Sequence alignment for CL0094

PF03410

Q6TUW3_YMTV5/1-588MIVLSNGVRIFINDDMNK-DIYLGVASFGFENDIGE.ILGVAHLLE----HILISFDSSKFIANASTARKYMSFWCCSIK
Q6TVT3_ORFSA/1-598MIVLENGVRVFLRPSMKR-DVYLGISNFGFGRDVGA.VLGLAHLLE----HVLISFDHRFFLANASTSRNYMSFWCKSRR
Q08FU3_DPV83/1-596MIVLSNGVRIFINPYMIK-DIYLGIASFGFENDIGN.ILGVAHLLE----HILISFDSSKYVANASTARSYMSFWCNSIK
Q8V3P7_SWPV1/1-592MIVLSNGVRIFIDNSMHK-DIYLGISRFGFENDIYE.VLGIAHLLE----HILIDFDSSKFIANASTARSYMSFWCNSIK
MP44_FOWPN/1-623MIQLNNGIRIFVNHSMKK-DIYIGISDFGFEKDINDGILGIAHLLE----HILISFDNKYFNANASTSRTYMSFWCVALQ
MP44_MYXVL/1-589MIVFDNGTRVFINSSTNK-DIYVGFSGFGFEKDIGG.ILGIAHLLE----HILISFDASRFVANASTARSYMSFWCTPIR
MP44_MCV1/1-592MILLENGVRVFPKPGMGK-DIYIGLANFGFENDVPE.LLGVAHLLE----HILISFDYTRFVANASTARTYMSFWCRALR
G1_VAR67/1-591MIVLPNKVRIFINDRMKK-DIYLGISNFGFENDIDE.ILGIAHLLE----HLLISFDSTIFLANASTSRSYMSFWCKSIN

PF00675

AXL1_YEAST/34-179LALIISDPT---DTSSSC-SLTVCT---GSHNDPKD-IAGLAHLCE----HMI-------------------------LS
IDE_HUMAN/74-212KVLLISDPT---TDKSSA-ALDVHI---GSLSDPPN-IAGLSHFCE----HML-------------------------FL
YMXG_BACSU/12-160RIVLENNPT---VRSVAI-GVWIGT---GSRHETPE-INGISHFLE----HMF-------------------------FK
YQA4_CAEEL/37-175RVLLVSDSK---TRVSAV-ALDVKV---GHLMDPWE-LPGLAHFCE----HML-------------------------FL
IDE_DROME/47-185KVLLISDPN---TDVSAA-ALSVQV---GHMSDPTN-LPGLAHFCE----HML-------------------------FL
MPPA_YEAST/29-176KVATSNT.P---GHFSAL-GLYIDA---GSRFEGRN-LKGCTHILD----RLA-------------------------FK
NRDC_RAT/210-348RVEARKKTT---EKQSAA-ALCVGV---GSFADPDD-LPGLAHFLE----HMV-------------------------FM
PTRA_ECOLI/54-192VVLLVSDPQ---AVKSLS-ALVVPV---GSLEDPEA-YQGLAHYLE----HMS-------------------------LM
QCR1_BOVIN/58-205RVASEQS.S---QPTCTV-GVWIDA---GSRYESEK-NNGAGYFVE----HLA-------------------------FK
MPPB_NEUCR/50-198TVASQYSPY---AQTSTV-GMWIDA---GSRAETDE-TNGTAHFLE----HLA-------------------------FK
MPPB_RAT/68-215RVASENS.G---ISTCTV-GLWIDA---GSRYENEK-NNGTAHFLE----HMA-------------------------FK
MPPB_YEAST/36-184TIATEYIPN---TSSATV-GIFVDA---GSRAENVK-NNGTAHFLE----HLA-------------------------FK
QCR2_YEAST/17-163LTVSARDAP---TKISTL-AVKVHG---GSRYATKD-..GVAHLLN----RFN-------------------------FQ
PQQL_HAEIN/45-188YFVLKNTEP---KERVYI-RLVINA---GSMHEDDD-QKGIAHLVE----HMA-------------------------FN
UCR1_CAEEL/48-195RVVTEDN.G---SATATV-GVWIET---GSRFENEK-NNGVAHFLE----RLI-------------------------HK
MPPA_SOLTU/85-231KVASEAS.V---NPAASI-GLYVDC---GSIYETPA-SYGATHLLE----RMA-------------------------FK
MPPA_NEUCR/62-209RVASEDL.P---DAFSGV-GVYIDA---GSRYENDY-VRGASHIMD----RLA-------------------------FK
PQQL_ECOLI/46-204YMIYPHAHP---KDQVNL-WLQIHT---GSLQEEDN-ELGVAHFVE----HMM-------------------------FN
MPPA_HUMAN/77-227RVASQNK.F---GQFCTV-GILINS---GSRYEAKY-LSGIAHFLE----KLA-------------------------FS
QCR2_BOVIN/48-194VIASLEN.Y---APASRI-GLFIKA---GSRYENSN-NLGTSHLLR----LAS-------------------------SL
QCR1_YEAST/37-182VVATEHNPS---AHTASV-GVVFGS---GAANENPY-NNGVSNLWK----NIF-------------------------LS
A6T9H3_KLEP7/17-153..TLVHQPQ---ADRAAA-LARVAA---GSHHEPSR-FPGLAHLLE----HLL-------------------------FY
Q4K4V3_PSEF5/19-156RVSLRHAPH---LKRCAA-TLRVAA---GSHDVPLA-WPGLAHFLE----HLL-------------------------FL
U6GTY1_EIMAC/46-182...AVHHPR---SNEAGF-AVAANT---GSLYDPED-VPGLAHFLE----HML-------------------------FL

PF02664

R4KBP6_CLOPA/3-152-----KIASFTVNHLKLK-.PGVYV---SRKDT.I.-GENIITTFD----LR--------------------------FT
R5KFX1_9CLOT/3-152-----KIKSFQINHLLLN-.PGIYV---SRKDK.A.-GDAVLTTFD----IR--------------------------MT
R5PX34_9BACT/3-152-----KIPSFTIDHNRLL-.RGIYV---SRKDK.V.-GGDTVTTFD----IR--------------------------MK
R6C8S4_9CLOT/3-152-----KIASFTIDHIKLQ-.PGVYV---SRKDK.V.-GVETITTFD----IR--------------------------MT
R6PKX1_9FIRM/2-152-----KVASFTIDHDRLL-.RGIYV---SRKDS.V.-GNETVTTFD----VR--------------------------IK
X2H624_9GAMM/3-155-----LLDSFKVDHTKMK-APFVRV---AKTMK.TP-KGDKITVFD----LR--------------------------FT
D7CY71_TRURR/20-171-----RVASFDLDHTKVR-APYVRL---AGRYR.GP-RGDTVTKFD----LR--------------------------LV
R5RBB5_9FIRM/3-152-----KITSFTIDHIKLQ-.PGVYV---SRKDP.L.-GDSMITTFD----IR--------------------------MT
LUXS_WOLSU/3-156-----LLDSFKVDHTKMP-APAVRL---AKTMT.TP-KGDEIAVFD----LR--------------------------FC
LUXS_LEUMM/6-151-----.VESFTLDHTKVK-APYVRV---IETQA.GP-NGGSITNYD----LR--------------------------LT
C4Z400_EUBE2/3-154-----KIASFTVNHLDLL-.TGVYV---SRKDY.I.-GDVCLTTFD----LR--------------------------FT
D5V4X1_ARCNC/3-156-----LLDSFKVDHTIMP-APAVRV---AKTMK.SP-SGDIITVFD----LR--------------------------FY
LUXS_STRSY/6-152-----TVESFELDHTIVK-APYIRL---ISEEV.GP-KGDIITNFD----IR--------------------------LI
R6HDC0_9CLOT/3-145-----KIESFKVDHTKIS-.KGLYI---SRIDG...-...DIVTYD----IR--------------------------MV
R5YRN6_9FIRM/3-151-----KITSFTINHLKLL-.PGVYV---SRKDK.V.-GDNVLTTFD----LR--------------------------IT
LUXS_PORGI/3-152-----KIPSFQLDHIRLK-.RGIYV---SRKDY.I.-GGEVVTTFD----IR--------------------------MK
E6TVC8_BACCJ/6-152-----NVESFNLDHTKVV-APYVRL---AGTTE.GV-NGDKIFKYD----IR--------------------------FC
R7HNK7_9BACT/3-153-----KIASFTINHLTLN-.RGIYV---SRKDS.TE-HGDIITTFD----VR--------------------------MK
G9WH82_9LACT/3-148-----EVESFTLDHTKVK-APYVRL---ITEEK.GP-NGGTVANYD----LR--------------------------LV
LUXS_SULDN/3-156-----LLDSFKVDHTIMP-APAVRR---AKGMK.TP-SGDDITVFD----LR--------------------------FV
LUXS_BORBU/3-151-----KITSFTIDHTKLN-.PGIYV---SRKDT.F.-ENVIFTTID----IR--------------------------IK
LUXS_HALH3/5-151-----NVESFNLDHTKVK-APYIRL---VGVTE.GD-KGDKIYKYD----IR--------------------------VK
F2FAS1_SOLSS/7-150-----NVESFDLDHTIVA-APYVRL---AGTKE.GA-KGDVVTKYD----IR--------------------------LK
B9L8B0_NAUPA/3-151-----MLDSFLVDHVKMP-SPGLRV---AKHVK.TP-NGDIITVYD----VR--------------------------FA
A9KLE6_CLOPH/4-152-----.IASFTIDHLKLL-.PGVYV---SRKDS.A.-GDAIITTFD----LR--------------------------MT
R6ITR1_9FIRM/3-144-----RITSFSVDHDYIV-.PGMYI---SRIDG...-...DITTYD----LR--------------------------TR
R6DD03_9FIRM/3-147-----RIASFTVDHDVLV-.PGLYL---SRQDG...-...DVVTLD----LR--------------------------FK
D6XTF8_BACIE/6-147-----NVESFNLDHTKVA-APYVRL---AGKTT.GA-NGDTIYKYD----LR--------------------------FK
U5RPD3_9CLOT/3-152-----KIASFTVNHLKLQ-.PGVYV---SRKDK.F.-KDVVLTTFD----IR--------------------------MT
C7MPF8_CRYCD/3-154-----KIASFTVDHLTLE-.PGVYV---SREDVDVE-TGAVVTTFD----IR--------------------------MT
R7IRY5_9FIRM/3-152-----KIASFTINHLKLL-.PGIYV---SRKDK.I.-GAETVTTFD----LR--------------------------MT
R6PNN5_9FIRM/2-151-----DVTSFGIDHNRLL-.RGIYV---SRKDT.V.-GDGVLTTFD----VR--------------------------MK
E4TXP8_SULKY/3-156-----LLDSFCVDHTIMP-APAVRK---AKGMK.TP-KGDDITVFD----LR--------------------------FV
R5WFL1_9CLOT/3-152-----QIASFTVNHMRLL-.PGIYV---SRKDS.T.-GQDVVTTYD----IR--------------------------MT
R6C5U0_9BACT/3-152-----KIPSFTINHNKLL-.RGIYV---SRKDE.V.-GGEVITTFD----IR--------------------------MK
LUXS_STAA8/5-151-----NVESFNLDHTKVV-APFIRL---AGTME.GL-NGDVIHKYD----IR--------------------------FK
E3HCL4_ILYPC/3-153-----KIASFTVNHIDLL-.RGVYV---SRKDV.VA-NEHILTTFD----IR--------------------------MK
R6YLM9_9FIRM/3-152-----TIASFTVDHLKLL-.PGVYV---SRKDC.T.-GTDIVTTFD----IR--------------------------MT
K4RLT5_HELHE/5-148-----NVESFNLDHRKVK-APYVRL---AGRKV.GA-GGDVIVKYD----VR--------------------------LK
D2RNA7_ACIFV/6-149-----.IESFTLDHTKVK-APYVRL---IGQET.GE-HGDIVSNFD----IR--------------------------LC
E3EF50_PAEPS/3-144-----KVESFQLDHTIVK-APYVRA---AGVEH.DE-KGSTVQKYD----LR--------------------------FL
R5FL10_9BACT/3-152-----KIPSFTINHEKLL-.RGIYV---SRKDE.V.-GGEVVTTFD----IR--------------------------MK
E6X176_NITSE/3-156-----MLDSFMVDHTRMP-APAVRV---AKTMQ.TP-CGDTITVFD----LR--------------------------FC
F2JMN8_CELLD/3-147-----KIASFTVNHIDLL-.PGIYT---SRVDA.I.-GDYTITTYD----LR--------------------------MK
R6GXR5_9FIRM/3-148-----KIASFTVNHLDLI-.PGVYV---SRKDY.V.-GKEVLTTFD----LR--------------------------MT
C3PK03_CORA7/11-156-----NVKSFELDHRLVA-APYIRV---ADRTD.LG-GGVEIIKYD----LR--------------------------FC
R5NSS3_9FIRM/3-152-----KIASFTINHLKLE-.PGIYV---SRRDY.I.-GSEVATTFD----IR--------------------------MT
H6LD48_ACEWD/3-152-----KIASFTVNHLDLL-.RGVYV---SRKDY.C.-GDHCITTFD----IR--------------------------MK
R6MPS4_9FIRM/7-150-----QIASFTVNHDKLE-.KGMYI---SRIDG...-...DVVTYD----IR--------------------------MK
R7MKY1_9FIRM/3-145-----RIKSFEVDHTKFG-.IGMYT---SRIDG...-...DITTYD----VR--------------------------MA
LUXS_SHELP/3-156-----LLDSFTVDHTRMN-APAVRV---AKTMT.TP-KGDTITVFD----LR--------------------------FC
F2NTN2_TRES6/7-150-----NVDSFNLDHTKVT-APFVRL---ASEKT.GR-KGDIVSKYD----VR--------------------------FC
LUXS_CAMJE/3-156-----LLDSFKVDHTKMP-APAVRL---AKVMK.TP-KGDDISVFD----LR--------------------------FC
R5KBK1_9CLOT/3-152-----KIASFTVDHLNLI-.PGVYV---SRKDH.I.-GSEVVTTFD----IR--------------------------MT
LUXS_CHRSD/7-153-----NVESFNLDHTKVK-APYVRL---AGIKT.GD-HGDAIHKYD----LR--------------------------IC
R6TY31_9FIRM/3-145-----RIASFSVDHDLIE-.PGIYI---SRIDG...-...DIVTYD----LR--------------------------TR
F2NKV7_MARHT/3-150-----EVESFRLDHTKVR-APYVRL---AGKKR.TP-SGDWIEKYD----LR--------------------------LA
LUXS_PEDPA/3-148-----KVESFELDHTKVK-APYVRL---ITVET.GN-KGDKISNFD----LR--------------------------LV
E4UA16_OCEP5/3-147-----KVASFDLDHTKVR-APYVRL---ADLKY.TP-GGEVISKWD----LR--------------------------VG
R5KTK9_9CLOT/3-145-----TIPSFQVDHNKLK-.KGIYI---SRIDD...-...DITTYD----IR--------------------------MR
A5HZR8_CLOBH/3-148-----KVESFSLDHTKVK-APFVRK---CGTQK.GE-MGDTITKFD----LR--------------------------FS
R5ED85_9CLOT/3-152-----KIASFTVNHLTLL-.PGIYV---SRKDK.V.-GAETVTTFD----LR--------------------------MT
C5ZWA6_9HELI/3-153-----LLDSFKVDHKKMP-APAVRL---GKVMH.TP-KGDEICVFD----LR--------------------------FC
LUXS_OCEIH/6-147-----NVESFNLDHTKVK-APYVRL---VGVTE.GA-NGDKVHKYD----IR--------------------------IK
C4L419_EXISA/5-147-----NVESFNLDHTKVQ-APFVRL---AGVKE.GT-.ADTIYKYD----IR--------------------------FI
D2NNT8_ROTMD/39-183-----NVESFNLDHRAVA-APYVRI---ADRKV.LP-GGDTLIKYD----IR--------------------------FT
R6LCE1_9FIRM/3-152-----KITSFTIDHLKLV-.PGLYV---SRKDF.A.-GEQVITTFD----IR--------------------------MT
R5CNL9_9FIRM/3-152-----KIASFTVNHLKLE-.PGIYV---SRKDH.F.-GDVTITTFD----LR--------------------------MT
R6MQH5_9FIRM/3-145-----RIASFQVNHDTLE-.PGVYV---SRIDG...-...DITTYD----MR--------------------------FI
F9YSB4_CAPCC/3-151-----KIASFCIDHLKME-.RGIYV---SRKDY.V.-GNEVLTSFD----IR--------------------------MK
B1HRL0_LYSSC/7-150-----NVESFDLDHTKVK-APYVRL---AGVKT.GK-NGDEVYKYD----IR--------------------------FK
LUXS_SULNB/3-156-----LLDSFTVDHTRMI-APAVRV---AKRMK.TP-CGDDITVFD----LR--------------------------FC
LUXS_LACLA/3-148-----EVESFQLDHTKVL-APYVRL---IGSET.GP-KGDVITNFD----VR--------------------------FV
I0FCF7_BORCA/3-151-----KISSFTIDHTKLQ-.PGIYI---SRKDT.F.-DNLTLTTVD----IR--------------------------MK
LUXS_HELPY/7-153-----NVESFNLDHTKVK-APYVRV---ADRKK.GV-NGDLIVKYD----VR--------------------------FK
R6R1H2_9FIRM/3-152-----KIASFTVNHIDLL-.AGIYV---SRRDS.I.-GSCVLTTFD----LR--------------------------FT
F4BP26_CARS1/6-149-----NVESFNLDHTKVK-APYVRL---ADKKI.GL-NGDKILKYD----VR--------------------------FS
F5YFP3_TREAZ/3-151-----KIASFQVDHLRLK-.PGLYV---SRRDK.Y.-GTTVLTTFD----LR--------------------------FK
LUXS_BACSU/3-154-----SVESFELDHNAVV-APYVRH---CGVHK.VG-TDGVVNKFD----IR--------------------------FC
D4KC03_9FIRM/3-145-----RIASFCVDHTRLE-.RGMYL---SRQDG...-...DVLTWD----IR--------------------------MK
R6HYL9_9FIRM/3-148-----KIASFTVNHLTLE-.PGLYV---SRKDR.M.-GAETVTTFD----LR--------------------------MT
C7NBV6_LEPBD/3-152-----RIASFTVDHIRLN-.RGIYV---SRIDE.V.-NGNYLTSFD----IR--------------------------MK
LUXS_ACTP2/3-157-----LLDSFKVDHTRMN-APAVRV---AKTMT.TP-KGDTITVFD----LR--------------------------FC
R6NAG0_9FIRM/3-152-----KIASFTIDHIKLQ-.PGIYV---SRKDF.V.-GKEVITTFD----LR--------------------------MT
R6RZY0_9FIRM/3-152-----KITSFTINHLKLL-.PGVYV---SRVDY.V.-AGNPVTTFD----LR--------------------------MT
R7DJC7_9PORP/3-152-----KIPSFTIDHIHLL-.RGIYV---SRKDY.I.-GNHTITTFD----IR--------------------------MK
E8NGC1_MICTS/3-149-----DVESFTLDHTAVL-APYVRR---IGTET.GP-RGDVITNFD----LR--------------------------LV
G4L3V1_TETHN/3-149-----EVESFTLDHTKVK-APYVRL---IGKEN.GK-KGDVISNYD----LR--------------------------FL
LUXS_THICR/3-156-----LLDSFTVDHKIMN-APAVRV---AKTMK.TP-GGDTITVFD----LR--------------------------FN
R5WY94_9FIRM/3-152-----KIASFTIDHIKLQ-.PGIYV---SRKDY.L.-GDQVITTFD----IR--------------------------MT
E1STH1_FERBD/3-156-----LLDSFTVDHTKMA-APAVRI---AKTMA.TP-KGDTITVFD----LR--------------------------FC
R6RGY7_9CLOT/3-152-----KIASFTVNHLKLL-.PGVYV---SRRDT.A.-GDARITTFD----IR--------------------------MT
V5WDC5_9SPIO/3-152-----KIPSFTIDHNKLL-.RGIYV---SRIDE.V.-GNDYVTTYD----IR--------------------------MK
R7FSM8_9FIRM/3-152-----KIASFTVDHLRLV-.PGVYV---SRVDQ.V.-AGNPITTFD----LR--------------------------MT
E0S2G2_BUTPB/3-152-----KIASFTVNHLDLE-.PGIYV---SRKDK.V.-GQETITTFD----LR--------------------------MT
E3GFJ9_EUBLK/3-152-----KIASFTVNHIDLL-.RGIYV---SRKDY.C.-GDDYITTFD----IR--------------------------MK
LUXS_CAMC1/3-156-----LLDSFCVDHVKMK-APGVRL---AKSMK.TP-KGDDISVFD----LR--------------------------FC
LUXS_HAEIN/3-156-----LLDSFKVDHTKMN-APAVRI---AKTML.TP-KGDNITVFD----LR--------------------------FC
F8EYR0_TRECH/3-151-----KIASFTVDHIRMK-.RGIFV---SRKDR.F.-GNTVLTTFD----IR--------------------------MK
R5IHR6_9CLOT/3-148-----KIASFTIDHIKLQ-.PGVYV---SRKDK.V.-GDSTVTTFD----LR--------------------------MT
LUXS_CLOB8/3-152-----KIASFTINHLELL-.PGVYV---SRQDK.F.-GDTVLTTFD----IR--------------------------MN
I6T8S7_ENTHA/4-150-----NVESFNLDHTKVK-APYIRV---ADKKT.GE-HGDVIIKYD----VR--------------------------FK
E1VUH9_ARTAR/8-152-----EVESFALDHTKVK-APYVRK---IAVEH.GP-KGDAITNYD----IR--------------------------FV
R6MF87_9BACE/3-152-----KIPSFTVDHIRLL-.RGIYV---SRKDT.V.-GNEIVTTFD----IR--------------------------MK
F4LMA9_TREBD/3-152-----KIASFTVDHLRLE-.PGLYV---SRIDT.F.-GGAPITTFD----IR--------------------------MT
LUXS_HELHP/3-152-----LLDSFKVDHTKMP-APAVRL---AKTMQ.TP-KGDTISVFD----LR--------------------------FT
R7FC53_9FIRM/3-148-----QITSFTINHDFLK-.RGMYI---SRVDG...-...DVITYD----IR--------------------------MK
R6A5W4_9BACT/3-149-----KIPSFTIDHTRLN-.RGIYV---SRKDE.V.-GGEVVTTFD----VR--------------------------MK
F4HBP5_GALAU/3-155-----LLDSFKVDHVKMN-APAVRV---AKTMQ.TP-KGDKITVFD----LR--------------------------FC
LUXS_PROAC/6-150-----NVESFNLDHTKVA-APFVRV---ADVKH.LP-AGDTLTKYD----VR--------------------------FC
G9ALV8_PANAN/3-156-----LLDSFTVDHTIMA-APAVRV---AKTMK.TP-HGDTITVFD----LR--------------------------FC
LUXS_ECOLI/3-156-----LLDSFTVDHTRME-APAVRV---AKTMN.TP-HGDAITVFD----LR--------------------------FC
D3FYW3_BACPE/3-149-----TVESFELDHTIVK-APFVRH---CGRHD.VG-TDGEINKFD----IR--------------------------FF
D9SL03_CLOC7/3-145-----KIESFLLDHTKVK-APFVRK---CEVKT.GP-KGDNITKFD----LR--------------------------FT
R6WDX5_9FIRM/3-150-----KITSFTIDHLKLI-.PGVYV---SRIDY.V.-EGHPITTFD----LR--------------------------MT
LUXS_CAMHC/3-156-----LLDSFKVDHTKMK-APGVRL---AKVMQ.TP-KGDNISVFD----LR--------------------------FC
R5T4J5_9CLOT/3-152-----KITSFTINHLKLL-.PGIYV---SRKDT.A.-GGHTVTTFD----LR--------------------------MT
LUXS_DESPS/3-152-----KIASFTIDHTKLK-.RGVYV---SRQDK.V.-AGNVITTFD----LR--------------------------LK
D1AKY0_SEBTE/5-153-----KIPSFTVDHIKLE-.PGIYI---SRIDE.V.-GGDYVTTFD----IR--------------------------LK
F8A102_CELGA/6-151-----NVESFNLDHRTVA-APYVRL---ADAKQ.LP-AGDVIEKYD----VR--------------------------FT
F0LWD7_VIBFN/3-156-----LLDSFTVDHTRMN-APAVRV---AKTMQ.TP-KGDTITVFD----LR--------------------------FT
X2HF86_9NEIS/3-156-----LLDSFTVDHTRMH-APAVRV---AKNMT.TP-KGDDITVFD----LR--------------------------FC
G2TLR1_BACCO/8-154-----NVESFNLDHTKVK-APYVRL---AGVKE.GI-HGDVIRKYD----IR--------------------------FC
R7LH99_9BACT/3-152-----KIASFTINHLKLN-.RGIYV---SRRDR.V.-GDEVLTSFD----VR--------------------------MK
R5GZ39_9FIRM/3-152-----KIASFTVDHIKLQ-.PGIYV---SRKDT.V.-GQEVITTFD----LR--------------------------MT
R5EUY8_9GAMM/3-152-----LVDSFLVDHTIMP-APSVRL---AKVMK.TP-LGDEIEVWD----LR--------------------------IK
X4RAQ7_9ACTO/5-148-----NVESFNLDHTLVS-APFVRV---ADVKR.LA-HGDVLTKYD----VR--------------------------FC
R5ZCW6_9FIRM/3-152-----KIASFTVNHLALL-.PGIYV---SRKDK.V.-GDQVLTTFD----LR--------------------------MT
LUXS_BIFLO/10-155-----VVESFQLDHTKVK-APYVRY---IDTET.GP-HGDVISNYD----LR--------------------------LT
R7EJJ6_9BACE/3-152-----KIPSFTIDHIRLL-.RGIYV---SRQDE.V.-NGETVTTFD----IR--------------------------MK
W6ETW6_SULMU/3-156-----LLDSFCVDHVKMP-APAVRV---AKTMK.TP-HGDEITVFD----LR--------------------------FC
LUXS_CLOAB/3-151-----KIASFTVNHLTLQ-.PGVYV---SRKDK.F.-GDVVITTFD----IR--------------------------MT
R6BK52_9CLOT/3-146-----RIESFCVNHDKLT-.PGMYL---SRIDG...-...DAVTYD----VR--------------------------MV
R6PJD2_9CLOT/3-152-----KITSFTIDHIRLV-.PGVYV---SRKDP.I.-GNEIITTFD----LR--------------------------MT
R6A2L5_9ACTN/3-154-----RIASFSVDHLLLE-.PGVYV---SRIDRDPA-TGAAVTTFD----LR--------------------------LT
LUXS_AERHH/3-156-----LLDSFTVDHTRMA-APAVRV---AKTMQ.TP-NKDTITVFD----LR--------------------------FC
W0DSV4_9GAMM/3-156-----LLDSFRVDHTIMP-APAVRV---AKTMT.SP-KGDTITVFD----LR--------------------------FC
LUXS_CAMFF/3-156-----LLDSFKVDHTIMN-APGVRL---AKVMN.TP-KGDKITVFD----LR--------------------------FC
LUXS_CLOPE/3-144-----KVESFELDHTKVK-APYVRK---AGIKI.GP-KGDIVSKFD----LR--------------------------FV
LUXS_HAEDU/3-157-----LLDSFKVDHTRMN-APAVRV---AKTIT.TP-KGDLITVFD----LR--------------------------FC
D6ZJM3_MOBCV/7-149-----NVESFQLDHTKVK-APFVRV---AHQET.LP-GGDEFIKYD----VR--------------------------FC
I1YS81_PREI7/3-152-----KIPSFTIDHDRLL-.RGIYV---SRQDY.V.-GNEIVTTFD----IR--------------------------MK
R5PFW0_9BACT/3-151-----KIPSFTIDHNQLL-.PGIYV---SRKDN.V.-GNDVVTTFD----IR--------------------------MK
R5EUU6_9FIRM/3-151-----KITSFTIDHIKLQ-.PGLYV---SRKDK.V.-GAETVTTFD----LR--------------------------LT
R5D5F7_9FIRM/3-152-----KVTSFTINHLKLK-.PGIYV---SRIDH.V.-NGNPLTTFD----LR--------------------------MT
W5XUN8_9CORY/9-154-----NVESFNLDHRAVA-APFVRV---ADRKE.LP-GGDVLVKYD----VR--------------------------FK
R5L929_9FIRM/3-152-----KITSFTIDHLKLL-.PGLYV---SRKDI.A.-GDCVITTFD----IR--------------------------MT
LUXS_DEIRA/6-150-----NVESFDLDHTKVK-APYVRL---AGVKT.TP-KGDQISKYD----LR--------------------------FL
R6UZ21_9FIRM/3-147-----KITSFCIDHDILE-.KGMYI---SRIDG...-...DIITYD----LR--------------------------MV
X4ZFG7_9BACL/3-145-----KVESFQLDHTKVK-APYVRV---AGTER.NG-TGAVLQKYD----LR--------------------------LL
R5UP43_9PORP/3-152-----KIPSFTIDHEHLL-.RGIYV---SRKDN.M.-GNQVITTFD----IR--------------------------MK
D7BBC0_MEISD/6-153-----LVESFRLDHTKVR-APYVRL---AGVKM.TP-KGDRIEKYD----LR--------------------------LG
A5N8G9_CLOK5/3-154-----KITSFTINHLELL-.PGVYV---SRKDN.I.-NGAIITTFD----IR--------------------------MT
D7GDL7_PROFC/6-150-----NVESFNLDHTKVK-APFIRV---ADVKH.LP-QGDTLTKYD----VR--------------------------FC
LUXS_LISMO/6-150-----NVESFNLDHTKVK-APFVRL---AGTKV.GV-HGDEIYKYD----VR--------------------------FK
LUXS_FINM2/3-149-----KIESFKINHLKLM-.PGIYV---SRKDY.L.-GNEVLTTFD----LR--------------------------IT
R5U9A0_9FIRM/3-152-----KITSFTIDHIKLT-.PGLYV---SRKDL.A.-GDTPVTTFD----IR--------------------------IT
R6FMJ5_9FIRM/3-152-----KIASFTIDHLKLL-.PGVYV---SRKDK.V.-GENTITTFD----IR--------------------------MT
R5QFC8_9FIRM/3-152-----KITSFTIDHIRLI-.PGIYV---SRKDS.V.-NGHIITTFD----IR--------------------------MT
R6UMD9_9CLOT/3-146-----KIASFTINHDTLT-.EGIYT---SRIDG...-...DIVTYD----IR--------------------------MR
R7I6H9_9CLOT/3-150-----EIASFTINHLKLL-.PGIYV---SRKDA.I.-GSEMVTTFD----IR--------------------------MT
R7J0C3_9BACT/3-152-----KIASFRINHLVLQ-.PGIYV---SRRDT.TP-SGDVLTTFD----IR--------------------------MT
A6Q5E8_NITSB/3-156-----LLESFTVDHTKMP-APAVRL---AKEMQ.TP-KGDEITVYD----LR--------------------------FC

PF05193

MPPA_SCHPO/216-408GITATSIREYLKYFYRPE.HLTLAY---AG.IP-QE-..IAKEITK....EL--------------------------YG
QCR1_MOUSE/210-395RLSRTDLTDYLNRHYKAP.RMVLAA---AGGVE-HQ-..QLLDLAQ....KH--------------------------LS
IDE_HUMAN/236-418DV.RQELLKFHSAYYSSN.LMAVCV---LGRES-LD-..DLTNLVV....KL--------------------------FS
IDE_HUMAN/706-889DVTLPRLKAFIPQLLSRL.HIEALL---HGNIT-KQ-..AALGIMQ....MV--------------------------ED
YMFH_BACSU/182-363HITKDLLYECYETFYHPS.NMLLFI---VGPVD-PE-..AIISQVR....EN--------------------------QG
YMXG_BACSU/165-338SFNGDSLRQYMHDYYTPD.RVVISV---AGNIS-D.-..SFIKDVE....KW--------------------------FG
YQA4_CAEEL/603-787SVTLEDVHGFAIKMLQAF.HMELFV---HGNST-EK-..DTLQL.S....KE--------------------------LS
QCR2_MOUSE/199-378KITSEELHYFVQNHFTSA.RMALVG---LG.VS-HS-..VLKQVAE....QF--------------------------LN
YQA4_CAEEL/200-382P..RDVLLDFYKNWYSSD.IMTCCI---VGKES-L.-.....DVLE....SY--------------------------LG
PREP1_ARATH/301-489NLTFEEFKEFHRQYYHPS.NARIWF---YGDDD-PV-..HRLRVLS....EY--------------------------LD
IDE_DROME/209-391DV.RDELLKFHKQWYSAN.IMCLAV---IGKES-LD-..ELEGMVL....EK--------------------------FS
Q9YFN7_AERPE/166-342NISKADVEEYKASVFSPE.RMSLAI---VGRIS-RL-..EALRV.V....KL--------------------------FS
IDE_DROME/679-863LVTYDRVLNFAKEFFQRL.HTECFI---FGNVT-KQ-..QATDIAG....RV--------------------------NT
Q9RRH6_DEIRA/141-315RLDRPALQRHFAERYGAE.RVTLVL---SGAFD-PA-..EVRAWAE....RE--------------------------LA
PQQL_ECOLI/206-388TVTPAQLRQFYQRWYQPN.NMTFIV---VGDID-SK-..EALALIK....DN--------------------------LS
Q9X167_THEMA/162-335KISSEDLREYHRKNYNLP.DTKIIL---AGKVN-D.-..DYLSLLE....KE--------------------------LS
Q9I6C2_PSEAE/203-388RMTIDDLRHWYESWYAPN.NATLVV---VGDVT-AD-..EVKTLAK....RY--------------------------FG
MPPB_SCHPO/185-372SLTREDLLQYIKDNYRSD.RMIISS---AGSIS-HE-..ELVKLAE....KY--------------------------FG
PXM16_ARATH/666-854HLEAEDVAKFVPMLLSRT.FIECYI---AGNVE-NN-..EAESM.V....KH--------------------------IE
Q9KUG7_VIBCH/219-398RVDVNDLKAFFLRWYGPN.NAVLTI---GGDLD-VK-..QTLAWVQ....KY--------------------------FG
O50511_STRCO/185-366AATLEDARAFFRTYYAPN.NAVLSV---VGDID-PE-..QTLAWIE....KY--------------------------FG
PTRA_ECOLI/681-858SITLKEVLAYRDALKSGA.RPEFMV---IGNMT-EA-..QATTLAR....DV--------------------------QK
MPPB_NEUCR/203-391DITRTELVNYIKNNYTAD.RMVLVG---AGGVP-HE-..QLVEMAD....KY--------------------------FS
Q9RRH5_DEIRA/126-298RLSAASLRAHWAR.FGQR.GSVLGV---VADAD-AQ-..EVYELVA....GL--------------------------FA
QCR2_NEUCR/198-375YLNENSVAAFANLAYNKA.NIAVVA---DG.AS-QA-..GLEKWVE....PF--------------------------FK
Q985V3_RHILO/166-339SFTSKQLHDFIERQYGAE.RMVIVA---AGDIK-HD-..NFVREVE....KQ--------------------------LG
Q9FJT9_ARATH/639-833KVDPLKACEYFNSCFRDPSTFTVVI---VGNLD-PT-..IALPLIL....QY--------------------------LG
Q23295_CAEEL/192-374TINKNDLQGYINTHYRSG.RMVLAA---AGGVN-HD-..AIVKMAE....KY--------------------------FG
CYM1_YEAST/735-911REVVDKLTELQKYIVDTN.NMNFFI---TSDSD-VQ-AKTVESQIS....KF--------------------------ME
O67308_AQUAE/184-360KFTREKLLKFYKSFYQPR.NMAVVI---VGKVN-PK-..EVEEEVM....KT--------------------------FG
O84812_CHLTR/225-408SVTTQDMQTWFATHYSPE.NMAAIV---YTTAP-LD-..TAVPYIA....SL--------------------------FS
P73670_SYNY3/182-362NYTANQLRCFHRTHYQPE.NMTVVM---VGDIR-EK-..AAIAYME....EI--------------------------FD
Q9VP94_DROME/242-425SL.HKELHKFYRDHYGSN.RMVVAL---QAQLS-LD-..ELEELLV....RH--------------------------CA
Q97II7_CLOAB/206-391DLSYEEALSFHEKYYHPS.NSIIYV---YGDID-IE-..EVLEFIN...DNY--------------------------LK
YPD1_CAEEL/194-376SCTLEKVRDYHKKFYHLS.NMVVTV---CGMVD-HD-..QVLEIMNNVENEH--------------------------MS
Q9VYT3_DROME/284-473EL.HKILHEIRKEHYGAN.RMYVCL---QARLP-ID-..ELESLVV....RH--------------------------FS
MPPA_HUMAN/232-431KINREVLHSYLRNYYTPD.RMVLAG---VG.VE-HE-..HLVDCAR....KY--------------------------LL
MPPA_YEAST/181-374SISKYYLLDYRNKFYTPE.NTVAAF---VG.VP-HE-..KALELTE....KY--------------------------LG
Q9VFF0_DROME/203-385SIGKADLTDYIQTHYKAS.RIVLAA---AGGVK-HD-..DLVKLAC....SS--------------------------LG
MPPB_YEAST/189-380SITRTDLKDYITKNYKGD.RMVLAG---AGAVD-HE-..KLVQYAQ....KY--------------------------FG
O83069_TREPA/199-385RLTYESFKAFHKKHYHPS.NCKLFL---YGNIP-TE-..KQMAFIE...DKC--------------------------LS
O25656_HELPY/198-379NWTLKDIKKFHSLYYQPK.NAIVLV---VGDVN-SQ-..KVFELSK....KH--------------------------FE
Y228_BORBU/711-879EI.ANKLDNLKNKIILKN.NLSALI---MGNTD-D.-..ILKNLEN....EF--------------------------FN
Q9A579_CAUCR/219-397AASLDDVKTWFKNYYGPA.NATLVL---AGDIS-AA-..EAKAKVE....KY--------------------------FG
MPPA2_ARATH/235-419GLTGEVLENFVFENYTAS.RMVLAA---SG.VD-HE-..ELLKVVE....PL--------------------------LS
PXM16_ARATH/198-379T..RSELIKFYEEHYSAN.IMHLVV---YGKES-LD-..KIQDLVE....RM--------------------------FQ
Q9PF62_XYLFA/244-422AASLADVKSWFQAHYGAA.NATLVL---AGDIT-VA-..EARDKAA....KY--------------------------FG
Q9CE72_LACLA/168-341KENPKAVFEYYQKMLTDN.AIDIFV---LGDVD-EK-..RMI........ER--------------------------FS
Q9RWP9_DEIRA/229-413GLTYEDLRAFHAAHYHPS.NAYFFS---YGNQD-LR-..RVLDTIE...EQV--------------------------MS
PTRA_ECOLI/213-396PV.QQALKDFHEKYYSAN.LMKAVI---YSNKP-LP-..ELAKMAA....DT--------------------------FG
Q97IL0_CLOAB/163-340DFSIDELRKFYKKYYTSD.NCVIGI---VTSLK-EE-..EVTDIIN....NY--------------------------MT
Q17593_CAEEL/199-381P..RDALLEFYKKWYSSN.IMTCCI---IGKES-LD-..VLESYLR....TL--------------------------EF
Q9A2H7_CAUCR/672-850KIKREDLAKTHAAYWRPD.NAVLVV---TGNLS-PE-..AGFALAE....KA--------------------------FG
Q9A531_CAUCR/720-903SASLDDLKAAVANPLAKG.DLEVVI---VGDTT-VD-..KAIAAVA....DT--------------------------FG
Q9HT96_PSEAE/190-362PLGAEQLERLRSDWYVPG.NMTLIL---VGDLD-P.-..RLPAYLT....RT--------------------------FG
Q9I6C3_PSEAE/229-405TISREQLQAFHKKAYAAG.NVVIAL---VGDLS-RQ-..EAEAIAA....EV--------------------------SK
STE23_YEAST/246-428NV.RDELLKFHKNFYSAN.LMKLCI---LGRED-LD-..TLSDWTY....DL--------------------------FK
Q9KUG7_VIBCH/686-864ALTLKDVKQFYRQHYTPH.GAQIAV---VGDIS-AR-..EIRQQ.L....QF--------------------------IA
Q9KQC8_VIBCH/661-839DVQVEELAHFVDTILSQL.HVEMFV---YGDWP-AA-..EAHKMAEV.LKDA--------------------------LR
PQQL_HAEIN/205-388TISAKRVADFYHKWYRPD.NMSVII---VGDID-TK-..QVVKLLK....QN--------------------------LS
MPPA_SOLTU/236-422RLNSTVLEEFVAENYTAP.RMVLAA---SG.VE-HE-..EFLKVAE....PL--------------------------LS
YAN2_SCHPO/193-378KLSIEKIREYHKEMYVPS.NICLIV---TGCIN-ES-..RLLSCAS....GI--------------------------VK
NRDC_HUMAN/837-1020GLSLESLLSFVKEFKSQL.FVEGLV---QGNVT-ST-..ESMDFLK....YV--------------------------VD
O84831_CHLTR/201-385SLNLETVRAFYESQYTLS.RCLFYF---YGNIK-PS-..RHLDFLE...EKL--------------------------LR
Q9A579_CAUCR/657-835AITRDDLIAYQKAWLQPK.DATLII---VGDTT-LE-..QILPKLE....AQ--------------------------LG
Q9FIH8_ARATH/360-598KWDVDKIRKFHERWYFPA.NATLYI---VGDID-NI-.PRIVHNIE....AV--------------------------FG
Q9A531_CAUCR/246-428TAPAQRIRDFYEAYYRPE.RTVLVA---VGDFD-VD-..AMEAKIK....GK--------------------------FG
CYM1_YEAST/221-407DLRYGDLLDFHHKNYHPS.NAKTFT---YGNLP-LV-..DTLKQLN....EQ--------------------------FS
Q97EV0_CLOAB/207-392DLTYDAFLDSHKKYYSPS.NSYIYL---YGDMD-ID-..EKLKYID...EEY--------------------------LK
Q9VYT3_DROME/769-953SVILEDMREFAHQFPKEL.YIQSLI---QGNYT-EE-..SAHNVMN....SL--------------------------LS
QCR1_YEAST/187-370NLVVADLESFANNHFLNS.NAVVVG---TGNIK-HE-..DLVNSIE...SKN--------------------------LS
Q9VP94_DROME/724-907DITMDDIKSFKENFHKKM.YVKGLI---QGNFT-ED-..QATDLMQ....KV--------------------------LD
O67945_AQUAE/183-355RVSREDLIRRFNQIKKGE.NVVVVL---VGDFK-AE-..DVLPLLE....EA--------------------------FS
Q9KRD3_VIBCH/199-378AATPDSLKAFYQQWYQPQ.LAELVI---TGNFT-LE-..QGQQWVE....NY--------------------------FS
Q9FIH8_ARATH/928-1156SLNLESVKDAVMSHFVGD.NMEVSI---VGDFS-EE-..EIERCIL....DY--------------------------LG
MU138_SCHPO/668-850DVQVGDMSDFISDLLKQN.FLESLV---HGNYT-EE-..DAKNLIE....SA--------------------------QK
NRDC_HUMAN/361-548T..HARLREFWMRYYSSH.YMTLVV---QSKET-LD-..TLEKWVT....EI--------------------------FS
P74016_SYNY3/241-420NIDRQAIIDFHRRYVRPD.QMILGI---VGDFD-SE-..TIKQTIA....ER--------------------------FG
MU138_SCHPO/196-378DV.RQELLKFYDKYYSAN.IMKLVI---IGREP-LD-..VLQDWAA....EL--------------------------FS
Q55159_SYNY3/175-359NLQAQQMRDFHAHWYQPP.AMTVTV---VGNQS-VG-..NLVETVA....RS--------------------------FA
MPPA1_ARATH/239-423RLNGELLEEFMTENFTAA.RMVLAA---SG.VE-HE-..ELLKVAE....PL--------------------------TS
O50512_STRCO/190-374TIDSAAVRAFYERHVRPA.TATAVV---VGDLT-GV-..DLDALLA....DT--------------------------LG
PQQL_HAEIN/680-857SFDKNQLNNAYQHYILDKTDFTYFI---IGDIE-LN-..QVKKLAE....RY--------------------------LA
O84831_CHLTR/717-886EI.IDRLQTLYKKCFVGR.RQLVIS---SSKAN-YQ-..VLHDQ......RF--------------------------FG
Q9KA85_BACHD/165-338SFNEGMLRHYMDRFYTGD.YVVISV---AG.NV-HD-..ELIDKIK....ET--------------------------FS
P74305_SYNY3/274-453NLSRQDVTDFYEKYYIPG.NMTIAV---VGDVK-VD-..QVKSLAQ....KY--------------------------FG
Q9CML5_PASMU/205-388TISRQRVADFYHKWYRAD.NMAVII---VGDID-AQ-..QVTSQLK....AQ--------------------------IG
MPPB_HUMAN/220-404SISRKDLVDYITTHYKGP.RIVLAA---AGGVS-HD-..ELLDLAK....FH--------------------------FG
Y219_RICPR/168-341TFTKEHFLNFIGKHYNAE.NLYLSI---AGNIE-HN-..KIVMIAE....EL--------------------------FA
O51486_BORBU/686-867YFTKENILSFYKKRFTYANNFKFVF---AGDSD-IQ-..TIKAYSK....KY--------------------------LG
Q9A308_CAUCR/166-339AASVEALSDWRGDLYAAD.RLVIAA---TGAVE-EA-..ELMAAAE....RA--------------------------FG
Q9KA98_BACHD/181-363KITKDLLYTCYETFYHPS.NMLLFI---VGPVD-VN-..EMMTLVK....EN--------------------------QG
PQQF_PSEAE/179-352AF.QRALREFHAAHYHAG.NCQLWL---QGPQT-LD-..ELERLAQ....RA--------------------------CA
YO098_YEAST/193-378TLTNDEIRQFHKSLYSSD.NLCVIV---CGNVP-TD-..ELLTVMEE.WDNK--------------------------LP
YHJJ_ECOLI/199-378PVEAEKIKDFYQKWYTPD.AMTLLV---VGNVD-AR-..SVVDQIN....KT--------------------------FG
Q9KQC8_VIBCH/196-377SI.RDEIIEFYQSHYSAK.LMTLSL---IGSQS-FD-..ELEAWAE....RY--------------------------FA
Q983M8_RHILO/208-384AITKDDLKALHKAVFARG.GLHVAV---VGAID-AE-..TLKKKLD....MV--------------------------FG
Q9RTZ9_DEIRA/246-424NVPIGNLKAFYKTYYQPD.NAVVTL---AGNFD-EG-..QALTLIA....DS--------------------------YG
Y4WA_RHISN/251-435QLNREDALKFYDRYYAPN.NAILVV---AGDVD-AG-..RVRQLAD....ET--------------------------FG
Y4WB_RHISN/198-374AVTTSDLKAVHERIFARG.NLTIAV---VGAID-PG-..TLKRDLD....RI--------------------------FG
MPPA_NEUCR/214-475YINRDVIQTYRDAFYRPE.RLVVAF---AG.VP-HE-..RAVKLAE....KY--------------------------FG
P73669_SYNY3/171-348HFTAQDLWEYHQAYFRPD.NLVISL---AGRLT-LA-..QAQDWVE....TS--------------------------FG
Q9CE73_LACLA/164-346AITADDLYKNYEVFYHPK.NMNLFL---TGPFD-IE-..MMSDFVR....SN--------------------------QA
Q9KRD3_VIBCH/671-849QVTAQQIEQVHQRLFSEGRNNTLVI---VGDIE-RS-..QITPMLR....QY--------------------------VA
Q9RTZ9_DEIRA/703-883AVTLAQVRDYYAKVWNGA.NAQLGV---VGDFD-PQ-..TIREALP....TL--------------------------LG
UCR1_CAEEL/200-386NISAQQLKEWQEDHYRPV.RMVLSA---VG.GG-VS-..NVSSLAD....KY--------------------------FG
Q9PF62_XYLFA/714-895SLTATDLKDFQQRWLRPD.NVRILV---TGHTT-LK-..SIIPQLE....AA--------------------------FG
MPPA_RAT/231-430KIDREVLHSYLKNYYTPD.RMVLAG---VG.VE-HE-..HLVECAR....KY--------------------------LL
O51486_BORBU/206-392SFQPEDFKKFYRKWYRPE.LASVIV---VGDID-PI-..EIEEKIK....KQ--------------------------FV
PQQL_ECOLI/683-863QFTAADALAADRQLFSSPADITFVI---VGNVA-ED-..KLVALIT....RY--------------------------LG
O16249_CAEEL/747-931SVTLEDVQGFAKEMLQAF.HMELFV---HGNST-EK-..EAIQLSK....EL--------------------------MD
Q97LA3_CLOAB/174-348KMEFQSVKSFHDKWYKPQ.NSAICI---CGDIA-NS-..DIENKIS....KY--------------------------FS
Q983M9_RHILO/206-390QLNRTDAVAFYDKYYRPN.NAVLIV---AGDVE-PE-..TVKALAE....KT--------------------------YG
Q9A2H7_CAUCR/210-390AATVDDVRAFHRTYYRPD.NAALII---VGNFD-QT-..KLDAMID....KY--------------------------FG
O16249_CAEEL/258-440P..RDALLQFHKKWYSSD.IMTCCI---VGKEP-L.-.....NVLE....SY--------------------------LG
Q97GF6_CLOAB/170-348GFSRNFIFDFYKKYYIPN.NCFIVI---VSKLE-HE-..QVFDLVE....KY--------------------------FG
PREP_DROME/268-457KLAYNDLVEFHKKYYHPS.NARIYS---YGLFD-AS-..KTLALLD...EEY--------------------------LS
STE23_YEAST/716-898KLTFEQLINFIPTIYEGV.YFETLI---HGNIK-HE-..EALEV.D....SL--------------------------IK
Y228_BORBU/195-380DLTYESFLDFYKKYYTLE.NCKIFL---CGNTQ-TE-..KNLNFIE....KY--------------------------II
Q9CML5_PASMU/680-857SFSRQELTQFYDSVMLDKTDFTYFL---IGDLP-QQ-..EAEKLAQ....TY--------------------------LA
Q9KA97_BACHD/184-365QLSAEELYRYYEQMLHSD.RIDLFV---LG.EK-GD-.PSLMSTVE....DT--------------------------FS
Y5738_STRCO/198-380ALTADRIRRFYRKHYDPT.HLVVAA---AGNVD-HN-..KVVRQVR....AA--------------------------FE
O25371_HELPY/185-361KIKLDDLKQQFAKVFELN.KLVVVL---GGDLK-ID-..QTLKRLN....NA--------------------------LN
B9PUJ6_TOXGO/295-477..NPDVIRHYMLQHFSPE.NMVFVG---VN.VN-HD-..ELCTWLM....RA--------------------------FV
C5AQL6_METEA/203-385.LNRTHAIDYYKRFYTPE.NAILVV---AGDVT-PD-..EVRRLAE....DT--------------------------YG
F4HNU6_ARATH/734-916.LSLDDLNSFIPELRSQI.FIEALC---HGNLS-ED-..EAVNI.S....NI--------------------------FK
F4J3D9_ARATH/200-377..TRSELIKFYDEHYSAN.IMHLVV---YGKEN-LD-..KTQGLVE....AL--------------------------FQ
M0ZLN7_SOLTU/259-444.ITRSHLKDYISTHYTAP.RMVIVA---SGPVK-HE-..EFVEQVK....KQ--------------------------FT
M1CRA1_SOLTU/262-448KMTRAHIQDYISTHYGAH.RMVISA---AGAVK-HE-..EVVELVK....KH--------------------------FT
Y2782_MYCTU/179-354.MTRAQLQSFHLRRYTPE.RMVVAA---AGNVD-HD-..GLVALVR....EH--------------------------FG
Q2FZ15_STAA8/181-362DITKDDLYLCYETFYHPS.NMVLFV---VGDVD-PE-..AICRIVK....QH--------------------------ED
Q2FZ16_STAA8/180-353.ITAETLYHTYQSMINND.QCSVYV---VGNVE-PE-..SVEKQIR....EK--------------------------FA
Q76NL8_PLAF7/282-509NLTYEEFKEFYYKNYNPK.KVKVFF---FSKNN-PT-..ELLNFVD....QY--------------------------LG
Q7MXI9_PORGI/690-872KVNYDQVMAFYNERFADAGDFMFFF---IGNLD-EA-..KMKPLIE....TY--------------------------LA
Q89V74_BRADU/167-339.FNRDMLRGYLSTHYRGP.DMVVAA---AGAVD-HS-..QVVAEAE....KR--------------------------FA
Q8DMX5_STRR6/179-350..TPQSSYSCFQEFLAND.RIDFFF---LGDFN-EV-..EIQNVLE....SF--------------------------GF
Q8DMX6_STRR6/187-363.INLTNLQENFTKFYKPV.NMSLFL---VGNFD-VE-..RVQDYFE...SKE--------------------------LK
Q99XH8_STRP1/184-361.ITKILLETHHTYFYQPT.NMSLFI---VGDID-ID-..ETFLAIQ....RF--------------------------QT
U6GTY1_EIMAC/205-387...VDRLRDFHSKYYCGS.NMVAVT---ISPRS-LD-..EQESLIR....EK--------------------------LE

PF03410

Q6TUW3_YMTV5/1-588GKSS-------------------------------------------------------------------------YID
Q6TVT3_ORFSA/1-598NRP.-------------------------------------------------------------------------.AD
Q08FU3_DPV83/1-596GRSN-------------------------------------------------------------------------RLD
Q8V3P7_SWPV1/1-592GKST-------------------------------------------------------------------------FLD
MP44_FOWPN/1-623KRH.-------------------------------------------------------------------------YED
MP44_MYXVL/1-589GRAT-------------------------------------------------------------------------SVD
MP44_MCV1/1-592AED.-------------------------------------------------------------------------YLA
G1_VAR67/1-591SAT.-------------------------------------------------------------------------ESD

PF00675

AXL1_YEAST/34-179AGSK-------------------------------------------------------------------------KYP
IDE_HUMAN/74-212G.TK-------------------------------------------------------------------------KYP
YMXG_BACSU/12-160G.TS-------------------------------------------------------------------------TKS
YQA4_CAEEL/37-175G.TA-------------------------------------------------------------------------KYP
IDE_DROME/47-185G.TE-------------------------------------------------------------------------KYP
MPPA_YEAST/29-176S.TE-------------------------------------------------------------------------HVE
NRDC_RAT/210-348G.SL-------------------------------------------------------------------------KYP
PTRA_ECOLI/54-192G.SK-------------------------------------------------------------------------KYP
QCR1_BOVIN/58-205G.TK-------------------------------------------------------------------------NRP
MPPB_NEUCR/50-198G.TT-------------------------------------------------------------------------KRT
MPPB_RAT/68-215G.TK-------------------------------------------------------------------------KRS
MPPB_YEAST/36-184G.TQ-------------------------------------------------------------------------NRS
QCR2_YEAST/17-163N.TN-------------------------------------------------------------------------TRS
PQQL_HAEIN/45-188G.SK-------------------------------------------------------------------------KYP
UCR1_CAEEL/48-195G.TG-------------------------------------------------------------------------KRA
MPPA_SOLTU/85-231S.TL-------------------------------------------------------------------------NRS
MPPA_NEUCR/62-209S.TS-------------------------------------------------------------------------TRT
PQQL_ECOLI/46-204G.TK-------------------------------------------------------------------------TWP
MPPA_HUMAN/77-227S.TA-------------------------------------------------------------------------RFD
QCR2_BOVIN/48-194T.TK-------------------------------------------------------------------------GAS
QCR1_YEAST/37-182K...-------------------------------------------------------------------------.EN
A6T9H3_KLEP7/17-153G.GE-------------------------------------------------------------------------RYQ
Q4K4V3_PSEF5/19-156G.TE-------------------------------------------------------------------------RFP
U6GTY1_EIMAC/46-182G.TS-------------------------------------------------------------------------KYP

PF02664

R4KBP6_CLOPA/3-152TPNL..-----------------------------------------------------------------------EPV
R5KFX1_9CLOT/3-152KPNF..-----------------------------------------------------------------------EPV
R5PX34_9BACT/3-152EPNR..-----------------------------------------------------------------------EPA
R6C8S4_9CLOT/3-152SPNE..-----------------------------------------------------------------------EPV
R6PKX1_9FIRM/2-152RPNI..-----------------------------------------------------------------------EPP
X2H624_9GAMM/3-155IPN...-----------------------------------------------------------------------KKL
D7CY71_TRURR/20-171QPN...-----------------------------------------------------------------------RAE
R5RBB5_9FIRM/3-152SPNE..-----------------------------------------------------------------------EPV
LUXS_WOLSU/3-156RPN...-----------------------------------------------------------------------QEI
LUXS_LEUMM/6-151QPN...-----------------------------------------------------------------------ETS
C4Z400_EUBE2/3-154RPNE..-----------------------------------------------------------------------EPP
D5V4X1_ARCNC/3-156VPN...-----------------------------------------------------------------------KDM
LUXS_STRSY/6-152QPN...-----------------------------------------------------------------------ENA
R6HDC0_9CLOT/3-145KPNT..-----------------------------------------------------------------------PPF
R5YRN6_9FIRM/3-151RPNY..-----------------------------------------------------------------------EPV
LUXS_PORGI/3-152EPNR..-----------------------------------------------------------------------EPV
E6TVC8_BACCJ/6-152QPN...-----------------------------------------------------------------------KEH
R7HNK7_9BACT/3-153EPNR..-----------------------------------------------------------------------EPA
G9WH82_9LACT/3-148QPN...-----------------------------------------------------------------------ETA
LUXS_SULDN/3-156APN...-----------------------------------------------------------------------KEI
LUXS_BORBU/3-151APNI..-----------------------------------------------------------------------EPI
LUXS_HALH3/5-151QPN...-----------------------------------------------------------------------QEH
F2FAS1_SOLSS/7-150QPN...-----------------------------------------------------------------------KEH
B9L8B0_NAUPA/3-151KPN...-----------------------------------------------------------------------EEI
A9KLE6_CLOPH/4-152RPNF..-----------------------------------------------------------------------EPV
R6ITR1_9FIRM/3-144KPNC..-----------------------------------------------------------------------GDY
R6DD03_9FIRM/3-147KPNT..-----------------------------------------------------------------------GDL
D6XTF8_BACIE/6-147QPN...-----------------------------------------------------------------------KAH
U5RPD3_9CLOT/3-152RPNF..-----------------------------------------------------------------------EPV
C7MPF8_CRYCD/3-154APNR..-----------------------------------------------------------------------EPV
R7IRY5_9FIRM/3-152RPNY..-----------------------------------------------------------------------EPV
R6PNN5_9FIRM/2-151EPNR..-----------------------------------------------------------------------EMV
E4TXP8_SULKY/3-156KPN...-----------------------------------------------------------------------EKT
R5WFL1_9CLOT/3-152RPNF..-----------------------------------------------------------------------EPV
R6C5U0_9BACT/3-152VPNQ..-----------------------------------------------------------------------EPC
LUXS_STAA8/5-151QPN...-----------------------------------------------------------------------KEH
E3HCL4_ILYPC/3-153RPNL..-----------------------------------------------------------------------EPV
R6YLM9_9FIRM/3-152RPNF..-----------------------------------------------------------------------EPV
K4RLT5_HELHE/5-148QPN...-----------------------------------------------------------------------KAH
D2RNA7_ACIFV/6-149QPN...-----------------------------------------------------------------------QQE
E3EF50_PAEPS/3-144QPN...-----------------------------------------------------------------------EDA
R5FL10_9BACT/3-152EPNR..-----------------------------------------------------------------------EPV
E6X176_NITSE/3-156RPN...-----------------------------------------------------------------------EEM
F2JMN8_CELLD/3-147RPNL..-----------------------------------------------------------------------EPV
R6GXR5_9FIRM/3-148APNR..-----------------------------------------------------------------------EPV
C3PK03_CORA7/11-156QPN...-----------------------------------------------------------------------KEH
R5NSS3_9FIRM/3-152RPNY..-----------------------------------------------------------------------EPV
H6LD48_ACEWD/3-152EPNR..-----------------------------------------------------------------------EPV
R6MPS4_9FIRM/7-150KPNG..-----------------------------------------------------------------------GDY
R7MKY1_9FIRM/3-145KPNG..-----------------------------------------------------------------------GRY
LUXS_SHELP/3-156VPN...-----------------------------------------------------------------------KEI
F2NTN2_TRES6/7-150QPN...-----------------------------------------------------------------------KEF
LUXS_CAMJE/3-156IPN...-----------------------------------------------------------------------KDI
R5KBK1_9CLOT/3-152RPNY..-----------------------------------------------------------------------EPV
LUXS_CHRSD/7-153QPN...-----------------------------------------------------------------------KAH
R6TY31_9FIRM/3-145KPNA..-----------------------------------------------------------------------GDY
F2NKV7_MARHT/3-150QPN...-----------------------------------------------------------------------RAV
LUXS_PEDPA/3-148QPN...-----------------------------------------------------------------------ENA
E4UA16_OCEP5/3-147QPN...-----------------------------------------------------------------------REV
R5KTK9_9CLOT/3-145EPNK..-----------------------------------------------------------------------EPV
A5HZR8_CLOBH/3-148QPN...-----------------------------------------------------------------------EEE
R5ED85_9CLOT/3-152RPNY..-----------------------------------------------------------------------EPV
C5ZWA6_9HELI/3-153KPN...-----------------------------------------------------------------------VEI
LUXS_OCEIH/6-147QPN...-----------------------------------------------------------------------KAH
C4L419_EXISA/5-147QPN...-----------------------------------------------------------------------EGL
D2NNT8_ROTMD/39-183QPN...-----------------------------------------------------------------------TAH
R6LCE1_9FIRM/3-152NPNE..-----------------------------------------------------------------------EPV
R5CNL9_9FIRM/3-152APNR..-----------------------------------------------------------------------EPV
R6MQH5_9FIRM/3-145KPNT..-----------------------------------------------------------------------PPF
F9YSB4_CAPCC/3-151LPYR..-----------------------------------------------------------------------EPV
B1HRL0_LYSSC/7-150QPN...-----------------------------------------------------------------------KEH
LUXS_SULNB/3-156KPN...-----------------------------------------------------------------------EER
LUXS_LACLA/3-148QPN...-----------------------------------------------------------------------ANA
I0FCF7_BORCA/3-151TPNK..-----------------------------------------------------------------------EPV
LUXS_HELPY/7-153QPN...-----------------------------------------------------------------------QDH
R6R1H2_9FIRM/3-152MPNR..-----------------------------------------------------------------------EPV
F4BP26_CARS1/6-149QPN...-----------------------------------------------------------------------KEH
F5YFP3_TREAZ/3-151QPNQ..-----------------------------------------------------------------------EPV
LUXS_BACSU/3-154QPN...-----------------------------------------------------------------------KQA
D4KC03_9FIRM/3-145KPNQ..-----------------------------------------------------------------------GDY
R6HYL9_9FIRM/3-148APNR..-----------------------------------------------------------------------EPV
C7NBV6_LEPBD/3-152LPNR..-----------------------------------------------------------------------EPV
LUXS_ACTP2/3-157RPN...-----------------------------------------------------------------------IDI
R6NAG0_9FIRM/3-152SPNE..-----------------------------------------------------------------------EPV
R6RZY0_9FIRM/3-152APNR..-----------------------------------------------------------------------EPV
R7DJC7_9PORP/3-152EPNR..-----------------------------------------------------------------------EPA
E8NGC1_MICTS/3-149QPN...-----------------------------------------------------------------------EGE
G4L3V1_TETHN/3-149QPN...-----------------------------------------------------------------------EKE
LUXS_THICR/3-156KPN...-----------------------------------------------------------------------VDM
R5WY94_9FIRM/3-152SPNE..-----------------------------------------------------------------------EPV
E1STH1_FERBD/3-156LPN...-----------------------------------------------------------------------AEI
R6RGY7_9CLOT/3-152RPNH..-----------------------------------------------------------------------EPV
V5WDC5_9SPIO/3-152EPNR..-----------------------------------------------------------------------EPV
R7FSM8_9FIRM/3-152RPNK..-----------------------------------------------------------------------EPV
E0S2G2_BUTPB/3-152APNK..-----------------------------------------------------------------------EPV
E3GFJ9_EUBLK/3-152EPNR..-----------------------------------------------------------------------EPV
LUXS_CAMC1/3-156KPN...-----------------------------------------------------------------------EEI
LUXS_HAEIN/3-156IPN...-----------------------------------------------------------------------KEI
F8EYR0_TRECH/3-151EPNR..-----------------------------------------------------------------------EPV
R5IHR6_9CLOT/3-148SPNE..-----------------------------------------------------------------------EPV
LUXS_CLOB8/3-152RPNF..-----------------------------------------------------------------------EPT
I6T8S7_ENTHA/4-150QPN...-----------------------------------------------------------------------KEH
E1VUH9_ARTAR/8-152QPN...-----------------------------------------------------------------------HGE
R6MF87_9BACE/3-152EPNR..-----------------------------------------------------------------------EPC
F4LMA9_TREBD/3-152SPND..-----------------------------------------------------------------------EPV
LUXS_HELHP/3-152RPN...-----------------------------------------------------------------------CEL
R7FC53_9FIRM/3-148LPNNAE-----------------------------------------------------------------------GDY
R6A5W4_9BACT/3-149LPNR..-----------------------------------------------------------------------EPA
F4HBP5_GALAU/3-155KPN...-----------------------------------------------------------------------QDN
LUXS_PROAC/6-150QPN...-----------------------------------------------------------------------KEH
G9ALV8_PANAN/3-156RPN...-----------------------------------------------------------------------IDI
LUXS_ECOLI/3-156VPN...-----------------------------------------------------------------------KEV
D3FYW3_BACPE/3-149QPN...-----------------------------------------------------------------------KQA
D9SL03_CLOC7/3-145QPN...-----------------------------------------------------------------------ESA
R6WDX5_9FIRM/3-150SPND..-----------------------------------------------------------------------EPV
LUXS_CAMHC/3-156RPN...-----------------------------------------------------------------------HEI
R5T4J5_9CLOT/3-152RPNY..-----------------------------------------------------------------------EPV
LUXS_DESPS/3-152EPNN..-----------------------------------------------------------------------EPA
D1AKY0_SEBTE/5-153KPNA..-----------------------------------------------------------------------EPV
F8A102_CELGA/6-151QPN...-----------------------------------------------------------------------VAH
F0LWD7_VIBFN/3-156MPN...-----------------------------------------------------------------------KDI
X2HF86_9NEIS/3-156KPN...-----------------------------------------------------------------------QTI
G2TLR1_BACCO/8-154QPN...-----------------------------------------------------------------------KEH
R7LH99_9BACT/3-152LPNR..-----------------------------------------------------------------------EPV
R5GZ39_9FIRM/3-152SPNE..-----------------------------------------------------------------------EPV
R5EUY8_9GAMM/3-152KPN...-----------------------------------------------------------------------QGM
X4RAQ7_9ACTO/5-148QPN...-----------------------------------------------------------------------IEH
R5ZCW6_9FIRM/3-152APNR..-----------------------------------------------------------------------EPV
LUXS_BIFLO/10-155QPN...-----------------------------------------------------------------------EQA
R7EJJ6_9BACE/3-152EPNR..-----------------------------------------------------------------------EPA
W6ETW6_SULMU/3-156KPN...-----------------------------------------------------------------------ETI
LUXS_CLOAB/3-151SPNE..-----------------------------------------------------------------------EPV
R6BK52_9CLOT/3-146TPNA..-----------------------------------------------------------------------GVY
R6PJD2_9CLOT/3-152SPND..-----------------------------------------------------------------------EPV
R6A2L5_9ACTN/3-154TPNK..-----------------------------------------------------------------------EPV
LUXS_AERHH/3-156VPN...-----------------------------------------------------------------------QEI
W0DSV4_9GAMM/3-156RPN...-----------------------------------------------------------------------KDI
LUXS_CAMFF/3-156KPN...-----------------------------------------------------------------------IEI
LUXS_CLOPE/3-144QPN...-----------------------------------------------------------------------KEL
LUXS_HAEDU/3-157RPN...-----------------------------------------------------------------------MEI
D6ZJM3_MOBCV/7-149QPN...-----------------------------------------------------------------------VEH
I1YS81_PREI7/3-152EPNR..-----------------------------------------------------------------------EPA
R5PFW0_9BACT/3-151APNR..-----------------------------------------------------------------------EPA
R5EUU6_9FIRM/3-151KPND..-----------------------------------------------------------------------EPV
R5D5F7_9FIRM/3-152TPNK..-----------------------------------------------------------------------EPV
W5XUN8_9CORY/9-154QPN...-----------------------------------------------------------------------SEH
R5L929_9FIRM/3-152RPNY..-----------------------------------------------------------------------EPV
LUXS_DEIRA/6-150QPN...-----------------------------------------------------------------------QGA
R6UZ21_9FIRM/3-147KPNY..-----------------------------------------------------------------------GTY
X4ZFG7_9BACL/3-145QPN...-----------------------------------------------------------------------TDA
R5UP43_9PORP/3-152EPNR..-----------------------------------------------------------------------EPA
D7BBC0_MEISD/6-153QPN...-----------------------------------------------------------------------QEI
A5N8G9_CLOK5/3-154RPNF..-----------------------------------------------------------------------EPV
D7GDL7_PROFC/6-150QPN...-----------------------------------------------------------------------VNH
LUXS_LISMO/6-150QPN...-----------------------------------------------------------------------KEH
LUXS_FINM2/3-149APNR..-----------------------------------------------------------------------EPV
R5U9A0_9FIRM/3-152NPNE..-----------------------------------------------------------------------EPV
R6FMJ5_9FIRM/3-152RPNF..-----------------------------------------------------------------------EPV
R5QFC8_9FIRM/3-152SPND..-----------------------------------------------------------------------EPV
R6UMD9_9CLOT/3-146KPNN..-----------------------------------------------------------------------GNY
R7I6H9_9CLOT/3-150RPNF..-----------------------------------------------------------------------EPV
R7J0C3_9BACT/3-152APNR..-----------------------------------------------------------------------EPA
A6Q5E8_NITSB/3-156HPN...-----------------------------------------------------------------------KEI

PF05193

MPPA_SCHPO/216-408HLPSSSLPP................................................................LEAIPSH
QCR1_MOUSE/210-395SVSRV........................................................................YEE
IDE_HUMAN/236-418EVENKNV.....................................................................PLPE
IDE_HUMAN/706-889TLIEHAHTK.................................................................PLLPSQ
YMFH_BACSU/182-363KKPYTD.......................................................................QPE
YMXG_BACSU/165-338SYEA.........................................................................KGK
YQA4_CAEEL/603-787DILKSVAPN................................................................SRPLKRD
QCR2_MOUSE/199-378MRGGLGLAGA..............................................................KAKYRGGE
YQA4_CAEEL/200-382SFKFDAIKN................................................................TRKERKI
PREP1_ARATH/301-489MFEASPSP..................................................................NSSKIK
IDE_DROME/209-391EIENKNV....................................................................KVPGW
Q9YFN7_AERPE/166-342QLE.............................................................................
IDE_DROME/679-863RLEATNASK.................................................................LPILAR
Q9RRH6_DEIRA/141-315GWP..........................................................................SGT
PQQL_ECOLI/206-388KLPANK.......................................................................AAE
Q9X167_THEMA/162-335ELERNK.......................................................................PGD
Q9I6C2_PSEAE/203-388EIPWR........................................................................QLP
MPPB_SCHPO/185-372HLEPSAEQLS..............................................................LGAPRGLK
PXM16_ARATH/666-854DVLFN........................................................................DPK
Q9KUG7_VIBCH/219-398SIPK.........................................................................GPD
O50511_STRCO/185-366SIASH........................................................................DGK
PTRA_ECOLI/681-858QLGA.........................................................................DGS
MPPB_NEUCR/203-391KLPATAP....................................................................VSSAS
Q9RRH5_DEIRA/126-298DWQ..........................................................................PGE
QCR2_NEUCR/198-375GVPATSSGN................................................................LNTA...
Q985V3_RHILO/166-339GFRS.........................................................................KAD
Q9FJT9_ARATH/639-833GIPKPPQPV................................................................LNFNRDD
Q23295_CAEEL/192-374ELKHGDSST................................................................EFVP...
CYM1_YEAST/735-911RLPHGSCL...................................................................PNGPK
O67308_AQUAE/184-360KEEGR........................................................................PVP
O84812_CHLTR/225-408EIPISAQ....................................................................YTPQK
P73670_SYNY3/182-362HFGVRSECPP..............................................................TTRLPNHP
Q9VP94_DROME/242-425DIPTSQQNS................................................................IDVSQLN
Q97II7_CLOAB/206-391DFNKKNI....................................................................DADIK
YPD1_CAEEL/194-376TVPDH........................................................................FPK
Q9VYT3_DROME/284-473GIPHNEVKA................................................................PDLSSFN
MPPA_HUMAN/232-431GVQPAW......................................................................GSAE
MPPA_YEAST/181-374DWQ..........................................................................STH
Q9VFF0_DROME/203-385GLEASVL....................................................................PA...
MPPB_YEAST/189-380HVPKSE.......................................................................SPV
O83069_TREPA/199-385KFSARKA....................................................................LPPIP
O25656_HELPY/198-379SLKNLDEKAI..............................................................PTPYMKEP
Y228_BORBU/711-879LKESLE.......................................................................ESN
Q9A579_CAUCR/219-397DIA..........................................................................SGP
MPPA2_ARATH/235-419DLPNVPR....................................................................PAEPK
PXM16_ARATH/198-379EIQNTNK.....................................................................VVPR
Q9PF62_XYLFA/244-422DIPAGPP.....................................................................VAHQ
Q9CE72_LACLA/168-341DFNFTD.......................................................................RAV
Q9RWP9_DEIRA/229-413HFQRQDLDV................................................................SIPD...
PTRA_ECOLI/213-396RVPNKES.....................................................................KKPE
Q97IL0_CLOAB/163-340LSK..........................................................................REK
Q17593_CAEEL/199-381DAIQNKKAE................................................................SKVW...
Q9A2H7_CAUCR/672-850GWKKPATPP................................................................PAPPAAP
Q9A531_CAUCR/720-903ALPARPG.....................................................................DPPL
Q9HT96_PSEAE/190-362TLEDHE.......................................................................LPE
Q9I6C3_PSEAE/229-405ALP..........................................................................QGP
STE23_YEAST/246-428DVANNGR.....................................................................EVPL
Q9KUG7_VIBCH/686-864DWKG.........................................................................EAA
Q9KQC8_VIBCH/661-839VQGQTYEESL..............................................................RPLVMLGK
PQQL_HAEIN/205-388QENPIT.......................................................................KTT
MPPA_SOLTU/236-422DLPKVAT....................................................................IEEPK
YAN2_SCHPO/193-378EILANGIITP..............................................................PTWTRPWC
NRDC_HUMAN/837-1020KLNFK.PLE.................................................................QEMPVQ
O84831_CHLTR/201-385RVG..........................................................................KVE
Q9A579_CAUCR/657-835GWT..........................................................................GAQ
Q9FIH8_ARATH/360-598KNGLDNESTPSSPSPGAFGAMANFLVPKLPAGL................GGTFSNEKTNTADQSKMIKRERHAIRPPVEH
Q9A531_CAUCR/246-428DWVGKG......................................................................PNGK
CYM1_YEAST/221-407GYGKRARK...................................................................DKLLM
Q97EV0_CLOAB/207-392NYDRIEV....................................................................DSKIE
Q9VYT3_DROME/769-953RLNCK........................................................................QIR
QCR1_YEAST/187-370LQT..........................................................................GTK
Q9VP94_DROME/724-907TYKSEKLDN................................................................LSALDNH
O67945_AQUAE/183-355DIP..........................................................................KGK
Q9KRD3_VIBCH/199-378SWKKGSTEKP..............................................................ASIYH...
Q9FIH8_ARATH/928-1156TVKASHDSA.................................................................KPPGSE
MU138_SCHPO/668-850LIDPKPV.....................................................................FASQ
NRDC_HUMAN/361-548QIPNNGLP..................................................................RPNFGH
P74016_SYNY3/241-420NWQGSG.......................................................................TVP
MU138_SCHPO/196-378PIKNKAV.....................................................................PIPK
Q55159_SYNY3/175-359DCYRVKSPS.................................................................QTLMPP
MPPA1_ARATH/239-423DLP..........................................................................NVP
O50512_STRCO/190-374AWTGS........................................................................AAE
PQQL_HAEIN/680-857SIES.........................................................................KTQ
O84831_CHLTR/717-886LLDERL......................................................................EGGE
Q9KA85_BACHD/165-338QVK..........................................................................PTT
P74305_SYNY3/274-453RFP..........................................................................QRP
Q9CML5_PASMU/205-388SINSHS.......................................................................TSP
MPPB_HUMAN/220-404DSLC.........................................................................THK
Y219_RICPR/168-341SLKQ.........................................................................GVK
O51486_BORBU/686-867NLNFKE.......................................................................INE
Q9A308_CAUCR/166-339DLP..........................................................................ATP
Q9KA98_BACHD/181-363KKEFKP.......................................................................AGD
PQQF_PSEAE/179-352DLPGR........................................................................APG
YO098_YEAST/193-378EIPSNIPKK................................................................RPFLDNK
YHJJ_ECOLI/199-378ELKG.........................................................................KRE
Q9KQC8_VIBCH/196-377AIPNPQ......................................................................RDIK
Q983M8_RHILO/208-384DLP..........................................................................QNQ
Q9RTZ9_DEIRA/246-424KVRRPW.......................................................................RTL
Y4WA_RHISN/251-435TLPRGP.......................................................................DLP
Y4WB_RHISN/198-374GLP..........................................................................AGP
MPPA_NEUCR/214-475DMKASDAPGLSRTGSETSVDSLVSESSEASSESSSSSSDSSESSGGLLSKLFSPKAKKATPNPFLTRVPISTEDLTRPAH
P73669_SYNY3/171-348DWV..........................................................................IPE
Q9CE73_LACLA/164-346KKD..........................................................................FAD
Q9KRD3_VIBCH/671-849SIPLS........................................................................KGT
Q9RTZ9_DEIRA/703-883GFDS.........................................................................AVK
UCR1_CAEEL/200-386DLSNEY.......................................................................PRK
Q9PF62_XYLFA/714-895DWQAPS.......................................................................TIK
MPPA_RAT/231-430GVQPAWG.....................................................................APGA
O51486_BORBU/206-392SWKN.........................................................................PTD
PQQL_ECOLI/683-863SIKHSD.......................................................................SPL
O16249_CAEEL/747-931VLK.SAAPNS..............................................................RPLYRNEH
Q97LA3_CLOAB/174-348EFKND........................................................................NEK
Q983M9_RHILO/206-390KVARGP.......................................................................DLP
Q9A2H7_CAUCR/210-390SLTTPA.......................................................................GAI
O16249_CAEEL/258-440TLEFDAIEN................................................................KKVERKV
Q97GF6_CLOAB/170-348DWN..........................................................................KGE
PREP_DROME/268-457DQSWVDNSY................................................................SLIRQQE
STE23_YEAST/716-898SLIPNNIHN................................................................LQVSNNR
Y228_BORBU/195-380RPYKKEK....................................................................SNVNI
Q9CML5_PASMU/680-857SVEV.........................................................................KHS
Q9KA97_BACHD/184-365KLA...TYQ.................................................................KEAKTD
Y5738_STRCO/198-380KSGALKD....................................................................PAAQP
O25371_HELPY/185-361FLP..........................................................................QGK
B9PUJ6_TOXGO/295-477DYN..........................................................................AIP
C5AQL6_METEA/203-385RVTPQG.......................................................................ARP
F4HNU6_ARATH/734-916DSLTVEPLPS...............................................................KCRHGEQ
F4J3D9_ARATH/200-377GIRNT........................................................................NQG
M0ZLN7_SOLTU/259-444KLSTNP.......................................................................TTA
M1CRA1_SOLTU/262-448KLSSNP.......................................................................ITT
Y2782_MYCTU/179-354SRLVRGR.....................................................................RPVA
Q2FZ15_STAA8/181-362ARNKVN.......................................................................QPK
Q2FZ16_STAA8/180-353LKPFDKH.....................................................................QFQH
Q76NL8_PLAF7/282-509QLDYSK.......................................................................YRD
Q7MXI9_PORGI/690-872SLPNLK.......................................................................RGD
Q89V74_BRADU/167-339SFEGTP.......................................................................GPK
Q8DMX5_STRR6/179-350KGRKG..........................................................................D
Q8DMX6_STRR6/187-363DSD..........................................................................FQE
Q99XH8_STRP1/184-361TLSYPD..........................................................................
U6GTY1_EIMAC/205-387GISAGHADWLG.............................................................MVQCPGPM

PF03410

Q6TUW3_YMTV5/1-588SVNTLISWFFINN.KL----RDS---------FLLSNVKNHIKELENEY-------------------------------
Q6TVT3_ORFSA/1-598AVRELASWFFDGG.GL----RTN---------FENVDIRAYAKELENEY-------------------------------
Q08FU3_DPV83/1-596AIKTLISWFFTGNGRI----KDI---------FTPTKIKDHIKELENEY-------------------------------
Q8V3P7_SWPV1/1-592SVKRLISWFFYKD.KI----RDS---------FSISKIKYHIKELENEY-------------------------------
MP44_FOWPN/1-623AIRTAISWFFDKKYIL----KTD---------FSRIVLENYITELENEY-------------------------------
MP44_MYXVL/1-589AVRTLISWFFDKD.GL----KDD---------FPVSKIKYHIKELENEY-------------------------------
MP44_MCV1/1-592ALETAVSWFFARG.AL----RTD---------FSRVRIRNYVRELENEY-------------------------------
G1_VAR67/1-591AIRTLVSWFFSNG.KL----KDN---------FSLSSIRFHIKELENEY-------------------------------

PF00675

AXL1_YEAST/34-179DPGLFHTLIAKNNGSQ....NAF---------TTGEQTTFYFELPNTQN-------------------------------
IDE_HUMAN/74-212KENEYSQFLSEHAGSS....NAF---------TSGEHTNYYFDVSHEH.-------------------------------
YMXG_BACSU/12-160A.REIAESFDRIGGQV....NAF---------TSKEYTCYYAKVLDEH.-------------------------------
YQA4_CAEEL/37-175SEREYFKYLAANNGDS....NAY---------TDTDHTNYSFEVRSEK.-------------------------------
IDE_DROME/47-185HENGYTTYLSQSGGSS....NAA---------TYPLMTKYHFHVAPDK.-------------------------------
MPPA_YEAST/29-176G.RAMAETLELLGGNY....QCT---------SSRENLMYQASVFNQD.-------------------------------
NRDC_RAT/210-348DENGFDAFLKKHGGSD....NAS---------TDCERTVFQFDVQRKY.-------------------------------
PTRA_ECOLI/54-192QADSLAEYLKMHGGSH....NAS---------TAPYRTAFYLEVENDA.-------------------------------
QCR1_BOVIN/58-205G.NALEKEVESMGAHL....NAY---------STREHTAYYIKALSKD.-------------------------------
MPPB_NEUCR/50-198Q.QQLELEIENMGAHL....NAY---------TSRENTVYFAKALNED.-------------------------------
MPPB_RAT/68-215Q.LDLELEIENMGAHL....NAY---------TSREQTVYYAKAFSKD.-------------------------------
MPPB_YEAST/36-184Q.QGIELEIENIGSHL....NAY---------TSRENTVYYAKSLQED.-------------------------------
QCR2_YEAST/17-163A.LKLVRESELLGGTF....KST---------LDREYITLKATFLKDD.-------------------------------
PQQL_HAEIN/45-188E.NQIINALEKLGMKFARDINAF---------TDFENTVYTLNLDSNNQ-------------------------------
UCR1_CAEEL/48-195S.AALESELNAIGAKL....NSF---------TERDQTAVFVQAGAQD.-------------------------------
MPPA_SOLTU/85-231H.LRIVREIEAIGGNV....TAS---------ASREHMIYTYDALKTY.-------------------------------
MPPA_NEUCR/62-209A.DEMLETVEKLGGNI....QCA---------SSRESMMYQAATFNKA.-------------------------------
PQQL_ECOLI/46-204G.NKVIETFESMGLRFGRDVNAY---------TSYDETVYQVSLPTTQK-------------------------------
MPPA_HUMAN/77-227SKDEILLTLEKHGGIC....DCQ---------TSRDTTMYAVSADSKG.-------------------------------
QCR2_BOVIN/48-194S.FKITRGIEAVGGKL....SVT---------STRENMAYTVECLRDD.-------------------------------
QCR1_YEAST/37-182S.....AVAAKEGLAL....SSN---------ISRDFQSYIVSSLPGS.-------------------------------
A6T9H3_KLEP7/17-153DDDRLMGWVQRQGGSV....NAT---------TLARHSAFFFEVAADA.-------------------------------
Q4K4V3_PSEF5/19-156VEQGLMAYVRAQGGQL....NAR---------TCERATEFFFELPASA.-------------------------------
U6GTY1_EIMAC/46-182EPESYDSFLTQNGGAN....NAY---------TDEEKTVFFNKVTDSA.-------------------------------

PF02664

R4KBP6_CLOPA/3-152LNTAEIHAIEHLAATYL-RNDKD---------.IS.AKTIYFGPMGCRT-------------------------------
R5KFX1_9CLOT/3-152MNTAEIHTIEHLAATYL-RNHED---------.YK.DKVIYFGPMGCRT-------------------------------
R5PX34_9BACT/3-152LHPGALHTIEHLAATYL-RNDSE---------.WK.DSIVYWGPMGCLT-------------------------------
R6C8S4_9CLOT/3-152MNTAEVHTIEHLAATFL-RNHKS---------.YK.DKTIYFGPMGCRT-------------------------------
R6PKX1_9FIRM/2-152VDIPAIHTLEHLLAVYL-RSDES---------GWA.DKVIYVGPMGCRT-------------------------------
X2H624_9GAMM/3-155LPEKGIHTLEHLFAGFM-RDHLN---------SEQ.VEIIDISPMGCRT-------------------------------
D7CY71_TRURR/20-171LPTAALHTLEHLLAGYL-RGALE---------GLEGVQLVDASPMGCRT-------------------------------
R5RBB5_9FIRM/3-152MNTAEVHTIEHLGATFL-RNHPE---------.FG.SQVVYFGPMGCRT-------------------------------
LUXS_WOLSU/3-156LSEKGIHTLEHLFAGFM-REHLN---------GEG.IEIIDISPMGCRT-------------------------------
LUXS_LEUMM/6-151IETGGLHTLEHLFAGLV-RDEID---------G.....IIDMSPFGCRT-------------------------------
C4Z400_EUBE2/3-154MDTPGIHSIEHLVATFL-RNHAE---------.WA.EKTIYFGPMGCRT-------------------------------
D5V4X1_ARCNC/3-156MSEKGIHTLEHLFAGFI-REHLN---------SPT.VEIIDVSPMGCRT-------------------------------
LUXS_STRSY/6-152MDTAGLHTIEHLLAKLI-RQRID---------G.....LIDCSPFGCRT-------------------------------
R6HDC0_9CLOT/3-145LENAGLHSFEHLLATFM-RNSDY---------S...KNIVYVGPMGCRT-------------------------------
R5YRN6_9FIRM/3-151MNTAEIHTIEHLGATYL-RNNFE---------.WG.DKTIYFGPMGCRT-------------------------------
LUXS_PORGI/3-152LGAPELHTIEHLAATYL-RNHPL---------.YK.DRIVFWGPMGCLT-------------------------------
E6TVC8_BACCJ/6-152MKMPGLHSLEHLMAELS-RNHHS---------Q.....IVDISPMGCQT-------------------------------
R7HNK7_9BACT/3-153VSQSALHTIEHLAATFL-RNHKQ---------.WK.DKIVYWGPMGCCT-------------------------------
G9WH82_9LACT/3-148IETAGIHTLEHLFADLM-RNRLD---------G.....IIDISPFGCRT-------------------------------
LUXS_SULDN/3-156LSSEGIHTLEHLFAGFM-RDHLN---------SKD.VEIIDISPMGCRT-------------------------------
LUXS_BORBU/3-151IENAAIHTIEHIGATLL-RNNEV---------.WT.EKIVYFGPMGCRT-------------------------------
LUXS_HALH3/5-151MDMPALHSLEHLMAENS-RNHHD---------R.....IIDIGPMGCQT-------------------------------
F2FAS1_SOLSS/7-150MEMPALHSLEHLMADRI-RNHSD---------A.....VVDISPMGCQT-------------------------------
B9L8B0_NAUPA/3-151IDERAMHTLEHLFAGYM-RDNLS---------N...YEIIDISPMGCRT-------------------------------
A9KLE6_CLOPH/4-152MNTAEMHAIEHLAATFL-RNHAV---------.FG.SKIIYFGPMGCRT-------------------------------
R6ITR1_9FIRM/3-144MDNITMHSMEHMLATFL-RNSDA---------A...DDVIYFGPMGCRT-------------------------------
R6DD03_9FIRM/3-147LTNAEMHSVEHVIATLL-RNSPE---------K...DAVVYFGPMGCQT-------------------------------
D6XTF8_BACIE/6-147MDMPALHSLEHMLAEFS-RNHHE---------G.....IIDVGPMGCQT-------------------------------
U5RPD3_9CLOT/3-152MNTAEVHTIEHLGATFL-RNHKV---------.YG.SKTVYFGPMGCRT-------------------------------
C7MPF8_CRYCD/3-154MDTAAVHCLEHLGATFM-RNDAE---------.WG.SRIVYFGPMGCRT-------------------------------
R7IRY5_9FIRM/3-152MNTAEVHTIEHLAATFL-RNHPQ---------.YK.EKCVYFGPMGCRT-------------------------------
R6PNN5_9FIRM/2-151MDTSVMHTIEHLMATFF-RGHDQ---------.WA.DQTIYVGPMGCRT-------------------------------
E4TXP8_SULKY/3-156LSPEGIHTLEHLFAGFM-RDHLN---------SDS.TEIIDISPMGCRT-------------------------------
R5WFL1_9CLOT/3-152MNTAEIHTIEHLGATFL-RNHEE---------.WG.DRIVYFGPMGCRT-------------------------------
R6C5U0_9BACT/3-152LHNGAIHTIEHLAATYL-RNDEE---------.WK.DRIIYWGPMGCLT-------------------------------
LUXS_STAA8/5-151MDMPGLHSLEHLMAENI-RNHSD---------K.....VVDLSPMGCQT-------------------------------
E3HCL4_ILYPC/3-153INNGELHTIEHLAATFL-RNHEV---------.WD.EKTVYFGPMGCRT-------------------------------
R6YLM9_9FIRM/3-152MNTAEIHAIEHLGATFL-RNHDT---------.MG.EKVVYFGPMGCRT-------------------------------
K4RLT5_HELHE/5-148MDMPSLHSLEHLVAELI-RNHAD---------Y.....VLDFSPMGCQT-------------------------------
D2RNA7_ACIFV/6-149IPTGGMHTLEHLLALYL-RPRIK---------G.....YLDCSPFGCRT-------------------------------
E3EF50_PAEPS/3-144LPTAAVHTLEHLLATYL-RDEIK---------G.....IIDISPMGCRT-------------------------------
R5FL10_9BACT/3-152MHPGALHTIEHLAATFL-RNDAE---------.WK.DRVIYWGPMGCLT-------------------------------
E6X176_NITSE/3-156MSEKGIHTLEHLFAGFM-REHLN---------REG.VEIIDISPMGCRT-------------------------------
F2JMN8_CELLD/3-147LNTAEIHAIEHIGATFL-RNHPT---------.FA.DETIYFGPMGCRT-------------------------------
R6GXR5_9FIRM/3-148MNTAELHTIEHLAATYL-RNNDE---------.WK.EKVIYFGPMGCRT-------------------------------
C3PK03_CORA7/11-156LGTEALHSVEHMMANFM-RNYTD---------K.....LIGFAPMGCRT-------------------------------
R5NSS3_9FIRM/3-152MNTAEVHTLEHLGATFL-RNHEK---------.YS.DKVIYFGPMGCRT-------------------------------
H6LD48_ACEWD/3-152INNAELHAMEHLGATFL-RNDPD---------.RS.EQIVYFGPMGCRT-------------------------------
R6MPS4_9FIRM/7-150LSNGALHTFEHLFATYA-RNSRF---------S...GSVLYVGPMGCRT-------------------------------
R7MKY1_9FIRM/3-145LEYPAIHTIEHLFATYA-RNTEF---------S...DNIIYVGPMGCRT-------------------------------
LUXS_SHELP/3-156LSERGIHTLEHLFAGFM-RDHLN---------SDR.VEIIDISPMGCRT-------------------------------
F2NTN2_TRES6/7-150MPTGAIHTLEHLVAEYI-RDELP---------RI....VIDFSPMGCRT-------------------------------
LUXS_CAMJE/3-156MSEKGTHTLEHLFAGFM-RDHLN---------SNS.VEIIDISPMGCRT-------------------------------
R5KBK1_9CLOT/3-152MNTAEVHTIEHLGATFL-RNDKE---------.YG.SKVVYFGPMGCRT-------------------------------
LUXS_CHRSD/7-153MEMPALHSLEHLMAELS-RNHTD---------K.....MLDISPMGCQT-------------------------------
R6TY31_9FIRM/3-145MDNLTMHTVEHMLATFL-RNSEI---------G...GEVIYFGPMGCRT-------------------------------
F2NKV7_MARHT/3-150VPTDALHTLEHLLAGYL-RDHLE---------G.....LVDLSPMGCRT-------------------------------
LUXS_PEDPA/3-148IPTAGLHTIEHLLAGLL-RDRMD---------G.....IIDCSPFGCRT-------------------------------
E4UA16_OCEP5/3-147IGTGAMHTFEHLLAMKM-RDHLE---------G.....IVDVSPMGCRT-------------------------------
R5KTK9_9CLOT/3-145MTNAAMHTIEHIFATYV-RNTEF---------G...DNIIYFGPMGCRT-------------------------------
A5HZR8_CLOBH/3-148MPTGAVHTLEHLLAGYM-REKMD---------N.....IIDISPMGCRT-------------------------------
R5ED85_9CLOT/3-152MNTAEVHTLEHLGATFL-RNHPE---------.WK.EKVIYFGPMGCRT-------------------------------
C5ZWA6_9HELI/3-153LSQEGIHTLEHLFAGFM-REHLN---------SDK.VEIIDISPMGCRT-------------------------------
LUXS_OCEIH/6-147MEMPGLHSLEHLMAENI-RNHSD---------A.....VLDIGPMGCQT-------------------------------
C4L419_EXISA/5-147MPMRAVHSLEHLIAENS-RNHSE---------D.....IVDISPMGCQT-------------------------------
D2NNT8_ROTMD/39-183LEMPTVHSIEHLSAEHM-RNHTD---------R.....LIDFSPMGCQT-------------------------------
R6LCE1_9FIRM/3-152MNTAEVHTIEHLGATFL-RNHRD---------.YA.SKTLYFGPMGCRT-------------------------------
R5CNL9_9FIRM/3-152MNTAELHTIEHLGATFL-RNDPE---------.WK.DRVIYFGPMGCRT-------------------------------
R6MQH5_9FIRM/3-145LPNPVMHTIEHLFATYS-RNSKY---------A...DKVIYFGPMGCRT-------------------------------
F9YSB4_CAPCC/3-151LGAAEIHTIEHLAATWL-RNSS.---------.WK.DKIIYWGPMGCQT-------------------------------
B1HRL0_LYSSC/7-150MEMPALHSLEHLSADII-RNYSD---------H.....IVDFSPMGCQT-------------------------------
LUXS_SULNB/3-156MPSKGIHTLEHLFAGFM-REHLN---------SKK.VEIIDISPMGCRT-------------------------------
LUXS_LACLA/3-148IGMAALHTIEHSMASLI-RDRID---------G.....MIDFSPFGCQT-------------------------------
I0FCF7_BORCA/3-151INNAEIHTIEHIGATLL-RNNKV---------.WG.DKIIYFGPMGCRT-------------------------------
LUXS_HELPY/7-153MDMPSLHSLEHLVAEII-RNHAS---------Y.....VVDWSPMGCQT-------------------------------
R6R1H2_9FIRM/3-152MDTPGIHTIEHLGATFL-RNHPQ---------.WK.DRVIYFGPMGCRT-------------------------------
F4BP26_CARS1/6-149MDMMSVHSLEHLTAELI-RNHAD---------Y.....IIDFGPMGCQT-------------------------------
F5YFP3_TREAZ/3-151IDMPALHTIEHLGATFL-RSHKE---------.WA.KRVVYFGPMGCRT-------------------------------
LUXS_BACSU/3-154MKPDTIHTLEHLLAFTI-RSHAE---------KYDHFDIIDISPMGCQT-------------------------------
D4KC03_9FIRM/3-145LTTAAAHTLEHLFATYA-RNSAV---------K...DGVIYVGPMGCRT-------------------------------
R6HYL9_9FIRM/3-148MNTAEIHTIEHLGATYL-RNDPD---------.WK.DRTVYFGPMGCRT-------------------------------
C7NBV6_LEPBD/3-152INIAELHTMEHLGATFL-RNHPT---------.WK.DEIVYFGPMGCRT-------------------------------
LUXS_ACTP2/3-157LPVRGIHTMEHLFAGFM-RDHLN---------SES.VEIIDISPMGCRT-------------------------------
R6NAG0_9FIRM/3-152MNTAEVHTIEHLGATFL-RNHKD---------.FS.DKVIYFGPMGCRT-------------------------------
R6RZY0_9FIRM/3-152MNTAEMHTMEHLGATFL-RNDPE---------.FG.EKDIYFGPMGCRT-------------------------------
R7DJC7_9PORP/3-152LGYGALHTIEHLAATYL-RNHSI---------.WG.EKIVFWGPMGCCT-------------------------------
E8NGC1_MICTS/3-149IPTAGLHTIEHLLASLV-RDRID---------G.....LIDISPFGCRT-------------------------------
G4L3V1_TETHN/3-149LPTAGMHTIEHLLADLL-RDRLE---------G.....IIDCSPFGCRT-------------------------------
LUXS_THICR/3-156MGEKGIHTLEHLFAGFI-RAHLN---------ADD.VEIIDVSPMGCRT-------------------------------
R5WY94_9FIRM/3-152MNTAELHAMEHLAATFL-RNHTE---------.FG.PKVIYWGPMGCRT-------------------------------
E1STH1_FERBD/3-156LSEKGIHTLEHLFAGFM-RDHLN---------GDS.VEIIDISPMGCRT-------------------------------
R6RGY7_9CLOT/3-152MNTAEIHTIEHLGATFL-RNHKV---------.YK.DRVLYFGPMGCRT-------------------------------
V5WDC5_9SPIO/3-152VDVPALHTIEHLGATFL-RNDTE---------.WK.DEVVYFGPMGCRT-------------------------------
R7FSM8_9FIRM/3-152MNTAEVHTIEHLAATFL-RNHAE---------.YA.DKTIYFGPMGCRT-------------------------------
E0S2G2_BUTPB/3-152MNTAEVHTMEHLGATFL-RNDPE---------.YK.DRTIYFGPMGCRT-------------------------------
E3GFJ9_EUBLK/3-152INTAELHTIEHLGATYL-RNDLE---------.LS.EKIVYFGPMGCRT-------------------------------
LUXS_CAMC1/3-156LPEKGTHTLEHLFAGFM-RNHLN---------GNG.VEIIDISPMGCRT-------------------------------
LUXS_HAEIN/3-156LSPKGIHTLEHLFAGFM-RDHLN---------GDS.IEIIDISPMGCRT-------------------------------
F8EYR0_TRECH/3-151LDVPTSHTIEHLGATFL-RSHPQ---------.WG.SRIVYFGPMGCRT-------------------------------
R5IHR6_9CLOT/3-148MNTAEMHTIEHLGATFL-RNHKD---------.FG.DKTVYFGPMGCRT-------------------------------
LUXS_CLOB8/3-152MNTAEMHAIEHLAATFL-RNHKD---------.YA.DKTVYFGPMGCRT-------------------------------
I6T8S7_ENTHA/4-150MDMPSLHSLEHLTAELI-RNHAD---------Y.....IVDWSPMGCQT-------------------------------
E1VUH9_ARTAR/8-152IPTAGLHTIEHTMAGLL-RTRME---------G.....LIDFSPFGCRT-------------------------------
R6MF87_9BACE/3-152LSPSAIHTMEHLAATFL-RNHPV---------.WA.DKIIYWGPMGCLT-------------------------------
F4LMA9_TREBD/3-152MNTAEIHTIEHLGATFL-RNHPD---------.FK.AKTVYFGPMGCRT-------------------------------
LUXS_HELHP/3-152LSEKGIHTMEHLIAGFM-REHLN---------NTR.VEIIDISPMGCRT-------------------------------
R7FC53_9FIRM/3-148LEDFALHTLEHLFATYV-RNTPA---------S...DQIIYVGPMGCRT-------------------------------
R6A5W4_9BACT/3-149LGQGAIHTIEHLAATFL-RNHPV---------.WK.DRIVYWGPMGCLT-------------------------------
F4HBP5_GALAU/3-155ISPKGIHTLEHLFAGFM-RDHLN---------SDS.VEIIDISPMGCRT-------------------------------
LUXS_PROAC/6-150LDMPAVHSLEHSFAECV-RNHSD---------A.....VIDFGPMGCQT-------------------------------
G9ALV8_PANAN/3-156LTERGIHTLEHLFAGFM-RNHLN---------GNG.VEIVDISPMGCRT-------------------------------
LUXS_ECOLI/3-156MPERGIHTLEHLFAGFM-RNHLN---------GNG.VEIIDISPMGCRT-------------------------------
D3FYW3_BACPE/3-149MKPNVIHTMEHLLALNV-RRFAE---------DYDHFDVIDLSPMGCQT-------------------------------
D9SL03_CLOC7/3-145LPTGAIHTLEHLLAGYM-REKMD---------G.....IIDLSPMGCRT-------------------------------
R6WDX5_9FIRM/3-150MNTAEMHTIEHLAATFL-RNHSE---------.FG.AKTIYFGPMGCRT-------------------------------
LUXS_CAMHC/3-156MSEKGTHTLEHLFAGFM-REHLN---------SKD.VEIIDISPMGCRT-------------------------------
R5T4J5_9CLOT/3-152INTAEIHTIEHLGATFL-RNHRD---------.YG.SRVLYFGPMGCRT-------------------------------
LUXS_DESPS/3-152LDGAASHTIEHIGATFL-RNHKT---------.WA.DRTIYFGPMGCQT-------------------------------
D1AKY0_SEBTE/5-153INIAELHTIEHLGATFL-RNDEE---------.WK.DKVVYFGPMGCRT-------------------------------
F8A102_CELGA/6-151LEMPTVHSLEHLFAEHS-RNHSD---------Q.....VIDFSPMGCQT-------------------------------
F0LWD7_VIBFN/3-156LSEKGIHTLEHLYAGFM-RAHLN---------GAN.VEIIDISPMGCRT-------------------------------
X2HF86_9NEIS/3-156LPEKGMHTIEHLFAGFM-RDHLN---------SDQ.VEIIDISPMGCRT-------------------------------
G2TLR1_BACCO/8-154MDMPGLHSLEHMMAEFA-RNYTD---------K.....IVDISPMGCQT-------------------------------
R7LH99_9BACT/3-152LGQGAIHTIEHLAATFL-RNHPV---------.WK.DRIVYWGPMGCLT-------------------------------
R5GZ39_9FIRM/3-152MNTAEMHTIEHLGATFL-RNHPV---------.YK.DKTIYFGPMGCRT-------------------------------
R5EUY8_9GAMM/3-152MPEKGIHTFEHFFAGFM-REHLN---------EKGVVEVIDISPMGCKT-------------------------------
X4RAQ7_9ACTO/5-148LEMDAVHSIEHSFAEYA-RNHAD---------N.....VVDFSPMGCQT-------------------------------
R5ZCW6_9FIRM/3-152INTAEIHTLEHLGATFL-RNHPD---------.WK.EKVIYFGPMGCRT-------------------------------
LUXS_BIFLO/10-155IPTGGLHTIEHTIAVLL-RERIP---------G.....YIDCSPFGCRT-------------------------------
R7EJJ6_9BACE/3-152LGQGALHTIEHLAATYL-RNDPQ---------.WQ.DKIIYWGPMGCLT-------------------------------
W6ETW6_SULMU/3-156LPERGIHTLEHLFAGFM-RNHLN---------GEG.VEIIDISPMGCRT-------------------------------
LUXS_CLOAB/3-151MNTAEVHTIEHLGATFL-RNHGT---------.YA.EKTVYFGPMGCRT-------------------------------
R6BK52_9CLOT/3-146LENDGIHTFEHLFATYV-RNTAD---------S...DNILYVGPMGCRT-------------------------------
R6PJD2_9CLOT/3-152MNTAEMHAIEHLAATFL-RNHPV---------.FG.NKIIYFGPMGCRT-------------------------------
R6A2L5_9ACTN/3-154MNTAECHTIEHLGATFL-RNHAE---------.WS.SRIVYFGPMGCRT-------------------------------
LUXS_AERHH/3-156LSERGIHTLEHLFAGFM-RDHLN---------GNG.VEIIDISPMGCRT-------------------------------
W0DSV4_9GAMM/3-156LGERGIHTLEHLFAGFI-RQHLN---------GDG.VEIIDVSPMGCRT-------------------------------
LUXS_CAMFF/3-156LPQKGTHTLEHLFAGFM-RDHLN---------NND.VEIIDISPMGCRT-------------------------------
LUXS_CLOPE/3-144LSDKGMHTLEHFLAGFM-REKLD---------D.....VIDISPMGCKT-------------------------------
LUXS_HAEDU/3-157MSSKGIHTLEHLYAGFM-RDHLN---------SDK.VEIIDISPMGCRT-------------------------------
D6ZJM3_MOBCV/7-149LDMPVVHSLEHSMAEHM-RDHTD---------K.....LLDFSPMGCQT-------------------------------
I1YS81_PREI7/3-152LHIGALHTIEHLAATYL-RNDAE---------.WK.ERVVYWGPMGCLT-------------------------------
R5PFW0_9BACT/3-151LHPGALHTIEHLVATYL-RNNEE---------.WQ.DRIVYWGPMGCLT-------------------------------
R5EUU6_9FIRM/3-151MNTAEVHTIEHLAATYL-RNEPT---------.WK.DKVLYFGPMGCRT-------------------------------
R5D5F7_9FIRM/3-152MNTAEVHTIEHLGATFL-RNHPT---------.YK.DLTIYFGPMGCRT-------------------------------
W5XUN8_9CORY/9-154LEMPTVHSLEHMLAELL-RNHTD---------A.....LIDFSPMGCQT-------------------------------
R5L929_9FIRM/3-152LNTAEVHTIEHLGATFL-RNHPD---------.YR.DKVLYFGPMGCRT-------------------------------
LUXS_DEIRA/6-150IDPAAIHTLEHLLAGYM-RDHLE---------G.....VVDVSPMGCRT-------------------------------
R6UZ21_9FIRM/3-147LDNDGLHTFEHLFATYV-RNSVY---------S...NAVIYAGPMGCRT-------------------------------
X4ZFG7_9BACL/3-145VPTAALHTLEHLLATYL-RDELP---------G.....IIDISPMGCRT-------------------------------
R5UP43_9PORP/3-152IGAGALHTMEHLAATFL-RNHPQ---------.WG.DQIVYWGPMGCAT-------------------------------
D7BBC0_MEISD/6-153LPPQAIHTLEHLLAGYL-RSHIE---------G.....VVDLSPMGCRT-------------------------------
A5N8G9_CLOK5/3-154MNTAELHTIEHLGATFL-RNHSE---------.YG.SKIVYFGPMGCRT-------------------------------
D7GDL7_PROFC/6-150LDMKAVHSVEHSFAECV-RNHSD---------S.....VIDFGPMGCQT-------------------------------
LUXS_LISMO/6-150MEMPALHSLEHLMAELA-RNHTD---------K.....LVDISPMGCQT-------------------------------
LUXS_FINM2/3-149MNTAEVHAIEHLGATFL-RNKLE---------....NEVIYFGPMGCRT-------------------------------
R5U9A0_9FIRM/3-152LNTAEVHTIEHLAATFL-RNHAE---------.YG.PKTLYFGPMGCRT-------------------------------
R6FMJ5_9FIRM/3-152MNTAEVHTIEHLGATFL-RNHKE---------.FS.NKTIYFGPMGCRT-------------------------------
R5QFC8_9FIRM/3-152MNTAEIHTIEHLGATFL-RNHEV---------.YK.DQVIYFGPMGCRT-------------------------------
R6UMD9_9CLOT/3-146LETGALHTVEHLFATYV-RNSPY---------A...DSIIYFGPMGCRT-------------------------------
R7I6H9_9CLOT/3-150MNTAEMHTIEHLAATYL-RNHPD---------.YA.SKTIYFGPMGCRT-------------------------------
R7J0C3_9BACT/3-152ADPRALHTIEHLAATWL-RNNAE---------.WR.DCVVYWGPMGCCT-------------------------------
A6Q5E8_NITSB/3-156MSVKGTHTLEHLFAGFM-RDHLN---------SDT.VEIIDISPMGCRT-------------------------------

PF05193

MPPA_SCHPO/216-408YTGGFMG.I.KKSEAPP.VPYQQ.........E...FTHVVIAMEGLPV...............................
QCR1_MOUSE/210-395DAVPGLTPC.RFTGSEI.RHRDD.........AL.PLAHVAIAVEGPGW...............................
IDE_HUMAN/236-418FPEHPFQEE.HLKQLYK.IVPIK.........D...IRNLYVTFPIPDL...............................
IDE_HUMAN/706-889LVRYREVQL.PDRGWFV.YQQRN.........EVHNNCGIEIYYQTDMQ...............................
YMFH_BACSU/182-363IKREEVKEQ.EAVFRKE.KEIKM.........NV.QGPKCLVGLKSKNPFK............................L
YMXG_BACSU/165-338ATGLEKP...EFHTEKL.TRKKE.........T..EQAHLCLGFKGLEV...............................
YQA4_CAEEL/603-787EHNPHRELQ.LINGHEH.VYRHF.........Q..KTHDVGCVEVAFQIG..............................
QCR2_MOUSE/199-378IREQNGD.........................N...LVHAAIVAESAAI...............................
YQA4_CAEEL/200-382WKDSPFGPD.QLAKRIE.IVPIQ.........N...TGQVSIKFPFPDL...............................
PREP1_ARATH/301-489FQKLFSEPV.RLVEKYP.AGRDG.........DLKKKHMLCVNWLLSEK...............................
IDE_DROME/209-391PRHPYAE.E.RYGQKVK.IVPIK.........D...IRSLTISFTTDDL...............................
Q9YFN7_AERPE/166-342PGGKVREPE.TPEPRTT.FLREE.........RGIEAAYAALTLPLPPR...............................
IDE_DROME/679-863QMLKKREYK.LLAGDSY.LFEKE.........NEFHKSSCAQLYLQCGA...............................
Q9RRH6_DEIRA/141-315PRLPDAAPA.PHWPGQV.RWVTD.........PELTRTQVALALPGLPV...............................
PQQL_ECOLI/206-388NRVWPTK.A.ENHLRFN.IINDKE.......NRV.NGIALYYRLPMVQV...............................
Q9X167_THEMA/162-335PLPPPPSFE.HTEPRYI.VRNDL.........E...QVHIAMARPICGR...............................
Q9I6C2_PSEAE/203-388PARKPLELA.EPGERRL.KLYVR.........T..QLPNLIMGFNVPSLG..............................
MPPB_SCHPO/185-372PRFVGSE...........IRARD.........DDSPTANIAIAVEGMSW...............................
PXM16_ARATH/666-854PICRPLFPS.QHLTNRV.VKLGE.........G....MKYFYHQDGSNPSDENS......................ALVH
Q9KUG7_VIBCH/219-398VVDAPKQPA.RLSEDRF.ITLED.........RV.QQPMLLIGWPTQYW...............................
O50511_STRCO/185-366QPPRDGALP.DVMGGEL.REVVE.........EEVPARALMAAYRLPED...............................
PTRA_ECOLI/681-858EWCRNKDVV.VDKKQSV.IFEKA.........G..NSTDSALAAVFVPT...............................
MPPB_NEUCR/203-391ILSKKKP...DFIGSDI.RIRDD.........TI.PTANIAIAVEGVSW...............................
Q9RRH5_DEIRA/126-298DRPMPAH...FQPGLRL.HLPSA.........TG.EQTHLSLVAPGPGP...............................
QCR2_NEUCR/198-375.......AS.KYFGGEQ.RVAKN.........G...KNAIVIAFPGASL...............................
Q985V3_RHILO/166-339STIPQYA.Q.YVGGDFR.EDRDL.........M...DAQIVLGFEGRAY...............................
Q9FJT9_ARATH/639-833LKGLPFTFP.TKITKEF.VRSPM.........VE.AQCSVQLCFPVQLTN..............................
Q23295_CAEEL/192-374........A.TYSPCEV.RGDIP.........DL.PMLYGAMVVEGVSW...............................
CYM1_YEAST/735-911TSDYPLI.G.SKCKHTL.IKFPF.........Q...VHYTSQALLGVPY...............................
O67308_AQUAE/184-360KVQIPTEPE.QIGIRFK.KLKDP.........RI.EKAYWIIGWRVPAI...............................
O84812_CHLTR/225-408PFPKTQD...TTALNKL.FINKA.........VE.PSPQLAIYWHFYDA...............................
P73670_SYNY3/182-362IQTIKRE........TL.RIPEL.........G...PSRLTMGWNGPGI...............................
Q9VP94_DROME/242-425YQKAFRD...QFYKDVF.LVQPV.........E..DVCKLELTWVLPPM...............................
Q97II7_CLOAB/206-391VNGAFSKVH.EKELEYS.ISEGE.........SENDKTYFGMSFVTGDA...............................
YPD1_CAEEL/194-376PFSFALSDI.KESTVHR.VECPT.........DDASRGAVEVAWFAHSP...............................
Q9VYT3_DROME/284-473YKDAFKA...EFHEQVF.FVKPV.........E..NETKLELTWVLPNV...............................
MPPA_HUMAN/232-431AVDIDRSVA.QYTGGIA.KLERDMSNVSLGPTPIPELTHIMVGLESCSF...............................
MPPA_YEAST/181-374PP.ITKKVA.QYTGGES.CIPPAPV.....FGNLPELFHIQIGFEGLPI...............................
Q9VFF0_DROME/203-385....EVTPC.RFTGSEV.RVRDD.........SL.PLAHVAIAVEGCGW...............................
MPPB_YEAST/189-380PLGSPRGPL.PVFCRGE.RFIKE.........NTLPTTHIAIALEGVSW...............................
O83069_TREPA/199-385PIPAYQSPR.TYTGYAP.ASEGM.........DL.TRCAVLLSWLLPES...............................
O25656_HELPY/198-379KQDGART...........AVVHK.........DGVHLEWVALGYKVPAF...............................
Y228_BORBU/711-879HYNGLLNLD.ANSKALR.EIIII.........QS.KVAFNAICFPSYKI...............................
Q9A579_CAUCR/219-397PVTRQKEWI.AKRTGSQ.RAEMQ.........DRVPQTRIYKVWNTPGF...............................
MPPA2_ARATH/235-419SQYVGGD...........FRQHT.........GG.EATHFALAFEVPGW...............................
PXM16_ARATH/198-379FPGQPCTAD.HLQILVK.AIPIK.........Q...GHKLGVSWPVTPS...............................
Q9PF62_XYLFA/244-422HPWITPLPA.QKRGVQY.DQVSQ.........P.....RLYRTWITPEL...............................
Q9CE72_LACLA/168-341SKEISYQ.Q.SLTESSV.VTDEK.........EV.AQSILQFAYQMPIA...............................
Q9RWP9_DEIRA/229-413....QTNFS.EPRRMDV.SYPGS.........DTERGGQVLLGWKLGYA...............................
PTRA_ECOLI/213-396ITVPVVTDA.QKGIIIH.YVPAL.........PR.KVLRVEFRIDNNSA...............................
Q97IL0_CLOAB/163-340PSLFDYEYE.KN.TSGI.FTSKM.........DV.KGAVIQYLFPIYKL...............................
Q17593_CAEEL/199-381.AEFQYGPD.QLAKKID.VVPIK.........D...KKLVSIIFPFPDL...............................
Q9A2H7_CAUCR/672-850TGYQPRN...........VVIDL.........PGTGQAAVVLAKPAITR...............................
Q9A531_CAUCR/720-903PGAEKAPFP.APSKEPV.IRTHK.........GRPDQAALFMTWRTDDL...............................
Q9HT96_PSEAE/190-362RRELPAANG.HAEARRT.LITRP.........FG.EGAMLHWIYPEPDD...............................
Q9I6C3_PSEAE/229-405ALAKTVQ.P.ETPKPGL.THIDF.........PS.EQTHLMLAQLGIDR...............................
STE23_YEAST/246-428YAEPIMQPE.HLQKIIQ.VRPVK.........D...LKKLEISFTVPDM...............................
Q9KUG7_VIBCH/686-864PLINPQVVP.TLTKQKI.YLVDK.........PGAPQSIIRMVRKGLPF...............................
Q9KQC8_VIBCH/661-839SGTFQRE...........VQCQQ.........D...DSAIVVYYQSHEV...............................
PQQL_HAEIN/205-388LEKIDFNIP.LINKWRL.DSISE.........QGTTIPSIELSFFENTI...............................
MPPA_SOLTU/236-422PVYVGGD...........YRCQA.........DA.EMTHFALAFEVPGG...............................
YAN2_SCHPO/193-378STNVDYTIP.EPILKTV.KFSSE.........DE.YTGSVSLAWNGPSA...............................
NRDC_HUMAN/837-1020FQVVELPSG.HHLCKVK.ALNKG.........D..ANSEVTVYYQSGTR...............................
O84831_CHLTR/201-385KQSVTLPLQ.KRFKEPV.RVIERYPS...DGADE.DKVLFGLAWLTCSI...............................
Q9A579_CAUCR/657-835AKAKPPITV.APNKGAV.YLIDK.........PGAQQSMLMVGNLVPPR...............................
Q9FIH8_ARATH/360-598NWSLPGTSV.DLKPPQI.FKHEL.........LQ.NFAINMFCKIPVSK...............................
Q9A531_CAUCR/246-428DPDVGPVAK.RGPTAKM.FVEAG.........AP.WSIQMTWTRKPEGLLETK.........................AV
CYM1_YEAST/221-407PIDLKKDID.VKLLGQI.DTMLP.........PE.KQTKASMTWICGAP...............................
Q97EV0_CLOAB/207-392PQKPIGKLV.ESSHEYP.ILQDE.........GEKDKTYLSLNFVVSSP...............................
Q9VYT3_DROME/769-953ERGRFLEDI.TVKLPVG.TSIIRCHA..LNVQDT.NTVITNFYQIGPNT...............................
QCR1_YEAST/187-370PVLKKKA...AFLGSEV.RLRDD.........TL.PKAWISLAVEGEPV...............................
Q9VP94_DROME/724-907LLQIPLG...SYYLRAK.TLNED.........DS.NTIITNYYQIGPSD...............................
O67945_AQUAE/183-355FELSSVN.K.KIEKNEV.KRVKR.........EG.TQATILCAFNAPPK...............................
Q9KRD3_VIBCH/199-378........Q.ALNNQDL.VAPVT.........AG.ESPSLTLIFPQGSAAI.............................
Q9FIH8_ARATH/928-1156PILFRQPTA.GLQFQQV.FLKDT.........D..ERACAYIAGPAPNRWGFTVDGD.................DLFQSV
MU138_SCHPO/668-850LSRKRAIIV.PEGGNYI.YKTVVP......NKEE.KNSAIMYNLQISQL...............................
NRDC_HUMAN/361-548LTDPFDT.P.AFNKLYR.VVPIR.........K...IHALTITWALPPQ...............................
P74016_SYNY3/241-420QLTPPSASQ.VNDSEVF.LVNLP.........HV.TQSNVLLGQIGGMV...............................
MU138_SCHPO/196-378FPDPPYTDN.EVRKICY.VKPVK.........N...LRRLDIVFPIPGQ...............................
Q55159_SYNY3/175-359LVNIPPPFT.KVETTTV.VDDSL.........Q...QARLILLWRSPGL...............................
MPPA1_ARATH/239-423PQLAPKS...QYVGGDF.RQHTG.........G..EATHFAVAFEVPGW...............................
O50512_STRCO/190-374PRPVPPVTA.DDRGRVV.IVDRP.........GA.VQTQLLIGRTGADR...............................
PQQL_HAEIN/680-857IRHFVPTII.HTPTQSF.IMNGL.........KE.PRADVEIYLTADNT...............................
O84831_CHLTR/717-886LWKNPVLDV.VKDSRGI.VIPAR.........G....AYNVLAFPLGSL...............................
Q9KA85_BACHD/165-338YNYQGEKPM.FLPNRIV.RKKET.........E...QAHLCLGYPGLPI...............................
P74305_SYNY3/274-453PTPQVTVVE.PPQTQQK.EINLT.........LP.SQPWYFEGYHSPAF...............................
Q9CML5_PASMU/205-388LPPIDFSIP.FVNQWRV.AGISE.........KGTYIPTLELSFFEKFT...............................
MPPB_HUMAN/220-404GEIPALPPC.KFTGSEI.RVRDD.........KM.PLAHLAIAVEAVGW...............................
Y219_RICPR/168-341SSFIPAK...YIGGKGF.IHKEL.........E...QTSLVLGFECTSY...............................
O51486_BORBU/686-867YKDLDYSYS.KNFNKIV.VRKGK.........NSTSFAYVIYPFKFNYL...............................
Q9A308_CAUCR/166-339GVGLAQSAA.FVGGPQA.EARKL.........E...QAHLVFMLPACGA...............................
Q9KA98_BACHD/181-363IQRFFPAEP.EKVAKPH.SVISM.........SV.QTPKCLVGYKEKQPVR............................Q
PQQF_PSEAE/179-352ASPPPPPLL.PFACEAL.ALRLP.........G...PPRLVLGFALDAL...............................
YO098_YEAST/193-378LSHIPQSRD.KVTESTV.EFPEL.........DE.SQGELLFSWIGVPY...............................
YHJJ_ECOLI/199-378TPAPVPTLS.PLRAEAV.SIMTD.........AV.RQDRLSIMWDTPWQ...............................
Q9KQC8_VIBCH/196-377PLPPFVDRE.HTGILIQ.IEPLK.........E...IRKLILAFPMPST...............................
Q983M8_RHILO/208-384ALTPVADVE.PKLAQRV.EVNYD.........L..PQTSLQLAWPGVKR...............................
Q9RTZ9_DEIRA/246-424PRQYTEENP.QDGERSL.TVRRV.........G..DAQYLIVGYHIPSV...............................
Y4WA_RHISN/251-435ARVRPQEPE.QNTKRIV.ALTDP.........RV.TVPSFQKSWVTTSYG..............................
Y4WB_RHISN/198-374SLTPVVDAV.PKLGRAI.RVAYD.........L..PQAQLSLAYPGIPR...............................
MPPA_NEUCR/214-475YTGGFLT...LPSQPPP.LNPNL.........P..TFTHIQLAFEGLAI...............................
P73669_SYNY3/171-348QSIVCPILT.PLNACPQ.EQLTP.........QATQQSVVLLGYLGVGV...............................
Q9CE73_LACLA/164-346LSEIQRKEI.KASEPIS.GESLE.........LEVAMPKFALGLRGEDQL..............................
Q9KRD3_VIBCH/671-849LSPMTSQLI.KPVAPRL.ELALN.........NE.NSTQYSLRLISETQ...............................
Q9RTZ9_DEIRA/703-883YERVKLPLT.TPAAQDL.VLNVP.........D..KANAIYIAQLNFPL...............................
UCR1_CAEEL/200-386VPQVDGT...RFTGSEY.RYRND.........NV.PHMYAAFAVEGVGY...............................
Q9PF62_XYLFA/714-895SHKQITDVA.AQFKPRI.FLIHR.........PEAQQSLILAGLLAPPT...............................
MPPA_RAT/231-430VWMLTAQWH.STRGGSS.RWRETCQMS.ALRPPRFQSSHIYGGARELLL...............................
O51486_BORBU/206-392KIKEVKVSL.DVELKDK.FLLLE.........DL.EVGEPSLMFFKKEIINF..........................VK
PQQL_ECOLI/683-863AAGKPLTRA.TDNASVT.VKEQN.........EPVAQVSQWKRYDSRTP...............................
O16249_CAEEL/747-931NPRRELQ...LNNGDEY.VYRHL.........Q..KTHDVGCVEVTYQIG..............................
Q97LA3_CLOAB/174-348IEKYSTNYC.PYGEKVV.VNNNV.........NK.NEVKAQFYYLKKDY...............................
Q983M9_RHILO/206-390PRIRPVEPE.QNTKRTV.TLADA.........RV.SVPSFSTQWVVPSYH..............................
Q9A2H7_CAUCR/210-390PKVTAVEPA.RTGPKTV.NTYGP.........NV.PLPALAITWLAPAA...............................
O16249_CAEEL/258-440WEEFPYGPD.QLAKRID.VVPIK.........D...TRLVSISFPFPDL...............................
Q97GF6_CLOAB/170-348VKDKDIIVE.ENIPKIV.TSHRK.........DI.SQSSIIYMFTAYNL...............................
PREP_DROME/268-457RWTQPRL...VHISSRL.DNMGT.........TIDRQNQIAIALLMCDA...............................
STE23_YEAST/716-898LRSYLLP...KGKTFRY.ETALK.........D..SQNVNSCIQHVTQL...............................
Y228_BORBU/195-380NIENVKRWE.KGKKLTY.KIPKE.........NDNSLGVYTINWLCTEI...............................
Q9CML5_PASMU/680-857PRHYYDSSP.ITPANHF.VMHGL.........DE.PRADVEIYFSTPNQ...............................
Q9KA97_BACHD/184-365SVPASIPSP.EVKEARE.VIEKQ.........DV.KQGKLNIGFRAYTT...............................
Y5738_STRCO/198-380LAPRAGRRT.VRAAGRV.ELIGR.........KT.EQAHVILGMPGLAR...............................
O25371_HELPY/185-361AYEEPYFET.SDKKSEK.VLYKD.........T..EQAFVYFGAPFKIK...............................
B9PUJ6_TOXGO/295-477PSKRTVASP.VYTGGDV.RLETP.........S..PHAHMAIAFETPGG...............................
C5AQL6_METEA/203-385LRTRPREPE.PRAMRRI.AVADP.........KV.EQPTLQRLYLTPSCM..............................
F4HNU6_ARATH/734-916ITCFPMG...AKLVRDV.NVKNK.........SE.TNSVVELYYQIEPEE..............................
F4J3D9_ARATH/200-377IPRFPGQPC.TLDHLQV.LVKAV.........PIMQGHELSVSWPVTPS...............................
M0ZLN7_SOLTU/259-444SELVAREPA.IFTGSEV.RVIDD.........DI.PLAQFAVAFQGAPW...............................
M1CRA1_SOLTU/262-448SQLVSEEPA.IFTGSEI.RIIDD.........DL.PLAQFAVAFSGASW...............................
Y2782_MYCTU/179-354PRKGTGR...VNGSPRL.TLVSR.........DA.EQTHVSLGIRTPGR...............................
Q2FZ15_STAA8/181-362IERGLVDEP.EDVKEAF.VTESM.........KI.QSPRLMLGFKNKPLQE............................A
Q2FZ16_STAA8/180-353STHHLHD.....EEVDY.IVEYD.........DV.DQAKLNMGYRFPTQ...............................
Q76NL8_PLAF7/282-509DAVESVEYQ.TYKKGPF.YIKKKYG....DHSEE.KENLVSVAWLLNPKVDKTNNHNNNHSNNQSSENNGYSNGSHSSDL
Q7MXI9_PORGI/690-872KMNKAQVPA.ARSGKID.CKFEK.........EM.DTPSTT.IFDVVSG...............................
Q89V74_BRADU/167-339PQAAQFG....KGGAKV.VHREL.........E...QAHLTLALEGVPQ...............................
Q8DMX5_STRR6/179-350VKVQYCQPYSNILQEGM.VRKNV.........G...QSILELGYHYRSK...............................
Q8DMX6_STRR6/187-363VAREKLFLQ.PVK..PT.DSMRM.........EV.SSPKLAIGVRGKREVS.............................
Q99XH8_STRP1/184-361RKRVTVDPL.HYYPVIKSSSVDM.........DV.TTAKLVVGFRGYLTLT.............................
U6GTY1_EIMAC/205-387FDTVKPFDH.TNSGKFI.HLQSF.........S..SQPSLWVAFGLPAT...............................

PF03410

Q6TUW3_YMTV5/1-588-YFRNEVFHCMDVLTFLENGD--LYNGG-------------------------RIDMLNNLED----VNNMLCNRMKKII
Q6TVT3_ORFSA/1-598-YFRNEVLHCFDVLTFLGGGD--LYNGG-------------------------RFADLVTTPD----LPARMRERMLSIS
Q08FU3_DPV83/1-596-YFRNEIFHCMDVLTFLSDGD--LYNGG-------------------------RIDMINDIDT----LENILYSRMHRII
Q8V3P7_SWPV1/1-592-YFRNEVFHCMDVLTFLIDGD--LYNGG-------------------------RISMLNNIND----ISIMLHNRMHRII
MP44_FOWPN/1-623-YYRTEMYHCMDVLAYLYGGD--LYNGG-------------------------RITMLERLPE----IRNMLSNRMKFLS
MP44_MYXVL/1-589-YFRNEVFHCMDALTFLANGD--LYNGG-------------------------RLSMLDRLED----IPLILRDRMRTII
MP44_MCV1/1-592-YFRNEVFHCMDILTFLGGGD--LYNGG-------------------------RLSMLEQLDA----VRELLGKRMRRLA
G1_VAR67/1-591-YFRNEVFHCMDILTFLSGGD--LYNGG-------------------------RIDMIDNLNI----VRDMLVNRMQRIS

PF00675

AXL1_YEAST/34-179-NGEFTFESILDVFA-----S--FFKEP-------------------------...LFNPLLI----SK....-------
IDE_HUMAN/74-212-.....LEGALDRFA-----Q--FFLCP-------------------------...LFDESCK----DR....-------
YMXG_BACSU/12-160-.....ANYALDVLA-----D--MFFHS-------------------------...TFDENEL----KKEKN.-------
YQA4_CAEEL/37-175-.....LYGALDRFA-----Q--FFLDP-------------------------...QFTESAT----ER....-------
IDE_DROME/47-185-.....LDGALDRFA-----Q--FFIAP-------------------------...LFTPSAT----ER....-------
MPPA_YEAST/29-176-.....VGKMLQLMS-----E--TVRFP-------------------------...KITEQEL----QEQKL.-------
NRDC_RAT/210-348-.....FKEALDRWA-----Q--FFIHP-------------------------...LMIRDAI----DR....-------
PTRA_ECOLI/54-192-.....LPGAVDRLA-----D--AIAEP-------------------------...LLDKKYA----ER....-------
QCR1_BOVIN/58-205-.....LPKAVELLA-----D--IVQNC-------------------------...SLEDSQI----EKERD.-------
MPPB_NEUCR/50-198-.....VPKCVDILQ-----D--ILQNS-------------------------...KLEESAI----ERERD.-------
MPPB_RAT/68-215-.....LPRAVEILA-----D--IIQNS-------------------------...TLGEAEI----ERERG.-------
MPPB_YEAST/36-184-.....IPKAVDILS-----D--ILTKS-------------------------...VLDNSAI----ERERD.-------
QCR2_YEAST/17-163-.....LPYYVNALA-----D--VLYKT-------------------------...AFKPHEL----TESVLP-------
PQQL_HAEIN/45-188-...QKLELAFDVIN-----E--WMNNI-------------------------...TFLPKDV----DG....-------
UCR1_CAEEL/48-195-.....VEKVVDILA-----D--VLRNS-------------------------...KLEASTI----DTERV.-------
MPPA_SOLTU/85-231-.....VPQMVEMLA-----D--CVRNP-------------------------...AFLDWEV----KEQLE.-------
MPPA_NEUCR/62-209-.....IPTAVELMA-----E--TIRDP-------------------------...KLTDEEL----EGQIM.-------
PQQL_ECOLI/46-204-...QNLQQVMAIFS-----E--WSNAA-------------------------...TFEKLEV----DAERGV-------
MPPA_HUMAN/77-227-.....LDTVVALLA-----D--VVLQP-------------------------...RLTDEEV----EMTRM.-------
QCR2_BOVIN/48-194-.....VDILMEFLL-----N--VTTAP-------------------------...EFRRWEV----AA..L.-------
QCR1_YEAST/37-182-.....TDKSLDFLN-----Q--SFIQQ-------------------------KANLLSSSNF----EATKK.-------
A6T9H3_KLEP7/17-153-.....LADGVARLQ-----E--MLQAP-------------------------...LLLREDI----QR....-------
Q4K4V3_PSEF5/19-156-.....FAGGLERLC-----E--MLAQP-------------------------...RMSLEDQ----HR....-------
U6GTY1_EIMAC/46-182-.....FEEALDRFA-----E--FFKSP-------------------------...LFNRQYE----EK....-------

PF02664

R4KBP6_CLOPA/3-152------GFY.LILAG-----D..YESKD-------------------------IVDLLINLFKFVA.DYEGE--------
R5KFX1_9CLOT/3-152------GFY.LILAG-----D..YKSED-------------------------IVDLMISMFEFIR.HYHDP--------
R5PX34_9BACT/3-152------GNY.LLMKG-----D..LQPAD-------------------------IVGLMKRTFAFVA.AFEGD--------
R6C8S4_9CLOT/3-152------GFY.LLLAG-----D..YKSSD-------------------------IVPLMIEMFEFMR.DYKGE--------
R6PKX1_9FIRM/2-152------GMY.LIFKG-----D..LSSKD-------------------------VADVITKSFEYVR.NFEGI--------
X2H624_9GAMM/3-155------GFY.MSLIG-----K..PDESL-------------------------VVDAWLKSMQDVL.KVKSQ--------
D7CY71_TRURR/20-171------GFY.LTVLG-----Q..PAEAD-------------------------IAQALTRALHAVV...AHQ--------
R5RBB5_9FIRM/3-152------GFY.LLLAG-----D..YESRQ-------------------------IVPLLTEMFTFIR.DYRDE--------
LUXS_WOLSU/3-156------GFY.MSLIG-----V..PKNAR-------------------------VLEAWRRSMEDIL.TLKSE--------
LUXS_LEUMM/6-151------GFH.VISWV-----N..YDSET-------------------------LAKVFKKVLEKIV..SDEV--------
C4Z400_EUBE2/3-154------GFY.VIFAG-----D..LKSED-------------------------IIGILREAADYVL.NYDDN--------
D5V4X1_ARCNC/3-156------GFY.MSLLG-----S..PKEET-------------------------VAAAWKAAMEDVL.NVAKQ--------
LUXS_STRSY/6-152------GFH.MIMWG-----K..QDSEK-------------------------IAQVIKSSLEEIA.EGITW--------
R6HDC0_9CLOT/3-145------GFY.LLIRG-----...LPYDV-------------------------TLSLIKSAMEHIA.KFEGE--------
R5YRN6_9FIRM/3-151------GFY.MILAG-----D..LTSND-------------------------VLQLVKDMFLFIK.NYEGD--------
LUXS_PORGI/3-152------GNY.FLMRG-----D..YVSKD-------------------------ILPLMQETFRFIR.DFEGE--------
E6TVC8_BACCJ/6-152------GFY.LSIIN-----D..ESYEN-------------------------VLNLLEKTLNDVL....EA--------
R7HNK7_9BACT/3-153------GNY.LIVKG-----D..LASSD-------------------------ILPLMVETFEFIR.DFDGI--------
G9WH82_9LACT/3-148------GFH.MISWY-----T..YSTEE-------------------------VAKALKSTLQEIV.DKIKF--------
LUXS_SULDN/3-156------GFY.MSLIG-----S..PDEQR-------------------------VADAWSASMQDIL.GVKEQ--------
LUXS_BORBU/3-151------GFY.LIIFG-----D..YESKD-------------------------LVDLVSWLFSEIV.NFSEP--------
LUXS_HALH3/5-151------GFY.LAVLN-----D..DSYEN-------------------------ILQVVENTLKDVL....NA--------
F2FAS1_SOLSS/7-150------GFY.VSFMN-----Y..DDYEG-------------------------VLSILEKTVQDVL....AA--------
B9L8B0_NAUPA/3-151------GFY.MSVIG-----E..PEDEE-------------------------VIEAWKKSMQNVL....ET--------
A9KLE6_CLOPH/4-152------GFY.LLLSG-----D..YTSAE-------------------------IIPLMKELFTFIS.EFEGE--------
R6ITR1_9FIRM/3-144------GFY.LLMRS-----Q...NHER-------------------------ALEKVKEALRKTI....DA--------
R6DD03_9FIRM/3-147------GFY.FLFDG-----E.QLTLAQ-------------------------AVALVQRVFAQGA.VFEGE--------
D6XTF8_BACIE/6-147------GFY.MAVLN-----D..ESYEN-------------------------ILQVLEKTLQDIL....EA--------
U5RPD3_9CLOT/3-152------GFY.LILEG-----D..YKSAD-------------------------VVDLLKEMYKFIG.DFEGD--------
C7MPF8_CRYCD/3-154------GFY.LLVFG-----T..VSSRE-------------------------IVGLLKRFCVFVR.DFNGE--------
R7IRY5_9FIRM/3-152------GFY.LLLAG-----D..YESKD-------------------------IVPLIREMFEFIR.DYKDE--------
R6PNN5_9FIRM/2-151------GMY.MIFKG-----D..LESKD-------------------------VAPIMADAYRYMA.EFTGE--------
E4TXP8_SULKY/3-156------GFY.MSVIG-----T..PSEEV-------------------------VADAWEASMKDIL.EVKSQ--------
R5WFL1_9CLOT/3-152------GFY.LIVAG-----D..YDSED-------------------------ILPLMREMFEFIR.NYEGE--------
R6C5U0_9BACT/3-152------GNY.LLIKG-----D..LESKD-------------------------IVELMKRTFQFIA.DFEGE--------
LUXS_STAA8/5-151------GFY.VSFIN-----H..DNYDD-------------------------VLNIVEATLNDVL....NA--------
E3HCL4_ILYPC/3-153------GVY.VIFKG-----D..LNPLD-------------------------VLPIITEMFQFIA.DFEGD--------
R6YLM9_9FIRM/3-152------GFY.LILAG-----D..YESAD-------------------------IVPLLEEMFTFIS.EYEGE--------
K4RLT5_HELHE/5-148------GFY.LMVLN-----H..DNRAE-------------------------ILDLLEKTMHDVL....QA--------
D2RNA7_ACIFV/6-149------GFH.LLCWG-----V..HDPKD-------------------------VAKALKEALELVV..ETTW--------
E3EF50_PAEPS/3-144------GFY.LILWN-----E..HEPEE-------------------------IALALEKTLKRIL....ET--------
R5FL10_9BACT/3-152------GNY.LLLRG-----D..LQSED-------------------------IVDLMRRTFKFVA.EYEGE--------
E6X176_NITSE/3-156------GFY.MSLIG-----T..PDEEE-------------------------VAKAWEASMRDVL.EVPAQ--------
F2JMN8_CELLD/3-147------GFY.LILKG-----N..RNPKE-------------------------IAPLITELFEFIS.HFEGE--------
R6GXR5_9FIRM/3-148------GCY.LILAG-----D..YESKD-------------------------VVGLVRDTFSFIA.DYEGE--------
C3PK03_CORA7/11-156------GFY..AITN-----G..MEQDE-------------------------LLRAVEGALNDIL....NA--------
R5NSS3_9FIRM/3-152------GFY.LILAG-----N..LESKD-------------------------IVDLVTEMYEFMS.GFEGD--------
H6LD48_ACEWD/3-152------GFY.LLIKG-----E..LTPTD-------------------------VMPLIVKLFTFMA.EYDDV--------
R6MPS4_9FIRM/7-150------GFY.LLLRS-----D..VSHAD-------------------------ALALVKESFRFIA.DFEGE--------
R7MKY1_9FIRM/3-145------GFY.FLTRN-----...LDPEK-------------------------AIRIVRDSFEYIA.SYNGE--------
LUXS_SHELP/3-156------GFY.MSLIG-----T..PKEAE-------------------------VAECWLAAMEDVL.KVKQQ--------
F2NTN2_TRES6/7-150------GFY.LTVWG-----D..HEESY-------------------------IAEHLCNVLEKVA...AWN--------
LUXS_CAMJE/3-156------GFY.MSLIG-----T..PDEKS-------------------------IAKAWEAAMKDVL.SVSDQ--------
R5KBK1_9CLOT/3-152------GFY.LLLAG-----D..YDSID-------------------------IVSLLTRMYEFIA.DYQGE--------
LUXS_CHRSD/7-153------GFY.VTLIN-----H..DDYDD-------------------------VLDLIDKTLNDVL....VA--------
R6TY31_9FIRM/3-145------GFY.LLVRG-----R...RPEE-------------------------VLSALKKALADTV.SYEGA--------
F2NKV7_MARHT/3-150------GFY.AVVLG-----T..PGTEA-------------------------VRQAFEAALRDVI...EHT--------
LUXS_PEDPA/3-148------GFH.LIAWG-----E..PTTTE-------------------------VAKALKGALEEIA.NVTKW--------
E4UA16_OCEP5/3-147------GFY.AVIIG-----Q..PAPEA-------------------------VMEAFAGALADIV...AHE--------
R5KTK9_9CLOT/3-145------GFY.FLTRS-----...LSDGY-------------------------SIQLIKDAFQHIA.DYWGM--------
A5HZR8_CLOBH/3-148------GFY.LIAWG-----E..VEVDT-------------------------IIEALNYSLNKVI....ET--------
R5ED85_9CLOT/3-152------GFY.LILAG-----D..YTSKD-------------------------IVELVKEMYAFMK.DFEGD--------
C5ZWA6_9HELI/3-153------GFY.MSLIG-----K..PSPEA-------------------------VKNAWEASMKDIL....EV--------
LUXS_OCEIH/6-147------GFY.LSLIN-----H..DDYDD-------------------------VLTMIEKTLEDVL....QA--------
C4L419_EXISA/5-147------GFY.WTMLN-----D..GNYER-------------------------MLDLVEATLRDAM....NA--------
D2NNT8_ROTMD/39-183------GFYALTLG.-----...LEPEK-------------------------FFPILEATLNDIL....NA--------
R6LCE1_9FIRM/3-152------GFY.LLLVG-----D..YESKD-------------------------IVPLMKEMFAFIA.DFNGD--------
R5CNL9_9FIRM/3-152------GCY.VLFEG-----D..LTSED-------------------------VAPLITRMFEFIR.DFEGD--------
R6MQH5_9FIRM/3-145------GFY.FLVRD-----...MSQED-------------------------ALELIKDTVFKCK.NHTGE--------
F9YSB4_CAPCC/3-151------GNY.LILAG-----D..YSSKD-------------------------IVPLITDLFKYMA.DFEGE--------
B1HRL0_LYSSC/7-150------GFY.VSLIN-----H..NDYED-------------------------LLAILENTFTDVT....KA--------
LUXS_SULNB/3-156------GFY.MSLLG-----T..PKPKR-------------------------VAKAWAASMKDVL.NVKSQ--------
LUXS_LACLA/3-148------GFH.MIMWG-----E..HSSEE-------------------------IAKVIKSSLEELASDEFGW--------
I0FCF7_BORCA/3-151------GFY.LILFG-----N..YESKD-------------------------LIDLISWLFNEIT.NFQGN--------
LUXS_HELPY/7-153------GFY.LTVLN-----H..DNYTE-------------------------ILEVLEKTMQDVL....KA--------
R6R1H2_9FIRM/3-152------GFY.MILAG-----K..LDSSD-------------------------VVPLVDEMIGFIE.NFEGD--------
F4BP26_CARS1/6-149------GFY.LTVIN-----H..ENYDE-------------------------ILEVLQKTMEDVL....VA--------
F5YFP3_TREAZ/3-151------GFY.VILEG-----E..LSSED-------------------------ALPLIQEMLDWII.AFSGP--------
LUXS_BACSU/3-154------GYY.LVVSG-----E..PTSAE-------------------------IVDLLEDTMKEAV....EI--------
D4KC03_9FIRM/3-145------GFY.LLTRG-----...LTPAQ-------------------------ALQLTVDAYRFMA.GFEGT--------
R6HYL9_9FIRM/3-148------GFY.LLLAG-----D..LEPRD-------------------------VEELVQAMFRFIR.DYEGP--------
C7NBV6_LEPBD/3-152------GFY.LILKG-----K..LESKD-------------------------IVDLMKELYKFMA.EFKGA--------
LUXS_ACTP2/3-157------GFY.MSLIG-----A..PSEAD-------------------------VVSAWTKSMEDALNKVPDV--------
R6NAG0_9FIRM/3-152------GFY.LLLAG-----N..YESKE-------------------------IVPLITEMFAFIR.DFHDK--------
R6RZY0_9FIRM/3-152------GFY.LVLAG-----E..YKSRD-------------------------IVPLMKRMFTFIA.EFEGD--------
R7DJC7_9PORP/3-152------GNY.FLVQG-----D..LESKD-------------------------IVELMRETFRFIR.DFEGK--------
E8NGC1_MICTS/3-149------GFH.VIMWG-----E..PEVPV-------------------------LVAAITDSLRAIA.EDVQW--------
G4L3V1_TETHN/3-149------GFH.LIIWG-----E..YSATE-------------------------VAQALTESLKTIA.YETKW--------
LUXS_THICR/3-156------GFY.MSLIG-----T..PDEKR-------------------------VADAWMKAMQDVL.NVEKM--------
R5WY94_9FIRM/3-152------GNY.LLLAG-----D..YESKD-------------------------IVGLMTEMFEFIC.DFEGE--------
E1STH1_FERBD/3-156------GFY.MSLIG-----T..PSETQ-------------------------VADAWRASMEDVL.QVEDQ--------
R6RGY7_9CLOT/3-152------GFY.LLLAG-----D..YESAD-------------------------IVPLLQEMFSYIR.DFEGE--------
V5WDC5_9SPIO/3-152------GFY.LLMKG-----K..RESAE-------------------------LVDLITNLFRFMS.EFDDD--------
R7FSM8_9FIRM/3-152------GFY.LILAG-----S..YESKD-------------------------IVPLLKEMYTFMA.EFEGE--------
E0S2G2_BUTPB/3-152------GFY.VVLAG-----D..LSSKE-------------------------IVPLITRMYEFMR.DFEGE--------
E3GFJ9_EUBLK/3-152------GYY.LLMKG-----D..LTSND-------------------------VVPLVTDLFKFMA.DFEGD--------
LUXS_CAMC1/3-156------GFY.MSVIG-----T..PSEEA-------------------------VKKAWLASMKDIL.EVKDQ--------
LUXS_HAEIN/3-156------GFY.MSLIG-----T..PNEQK-------------------------VSEAWLASMQDVL.GVQDQ--------
F8EYR0_TRECH/3-151------GFY.VILEG-----N..LSSLD-------------------------VLSVITEMYQWIA.SYVDE--------
R5IHR6_9CLOT/3-148------GFY.LLLAG-----D..YESKD-------------------------ILPLVVEMYEFVR.DFEGE--------
LUXS_CLOB8/3-152------GFY.LILHG-----D..YKSKD-------------------------IVPLLTELYKFMA.EFEGD--------
I6T8S7_ENTHA/4-150------GFY.LTVLN-----H..ESYED-------------------------ILDVLEQTMKDVL....EA--------
E1VUH9_ARTAR/8-152------GFH.MILWG-----E..PTPEV-------------------------VAAAIKSSLEDIA.EKVTW--------
R6MF87_9BACE/3-152------GNY.LVVKG-----D..LESKD-------------------------ILPLMQETFRFIA.DFEGD--------
F4LMA9_TREBD/3-152------GFY.LLLAG-----S..YTSRA-------------------------AVPLITELFEFVR.DFCGA--------
LUXS_HELHP/3-152------GFY.MSVVG-----A..PNEYN-------------------------VKEAWESSMRDVL.RICDE--------
R7FC53_9FIRM/3-148------GFY.FLTRD-----T..LSGAD-------------------------AIRLVQETLQFVI.GFTGE--------
R6A5W4_9BACT/3-149------GNY.LIVKG-----D..LTSRD-------------------------VLPLMQETFEFIA.QYKGD--------
F4HBP5_GALAU/3-155------GFY.MSLIG-----T..PAEQL-------------------------VIEAWEKAMQDVL.SIKSE--------
LUXS_PROAC/6-150------GFY.LIMIG-----E..PDVSG-------------------------TCELVETTLRDIL....KL--------
G9ALV8_PANAN/3-156------GFY.MSLIG-----T..PDEQR-------------------------VAQAWKGAMEDVL.KVKDQ--------
LUXS_ECOLI/3-156------GFY.MSLIG-----T..PDEQR-------------------------VADAWKAAMEDVL.KVQDQ--------
D3FYW3_BACPE/3-149------GFY.LIMSG-----A..PSVDE-------------------------IIDVLEKTMKYSI....EL--------
D9SL03_CLOC7/3-145------GFY.MVAWG-----D..IQAET-------------------------VIDALTYGLKKVL....DT--------
R6WDX5_9FIRM/3-150------GFY.LLLSG-----E..YSSRD-------------------------IIPLMREMFTFIA.DFEGE--------
LUXS_CAMHC/3-156------GFY.MSLIG-----R..PSETE-------------------------VIKAFENSMKDVL.KVTSQ--------
R5T4J5_9CLOT/3-152------GFY.LLLAG-----D..YESKD-------------------------IVPLITELFEFIR.DFEGE--------
LUXS_DESPS/3-152------GFY.LILAG-----D..WKAKD-------------------------IVPLMQEMFAYVA.QFTGT--------
D1AKY0_SEBTE/5-153------GCY.LLLKG-----R..LEPKD-------------------------ILDLIKRLWKFIS.TFEGE--------
F8A102_CELGA/6-151------GFY.LTLAG-----Q..WDYDD-------------------------VLALVEATLRDVL....AA--------
F0LWD7_VIBFN/3-156------GFY.MSLIG-----A..PSEEQ-------------------------VAAAWLASMQDVL.SVESQ--------
X2HF86_9NEIS/3-156------GFY.MSLIG-----T..PDEAT-------------------------VAKAWAESMQDVL.AVTDQ--------
G2TLR1_BACCO/8-154------GFY.FSVIN-----L..DDDGE-------------------------VLDIIEKTLNDVL....HA--------
R7LH99_9BACT/3-152------GNY.FIVKG-----E..VSSAD-------------------------ILPLMKETFSFIA.DFDGE--------
R5GZ39_9FIRM/3-152------GFY.MLLAG-----D..YTSKD-------------------------VVGLVTELFEFVR.DFKGE--------
R5EUY8_9GAMM/3-152------GFY.MSLIG-----K..ADGKK-------------------------VADAFRASMEDIY.SLPEG--------
X4RAQ7_9ACTO/5-148------GFY.LILAG-----E..PDVTA-------------------------TMELIEVTLRDIL....AA--------
R5ZCW6_9FIRM/3-152------GFY.LILAG-----D..YESKD-------------------------VVSLVQEMFTFMA.NFEGD--------
LUXS_BIFLO/10-155------GFH.LLTWG-----T..HSTED-------------------------VAKALKESLEFIA.YKATW--------
R7EJJ6_9BACE/3-152------GNY.LLMKG-----D..LKPQD-------------------------ILALMQDTFRFVA.EYEGE--------
W6ETW6_SULMU/3-156------GFY.MSLIG-----T..PEPKR-------------------------VVSAWKASMNDIL.HVKSE--------
LUXS_CLOAB/3-151------GFY.LILQG-----D..YTSND-------------------------IVPLLREMYKFIA.DFKGE--------
R6BK52_9CLOT/3-146------GFY.FITRD-----K..ISKAR-------------------------AIELVQETCAFIE.HFEGE--------
R6PJD2_9CLOT/3-152------GFY.LLLAG-----D..YCSED-------------------------IIELLKELFTFIA.EFNDE--------
R6A2L5_9ACTN/3-154------GFY.LVVFG-----E..VTSEE-------------------------ILPLVRELFEFVA.DFEGD--------
LUXS_AERHH/3-156------GFY.MSLIG-----A..PDEAR-------------------------VGAAWQAAMSDVL.TVQEQ--------
W0DSV4_9GAMM/3-156------GFY.MSLIG-----E..PDEQR-------------------------VAQAWLAAMHDVL.AVKSE--------
LUXS_CAMFF/3-156------GFY.MSLIG-----T..PSWEM-------------------------VAKAWEESMKDIL.NVKSQ--------
LUXS_CLOPE/3-144------GFY.LTSFG-----D..IDVKD-------------------------IIEALEYSLSKVL....EQ--------
LUXS_HAEDU/3-157------GFY.MSLIG-----E..PSAQA-------------------------VANAWKNAMHDILTKVSDV--------
D6ZJM3_MOBCV/7-149------GFYAMTLG.-----...IQPEE-------------------------FMSILQATLVDIV....NM--------
I1YS81_PREI7/3-152------GNY.LILKG-----D..LKSVE-------------------------IIDLMRRTFEFVA.SFEDE--------
R5PFW0_9BACT/3-151------GNY.LLMKG-----D..MKSEE-------------------------IVKLMIDTFEFVA.NYDGV--------
R5EUU6_9FIRM/3-151------GFY.LLLTG-----D..HTSKD-------------------------VVPLVLDCFRFIR.DYRGE--------
R5D5F7_9FIRM/3-152------GFY.LILAG-----E..LTSKE-------------------------IVPLICEMFRFIA.DFNDE--------
W5XUN8_9CORY/9-154------GFYALMLG.-----...VETDE-------------------------FVSILEKGLNDVL....TA--------
R5L929_9FIRM/3-152------GFY.MVLAG-----D..YTSKD-------------------------ILPLVKEMYLFMK.DFEGD--------
LUXS_DEIRA/6-150------GMY.MAVIG-----E..PDEQG-------------------------VMKAFEAALKDTA...GHD--------
R6UZ21_9FIRM/3-147------GFY.FLTRD-----S..ISKAQ-------------------------AVQLVKDTMAFIA.GFEGD--------
X4ZFG7_9BACL/3-145------GFY.LIIWD-----E..HEPAA-------------------------VAAALTKVLRKVL....ET--------
R5UP43_9PORP/3-152------GNY.LLLRG-----D..LQPRD-------------------------IEELMRETFRFVR.DYEGE--------
D7BBC0_MEISD/6-153------GFY.AVMLG-----E..IGPER-------------------------MLEAFRASLEDVV...AFE--------
A5N8G9_CLOK5/3-154------GLY.LLLGS-----DRGFESKE-------------------------IIGLVKEMFQFIA.EYEGE--------
D7GDL7_PROFC/6-150------GFY.LIMVG-----E..PDVPR-------------------------IADLVEQTFRDIL....AL--------
LUXS_LISMO/6-150------GFY.VSFIN-----H..SDYDD-------------------------ALEIIATTLTDVL....VA--------
LUXS_FINM2/3-149------GFY.LILVG-----D..KKSED-------------------------IVDLIKELFEFIS.NYEGE--------
R5U9A0_9FIRM/3-152------GFY.LLLIG-----D..YESCD-------------------------ILPLMKEMFAFIA.SYDQE--------
R6FMJ5_9FIRM/3-152------GFY.LVLAG-----D..YESKD-------------------------IVDLMKEMFDFMR.NFEGE--------
R5QFC8_9FIRM/3-152------GFY.LLLAD-----D..LTSSE-------------------------ILPLMKEMFSFIA.SFKGE--------
R6UMD9_9CLOT/3-146------GCY.LIVRD-----S..LKPQQ-------------------------VIDLVKETFEFIR.DYEGE--------
R7I6H9_9CLOT/3-150------GFY.LLLAG-----D..YTSKD-------------------------IVPLITSLFEFIR.DFEGQ--------
R7J0C3_9BACT/3-152------GSY.LILQG-----N..LESED-------------------------IVPLMREMFRFIA.SFEGD--------
A6Q5E8_NITSB/3-156------GFY.MSVIG-----R..PSALD-------------------------VAQAWEKSMRDIL.ALKSI--------

PF05193

MPPA_SCHPO/216-408...TDPDIYALACLQ-----F--LLGGGGSFSA..............GGPGKGMYSRLYLNVL..N-QYPW.--------
QCR1_MOUSE/210-395...ANPDNVTLQVAN-----A--IIGHYDCTY................GGGVHLSSPLASVAV...-ANKL.--------
IDE_HUMAN/236-418..QKYYKSNPGHYLG-----H--LIGHE.........................GPGSLLSELK...-SKGW.--------
IDE_HUMAN/706-889...STSENMFLELFC-----Q--IISEP.............................CFNTLR..T-KEQL.--------
YMFH_BACSU/182-363GKELLKHELSMNLLL-----E--ALFGK..........................SSAQYESLY...-EKGY.--------
YMXG_BACSU/165-338...GHERIYDLIVLN-----N--VLGGS.........................MSSRLFQDVR..E-DKGL.--------
YQA4_CAEEL/603-787.VQSTYNNSVNKLLN-----E--LIKNP.............................AYTILR..T-NEAL.--------
QCR2_MOUSE/199-378...GNAEANAFSVLQ-----H--LLGAGPHIK.................RGNNTTSLLSQSVA..K-GSHQ.--------
YQA4_CAEEL/200-382..NGEFLSQPGDYIA-----H--LIGHE.........................GPGSLLSELK...-RLGW.--------
PREP1_ARATH/301-489.PLDLQTQLALGFLD-----H--LMLGT.........................PASPLRKILL...-ESGL.--------
IDE_DROME/209-391..TQFYKSGPDNYLT-----H--LIGHE.........................GKGSILSELR...-RLGW.--------
Q9YFN7_AERPE/166-342.......SGLANVLA-----R--LRGVVFNL...................EAGATSILFKEVR..E-ERGL.--------
IDE_DROME/679-863..QTDHTNIMVNLVS-----Q--VLSEP.............................CYDCLR..T-KEQL.--------
Q9RRH6_DEIRA/141-315...SHPLREAAGLLA-----E--LIGGE..........................NGALYWALL...-DTGL.--------
PQQL_ECOLI/206-388...NDEQSFIEQAEW-----S--MLVQL.........................FNQRLQERIQ...-SGELK--------
Q9X167_THEMA/162-335...ISEDIYPLYALN-----T--ALGSG.........................MSSILFHEIR..E-KEGF.--------
Q9I6C2_PSEAE/203-388SSENPREVNALRLIG-----A--LLDGG.........................YSARLASRLE..R-GEEL.--------
MPPB_SCHPO/185-372...KHPDYFTALVMQ-----A--IIGNWDRAM................GASPHLSSRLSTIVQ...-QHQL.--------
PXM16_ARATH/666-854YIQVHRDDFSMNIKL-----Q--LFGLV.........................AKQATFHQLR..T-VEQL.--------
Q9KUG7_VIBCH/219-398...GAEDQVALDALA-----S--ALGSG.........................NNSLLYQELV...-KTQK.--------
O50511_STRCO/185-366...GTRACDAADLAL-----T--VLGGG.........................ESSRLYNRLVRRD-RTAV.--------
PTRA_ECOLI/681-858....GYDEYTSSAYS-----S--LLGQI.........................VQPWFYNQLR..T-EEQL.--------
MPPB_NEUCR/203-391...SDDDYFTGLVTQ-----A--IVGNYDKAL................GNAPHQGSKLSGFVH...-KHDL.--------
Q9RRH5_DEIRA/126-298...RDPDWLPWQLAL-----T--ALSGG.........................SASRLFTRVR..E-ERGL.--------
QCR2_NEUCR/198-375....GVPHPETSVLV-----G--LLGGVSNI...................KWSPGFSLLAKAT...-..AAN--------
Q985V3_RHILO/166-339...HVRDFYASQVLS-----M--ILGGG.........................MSSRLFQEVR..E-KRGL.--------
Q9FJT9_ARATH/639-833.GTMIEEIHCIGFLG-----K--LLETK.............................IIQFLR..F-EHGQI--------
Q23295_CAEEL/192-374...THEDNLALMVAN-----T--LMGEYDRMR................GFGVNAPTRLAEKLS...-QDAG.--------
CYM1_YEAST/735-911...THKDGSALQVMS-----N--MLTFK............................HLHREVR..E-KGG..--------
O67308_AQUAE/184-360...GKTDYKGLLVFS-----E--ILCGG.........................RISVFYRELR...-EKGL.--------
O84812_CHLTR/225-408...PQSLQGWAQSLI-----S--ILSSE.........................KENSLVALLK...-KEQL.--------
P73670_SYNY3/182-362..DRLQDNIGLDLLA-----V--VLAGS.........................HCARLVQRLR..E-ELGL.--------
Q9VP94_DROME/242-425..KNFYRSKPDMFIS-----Q--LIGYE.........................GVGSLCAYLR...-HHLW.--------
Q97II7_CLOAB/206-391..LDTELSMGLELLE-----S--ILLEA.........................SSSPLRRAIV...-EENI.--------
YPD1_CAEEL/194-376..SDLETHSSLHVLF-----D--YLSNT.........................SVAPLQKDFI.LL-EDPL.--------
Q9VYT3_DROME/284-473..RQYYRSKPDQFLS-----Y--LLGYE.........................GRGSLCAYLR...-RRLW.--------
MPPA_HUMAN/232-431...LEEDFIPFAVLN-----M--MMGGGGSFSA..............GGPGKGMFSRLYLNVL..N-RHHW.--------
MPPA_YEAST/181-374...DHPDIYALATLQ-----T--LLGGGGSFSA..............GGPGKGMYSRLYTHVL..N-QYYF.--------
Q9VFF0_DROME/203-385...TDQDNIPLMVAN-----T--LVGAWDRSQ................GGGANNASNLARASA...-EDNL.--------
MPPB_YEAST/189-380...SAPDYFVALATQ-----A--IVGNWDRAI................GTGTNSPSPLAVAAS..Q-NGSL.--------
O83069_TREPA/199-385..DKAEQLMDVFLLE-----H--VLLGH.........................DAAPLAQALL...-ESEL.--------
O25656_HELPY/198-379...KHKDQVALDALS-----R--LLGEG.........................KSSWLQSELV..D-KKRL.--------
Y228_BORBU/711-879...NDENYPKANFLE-----H--VLRSG............................IFWEKIR...-VMGG.--------
Q9A579_CAUCR/219-397...GAAETDYLDLLS-----D--VLVSD.........................KTSRLYKRLV..F-TDQS.--------
MPPA2_ARATH/235-419..NNEKEAIIATVLQ-----M--LMGGGGSFSA..............GGPGKGMHSWLYLRLL..N-QHQQ.--------
PXM16_ARATH/198-379..IHHYDEAPSQYLG-----H--LIGHE.........................GEGSLFHALK...-TLGW.--------
Q9PF62_XYLFA/244-422...GSDTVVQLDLAT-----T--ILGGN.........................KSSRLYQRLV..Y-KDKL.--------
Q9CE72_LACLA/168-341..YGDKNYLALQVMN-----G--LLGGF.........................AHSKLFTNVR..E-KASL.--------
Q9RWP9_DEIRA/229-413..SDPDLSLRWGVLS-----D--VLLGN.........................AAAPLTRPLI...-ESGL.--------
PTRA_ECOLI/213-396....KFRSKTDELIT-----Y--LIGNR.........................SPGTLSDWLQ...-KQGLV--------
Q97IL0_CLOAB/163-340...KDDEIKALRAFN-----V--IFGEG.........................TSSMLYDKIR..T-KYGL.--------
Q17593_CAEEL/199-381..NNEYLSQPGHYIA-----H--LIGHK.........................GPGSISSELK...-RLGW.--------
Q9A2H7_CAUCR/672-850...ADPSYYQGVVAN-----T--VLGVG.........................FSSRLNQEIR..I-KRGL.--------
Q9A531_CAUCR/720-903.FSNLQRSRDVSVLG-----Q--VMQLR.............................LTDELR..E-KQGA.--------
Q9HT96_PSEAE/190-362.....AAPDAMVLLQ-----A--YMNDA.............................LYADLR..V-RRGL.--------
Q9I6C3_PSEAE/229-405...QDPDYAALYLGN-----Q--ILGGG........................GFGTRLMDQVR..E-KRGL.--------
STE23_YEAST/246-428..EEHWESKPPRILS-----H--LIGHE.........................GSGSLLAHLK...-KLGW.--------
Q9KUG7_VIBCH/686-864..DATGELYLTQLAN-----F--NLAGN.........................FNSRINQNLR..E-DKGY.--------
Q9KQC8_VIBCH/661-839....SPRSIALYSLA-----N--HLMSA............................TFFHEIR..T-KQQL.--------
PQQL_HAEIN/205-388.ETNTLASYKQELIQ-----Q--ITTRL.........................LNLRLQQWEK..E-TENG.--------
MPPA_SOLTU/236-422.WMSEKESMTLTVLQ-----M--LMGGGGSFSA..............GGPGKGMYSRLYLRVL..N-QYPQ.--------
YAN2_SCHPO/193-378..LDAYTVFAIETLC-----E--FLSES.........................AVSPFGQTFV...-...E.--------
NRDC_HUMAN/837-1020...SLREYTLMELLV-----M--HMEEP.............................CFDFLR..T-KQTL.--------
O84831_CHLTR/201-385..FDQQDLLALHVLD-----L--VLMGT.........................DAAPLKSRLL...-KSGL.--------
Q9A579_CAUCR/657-835...NPSDEAAIDVMN-----T--LFGGD.........................FVSRLNMNLR..E-DKHW.--------
Q9FIH8_ARATH/360-598..VQTFGDLRNVLMK-----R--IFLSA.........................LHFRINTRYK...-SSN.P--------
Q9A531_CAUCR/246-428DERDTLENLGFAVLN-----R--RLQAV.....................................G-RSAEP--------
CYM1_YEAST/221-407..QDTYDTFLLKVLG-----N--LLMDG.........................HSSVMYQKLI...-ESGIG--------
Q97EV0_CLOAB/207-392..TDNEKYLAFDMLE-----Y--ILLES.........................EAAPLKKAII...-KAGL.--------
Q9VYT3_DROME/769-953.....VRVESILDLL-----M--MFVDE............................PLFDQLR..T-KEQL.--------
QCR1_YEAST/187-370...NSPNYFVAKLAA-----Q--IFGSYNAFE................PASRLQGIKLLDNIQ...-EYQL.--------
Q9VP94_DROME/724-907.....LKMECIMDLV-----E--LIVEE............................PFFNQLR..T-QEQL.--------
O67945_AQUAE/183-355...DSKDYFVFKVYN-----A--VLGEG.........................MTSKLFKVLR..E-EKGY.--------
Q9KRD3_VIBCH/199-378KDYASQQEFWRDDVG-----E--QLLHT............................RLVAAFN..D-AAQA.--------
Q9FIH8_ARATH/928-1156SKLPVAHDGLLKSEE-----Q--LLEGGDRELQKKLRAHPLFFGVTMGLLAEIINSRLFTTVR..D-SLGL.--------
MU138_SCHPO/668-850...DDERSGALTRLA-----R--QIMKE............................PTFSILR..T-KEQL.--------
NRDC_HUMAN/361-548..QQHYRVKPLHYIS-----W--LVGHE.........................GKGSILSFLR...-KKCW.--------
P74016_SYNY3/241-420...DSPDYAALSVMN-----G--VLGGF..........................AGRLFNNIR..S-TQGL.--------
MU138_SCHPO/196-378..YHKYKCRPAEYVC-----H--LLGHE.........................GEGSYLAYLK...-SLGL.--------
Q55159_SYNY3/175-359..DQFEKTLPLGVLA-----V--ILGRG.........................RVSRLFRELR..E-EKGL.--------
MPPA1_ARATH/239-423..NNEKEAVTATVLQ-----M--LMGGGGSFSA..............GGPGKGMHSWLYRRVL..N-EYQE.--------
O50512_STRCO/190-374...HDRVWPAQVLGT-----Y--CLGGT.........................LTSRLDRVLR..E-EKGY.--------
PQQL_HAEIN/680-857..WRTEQKYLFNILA-----D--IVQEK.............................LRLILR..E-KVSG.--------
O84831_CHLTR/717-886.AYDHPDAAVLSVAA-----E--VLGNV............................ILHTRIR...-EQGG.--------
Q9KA85_BACHD/165-338...GDKDVYALVLLN-----N--VLGGS.........................MSSRLFQDIR..E-KRGL.--------
P74305_SYNY3/274-453...DDPDSAVFDVMT-----T--ILSSG.........................RTSRLYQSLV..E-EKQLA--------
Q9CML5_PASMU/205-388.EQNTLAAYKQDLTQ-----Q--ILIRL.........................INLRLQDWEQ..V-KQQK.--------
MPPB_HUMAN/220-404...AHPDTICLMVAN-----T--LIGNWDRSF................GGGMNLSSKLAQLTC...-HGNL.--------
Y219_RICPR/168-341..INLGQLYQTYLLS-----I--IFGGG.........................MSSRLFQSIR..E-KLGL.--------
O51486_BORBU/686-867....AETWLNLNALA-----D--LLTDG.............................LIKNIX..E-KMSS.--------
Q9A308_CAUCR/166-339...REDDYFALRIFA-----E--CLGGG.........................MSSRLFQEAR..E-KRGL.--------
Q9KA98_BACHD/181-363GKDLLVRELGINVLL-----E--LMFGQ..........................GSKQYEQLD...-DEGL.--------
PQQF_PSEAE/179-352...RGADEQTLLAFA-----E--LLGDR.........................SPGGLLAALG...-EQGL.--------
YO098_YEAST/193-378..SDFRNDLAVDVLL-----D--YFTDS.........................ALAVFTRELV...-...E.--------
YHJJ_ECOLI/199-378.....PIRESAALLR-----Y--WRADL.........................AREALFWHVQ..Q-ALSAS--------
Q9KQC8_VIBCH/196-377..ESYYQKKPLSYFA-----H--LIGYE.........................GEGSLLEALK...-EKGW.--------
Q983M8_RHILO/208-384...KSADFFPAVLMN-----E--ILGGG........................TFTSRLFAEVR..E-KRGL.--------
Q9RTZ9_DEIRA/246-424...RHPDAAALQVLG-----E--LLSDE.........................PSGRLYQALV...-QTGQ.--------
Y4WA_RHISN/251-435.TAEQGEAEALDILS-----E--ILGGG.........................TRSRIYQELV..V-KQAI.--------
Y4WB_RHISN/198-374...KDPQFFAANLMN-----Q--ILGGG........................AFTSRLWNEVR..E-KRGL.--------
MPPA_NEUCR/214-475...SDDDIYALATLQ-----T--LLGGGGSFSA..............GGPGKGMYSRLYTNVL..N-QHGW.--------
P73669_SYNY3/171-348...KHEDYAPLKLLS-----T--YLGNG.........................LSSRLFVELR..E-KRGL.--------
Q9CE73_LACLA/164-346.SSDSKTLFKYKLAN-----Q--LFLDLL......................FGRTSQRYEELY...-NSGL.--------
Q9KRD3_VIBCH/671-849.....PRTAKTVFID-----D--MLQRI.........................ATQRLLAEVR..E-HQGLD--------
Q9RTZ9_DEIRA/703-883.RDDHPDAAALDVAM-----R--IFGGG.........................TDSRLFARLR..Q-QDGL.--------
UCR1_CAEEL/200-386...AHKDALALQIAN-----Q--FIGQWDVTH................ATSRTAASRLVQKIG...-HDHG.--------
Q9PF62_XYLFA/714-895...KDPANLEINVGN-----E--AFGGT.........................FSSRLNMNLR..E-EKHW.--------
MPPA_RAT/231-430...LEEDFIPFAVLN-----M--MMGGGGSFSA..............GGPGKGMFSRLYLNVL..N-RHHW.--------
O51486_BORBU/206-392TKDDLLNAIKKSLLA-----A--LFENR..............................FSELK...-TAGVK--------
PQQL_ECOLI/683-863..VNLPTRMALDAFN-----V--ALAKD.............................LRVNIR..E-QASG.--------
O16249_CAEEL/747-931.VQNTYDNAVVGLID-----Q--LIREP.............................AFNTLR..T-NEAL.--------
Q97LA3_CLOAB/174-348.....KYSLKSDTIE-----Y--FLFSI.........................IKNYILDLFT..D-KSFG.--------
Q983M9_RHILO/206-390.TAKPGEAEALDLLA-----E--ILGGG.........................NRSRLYQALV..V-KQGI.--------
Q9A2H7_CAUCR/210-390...ADKDAPALAVLD-----A--ILTAG.........................KSSRLYDSLV..Y-DQKI.--------
O16249_CAEEL/258-440..NGEFLSQPGHYIS-----H--LIGHE.........................GPGSLLSELK...-RLGW.--------
Q97GF6_CLOAB/170-348...NRFEEAALKILN-----Y--KLGES.........................ANSILFREIR..E-NKGL.--------
PREP_DROME/268-457..TNIQESFELHVLS-----E--VLIRG.........................PNSPFYKNLI...-.....--------
STE23_YEAST/716-898....DVYSEDLSALS-----G--LFAQL.........................IHEPCFDTLR..T-KEQL.--------
Y228_BORBU/195-380..NNIEDSIGLEILS-----E--ILLDD.........................SCSFTINILK...-.SGI.--------
Q9CML5_PASMU/680-857..WTPELQYQLDLLA-----D--VLQEV.............................LRLTLR..E-QSSG.--------
Q9KA97_BACHD/184-365..YGDPDYVAMQVMN-----G--LFGGF.........................SHSKLFINVR..E-KESL.--------
Y5738_STRCO/198-380...TDERRWAMGVLN-----T--ALGGG.........................MSSRLFQEVR..E-KRGL.--------
O25371_HELPY/185-361..DLKQDLAKSKVMM-----F--VLGGG.........................FGSRLMEKIR..V-QEGL.--------
B9PUJ6_TOXGO/295-477..WNGGDLVAYSVLQ-----T--ILGGGGAFST..............GGPGKGMYTRLYLNVL..N-QNEW.--------
C5AQL6_METEA/203-385.TARDGEGYALELLA-----E--VVGGG.........................STSFLYRKLV..L-EMGV.--------
F4HNU6_ARATH/734-916.AQSTRTKAVLDLFH-----E--IIEEP.............................LFNQLR..T-KEQL.--------
F4J3D9_ARATH/200-377..ISHYEEAPCRYLG-----D--LIGHE.........................GEGSLFHALK...-ILGW.--------
M0ZLN7_SOLTU/259-444...TDPDAIPLMVMQ-----S--MLGTWNKNA................GGGKHMGSDLAQSVA...-INEL.--------
M1CRA1_SOLTU/262-448...TDPDSIALMVMQ-----Q--MLGSWNKSS................GGGKHMGSELVQRVA...-INEL.--------
Y2782_MYCTU/179-354...GWEHRWALSVLH-----T--ALGGG.........................LSSRLFQEVR..E-TRGL.--------
Q2FZ15_STAA8/181-362PQKYVQRDLEMSLFF-----E--LIFGE..........................ETDFYQNLL...-NEGL.--------
Q2FZ16_STAA8/180-353..YGQSGYAAFVVFN-----M--MFGGD.........................PSSVLFNEVR..E-KQSL.--------
Q76NL8_PLAF7/282-509SLENPTDYFVLLIIN-----N--LLIHT.........................PESVLYKALT...-.....--------
Q7MXI9_PORGI/690-872...NVEYTLKNSLLL-----E--VFSAV.........................MDQVYTATVR..E-KEGG.--------
Q89V74_BRADU/167-339...NDLSLFSLQVFT-----N--ILGGG.........................MSSRLFQEVR..E-KRGL.--------
Q8DMX5_STRR6/179-350..YGDEQHLPMIVMN-----G--LLGGF.........................AHSKLFTNVR..E-NAGL.--------
Q8DMX6_STRR6/187-363EADCYRHHILLKLLF-----A--MMFGW..........................TSDRFQKCY..E-SGKI.--------
Q99XH8_STRP1/184-361QHSLLTYRIALKLFL-----S--MLIGW..........................TSKIYHTLY..E-DGKID--------
U6GTY1_EIMAC/205-387..LTSYKKQPTSVLT-----Y--LLEYT.........................GEGSLAKRLR...-LLGL.--------

PF03410

Q6TUW3_YMTV5/1-588GPNIVIFVKELNKTCLNMLQNSFGTLPSCPMLFSL.PTFSNIEGKIIMMPSPFYTVMIKISLSISNVISIICLFKTYHLI
Q6TVT3_ORFSA/1-598GPSVVVFLRQSNAATVALLNATFGRLPRTPEVIFP.RAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLF
Q08FU3_DPV83/1-596GPNTIIFIKELDEETLSLLSNTFGKLPSCPLTIPC.NSFSSIVGKVVMMPSPFYTVMVNVKQSLENILAIMCLYEIYHLI
Q8V3P7_SWPV1/1-592GPNIIIFVKDINDYVLSILEKSFGSLPSCPLTIPY.MMSSHITGKIIMMPSPFYTIMINIKSTLDNILSIMCLYEIYHLI
MP44_FOWPN/1-623GKNIVIFVKRLTNNILTLLTNTFGSIPKYPIIIPLDPQIQDARRKIIMMPCPFYTLLIQVDNTMNNLLAIICLVENYNLI
MP44_MYXVL/1-589GPNVVIFVRELNDVVLSLLANTFGRLPACPLTIPC.TVRTIIGGKTIMMPSPFYTVMVRVEPSLHNILSILCLYEIYHLV
MP44_MCV1/1-592GPNVVIFVRELSPAALALLERSFGTLPRFPSTIPA.TRLGSIHNKAVLVPAPFYALLIQVDNTVENVLAVICLAESYHFV
G1_VAR67/1-591GSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLI

PF00675

AXL1_YEAST/34-179--------------------------------------------------------------------------------
IDE_HUMAN/74-212--------------------------------------------------------------------------------
YMXG_BACSU/12-160--------------------------------------------------------------------------------
YQA4_CAEEL/37-175--------------------------------------------------------------------------------
IDE_DROME/47-185--------------------------------------------------------------------------------
MPPA_YEAST/29-176--------------------------------------------------------------------------------
NRDC_RAT/210-348--------------------------------------------------------------------------------
PTRA_ECOLI/54-192--------------------------------------------------------------------------------
QCR1_BOVIN/58-205--------------------------------------------------------------------------------
MPPB_NEUCR/50-198--------------------------------------------------------------------------------
MPPB_RAT/68-215--------------------------------------------------------------------------------
MPPB_YEAST/36-184--------------------------------------------------------------------------------
QCR2_YEAST/17-163--------------------------------------------------------------------------------
PQQL_HAEIN/45-188--------------------------------------------------------------------------------
UCR1_CAEEL/48-195--------------------------------------------------------------------------------
MPPA_SOLTU/85-231--------------------------------------------------------------------------------
MPPA_NEUCR/62-209--------------------------------------------------------------------------------
PQQL_ECOLI/46-204--------------------------------------------------------------------------------
MPPA_HUMAN/77-227--------------------------------------------------------------------------------
QCR2_BOVIN/48-194--------------------------------------------------------------------------------
QCR1_YEAST/37-182--------------------------------------------------------------------------------
A6T9H3_KLEP7/17-153--------------------------------------------------------------------------------
Q4K4V3_PSEF5/19-156--------------------------------------------------------------------------------
U6GTY1_EIMAC/46-182--------------------------------------------------------------------------------

PF02664

R4KBP6_CLOPA/3-152--------------------------------------------------------------------------------
R5KFX1_9CLOT/3-152--------------------------------------------------------------------------------
R5PX34_9BACT/3-152--------------------------------------------------------------------------------
R6C8S4_9CLOT/3-152--------------------------------------------------------------------------------
R6PKX1_9FIRM/2-152--------------------------------------------------------------------------------
X2H624_9GAMM/3-155--------------------------------------------------------------------------------
D7CY71_TRURR/20-171--------------------------------------------------------------------------------
R5RBB5_9FIRM/3-152--------------------------------------------------------------------------------
LUXS_WOLSU/3-156--------------------------------------------------------------------------------
LUXS_LEUMM/6-151--------------------------------------------------------------------------------
C4Z400_EUBE2/3-154--------------------------------------------------------------------------------
D5V4X1_ARCNC/3-156--------------------------------------------------------------------------------
LUXS_STRSY/6-152--------------------------------------------------------------------------------
R6HDC0_9CLOT/3-145--------------------------------------------------------------------------------
R5YRN6_9FIRM/3-151--------------------------------------------------------------------------------
LUXS_PORGI/3-152--------------------------------------------------------------------------------
E6TVC8_BACCJ/6-152--------------------------------------------------------------------------------
R7HNK7_9BACT/3-153--------------------------------------------------------------------------------
G9WH82_9LACT/3-148--------------------------------------------------------------------------------
LUXS_SULDN/3-156--------------------------------------------------------------------------------
LUXS_BORBU/3-151--------------------------------------------------------------------------------
LUXS_HALH3/5-151--------------------------------------------------------------------------------
F2FAS1_SOLSS/7-150--------------------------------------------------------------------------------
B9L8B0_NAUPA/3-151--------------------------------------------------------------------------------
A9KLE6_CLOPH/4-152--------------------------------------------------------------------------------
R6ITR1_9FIRM/3-144--------------------------------------------------------------------------------
R6DD03_9FIRM/3-147--------------------------------------------------------------------------------
D6XTF8_BACIE/6-147--------------------------------------------------------------------------------
U5RPD3_9CLOT/3-152--------------------------------------------------------------------------------
C7MPF8_CRYCD/3-154--------------------------------------------------------------------------------
R7IRY5_9FIRM/3-152--------------------------------------------------------------------------------
R6PNN5_9FIRM/2-151--------------------------------------------------------------------------------
E4TXP8_SULKY/3-156--------------------------------------------------------------------------------
R5WFL1_9CLOT/3-152--------------------------------------------------------------------------------
R6C5U0_9BACT/3-152--------------------------------------------------------------------------------
LUXS_STAA8/5-151--------------------------------------------------------------------------------
E3HCL4_ILYPC/3-153--------------------------------------------------------------------------------
R6YLM9_9FIRM/3-152--------------------------------------------------------------------------------
K4RLT5_HELHE/5-148--------------------------------------------------------------------------------
D2RNA7_ACIFV/6-149--------------------------------------------------------------------------------
E3EF50_PAEPS/3-144--------------------------------------------------------------------------------
R5FL10_9BACT/3-152--------------------------------------------------------------------------------
E6X176_NITSE/3-156--------------------------------------------------------------------------------
F2JMN8_CELLD/3-147--------------------------------------------------------------------------------
R6GXR5_9FIRM/3-148--------------------------------------------------------------------------------
C3PK03_CORA7/11-156--------------------------------------------------------------------------------
R5NSS3_9FIRM/3-152--------------------------------------------------------------------------------
H6LD48_ACEWD/3-152--------------------------------------------------------------------------------
R6MPS4_9FIRM/7-150--------------------------------------------------------------------------------
R7MKY1_9FIRM/3-145--------------------------------------------------------------------------------
LUXS_SHELP/3-156--------------------------------------------------------------------------------
F2NTN2_TRES6/7-150--------------------------------------------------------------------------------
LUXS_CAMJE/3-156--------------------------------------------------------------------------------
R5KBK1_9CLOT/3-152--------------------------------------------------------------------------------
LUXS_CHRSD/7-153--------------------------------------------------------------------------------
R6TY31_9FIRM/3-145--------------------------------------------------------------------------------
F2NKV7_MARHT/3-150--------------------------------------------------------------------------------
LUXS_PEDPA/3-148--------------------------------------------------------------------------------
E4UA16_OCEP5/3-147--------------------------------------------------------------------------------
R5KTK9_9CLOT/3-145--------------------------------------------------------------------------------
A5HZR8_CLOBH/3-148--------------------------------------------------------------------------------
R5ED85_9CLOT/3-152--------------------------------------------------------------------------------
C5ZWA6_9HELI/3-153--------------------------------------------------------------------------------
LUXS_OCEIH/6-147--------------------------------------------------------------------------------
C4L419_EXISA/5-147--------------------------------------------------------------------------------
D2NNT8_ROTMD/39-183--------------------------------------------------------------------------------
R6LCE1_9FIRM/3-152--------------------------------------------------------------------------------
R5CNL9_9FIRM/3-152--------------------------------------------------------------------------------
R6MQH5_9FIRM/3-145--------------------------------------------------------------------------------
F9YSB4_CAPCC/3-151--------------------------------------------------------------------------------
B1HRL0_LYSSC/7-150--------------------------------------------------------------------------------
LUXS_SULNB/3-156--------------------------------------------------------------------------------
LUXS_LACLA/3-148--------------------------------------------------------------------------------
I0FCF7_BORCA/3-151--------------------------------------------------------------------------------
LUXS_HELPY/7-153--------------------------------------------------------------------------------
R6R1H2_9FIRM/3-152--------------------------------------------------------------------------------
F4BP26_CARS1/6-149--------------------------------------------------------------------------------
F5YFP3_TREAZ/3-151--------------------------------------------------------------------------------
LUXS_BACSU/3-154--------------------------------------------------------------------------------
D4KC03_9FIRM/3-145--------------------------------------------------------------------------------
R6HYL9_9FIRM/3-148--------------------------------------------------------------------------------
C7NBV6_LEPBD/3-152--------------------------------------------------------------------------------
LUXS_ACTP2/3-157--------------------------------------------------------------------------------
R6NAG0_9FIRM/3-152--------------------------------------------------------------------------------
R6RZY0_9FIRM/3-152--------------------------------------------------------------------------------
R7DJC7_9PORP/3-152--------------------------------------------------------------------------------
E8NGC1_MICTS/3-149--------------------------------------------------------------------------------
G4L3V1_TETHN/3-149--------------------------------------------------------------------------------
LUXS_THICR/3-156--------------------------------------------------------------------------------
R5WY94_9FIRM/3-152--------------------------------------------------------------------------------
E1STH1_FERBD/3-156--------------------------------------------------------------------------------
R6RGY7_9CLOT/3-152--------------------------------------------------------------------------------
V5WDC5_9SPIO/3-152--------------------------------------------------------------------------------
R7FSM8_9FIRM/3-152--------------------------------------------------------------------------------
E0S2G2_BUTPB/3-152--------------------------------------------------------------------------------
E3GFJ9_EUBLK/3-152--------------------------------------------------------------------------------
LUXS_CAMC1/3-156--------------------------------------------------------------------------------
LUXS_HAEIN/3-156--------------------------------------------------------------------------------
F8EYR0_TRECH/3-151--------------------------------------------------------------------------------
R5IHR6_9CLOT/3-148--------------------------------------------------------------------------------
LUXS_CLOB8/3-152--------------------------------------------------------------------------------
I6T8S7_ENTHA/4-150--------------------------------------------------------------------------------
E1VUH9_ARTAR/8-152--------------------------------------------------------------------------------
R6MF87_9BACE/3-152--------------------------------------------------------------------------------
F4LMA9_TREBD/3-152--------------------------------------------------------------------------------
LUXS_HELHP/3-152--------------------------------------------------------------------------------
R7FC53_9FIRM/3-148--------------------------------------------------------------------------------
R6A5W4_9BACT/3-149--------------------------------------------------------------------------------
F4HBP5_GALAU/3-155--------------------------------------------------------------------------------
LUXS_PROAC/6-150--------------------------------------------------------------------------------
G9ALV8_PANAN/3-156--------------------------------------------------------------------------------
LUXS_ECOLI/3-156--------------------------------------------------------------------------------
D3FYW3_BACPE/3-149--------------------------------------------------------------------------------
D9SL03_CLOC7/3-145--------------------------------------------------------------------------------
R6WDX5_9FIRM/3-150--------------------------------------------------------------------------------
LUXS_CAMHC/3-156--------------------------------------------------------------------------------
R5T4J5_9CLOT/3-152--------------------------------------------------------------------------------
LUXS_DESPS/3-152--------------------------------------------------------------------------------
D1AKY0_SEBTE/5-153--------------------------------------------------------------------------------
F8A102_CELGA/6-151--------------------------------------------------------------------------------
F0LWD7_VIBFN/3-156--------------------------------------------------------------------------------
X2HF86_9NEIS/3-156--------------------------------------------------------------------------------
G2TLR1_BACCO/8-154--------------------------------------------------------------------------------
R7LH99_9BACT/3-152--------------------------------------------------------------------------------
R5GZ39_9FIRM/3-152--------------------------------------------------------------------------------
R5EUY8_9GAMM/3-152--------------------------------------------------------------------------------
X4RAQ7_9ACTO/5-148--------------------------------------------------------------------------------
R5ZCW6_9FIRM/3-152--------------------------------------------------------------------------------
LUXS_BIFLO/10-155--------------------------------------------------------------------------------
R7EJJ6_9BACE/3-152--------------------------------------------------------------------------------
W6ETW6_SULMU/3-156--------------------------------------------------------------------------------
LUXS_CLOAB/3-151--------------------------------------------------------------------------------
R6BK52_9CLOT/3-146--------------------------------------------------------------------------------
R6PJD2_9CLOT/3-152--------------------------------------------------------------------------------
R6A2L5_9ACTN/3-154--------------------------------------------------------------------------------
LUXS_AERHH/3-156--------------------------------------------------------------------------------
W0DSV4_9GAMM/3-156--------------------------------------------------------------------------------
LUXS_CAMFF/3-156--------------------------------------------------------------------------------
LUXS_CLOPE/3-144--------------------------------------------------------------------------------
LUXS_HAEDU/3-157--------------------------------------------------------------------------------
D6ZJM3_MOBCV/7-149--------------------------------------------------------------------------------
I1YS81_PREI7/3-152--------------------------------------------------------------------------------
R5PFW0_9BACT/3-151--------------------------------------------------------------------------------
R5EUU6_9FIRM/3-151--------------------------------------------------------------------------------
R5D5F7_9FIRM/3-152--------------------------------------------------------------------------------
W5XUN8_9CORY/9-154--------------------------------------------------------------------------------
R5L929_9FIRM/3-152--------------------------------------------------------------------------------
LUXS_DEIRA/6-150--------------------------------------------------------------------------------
R6UZ21_9FIRM/3-147--------------------------------------------------------------------------------
X4ZFG7_9BACL/3-145--------------------------------------------------------------------------------
R5UP43_9PORP/3-152--------------------------------------------------------------------------------
D7BBC0_MEISD/6-153--------------------------------------------------------------------------------
A5N8G9_CLOK5/3-154--------------------------------------------------------------------------------
D7GDL7_PROFC/6-150--------------------------------------------------------------------------------
LUXS_LISMO/6-150--------------------------------------------------------------------------------
LUXS_FINM2/3-149--------------------------------------------------------------------------------
R5U9A0_9FIRM/3-152--------------------------------------------------------------------------------
R6FMJ5_9FIRM/3-152--------------------------------------------------------------------------------
R5QFC8_9FIRM/3-152--------------------------------------------------------------------------------
R6UMD9_9CLOT/3-146--------------------------------------------------------------------------------
R7I6H9_9CLOT/3-150--------------------------------------------------------------------------------
R7J0C3_9BACT/3-152--------------------------------------------------------------------------------
A6Q5E8_NITSB/3-156--------------------------------------------------------------------------------

PF05193

MPPA_SCHPO/216-408--------------------------------------------------------------------------------
QCR1_MOUSE/210-395--------------------------------------------------------------------------------
IDE_HUMAN/236-418--------------------------------------------------------------------------------
IDE_HUMAN/706-889--------------------------------------------------------------------------------
YMFH_BACSU/182-363--------------------------------------------------------------------------------
YMXG_BACSU/165-338--------------------------------------------------------------------------------
YQA4_CAEEL/603-787--------------------------------------------------------------------------------
QCR2_MOUSE/199-378--------------------------------------------------------------------------------
YQA4_CAEEL/200-382--------------------------------------------------------------------------------
PREP1_ARATH/301-489--------------------------------------------------------------------------------
IDE_DROME/209-391--------------------------------------------------------------------------------
Q9YFN7_AERPE/166-342--------------------------------------------------------------------------------
IDE_DROME/679-863--------------------------------------------------------------------------------
Q9RRH6_DEIRA/141-315--------------------------------------------------------------------------------
PQQL_ECOLI/206-388--------------------------------------------------------------------------------
Q9X167_THEMA/162-335--------------------------------------------------------------------------------
Q9I6C2_PSEAE/203-388--------------------------------------------------------------------------------
MPPB_SCHPO/185-372--------------------------------------------------------------------------------
PXM16_ARATH/666-854--------------------------------------------------------------------------------
Q9KUG7_VIBCH/219-398--------------------------------------------------------------------------------
O50511_STRCO/185-366--------------------------------------------------------------------------------
PTRA_ECOLI/681-858--------------------------------------------------------------------------------
MPPB_NEUCR/203-391--------------------------------------------------------------------------------
Q9RRH5_DEIRA/126-298--------------------------------------------------------------------------------
QCR2_NEUCR/198-375--------------------------------------------------------------------------------
Q985V3_RHILO/166-339--------------------------------------------------------------------------------
Q9FJT9_ARATH/639-833--------------------------------------------------------------------------------
Q23295_CAEEL/192-374--------------------------------------------------------------------------------
CYM1_YEAST/735-911--------------------------------------------------------------------------------
O67308_AQUAE/184-360--------------------------------------------------------------------------------
O84812_CHLTR/225-408--------------------------------------------------------------------------------
P73670_SYNY3/182-362--------------------------------------------------------------------------------
Q9VP94_DROME/242-425--------------------------------------------------------------------------------
Q97II7_CLOAB/206-391--------------------------------------------------------------------------------
YPD1_CAEEL/194-376--------------------------------------------------------------------------------
Q9VYT3_DROME/284-473--------------------------------------------------------------------------------
MPPA_HUMAN/232-431--------------------------------------------------------------------------------
MPPA_YEAST/181-374--------------------------------------------------------------------------------
Q9VFF0_DROME/203-385--------------------------------------------------------------------------------
MPPB_YEAST/189-380--------------------------------------------------------------------------------
O83069_TREPA/199-385--------------------------------------------------------------------------------
O25656_HELPY/198-379--------------------------------------------------------------------------------
Y228_BORBU/711-879--------------------------------------------------------------------------------
Q9A579_CAUCR/219-397--------------------------------------------------------------------------------
MPPA2_ARATH/235-419--------------------------------------------------------------------------------
PXM16_ARATH/198-379--------------------------------------------------------------------------------
Q9PF62_XYLFA/244-422--------------------------------------------------------------------------------
Q9CE72_LACLA/168-341--------------------------------------------------------------------------------
Q9RWP9_DEIRA/229-413--------------------------------------------------------------------------------
PTRA_ECOLI/213-396--------------------------------------------------------------------------------
Q97IL0_CLOAB/163-340--------------------------------------------------------------------------------
Q17593_CAEEL/199-381--------------------------------------------------------------------------------
Q9A2H7_CAUCR/672-850--------------------------------------------------------------------------------
Q9A531_CAUCR/720-903--------------------------------------------------------------------------------
Q9HT96_PSEAE/190-362--------------------------------------------------------------------------------
Q9I6C3_PSEAE/229-405--------------------------------------------------------------------------------
STE23_YEAST/246-428--------------------------------------------------------------------------------
Q9KUG7_VIBCH/686-864--------------------------------------------------------------------------------
Q9KQC8_VIBCH/661-839--------------------------------------------------------------------------------
PQQL_HAEIN/205-388--------------------------------------------------------------------------------
MPPA_SOLTU/236-422--------------------------------------------------------------------------------
YAN2_SCHPO/193-378--------------------------------------------------------------------------------
NRDC_HUMAN/837-1020--------------------------------------------------------------------------------
O84831_CHLTR/201-385--------------------------------------------------------------------------------
Q9A579_CAUCR/657-835--------------------------------------------------------------------------------
Q9FIH8_ARATH/360-598--------------------------------------------------------------------------------
Q9A531_CAUCR/246-428--------------------------------------------------------------------------------
CYM1_YEAST/221-407--------------------------------------------------------------------------------
Q97EV0_CLOAB/207-392--------------------------------------------------------------------------------
Q9VYT3_DROME/769-953--------------------------------------------------------------------------------
QCR1_YEAST/187-370--------------------------------------------------------------------------------
Q9VP94_DROME/724-907--------------------------------------------------------------------------------
O67945_AQUAE/183-355--------------------------------------------------------------------------------
Q9KRD3_VIBCH/199-378--------------------------------------------------------------------------------
Q9FIH8_ARATH/928-1156--------------------------------------------------------------------------------
MU138_SCHPO/668-850--------------------------------------------------------------------------------
NRDC_HUMAN/361-548--------------------------------------------------------------------------------
P74016_SYNY3/241-420--------------------------------------------------------------------------------
MU138_SCHPO/196-378--------------------------------------------------------------------------------
Q55159_SYNY3/175-359--------------------------------------------------------------------------------
MPPA1_ARATH/239-423--------------------------------------------------------------------------------
O50512_STRCO/190-374--------------------------------------------------------------------------------
PQQL_HAEIN/680-857--------------------------------------------------------------------------------
O84831_CHLTR/717-886--------------------------------------------------------------------------------
Q9KA85_BACHD/165-338--------------------------------------------------------------------------------
P74305_SYNY3/274-453--------------------------------------------------------------------------------
Q9CML5_PASMU/205-388--------------------------------------------------------------------------------
MPPB_HUMAN/220-404--------------------------------------------------------------------------------
Y219_RICPR/168-341--------------------------------------------------------------------------------
O51486_BORBU/686-867--------------------------------------------------------------------------------
Q9A308_CAUCR/166-339--------------------------------------------------------------------------------
Q9KA98_BACHD/181-363--------------------------------------------------------------------------------
PQQF_PSEAE/179-352--------------------------------------------------------------------------------
YO098_YEAST/193-378--------------------------------------------------------------------------------
YHJJ_ECOLI/199-378--------------------------------------------------------------------------------
Q9KQC8_VIBCH/196-377--------------------------------------------------------------------------------
Q983M8_RHILO/208-384--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/246-424--------------------------------------------------------------------------------
Y4WA_RHISN/251-435--------------------------------------------------------------------------------
Y4WB_RHISN/198-374--------------------------------------------------------------------------------
MPPA_NEUCR/214-475--------------------------------------------------------------------------------
P73669_SYNY3/171-348--------------------------------------------------------------------------------
Q9CE73_LACLA/164-346--------------------------------------------------------------------------------
Q9KRD3_VIBCH/671-849--------------------------------------------------------------------------------
Q9RTZ9_DEIRA/703-883--------------------------------------------------------------------------------
UCR1_CAEEL/200-386--------------------------------------------------------------------------------
Q9PF62_XYLFA/714-895--------------------------------------------------------------------------------
MPPA_RAT/231-430--------------------------------------------------------------------------------
O51486_BORBU/206-392--------------------------------------------------------------------------------
PQQL_ECOLI/683-863--------------------------------------------------------------------------------
O16249_CAEEL/747-931--------------------------------------------------------------------------------
Q97LA3_CLOAB/174-348--------------------------------------------------------------------------------
Q983M9_RHILO/206-390--------------------------------------------------------------------------------
Q9A2H7_CAUCR/210-390--------------------------------------------------------------------------------
O16249_CAEEL/258-440--------------------------------------------------------------------------------
Q97GF6_CLOAB/170-348--------------------------------------------------------------------------------
PREP_DROME/268-457--------------------------------------------------------------------------------
STE23_YEAST/716-898--------------------------------------------------------------------------------
Y228_BORBU/195-380--------------------------------------------------------------------------------
Q9CML5_PASMU/680-857--------------------------------------------------------------------------------
Q9KA97_BACHD/184-365--------------------------------------------------------------------------------
Y5738_STRCO/198-380--------------------------------------------------------------------------------
O25371_HELPY/185-361--------------------------------------------------------------------------------
B9PUJ6_TOXGO/295-477--------------------------------------------------------------------------------
C5AQL6_METEA/203-385--------------------------------------------------------------------------------
F4HNU6_ARATH/734-916--------------------------------------------------------------------------------
F4J3D9_ARATH/200-377--------------------------------------------------------------------------------
M0ZLN7_SOLTU/259-444--------------------------------------------------------------------------------
M1CRA1_SOLTU/262-448--------------------------------------------------------------------------------
Y2782_MYCTU/179-354--------------------------------------------------------------------------------
Q2FZ15_STAA8/181-362--------------------------------------------------------------------------------
Q2FZ16_STAA8/180-353--------------------------------------------------------------------------------
Q76NL8_PLAF7/282-509--------------------------------------------------------------------------------
Q7MXI9_PORGI/690-872--------------------------------------------------------------------------------
Q89V74_BRADU/167-339--------------------------------------------------------------------------------
Q8DMX5_STRR6/179-350--------------------------------------------------------------------------------
Q8DMX6_STRR6/187-363--------------------------------------------------------------------------------
Q99XH8_STRP1/184-361--------------------------------------------------------------------------------
U6GTY1_EIMAC/205-387--------------------------------------------------------------------------------

PF03410

Q6TUW3_YMTV5/1-588DYETVGNDLYITLSFVKENDYENFINGVSTLKFDDVTDYSFFSL.CDDFLMNI--------------------YLCFPWL
Q6TVT3_ORFSA/1-598DYETVGEDLFVVLSFVDESDYDGLLRGIKDLPI.AATPDTRICFDAEDYAMNA--------------------YLNFPWM
Q08FU3_DPV83/1-596DYETVGDQLYITISFVKEHEYDNFLKGVSMLKF..IPDEIKFNH.SDDFLMNL--------------------YLCFPWI
Q8V3P7_SWPV1/1-592DYETVGDQLYITISFIDEKDYESILKGISRIRL.HIDREIMMKH.TDDFLMNI--------------------YLCFPWI
MP44_FOWPN/1-623DYETISDKLYVCISFANEDQYEYLLYNIKDMDF..NINRIELDL.GEDYIMNL--------------------YINFPWL
MP44_MYXVL/1-589DYETVDNKLYVTFSFIHEHDYERFLQGSGRLNL.TIYKKIRLCY.GDDFLMNV--------------------YLSFPCI
MP44_MCV1/1-592DYETLGERLYVSFAFVHEQDCEAFLRNVGELRF.EPAPRVELNY.SDDYVMNL--------------------YVNFPWL
G1_VAR67/1-591DYETIGNQLYLTVSFIDETEYESFLRGEAILQI.SQCQRINMNY.SDDYMMNI--------------------YLNFPWL

PF00675

AXL1_YEAST/34-179---------------------------------------------....EIYA--------------------IQSEH..
IDE_HUMAN/74-212---------------------------------------------....EVNA--------------------VDSEH..
YMXG_BACSU/12-160---------------------------------------------VVYEEIKM--------------------YEDAP..
YQA4_CAEEL/37-175---------------------------------------------....EVCA--------------------VNCEY..
IDE_DROME/47-185---------------------------------------------....EINA--------------------VNSEH..
MPPA_YEAST/29-176---------------------------------------------SAEYEIDE--------------------VWMKP..
NRDC_RAT/210-348---------------------------------------------....EVEA--------------------VDSEY..
PTRA_ECOLI/54-192---------------------------------------------....ERNA--------------------VNAEL..
QCR1_BOVIN/58-205---------------------------------------------VILQELQE--------------------NDTSM..
MPPB_NEUCR/50-198---------------------------------------------VILRESEE--------------------VEKQL..
MPPB_RAT/68-215---------------------------------------------VILREMQE--------------------VETNL..
MPPB_YEAST/36-184---------------------------------------------VIIRESEE--------------------VDKMY..
QCR2_YEAST/17-163---------------------------------------------AARYDYAV--------------------AEQCP..
PQQL_HAEIN/45-188---------------------------------------------....ERGV--------------------VQEEW..
UCR1_CAEEL/48-195---------------------------------------------NLLKELEA--------------------SDDYH..
MPPA_SOLTU/85-231---------------------------------------------KVKAEISE--------------------YSKNP..
MPPA_NEUCR/62-209---------------------------------------------TAQYEVNE--------------------IWSKA..
PQQL_ECOLI/46-204---------------------------------------------ITEEWRAH--------------------QDAKWRT
MPPA_HUMAN/77-227---------------------------------------------AVQFELED--------------------LNLRPDP
QCR2_BOVIN/48-194---------------------------------------------QPQLRIDK--------------------AVALQNP
QCR1_YEAST/37-182---------------------------------------------SVLKQVQD--------------------FEEND.H
A6T9H3_KLEP7/17-153---------------------------------------------....EVAV--------------------IDAEY..
Q4K4V3_PSEF5/19-156---------------------------------------------....EREV--------------------LHAEF..
U6GTY1_EIMAC/46-182---------------------------------------------....EVNA--------------------IDAEH..

PF02664

R4KBP6_CLOPA/3-152---------------------------------------------..IPGAAA.R-------------DCGNYLDMNLPM
R5KFX1_9CLOT/3-152---------------------------------------------..IPGANP.R-------------ECGNYQDMNLNM
R5PX34_9BACT/3-152---------------------------------------------..VPGAAP.Q-------------DCGNWLLHDLPM
R6C8S4_9CLOT/3-152---------------------------------------------..VPGASP.K-------------DCGNYLDMNLPM
R6PKX1_9FIRM/2-152---------------------------------------------..VPATTS.K-------------ECGNYLDHNLTL
X2H624_9GAMM/3-155---------------------------------------------NQIPELNE.Y-------------QCGTYKMHSLDE
D7CY71_TRURR/20-171---------------------------------------------GEIPGCSE.R-------------ACGNYRDHSLPG
R5RBB5_9FIRM/3-152---------------------------------------------..VPGASA.K-------------DCGNYLDMNLPM
LUXS_WOLSU/3-156---------------------------------------------EEIPELNI.Y-------------QCGTACMHSLKE
LUXS_LEUMM/6-151---------------------------------------------TEVPAAEI.E-------------SCGNYKDHSLHS
C4Z400_EUBE2/3-154---------------------------------------------TPIPGYSP.R-------------DCGNYLDNNLKL
D5V4X1_ARCNC/3-156---------------------------------------------EDIPELNI.Y-------------QCGTCNMHSLEE
LUXS_STRSY/6-152---------------------------------------------EDVPGTTI.E-------------SCGNYKDHSLHS
R6HDC0_9CLOT/3-145---------------------------------------------..LPGNTE.V-------------ECGNYLEHDVNK
R5YRN6_9FIRM/3-151---------------------------------------------..IPGASA.K-------------DCGNYLDLNLYM
LUXS_PORGI/3-152---------------------------------------------..VPGTEP.R-------------DCGNCLLHNLPM
E6TVC8_BACCJ/6-152---------------------------------------------TEVPACNE.V-------------QCGWAASHSLDG
R7HNK7_9BACT/3-153---------------------------------------------..IPGATP.R-------------DCGNYLLNNLPM
G9WH82_9LACT/3-148---------------------------------------------SDIQGVSA.K-------------TCGNYKDHSLHS
LUXS_SULDN/3-156---------------------------------------------KDIPELNV.Y-------------QCGTYKMHSLED
LUXS_BORBU/3-151---------------------------------------------..IPGASD.K-------------ECGNYKEHNLDM
LUXS_HALH3/5-151---------------------------------------------TEVPACNE.V-------------QCGFAASHSLEG
F2FAS1_SOLSS/7-150---------------------------------------------TAVPACNE.V-------------QCGWAASHSLEG
B9L8B0_NAUPA/3-151---------------------------------------------DTIPEANV.Y-------------QCGSCYMHSLDG
A9KLE6_CLOPH/4-152---------------------------------------------..IPGAAA.I-------------HCGNYLDMNLPM
R6ITR1_9FIRM/3-144---------------------------------------------PEMFGASR.K-------------ECGNYKELSIEA
R6DD03_9FIRM/3-147---------------------------------------------..MPGKSA.K-------------ECGNYRNLDVEL
D6XTF8_BACIE/6-147---------------------------------------------DEVPACNE.L-------------QCGWAASHSLEG
U5RPD3_9CLOT/3-152---------------------------------------------..VPGAAA.K-------------DCGNYLDMNLSM
C7MPF8_CRYCD/3-154---------------------------------------------..VPGARP.E-------------ECGNYHDSDLPQ
R7IRY5_9FIRM/3-152---------------------------------------------..VPGASA.R-------------DCGNYLDMNLPM
R6PNN5_9FIRM/2-151---------------------------------------------..IPAAKA.E-------------MCGNYLDHNLEI
E4TXP8_SULKY/3-156---------------------------------------------NDIPELNI.Y-------------QCGTYKMHSLED
R5WFL1_9CLOT/3-152---------------------------------------------..VPGAAP.E-------------CCGNYLDLNLPM
R6C5U0_9BACT/3-152---------------------------------------------..IPGQAA.K-------------DCGNYLLHDLPM
LUXS_STAA8/5-151---------------------------------------------TEVPACNE.V-------------QCGWAASHSLEG
E3HCL4_ILYPC/3-153---------------------------------------------..IPGATA.R-------------DCGNYLDMNLPM
R6YLM9_9FIRM/3-152---------------------------------------------..IPGAAP.E-------------ACGNYLDLNLPM
K4RLT5_HELHE/5-148---------------------------------------------KEVPACNE.I-------------QCGFAASHSLEG
D2RNA7_ACIFV/6-149---------------------------------------------DQVPGTKE.K-------------ECGNYKDHSLFC
E3EF50_PAEPS/3-144---------------------------------------------TEVPAVTA.L-------------ECGNYKDHSLFS
R5FL10_9BACT/3-152---------------------------------------------..IPGAAP.R-------------DCGNYLLHDLPM
E6X176_NITSE/3-156---------------------------------------------EAIPELNI.Y-------------QCGSCKMHSLDE
F2JMN8_CELLD/3-147---------------------------------------------..IPGATA.R-------------DCGNYLDLNLPM
R6GXR5_9FIRM/3-148---------------------------------------------..IPGAAA.R-------------DCGNYLDQNLPM
C3PK03_CORA7/11-156---------------------------------------------TEVPAANE.V-------------QCGWGAHHSLEG
R5NSS3_9FIRM/3-152---------------------------------------------..VPGASA.R-------------DCGNYLDMNLPM
H6LD48_ACEWD/3-152---------------------------------------------..IPGASP.R-------------DCGNYLDMNLSM
R6MPS4_9FIRM/7-150---------------------------------------------..IPGSRR.W-------------ECGNYLEHDLPG
R7MKY1_9FIRM/3-145---------------------------------------------..IPGVSE.K-------------ECGNYREHDLEG
LUXS_SHELP/3-156---------------------------------------------SEIPELNE.Y-------------QCGTYEMHSLEQ
F2NTN2_TRES6/7-150---------------------------------------------KEIPGSTE.V-------------ECGNYKDHDLEG
LUXS_CAMJE/3-156---------------------------------------------SKIPELNI.Y-------------QCGTCAMHSLDE
R5KBK1_9CLOT/3-152---------------------------------------------..VPGASP.R-------------DCGNYLDMNLPM
LUXS_CHRSD/7-153---------------------------------------------KEVPACNE.M-------------QCGWAASHSLEG
R6TY31_9FIRM/3-145---------------------------------------------..VFGAAR.K-------------ECGNYRELDLQS
F2NKV7_MARHT/3-150---------------------------------------------GAVPGASA.L-------------ECGNYRDHNLKA
LUXS_PEDPA/3-148---------------------------------------------EDVPGTDI.Y-------------SCGNYRDHSLFS
E4UA16_OCEP5/3-147---------------------------------------------GPVPAANP.L-------------ECGNYRDHDLEE
R5KTK9_9CLOT/3-145---------------------------------------------..IPGATM.K-------------ECGNCKDHNLAQ
A5HZR8_CLOBH/3-148---------------------------------------------EEVPATNA.V-------------QCGNYRDHSLFS
R5ED85_9CLOT/3-152---------------------------------------------..VPGACA.R-------------DCGNYLDMNLPM
C5ZWA6_9HELI/3-153---------------------------------------------NEIPEANE.L-------------QCGTYKMHSLDA
LUXS_OCEIH/6-147---------------------------------------------TEVPACNE.V-------------QCGWAANHSLLG
C4L419_EXISA/5-147---------------------------------------------EELPAQNP.V-------------QCGNANHHDFEG
D2NNT8_ROTMD/39-183---------------------------------------------TEVPAANE.V-------------QCGWGANHTLEG
R6LCE1_9FIRM/3-152---------------------------------------------..VPGAAA.K-------------DCGNYLDMNLPM
R5CNL9_9FIRM/3-152---------------------------------------------..IPGAAA.R-------------DCGNYLDQNLGM
R6MQH5_9FIRM/3-145---------------------------------------------..IPGNTA.A-------------ECGNYKEHDFNG
F9YSB4_CAPCC/3-151---------------------------------------------..IPGASA.L-------------ECGNFYNNNLPM
B1HRL0_LYSSC/7-150---------------------------------------------TAVPACNE.V-------------QCGWAASHSLEG
LUXS_SULNB/3-156---------------------------------------------KDIPELNV.Y-------------QCGSYKMHSLKE
LUXS_LACLA/3-148---------------------------------------------DNVPGVAE.K-------------ECGNYRNHSLFG
I0FCF7_BORCA/3-151---------------------------------------------..VIGATE.K-------------ECGNYQDHNLNM
LUXS_HELPY/7-153---------------------------------------------TEVPASNE.K-------------QCGWAANHTLEG
R6R1H2_9FIRM/3-152---------------------------------------------..IPGATA.R-------------DCGNYLDNNLSL
F4BP26_CARS1/6-149---------------------------------------------TEVPASNE.T-------------QCGWAAHHTLEG
F5YFP3_TREAZ/3-151---------------------------------------------..IPGAAP.G-------------ECGNYSEQNLGM
LUXS_BACSU/3-154---------------------------------------------TEIPAANE.K-------------QCGQAKLHDLEG
D4KC03_9FIRM/3-145---------------------------------------------..VPGASE.V-------------ECGNYRDMDLPA
R6HYL9_9FIRM/3-148---------------------------------------------..VPGAAA.R-------------DCGNYLDMNLPM
C7NBV6_LEPBD/3-152---------------------------------------------..IPGATA.I-------------ECGNYLDQNLPM
LUXS_ACTP2/3-157---------------------------------------------SKIPELNE.Y-------------QCGSYKEHSLEE
R6NAG0_9FIRM/3-152---------------------------------------------..VPGASA.K-------------DCGNYLDMNLNM
R6RZY0_9FIRM/3-152---------------------------------------------..IPGAAA.R-------------DCGNYLDQNLGM
R7DJC7_9PORP/3-152---------------------------------------------..IPGAAP.Q-------------DCGNYLLHDLPM
E8NGC1_MICTS/3-149---------------------------------------------DDVPGTDA.F-------------SCGNYRDHSLHS
G4L3V1_TETHN/3-149---------------------------------------------EDVQGVDI.T-------------SCGNYRDHSLFS
LUXS_THICR/3-156---------------------------------------------EDIPELNE.Y-------------QCGTYTMHSLEE
R5WY94_9FIRM/3-152---------------------------------------------..IPGASA.K-------------DCGNYLDMNLNM
E1STH1_FERBD/3-156---------------------------------------------NKIPELNE.Y-------------QCGTYAMHSLAE
R6RGY7_9CLOT/3-152---------------------------------------------..IPGAAA.R-------------DCGNYLDMNLPM
V5WDC5_9SPIO/3-152---------------------------------------------..IPGAAA.K-------------DCGNYLSHNLTM
R7FSM8_9FIRM/3-152---------------------------------------------..VPGAAA.K-------------DCGNYLDMNLPM
E0S2G2_BUTPB/3-152---------------------------------------------..VPGASA.R-------------DCGNYLDMNLGM
E3GFJ9_EUBLK/3-152---------------------------------------------..VPGAAP.R-------------DCGNYLDMNLGM
LUXS_CAMC1/3-156---------------------------------------------DKIPELNK.F-------------QCGTYKMHSLDE
LUXS_HAEIN/3-156---------------------------------------------ASIPELNI.Y-------------QCGSYTEHSLED
F8EYR0_TRECH/3-151---------------------------------------------..IPGASA.A-------------ECGNWRDHNLDM
R5IHR6_9CLOT/3-148---------------------------------------------..VPGASP.K-------------DCGNYLDMNLGM
LUXS_CLOB8/3-152---------------------------------------------..IPGASA.K-------------DCGNYLDMNLPM
I6T8S7_ENTHA/4-150---------------------------------------------TELPASNE.T-------------QCGWAASHTLEG
E1VUH9_ARTAR/8-152---------------------------------------------EDVPGTEA.V-------------SCGNYRDHSLHS
R6MF87_9BACE/3-152---------------------------------------------..VPGASA.K-------------DCGNYLMMNLPM
F4LMA9_TREBD/3-152---------------------------------------------..VPGASA.K-------------DCGNYLDMNLPM
LUXS_HELHP/3-152---------------------------------------------KDIPELNI.Y-------------QCGTAKMHSLKE
R7FC53_9FIRM/3-148---------------------------------------------..IPGGKR.W-------------ECGNYLAHDLEG
R6A5W4_9BACT/3-149---------------------------------------------..IPGATE.R-------------DCGNYLLQDLPM
F4HBP5_GALAU/3-155---------------------------------------------KEIPELNQ.Y-------------QCGTYTEHSLVE
LUXS_PROAC/6-150---------------------------------------------NTTPAANE.V-------------QCGWGANHSIKA
G9ALV8_PANAN/3-156---------------------------------------------NQIPELNE.Y-------------QCGSYKLHSLDE
LUXS_ECOLI/3-156---------------------------------------------NQIPELNV.Y-------------QCGTYQMHSLQE
D3FYW3_BACPE/3-149---------------------------------------------EEVPAATE.K-------------QCGQAKLHDLKG
D9SL03_CLOC7/3-145---------------------------------------------EVIPATTA.V-------------ECGNYRDHSLFA
R6WDX5_9FIRM/3-150---------------------------------------------..VPGASA.K-------------DCGNHLDMNLPM
LUXS_CAMHC/3-156---------------------------------------------DDIPELNK.F-------------QCGSYKMHSLSE
R5T4J5_9CLOT/3-152---------------------------------------------..VPGAAA.R-------------DCGNYLDMNLGM
LUXS_DESPS/3-152---------------------------------------------..IPGESA.V-------------ECGNFRFMDLIQ
D1AKY0_SEBTE/5-153---------------------------------------------..IPGAAA.K-------------DCGNYLDQNLPM
F8A102_CELGA/6-151---------------------------------------------DAVPAANE.V-------------QCGWGANHTLEG
F0LWD7_VIBFN/3-156---------------------------------------------DQIPELNE.Y-------------QCGTAAMHSLNE
X2HF86_9NEIS/3-156---------------------------------------------SRIPELNR.Y-------------QCGSYTMHSLEE
G2TLR1_BACCO/8-154---------------------------------------------TEVPACNE.T-------------QCGWAASHSLEG
R7LH99_9BACT/3-152---------------------------------------------..IPGATA.Q-------------DCGTWLLHDLPM
R5GZ39_9FIRM/3-152---------------------------------------------..VPGAAA.K-------------DCGNYLDMNLPM
R5EUY8_9GAMM/3-152---------------------------------------------TVVPASNP.Y-------------QCGSCKLHSLEE
X4RAQ7_9ACTO/5-148---------------------------------------------TAVPAANE.V-------------QCGWGSHHSLAA
R5ZCW6_9FIRM/3-152---------------------------------------------..VPGASP.R-------------DCGNYLDMNLPL
LUXS_BIFLO/10-155---------------------------------------------DDVPATTE.K-------------SCGNYRDHSLFT
R7EJJ6_9BACE/3-152---------------------------------------------..VPGAAP.Q-------------DCGNYLLHDLPM
W6ETW6_SULMU/3-156---------------------------------------------NDIPELNI.Y-------------QCGTYKMHSLDE
LUXS_CLOAB/3-151---------------------------------------------..VPGAAA.R-------------DCGNYLDMNLPM
R6BK52_9CLOT/3-146---------------------------------------------..IPGSSR.I-------------ECGNYLDHSLPK
R6PJD2_9CLOT/3-152---------------------------------------------..IPGASA.K-------------DCGNYLDMNLPM
R6A2L5_9ACTN/3-154---------------------------------------------..VPGAAP.E-------------ECGNYLDQNLPM
LUXS_AERHH/3-156---------------------------------------------GKIPELNE.Y-------------QCGTYSMHSLEE
W0DSV4_9GAMM/3-156---------------------------------------------ADIPELNV.Y-------------QCGTCTMHSLDE
LUXS_CAMFF/3-156---------------------------------------------DDIPELNK.Y-------------QCGTCTLHSLDE
LUXS_CLOPE/3-144---------------------------------------------EEIPAANE.L-------------QCGSAKLHSLEL
LUXS_HAEDU/3-157---------------------------------------------TQIPELNI.Y-------------QCGTFSEHSLED
D6ZJM3_MOBCV/7-149---------------------------------------------NEVPAANE.V-------------QCGWGKSHSLAG
I1YS81_PREI7/3-152---------------------------------------------..IPGAAP.K-------------DCGNYLLHDLPM
R5PFW0_9BACT/3-151---------------------------------------------..VPGTEP.Q-------------DCGNYLLHDLPM
R5EUU6_9FIRM/3-151---------------------------------------------..VPGASP.K-------------DCGNYLDMNLSM
R5D5F7_9FIRM/3-152---------------------------------------------..VPGASA.R-------------DCGNYLDMNLPM
W5XUN8_9CORY/9-154---------------------------------------------TEVPAANE.V-------------QCGWGESHSLEG
R5L929_9FIRM/3-152---------------------------------------------..VPGACA.K-------------DCGNYLDMNLNM
LUXS_DEIRA/6-150---------------------------------------------QPIPGVSE.L-------------ECGNYRDHDLAA
R6UZ21_9FIRM/3-147---------------------------------------------..IPGAQESK-------------ECGNYLDHDLAK
X4ZFG7_9BACL/3-145---------------------------------------------ETVPAVSA.L-------------ECGNYKDHSLFG
R5UP43_9PORP/3-152---------------------------------------------..VPGAAP.R-------------DCGNYLLHDLPM
D7BBC0_MEISD/6-153---------------------------------------------GEIPGASE.L-------------ECGNYRNHDLTL
A5N8G9_CLOK5/3-154---------------------------------------------..IPGALP.K-------------DCGNYLDMNLPM
D7GDL7_PROFC/6-150---------------------------------------------DAVPAANV.V-------------QCGWGANHSLQG
LUXS_LISMO/6-150---------------------------------------------TEVPACNE.V-------------QCGWAASHSLEG
LUXS_FINM2/3-149---------------------------------------------..IPGQSA.K-------------DCGNYSDMNLSM
R5U9A0_9FIRM/3-152---------------------------------------------..VPGACA.K-------------DCGNFLDMNLPM
R6FMJ5_9FIRM/3-152---------------------------------------------..VPGACA.K-------------DCGNYLDMNLNM
R5QFC8_9FIRM/3-152---------------------------------------------..VPGASA.K-------------DCGNYLDMNLPM
R6UMD9_9CLOT/3-146---------------------------------------------..IPGDKK.E-------------ECGNYLDHDLHG
R7I6H9_9CLOT/3-150---------------------------------------------..VPGAAA.F-------------NCGNYLDMNLPM
R7J0C3_9BACT/3-152---------------------------------------------..IPGATA.R-------------DCGNYTFNDLPA
A6Q5E8_NITSB/3-156---------------------------------------------EEIPELNV.Y-------------QCGSCYMHSLNE

PF05193

MPPA_SCHPO/216-408---------------------------------------------..VETCMA-F..NHSYT......DSGL.FGMFVTI
QCR1_MOUSE/210-395---------------------------------------------..CQSFQT-F..NISYS......DTGL.LGAHFVC
IDE_HUMAN/236-418---------------------------------------------..VNTLVG-G..QKEGA.....RGFMF.FIINVDL
IDE_HUMAN/706-889---------------------------------------------..GYIVFS-G..PRRAN........GI.QGLRFII
YMFH_BACSU/182-363---------------------------------------------..IDETFS-F.DFTAEY......GFGF.AAIGGDT
YMXG_BACSU/165-338---------------------------------------------..AYSVYS-Y..HSSYE......DSGM.LTIYGGT
YQA4_CAEEL/603-787---------------------------------------------..GYNVST-E..SRLND........GN.VYLHVIV
QCR2_MOUSE/199-378---------------------------------------------..PFDVSA-F..NASYS......DSGL.FGIYTIS
YQA4_CAEEL/200-382---------------------------------------------..VISLEA-D.NHTIAS......GFGV.FSVTMDL
PREP1_ARATH/301-489---------------------------------------------..GEALVS-S..GLSDE.....LLQPQ.FGIGLKG
IDE_DROME/209-391---------------------------------------------..CNDLMA-G.HQNTQN......GFGF.FDIVVDL
Q9YFN7_AERPE/166-342---------------------------------------------..AYGFNV-D..VHITS.....WGSSM.SLIVLEG
IDE_DROME/679-863---------------------------------------------..GYIVFS-G..VRKVN........GA.NGIRIIV
Q9RRH6_DEIRA/141-315---------------------------------------------..ADSADL-G..HIEYR......DAGV.FEGGFSC
PQQL_ECOLI/206-388---------------------------------------------.TISGGTA-R.SVKIAP......DYQS.LFFRVNA
Q9X167_THEMA/162-335---------------------------------------------..VYDVFS-Q..IYALK......ETGI.IIVYAAL
Q9I6C2_PSEAE/203-388---------------------------------------------..VAGAST-Y..YDAFN.....RGDSL.FVLSATP
MPPB_SCHPO/185-372---------------------------------------------..ANSFMS-F..STSYS......DTGL.WGIYLVT
PXM16_ARATH/666-854---------------------------------------------..GYITAL-A..QRNDS........GI.YGVQFII
Q9KUG7_VIBCH/219-398---------------------------------------------..AVDAGA-F..QDCAE......LACT.FYVYAMA
O50511_STRCO/185-366---------------------------------------------..AAGFGL-L.RLAGAP......SLGW.LDVKTSG
PTRA_ECOLI/681-858---------------------------------------------..GYAVFA-F..PMSVG........RQ.WGMGFLL
MPPB_NEUCR/203-391---------------------------------------------..ATSFMS-F..STSYS......DTGL.WGIYLVT
Q9RRH5_DEIRA/126-298---------------------------------------------..AYEVSA-T..PLVLG......GEGF.VSLYAGS
QCR2_NEUCR/198-375---------------------------------------------.PGAEAFA-H..NYAYS......DAGL.LAIQITG
Q985V3_RHILO/166-339---------------------------------------------..CYSVYA-F..HWGFS......DTGI.FGVHAAT
Q9FJT9_ARATH/639-833---------------------------------------------.YSAEVSV-F..LGGNKPSRTADLRGD.ISVNFSC
Q23295_CAEEL/192-374---------------------------------------------..IEVFQS-F..NTCYK......ETGL.VGTYFVA
CYM1_YEAST/735-911---------------------------------------------..AYGGGA-S..YSALA........GI.FSFYSYR
O67308_AQUAE/184-360---------------------------------------------..VYSYSC-G..DMGRP......RDNI.FIITATF
O84812_CHLTR/225-408---------------------------------------------..ITEMEA-E..LYSTS.....HNTQD.FEILYKL
P73670_SYNY3/182-362---------------------------------------------..VFDIQS-C..FSLQK......EASL.FTINAYL
Q9VP94_DROME/242-425---------------------------------------------..CISVVA-G..VAESSFD.SNSIYSL.FNICIYL
Q97II7_CLOAB/206-391---------------------------------------------..GKDVFG-V..FDSSI......LKNT.FSIILKD
YPD1_CAEEL/194-376---------------------------------------------..ASSVSF-H..IA...EG.VRCDLRL.NFAGVPV
Q9VYT3_DROME/284-473---------------------------------------------..ALQLIA-G..IDENGFD.MNSMYSL.FNICIYL
MPPA_HUMAN/232-431---------------------------------------------..MYNATS-Y..HHSYE......DTGL.LCIHASA
MPPA_YEAST/181-374---------------------------------------------..VENCVA-F..NHSYS......DSGI.FGISLSC
Q9VFF0_DROME/203-385---------------------------------------------..CHSFQS-F..NTCYK......DTGL.WGIYFVC
MPPB_YEAST/189-380---------------------------------------------..ANSYMS-F..STSYA......DSGL.WGMYIVT
O83069_TREPA/199-385---------------------------------------------..GEDLYA-Y..NG...SH.IDLKRML.FFVGMTG
O25656_HELPY/198-379---------------------------------------------..ASQAFS-H..NMQLQ......DESV.FLFIAGG
Y228_BORBU/711-879---------------------------------------------..AYGASA-S..IA..N........GI.FSFASYR
Q9A579_CAUCR/219-397---------------------------------------------..ATAVGA-S..VSPSE......IGGQ.FIVTLTV
MPPA2_ARATH/235-419---------------------------------------------..FQSCTA-F..TSVFN......NTGL.FGIYGCT
PXM16_ARATH/198-379---------------------------------------------..ATGLSA-G.EGEWTL......DYSF.FKVSIDL
Q9PF62_XYLFA/244-422---------------------------------------------..ADSISA-G..ISPFA......LASQ.MQINADV
Q9CE72_LACLA/168-341---------------------------------------------..AYSISS-T..FDSFT........GF.LKIAAGI
Q9RWP9_DEIRA/229-413---------------------------------------------......GS-A..LADLSGYRDDFREAA.FAVGLKG
PTRA_ECOLI/213-396---------------------------------------------.EGISANS-D..PIVNG......NSGV.LAISASL
Q97IL0_CLOAB/163-340---------------------------------------------..AYDIYS-K..INNDG......GIKL.FYIGLGT
Q17593_CAEEL/199-381---------------------------------------------..ASSLKP-E.SKTIAA......GFGY.FNVTMDL
Q9A2H7_CAUCR/672-850---------------------------------------------..SYGAGS-S..LTPQG......QFGG.FSARVQT
Q9A531_CAUCR/720-903---------------------------------------------..TYSPNA-T.ATA...SV.VFDDWGY.LAVSLEV
Q9HT96_PSEAE/190-362---------------------------------------------..TYGPST-D..RQVFA......NQGF.FSLDADV
Q9I6C3_PSEAE/229-405---------------------------------------------..TYGIYS-G..FTAMQ......ARGP.FMINFQT
STE23_YEAST/246-428---------------------------------------------..ANELSA-G.GHTVSK......GNAF.FAVDIDL
Q9KUG7_VIBCH/686-864---------------------------------------------..TYGAGS-Y..FASNR......EIGA.IVFNAPV
Q9KQC8_VIBCH/661-839---------------------------------------------..GYMVGT-G..NMPLN.....RHPGLILYVQSPS
PQQL_HAEIN/205-388---------------------------------------------..VDSANF-Y.RTH...LG.KETLQSI.FSLQLID
MPPA_SOLTU/236-422---------------------------------------------..IHAFSA-F..SSIYN......NTGL.FGIQGTT
YAN2_SCHPO/193-378---------------------------------------------..IEDPFC-S..FV...YF.YVSLRVP.CSIQLFF
NRDC_HUMAN/837-1020---------------------------------------------..GYHVYP-T..CRNTS........GI.LGFSVTV
O84831_CHLTR/201-385---------------------------------------------..CKQVDM-S..IDSEL......HEIP.VYIVCRG
Q9A579_CAUCR/657-835---------------------------------------------..SYGAGS-F..VRAAR......GTRL.FQAYAPV
Q9FIH8_ARATH/360-598---------------------------------------------.PFTSVEL-D.HSDSGR.....EGCTV.TTLTVTA
Q9A531_CAUCR/246-428---------------------------------------------.PFIAGGA-F.KGDQFG......AVRV.TTFGATA
CYM1_YEAST/221-407---------------------------------------------.LEFSVNS-G..VEPTT......AVNL.LTVGIQG
Q97EV0_CLOAB/207-392---------------------------------------------..GKDVFG-I.......YD.NGIMQTY.FSVIVKN
Q9VYT3_DROME/769-953---------------------------------------------..GYHVGA-T..VRLNY........GI.AGYSIMV
QCR1_YEAST/187-370---------------------------------------------..CDNFNH-F..SLSYK......DSGL.WGFSTAT
Q9VP94_DROME/724-907---------------------------------------------..GYSLGI-H..QRIGY........GV.LAFLITI
O67945_AQUAE/183-355---------------------------------------------..AYATYS-F.YPTRYS......SPRL.FAYVG.T
Q9KRD3_VIBCH/199-378---------------------------------------------..ITGIYA-T..HYEIE......GQRY.TLISVGF
Q9FIH8_ARATH/928-1156---------------------------------------------..TYDVSF-E..LN...LF.DRLNLGW.YVISVTS
MU138_SCHPO/668-850---------------------------------------------..GYIVFT-L..VRQVT........PF.INLNIFV
NRDC_HUMAN/361-548---------------------------------------------..ALALFG-G..NGETGFE.QNSTYSV.FSISITL
P74016_SYNY3/241-420---------------------------------------------..AYSVSG-S.WQAAYD......YPGY.FLAGGPT
MU138_SCHPO/196-378---------------------------------------------..ATSLIA-F.NVSITE......DADI.IVVSTFL
Q55159_SYNY3/175-359---------------------------------------------..VTAIGA-S..NSTQA......TQGM.FYISAQL
MPPA1_ARATH/239-423---------------------------------------------..VQSCTA-F..TSIFN......DTGL.FGIYGCS
O50512_STRCO/190-374---------------------------------------------..TYGVRA-F..GQVLRSAPDGTGAAM.LAISGSV
PQQL_HAEIN/680-857---------------------------------------------..IYSVNS-W..FM..QDVYAPQIEGK.IEFSCDP
O84831_CHLTR/717-886---------------------------------------------..AYGSGA-S..ANLGR........GA.FYCYSYR
Q9KA85_BACHD/165-338---------------------------------------------..CYSVFS-Y..HSSFR......DSGM.LTIYAGT
P74305_SYNY3/274-453---------------------------------------------LMAQGFNG-F.PADKFP........NL.LMFYAQS
Q9CML5_PASMU/205-388---------------------------------------------..VESANF-Y.RTH...LG.KETLQNI.FLLQLFD
MPPB_HUMAN/220-404---------------------------------------------..CHSFQS-F..NTSYT......DTGL.WGLYMVC
Y219_RICPR/168-341---------------------------------------------..AYVVGS-Y..NSAYF......DSGV.FTIYAST
O51486_BORBU/686-867---------------------------------------------..VYAIQA-S..FDSNLRK.NVDSDGI.LSIFFTT
Q9A308_CAUCR/166-339---------------------------------------------..AYNIDA-Y..ADTYA......DHGA.LGIYAGC
Q9KA98_BACHD/181-363---------------------------------------------..INDTFS-F.DHTSEY......GFGF.TIMGGDT
PQQF_PSEAE/179-352---------------------------------------------..GESVAL-R.VVHRDA......RQAL.LALTFEL
YO098_YEAST/193-378---------------------------------------------..IDDPMA-N....STDCCTDYFMRTI.IDLRIQG
YHJJ_ECOLI/199-378---------------------------------------------.NSKDIGL-G..FD...CR.VLYLRAQ.CAINIES
Q9KQC8_VIBCH/196-377---------------------------------------------..ITTLSA-G.GGVSGS......NYRE.FAVSCVL
Q983M8_RHILO/208-384---------------------------------------------..AYSVNS-S..LVNQD......HADA.LIVTTGT
Q9RTZ9_DEIRA/246-424---------------------------------------------..ATAAGS-I..TNPGS......DPGL.ATYVAIL
Y4WA_RHISN/251-435---------------------------------------------..ASSGGA-Y..FN...GR.SLDPSSF.TVFGSPR
Y4WB_RHISN/198-374---------------------------------------------..AYGIYS-T..LENID......HASA.LVIGTGT
MPPA_NEUCR/214-475---------------------------------------------..VESCVA-F..NHSYT......DSGL.FGIAASC
P73669_SYNY3/171-348---------------------------------------------..AYDVSA-F.......YP.TRLGSSQ.FVTYMGT
Q9CE73_LACLA/164-346---------------------------------------------..IDDSFG-F.SFDLDK........RF.HFAVLTA
Q9KRD3_VIBCH/671-849---------------------------------------------.YTPQVIP-Y.......VV.DGDILND.WVLSALV
Q9RTZ9_DEIRA/703-883---------------------------------------------..SYTVGG-G.AHTSSL.....DEKGS.FTTYAIF
UCR1_CAEEL/200-386---------------------------------------------..VHNLQH-F..NINYK......DTGL.FGIYFVA
Q9PF62_XYLFA/714-895---------------------------------------------..AYGASS-V..LPNAQ......GQRP.YVFIAPV
MPPA_RAT/231-430---------------------------------------------..MYNATS-Y..HHSYE......DTGL.LCIHASA
O51486_BORBU/206-392---------------------------------------------.QFKNVSN-K.DFFSFKSDNNTIVAKS.ISLNFNP
PQQL_ECOLI/683-863---------------------------------------------..AYSVSS-R..LSVDPQA..KDISHL.LAFTCQP
O16249_CAEEL/747-931---------------------------------------------..GYIVWT-G..SR..L......NCGT.V