
Q9VFF0_DROME/203-385..........PA.......EVTPCRFTGSEVRVRDD.........SL.PLAHVAIA------------------------
MPPB_YEAST/189-380............SPVPLGSPRGPLPVFCRGERFIKE.........NTLPTTHIAIA------------------------
O83069_TREPA/199-385..........LPPIPPIPAYQSPRTYTGYAPASEGM.........DL.TRCAVLLS------------------------
QCR1_EUGGR/190-391............QPKPSGFTRF...LGGDKRETNQL.........N..PLTHVAVA------------------------
Q9M9Z4_ARATH/273-458............KIRPTLEAEGPIWKGGKLYRLEAV.........K..DVHILDLT------------------------
O61441_HAEIR/3-170..........YYGGDARKDTPG.......................N...MAHVAVA------------------------
O25656_HELPY/198-379.........PYMKEPKQDGART.........AVVHK.........DGVHLEWVALG------------------------
Y228_BORBU/711-879............ESNHYNGLLNLDANSKALREIIII.........QS.KVAFNAIC------------------------
Q9A579_CAUCR/219-397............SGPPVTRQKEWIAKRTGSQRAEMQ.........DRVPQTRIYKV------------------------
MPPB_BLAEM/198-380.........FVR...........PAFTGSDVRIRVD.........DM.PTAHIALA------------------------
MPPA2_ARATH/235-419..........PAEPKSQYVGGD.........FRQHT.........GG.EATHFALA------------------------
Q9PLB7_CHLMU/683-862............DPPSYYPKRK..PLFTTDFSFQYP.........L...SGNGMLL------------------------
PXM16_ARATH/198-379...........VVPRFPGQPCTADHLQILVKAIPIK.........Q...GHKLGVS------------------------
Q9PF62_XYLFA/244-422...........VAHQHPWITPLPAQKRGVQYDQVSQ.........P.....RLYRT------------------------
Q9CE72_LACLA/168-341............RAVSKEISYQ.QSLTESSVVTDEK.........EV.AQSILQFA------------------------
Q22370_CAEEL/182-353............PIRSGNAASPSSSAYKGGEVRRDA.........DS.KYAHVIVA------------------------
Q9XBW5_PORGN/690-872............RGDKMNKAQVPAARSGKIDCKFEK.........EMDTPSTTIFD------------------------
Q9RWP9_DEIRA/229-413.........IPD.......QTNFSEPRRMDVSYPGS.........DTERGGQVLLG------------------------
Q9JMV9_BRAJP/168-341.........QAA............QFGKGGAKVVHR.........EL.EQAHLALA------------------------
PTRA_ECOLI/213-396...........KKPEITVPVVTDAQKGIIIHYVPAL.........PR.KVLRVEFR------------------------
Q97IL0_CLOAB/163-340............REKPSLFDYEYEKN.TSGIFTSKM.........DV.KGAVIQYL------------------------
Q17593_CAEEL/199-381.........KVW....AEFQYGPDQLAKKIDVVPIK.........D...KKLVSII------------------------
Q9A2H7_CAUCR/672-850.........APPAAPTGYQPRN.........VVIDL.........PGTGQAAVVLA------------------------
Q9A531_CAUCR/720-903...........DPPLPGAEKAPFPAPSKEPVIRTHK.........GRPDQAALFMT------------------------
MPPA_SCHPO/208-400.........EAIPSHYTGGFMG.IKKSEAPPVPYQQ.........E...FTHVVIA------------------------
Q9SCM5_ARATH/200-381............NQGIPRFPGQPCTLDHLQVLVKAV.........PIMQGHELSVS------------------------
Q9HT96_PSEAE/190-362............LPERRELPAANGHAEARRTLITRP.........FG.EGAMLHWI------------------------
Q9I6C3_PSEAE/229-405............QGPALAKTVQ.PETPKPGLTHIDF.........PS.EQTHLMLA------------------------
PREP_DROME/784-953.........TSRNIHYLDPSCQ..........QYVM.........NI.PVNYCAKA------------------------
Q17592_CAEEL/199-354.........KVE.................................R........KV------------------------
Q9UVF2_YARLL/16-206...........TPGNTERLPLEFSSAAENTRIVEEGPID...TLLDTSKQHKMSMS------------------------
STE23_YEAST/246-428...........EVPLYAEPIMQPEHLQKIIQVRPVK.........D...LKKLEIS------------------------
Q9KUG7_VIBCH/686-864............EAAPLINPQVVPTLTKQKIYLVDK.........PGAPQSIIRMV------------------------
Q9KQC8_VIBCH/661-839.........LVMLGKSGTFQRE.........VQCQQ.........D...DSAIVVY------------------------
Q9VV75_DROME/190-364.........NWYGGDARKDTSG.......................H...RAVVAVA------------------------
PQQL_HAEIN/205-388............KTTLEKIDFNIPLINKWRLDSISE.........QGTTIPSIELS------------------------
MPPA_SOLTU/236-422..........IEEPKPVYVGGD.........YRCQA.........DA.EMTHFALA------------------------
YAN2_SCHPO/193-378.........WTRPWCSTNVDYTIPEPILKTVKFSSE.........DE.YTGSVSLA------------------------
NRDC_HUMAN/837-1020..........EMPVQFQVVELPSGHHLCKVKALNKG.........D..ANSEVTVY------------------------
Q9JS80_CHLPN/718-886..........IVIPEPWENPSINLYVTSRGLHIPAR.........A....AFNALA------------------------
Q9U7N7_PLAFA/914-1104.NKVNDPTVMGWNEEIKSKKLFDEEKVKKEFFVLPT.........F...VNSVSMS------------------------
O84831_CHLTR/201-385............KVEKQSVTLPLQKRFKEPVRVIERYPS...DGADE.DKVLFGLA------------------------
Q9A579_CAUCR/657-835............GAQAKAKPPITVAPNKGAVYLIDK.........PGAQQSMLMVG------------------------
Q9FIH8_ARATH/360-598MIKRERHAIRPPVEHNWSLPGTSVDLKPPQIFKHEL.........LQ.NFAINMFC------------------------
Q9A531_CAUCR/246-428...........PNGKDPDVGPVAKRGPTAKMFVEAG.........AP.WSIQMTWT------------------------
O84812_CHLTR/700-879............AAPSYYPQRK.......................PL.SSTKLSFQ------------------------
Q40983_PEA/925-1150.........NQQQIIPPTFRLSPSSLQSQEVFLNDT.........D..ERACAYIA------------------------
Q49145_METEX/235-418.........RPREPEPRAMRRI.........AVADP.........KV.EQPTLQRL------------------------
CYM1_YEAST/221-407..........DKLLMPIDLKKDIDVKLLGQIDTMLP.........PE.KQTKASMT------------------------
Q97EV0_CLOAB/207-392..........DSKIEPQKPIGKLVESSHEYPILQDE.........GEKDKTYLSLN------------------------
Q9VYT3_DROME/769-953............QIRERGRFLEDITVKLPVGTSIIRCHA..LNVQDT.NTVITNFY------------------------
QCR1_YEAST/187-370............GTKPVLKKKA..AFLGSEVRLRDD.........TL.PKAWISLA------------------------
Q9TZ33_CAEEL/181-355.........PFRGGDYRRFARG.......................N...DVHIMVA------------------------
Q9FNU9_DACGL/238-423..........TAKPKSVYVGGE.........YRRAA.........DS.SNTEIALA------------------------
Q40738_ORYSA/2-120..........PEEPKSVYVGGD.........YRCQA.........DS.DKTHIALA------------------------
Q9VP94_DROME/724-907.........SALDNHLLQIPLG..SYYLRAKTLNED.........DS.NTIITNYY------------------------
O67945_AQUAE/183-355............KGKFELSSVN.KKIEKNEVKRVKR.........EG.TQATILCA------------------------
Q9KRD3_VIBCH/199-378.........IYH...........QALNNQDLVAPVT.........AG.ESPSLTLI------------------------
Q9FIH8_ARATH/928-1156..........PPGSEPILFRQPTAGLQFQQVFLKDT.........D..ERACAYIA------------------------
Q41445_SOLTU/262-449...........IITTSQLVSEEPAIFTGSEIRIIDD.........DL.PLAQFAVA------------------------
MU138_SCHPO/668-850...........FASQLSRKRAIIVPEGGNYIYKTVVP......NKEE.KNSAIMYN------------------------
Q9ANJ2_BRAJP/2-119.............................................RV.EQPALRRY------------------------
Q9PL96_CHLMU/717-886...........SGELWRNPVLD..KVNDSRGIMIPA.........R...GAYNVLS------------------------
Q41444_SOLTU/259-445............TTASELVAREPAIFTGSEVRVIDD.........DI.PLAQFAVA------------------------
NRDC_HUMAN/361-548..........PNFGHLTDPFDT.PAFNKLYRVVPIR.........K...IHALTIT------------------------
Q9U7N7_PLAFA/282-510............YRDDAVESVEYQTYKKGPFYIKKKYG....DHSEE.KENLVSVA------------------------
Q97EV0_CLOAB/725-889............KLKSFEVPAKSEEYNKVAQSNNEG.........LI.TSSKVQYA------------------------
QCR2_EUGGR/221-398.........AAPASKYSGGEGYDVVHRAKEFDDQFT.........DV.YSTYTAYA------------------------
QCR2_SCHPO/182-354............DGSPLKSAPT..KISSGESRVYSK.........G...TNYFCLG------------------------
P74016_SYNY3/241-420............TVPQLTPPSASQVNDSEVFLVNLP.........HV.TQSNVLLG------------------------
Q9RHS7_9LACT/2-99.............................................P..........------------------------
Q9TAP0_TOXGO/4-197............RSKIILPTEK.PFFCGSELLHRND.........DMGPTAHVAVG------------------------
Q99UJ4_STAAM/179-355............KHQFQHSTHH.LHDEEVDYIVEYD.........DV.DQAKLNMG------------------------
MU138_SCHPO/196-378...........PIPKFPDPPYTDNEVRKICYVKPVK.........N...LRRLDIV------------------------
Q55159_SYNY3/175-359..........TLMPPLVNIPPPFTKVETTTVVDDSL.........Q...QARLILL------------------------
MPPA1_ARATH/239-423............NVPPQLAPKS..QYVGGDFRQHTG.........G..EATHFAVA------------------------
O50512_STRCO/190-374............AAEPRPVPPVTADDRGRVVIVDRP.........GA.VQTQLLIG------------------------
PQQL_HAEIN/680-857............KTQIRHFVPTIIHTPTQSFIMNGL.........KE.PRADVEIY------------------------
O84831_CHLTR/717-886...........EGGELWKNPVLDVVKDSRGIVIPAR.........G....AYNVLA------------------------
Q9KA85_BACHD/165-338............PTTYNYQGEKPMFLPNRIVRKKET.........E...QAHLCLG------------------------
P74305_SYNY3/274-453............QRPPTPQVTVVEPPQTQQKEINLT.........LP.SQPWYFEG------------------------
Y2805_MYCBO/178-357...........RPVAPRKGTGR..VNGSPRLTLVSR.........DA.EQTHVSLG------------------------
Q9CML5_PASMU/205-388............TSPLPPIDFSIPFVNQWRVAGISE.........KGTYIPTLELS------------------------
O87530_STRPY/183-363.........TVDPLHYYPVIKS.........SSVDM.........DV.TTAKLVVG------------------------
MPPB_HUMAN/220-404............THKGEIPALPPCKFTGSEIRVRDD.........KM.PLAHLAIA------------------------
Q9Z6V1_CHLPN/688-867............ATKPFYYELQSQEISEIHHDYPLT.........A...NGMLLLL------------------------
Y219_RICPR/168-341............GVKSSFIPAK..YIGGKGFIHKEL.........E...QTSLVLG------------------------
O51486_BORBU/686-867............INEYKDLDYSYSKNFNKIVVRKGK.........NSTSFAYVIYP------------------------
Q9A308_CAUCR/166-339............ATPGVGLAQSAAFVGGPQAEARKL.........E...QAHLVFM------------------------
Q9KA98_BACHD/181-363............AGDIQRFFPAEPEKVAKPHSVISM.........SV.QTPKCLVG------------------------
PQQF_PSEAE/179-352............APGASPPPPPLLPFACEALALRLP.........G...PPRLVLG------------------------
YO098_YEAST/193-378.........PFLDNKLSHIPQSRDKVTESTVEFPEL.........DE.SQGELLFS------------------------
PQQF_KLEPN/173-343............EAPPPAPPLRLGEFTALQLAVSSQ.........P........AL------------------------
YHJJ_ECOLI/199-378............KRETPAPVPTLSPLRAEAVSIMTD.........AV.RQDRLSIM------------------------
Q9KQC8_VIBCH/196-377...........RDIKPLPPFVDREHTGILIQIEPLK.........E...IRKLILA------------------------
Q983M8_RHILO/208-384............QNQALTPVADVEPKLAQRVEVNYD.........L..PQTSLQLA------------------------
Q9RTZ9_DEIRA/246-424............RTLPRQYTEENPQDGERSLTVRRV.........G..DAQYLIVG------------------------
Y4WA_RHISN/251-435............DLPARVRPQEPEQNTKRIVALTDP.........RV.TVPSFQKS------------------------
Y4WB_RHISN/198-374............AGPSLTPVVDAVPKLGRAIRVAYD.........L..PQAQLSLA------------------------
MPPA_NEUCR/214-475TRVPISTEDLTRPAHYTGGFLT..LPSQPPPLNPNL.........P..TFTHIQLA------------------------
P73669_SYNY3/171-348............IPEQSIVCPILTPLNACPQEQLTP.........QATQQSVVLLG------------------------
Q9CE73_LACLA/164-346............FADLSEIQRKEIKASEPISGESLE.........LEVAMPKFALG------------------------
Q9KRD3_VIBCH/671-849............KGTLSPMTSQLIKPVAPRLELALN.........NE.NSTQYSLR------------------------
Q9RTZ9_DEIRA/703-883............AVKYERVKLPLTTPAAQDLVLNVP.........D..KANAIYIA------------------------
UCR1_CAEEL/200-386............PRKVPQVDGT..RFTGSEYRYRND.........NV.PHMYAAFA------------------------
Q9PF62_XYLFA/714-895............TIKSHKQITDVAAQFKPRIFLIHR.........PEAQQSLILAG------------------------
Q40983_PEA/357-594KVFKKERHAVRPPVKHTWSLPGSSANLKPPQIFQHE.........LLQNFSINMFC------------------------
MPPA_RAT/231-430...........APGAVWMLTAQWHSTRGGSSRWRETCQMS.ALRPPRFQSSHIYGG------------------------
QCR2_YEAST/166-327............AGKSLVSKSEPKFFLGEENRVRFI.........G...DSVAAIG------------------------
O51486_BORBU/206-392............PTDKIKEVKVSLDVELKDKFLLLE.........DL.EVGEPSLM------------------------
PQQL_ECOLI/683-863............SPLAAGKPLTRATDNASVTVKEQN.........EPVAQVSQWKR------------------------
O16249_CAEEL/747-931.........LYRNEHNPRRELQ..LNNGDEYVYRHL.........Q..KTHDVGCV------------------------
Q97LA3_CLOAB/174-348............NEKIEKYSTNYCPYGEKVVVNNNV.........NK.NEVKAQFY------------------------
Q9RWP9_DEIRA/777-912.........LAA...................RVPQAR......TTDS.PVAFNALA------------------------
Q983M9_RHILO/206-390............DLPPRIRPVEPEQNTKRTVTLADA.........RV.SVPSFSTQ------------------------
Q9A2H7_CAUCR/210-390............GAIPKVTAVEPARTGPKTVNTYGP.........NV.PLPALAIT------------------------
Q99UJ3_STAAM/181-363............QPKIERGLVDEPEDVKEAFVTESM.........KI.QSPRLMLG------------------------
O16249_CAEEL/258-440.........KVERKVWEEFPYGPDQLAKRIDVVPIK.........D...TRLVSIS------------------------
PQQF_PSEFL/185-366............SGQHLEQTAPPALMTTGNQTYQQL.........SG.QRLDLLFA------------------------
Q97N47_STRPN/186-364.........EVAREKLFLQPVK.......PTDSMRM.........EV.SSPKLAIG------------------------
Q97GF6_CLOAB/170-348............KGEVKDKDIIVEENIPKIVTSHRK.........DI.SQSSIIYM------------------------
PREP_DROME/268-457.........LIRQQERWTQPRL..VHISSRLDNMGT.........TIDRQNQIAIA------------------------
STE23_YEAST/716-898.........QVSNNRLRSYLLP..KGKTFRYETALK.........D..SQNVNSCI------------------------
Y228_BORBU/195-380..........SNVNINIENVKRWEKGKKLTYKIPKE.........NDNSLGVYTIN------------------------
Q9CML5_PASMU/680-857............KHSPRHYYDSSPITPANHFVMHGL.........DE.PRADVEIY------------------------
MPPA_BLAEM/177-373.....SHQLVIPKPPPTHPNYE.......................Q..TLTHVQVA------------------------
Q9KA97_BACHD/184-365..........EAKTDSVPASIPSPEVKEAREVIEKQ.........DV.KQGKLNIG------------------------
O87529_STRPY/177-351............KNLNFFHLQN..SVNIIKESIEKR.........AV.HQSILQLA------------------------
Y5738_STRCO/198-380..........PAAQPLAPRAGRRTVRAAGRVELIGR.........KT.EQAHVILG------------------------
O25371_HELPY/185-361............QGKAYEEPYFETSDKKSEKVLYKD.........T..EQAFVYFG------------------------

PF03410

MP44_MCV1/1-592GKRMRRLAGPNVVIFVRELSPAALALLER---------------------------------------SFGTLPRFPSTI
G1_VAR67/1-591VNRMQRISGSNIVIFVKRLGPGTLDFFNQ---------------------------------------TFGSLPACPEII
MP44_MYXVL/1-589RDRMRTIIGPNVVIFVRELNDVVLSLLAN---------------------------------------TFGRLPACPLTI

PF00675

AXL1_YEAST/34-179-----------------------FELPNT---------------------------------------QNNGEFTFESIL
IDE_HUMAN/74-212-----------------------FDVSHE---------------------------------------H......LEGAL
YMXG_BACSU/12-160-----------------------AKVLDE---------------------------------------H......ANYAL
YQA4_CAEEL/37-175-----------------------FEVRSE---------------------------------------K......LYGAL
IDE_DROME/47-185-----------------------FHVAPD---------------------------------------K......LDGAL
MPPA_YEAST/29-176-----------------------ASVFNQ---------------------------------------D......VGKML
NRDC_RAT/210-348-----------------------FDVQRK---------------------------------------Y......FKEAL
PTRA_ECOLI/54-192-----------------------LEVEND---------------------------------------A......LPGAV
QCR1_BOVIN/58-205-----------------------IKALSK---------------------------------------D......LPKAV
MPPB_NEUCR/50-198-----------------------AKALNE---------------------------------------D......VPKCV
QCR2_EUGGR/64-216-----------------------VEGFRD---------------------------------------TL....AQPAVA
MPPB_RAT/68-215-----------------------AKAFSK---------------------------------------D......LPRAV
MPPB_YEAST/36-184-----------------------AKSLQE---------------------------------------D......IPKAV
QCR2_YEAST/17-163-----------------------ATFLKD---------------------------------------D......LPYYV
PQQL_HAEIN/45-188-----------------------LNLDSN---------------------------------------NQ...QKLELAF
UCR1_CAEEL/48-195-----------------------VQAGAQ---------------------------------------D......VEKVV
PQQF_KLEPN/15-154-----------------------FEVAAD---------------------------------------A......LADGV
MPPA_SOLTU/85-231-----------------------YDALKT---------------------------------------Y......VPQMV
SDP_EIMBO/44-183-----------------------NKVTDS---------------------------------------S......FEEAL
QCR1_EUGGR/37-184-----------------------VKCFKK---------------------------------------D......VPEAV
MPPA_NEUCR/62-209-----------------------AATFNK---------------------------------------A......IPTAV
PQQF_PSEFL/28-167-----------------------FELPAS---------------------------------------A......FAGGL
PQQL_ECOLI/46-204-----------------------VSLPTT---------------------------------------QK...QNLQQVM
MPPA_HUMAN/77-227-----------------------VSADSK---------------------------------------G......LDTVV
QCR2_BOVIN/48-194-----------------------VECLRD---------------------------------------D......VDILM
QCR1_YEAST/37-182-----------------------VSSLPG---------------------------------------S......TDKSL

PF02664

LUXS_HAEIN/2-162-----------------------PMGCRT---------------------------------------------------
LUXS_ECOLI/2-162-----------------------PMGCRT---------------------------------------------------
LUXS_BACSU/2-156-----------------------PMGCQT---------------------------------------------------
LUXS_HELPJ/3-151-----------------------PMGCQT---------------------------------------------------
LUXS_BORBU/2-157-----------------------PMGCRT---------------------------------------------------

PF05193

QCR1_MOUSE/210-395-----------------------VEGPGW...........................................ANPDNVTL
IDE_HUMAN/236-418-----------------------FPIPDL..........................................QKYYKSNPG
IDE_HUMAN/706-889-----------------------YQTDMQ...........................................STSENMFL
YMFH_BACSU/182-363-----------------------LKSKNPFK.....................................LGKELLKHELSM
YMXG_BACSU/165-338-----------------------FKGLEV...........................................GHERIYDL
YQA4_CAEEL/603-787-----------------------EVAFQIG........................................VQSTYNNSVN
QCR2_MOUSE/199-378-----------------------AESAAI...........................................GNAEANAF
YQA4_CAEEL/200-382-----------------------FPFPDL..........................................NGEFLSQPG
PREP1_ARATH/301-489-----------------------WLLSEK.........................................PLDLQTQLAL
IDE_DROME/209-391-----------------------FTTDDL..........................................TQFYKSGPD
Q9YFN7_AERPE/166-342-----------------------LPLPPR...............................................SGLA
IDE_DROME/679-863-----------------------YLQCGA..........................................QTDHTNIMV
Q9RRH6_DEIRA/141-315-----------------------LPGLPV...........................................SHPLREAA
PQQL_ECOLI/206-388-----------------------LPMVQV...........................................NDEQSFIE
Q9X167_THEMA/162-335-----------------------RPICGR...........................................ISEDIYPL
Q9U6C9_TOXGO/170-352-----------------------FETPGG..........................................WNGGDLVAY
Q97N46_STRPN/177-351-----------------------YHYCSK..........................................YGDEQHLPM
Q9JS80_CHLPN/201-385-----------------------WLTCSI..........................................LEQQELLAL
Q9I6C2_PSEAE/203-388-----------------------FNVPSLG.......................................SSENPREVNAL
Q9ANJ4_BRAJP/5-169-----------------------GPAVRR...........................................SEPGFMPA
MPPB_SCHPO/185-372-----------------------VEGMSW...........................................KHPDYFTA
PXM16_ARATH/666-854-----------------------QDGSNPSDENS...............................ALVHYIQVHRDDFSM
MPPB_LENED/192-381-----------------------VEGVGW...........................................SSPDYFPM
Q9KUG7_VIBCH/219-398-----------------------WPTQYW...........................................GAEDQVAL
O50511_STRCO/185-366-----------------------YRLPED...........................................GTRACDAA
Q9UVF2_YARLL/538-703-----------------------IPGVPY...........................................THADGAPL
Q49146_METEX/5-143-----------------------MPGVAW...........................................RDPDFIPA
PTRA_ECOLI/681-858-----------------------AVFVPT............................................GYDEYTS
MPPB_NEUCR/203-391-----------------------VEGVSW...........................................SDDDYFTG
Q9RRH5_DEIRA/126-298-----------------------APGPGP...........................................RDPDWLPW
QCR2_NEUCR/198-375-----------------------FPGASL............................................GVPHPET
Q985V3_RHILO/166-339-----------------------FEGRAY...........................................HVRDFYAS
Q9AXQ2_CUCME/257-443-----------------------FNGASW...........................................TDPDSIAL
Q9PLB7_CHLMU/208-391-----------------------WHLYDA...........................................PASLQGWA
Q9FJT9_ARATH/639-833-----------------------FPVQLTN........................................GTMIEEIHCI
Q23295_CAEEL/192-374-----------------------VEGVSW...........................................THEDNLAL
CYM1_YEAST/735-911-----------------------LLGVPY...........................................THKDGSAL
O67308_AQUAE/184-360-----------------------WRVPAI...........................................GKTDYKGL
O84812_CHLTR/225-408-----------------------WHFYDA...........................................PQSLQGWA
Q9M9Z4_ARATH/748-933-----------------------YQIEPEE........................................AQSTRTKAVL
SDP_EIMBO/201-391-----------------------FGLPPT..........................................LTSYKKQPI
P73670_SYNY3/182-362-----------------------WNGPGI..........................................DRLQDNIGL
Q9VP94_DROME/242-425-----------------------WVLPPM..........................................KNFYRSKPD
Q9Z6V1_CHLPN/209-393-----------------------WHIYES..........................................SHPIPLGCY
Q97II7_CLOAB/206-391-----------------------FVTGDA..........................................LDTELSMGL
YPD1_CAEEL/194-376-----------------------WFAHSP..........................................SDLETHSSL
Q9VYT3_DROME/284-473-----------------------WVLPNV..........................................RQYYRSKPD
MPPA_HUMAN/232-431-----------------------LESCSF...........................................LEEDFIPF
Q9ZIG1_RHOSI/193-288-----------------------GRASPR...................................................
MPPA_YEAST/181-374-----------------------FEGLPI...........................................DHPDIYAL
Q9XBW5_PORGN/207-395-----------------------FKSDPT..........................................PQEVRGSIF
Q9VFF0_DROME/203-385-----------------------VEGCGW...........................................TDQDNIPL
MPPB_YEAST/189-380-----------------------LEGVSW...........................................SAPDYFVA
O83069_TREPA/199-385-----------------------WLLPES..........................................DKAEQLMDV
QCR1_EUGGR/190-391-----------------------FQTPGI...........................................SHPDAIKI
Q9M9Z4_ARATH/273-458-----------------------WTLPPL..........................................RSAYVKKPE
O61441_HAEIR/3-170-----------------------GPGGAV..........................................SNQKEALAF
O25656_HELPY/198-379-----------------------YKVPAF...........................................KHKDQVAL
Y228_BORBU/711-879-----------------------FPSYKI...........................................NDENYPKA
Q9A579_CAUCR/219-397-----------------------WNTPGF...........................................GAAETDYL
MPPB_BLAEM/198-380-----------------------VEGASW...........................................TSADHWPL
MPPA2_ARATH/235-419-----------------------FEVPGW..........................................NNEKEAIIA
Q9PLB7_CHLMU/683-862-----------------------LEQNEH.............................................PNQYED
PXM16_ARATH/198-379-----------------------WPVTPS..........................................IHHYDEAPS
Q9PF62_XYLFA/244-422-----------------------WITPEL...........................................GSDTVVQL
Q9CE72_LACLA/168-341-----------------------YQMPIA..........................................YGDKNYLAL
Q22370_CAEEL/182-353-----------------------GEGAAG..........................................NNTKALATQ
Q9XBW5_PORGN/690-872-----------------------VVSGNV.........................................EYTLKNSLLL
Q9RWP9_DEIRA/229-413-----------------------WKLGYA..........................................SDPDLSLRW
Q9JMV9_BRAJP/168-341-----------------------LEGVPQ...........................................NDLSLFSL
PTRA_ECOLI/213-396-----------------------IDNNSA............................................KFRSKTD
Q97IL0_CLOAB/163-340-----------------------FPIYKL...........................................KDDEIKAL
Q17593_CAEEL/199-381-----------------------FPFPDL..........................................NNEYLSQPG
Q9A2H7_CAUCR/672-850-----------------------KPAITR...........................................ADPSYYQG
Q9A531_CAUCR/720-903-----------------------WRTDDL.........................................FSNLQRSRDV
MPPA_SCHPO/208-400-----------------------MEGLPV...........................................TDPDIYAL
Q9SCM5_ARATH/200-381-----------------------WPVTPS..........................................ISHYEEAPC
Q9HT96_PSEAE/190-362-----------------------YPEPDD.............................................AAPDAM
Q9I6C3_PSEAE/229-405-----------------------QLGIDR...........................................QDPDYAAL
PREP_DROME/784-953-----------------------LFTVPY...........................................LHQDHPTL
Q17592_CAEEL/199-354-----------------------WNENPYG........................................PEQLGKRIDR
Q9UVF2_YARLL/16-206-----------------------WLMGSP..........................................KDIYESFCV
STE23_YEAST/246-428-----------------------FTVPDM..........................................EEHWESKPP
Q9KUG7_VIBCH/686-864-----------------------RKGLPF..........................................DATGELYLT
Q9KQC8_VIBCH/661-839-----------------------YQSHEV............................................SPRSIAL
Q9VV75_DROME/190-364-----------------------GQGAAA..........................................SNHKEALAF
PQQL_HAEIN/205-388-----------------------FFENTI.........................................ETNTLASYKQ
MPPA_SOLTU/236-422-----------------------FEVPGG.........................................WMSEKESMTL
YAN2_SCHPO/193-378-----------------------WNGPSA..........................................LDAYTVFAI
NRDC_HUMAN/837-1020-----------------------YQSGTR...........................................SLREYTLM
Q9JS80_CHLPN/718-886-----------------------FPIGDI.........................................AYDHPDAAAL
Q9U7N7_PLAFA/914-1104-----------------------GILFKP...........................................GEYLDPSF
O84831_CHLTR/201-385-----------------------WLTCSI..........................................FDQQDLLAL
Q9A579_CAUCR/657-835-----------------------NLVPPR...........................................NPSDEAAI
Q9FIH8_ARATH/360-598-----------------------KIPVSK..........................................VQTFGDLRN
Q9A531_CAUCR/246-428-----------------------RKPEGLLETK..................................AVDERDTLENLGF
O84812_CHLTR/700-879-----------------------YPLSGNGML...................................LLEQNEDPHQYKD
Q40983_PEA/925-1150-----------------------GPAPNRWGFTADGNDLLETIDNASSVNNNGTKSDALQTEGAPRRSLRSHPLFFGITM
Q49145_METEX/235-418-----------------------YLTPSCM........................................TARDGEGYAL
CYM1_YEAST/221-407-----------------------WICGAP..........................................QDTYDTFLL
Q97EV0_CLOAB/207-392-----------------------FVVSSP..........................................TDNEKYLAF
Q9VYT3_DROME/769-953-----------------------QIGPNT.............................................VRVESI
QCR1_YEAST/187-370-----------------------VEGEPV...........................................NSPNYFVA
Q9TZ33_CAEEL/181-355-----------------------GDGAAV..........................................GDLKFLAAQ
Q9FNU9_DACGL/238-423-----------------------FELPGG.........................................WLKEKDYVTA
Q40738_ORYSA/2-120-----------------------FEVPGG.........................................WFEEKTAIIV
Q9VP94_DROME/724-907-----------------------QIGPSD.............................................LKMECI
O67945_AQUAE/183-355-----------------------FNAPPK...........................................DSKDYFVF
Q9KRD3_VIBCH/199-378-----------------------FPQGSAAI......................................KDYASQQEFWR
Q9FIH8_ARATH/928-1156-----------------------GPAPNRWGFTVDGD..........................DLFQSVSKLPVAHDGLL
Q41445_SOLTU/262-449-----------------------FSGASW...........................................TDPDSIAL
MU138_SCHPO/668-850-----------------------LQISQL...........................................DDERSGAL
Q9ANJ2_BRAJP/2-119-----------------------YLVPSTR........................................SAAAGEGPAL
Q9PL96_CHLMU/717-886-----------------------FPLESL.........................................SYDHPDAAVL
Q41444_SOLTU/259-445-----------------------FQGAPW...........................................TDPDAIPL
NRDC_HUMAN/361-548-----------------------WALPPQ..........................................QQHYRVKPL
Q9U7N7_PLAFA/282-510-----------------------WLLNPKVDKTNNHNNNHSNNQS.........SENNGYSNGSHSSDLSLENPTDYFVL
Q97EV0_CLOAB/725-889-----------------------AKGFNFR........................................RLGYDYSGKM
QCR2_EUGGR/221-398-----------------------FKAPGR..........................................SNLKEHAAS
QCR2_SCHPO/182-354-----------------------FPAPAA...............................................SPEL
P74016_SYNY3/241-420-----------------------QIGGMV...........................................DSPDYAAL
Q9RHS7_9LACT/2-99-----------------------.TTYGS.............................................KDYMTL
Q9TAP0_TOXGO/4-197-----------------------FEGVPW...........................................KSPDAVTF
Q99UJ4_STAAM/179-355-----------------------YRFPTQ..........................................YGQSGYAAF
MU138_SCHPO/196-378-----------------------FPIPGQ..........................................YHKYKCRPA
Q55159_SYNY3/175-359-----------------------WRSPGL..........................................DQFEKTLPL
MPPA1_ARATH/239-423-----------------------FEVPGW..........................................NNEKEAVTA
O50512_STRCO/190-374-----------------------RTGADR...........................................HDRVWPAQ
PQQL_HAEIN/680-857-----------------------LTADNT..........................................WRTEQKYLF
O84831_CHLTR/717-886-----------------------FPLGSL.........................................AYDHPDAAVL
Q9KA85_BACHD/165-338-----------------------YPGLPI...........................................GDKDVYAL
P74305_SYNY3/274-453-----------------------YHSPAF...........................................DDPDSAVF
Y2805_MYCBO/178-357-----------------------IRTPGR...........................................GWEHRWAL
Q9CML5_PASMU/205-388-----------------------FFEKFT.........................................EQNTLAAYKQ
O87530_STRPY/183-363-----------------------FRGYLTLT......................................QHSLLTYRIAL
MPPB_HUMAN/220-404-----------------------VEAVGW...........................................AHPDTICL
Q9Z6V1_CHLPN/688-867-----------------------QDKSSP...............................................SIQG
Y219_RICPR/168-341-----------------------FECTSY..........................................INLGQLYQT
O51486_BORBU/686-867-----------------------FKFNYL............................................AETWLNL
Q9A308_CAUCR/166-339-----------------------LPACGA...........................................REDDYFAL
Q9KA98_BACHD/181-363-----------------------YKEKQPVR.....................................QGKDLLVRELGI
PQQF_PSEAE/179-352-----------------------FALDAL...........................................RGADEQTL
YO098_YEAST/193-378-----------------------WIGVPY..........................................SDFRNDLAV
PQQF_KLEPN/173-343-----------------------WRCPLI.............................................ALSDNV
YHJJ_ECOLI/199-378-----------------------WDTPWQ.............................................PIRESA
Q9KQC8_VIBCH/196-377-----------------------FPMPST..........................................ESYYQKKPL
Q983M8_RHILO/208-384-----------------------WPGVKR...........................................KSADFFPA
Q9RTZ9_DEIRA/246-424-----------------------YHIPSV...........................................RHPDAAAL
Y4WA_RHISN/251-435-----------------------WVTTSYG........................................TAEQGEAEAL
Y4WB_RHISN/198-374-----------------------YPGIPR...........................................KDPQFFAA
MPPA_NEUCR/214-475-----------------------FEGLAI...........................................SDDDIYAL
P73669_SYNY3/171-348-----------------------YLGVGV...........................................KHEDYAPL
Q9CE73_LACLA/164-346-----------------------LRGEDQL........................................SSDSKTLFKY
Q9KRD3_VIBCH/671-849-----------------------LISETQ.............................................PRTAKT
Q9RTZ9_DEIRA/703-883-----------------------QLNFPL.........................................RDDHPDAAAL
UCR1_CAEEL/200-386-----------------------VEGVGY...........................................AHKDALAL
Q9PF62_XYLFA/714-895-----------------------LLAPPT...........................................KDPANLEI
Q40983_PEA/357-594-----------------------KIPVNK..........................................VQTYRDLRI
MPPA_RAT/231-430-----------------------ARELLL...........................................LEEDFIPF
QCR2_YEAST/166-327-----------------------IPVNKA..............................................SLAQY
O51486_BORBU/206-392-----------------------FFKKEIINF...................................VKTKDDLLNAIKK
PQQL_ECOLI/683-863-----------------------YDSRTP..........................................VNLPTRMAL
O16249_CAEEL/747-931-----------------------EVTYQIG........................................VQNTYDNAVV
Q97LA3_CLOAB/174-348-----------------------YLKKDY.............................................KYSLKS
Q9RWP9_DEIRA/777-912-----------------------FATVPY...........................................THPDSPAL
Q983M9_RHILO/206-390-----------------------WVVPSYH........................................TAKPGEAEAL
Q9A2H7_CAUCR/210-390-----------------------WLAPAA...........................................ADKDAPAL
Q99UJ3_STAAM/181-363-----------------------FKNKPLQE.....................................APQKYVQRDLEM
O16249_CAEEL/258-440-----------------------FPFPDL..........................................NGEFLSQPG
PQQF_PSEFL/185-366-----------------------LERLPA.............................................GATAAV
Q97N47_STRPN/186-364-----------------------VRGKREVS......................................EADCYRHHILL
Q97GF6_CLOAB/170-348-----------------------FTAYNL...........................................NRFEEAAL
PREP_DROME/268-457-----------------------LLMCDA..........................................TNIQESFEL
STE23_YEAST/716-898-----------------------QHVTQL............................................DVYSEDL
Y228_BORBU/195-380-----------------------WLCTEI..........................................NNIEDSIGL
Q9CML5_PASMU/680-857-----------------------FSTPNQ..........................................WTPELQYQL
MPPA_BLAEM/177-373-----------------------FPVPPF...........................................THPDMFPV
Q9KA97_BACHD/184-365-----------------------FRAYTT..........................................YGDPDYVAM
O87529_STRPY/177-351-----------------------YHFPSV..........................................FGQRDYYAL
Y5738_STRCO/198-380-----------------------MPGLAR...........................................TDERRWAM
O25371_HELPY/185-361-----------------------APFKIK..........................................DLKQDLAKS

PF03410

MP44_MCV1/1-592PATRLGSIHNKAVLVPAPFYALLIQVDNTVENVLAVICLAESYHFVDYETLGERLYVSFAFVHEQDCEAFLRNVGELRFE
G1_VAR67/1-591PSSIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAILQIS
MP44_MYXVL/1-589PCTVRTIIGGKTIMMPSPFYTVMVRVEPSLHNILSILCLYEIYHLVDYETVDNKLYVTFSFIHEHDYERFLQGSGRLNLT

PF00675

AXL1_YEAST/34-179--------------------------------------------------------------------------------
IDE_HUMAN/74-212--------------------------------------------------------------------------------
YMXG_BACSU/12-160--------------------------------------------------------------------------------
YQA4_CAEEL/37-175--------------------------------------------------------------------------------
IDE_DROME/47-185--------------------------------------------------------------------------------
MPPA_YEAST/29-176--------------------------------------------------------------------------------
NRDC_RAT/210-348--------------------------------------------------------------------------------
PTRA_ECOLI/54-192--------------------------------------------------------------------------------
QCR1_BOVIN/58-205--------------------------------------------------------------------------------
MPPB_NEUCR/50-198--------------------------------------------------------------------------------
QCR2_EUGGR/64-216--------------------------------------------------------------------------------
MPPB_RAT/68-215--------------------------------------------------------------------------------
MPPB_YEAST/36-184--------------------------------------------------------------------------------
QCR2_YEAST/17-163--------------------------------------------------------------------------------
PQQL_HAEIN/45-188--------------------------------------------------------------------------------
UCR1_CAEEL/48-195--------------------------------------------------------------------------------
PQQF_KLEPN/15-154--------------------------------------------------------------------------------
MPPA_SOLTU/85-231--------------------------------------------------------------------------------
SDP_EIMBO/44-183--------------------------------------------------------------------------------
QCR1_EUGGR/37-184--------------------------------------------------------------------------------
MPPA_NEUCR/62-209--------------------------------------------------------------------------------
PQQF_PSEFL/28-167--------------------------------------------------------------------------------
PQQL_ECOLI/46-204--------------------------------------------------------------------------------
MPPA_HUMAN/77-227--------------------------------------------------------------------------------
QCR2_BOVIN/48-194--------------------------------------------------------------------------------
QCR1_YEAST/37-182--------------------------------------------------------------------------------

PF02664

LUXS_HAEIN/2-162--------------------------------------------------------------------------------
LUXS_ECOLI/2-162--------------------------------------------------------------------------------
LUXS_BACSU/2-156--------------------------------------------------------------------------------
LUXS_HELPJ/3-151--------------------------------------------------------------------------------
LUXS_BORBU/2-157--------------------------------------------------------------------------------

PF05193

QCR1_MOUSE/210-395--------------------------------------------------------------------------------
IDE_HUMAN/236-418--------------------------------------------------------------------------------
IDE_HUMAN/706-889--------------------------------------------------------------------------------
YMFH_BACSU/182-363--------------------------------------------------------------------------------
YMXG_BACSU/165-338--------------------------------------------------------------------------------
YQA4_CAEEL/603-787--------------------------------------------------------------------------------
QCR2_MOUSE/199-378--------------------------------------------------------------------------------
YQA4_CAEEL/200-382--------------------------------------------------------------------------------
PREP1_ARATH/301-489--------------------------------------------------------------------------------
IDE_DROME/209-391--------------------------------------------------------------------------------
Q9YFN7_AERPE/166-342--------------------------------------------------------------------------------
IDE_DROME/679-863--------------------------------------------------------------------------------
Q9RRH6_DEIRA/141-315--------------------------------------------------------------------------------
PQQL_ECOLI/206-388--------------------------------------------------------------------------------
Q9X167_THEMA/162-335--------------------------------------------------------------------------------
Q9U6C9_TOXGO/170-352--------------------------------------------------------------------------------
Q97N46_STRPN/177-351--------------------------------------------------------------------------------
Q9JS80_CHLPN/201-385--------------------------------------------------------------------------------
Q9I6C2_PSEAE/203-388--------------------------------------------------------------------------------
Q9ANJ4_BRAJP/5-169--------------------------------------------------------------------------------
MPPB_SCHPO/185-372--------------------------------------------------------------------------------
PXM16_ARATH/666-854--------------------------------------------------------------------------------
MPPB_LENED/192-381--------------------------------------------------------------------------------
Q9KUG7_VIBCH/219-398--------------------------------------------------------------------------------
O50511_STRCO/185-366--------------------------------------------------------------------------------
Q9UVF2_YARLL/538-703--------------------------------------------------------------------------------
Q49146_METEX/5-143--------------------------------------------------------------------------------
PTRA_ECOLI/681-858--------------------------------------------------------------------------------
MPPB_NEUCR/203-391--------------------------------------------------------------------------------
Q9RRH5_DEIRA/126-298--------------------------------------------------------------------------------
QCR2_NEUCR/198-375--------------------------------------------------------------------------------
Q985V3_RHILO/166-339--------------------------------------------------------------------------------
Q9AXQ2_CUCME/257-443--------------------------------------------------------------------------------
Q9PLB7_CHLMU/208-391--------------------------------------------------------------------------------
Q9FJT9_ARATH/639-833--------------------------------------------------------------------------------
Q23295_CAEEL/192-374--------------------------------------------------------------------------------
CYM1_YEAST/735-911--------------------------------------------------------------------------------
O67308_AQUAE/184-360--------------------------------------------------------------------------------
O84812_CHLTR/225-408--------------------------------------------------------------------------------
Q9M9Z4_ARATH/748-933--------------------------------------------------------------------------------
SDP_EIMBO/201-391--------------------------------------------------------------------------------
P73670_SYNY3/182-362--------------------------------------------------------------------------------
Q9VP94_DROME/242-425--------------------------------------------------------------------------------
Q9Z6V1_CHLPN/209-393--------------------------------------------------------------------------------
Q97II7_CLOAB/206-391--------------------------------------------------------------------------------
YPD1_CAEEL/194-376--------------------------------------------------------------------------------
Q9VYT3_DROME/284-473--------------------------------------------------------------------------------
MPPA_HUMAN/232-431--------------------------------------------------------------------------------
Q9ZIG1_RHOSI/193-288--------------------------------------------------------------------------------
MPPA_YEAST/181-374--------------------------------------------------------------------------------
Q9XBW5_PORGN/207-395--------------------------------------------------------------------------------
Q9VFF0_DROME/203-385--------------------------------------------------------------------------------
MPPB_YEAST/189-380--------------------------------------------------------------------------------
O83069_TREPA/199-385--------------------------------------------------------------------------------
QCR1_EUGGR/190-391--------------------------------------------------------------------------------
Q9M9Z4_ARATH/273-458--------------------------------------------------------------------------------
O61441_HAEIR/3-170--------------------------------------------------------------------------------
O25656_HELPY/198-379--------------------------------------------------------------------------------
Y228_BORBU/711-879--------------------------------------------------------------------------------
Q9A579_CAUCR/219-397--------------------------------------------------------------------------------
MPPB_BLAEM/198-380--------------------------------------------------------------------------------
MPPA2_ARATH/235-419--------------------------------------------------------------------------------
Q9PLB7_CHLMU/683-862--------------------------------------------------------------------------------
PXM16_ARATH/198-379--------------------------------------------------------------------------------
Q9PF62_XYLFA/244-422--------------------------------------------------------------------------------
Q9CE72_LACLA/168-341--------------------------------------------------------------------------------
Q22370_CAEEL/182-353--------------------------------------------------------------------------------
Q9XBW5_PORGN/690-872--------------------------------------------------------------------------------
Q9RWP9_DEIRA/229-413--------------------------------------------------------------------------------
Q9JMV9_BRAJP/168-341--------------------------------------------------------------------------------
PTRA_ECOLI/213-396--------------------------------------------------------------------------------
Q97IL0_CLOAB/163-340--------------------------------------------------------------------------------
Q17593_CAEEL/199-381--------------------------------------------------------------------------------
Q9A2H7_CAUCR/672-850--------------------------------------------------------------------------------
Q9A531_CAUCR/720-903--------------------------------------------------------------------------------
MPPA_SCHPO/208-400--------------------------------------------------------------------------------
Q9SCM5_ARATH/200-381--------------------------------------------------------------------------------
Q9HT96_PSEAE/190-362--------------------------------------------------------------------------------
Q9I6C3_PSEAE/229-405--------------------------------------------------------------------------------
PREP_DROME/784-953--------------------------------------------------------------------------------
Q17592_CAEEL/199-354--------------------------------------------------------------------------------
Q9UVF2_YARLL/16-206--------------------------------------------------------------------------------
STE23_YEAST/246-428--------------------------------------------------------------------------------
Q9KUG7_VIBCH/686-864--------------------------------------------------------------------------------
Q9KQC8_VIBCH/661-839--------------------------------------------------------------------------------
Q9VV75_DROME/190-364--------------------------------------------------------------------------------
PQQL_HAEIN/205-388--------------------------------------------------------------------------------
MPPA_SOLTU/236-422--------------------------------------------------------------------------------
YAN2_SCHPO/193-378--------------------------------------------------------------------------------
NRDC_HUMAN/837-1020--------------------------------------------------------------------------------
Q9JS80_CHLPN/718-886--------------------------------------------------------------------------------
Q9U7N7_PLAFA/914-1104--------------------------------------------------------------------------------
O84831_CHLTR/201-385--------------------------------------------------------------------------------
Q9A579_CAUCR/657-835--------------------------------------------------------------------------------
Q9FIH8_ARATH/360-598--------------------------------------------------------------------------------
Q9A531_CAUCR/246-428--------------------------------------------------------------------------------
O84812_CHLTR/700-879--------------------------------------------------------------------------------
Q40983_PEA/925-1150--------------------------------------------------------------------------------
Q49145_METEX/235-418--------------------------------------------------------------------------------
CYM1_YEAST/221-407--------------------------------------------------------------------------------
Q97EV0_CLOAB/207-392--------------------------------------------------------------------------------
Q9VYT3_DROME/769-953--------------------------------------------------------------------------------
QCR1_YEAST/187-370--------------------------------------------------------------------------------
Q9TZ33_CAEEL/181-355--------------------------------------------------------------------------------
Q9FNU9_DACGL/238-423--------------------------------------------------------------------------------
Q40738_ORYSA/2-120--------------------------------------------------------------------------------
Q9VP94_DROME/724-907--------------------------------------------------------------------------------
O67945_AQUAE/183-355--------------------------------------------------------------------------------
Q9KRD3_VIBCH/199-378--------------------------------------------------------------------------------
Q9FIH8_ARATH/928-1156--------------------------------------------------------------------------------
Q41445_SOLTU/262-449--------------------------------------------------------------------------------
MU138_SCHPO/668-850--------------------------------------------------------------------------------
Q9ANJ2_BRAJP/2-119--------------------------------------------------------------------------------
Q9PL96_CHLMU/717-886--------------------------------------------------------------------------------
Q41444_SOLTU/259-445--------------------------------------------------------------------------------
NRDC_HUMAN/361-548--------------------------------------------------------------------------------
Q9U7N7_PLAFA/282-510--------------------------------------------------------------------------------
Q97EV0_CLOAB/725-889--------------------------------------------------------------------------------
QCR2_EUGGR/221-398--------------------------------------------------------------------------------
QCR2_SCHPO/182-354--------------------------------------------------------------------------------
P74016_SYNY3/241-420--------------------------------------------------------------------------------
Q9RHS7_9LACT/2-99--------------------------------------------------------------------------------
Q9TAP0_TOXGO/4-197--------------------------------------------------------------------------------
Q99UJ4_STAAM/179-355--------------------------------------------------------------------------------
MU138_SCHPO/196-378--------------------------------------------------------------------------------
Q55159_SYNY3/175-359--------------------------------------------------------------------------------
MPPA1_ARATH/239-423--------------------------------------------------------------------------------
O50512_STRCO/190-374--------------------------------------------------------------------------------
PQQL_HAEIN/680-857--------------------------------------------------------------------------------
O84831_CHLTR/717-886--------------------------------------------------------------------------------
Q9KA85_BACHD/165-338--------------------------------------------------------------------------------
P74305_SYNY3/274-453--------------------------------------------------------------------------------
Y2805_MYCBO/178-357--------------------------------------------------------------------------------
Q9CML5_PASMU/205-388--------------------------------------------------------------------------------
O87530_STRPY/183-363--------------------------------------------------------------------------------
MPPB_HUMAN/220-404--------------------------------------------------------------------------------
Q9Z6V1_CHLPN/688-867--------------------------------------------------------------------------------
Y219_RICPR/168-341--------------------------------------------------------------------------------
O51486_BORBU/686-867--------------------------------------------------------------------------------
Q9A308_CAUCR/166-339--------------------------------------------------------------------------------
Q9KA98_BACHD/181-363--------------------------------------------------------------------------------
PQQF_PSEAE/179-352--------------------------------------------------------------------------------
YO098_YEAST/193-378--------------------------------------------------------------------------------
PQQF_KLEPN/173-343--------------------------------------------------------------------------------
YHJJ_ECOLI/199-378--------------------------------------------------------------------------------
Q9KQC8_VIBCH/196-377--------------------------------------------------------------------------------
Q983M8_RHILO/208-384--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/246-424--------------------------------------------------------------------------------
Y4WA_RHISN/251-435--------------------------------------------------------------------------------
Y4WB_RHISN/198-374--------------------------------------------------------------------------------
MPPA_NEUCR/214-475--------------------------------------------------------------------------------
P73669_SYNY3/171-348--------------------------------------------------------------------------------
Q9CE73_LACLA/164-346--------------------------------------------------------------------------------
Q9KRD3_VIBCH/671-849--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/703-883--------------------------------------------------------------------------------
UCR1_CAEEL/200-386--------------------------------------------------------------------------------
Q9PF62_XYLFA/714-895--------------------------------------------------------------------------------
Q40983_PEA/357-594--------------------------------------------------------------------------------
MPPA_RAT/231-430--------------------------------------------------------------------------------
QCR2_YEAST/166-327--------------------------------------------------------------------------------
O51486_BORBU/206-392--------------------------------------------------------------------------------
PQQL_ECOLI/683-863--------------------------------------------------------------------------------
O16249_CAEEL/747-931--------------------------------------------------------------------------------
Q97LA3_CLOAB/174-348--------------------------------------------------------------------------------
Q9RWP9_DEIRA/777-912--------------------------------------------------------------------------------
Q983M9_RHILO/206-390--------------------------------------------------------------------------------
Q9A2H7_CAUCR/210-390--------------------------------------------------------------------------------
Q99UJ3_STAAM/181-363--------------------------------------------------------------------------------
O16249_CAEEL/258-440--------------------------------------------------------------------------------
PQQF_PSEFL/185-366--------------------------------------------------------------------------------
Q97N47_STRPN/186-364--------------------------------------------------------------------------------
Q97GF6_CLOAB/170-348--------------------------------------------------------------------------------
PREP_DROME/268-457--------------------------------------------------------------------------------
STE23_YEAST/716-898--------------------------------------------------------------------------------
Y228_BORBU/195-380--------------------------------------------------------------------------------
Q9CML5_PASMU/680-857--------------------------------------------------------------------------------
MPPA_BLAEM/177-373--------------------------------------------------------------------------------
Q9KA97_BACHD/184-365--------------------------------------------------------------------------------
O87529_STRPY/177-351--------------------------------------------------------------------------------
Y5738_STRCO/198-380--------------------------------------------------------------------------------
O25371_HELPY/185-361--------------------------------------------------------------------------------

PF03410

MP44_MCV1/1-592PAPRVELNYSDDYVMNLYVNFPWLQHDLADYLYTLNADCVPLLRGLEENLRRSVRERQLVVVYPSFSPSLFNSRDRQDHR
G1_VAR67/1-591QCQRINMNYSDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHP
MP44_MYXVL/1-589IYKKIRLCYGDDFLMNVYLSFPCIRHDIFDYLTIVNTDTSSMISSLERDIYQSVRTGDYIVVYPNFSNTMSNTADRQLHK

PF00675

AXL1_YEAST/34-179--------------------------------------------------------------------------------
IDE_HUMAN/74-212--------------------------------------------------------------------------------
YMXG_BACSU/12-160--------------------------------------------------------------------------------
YQA4_CAEEL/37-175--------------------------------------------------------------------------------
IDE_DROME/47-185--------------------------------------------------------------------------------
MPPA_YEAST/29-176--------------------------------------------------------------------------------
NRDC_RAT/210-348--------------------------------------------------------------------------------
PTRA_ECOLI/54-192--------------------------------------------------------------------------------
QCR1_BOVIN/58-205--------------------------------------------------------------------------------
MPPB_NEUCR/50-198--------------------------------------------------------------------------------
QCR2_EUGGR/64-216--------------------------------------------------------------------------------
MPPB_RAT/68-215--------------------------------------------------------------------------------
MPPB_YEAST/36-184--------------------------------------------------------------------------------
QCR2_YEAST/17-163--------------------------------------------------------------------------------
PQQL_HAEIN/45-188--------------------------------------------------------------------------------
UCR1_CAEEL/48-195--------------------------------------------------------------------------------
PQQF_KLEPN/15-154--------------------------------------------------------------------------------
MPPA_SOLTU/85-231--------------------------------------------------------------------------------
SDP_EIMBO/44-183--------------------------------------------------------------------------------
QCR1_EUGGR/37-184--------------------------------------------------------------------------------
MPPA_NEUCR/62-209--------------------------------------------------------------------------------
PQQF_PSEFL/28-167--------------------------------------------------------------------------------
PQQL_ECOLI/46-204--------------------------------------------------------------------------------
MPPA_HUMAN/77-227--------------------------------------------------------------------------------
QCR2_BOVIN/48-194--------------------------------------------------------------------------------
QCR1_YEAST/37-182--------------------------------------------------------------------------------

PF02664

LUXS_HAEIN/2-162--------------------------------------------------------------------------------
LUXS_ECOLI/2-162--------------------------------------------------------------------------------
LUXS_BACSU/2-156--------------------------------------------------------------------------------
LUXS_HELPJ/3-151--------------------------------------------------------------------------------
LUXS_BORBU/2-157--------------------------------------------------------------------------------

PF05193

QCR1_MOUSE/210-395--------------------------------------------------------------------------------
IDE_HUMAN/236-418--------------------------------------------------------------------------------
IDE_HUMAN/706-889--------------------------------------------------------------------------------
YMFH_BACSU/182-363--------------------------------------------------------------------------------
YMXG_BACSU/165-338--------------------------------------------------------------------------------
YQA4_CAEEL/603-787--------------------------------------------------------------------------------
QCR2_MOUSE/199-378--------------------------------------------------------------------------------
YQA4_CAEEL/200-382--------------------------------------------------------------------------------
PREP1_ARATH/301-489--------------------------------------------------------------------------------
IDE_DROME/209-391--------------------------------------------------------------------------------
Q9YFN7_AERPE/166-342--------------------------------------------------------------------------------
IDE_DROME/679-863--------------------------------------------------------------------------------
Q9RRH6_DEIRA/141-315--------------------------------------------------------------------------------
PQQL_ECOLI/206-388--------------------------------------------------------------------------------
Q9X167_THEMA/162-335--------------------------------------------------------------------------------
Q9U6C9_TOXGO/170-352--------------------------------------------------------------------------------
Q97N46_STRPN/177-351--------------------------------------------------------------------------------
Q9JS80_CHLPN/201-385--------------------------------------------------------------------------------
Q9I6C2_PSEAE/203-388--------------------------------------------------------------------------------
Q9ANJ4_BRAJP/5-169--------------------------------------------------------------------------------
MPPB_SCHPO/185-372--------------------------------------------------------------------------------
PXM16_ARATH/666-854--------------------------------------------------------------------------------
MPPB_LENED/192-381--------------------------------------------------------------------------------
Q9KUG7_VIBCH/219-398--------------------------------------------------------------------------------
O50511_STRCO/185-366--------------------------------------------------------------------------------
Q9UVF2_YARLL/538-703--------------------------------------------------------------------------------
Q49146_METEX/5-143--------------------------------------------------------------------------------
PTRA_ECOLI/681-858--------------------------------------------------------------------------------
MPPB_NEUCR/203-391--------------------------------------------------------------------------------
Q9RRH5_DEIRA/126-298--------------------------------------------------------------------------------
QCR2_NEUCR/198-375--------------------------------------------------------------------------------
Q985V3_RHILO/166-339--------------------------------------------------------------------------------
Q9AXQ2_CUCME/257-443--------------------------------------------------------------------------------
Q9PLB7_CHLMU/208-391--------------------------------------------------------------------------------
Q9FJT9_ARATH/639-833--------------------------------------------------------------------------------
Q23295_CAEEL/192-374--------------------------------------------------------------------------------
CYM1_YEAST/735-911--------------------------------------------------------------------------------
O67308_AQUAE/184-360--------------------------------------------------------------------------------
O84812_CHLTR/225-408--------------------------------------------------------------------------------
Q9M9Z4_ARATH/748-933--------------------------------------------------------------------------------
SDP_EIMBO/201-391--------------------------------------------------------------------------------
P73670_SYNY3/182-362--------------------------------------------------------------------------------
Q9VP94_DROME/242-425--------------------------------------------------------------------------------
Q9Z6V1_CHLPN/209-393--------------------------------------------------------------------------------
Q97II7_CLOAB/206-391--------------------------------------------------------------------------------
YPD1_CAEEL/194-376--------------------------------------------------------------------------------
Q9VYT3_DROME/284-473--------------------------------------------------------------------------------
MPPA_HUMAN/232-431--------------------------------------------------------------------------------
Q9ZIG1_RHOSI/193-288--------------------------------------------------------------------------------
MPPA_YEAST/181-374--------------------------------------------------------------------------------
Q9XBW5_PORGN/207-395--------------------------------------------------------------------------------
Q9VFF0_DROME/203-385--------------------------------------------------------------------------------
MPPB_YEAST/189-380--------------------------------------------------------------------------------
O83069_TREPA/199-385--------------------------------------------------------------------------------
QCR1_EUGGR/190-391--------------------------------------------------------------------------------
Q9M9Z4_ARATH/273-458--------------------------------------------------------------------------------
O61441_HAEIR/3-170--------------------------------------------------------------------------------
O25656_HELPY/198-379--------------------------------------------------------------------------------
Y228_BORBU/711-879--------------------------------------------------------------------------------
Q9A579_CAUCR/219-397--------------------------------------------------------------------------------
MPPB_BLAEM/198-380--------------------------------------------------------------------------------
MPPA2_ARATH/235-419--------------------------------------------------------------------------------
Q9PLB7_CHLMU/683-862--------------------------------------------------------------------------------
PXM16_ARATH/198-379--------------------------------------------------------------------------------
Q9PF62_XYLFA/244-422--------------------------------------------------------------------------------
Q9CE72_LACLA/168-341--------------------------------------------------------------------------------
Q22370_CAEEL/182-353--------------------------------------------------------------------------------
Q9XBW5_PORGN/690-872--------------------------------------------------------------------------------
Q9RWP9_DEIRA/229-413--------------------------------------------------------------------------------
Q9JMV9_BRAJP/168-341--------------------------------------------------------------------------------
PTRA_ECOLI/213-396--------------------------------------------------------------------------------
Q97IL0_CLOAB/163-340--------------------------------------------------------------------------------
Q17593_CAEEL/199-381--------------------------------------------------------------------------------
Q9A2H7_CAUCR/672-850--------------------------------------------------------------------------------
Q9A531_CAUCR/720-903--------------------------------------------------------------------------------
MPPA_SCHPO/208-400--------------------------------------------------------------------------------
Q9SCM5_ARATH/200-381--------------------------------------------------------------------------------
Q9HT96_PSEAE/190-362--------------------------------------------------------------------------------
Q9I6C3_PSEAE/229-405--------------------------------------------------------------------------------
PREP_DROME/784-953--------------------------------------------------------------------------------
Q17592_CAEEL/199-354--------------------------------------------------------------------------------
Q9UVF2_YARLL/16-206--------------------------------------------------------------------------------
STE23_YEAST/246-428--------------------------------------------------------------------------------
Q9KUG7_VIBCH/686-864--------------------------------------------------------------------------------
Q9KQC8_VIBCH/661-839--------------------------------------------------------------------------------
Q9VV75_DROME/190-364--------------------------------------------------------------------------------
PQQL_HAEIN/205-388--------------------------------------------------------------------------------
MPPA_SOLTU/236-422--------------------------------------------------------------------------------
YAN2_SCHPO/193-378--------------------------------------------------------------------------------
NRDC_HUMAN/837-1020--------------------------------------------------------------------------------
Q9JS80_CHLPN/718-886--------------------------------------------------------------------------------
Q9U7N7_PLAFA/914-1104--------------------------------------------------------------------------------
O84831_CHLTR/201-385--------------------------------------------------------------------------------
Q9A579_CAUCR/657-835--------------------------------------------------------------------------------
Q9FIH8_ARATH/360-598--------------------------------------------------------------------------------
Q9A531_CAUCR/246-428--------------------------------------------------------------------------------
O84812_CHLTR/700-879--------------------------------------------------------------------------------
Q40983_PEA/925-1150--------------------------------------------------------------------------------
Q49145_METEX/235-418--------------------------------------------------------------------------------
CYM1_YEAST/221-407--------------------------------------------------------------------------------
Q97EV0_CLOAB/207-392--------------------------------------------------------------------------------
Q9VYT3_DROME/769-953--------------------------------------------------------------------------------
QCR1_YEAST/187-370--------------------------------------------------------------------------------
Q9TZ33_CAEEL/181-355--------------------------------------------------------------------------------
Q9FNU9_DACGL/238-423--------------------------------------------------------------------------------
Q40738_ORYSA/2-120--------------------------------------------------------------------------------
Q9VP94_DROME/724-907--------------------------------------------------------------------------------
O67945_AQUAE/183-355--------------------------------------------------------------------------------
Q9KRD3_VIBCH/199-378--------------------------------------------------------------------------------
Q9FIH8_ARATH/928-1156--------------------------------------------------------------------------------
Q41445_SOLTU/262-449--------------------------------------------------------------------------------
MU138_SCHPO/668-850--------------------------------------------------------------------------------
Q9ANJ2_BRAJP/2-119--------------------------------------------------------------------------------
Q9PL96_CHLMU/717-886--------------------------------------------------------------------------------
Q41444_SOLTU/259-445--------------------------------------------------------------------------------
NRDC_HUMAN/361-548--------------------------------------------------------------------------------
Q9U7N7_PLAFA/282-510--------------------------------------------------------------------------------
Q97EV0_CLOAB/725-889--------------------------------------------------------------------------------
QCR2_EUGGR/221-398--------------------------------------------------------------------------------
QCR2_SCHPO/182-354--------------------------------------------------------------------------------
P74016_SYNY3/241-420--------------------------------------------------------------------------------
Q9RHS7_9LACT/2-99--------------------------------------------------------------------------------
Q9TAP0_TOXGO/4-197--------------------------------------------------------------------------------
Q99UJ4_STAAM/179-355--------------------------------------------------------------------------------
MU138_SCHPO/196-378--------------------------------------------------------------------------------
Q55159_SYNY3/175-359--------------------------------------------------------------------------------
MPPA1_ARATH/239-423--------------------------------------------------------------------------------
O50512_STRCO/190-374--------------------------------------------------------------------------------
PQQL_HAEIN/680-857--------------------------------------------------------------------------------
O84831_CHLTR/717-886--------------------------------------------------------------------------------
Q9KA85_BACHD/165-338--------------------------------------------------------------------------------
P74305_SYNY3/274-453--------------------------------------------------------------------------------
Y2805_MYCBO/178-357--------------------------------------------------------------------------------
Q9CML5_PASMU/205-388--------------------------------------------------------------------------------
O87530_STRPY/183-363--------------------------------------------------------------------------------
MPPB_HUMAN/220-404--------------------------------------------------------------------------------
Q9Z6V1_CHLPN/688-867--------------------------------------------------------------------------------
Y219_RICPR/168-341--------------------------------------------------------------------------------
O51486_BORBU/686-867--------------------------------------------------------------------------------
Q9A308_CAUCR/166-339--------------------------------------------------------------------------------
Q9KA98_BACHD/181-363--------------------------------------------------------------------------------
PQQF_PSEAE/179-352--------------------------------------------------------------------------------
YO098_YEAST/193-378--------------------------------------------------------------------------------
PQQF_KLEPN/173-343--------------------------------------------------------------------------------
YHJJ_ECOLI/199-378--------------------------------------------------------------------------------
Q9KQC8_VIBCH/196-377--------------------------------------------------------------------------------
Q983M8_RHILO/208-384--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/246-424--------------------------------------------------------------------------------
Y4WA_RHISN/251-435--------------------------------------------------------------------------------
Y4WB_RHISN/198-374--------------------------------------------------------------------------------
MPPA_NEUCR/214-475--------------------------------------------------------------------------------
P73669_SYNY3/171-348--------------------------------------------------------------------------------
Q9CE73_LACLA/164-346--------------------------------------------------------------------------------
Q9KRD3_VIBCH/671-849--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/703-883--------------------------------------------------------------------------------
UCR1_CAEEL/200-386--------------------------------------------------------------------------------
Q9PF62_XYLFA/714-895--------------------------------------------------------------------------------
Q40983_PEA/357-594--------------------------------------------------------------------------------
MPPA_RAT/231-430--------------------------------------------------------------------------------
QCR2_YEAST/166-327--------------------------------------------------------------------------------
O51486_BORBU/206-392--------------------------------------------------------------------------------
PQQL_ECOLI/683-863--------------------------------------------------------------------------------
O16249_CAEEL/747-931--------------------------------------------------------------------------------
Q97LA3_CLOAB/174-348--------------------------------------------------------------------------------
Q9RWP9_DEIRA/777-912--------------------------------------------------------------------------------
Q983M9_RHILO/206-390--------------------------------------------------------------------------------
Q9A2H7_CAUCR/210-390--------------------------------------------------------------------------------
Q99UJ3_STAAM/181-363--------------------------------------------------------------------------------
O16249_CAEEL/258-440--------------------------------------------------------------------------------
PQQF_PSEFL/185-366--------------------------------------------------------------------------------
Q97N47_STRPN/186-364--------------------------------------------------------------------------------
Q97GF6_CLOAB/170-348--------------------------------------------------------------------------------
PREP_DROME/268-457--------------------------------------------------------------------------------
STE23_YEAST/716-898--------------------------------------------------------------------------------
Y228_BORBU/195-380--------------------------------------------------------------------------------
Q9CML5_PASMU/680-857--------------------------------------------------------------------------------
MPPA_BLAEM/177-373--------------------------------------------------------------------------------
Q9KA97_BACHD/184-365--------------------------------------------------------------------------------
O87529_STRPY/177-351--------------------------------------------------------------------------------
Y5738_STRCO/198-380--------------------------------------------------------------------------------
O25371_HELPY/185-361--------------------------------------------------------------------------------

PF03410

MP44_MCV1/1-592LLVLDV.DLARSAGPARVPRTFRRQPRAEVFVRYGDPALLDYVAFALARPRAAALRRLPRGVRLAHGFSHADMHEIMASE
G1_VAR67/1-591IVVLDATNDGLIKKPYRSIPLMKRLTSNEIFIRYGDASLMDMITLSLSK.QDISLKRNAEGIRVKHSFSADDIQAIMESD
MP44_MYXVL/1-589TVVINP.NIVYASQPTTSIDLMKKQTHNEMYIKYSDAGFIDYVQLALGL.RR.KIHKHVHGIHIRHQFSADDIKTILESD

PF00675

AXL1_YEAST/34-179--------------------------------------------------------------------------------
IDE_HUMAN/74-212--------------------------------------------------------------------------------
YMXG_BACSU/12-160--------------------------------------------------------------------------------
YQA4_CAEEL/37-175--------------------------------------------------------------------------------
IDE_DROME/47-185--------------------------------------------------------------------------------
MPPA_YEAST/29-176--------------------------------------------------------------------------------
NRDC_RAT/210-348--------------------------------------------------------------------------------
PTRA_ECOLI/54-192--------------------------------------------------------------------------------
QCR1_BOVIN/58-205--------------------------------------------------------------------------------
MPPB_NEUCR/50-198--------------------------------------------------------------------------------
QCR2_EUGGR/64-216--------------------------------------------------------------------------------
MPPB_RAT/68-215--------------------------------------------------------------------------------
MPPB_YEAST/36-184--------------------------------------------------------------------------------
QCR2_YEAST/17-163--------------------------------------------------------------------------------
PQQL_HAEIN/45-188--------------------------------------------------------------------------------
UCR1_CAEEL/48-195--------------------------------------------------------------------------------
PQQF_KLEPN/15-154--------------------------------------------------------------------------------
MPPA_SOLTU/85-231--------------------------------------------------------------------------------
SDP_EIMBO/44-183--------------------------------------------------------------------------------
QCR1_EUGGR/37-184--------------------------------------------------------------------------------
MPPA_NEUCR/62-209--------------------------------------------------------------------------------
PQQF_PSEFL/28-167--------------------------------------------------------------------------------
PQQL_ECOLI/46-204--------------------------------------------------------------------------------
MPPA_HUMAN/77-227--------------------------------------------------------------------------------
QCR2_BOVIN/48-194--------------------------------------------------------------------------------
QCR1_YEAST/37-182--------------------------------------------------------------------------------

PF02664

LUXS_HAEIN/2-162--------------------------------------------------------------------------------
LUXS_ECOLI/2-162--------------------------------------------------------------------------------
LUXS_BACSU/2-156--------------------------------------------------------------------------------
LUXS_HELPJ/3-151--------------------------------------------------------------------------------
LUXS_BORBU/2-157--------------------------------------------------------------------------------

PF05193

QCR1_MOUSE/210-395--------------------------------------------------------------------------------
IDE_HUMAN/236-418--------------------------------------------------------------------------------
IDE_HUMAN/706-889--------------------------------------------------------------------------------
YMFH_BACSU/182-363--------------------------------------------------------------------------------
YMXG_BACSU/165-338--------------------------------------------------------------------------------
YQA4_CAEEL/603-787--------------------------------------------------------------------------------
QCR2_MOUSE/199-378--------------------------------------------------------------------------------
YQA4_CAEEL/200-382--------------------------------------------------------------------------------
PREP1_ARATH/301-489--------------------------------------------------------------------------------
IDE_DROME/209-391--------------------------------------------------------------------------------
Q9YFN7_AERPE/166-342--------------------------------------------------------------------------------
IDE_DROME/679-863--------------------------------------------------------------------------------
Q9RRH6_DEIRA/141-315--------------------------------------------------------------------------------
PQQL_ECOLI/206-388--------------------------------------------------------------------------------
Q9X167_THEMA/162-335--------------------------------------------------------------------------------
Q9U6C9_TOXGO/170-352--------------------------------------------------------------------------------
Q97N46_STRPN/177-351--------------------------------------------------------------------------------
Q9JS80_CHLPN/201-385--------------------------------------------------------------------------------
Q9I6C2_PSEAE/203-388--------------------------------------------------------------------------------
Q9ANJ4_BRAJP/5-169--------------------------------------------------------------------------------
MPPB_SCHPO/185-372--------------------------------------------------------------------------------
PXM16_ARATH/666-854--------------------------------------------------------------------------------
MPPB_LENED/192-381--------------------------------------------------------------------------------
Q9KUG7_VIBCH/219-398--------------------------------------------------------------------------------
O50511_STRCO/185-366--------------------------------------------------------------------------------
Q9UVF2_YARLL/538-703--------------------------------------------------------------------------------
Q49146_METEX/5-143--------------------------------------------------------------------------------
PTRA_ECOLI/681-858--------------------------------------------------------------------------------
MPPB_NEUCR/203-391--------------------------------------------------------------------------------
Q9RRH5_DEIRA/126-298--------------------------------------------------------------------------------
QCR2_NEUCR/198-375--------------------------------------------------------------------------------
Q985V3_RHILO/166-339--------------------------------------------------------------------------------
Q9AXQ2_CUCME/257-443--------------------------------------------------------------------------------
Q9PLB7_CHLMU/208-391--------------------------------------------------------------------------------
Q9FJT9_ARATH/639-833--------------------------------------------------------------------------------
Q23295_CAEEL/192-374--------------------------------------------------------------------------------
CYM1_YEAST/735-911--------------------------------------------------------------------------------
O67308_AQUAE/184-360--------------------------------------------------------------------------------
O84812_CHLTR/225-408--------------------------------------------------------------------------------
Q9M9Z4_ARATH/748-933--------------------------------------------------------------------------------
SDP_EIMBO/201-391--------------------------------------------------------------------------------
P73670_SYNY3/182-362--------------------------------------------------------------------------------
Q9VP94_DROME/242-425--------------------------------------------------------------------------------
Q9Z6V1_CHLPN/209-393--------------------------------------------------------------------------------
Q97II7_CLOAB/206-391--------------------------------------------------------------------------------
YPD1_CAEEL/194-376--------------------------------------------------------------------------------
Q9VYT3_DROME/284-473--------------------------------------------------------------------------------
MPPA_HUMAN/232-431--------------------------------------------------------------------------------
Q9ZIG1_RHOSI/193-288--------------------------------------------------------------------------------
MPPA_YEAST/181-374--------------------------------------------------------------------------------
Q9XBW5_PORGN/207-395--------------------------------------------------------------------------------
Q9VFF0_DROME/203-385--------------------------------------------------------------------------------
MPPB_YEAST/189-380--------------------------------------------------------------------------------
O83069_TREPA/199-385--------------------------------------------------------------------------------
QCR1_EUGGR/190-391--------------------------------------------------------------------------------
Q9M9Z4_ARATH/273-458--------------------------------------------------------------------------------
O61441_HAEIR/3-170--------------------------------------------------------------------------------
O25656_HELPY/198-379--------------------------------------------------------------------------------
Y228_BORBU/711-879--------------------------------------------------------------------------------
Q9A579_CAUCR/219-397--------------------------------------------------------------------------------
MPPB_BLAEM/198-380--------------------------------------------------------------------------------
MPPA2_ARATH/235-419--------------------------------------------------------------------------------
Q9PLB7_CHLMU/683-862--------------------------------------------------------------------------------
PXM16_ARATH/198-379--------------------------------------------------------------------------------
Q9PF62_XYLFA/244-422--------------------------------------------------------------------------------
Q9CE72_LACLA/168-341--------------------------------------------------------------------------------
Q22370_CAEEL/182-353--------------------------------------------------------------------------------
Q9XBW5_PORGN/690-872--------------------------------------------------------------------------------
Q9RWP9_DEIRA/229-413--------------------------------------------------------------------------------
Q9JMV9_BRAJP/168-341--------------------------------------------------------------------------------
PTRA_ECOLI/213-396--------------------------------------------------------------------------------
Q97IL0_CLOAB/163-340--------------------------------------------------------------------------------
Q17593_CAEEL/199-381--------------------------------------------------------------------------------
Q9A2H7_CAUCR/672-850--------------------------------------------------------------------------------
Q9A531_CAUCR/720-903--------------------------------------------------------------------------------
MPPA_SCHPO/208-400--------------------------------------------------------------------------------
Q9SCM5_ARATH/200-381--------------------------------------------------------------------------------
Q9HT96_PSEAE/190-362--------------------------------------------------------------------------------
Q9I6C3_PSEAE/229-405--------------------------------------------------------------------------------
PREP_DROME/784-953--------------------------------------------------------------------------------
Q17592_CAEEL/199-354--------------------------------------------------------------------------------
Q9UVF2_YARLL/16-206--------------------------------------------------------------------------------
STE23_YEAST/246-428--------------------------------------------------------------------------------
Q9KUG7_VIBCH/686-864--------------------------------------------------------------------------------
Q9KQC8_VIBCH/661-839--------------------------------------------------------------------------------
Q9VV75_DROME/190-364--------------------------------------------------------------------------------
PQQL_HAEIN/205-388--------------------------------------------------------------------------------
MPPA_SOLTU/236-422--------------------------------------------------------------------------------
YAN2_SCHPO/193-378--------------------------------------------------------------------------------
NRDC_HUMAN/837-1020--------------------------------------------------------------------------------
Q9JS80_CHLPN/718-886--------------------------------------------------------------------------------
Q9U7N7_PLAFA/914-1104--------------------------------------------------------------------------------
O84831_CHLTR/201-385--------------------------------------------------------------------------------
Q9A579_CAUCR/657-835--------------------------------------------------------------------------------
Q9FIH8_ARATH/360-598--------------------------------------------------------------------------------
Q9A531_CAUCR/246-428--------------------------------------------------------------------------------
O84812_CHLTR/700-879--------------------------------------------------------------------------------
Q40983_PEA/925-1150--------------------------------------------------------------------------------
Q49145_METEX/235-418--------------------------------------------------------------------------------
CYM1_YEAST/221-407--------------------------------------------------------------------------------
Q97EV0_CLOAB/207-392--------------------------------------------------------------------------------
Q9VYT3_DROME/769-953--------------------------------------------------------------------------------
QCR1_YEAST/187-370--------------------------------------------------------------------------------
Q9TZ33_CAEEL/181-355--------------------------------------------------------------------------------
Q9FNU9_DACGL/238-423--------------------------------------------------------------------------------
Q40738_ORYSA/2-120--------------------------------------------------------------------------------
Q9VP94_DROME/724-907--------------------------------------------------------------------------------
O67945_AQUAE/183-355--------------------------------------------------------------------------------
Q9KRD3_VIBCH/199-378--------------------------------------------------------------------------------
Q9FIH8_ARATH/928-1156--------------------------------------------------------------------------------
Q41445_SOLTU/262-449--------------------------------------------------------------------------------
MU138_SCHPO/668-850--------------------------------------------------------------------------------
Q9ANJ2_BRAJP/2-119--------------------------------------------------------------------------------
Q9PL96_CHLMU/717-886--------------------------------------------------------------------------------
Q41444_SOLTU/259-445--------------------------------------------------------------------------------
NRDC_HUMAN/361-548--------------------------------------------------------------------------------
Q9U7N7_PLAFA/282-510--------------------------------------------------------------------------------
Q97EV0_CLOAB/725-889--------------------------------------------------------------------------------
QCR2_EUGGR/221-398--------------------------------------------------------------------------------
QCR2_SCHPO/182-354--------------------------------------------------------------------------------
P74016_SYNY3/241-420--------------------------------------------------------------------------------
Q9RHS7_9LACT/2-99--------------------------------------------------------------------------------
Q9TAP0_TOXGO/4-197--------------------------------------------------------------------------------
Q99UJ4_STAAM/179-355--------------------------------------------------------------------------------
MU138_SCHPO/196-378--------------------------------------------------------------------------------
Q55159_SYNY3/175-359--------------------------------------------------------------------------------
MPPA1_ARATH/239-423--------------------------------------------------------------------------------
O50512_STRCO/190-374--------------------------------------------------------------------------------
PQQL_HAEIN/680-857--------------------------------------------------------------------------------
O84831_CHLTR/717-886--------------------------------------------------------------------------------
Q9KA85_BACHD/165-338--------------------------------------------------------------------------------
P74305_SYNY3/274-453--------------------------------------------------------------------------------
Y2805_MYCBO/178-357--------------------------------------------------------------------------------
Q9CML5_PASMU/205-388--------------------------------------------------------------------------------
O87530_STRPY/183-363--------------------------------------------------------------------------------
MPPB_HUMAN/220-404--------------------------------------------------------------------------------
Q9Z6V1_CHLPN/688-867--------------------------------------------------------------------------------
Y219_RICPR/168-341--------------------------------------------------------------------------------
O51486_BORBU/686-867--------------------------------------------------------------------------------
Q9A308_CAUCR/166-339--------------------------------------------------------------------------------
Q9KA98_BACHD/181-363--------------------------------------------------------------------------------
PQQF_PSEAE/179-352--------------------------------------------------------------------------------
YO098_YEAST/193-378--------------------------------------------------------------------------------
PQQF_KLEPN/173-343--------------------------------------------------------------------------------
YHJJ_ECOLI/199-378--------------------------------------------------------------------------------
Q9KQC8_VIBCH/196-377--------------------------------------------------------------------------------
Q983M8_RHILO/208-384--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/246-424--------------------------------------------------------------------------------
Y4WA_RHISN/251-435--------------------------------------------------------------------------------
Y4WB_RHISN/198-374--------------------------------------------------------------------------------
MPPA_NEUCR/214-475--------------------------------------------------------------------------------
P73669_SYNY3/171-348--------------------------------------------------------------------------------
Q9CE73_LACLA/164-346--------------------------------------------------------------------------------
Q9KRD3_VIBCH/671-849--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/703-883--------------------------------------------------------------------------------
UCR1_CAEEL/200-386--------------------------------------------------------------------------------
Q9PF62_XYLFA/714-895--------------------------------------------------------------------------------
Q40983_PEA/357-594--------------------------------------------------------------------------------
MPPA_RAT/231-430--------------------------------------------------------------------------------
QCR2_YEAST/166-327--------------------------------------------------------------------------------
O51486_BORBU/206-392--------------------------------------------------------------------------------
PQQL_ECOLI/683-863--------------------------------------------------------------------------------
O16249_CAEEL/747-931--------------------------------------------------------------------------------
Q97LA3_CLOAB/174-348--------------------------------------------------------------------------------
Q9RWP9_DEIRA/777-912--------------------------------------------------------------------------------
Q983M9_RHILO/206-390--------------------------------------------------------------------------------
Q9A2H7_CAUCR/210-390--------------------------------------------------------------------------------
Q99UJ3_STAAM/181-363--------------------------------------------------------------------------------
O16249_CAEEL/258-440--------------------------------------------------------------------------------
PQQF_PSEFL/185-366--------------------------------------------------------------------------------
Q97N47_STRPN/186-364--------------------------------------------------------------------------------
Q97GF6_CLOAB/170-348--------------------------------------------------------------------------------
PREP_DROME/268-457--------------------------------------------------------------------------------
STE23_YEAST/716-898--------------------------------------------------------------------------------
Y228_BORBU/195-380--------------------------------------------------------------------------------
Q9CML5_PASMU/680-857--------------------------------------------------------------------------------
MPPA_BLAEM/177-373--------------------------------------------------------------------------------
Q9KA97_BACHD/184-365--------------------------------------------------------------------------------
O87529_STRPY/177-351--------------------------------------------------------------------------------
Y5738_STRCO/198-380--------------------------------------------------------------------------------
O25371_HELPY/185-361--------------------------------------------------------------------------------

PF03410

MP44_MCV1/1-592TFIKYSRSRPAALFQYIFLAFFATGRSIAEILERREALVSFDARRCVNRLVFAKRARYDVVTKSSFVCGVLRGP------
G1_VAR67/1-591SFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF.SKKTKSKILFGRNARYDVTTKSSFVCGIVRGK------
MP44_MYXVL/1-589TFMKYSKSKPAAMYQYLILSFFVSGNTIEDILQHRESVVKL.CRTYKNKIVLGKQTRYDIQTLSSFVCGIFKGP------

PF00675

AXL1_YEAST/34-179----------------------------------------------------------------DVFASFFKEP------
IDE_HUMAN/74-212----------------------------------------------------------------DRFAQFFLCP------
YMXG_BACSU/12-160----------------------------------------------------------------DVLADMFFHS------
YQA4_CAEEL/37-175----------------------------------------------------------------DRFAQFFLDP------
IDE_DROME/47-185----------------------------------------------------------------DRFAQFFIAP------
MPPA_YEAST/29-176----------------------------------------------------------------QLMSETVRFP------
NRDC_RAT/210-348----------------------------------------------------------------DRWAQFFIHP------
PTRA_ECOLI/54-192----------------------------------------------------------------DRLADAIAEP------
QCR1_BOVIN/58-205----------------------------------------------------------------ELLADIVQNC------
MPPB_NEUCR/50-198----------------------------------------------------------------DILQDILQNS------
QCR2_EUGGR/64-216----------------------------------------------------------------DKFWQSLLFP------
MPPB_RAT/68-215----------------------------------------------------------------EILADIIQNS------
MPPB_YEAST/36-184----------------------------------------------------------------DILSDILTKS------
QCR2_YEAST/17-163----------------------------------------------------------------NALADVLYKT------
PQQL_HAEIN/45-188----------------------------------------------------------------DVINEWMNNI------
UCR1_CAEEL/48-195----------------------------------------------------------------DILADVLRNS------
PQQF_KLEPN/15-154----------------------------------------------------------------ARLQEMLQAP------
MPPA_SOLTU/85-231----------------------------------------------------------------EMLADCVRNP------
SDP_EIMBO/44-183----------------------------------------------------------------DRFS..FKSP------
QCR1_EUGGR/37-184----------------------------------------------------------------DILADILLNS------
MPPA_NEUCR/62-209----------------------------------------------------------------ELMAETIRDP------
PQQF_PSEFL/28-167----------------------------------------------------------------ERLCEMLAQP------
PQQL_ECOLI/46-204----------------------------------------------------------------AIFSEWSNAA------
MPPA_HUMAN/77-227----------------------------------------------------------------ALLADVVLQP------
QCR2_BOVIN/48-194----------------------------------------------------------------EFLLNVTTAP------
QCR1_YEAST/37-182----------------------------------------------------------------DFLNQSFIQQ------

PF02664

LUXS_HAEIN/2-162----------------------------------------------------------------GFYMSLIGTP------
LUXS_ECOLI/2-162----------------------------------------------------------------GFYMSLIGTP------
LUXS_BACSU/2-156----------------------------------------------------------------GYYLVVSGEP------
LUXS_HELPJ/3-151----------------------------------------------------------------GFYLTVLNHD------
LUXS_BORBU/2-157----------------------------------------------------------------GFYLIIFGDY------

PF05193

QCR1_MOUSE/210-395----------------------------------------------------------------QVANAIIGHYDCTY..
IDE_HUMAN/236-418----------------------------------------------------------------HYLGHLIGHE......
IDE_HUMAN/706-889----------------------------------------------------------------ELFCQIISEP......
YMFH_BACSU/182-363----------------------------------------------------------------NLLLEALFGK......
YMXG_BACSU/165-338----------------------------------------------------------------IVLNNVLGGS......
YQA4_CAEEL/603-787----------------------------------------------------------------KLLNELIKNP......
QCR2_MOUSE/199-378----------------------------------------------------------------SVLQHLLGAGPHIK..
YQA4_CAEEL/200-382----------------------------------------------------------------DYIAHLIGHE......
PREP1_ARATH/301-489----------------------------------------------------------------GFLDHLMLGT......
IDE_DROME/209-391----------------------------------------------------------------NYLTHLIGHE......
Q9YFN7_AERPE/166-342----------------------------------------------------------------NVLARLRGVVFNL...
IDE_DROME/679-863----------------------------------------------------------------NLVSQVLSEP......
Q9RRH6_DEIRA/141-315----------------------------------------------------------------GLLAELIGGE......
PQQL_ECOLI/206-388----------------------------------------------------------------QAEWSMLVQL......
Q9X167_THEMA/162-335----------------------------------------------------------------YALNTALGSG......
Q9U6C9_TOXGO/170-352----------------------------------------------------------------SVLQTILGGGGAFST.
Q97N46_STRPN/177-351----------------------------------------------------------------IVMNGLLGGF......
Q9JS80_CHLPN/201-385----------------------------------------------------------------HVLEIILMGT......
Q9I6C2_PSEAE/203-388----------------------------------------------------------------RLIGALLDGG......
Q9ANJ4_BRAJP/5-169----------------------------------------------------------------CIVNHILGGG......
MPPB_SCHPO/185-372----------------------------------------------------------------LVMQAIIGNWDRAM..
PXM16_ARATH/666-854----------------------------------------------------------------NIKLQLFGLV......
MPPB_LENED/192-381----------------------------------------------------------------MVMQSIFGNWDRSL..
Q9KUG7_VIBCH/219-398----------------------------------------------------------------DALASALGSG......
O50511_STRCO/185-366----------------------------------------------------------------DLALTVLGGG......
Q9UVF2_YARLL/538-703----------------------------------------------------------------QVLANMLTHK......
Q49146_METEX/5-143----------------------------------------------------------------YVLNHILGGG......
PTRA_ECOLI/681-858----------------------------------------------------------------SAYSSLLGQI......
MPPB_NEUCR/203-391----------------------------------------------------------------LVTQAIVGNYDKAL..
Q9RRH5_DEIRA/126-298----------------------------------------------------------------QLALTALSGG......
QCR2_NEUCR/198-375----------------------------------------------------------------SVLVGLLGGVSNI...
Q985V3_RHILO/166-339----------------------------------------------------------------QVLSMILGGG......
Q9AXQ2_CUCME/257-443----------------------------------------------------------------MVMQAMLGSWNKSA..
Q9PLB7_CHLMU/208-391----------------------------------------------------------------QSLVSVLSSE......
Q9FJT9_ARATH/639-833----------------------------------------------------------------GFLGKLLETK......
Q23295_CAEEL/192-374----------------------------------------------------------------MVANTLMGEYDRMR..
CYM1_YEAST/735-911----------------------------------------------------------------QVMSNMLTFK......
O67308_AQUAE/184-360----------------------------------------------------------------LVFSEILCGG......
O84812_CHLTR/225-408----------------------------------------------------------------QSLISILSSE......
Q9M9Z4_ARATH/748-933----------------------------------------------------------------DLFHEIIEEP......
SDP_EIMBO/201-391----------------------------------------------------------------SVLTYLLEYT......
P73670_SYNY3/182-362----------------------------------------------------------------DLLAVVLAGS......
Q9VP94_DROME/242-425----------------------------------------------------------------MFISQLIGYE......
Q9Z6V1_CHLPN/209-393----------------------------------------------------------------KALAEVLRNE......
Q97II7_CLOAB/206-391----------------------------------------------------------------ELLESILLEA......
YPD1_CAEEL/194-376----------------------------------------------------------------HVLFDYLSNT......
Q9VYT3_DROME/284-473----------------------------------------------------------------QFLSYLLGYE......
MPPA_HUMAN/232-431----------------------------------------------------------------AVLNMMMGGGGSFSA.
Q9ZIG1_RHOSI/193-288----------------------------------------------------------------.......QRG......
MPPA_YEAST/181-374----------------------------------------------------------------ATLQTLLGGGGSFSA.
Q9XBW5_PORGN/207-395----------------------------------------------------------------GLVEDYMKQV......
Q9VFF0_DROME/203-385----------------------------------------------------------------MVANTLVGAWDRSQ..
MPPB_YEAST/189-380----------------------------------------------------------------LATQAIVGNWDRAI..
O83069_TREPA/199-385----------------------------------------------------------------FLLEHVLLGH......
QCR1_EUGGR/190-391----------------------------------------------------------------KVLEQLLGSYSRD...
Q9M9Z4_ARATH/273-458----------------------------------------------------------------DYLAHLLGHE......
O61441_HAEIR/3-170----------------------------------------------------------------AVLQCALGAGPAT...
O25656_HELPY/198-379----------------------------------------------------------------DALSRLLGEG......
Y228_BORBU/711-879----------------------------------------------------------------NFLEHVLRSG......
Q9A579_CAUCR/219-397----------------------------------------------------------------DLLSDVLVSD......
MPPB_BLAEM/198-380----------------------------------------------------------------LVASAMIGSYDRAA..
MPPA2_ARATH/235-419----------------------------------------------------------------TVLQMLMGGGGSFSA.
Q9PLB7_CHLMU/683-862----------------------------------------------------------------SVATSMLLSW......
PXM16_ARATH/198-379----------------------------------------------------------------QYLGHLIGHE......
Q9PF62_XYLFA/244-422----------------------------------------------------------------DLATTILGGN......
Q9CE72_LACLA/168-341----------------------------------------------------------------QVMNGLLGGF......
Q22370_CAEEL/182-353----------------------------------------------------------------AVLLTALGNSSPVK..
Q9XBW5_PORGN/690-872----------------------------------------------------------------EVFSAVMDQV......
Q9RWP9_DEIRA/229-413----------------------------------------------------------------GVLSDVLLGN......
Q9JMV9_BRAJP/168-341----------------------------------------------------------------QVFTNILGGG......
PTRA_ECOLI/213-396----------------------------------------------------------------ELITYLIGNR......
Q97IL0_CLOAB/163-340----------------------------------------------------------------RAFNVIFGEG......
Q17593_CAEEL/199-381----------------------------------------------------------------HYIAHLIGHK......
Q9A2H7_CAUCR/672-850----------------------------------------------------------------VVANTVLGVG......
Q9A531_CAUCR/720-903----------------------------------------------------------------SVLGQVMQLR......
MPPA_SCHPO/208-400----------------------------------------------------------------ACLQFLLGGGGSFSA.
Q9SCM5_ARATH/200-381----------------------------------------------------------------RYLGDLIGHE......
Q9HT96_PSEAE/190-362----------------------------------------------------------------VLLQAYMNDA......
Q9I6C3_PSEAE/229-405----------------------------------------------------------------YLGNQILGGG......
PREP_DROME/784-953----------------------------------------------------------------RVLAKLLSAK......
Q17592_CAEEL/199-354----------------------------------------------------------------KFFAHLIRHK......
Q9UVF2_YARLL/16-206----------------------------------------------------------------KIISSLLIDG......
STE23_YEAST/246-428----------------------------------------------------------------RILSHLIGHE......
Q9KUG7_VIBCH/686-864----------------------------------------------------------------QLANFNLAGN......
Q9KQC8_VIBCH/661-839----------------------------------------------------------------YSLANHLMSA......
Q9VV75_DROME/190-364----------------------------------------------------------------AILEQALGAKAAT...
PQQL_HAEIN/205-388----------------------------------------------------------------ELIQQITTRL......
MPPA_SOLTU/236-422----------------------------------------------------------------TVLQMLMGGGGSFSA.
YAN2_SCHPO/193-378----------------------------------------------------------------ETLCEFLSES......
NRDC_HUMAN/837-1020----------------------------------------------------------------ELLVMHMEEP......
Q9JS80_CHLPN/718-886----------------------------------------------------------------TVAAEILDNV......
Q9U7N7_PLAFA/914-1104----------------------------------------------------------------TVIVAALKNS......
O84831_CHLTR/201-385----------------------------------------------------------------HVLDLVLMGT......
Q9A579_CAUCR/657-835----------------------------------------------------------------DVMNTLFGGD......
Q9FIH8_ARATH/360-598----------------------------------------------------------------VLMKRIFLSA......
Q9A531_CAUCR/246-428----------------------------------------------------------------AVLNRRLQAV......
O84812_CHLTR/700-879----------------------------------------------------------------SVATSMLLSW......
Q40983_PEA/925-1150----------------------------------------------------------------GLLSEIINSR......
Q49145_METEX/235-418----------------------------------------------------------------ELLAEVVGGG......
CYM1_YEAST/221-407----------------------------------------------------------------KVLGNLLMDG......
Q97EV0_CLOAB/207-392----------------------------------------------------------------DMLEYILLES......
Q9VYT3_DROME/769-953----------------------------------------------------------------LDLLMMFVDE......
QCR1_YEAST/187-370----------------------------------------------------------------KLAAQIFGSYNAFE..
Q9TZ33_CAEEL/181-355----------------------------------------------------------------AVFLAHIGRASPLKF.
Q9FNU9_DACGL/238-423----------------------------------------------------------------SVLQALLGGGGLFSW.
Q40738_ORYSA/2-120----------------------------------------------------------------TVLQMLMGGGGSFSA.
Q9VP94_DROME/724-907----------------------------------------------------------------MDLVELIVEE......
O67945_AQUAE/183-355----------------------------------------------------------------KVYNAVLGEG......
Q9KRD3_VIBCH/199-378----------------------------------------------------------------DDVGEQLLHT......
Q9FIH8_ARATH/928-1156----------------------------------------------------------------KSEEQLLEGGDRELQK
Q41445_SOLTU/262-449----------------------------------------------------------------MVMQQMLGSWNKSS..
MU138_SCHPO/668-850----------------------------------------------------------------TRLARQIMKE......
Q9ANJ2_BRAJP/2-119----------------------------------------------------------------EVLEQLMGGG......
Q9PL96_CHLMU/717-886----------------------------------------------------------------SVAAEVLGNV......
Q41444_SOLTU/259-445----------------------------------------------------------------MVMQSMLGTWNKNA..
NRDC_HUMAN/361-548----------------------------------------------------------------HYISWLVGHE......
Q9U7N7_PLAFA/282-510----------------------------------------------------------------LIINNLLIHT......
Q97EV0_CLOAB/725-889----------------------------------------------------------------KVLKSIISLS......
QCR2_EUGGR/221-398----------------------------------------------------------------LVIAQALSNA......
QCR2_SCHPO/182-354----------------------------------------------------------------FVLSSILGGDAAV...
P74016_SYNY3/241-420----------------------------------------------------------------SVMNGVLGGF......
Q9RHS7_9LACT/2-99----------------------------------------------------------------QVMNGLFGGF......
Q9TAP0_TOXGO/4-197----------------------------------------------------------------MLMQAIVGSYRKHDEG
Q99UJ4_STAAM/179-355----------------------------------------------------------------VVFNMMFGGD......
MU138_SCHPO/196-378----------------------------------------------------------------EYVCHLLGHE......
Q55159_SYNY3/175-359----------------------------------------------------------------GVLAVILGRG......
MPPA1_ARATH/239-423----------------------------------------------------------------TVLQMLMGGGGSFSA.
O50512_STRCO/190-374----------------------------------------------------------------VLGTYCLGGT......
PQQL_HAEIN/680-857----------------------------------------------------------------NILADIVQEK......
O84831_CHLTR/717-886----------------------------------------------------------------SVAAEVLGNV......
Q9KA85_BACHD/165-338----------------------------------------------------------------VLLNNVLGGS......
P74305_SYNY3/274-453----------------------------------------------------------------DVMTTILSSG......
Y2805_MYCBO/178-357----------------------------------------------------------------SVLHTALGGG......
Q9CML5_PASMU/205-388----------------------------------------------------------------DLTQQILIRL......
O87530_STRPY/183-363----------------------------------------------------------------KLFLSMLIGW......
MPPB_HUMAN/220-404----------------------------------------------------------------MVANTLIGNWDRSF..
Q9Z6V1_CHLPN/688-867----------------------------------------------------------------KVCAEMLFEW......
Y219_RICPR/168-341----------------------------------------------------------------YLLSIIFGGG......
O51486_BORBU/686-867----------------------------------------------------------------NALADLLTDG......
Q9A308_CAUCR/166-339----------------------------------------------------------------RIFAECLGGG......
Q9KA98_BACHD/181-363----------------------------------------------------------------NVLLELMFGQ......
PQQF_PSEAE/179-352----------------------------------------------------------------LAFAELLGDR......
YO098_YEAST/193-378----------------------------------------------------------------DVLLDYFTDS......
PQQF_KLEPN/173-343----------------------------------------------------------------TLLREFLLDE......
YHJJ_ECOLI/199-378----------------------------------------------------------------ALLRYWRADL......
Q9KQC8_VIBCH/196-377----------------------------------------------------------------SYFAHLIGYE......
Q983M8_RHILO/208-384----------------------------------------------------------------VLMNEILGGG......
Q9RTZ9_DEIRA/246-424----------------------------------------------------------------QVLGELLSDE......
Y4WA_RHISN/251-435----------------------------------------------------------------DILSEILGGG......
Y4WB_RHISN/198-374----------------------------------------------------------------NLMNQILGGG......
MPPA_NEUCR/214-475----------------------------------------------------------------ATLQTLLGGGGSFSA.
P73669_SYNY3/171-348----------------------------------------------------------------KLLSTYLGNG......
Q9CE73_LACLA/164-346----------------------------------------------------------------KLANQLFLDLL.....
Q9KRD3_VIBCH/671-849----------------------------------------------------------------VFIDDMLQRI......
Q9RTZ9_DEIRA/703-883----------------------------------------------------------------DVAMRIFGGG......
UCR1_CAEEL/200-386----------------------------------------------------------------QIANQFIGQWDVTH..
Q9PF62_XYLFA/714-895----------------------------------------------------------------NVGNEAFGGT......
Q40983_PEA/357-594----------------------------------------------------------------VLMKRIFLSA......
MPPA_RAT/231-430----------------------------------------------------------------AVLNMMMGGGGSFSA.
QCR2_YEAST/166-327----------------------------------------------------------------EVLANYLTSA......
O51486_BORBU/206-392----------------------------------------------------------------SLLAALFENR......
PQQL_ECOLI/683-863----------------------------------------------------------------DAFNVALAKD......
O16249_CAEEL/747-931----------------------------------------------------------------GLIDQLIREP......
Q97LA3_CLOAB/174-348----------------------------------------------------------------DTIEYFLFSI......
Q9RWP9_DEIRA/777-912----------------------------------------------------------------LVLSRLLRSE......
Q983M9_RHILO/206-390----------------------------------------------------------------DLLAEILGGG......
Q9A2H7_CAUCR/210-390----------------------------------------------------------------AVLDAILTAG......
Q99UJ3_STAAM/181-363----------------------------------------------------------------SLFFELIFGE......
O16249_CAEEL/258-440----------------------------------------------------------------HYISHLIGHE......
PQQF_PSEFL/185-366----------------------------------------------------------------DFLCTWLQSA......
Q97N47_STRPN/186-364----------------------------------------------------------------KLLFAMMFGW......
Q97GF6_CLOAB/170-348----------------------------------------------------------------KILNYKLGES......
PREP_DROME/268-457----------------------------------------------------------------HVLSEVLIRG......
STE23_YEAST/716-898----------------------------------------------------------------SALSGLFAQL......
Y228_BORBU/195-380----------------------------------------------------------------EILSEILLDD......
Q9CML5_PASMU/680-857----------------------------------------------------------------DLLADVLQEV......
MPPA_BLAEM/177-373----------------------------------------------------------------STLQVLMGGGGAFSA.
Q9KA97_BACHD/184-365----------------------------------------------------------------QVMNGLFGGF......
O87529_STRPY/177-351----------------------------------------------------------------VFLNGLLGSF......
Y5738_STRCO/198-380----------------------------------------------------------------GVLNTALGGG......
O25371_HELPY/185-361----------------------------------------------------------------KVMMFVLGGG......

PF03410

MP44_MCV1/1-592----------------------RLSEAALTRAMWEL--------------KRKGL-LYSLEHTRMHAKHTF---------
G1_VAR67/1-591----------------------LLDKTSLVEMMWDL--------------KKKGL-IYSMEFTNLLSKNTF---------
MP44_MYXVL/1-589----------------------SVTSEYLTDIMWKL--------------KRKGL-IYSLEFVEL.QKNMF---------

PF00675

AXL1_YEAST/34-179-------------------...LFNP-------LLI--------------SK........EIYAIQSEH..---------
IDE_HUMAN/74-212-------------------...LFDE-------SCK--------------DR........EVNAVDSEH..---------
YMXG_BACSU/12-160-------------------...TFDE-------NEL--------------KKEKN.VVYEEIKMYEDAP..---------
YQA4_CAEEL/37-175-------------------...QFTE-------SAT--------------ER........EVCAVNCEY..---------
IDE_DROME/47-185-------------------...LFTP-------SAT--------------ER........EINAVNSEH..---------
MPPA_YEAST/29-176-------------------...KITE-------QEL--------------QEQKL.SAEYEIDEVWMKP..---------
NRDC_RAT/210-348-------------------...LMIR-------DAI--------------DR........EVEAVDSEY..---------
PTRA_ECOLI/54-192-------------------...LLDK-------KYA--------------ER........ERNAVNAEL..---------
QCR1_BOVIN/58-205-------------------...SLED-------SQI--------------EKERD.VILQELQENDTSM..---------
MPPB_NEUCR/50-198-------------------...KLEE-------SAI--------------ERERD.VILRESEEVEKQL..---------
QCR2_EUGGR/64-216-------------------...RFSP-------ENV--------------KEVKR.LVELESKETKRDS.P---------
MPPB_RAT/68-215-------------------...TLGE-------AEI--------------ERERG.VILREMQEVETNL..---------
MPPB_YEAST/36-184-------------------...VLDN-------SAI--------------ERERD.VIIRESEEVDKMY..---------
QCR2_YEAST/17-163-------------------...AFKP-------HEL--------------TESVLPAARYDYAVAEQCP..---------
PQQL_HAEIN/45-188-------------------...TFLP-------KDV--------------DG........ERGVVQEEW..---------
UCR1_CAEEL/48-195-------------------...KLEA-------STI--------------DTERV.NLLKELEASDDYH..---------
PQQF_KLEPN/15-154-------------------...LLLR-------EDI--------------QR........EVAVIDAEY.R---------
MPPA_SOLTU/85-231-------------------...AFLD-------WEV--------------KEQLE.KVKAEISEYSKNP..---------
SDP_EIMBO/44-183-------------------...LFSR-------QYE--------------EK........EVNAIDAEH..---------
QCR1_EUGGR/37-184-------------------...KRTE-------QDL--------------DAERQ.TIVQEKEDVEARI.D---------
MPPA_NEUCR/62-209-------------------...KLTD-------EEL--------------EGQIM.TAQYEVNEIWSKA..---------
PQQF_PSEFL/28-167-------------------...RMSL-------EDQ--------------HR........EREVLHAEF..---------
PQQL_ECOLI/46-204-------------------...TFEK-------LEV--------------DAERGVITEEWRAHQDAKWRT---------
MPPA_HUMAN/77-227-------------------...RLTD-------EEV--------------EMTRM.AVQFELEDLNLRPDP---------
QCR2_BOVIN/48-194-------------------...EFRR-------WEV--------------AA..L.QPQLRIDKAVALQNP---------
QCR1_YEAST/37-182-------------------KANLLSS-------SNF--------------EATKK.SVLKQVQDFEEND.H---------

PF02664

LUXS_HAEIN/2-162-------------------NEQKVSE-------AWL--------------ASMQD---VLGVQDQASIPEL------NIY
LUXS_ECOLI/2-162-------------------DEQRVAD-------AWK--------------AAMED---VLKVQDQNQIPEL------NVY
LUXS_BACSU/2-156-------------------TSAEIVD-------LLE--------------DTMKE---AVEIT...EIPAA------NEK
LUXS_HELPJ/3-151-------------------NYTEILE-------VLE--------------KTMQD---VLKAK...EVPAS------NEK
LUXS_BORBU/2-157-------------------ESKDLVD-------LVS--------------WLFSE---IVNFSE..PIPGA------SDK

PF05193

QCR1_MOUSE/210-395..............GGGVHLSSPLAS-------VAV...............ANKL...CQSFQTF.NISYS......DTG
IDE_HUMAN/236-418...................GPGSLLS-------ELK...............SKGW...VNTLVGG.QKEGA.....RGFM
IDE_HUMAN/706-889.......................CFN-------TLR..............TKEQL...GYIVFSG.PRRAN........G
YMFH_BACSU/182-363....................SSAQYE-------SLY...............EKGY...IDETFSFDFTAEY......GFG
YMXG_BACSU/165-338...................MSSRLFQ-------DVR..............EDKGL...AYSVYSY.HSSYE......DSG
YQA4_CAEEL/603-787.......................AYT-------ILR..............TNEAL...GYNVSTE.SRLND........G
QCR2_MOUSE/199-378...............RGNNTTSLLSQ-------SVA..............KGSHQ...PFDVSAF.NASYS......DSG
YQA4_CAEEL/200-382...................GPGSLLS-------ELK...............RLGW...VISLEADNHTIAS......GFG
PREP1_ARATH/301-489...................PASPLRK-------ILL...............ESGL...GEALVSS.GLSDE.....LLQP
IDE_DROME/209-391...................GKGSILS-------ELR...............RLGW...CNDLMAGHQNTQN......GFG
Q9YFN7_AERPE/166-342................EAGATSILFK-------EVR..............EERGL...AYGFNVD.VHITS.....WGSS
IDE_DROME/679-863.......................CYD-------CLR..............TKEQL...GYIVFSG.VRKVN........G
Q9RRH6_DEIRA/141-315....................NGALYW-------ALL...............DTGL...ADSADLG.HIEYR......DAG
PQQL_ECOLI/206-388...................FNQRLQE-------RIQ...............SGELK.TISGGTARSVKIAP......DYQ
Q9X167_THEMA/162-335...................MSSILFH-------EIR..............EKEGF...VYDVFSQ.IYALK......ETG
Q9U6C9_TOXGO/170-352.............GGPGKGMYTRLYL-------NVL..............NQNEW...VESAMAF.NTQYT......DSG
Q97N46_STRPN/177-351...................AHSKLFT-------NVR..............ENAGL...AYTISSE.LDLFS........G
Q9JS80_CHLPN/201-385...................DASPLKS-------RLL...............KSGF...CKQTEMS......IE.NDIREI
Q9I6C2_PSEAE/203-388...................YSARLAS-------RLE..............RGEEL...VAGASTY.YDAFN.....RGDS
Q9ANJ4_BRAJP/5-169..................GLTSRLFR-------EVR..............EKRGL...AYSVREQ.LVWLD......HSA
MPPB_SCHPO/185-372..............GASPHLSSRLST-------IVQ...............QHQL...ANSFMSF.STSYS......DTG
PXM16_ARATH/666-854...................AKQATFH-------QLR..............TVEQL...GYITALA.QRNDS........G
MPPB_LENED/192-381..............GASSLLSSRLSH-------IIS...............SNSL...ANSFMSF.STSYS......DTG
Q9KUG7_VIBCH/219-398...................NNSLLYQ-------ELV...............KTQK...AVDAGAF.QDCAE......LAC
O50511_STRCO/185-366...................ESSRLYN-------RLVR............RDRTAV...AAGFGLLRLAGAP......SLG
Q9UVF2_YARLL/538-703......................HLHR-------EIR..............EKGG....AYGGGAS.YNPTD........G
Q49146_METEX/5-143..................AFTSRLFQ-------EVR..............EKRGL...AYSVGTS.LTSHR......AVA
PTRA_ECOLI/681-858...................VQPWFYN-------QLR..............TEEQL...GYAVFAF.PMSVG........R
MPPB_NEUCR/203-391..............GNAPHQGSKLSG-------FVH...............KHDL...ATSFMSF.STSYS......DTG
Q9RRH5_DEIRA/126-298...................SASRLFT-------RVR..............EERGL...AYEVSAT.PLVLG......GEG
QCR2_NEUCR/198-375................KWSPGFSLLA-------KAT.................AAN.PGAEAFAH.NYAYS......DAG
Q985V3_RHILO/166-339...................MSSRLFQ-------EVR..............EKRGL...CYSVYAF.HWGFS......DTG
Q9AXQ2_CUCME/257-443..............GGGKHMGSELAQ-------RVA...............INEV...AESMMAF.NTNYK......DTG
Q9PLB7_CHLMU/208-391...................KEHSLIA-------LLK...............KEHL...ITHMEAG.TYNTS.....LNTQ
Q9FJT9_ARATH/639-833.......................IIQ-------FLR..............FEHGQI.YSAEVSVF.LGGNKPSRTADLRG
Q23295_CAEEL/192-374..............GFGVNAPTRLAE-------KLS...............QDAG...IEVFQSF.NTCYK......ETG
CYM1_YEAST/735-911......................HLHR-------EVR..............EKGG....AYGGGAS.YSALA........G
O67308_AQUAE/184-360...................RISVFYR-------ELR...............EKGL...VYSYSCG.DMGRP......RDN
O84812_CHLTR/225-408...................KENSLVA-------LLK...............KEQL...ITEMEAE.LYSTS.....HNTQ
Q9M9Z4_ARATH/748-933.......................LFN-------QLR..............TKEQL...GYVVECG.PRLTY........R
SDP_EIMBO/201-391...................GQGSLAK-------RLR...............LLGL...ADGLSPV.VDKNT......VST
P73670_SYNY3/182-362...................HCARLVQ-------RLR..............EELGL...VFDIQSC.FSLQK......EAS
Q9VP94_DROME/242-425...................GVGSLCA-------YLR...............HHLW...CISVVAG.VAESSFD.SNSIYS
Q9Z6V1_CHLPN/209-393...................SKNSLVS-------LLK...............NEQL...ITDLDVEFFRSSL......NTG
Q97II7_CLOAB/206-391...................SSSPLRR-------AIV...............EENI...GKDVFGV.FDSSI......LKN
YPD1_CAEEL/194-376...................SVAPLQK-------DFI.............LLEDPL...ASSVSFH.IA...EG.VRCDLR
Q9VYT3_DROME/284-473...................GRGSLCA-------YLR...............RRLW...ALQLIAG.IDENGFD.MNSMYS
MPPA_HUMAN/232-431.............GGPGKGMFSRLYL-------NVL..............NRHHW...MYNATSY.HHSYE......DTG
Q9ZIG1_RHOSI/193-288..........................-------..................ERGV.............TVR.........
MPPA_YEAST/181-374.............GGPGKGMYSRLYT-------HVL..............NQYYF...VENCVAF.NHSYS......DSG
Q9XBW5_PORGN/207-395...................ITTAVNE-------RLS..............EITHKP.NAPFLSAGAFFSNFMY.ITQTKD
Q9VFF0_DROME/203-385..............GGGANNASNLAR-------ASA...............EDNL...CHSFQSF.NTCYK......DTG
MPPB_YEAST/189-380..............GTGTNSPSPLAV-------AAS..............QNGSL...ANSYMSF.STSYA......DSG
O83069_TREPA/199-385...................DAAPLAQ-------ALL...............ESEL...GEDLYAY.NG...SH.IDLKRM
QCR1_EUGGR/190-391...............KGEAAYSCFAR-------AIVMDFYDPKVGQFFRPNKAGHN.PIHSLNAF.WAPYS......DVG
Q9M9Z4_ARATH/273-458...................GRGSLHS-------FLK...............AKGW...ATSLSAG.VGDDGIN.RSSLAY
O61441_HAEIR/3-170................KRGAVNGPFG-------KAL...............SSALG.DANARFAALNASYA......DAG
O25656_HELPY/198-379...................KSSWLQS-------ELV..............DKKRL...ASQAFSH.NMQLQ......DES
Y228_BORBU/711-879......................IFWE-------KIR...............VMGG...AYGASAS.IA..N........G
Q9A579_CAUCR/219-397...................KTSRLYK-------RLV..............FTDQS...ATAVGAS.VSPSE......IGG
MPPB_BLAEM/198-380...............GNAHPSSKLAQ-------IVA...............KHNL...ANSFTSF.NTTYS......DTG
MPPA2_ARATH/235-419.............GGPGKGMHSWLYL-------RLL..............NQHQQ...FQSCTAF.TSVFN......NTG
Q9PLB7_CHLMU/683-862...................IHNLYYN-------DLR..............TNQQL...GYMVGAK.YQ...EF.AETPCG
PXM16_ARATH/198-379...................GEGSLFH-------ALK...............TLGW...ATGLSAGEGEWTL......DYS
Q9PF62_XYLFA/244-422...................KSSRLYQ-------RLV..............YKDKL...ADSISAG.ISPFA......LAS
Q9CE72_LACLA/168-341...................AHSKLFT-------NVR..............EKASL...AYSISST.FDSFT........G
Q22370_CAEEL/182-353...............FNTGTTGVIAK-------AVG...............QNG......SASAF.QAVHA......DSG
Q9XBW5_PORGN/690-872.......................YTA-------TVR..............EKEGG...AYSVAAFGGL...EQ.YPQPKA
Q9RWP9_DEIRA/229-413...................AAAPLTR-------PLI...............ESGL.......GSA.LADLSGYRDDFREA
Q9JMV9_BRAJP/168-341...................MSYQLFQ-------EVR..............EKRGL...CYSIYSF.HAPYT......DTG
PTRA_ECOLI/213-396...................SPGTLSD-------WLQ...............KQGLV.EGISANSD.PIVNG......NSG
Q97IL0_CLOAB/163-340...................TSSMLYD-------KIR..............TKYGL...AYDIYSK.INNDG......GIK
Q17593_CAEEL/199-381...................GPGSISS-------ELK...............RLGW...ASSLKPESKTIAA......GFG
Q9A2H7_CAUCR/672-850...................FSSRLNQ-------EIR..............IKRGL...SYGAGSS.LTPQG......QFG
Q9A531_CAUCR/720-903.......................LTD-------ELR..............EKQGA...TYSPNATATA...SV.VFDDWG
MPPA_SCHPO/208-400.............GGPGKGMYSRLYL-------NVL..............NQYPW...VETCMAF.NHSYT......DSG
Q9SCM5_ARATH/200-381...................GEGSLFH-------ALK...............ILGW...ATGLYAGEADWSM......EYS
Q9HT96_PSEAE/190-362.......................LYA-------DLR..............VRRGL...TYGPSTD.RQVFA......NQG
Q9I6C3_PSEAE/229-405..................GFGTRLMD-------QVR..............EKRGL...TYGIYSG.FTAMQ......ARG
PREP_DROME/784-953......................YLLP-------VIR..............EKNG....AYGAGAK.ISSDG.........
Q17592_CAEEL/199-354...................GPGSLLV-------ELK...............RLGW...VNSLKSDSNTIAA......GFG
Q9UVF2_YARLL/16-206...................HSSPLHQ-------KLI...............DSGLG.SSYSPNTG.LDSAP......GAN
STE23_YEAST/246-428...................GSGSLLA-------HLK...............KLGW...ANELSAGGHTVSK......GNA
Q9KUG7_VIBCH/686-864...................FNSRINQ-------NLR..............EDKGY...TYGAGSY.FASNR......EIG
Q9KQC8_VIBCH/661-839......................TFFH-------EIR..............TKQQL...GYMVGTG.NMPLN.....RHPG
Q9VV75_DROME/190-364................KRGTSAGLFG-------EAV..............NCAG.G.VGASVKAV.NASYS......DAG
PQQL_HAEIN/205-388...................LNLRLQQ-------WEK..............ETENG...VDSANFYRTH...LG.KETLQS
MPPA_SOLTU/236-422.............GGPGKGMYSRLYL-------RVL..............NQYPQ...IHAFSAF.SSIYN......NTG
YAN2_SCHPO/193-378...................AVSPFGQ-------TFV..................E...IEDPFCS.FV...YF.YVSLRV
NRDC_HUMAN/837-1020.......................CFD-------FLR..............TKQTL...GYHVYPT.CRNTS........G
Q9JS80_CHLPN/718-886......................VLHT-------KIR...............EQGG...AYGSGAA.ANLSR........G
Q9U7N7_PLAFA/914-1104......................YLWD-------TVR.................GLN.GAYGVFAD..IEYD........G
O84831_CHLTR/201-385...................DAAPLKS-------RLL...............KSGL...CKQVDMS.IDSEL......HEI
Q9A579_CAUCR/657-835...................FVSRLNM-------NLR..............EDKHW...SYGAGSF.VRAAR......GTR
Q9FIH8_ARATH/360-598...................LHFRINT-------RYK...............SSN.P.PFTSVELDHSDSGR.....EGCT
Q9A531_CAUCR/246-428..........................-------.................GRSAEP.PFIAGGAFKGDQFG......AVR
O84812_CHLTR/700-879...................IHNLYFS-------DLR..............TEQQL...GYMVGSK.YL...EF.AETPCG
Q40983_PEA/925-1150.......................LFT-------TVR..............DSLGL...TYDVSFE.LN...LF.DRLKLG
Q49145_METEX/235-418...................STSFLYR-------KLV..............LEMGV...AVNAGAW.YM...GS.AMDDTR
CYM1_YEAST/221-407...................HSSVMYQ-------KLI...............ESGIG.LEFSVNSG.VEPTT......AVN
Q97EV0_CLOAB/207-392...................EAAPLKK-------AII...............KAGL...GKDVFGI......YD.NGIMQT
Q9VYT3_DROME/769-953......................PLFD-------QLR..............TKEQL...GYHVGAT.VRLNY........G
QCR1_YEAST/187-370..............PASRLQGIKLLD-------NIQ...............EYQL...CDNFNHF.SLSYK......DSG
Q9TZ33_CAEEL/181-355..............ASLPGSTSGLAL-------ANL...................P.EGVTGSAF.QAPYD......GSG
Q9FNU9_DACGL/238-423.............GRPGKGLHSRLNH-------LVN..............EFDQ....IKSISAF.KDVHS......TTG
Q40738_ORYSA/2-120.............GGPGKGMHSRLYL-------RIL..................................X.........
Q9VP94_DROME/724-907......................PFFN-------QLR..............TQEQL...GYSLGIH.QRIGY........G
O67945_AQUAE/183-355...................MTSKLFK-------VLR..............EEKGY...AYATYSFYPTRYS......SPR
Q9KRD3_VIBCH/199-378......................RLVA-------AFN..............DAAQA...ITGIYAT.HYEIE......GQR
Q9FIH8_ARATH/928-1156KLRAHPLFFGVTMGLLAEIINSRLFT-------TVR..............DSLGL...TYDVSFE.LN...LF.DRLNLG
Q41445_SOLTU/262-449..............GGGKHMGSELVQ-------RVA...............INEL...AESVMAF.NTNYK......DTG
MU138_SCHPO/668-850......................PTFS-------ILR..............TKEQL...GYIVFTL.VRQVT........P
Q9ANJ2_BRAJP/2-119...................INSYLYL-------SLV..............VEKQL...AVTARAS.YHSAA.....LDPS
Q9PL96_CHLMU/717-886......................ILHT-------KIR...............EQGG...AYGSGAS.ANLGR........G
Q41444_SOLTU/259-445..............GGGKHMGSDLAQ-------SVA...............INEL...AESMMSF.NTNYK......DTG
NRDC_HUMAN/361-548...................GKGSILS-------FLR...............KKCW...ALALFGG.NGETGFE.QNSTYS
Q9U7N7_PLAFA/282-510...................PESVLYK-------ALT........................DCGLGNNVIDRGLNDSLVQY
Q97EV0_CLOAB/725-889......................YLWN-------NVR...............VMGG...AYGCSAY.IQRNG.........
QCR2_EUGGR/221-398...................VSPVLNT-------SFA..............PKRLE........VF.YQAYD......TVG
QCR2_SCHPO/182-354................KWSHGNTLLA-------KAAG...........TASEYKA.....TAVAD.LTPYS......DAS
P74016_SYNY3/241-420....................AGRLFN-------NIR..............STQGL...AYSVSGSWQAAYD......YPG
Q9RHS7_9LACT/2-99...................AHSKLFM-------NVR..............EKASL...AYYASSA.FDSFT........G
Q9TAP0_TOXGO/4-197............IVPGKVSANAELCE-------NVC..............NKMTVG.CADMFSAF.NTCYS......DTG
Q99UJ4_STAAM/179-355...................PSSVLFN-------EVR..............EKQSL...AYSIHSQ.IDGKN........G
MU138_SCHPO/196-378...................GEGSYLA-------YLK...............SLGL...ATSLIAFNVSITE......DAD
Q55159_SYNY3/175-359...................RVSRLFR-------ELR..............EEKGL...VTAIGAS.NSTQA......TQG
MPPA1_ARATH/239-423.............GGPGKGMHSWLYR-------RVL..............NEYQE...VQSCTAF.TSIFN......DTG
O50512_STRCO/190-374...................LTSRLDR-------VLR..............EEKGY...TYGVRAF.GQVLRSAPDGTGAA
PQQL_HAEIN/680-857.......................LRL-------ILR..............EKVSG...IYSVNSW.FM..QDVYAPQIEG
O84831_CHLTR/717-886......................ILHT-------RIR...............EQGG...AYGSGAS.ANLGR........G
Q9KA85_BACHD/165-338...................MSSRLFQ-------DIR..............EKRGL...CYSVFSY.HSSFR......DSG
P74305_SYNY3/274-453...................RTSRLYQ-------SLV..............EEKQLALMAQGFNGFPADKFP........N
Y2805_MYCBO/178-357...................LSSRLFQ-------EVR..............ETRGL...AYSVYSA.LDLFA......DSG
Q9CML5_PASMU/205-388...................INLRLQD-------WEQ..............VKQQK...VESANFYRTH...LG.KETLQN
O87530_STRPY/183-363....................TSKIYH-------TLY..............EDGKID.DSFDVDVEIHHNFQ.........
MPPB_HUMAN/220-404..............GGGMNLSSKLAQ-------LTC...............HGNL...CHSFQSF.NTSYT......DTG
Q9Z6V1_CHLPN/688-867...................LHHITFE-------ELR..............TQQQL...GYMVGAR.YR...EF.ASRPFG
Y219_RICPR/168-341...................MSSRLFQ-------SIR..............EKLGL...AYVVGSY.NSAYF......DSG
O51486_BORBU/686-867.......................LIK-------NIX..............EKMSS...VYAIQAS.FDSNLRK.NVDSDG
Q9A308_CAUCR/166-339...................MSSRLFQ-------EAR..............EKRGL...AYNIDAY.ADTYA......DHG
Q9KA98_BACHD/181-363....................GSKQYE-------QLD...............DEGL...INDTFSFDHTSEY......GFG
PQQF_PSEAE/179-352...................SPGGLLA-------ALG...............EQGL...GESVALRVVHRDA......RQA
YO098_YEAST/193-378...................ALAVFTR-------ELV..................E...IDDPMAN...STDCCTDYFMRT
PQQF_KLEPN/173-343...................APGSLMA-------GLR...............QRRL...AGDVALNWLYQDR......HLG
YHJJ_ECOLI/199-378...................AREALFW-------HVQ..............QALSAS.NSKDIGLG.FD...CR.VLYLRA
Q9KQC8_VIBCH/196-377...................GEGSLLE-------ALK...............EKGW...ITTLSAGGGVSGS......NYR
Q983M8_RHILO/208-384..................TFTSRLFA-------EVR..............EKRGL...AYSVNSS.LVNQD......HAD
Q9RTZ9_DEIRA/246-424...................PSGRLYQ-------ALV...............QTGQ...ATAAGSI.TNPGS......DPG
Y4WA_RHISN/251-435...................TRSRIYQ-------ELV..............VKQAI...ASSGGAY.FN...GR.SLDPSS
Y4WB_RHISN/198-374..................AFTSRLWN-------EVR..............EKRGL...AYGIYST.LENID......HAS
MPPA_NEUCR/214-475.............GGPGKGMYSRLYT-------NVL..............NQHGW...VESCVAF.NHSYT......DSG
P73669_SYNY3/171-348...................LSSRLFV-------ELR..............EKRGL...AYDVSAF......YP.TRLGSS
Q9CE73_LACLA/164-346.................FGRTSQRYE-------ELY...............NSGL...IDDSFGFSFDLDK........R
Q9KRD3_VIBCH/671-849...................ATQRLLA-------EVR..............EHQGLD.YTPQVIPY......VV.DGDILN
Q9RTZ9_DEIRA/703-883...................TDSRLFA-------RLR..............QQDGL...SYTVGGGAHTSSL.....DEKG
UCR1_CAEEL/200-386..............ATSRTAASRLVQ-------KIG...............HDHG...VHNLQHF.NINYK......DTG
Q9PF62_XYLFA/714-895...................FSSRLNM-------NLR..............EEKHW...AYGASSV.LPNAQ......GQR
Q40983_PEA/357-594...................LHFRINT-------RYK...............SSN.P.PFTSVELDHSDSGR.....EGCT
MPPA_RAT/231-430.............GGPGKGMFSRLYL-------NVL..............NRHHW...MYNATSY.HHSYE......DTG
QCR2_YEAST/166-327..........................-------.LS..............ELSGL.....ISSAK.LDKFT......DGG
O51486_BORBU/206-392........................FS-------ELK...............TAGVK.QFKNVSNKDFFSFKSDNNTIVAK
PQQL_ECOLI/683-863.......................LRV-------NIR..............EQASG...AYSVSSR.LSVDPQA..KDISH
O16249_CAEEL/747-931.......................AFN-------TLR..............TNEAL...GYIVWTG.SR..L......NCG
Q97LA3_CLOAB/174-348...................IKNYILD-------LFT..............DKSFG...IVEFYSKVFLHNL........K
Q9RWP9_DEIRA/777-912......................YLLG-------EIR..............EKGG....AYGAAAS.FDARS........G
Q983M9_RHILO/206-390...................NRSRLYQ-------ALV..............VKQGI...ASNAGAY.FQ...GT.MLDDTN
Q9A2H7_CAUCR/210-390...................KSSRLYD-------SLV..............YDQKI...AQSVFSS.APNNA......QPG
Q99UJ3_STAAM/181-363....................ETDFYQ-------NLL...............NEGL...IDDTFGY.QFVLE......PTY
O16249_CAEEL/258-440...................GPGSLLS-------ELK...............RLGW...VSSLQSDSHTQAA......GFG
PQQF_PSEFL/185-366...................KPGGLLA-------ELQ...............QRQL...AHSLKATLLYEFA......GQA
Q97N47_STRPN/186-364....................TSDRFQ-------KCY...............ESGK......IDAS.LS...LE.VEITSR
Q97GF6_CLOAB/170-348...................ANSILFR-------EIR..............ENKGL...AYDIYSD.LNLSK......NVK
PREP_DROME/268-457...................PNSPFYK-------NLI......................EPNFSGG.YNQTTGYSSDTKDT
STE23_YEAST/716-898...................IHEPCFD-------TLR..............TKEQL...GYVVFSS.SLNNH........G
Y228_BORBU/195-380...................SCSFTIN-------ILK................SGI...GEDIAHI.SG...IN.TDLKES
Q9CML5_PASMU/680-857.......................LRL-------TLR..............EQSSG...IYAVNSW.FNQEK.....SHAR
MPPA_BLAEM/177-373.............GGPGKGMYSRLYT-------NVL..............NRYRW...MESCAAF.QHAYS......STS
Q9KA97_BACHD/184-365...................SHSKLFI-------NVR..............EKESL...AYYAASR.FESHK........G
O87529_STRPY/177-351...................AHSRLFI-------KIR..............EEEGL...AYSIGCR.FDSYT........G
Y5738_STRCO/198-380...................MSSRLFQ-------EVR..............EKRGL...AYSVYSY.TSGFA......DCG
O25371_HELPY/185-361...................FGSRLME-------KIR..............VQEGL...AYSVYIR...SNFSKVAHFASG

PF03410

MP44_MCV1/1-592--YVFAFSIYPE------QVYRYFARWQLVSKHCCVVSMRGEREDYSAL--------------RKEVVVNF
G1_VAR67/1-591--YLFTFTIYTD------EVYDYLNTNKLFSAKCLVISTKGDVENFSSL--------------KKDVVIRV
MP44_MYXVL/1-589--YLFMFTIYPE------DVTTYLSSRKLFTSRCVVVSKKGNTEDFSSM--------------KKDIIIKL

PF00675

AXL1_YEAST/34-179--....EGNISS------TTKI-----------------------FYHA--------------ARILANPD
IDE_HUMAN/74-212--....EKNVMN------DAWR-----------------------LFQL--------------EKATGNPK
YMXG_BACSU/12-160--DDIVHDLLSK------ATYG-----------------------NHSL--------------GYPILGTE
YQA4_CAEEL/37-175--....LDKVNE------DFWR-----------------------CLQV--------------ERSLSKPG
IDE_DROME/47-185--....EKNLPS------DLWR-----------------------IKQV--------------NRHLAKPD
MPPA_YEAST/29-176--ELVLPELLHT------AAYS-----------------------GETL--------------GSPLICPR
NRDC_RAT/210-348--....QLARPS------DANR-----------------------KEML--------------FGSLARPG
PTRA_ECOLI/54-192--....TMARTR------DGMR-----------------------MAQV--------------SAETINPA
QCR1_BOVIN/58-205--RDVVFNYLHA------TAFQ-----------------------GTPL--------------AQSVEGPS
MPPB_NEUCR/50-198--EEVVFDHLHA------TAYQ-----------------------HQPL--------------GRTILGPR
QCR2_EUGGR/64-216--FAYLQDILHK------TAFK-----------------------GSPL--------------GHTSFVPA
MPPB_RAT/68-215--QEVVFDYLHA------TAYQ-----------------------NTAL--------------GRTILGPT
MPPB_YEAST/36-184--DEVVFDHLHE------ITYK-----------------------DQPL--------------GRTILGPI
QCR2_YEAST/17-163--VKSAEDQLYA------ITFR-----------------------.KGL--------------GNPLLYDG
PQQL_HAEIN/45-188--.....RRRLS------PMLR-----------------------IGNK--------------KSAIEMAG
UCR1_CAEEL/48-195--QLVLFDMLHA------AGFQ-----------------------GTPL--------------ALSVLGTS
PQQF_KLEPN/15-154--....LIQQHE------PSRR-----------------------EAAV--------------RHAASAPA
MPPA_SOLTU/85-231--QHLLLEAVHS------AGYA-----------------------.GPY--------------GNSLMATE
SDP_EIMBO/44-183--QKNIPNDDER------AWYS-----------------------IRSL--------------AKGPMSRF
QCR1_EUGGR/37-184--.EVLMDHLHS------AAFE-----------------------GSGL--------------GLSILGPL
MPPA_NEUCR/62-209--ELILPELVHM------AAFK-----------------------DNTL--------------GNPLLCPK
PQQF_PSEFL/28-167--...IAWSRDA------TAQR-----------------------QFAL--------------FDGLHAAH
PQQL_ECOLI/46-204--SQARRPFLLA------NTRN-----------------------LDRE--------------PIGLMDTV
MPPA_HUMAN/77-227--EPLLTEMIHE------AAYR-----------------------ENTV--------------GLHRFCPT
QCR2_BOVIN/48-194--QAHVIENLHA------AAYR-----------------------.NAL--------------ANSLYCPD
QCR1_YEAST/37-182--PNRVLEHLHS------TAFQ-----------------------NTPL--------------SLPTRGTL

PF02664

LUXS_HAEIN/2-162Q-CGSYTEHSLE------DAHE------------IAKNVIAR..GIGVN--------------KNEDLSLD
LUXS_ECOLI/2-162Q-CGTYQMHSLQ------EAQD------------IARSILERDVRI..N--------------SNEELALP
LUXS_BACSU/2-156Q-CGQAKLHDLE------GAKR------------LMRFWLSQD......--------------KEELLKVF
LUXS_HELPJ/3-151Q-CGWAANHTLE------GAQN------------LARAFLDK.......--------------RAEWSEVG
LUXS_BORBU/2-157E-CGNYKEHNLD------MAKY------------ESSKYLQILNNI...--------------KEENLKYP

PF05193

QCR1_MOUSE/210-395L.LGAHFVCDAM......SIDD............MVFFLQGQWMRLCTS.....ATESE....VTRGKNIL
IDE_HUMAN/236-418F.FIINVDLTEEG...LLHVED............IILHMFQYIQKLRAE.G...PQEWV....FQECKDLN
IDE_HUMAN/706-889I.QGLRFIIQSEK...PPHYLE...........SRVEAFLITMEKSIED.....MTEEA....FQKHIQAL
YMFH_BACSU/182-363F.AAIGGDTP........EPDQ............LAEDISSMLLRAGEL.....ITAEK....IELARKKK
YMXG_BACSU/165-338M.LTIYGGTGAN......QLQQ............LSETIQETLATLKRD.G...ITSKE....LENSKEQM
YQA4_CAEEL/603-787N.VYLHVIVQGPES..ADHVLE...........R.IEVFLESAREEIVA.....MPQED....FDYQVWAM
QCR2_MOUSE/199-378L.FGIYTISQAA......AAGE............VINAAYNQVKAVAQG.N...LSSAD....VQAAKNKL
YQA4_CAEEL/200-382V.FSVTMDLSTEG...LEHVDD............VIQLVFNFIGFLKSS.G...PQKWI....HDELAELN
PREP1_ARATH/301-489Q.FGIGLKGVSE.....ENVQK............VEELIMDTLKKLAEE.G...FDNDA....VEASMNTI
IDE_DROME/209-391F.FDIVVDLTQEG...LEHVDD............IVKIVFQYLEMLRKE.G...PKKWI....FDECVKLN
Q9YFN7_AERPE/166-342M.SLIVLEGNRD......RVGE............LFDAMTRSLERALRG.G...YPESE....WREGRRRL
IDE_DROME/679-863A.NGIRIIVQSAK...HPSYVED..........R.IENFLQTYLQVIED.....MPLDE....FERHKEAL
Q9RRH6_DEIRA/141-315V.FEGGFSCDPD......RAQE............ALDRFRAVLDSAESL.....ITDLS....VRRAARKA
PQQL_ECOLI/206-388S.LFFRVNARDD......NMQD............AANALMAELATIDQH.G...FSAEE....LDDVKSTR
Q9X167_THEMA/162-335I.IIVYAALSPE......KIDE............FFSKMKDVLSNESLF.......MKN....FEYGKMRY
Q9U6C9_TOXGO/170-352I.FGLYMLADPT......KSAN............AVKVMAEQFGKMGS......VTKEE....LQRAKNSL
Q97N46_STRPN/177-351F.LRMYAGINRE......NRNQ............ARKMMNNQLLDLKKG.Y...FTEFE....LNQTKEMI
Q9JS80_CHLPN/201-385P.MTLVCKGCSP.....AGAQK............LEALIFASLEEIIRE.G...ISENI....VEGAVHQL
Q9I6C2_PSEAE/203-388L.FVLSATPNVQK...GKTLEQ............VEAGLWKQLDDLKQN.P...PSAAE....IERVRAQM
Q9ANJ4_BRAJP/5-169M.FLGTSGTCAD......RAGE............TVEEIEKQVRQIAAE.G...PTQQE....LDDAKSYL
MPPB_SCHPO/185-372L.WGIYLVTENL.....GRIDD............LVHFTLQNWARLTVA......TRAE....VERAKAQL
PXM16_ARATH/666-854I.YGVQFIIQSSVK.GPGHIDS...........R.VESLLKNFESKLYE.....MSNED....FKSNVTAL
MPPB_LENED/192-381L.WGIYLVSENL.....MNLDD............TLHFTLKEWTRMSIA.....PTEGE....VERAKSQL
Q9KUG7_VIBCH/219-398T.FYVYAMAPSGA...KGKLAP............LYQETLQVLEKFKQQ.G...VSASR....LEQIIGSE
O50511_STRCO/185-366W.LDVKTSGDVE.......VPV............IETAIDEELARFADE.G...PTAEE....MERAQAQL
Q9UVF2_YARLL/538-703F.FSYYSYRDPN.......LER............TLQTCQEAGEWSVKK.D...WSSSD....LQEAKLSL
Q49146_METEX/5-143M.TWGYTATKNE......RVVE............ALDVIGDEIQRLITD.G...PSDEE....LQKAKDYL
PTRA_ECOLI/681-858Q.WGMGFLLQSNDK..QPSFLWE..........R.YKAFFPTAEAKLRA.....MKPDE....FAQIQQAV
MPPB_NEUCR/203-391L.WGIYLVTDKL.....DRVDD............LVHFSLREWTRLCSN.....VSEAE....VERAKAQL
Q9RRH5_DEIRA/126-298F.VSLYAGSTPA......NAPA............TLDVLLAELDVLSQG.....LSEAE....FRRARTAL
QCR2_NEUCR/198-375L.LAIQITGKGA......AVGK............VAVEAVKGLKAIAAG.G...VSKED....LTKAIAKA
Q985V3_RHILO/166-339I.FGVHAATGQS......DIAE............LVPVIIDELQKAGEN.....ILQEE....LDRARAQY
Q9AXQ2_CUCME/257-443L.FGVYAVAKPD......CLDD............LAYAIMYETTKLAYR.....VSEAD....VTRARNQL
Q9PLB7_CHLMU/208-391D.FEIIYKLTTKG...EREYQK............VLQLTFAFLDYVRDE.Q...LPAYI....LPELHRIN
Q9FJT9_ARATH/639-833D.ISVNFSCDPE......ISSK............LVDLALEEIVRLQKE.G...PSQED....ISAILEIE
Q23295_CAEEL/192-374L.VGTYFVAAPE......SIDN............LIDSVLQQWVWLANN.....IDEAA....VDRAKRSL
CYM1_YEAST/735-911I.FSFYSYRDPQ.......PLK............SLETFKNSGRYILNDAK...WGVTD....LDEAKLTI
O67308_AQUAE/184-360I.FIITATFPPE......NYEK............VKKRVFELLKETYEN.....LTDEQ....VEEAKSRI
O84812_CHLTR/225-408D.FEILYKLTNKG...EREYQR............VLQLTFAFLDYVRHE.R...LPAYS....LPEIQKIN
Q9M9Z4_ARATH/748-933V.HGFCFCVQSS......KYGPVHL......LGR.VDNFIKDIEGLLEQ.....LDDES....YEDYRSGM
SDP_EIMBO/201-391L.LGIKVDLTQKG...AAHRGL............VLQEIFSYINFLRDH.G...VGHDL....VSTLAQQS
P73670_SYNY3/182-362L.FTINAYLTSA......QAER............VEAEICAAIQTLQTT.P...ISTAE....LARAQRLL
Q9VP94_DROME/242-425L.FNICIYLSDDG...FDHIDE............VLEATFAWVKLIINS.D..............QLQDSY
Q9Z6V1_CHLPN/209-393E.FYISYELTEKG...DKHYSQ............VIDSTFQYLRYIQEH.G...IPNYT....LEEISTIN
Q97II7_CLOAB/206-391T.FSIILKDSNL.....EDKDK............FKEVVKNTLKELVKN.G...IDKKL....INGIINAK
YPD1_CAEEL/194-376L.NFAGVPVE........KLDE...............CAPKFFDKTVRE.H...LEEAN....FDMERMGY
Q9VYT3_DROME/284-473L.FNICIYLTDEG...FKNLDE............VLAATFAYVKLFANC.G....SMKD....VYEEQQRN
MPPA_HUMAN/232-431L.LCIHASADPR......QVRE............MVEIITKEFILMGGT.....VDTVE....LERAKTQL
Q9ZIG1_RHOSI/193-288..................QAGQ.............LGLVHGGLQGTGRA.G..............AGRRRA
MPPA_YEAST/181-374I.FGISLSCIPQ......AAPQ............AVEVIAQQMYNTFAN.KDLRLTEDE....VSRAKNQL
Q9XBW5_PORGN/207-395A.FNFVASVREG......EAEK............AMNALVAEIESLRQF.G...ITKGE....YDRARTNV
Q9VFF0_DROME/203-385L.WGIYFVCDPL......QCED............MLFNVQTEWMRLCTM.....VTEAE....VERAKNLL
MPPB_YEAST/189-380L.WGMYIVTDSNE....HNVQL............IVNEILKEWKRIKSG.K...ISDAE....VNRAKAQL
O83069_TREPA/199-385L.FFVGMTGVQH.....TQVDA............LKACVFETLESLVAH.G...IPPQE....VETALNAL
QCR1_EUGGR/190-391L.LGFYAIAEPGKS.YGHEWEN............ILHYAMRELIRVSRN.....ISEEE....FERAKNQL
Q9M9Z4_ARATH/273-458V.FGMSIHLTDSG...LEKIYD............IIGYIYQYLKLLRDV.S...PQEWI....FKELQDIG
O61441_HAEIR/3-170L.FGFVVSTEAQ......NAGK............AVDALTRALKSGS.......VSAED....VNRGKALL
O25656_HELPY/198-379V.FLFIAGGNPN.....VKAEA............LQKEIVALLEKLKKG.E...ITQAE....LDKLKINQ
Y228_BORBU/711-879I.FSFASYRDPN.......FTK............TYQAFEKSLEELANN.K...MTDDE....IYTYLIGL
Q9A579_CAUCR/219-397Q.FIVTLTVKPG.....GDPAA............VEKAFDEEFQRLLRD.G...PTPEE....VAKVRTNN
MPPB_BLAEM/198-380L.WGIYIQSNNR.....DNLDD............LAHFTVREWMRLATA.....PSEGE....VAIAKQQL
MPPA2_ARATH/235-419L.FGIYGCTSPE......FASQ............GIELVASEMNAVADG.K...VNQKH....LDRAKAAT
Q9PLB7_CHLMU/683-862L.FYIRSNKSSP.....EELVN...........K.TQLFLQKIATDPEASG...LSEEI....FEQLRETY
PXM16_ARATH/198-379F.FKVSIDLTDAG...HEHMQE............ILGLLFNYIQLLQQT.G...VCQWI....FDELSAIC
Q9PF62_XYLFA/244-422Q.MQINADVKPG.....IDPAK............VEAAIAEELKKFLAE.G...PSDDE....LQRAQMNY
Q9CE72_LACLA/168-341F.LKIAAGIDVE......NYEE............AKSLIFEQLEAIKSG.D...FTELE....VEQTKTML
Q22370_CAEEL/182-353L.AGVYLVVEGS......QANQ............AVSNVVGALKSLKVA.D............IEAVKKQA
Q9XBW5_PORGN/690-872L.MQIYFPTDPA......RAEE............MNAIVFAELEKLAKE.G...PNVEY....FKKTIENL
Q9RWP9_DEIRA/229-413A.FAVGLKGLSS.....GKAAQ............VQELVLSTLRQIADE.G...IDPAL....IEASLHQF
Q9JMV9_BRAJP/168-341F.FGLYTGTDPA......DAPE............MMEVVVDVMNDSVET.....LTEAE....IARAKAQM
PTRA_ECOLI/213-396V.LAISASLTDKG...LANRDQ............VVAAIFSYLNLLREK.G...IDKQY....FDELANVL
Q97IL0_CLOAB/163-340L.FYIGLGTASE......NFDK............SIEFVNDTICEAKNLKG..QFSSDK....LLKIEKTM
Q17593_CAEEL/199-381Y.FNVTMDLSTEG...LEHVDE............IIQLMFNYIGMLQSA.G...PQQWI....HEELAELS
Q9A2H7_CAUCR/672-850G.FSARVQTKNP......SAGE............VISLTRAELSRLANE.P...ASVGE....LAARKSVL
Q9A531_CAUCR/720-903Y.LAVSLEVPPE......KLDG............VVASIRKIAADLRDK.P...VSADE....LDRAKKPR
MPPA_SCHPO/208-400L.FGMFVTILDD......AAHL............AAPLIIRELCNTVLS.....VTSEE....TERAKNQL
Q9SCM5_ARATH/200-381F.FNVSIDLTDAG...HEHMQD............ILGLLFEYIKVLQQS.G...VSQWI....FDELSAIC
Q9HT96_PSEAE/190-362F.FSLDADVERS......DLPA............TEAALRELLDGIRQH.G...LDPGR....FKRVQFAE
Q9I6C3_PSEAE/229-405P.FMINFQTRAE......LSEG............ALKLVQDIVRDYLAN.G...PTQKE....LDDAKREL
PREP_DROME/784-953I.FSFYSYRDPN.......STK............TLNAFDETYKWLRAN.QN.VIDQQS....LFESKLGV
Q17592_CAEEL/199-354I.LNVTMDLSTGG...LENVDE............IIQLMLNYIGMLKSF.G...PQQWI....HDELADLS
Q9UVF2_YARLL/16-206I.FSVGLQGVTE.....SDLTK............VETVILDTIKTTVAE.G...FDKGR....IDGLLHQT
STE23_YEAST/246-428F.FAVDIDLTDNG...LTHYRD............VIVLIFQYIEMLKNS.L...PQKWI....FNELQDIS
Q9KUG7_VIBCH/686-864A.IVFNAPVRAD......VTVE............AIQEMIKEMHHFSQA.G...MSEEE....MKFLRLAV
Q9KQC8_VIBCH/661-839LILYVQSPSAPP.....SELIR............SIDEFLNALYMVLLE.....LNEYQ....WHSSKRGL
Q9VV75_DROME/190-364L.FGFVVSADSK......DIGK............TVEFLVRGLKSAS.......VSDKD....VARGKALL
PQQL_HAEIN/205-388I.FSLQLIDT........QYSK............TIDKLFAFIASIKQQ.G...FTQNE....LSGEIKRL
MPPA_SOLTU/236-422L.FGIQGTTSSD......FGPQ............AVDVAVKELIAVANPSE...VDQVQ....LNRAKQAT
YAN2_SCHPO/193-378P.CSIQLFFDSVP...LEKING............LEQRALRLLAETKQI.D............MNRMKDYL
NRDC_HUMAN/837-1020I.LGFSVTVGTQATKYNSEVVDK..........K.IEEFLSSFEEKIEN.....LTEEA....FNTQVTAL
Q9JS80_CHLPN/718-886S.FYCYSYRDPE.......IAT............TYKTFLKGVSEIASG.N...FTKED....IYEGALGV
Q9U7N7_PLAFA/914-1104S.VVFLSARDPN.......LEK............TLATFRESAKGLRKMAD..TMTEND....LLRYIINT
O84831_CHLTR/201-385P.VYIVCRGCSH.....SGSQK............LESLILASLEEILQE.G...IPMHL....VEGAVHQL
Q9A579_CAUCR/657-835L.FQAYAPVQTD......KTAE............SFAEARKELLGIIGDKP...ITAAE....LAKAQNSL
Q9FIH8_ARATH/360-598V.TTLTVTAEPQ......NWQN............AVKVAVQEVRRLKEF.G...VTRGE....LTRYMDAL
Q9A531_CAUCR/246-428V.TTFGATAQPG......RWRE............ALTALDAEQRRAIQY.G...VRQDE....LDREIASL
O84812_CHLTR/700-879L.FYIRSNNY........SPEELV........HR.TQLFIQKIATDPESAG...LSEEI....FEQLRETY
Q40983_PEA/925-1150W.YVVSVTSTPS......KVHK............AVDACKNVLRGLHSN.G...ITVRE....LDRAKRTL
Q49145_METEX/235-418F.AVYAVPAEGV......TLEA............LEEHIDRVLRRVPEA.....LGAEA....IERAKIRL
CYM1_YEAST/221-407L.LTVGIQGVSDI....EIFKD............TVNNIFQNLLETEHP.....FDRKR....IDAIIEQL
Q97EV0_CLOAB/207-392Y.FSVIVKNSNE.....ERKEE............FKKLVFDTLNDLVKN.G...IDKKL....IEAAINIR
Q9VYT3_DROME/769-953I.AGYSIMVNSQETKTTADYVEG..........R.IEVFRAKMLQILRH.....LPQDE....YEHTRDSL
QCR1_YEAST/187-370L.WGFSTATRNV.....TMIDD............LIHFTLKQWNRLTIS.....VTDTE....VERAKSLL
Q9TZ33_CAEEL/181-355L.VGVYLLATGA......NADS............AVRATVKVLRTTQVQ.D............IEGCKRRA
Q9FNU9_DACGL/238-423I.FGIHTSTDAA......FAPK............AIDLAARELTSLATP.G..QVDQTQ....LDRAKALA
Q40738_ORYSA/2-120..................NXHQ............................................IXHSL
Q9VP94_DROME/724-907V.LAFLITINTQETKHRADYVEQ..........R.IEAFRSRMAELVSQ.....MSDTE....FKNIRETL
O67945_AQUAE/183-355L.FAYVG.TSPE......KKEN............ALQDLIKVVSEGR.......VSEED....VELAKRKI
Q9KRD3_VIBCH/199-378Y.TLISVGFAAE......QREK............VQALLLETLASMRDY.G...VTKNE....LDIILRGY
Q9FIH8_ARATH/928-1156W.YVISVTSTPG......KVYK............AVDACKSVLRGLHSN.Q...IAPRE....LDRAKRTL
Q41445_SOLTU/262-449L.FGVYAEAKPD......CLSD............LAYVIMNGICKLSYK.....VSDAD....VVRARNQL
MU138_SCHPO/668-850F.INLNIFVQSER...SSTYLES..........R.IRALLDQFKSEFLE.....MSDED....FSKHKSSL
Q9ANJ2_BRAJP/2-119L.FEISVIPKPG.....ANLSL............IERCIDEVIAGIARN.P...ASAED....LQRAKTRL
Q9PL96_CHLMU/717-886T.FYCYSYRDPE.......VSA............TYQVFLQGIRDMAAG.E...FSEDD....VHEGILGV
Q41444_SOLTU/259-445L.FGVYAVAKSD......CLSD............LSYCIMREISKLCYR.....VSDAD....VTHACNQL
NRDC_HUMAN/361-548V.FSISITLTDEG...YEHFYE............VAYTVFQYLKMLQKL.G...PEKRI....FEEIRKIE
Q9U7N7_PLAFA/282-510I.FSIGLKGI........KRNNEKIKNFDKVHYEVEDVIMNALKKVVKE.G...FNKSA....VEASINNI
Q97EV0_CLOAB/725-889...SILFASYRD.....PNLTE.............TLKIYDEVYKYIEN.....FNADD....YEMTKYIL
QCR2_EUGGR/221-398L.IGLSS.VQAS......NA..............QLKAFKAALSKIGT......LSEAD....LAVHKSAA
QCR2_SCHPO/182-354L.LSVVISGSCP.....KAIKA............TASESFKALKSLSSN.....IPNDV....VKSGIAMA
P74016_SYNY3/241-420Y.FLAGGPTRTE......TTVQ............FLQSLLQEFEKLRIT.E...VTAEE....LAYAKDSI
Q9RHS7_9LACT/2-99L.LRVNAGIDAG......NYQQ............ARALILEQLQAMQSG.D...FTAQE....IEQTKTML
Q9TAP0_TOXGO/4-197L.FGFYAQCDEI......AFEH............LRMEIMFGITSLSYA.....VTDEE....VERAKAQL
Q99UJ4_STAAM/179-355Y.LFVLSGVSSD......KYET............AKDTIISEFEKIKAG.D...FTEEK....LELAKKVI
MU138_SCHPO/196-378I.IVVSTFLTEEG...LTDYQR............VIKILFEYIRLLDQT.N...AHKFL....FEETRIMS
Q55159_SYNY3/175-359M.FYISAQLPAE......NIPM............VEQYILDHIERLQNE.P...IPEKD....LERIRTQV
MPPA1_ARATH/239-423L.FGIYGCSSPQ......FAAK............AIELAAKELKDVAGG.K...VNQAH....LDRAKAAT
O50512_STRCO/190-374M.LAISGSVDTP......NTGP............ALEDLWTVLRKLAAE.G...LTDAE....RDVAVQNL
PQQL_HAEIN/680-857K.IEFSCDPK........RVEE............LTYLTNQVLDDIIKN.G...IDENL....LRKKLAEQ
O84831_CHLTR/717-886A.FYCYSYRDPE.......VAT............TYQVLLQGIRDMAAG.D...FSEED....VHEGILGV
Q9KA85_BACHD/165-338M.LTIYAGTGHD......QLDD............LVYSIQETTSALAEK.G...LTEKE....LENGKEQL
P74305_SYNY3/274-453L.LMFYAQSAPG.....RSLDD............LSEALHGEIERLKME.P...VTPEE....LERAQNLL
Y2805_MYCBO/178-357A.LSVYAACLPE......RFAD............VMRVTADVLESVARD.G...ITEAE....CGIAKGSL
Q9CML5_PASMU/205-388I.FLLQLFDT........DYQK............ATQSLFQFIAEIQQH.G...FSAQE....FQQEKARL
O87530_STRPY/183-363...FVLISLDTP......EPIA............MSNYIRQKLATIKISKE...FTNEH....LNLLKKEM
MPPB_HUMAN/220-404L.WGLYMVCESS......TVAD............MLHVVQKEWMRLCTS.....VTESE....VARARNLL
Q9Z6V1_CHLPN/688-867F.LYIRSDAYSPE....ELLAK.............TSLFLNKVSASPEKFG...ISQEK....FANIRKAY
Y219_RICPR/168-341V.FTIYASTAHN......KLEL............LYREIKNEIIKITET.....VSTEE....IIRAKMQL
O51486_BORBU/686-867I.LSIFFTTEPK......ELDN............VLNSINRYMIERQKI.D...FNDKD....FSYVKKNY
Q9A308_CAUCR/166-339A.LGIYAGCAAS......DAVE............TAKVCADELIKLADR.....IEEAE....LARAKAQL
Q9KA98_BACHD/181-363F.TIMGGDTKSP......NR..............LAERIEEMVEAFKEQ.P...LDEAA....VKRVIKKK
PQQF_PSEAE/179-352L.LALTFELFDG.....SAAAA............LEAAFFDWLGALRDD.......AAS....LLAARRPL
YO098_YEAST/193-378I.IDLRIQGVPT.....EKIAA............TKTKVLEILKTHTID..............LSRVRQVV
PQQF_KLEPN/173-343W.LALVFASD........RPEE............VDRQITHWLQALQQT.T...PEQQQHYYQLSRRRFQA
YHJJ_ECOLI/199-378Q.CAINIESPND......KLNS............NLNLVARELAKVRDK.G...LPEEE....FNALVAQK
Q9KQC8_VIBCH/196-377E.FAVSCVLTQEG...LDHVDE............IIQSLFQTLNLIATQ.G...LQAWR....YQEKRAVL
Q983M8_RHILO/208-384A.LIVTTGTRSD......RAAE............TLGIVRDVARQLAEE.G...PTEAE....LAATKKYL
Q9RTZ9_DEIRA/246-424L.ATYVAILGKD.....DDLQK............AQATLLSTLENAAKT.P...FTEEE....VARVRTRV
Y4WA_RHISN/251-435F.TVFGSPRGEA......KIEE............VEDAIDAEIRKIIEF.G...ITDVE....LEKAKNRF
Y4WB_RHISN/198-374A.LVIGTGTRPD......RAAE............TLSLIQAEVRRMSEE.G...VSEDE....LTAAKKKL
MPPA_NEUCR/214-475L.FGIAASCYPG......RTLP............MLQVMCRELHALTTDHGYSALGELE....VSRAKNQL
P73669_SYNY3/171-348Q.FVTYMGTAPE......NTAI............AIAGLRAETDRLCEE.R...LEEGE....IKAAQNKL
Q9CE73_LACLA/164-346F.HFAVLTADTE......NPQI............LGQTLQEAIKSYKIDRD...FSEEH....LDLLKREM
Q9KRD3_VIBCH/671-849D.WVLSALVDPK......SEPQ............VAKVMHEVARELAQG.....VTQQE....LDVVKQKF
Q9RTZ9_DEIRA/703-883S.FTTYAIFNPV......NSEK............VAAGMREELARALKE.G...FSAQE....VATAQSAL
UCR1_CAEEL/200-386L.FGIYFVADAHD...LNDTSG............IMKSVAHEWKHLASA.....ATEEE....VAMAKNQF
Q9PF62_XYLFA/714-895P.YVFIAPVQTD......KTAE............SIAEIQKEAQDVIVNKP...LTQEE....VDKIKQQI
Q40983_PEA/357-594V.TTLTITAEPK......NWQN............AIRVAVHEVRRLKEF.G...VTQGE....LTRYLDAL
MPPA_RAT/231-430L.LCIHASADPR......QVRE............MVEIITKEFILMGRT.....VDLVE....LERAKTQL
QCR2_YEAST/166-327L.FTLFVRDQDS......AV..............VSSNIKKIVADLKKGKD...LSPAI...NYTKLKNAV
O51486_BORBU/206-392S.ISLNFNPD........HLNE............GIQDFFYELERIRKF.G...FTQGE....LEKVRSQF
PQQL_ECOLI/683-863L.LAFTCQPE........RHDE............LLTLANEVMVKRLAK.G...ISEQE....LNEYQQNV
O16249_CAEEL/747-931T.VALNVIVQGPKS..VDHVLE...........R.IEVFLESVRKEIAE.....MPQEE....FDNQVSGM
Q97LA3_CLOAB/174-348L.NVLEFKSQSE.......FVE...........R.LEFIIDSINKIQAK.G...INEND....FVKYKRIF
Q9RWP9_DEIRA/777-912V.FALSSYRDPN.......IAR............TYGVFRDARQFLDTD.....LGERE....LTEAILGA
Q983M9_RHILO/206-390F.TVYGAPRGDA......KLAD............VEAAVDAEVARIASG.G...VTPDE....LEKAKDRY
Q9A2H7_CAUCR/210-390L.FYVGAIMAGG.....KTVAQ............GEAALRAQVARVRDG.L...VTPAE....LAEAKAGL
Q99UJ3_STAAM/181-363S.FSIVTSATEE.......PDK............LKKLLLDELRDKKGN.....FQDAE...AFELLKKQF
O16249_CAEEL/258-440V.YNVTMDLSTEG...LEHVDE............IIQLMFNYIGMLQSA.G...PKQWV....HDELAELS
PQQF_PSEFL/185-366L.LHLEFDLTSVA...ASAPVQ............VRELLTEWLGFFSAQADWAPLREEY....VLLQQRQI
Q97N47_STRPN/186-364F.HFVMLTMDTK......EPVA............LSHQFRKAIRNFTKDLD...ITEEH....LDIIKREM
Q97GF6_CLOAB/170-348T.MYIYTAVNNE......NVKE............TIDSINNCIEKIKYE.EK.WLDDNS....ILLMKKVL
PREP_DROME/268-457T.FVVGLQDLRV.....EDFKK............CIEIFDKTIINSMND.G...FDSQH....VESVLHNL
STE23_YEAST/716-898T.ANIRILIQSE......HTTPYL.......EWR.INNFYETFGQVLRD.....MPEED....FEKHKEAL
Y228_BORBU/195-380I.FSFGLQNVVE.....NKEKE............FKNLVFSELKNLVKN.K...IPKEL....IKGILFGY
Q9CML5_PASMU/680-857LEGKIEFSCAPD......RVAE............LTAQTYHILDEIMQK.G...VSASL....LEKKRSEK
MPPA_BLAEM/177-373L.FGISASCVPS......FNPH............LCNVLAGEFVHMARN.....LSDEE....VARAKNQL
Q9KA97_BACHD/184-365L.LIVMSGIEFT......NYEK............AVTIIKEQLEEMKNG.R...FTDKE....LEQTRAML
O87529_STRPY/177-351L.FEIYTGIDSQ......HRTK............TLQLIIQEINAIKMG.R...FSEQL....IKKTRSML
Y5738_STRCO/198-380L.FGVYAGCRPS......QVHD............VLKICRDELDHVAEH.G...LTDDE....IGRAVGQL
O25371_HELPY/185-361Y.LQTKLSTQTK......................SVALVKKIVKEFIEK.G...MTQQE....LDDAKKFL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window