Sequence alignment for CL0095

PF06866

Q898W9_CLOTE/5-163------------------------------------------MVHY------------------------------NDPL
Q8R6L8_CALS4/3-170------------------------------------------FINI------------------------------EDKN
Q8EKU9_OCEIH/15-178------------------------------------------RLHY------------------------------KENN
Q8RCE8_CALS4/5-162------------------------------------------RLRY------------------------------NEEK
Q8XIE2_CLOPE/5-164------------------------------------------KIYY------------------------------KNYL
Q899R5_CLOTE/6-172------------------------------------------IINS------------------------------NSKS
YYAC_BACSU/17-181------------------------------------------YVSH------------------------------TDAA
Q97HP9_CLOAB/17-181------------------------------------------FSYN------------------------------VDKE
Q97CW9_CLOAB/6-171------------------------------------------VFNV------------------------------DDSN
Q8XH36_CLOPE/6-172------------------------------------------YINS------------------------------LDPK
Q97F84_CLOAB/5-164------------------------------------------KAFY------------------------------NLPM
Q97HQ0_CLOAB/4-165------------------------------------------EKYY------------------------------YEKN
Q9K5N4_BACHD/15-179------------------------------------------RVHM------------------------------DDPQ

PF03418

GPR_BACHD/17-371AIEAHDIVKEQEAQ--EAKQPASTVEGFDIE-ETVMDGVKVSKVVI-HPLGAERTGKKAGRYLTFESQGIRKKDTDIQEK
B7GKC1_ANOFW/14-366AIEAHEIAIEERLE----REQKTSLDGVSIR-DWEEEGVRFSFVEV-TEEGAKTLGKKAGKYLTIEAQGIRTQDTDLQQK
GPR_BACAN/17-367AVEAHQMLQERQ------EEQQQGIQGVIVK-EREEEGIIITKVTI-DEVASESMGKKPGNYLTLEVQGIRQQDTELQQK
D3FXK2_BACPE/17-373AVEAHQLAVEEQERKAPGEQESQNVSGVQIE-EEVIDDVKVIKVII-DEVGAKRLGKKQGSYLTFESQGIRKKDTDIQEK
GPR_BACLD/18-367AVEARDLAEEKEAS--P----KKELKGFTVK-EYEKDGIKIQTMDI-DEEGAKLSGKKAGRYLTFETQGIRQQDSVLQEK
K0IXM1_AMPXN/14-362AVEAREMYVEEEKQ-------TEDIEGVLLK-EQKIKGFQVTDVRV-DKTGEKKIDKKAGRYITLETDAIKNGDSNQQQA
GPR_BACSU/18-367AVETKEAMANQQAV--P----TKEIKGFIEK-ERDHGGIKIRTVDV-TKEGAELSGKKEGRYLTLEAQGIRENDSEMQEK
Q5WHG8_BACSK/16-371ALEAHEMAVEEQRE-KAGQESSSAVTDVVVK-EETVEGVKITTVEI-GEEGAKRLNKRAGHYLTFEAQGIRKKDTALQDN
G2TNJ1_BACCO/13-363AIEARDLAVEEKVK----NRESEELEGVTVE-ERTVNDIKVTTVQI-SKKGEKVIGKKAGNYLTIEMQGIRSGDMDIQQK
C0ZB22_BREBN/21-365----HELAQQQN---------QSDIEGIWLQADDSEPNVKVTRLHVETEEAGKEIGKLPGHYLTIEVPKLRDNDTSIEEQ
I0JP56_HALH3/16-362--EAQEMNVKDDPD-------SSDHDGVKVE-ENEKDDIKITYVTV-DDEGAARIGKKAGHYITLESQAIRKQDTDLQVN
GPR_BACP2/18-370AVETKEIL-EQEND--PNVITKDGIQGIVEK-EKEEHGIRIRTVEI-TKEGEALTSKKAGTYLTLEAQGIREKDSEMQEK
GPR_OCEIH/15-366AIEAKDMYTESKPE----ETNDKEIKGVTFK-ERSVKDIKVSYVDI-DEEGEKLLGKKPGSYVTIYADGVKKQDTDRQGQ
N0AYB4_9BACI/17-373AVEAREMAIAERAKTVQNEENLSQIEGVIIK-EKEEDGMKISIVEI-TKQAEEAIGKKQGRYLTIEVAGIRQQDSELQQK
E6TW21_BACCJ/17-373AVEAHEMLVEREGQKEKKEETSSAIDGVKVE-SRDIDGVNITKVDI-SEGGSERIGKKAGQYLTFEAQGIRRKDTNIQDR
U5LCK0_9BACI/17-373AIEAREIVMDERSKNLGKEENLSQLEGVIIK-EKEEDDLKISYVEV-TSEGAKSLGKKEGKYLTIEVQGIRQQDTELQQK
GPR_GEOSW/17-371AIEAHEIAVEERLQ--QKRESASPIEGVIIH-DREIDGIKLSHVEV-TEEGAKSIGKKPGNYLTIEAQGIREHNTELQQK

PF01750

HYCI_ECOLI/20-142--------------------------------PLLAEKCAA--APK----------------------G------NWVVI
HUPD_BRADU/27-156--------------------------------VRAVEEFHRRYAVP----------------------D------NVTIL
HYBD_ECOLI/20-148--------------------------------VRIVEALEQRYILP----------------------D------YVEIL
O66898_AQUAE/19-146--------------------------------VRTVEELQRRYEFP----------------------E------NVKVL
FRXA_PYRFU/8-132--------------------------------IKIGRELKRQGYKV----------------------E-----------
O26832_METTH/37-160--------------------------------PYLASLIQEAMEER----------------------G-------HLVI
HYDD_WOLSU/1-132--------------------------------MHLSNLLKVNYRFE----------------------GP----HQVDVI
Y631_METJA/32-161--------------------------------IYVVKKLMRYFGEE----------------------KEFINIKNLYLI
O25351_HELPY/22-151--------------------------------VHLAHYLKKNFSFF----------------------P------SVDII
Y253_METJA/23-151--------------------------------CEVVSKLEKMNLPD-----------------------------NVEVI
HOXM_CUPNH/19-148--------------------------------VRCIETLQQRYQFA----------------------P------QVCLV
O28893_ARCFU/21-148--------------------------------IRVVEELKRRRLPK----------------------N-------VTVM
HYAD_ECOLI/23-152--------------------------------VRVAERLYAHYHWP----------------------E------YVEIV
FRHD_METTH/24-153--------------------------------PEVIKALEEYFKDR----------------------EK---PDNVMFI
FRHD_METJA/45-179--------------------------------VHVIEKLNKILTDK-----------------------E---KQKIALV
C1DLF1_AZOVD/23-151--------------------------------VRCVELLNERYRFP----------------------D------GVRLM
D5APG3_RHOCB/26-155--------------------------------VRCVERMAETHALP----------------------A------NVRLL
Q8TS31_METAC/26-151---------------------------------AVVESLKG-LELP----------------------E------NVTVV
T2GBP7_DESGI/25-152--------------------------------VRLVEHLEARYDFS----------------------E------QVTLF

PF06866

Q898W9_CLOTE/5-163AYKIMGETLSNFL-------NNNTIIVCVGTDKCIGDSLGPITGTIL-------------KEKNFP-LPVFGTVENPIHA
Q8R6L8_CALS4/3-170AFENFYRTFQFYFKNLYKEPYREIILLCIGTDRSTGDSLGPLTGHKL-------------KPLLRNKAHVFGTLEDPLHA
Q8EKU9_OCEIH/15-178----LPSLMCQHIMNWFPYQPREYVAVFIGTDRSTGDALGPLAGMYF-------------QSYKPRHIRVYGTIHEPVHA
Q8RCE8_CALS4/5-162ASFQIANFLSRHL-------LPETVFLCIGTDRFITDSLGPIVGNLI-------------SGSLPPIYYVYGTLKNPVHA
Q8XIE2_CLOPE/5-164AYYEISNFLKNHI-------DEKTIIVCIGTDKCIGDCLGPLVGTLL-------------KEKFFP-LKVFGTLDSPIHA
Q899R5_CLOTE/6-172AIITLRDTLCGYITPVLAS-GKHIILLCIGSDRSTGDSLGPLVGHNL-------------KFLSRNNFHVFGNLEMPVHA
YYAC_BACSU/17-181AAKQIQTILSSSLRKAA---GKPIVVVCIGTDRSTGDSLGPLVGMKL-------------KQMQLTRFHVYGTLSDPVHA
Q97HP9_CLOAB/17-181NIEHWISAILFQVLKD----KEDIVILSLGVDTLVGDSLGPLVGSIL-------------KRNGIP--NVYGTLDRTVNA
Q97CW9_CLOAB/6-171ILYSFSNYLSSEIKSIAV--NRDIVFLCIGTDRSTGDSLGPMVGYKL-------------TKFHKNNLIVFGTLQEPVHA
Q8XH36_CLOPE/6-172ASFKIRDYLCRELSPVIKE-NRPIVFICIGSDRSTGDALGPLIGEKI-------------KFLSKNNIFIYGTLEETVHA
Q97F84_CLOAB/5-164AYYRLSNFLKHYI-------DDNTIIICIGTDRCIGDCLGPMVGTML-------------KEKFFP-LNVYGTISEPIHA
Q97HQ0_CLOAB/4-165IQEEFFKFLYSMTGK-----KEEIVVICIGDPVFEGNILAPLVGTLL-------------HERNIP--NVYGTLKEPVYE
Q9K5N4_BACHD/15-179ASDQLVEQLLTHVSSYR---HRELVIVCIGTDRSTGDALGPIVGTAL-------------TKECLNCFHVYGTLADPVHA

PF03418

GPR_BACHD/17-371MERVFAQQFSQFMGELGITKDHTCLVVGLGNWNVTPDALGPITVENLLVTRHLFTLAPEEVGEGFRPVSAIAPGVMGVTG
B7GKC1_ANOFW/14-366VEKLFAKHFYAFLQQLGIPREASCLVVGLGNAEVTPDALGPLAVSNLLVTRHLFQLQPESVQDGFRSVSALAPGVMGMTG
GPR_BACAN/17-367VERIFAKEFSYFLEEVGVTKEASCLIVGLGNWNVTPDALGPIVVENVLVTRHLFQLQPESVEEGFRPVSAIRPGVMGITG
D3FXK2_BACPE/17-373MERVFASQFHQFMTDIGIKEEDTCLVVGLGNWNVTPDALGPIAAENLLITRHLFELAPEQVQGGYRPVSAVTPGVMGLTG
GPR_BACLD/18-367VVDVFAKEFSSFLDYLGIPRDASCLIVGLGNWNVTPDSLGPLVTENLLVTRHLFQLQPENVEEGYRPVSALSPGVMGLTG
K0IXM1_AMPXN/14-362TAEVLSVLLADLLKENNINESAQCLVVGLGNDYVTPDALGPQTVKKILVTKHLFTYHPEMVAEGYRPVSAFSPGVMGVTG
GPR_BACSU/18-367VSAVFAEEFSAFLENLNISKDASCLIVGLGNWNVTPDALGPMAVENLLVTRHLFKLQPENVQEGYRPVSAFAPGVMGITG
Q5WHG8_BACSK/16-371IERVFAKEFAAFLRNKGIKDSDTCLVVGLGNWNVTPDALGPLAVEELLVTRHLFQLAPEEIEEGYRPVSALTPGVMGTTG
G2TNJ1_BACCO/13-363VEELFALEFNQYLKHLNIGPEASCLVVGLGNWNVTPDALGPLVCEKVLVTRHLFKIEPENVESRYRPVSALAPGVMGLTG
C0ZB22_BREBN/21-365VAKRFSAEFAMFLKQLGITEDKKALVVGLGNWNVTPDALGPMVVENLLITRHLYTLAPETVGEGYREVSALSPGVLGITG
I0JP56_HALH3/16-362LAKTLSGQLRKLLQDSGVQEMDRCLLVGLGNHQVTPDALGPLVTEKVLVTSHLFELHPETVAEGYRPVSAVTPGVMGVTG
GPR_BACP2/18-370VVEVFAHHFAQFLKDRGIQTDASCLVVGLGNWNVTPDALGPLTVESLLVTRHLFELQPENVQEGYRPVSSLSPGVMGLTG
GPR_OCEIH/15-366AAQVLAKELEDLMRKNNVTKESTCLVVGLGNWNVTPDALGPMTVEKVLVTSHLFRLQYETVAQGYRDVAAVTPGVMGVTG
N0AYB4_9BACI/17-373VAKVFAQEFAHFLKMLGISETASCLVVGLGNWNVTPDALGPSVCENLLVTRHLFQLQPENVEEGFRPVSAFAPGVMGITG
E6TW21_BACCJ/17-373VEEIFAKEFHQFLNELGIKQDDRCLVVGLGNWNVTPDALGPLVVDNLLVTSHLFELQPENVSEGFRPVSAITPGVMGITG
U5LCK0_9BACI/17-373VENVFSSELARFIEGMGIKKDASCLVVGLGNWNVTPDALGPQVCENILVTRHLYQLQPENVEEGYRPVSALAPGVMGLTG
GPR_GEOSW/17-371VQDIFAKEFNAFLRKLDIRKESSCLVVGLGNSNVTPDALGPLTVENLLITRHLFHLQPESVEEGFRPVSAIAPGVMGTTG

PF01750

HYCI_ECOLI/20-142DGGSAPENDIVAIREL--RPTRLLIVDATDM-GLNPGEIRIIDPDDI--------------------A--EMFM-MTTHN
HUPD_BRADU/27-156DGGTQGLYLVNYLEE----ADRLIVFDAIDY-GLEPGRLKLVRDDEV--------------------PRFTGAKKMSLHQ
HYBD_ECOLI/20-148DGGTAGMELLGDMAN----RDHLIIADAIVSKKNAPGTMMILRDEEV--------------------PALFTNK-ISPHQ
O66898_AQUAE/19-146DGGTLGIDLLYHIEG----TEKLLIIDAVLG-GKKPGTFYKIKNENV--------------------KKYFKSK-VSMHE
FRXA_PYRFU/8-132ELGTDIFSLMRVYNG----ENKVIIVDAVLG--EIPGKVVYFKGEDI--------------------FKKLRAEIRSAHF
O26832_METTH/37-160NAGTVPENFTGKIRSE--RPSHILIVDAVEMR-EEPGTVRLIERDSI--------------------S----EYSISTHA
HYDD_WOLSU/1-132DGGTLAQLLIPLITS----YDYVIVIDCVDAGGGKIGEVYFFDFDNV--------------------P-NVITWQGSAHE
Y631_METJA/32-161NAGTVPDFFTDILKEI--KPTHILIIDCALM-DKDVGEVKIIKEDEI--------------------IN----YSFSTHT
O25351_HELPY/22-151DGGTMAQQLIPLITS----YEKVLILDCVSAEGVEIGSVYAFDFKDA--------------------P-KEITWAGSAHE
Y253_METJA/23-151DAGASGAYYLMTLVDE--DIKKIIVVDAIDF-DLEPGTIKKIDVDEL--------------------PNIKKYS-FDAHN
HOXM_CUPNH/19-148DGGTQGLYLIHHVQA----ASRLLIFDAIDY-GLPPGTLRIIEDEAV--------------------PKFLGAKKMSLHQ
O28893_ARCFU/21-148DGGTGSFDLVNYFFF----YDVVVIVDAVNF-GGKPGRVYRLPVERV--------------------LKRKIAS---IHD
HYAD_ECOLI/23-152DGGTQGLNLLGYVES----ASHLLILDAIDY-GLEPGTLRTYAGERI--------------------PAYLSAKKMSLHQ
FRHD_METTH/24-153DAGTGGPHFVFSLPHE--EWKKMIVVDVVEF-NAEPGTLRKFDVTEI--------------------PK-GSYE--NMHT
FRHD_METJA/45-179DAGAGAPQQVLTLIDENSKTKKIIVVDVIDW-GIKPGEIKIIEKDEL--------------------PN-PKYHRLDSHD
C1DLF1_AZOVD/23-151DGGTQGIYLVQHVQQ----ADCLIVFDAVDY-GLAPGTLKIVRDDEV--------------------PRFMGAKRMSLHQ
D5APG3_RHOCB/26-155DGGTQGLYLLPFLEE----AEALIVFDAVDF-GFTPGTLVTMRDDDV--------------------PAFMGAKKMSLHQ
Q8TS31_METAC/26-151DAGLGGPHFVFTLLNP-ESTKTLIIVDIADF-GGEPGELRWLAVDEL--------------------PV-GSYR--DAHS
T2GBP7_DESGI/25-152DGGTLGMRLMGPIME----CDLLIVLDAVLG-GDEPGAIYRLTGDDL--------------------RKSLAFK-NSMHQ

PF06866

Q898W9_CLOTE/5-163LNIKVKMSEIASLYPNHNIIGIDACLGES--NNIGFIQSRNYPIYPGKGVGKK-----------------LPHVGN----
Q8R6L8_CALS4/3-170KNIIDVLKEIRNTFYMPFTIAIDASLGSL--KHVGHISIGKGPIKPGAGVSKE-----------------LPPVGD----
Q8EKU9_OCEIH/15-178VNLEESLERIDKLHNNPFIIAIDACLGRS--TSIGHIITEKKSLQPGTALNKT-----------------LPAVGD----
Q8RCE8_CALS4/5-162INLEENLRYIKKKHPYSKIIAVDASLGEE--ENIGKISIKKSPIHPGKGVGKI-----------------LPPVGD----
Q8XIE2_CLOPE/5-164LNLDKKITEILKTYPGYKILAIDACLGDS--NSIGEIHARNEPIHPGKGVGKS-----------------LRSVGD----
Q899R5_CLOTE/6-172KNLHQILKYINKKFDDPYIIAVDACLGHI--QNIGKVFVEDKPLKPGSAVNKD-----------------LPPVGN----
YYAC_BACSU/17-181VNMKDKINDIHKLHKNPFVIAVDACLGRV--KSVGSFQIGDGPLKPGAGVQKD-----------------LPEVGD----
Q97HP9_CLOAB/17-181SNIIKILDEIHERFKNPYILVVDAAVTAE--NNINDIVLRNGGFTPGFGVYRQ-----------------LPTVGD----
Q97CW9_CLOAB/6-171KNLCNTMDIIKTKYENPFIIAIDACLGST--KTVGNIVIQNTPLSPGSAMNKS-----------------LPTVGD----
Q8XH36_CLOPE/6-172GNLKETVKIIKSKHKKPFIIAIDACLGAV--DNVGHVLIEKRPLKPGIALNKD-----------------LPEVGD----
Q97F84_CLOAB/5-164LNIDKKLYKIKKDHTNSTIIGIDACLGDT--ENIGEIQVRDYAIHPGKGVGKS-----------------LPDVGE----
Q97HQ0_CLOAB/4-165INIKEIYNKILKKYDNPYIILVASSFPVDFHDEREVIVLKNDPYEIQTASGS-------------------LKLGN----
Q9K5N4_BACHD/15-179VNLEEKLKLIEKKHRRPFIIAIDACLGKL--SSVGKVSLAAGPVQPGAAVNKK-----------------LPAVGD----

PF03418

GPR_BACHD/17-371IETSDVIYGIIEQTKPDFVIAVDALASRSIERVNATIQVSDTGIHPGSGVGNKRKELSKETLGIPVIAVGIPTVVDAVTI
B7GKC1_ANOFW/14-366IETSDIIAGIVEKTQPDFIIAIDALAARSIERVNATIQISDTGIHPGAGVGNKRKELSKQTLGIPVIAIGVPTVVDAVSI
GPR_BACAN/17-367IETSDVIYGIIEKTKPDFVIAIDALAARSIERVNSTIQISDTGIHPGSGVGNKRKELSKETLGIPVIAIGVPTVVDAVSI
D3FXK2_BACPE/17-373IETSDVIFGIIEKTKPDFVIAIDALASRSIERVNATIQVSDTGIHPGSGVGNKRKELSKDTLGIPVIAVGIPTVVDAVSI
GPR_BACLD/18-367IETSDIIQGVIDRSKPDFVIAIDALASRGIERVNSTIQISDSGIHPGSGVGNKRKELSKDTLGIPVIAIGVPTVVDAVTI
K0IXM1_AMPXN/14-362METSDIIQGIVKELNPDFIIAIDALASRSIDRVNSTIQVSDTGIHPGSGVNNKRKALSYENFGIPVISIGVPTVVDAVTI
GPR_BACSU/18-367IETSDIIKGVIEQSKPDFVIAIDALAARAVERVNTTIQISDTGIHPGSGVGNKRKDLSKDTLGVPVIAIGVPTVVDAVTI
Q5WHG8_BACSK/16-371IETSDIVFGVIEKTKPDFVVVIDALASRSIERVNTTIQVADTGIHPGSGVGNNRKAMNEETLGIPVIAIGIPTVVDAVTI
G2TNJ1_BACCO/13-363IETSDIIFGVSEKSKPDFIIVVDALASRSLERVNATIQISDTGIQPGSGVGNKRKELSKETLGVPVIAIGVPTVVDAVTI
C0ZB22_BREBN/21-365IETSEIIFGVVEKSKPDFVICIDALASRALHRVNTTIQISDTGIHPGSGVGNKRKAIDQETLGVPVIAIGVPTVVFASTI
I0JP56_HALH3/16-362IETSDMVNGIIEETKPDFVIVIDALASRSISRINSTIQLSDTGIHPGSGVGNKRKEISRETYGIPVISIGVPTVVDAVTI
GPR_BACP2/18-370IETSDIIQGVIERSKPDFVIAIDALAARAVERVNTTIQISDTGIHPGSGVGNKRKELSKETLGIPVIAIGVPTVVDAVTI
GPR_OCEIH/15-366IETSDIIFGIVEKYKPDLVIAVDALASRSINRVNETIQLSDTGIHPGSGVGNKRKEISKKTLGIPVIAIGVPTVVDAVTI
N0AYB4_9BACI/17-373IETSDIILGVVEKTKPDFVIAIDALAARSIERVNSTIQISDSGIHPGSGVGNKRKEISQATLGIPVIALGVPTVVDAVSI
E6TW21_BACCJ/17-373IETSDIIHGVVEKVKPDFIIAIDALASRSIERVNTTIQISDTGIHPGSGVGNKRKELSKEVLGIPVIAVGIPTVVDAVSI
U5LCK0_9BACI/17-373IETSDIIFGVVEKTKPDFVLAVDALAARSIERVNSTIQISDTGIHPGSGVGNKRKELSRETLGIPVIAIGVPTVVDAVSI
GPR_GEOSW/17-371IETSDIIHGIVEKTKPDFVIVIDALAARSIERVNATIQISDTGIHPGSGVGNKRKELSKETLGIPVISIGVPTVVDAVSI

PF01750

HYCI_ECOLI/20-142MPLNYLIDQLKEDIG---EVIFLGIQPDIVGF---YYPMT-------------------------------QPIKD----
HUPD_BRADU/27-156TGFQEVISAADLLGRCPKHLVLIGCQPLDLED--WGGPLT-------------------------------PPVRD----
HYBD_ECOLI/20-148LGLADVLSALRFTGEFPKKLTLVGVIPESLEP---HIGLT-------------------------------PTVEA----
O66898_AQUAE/19-146LGIQEVLALLEVLEKPIKEIVVLGLEPKSLEV---STELT-------------------------------PEIQE----
FRXA_PYRFU/8-132MGAVEGLKLLLEVDERLKNAELHFVGVTIKEP-KLGLELS-------------------------------EEVKR----
O26832_METTH/37-160MPLSFLVRYLEDQG--AYRIALMGVQPENLEF---GTGLS-------------------------------PAVED----
HYDD_WOLSU/1-132VEMLQTLRMTEVNGDLPPVKIVGVIPSIIGSE--TAFDLS-------------------------------KEVAE----
Y631_METJA/32-161LPLSIIVKYLKKFIN--AEIIILGIQPKIIDF----CPIS-------------------------------EEVKL----
O25351_HELPY/22-151VEMLHTLRLTEFLGDLPKTFIVGLVPFVIGSE--TTFKLS-------------------------------SKILN----
Y253_METJA/23-151VPLAPFLKDLHNK-GIEVVVIGCQGKEFTMPD--IKPGLS-------------------------------EEVAK----
HOXM_CUPNH/19-148TGFQEVLLLAQLTGQYPQQVVLIGCQPEELED--YGGSLR-------------------------------RVMKA----
O28893_ARCFU/21-148LDIFYAISAMSAIQAMPRVILIGAEVKNLAEFSEMSSEAE-------------------------------EAVKK----
HYAD_ECOLI/23-152NSFSEVLALADIRGHLPAHIALVGLQPAMLDD--YGGSLS-------------------------------ELARE----
FRHD_METTH/24-153WPVSQPLHELSEK--IDVVVIGCKPKEISAPN--VEMGLT-------------------------------PPVKK----
FRHD_METJA/45-179WPLAPLLREVAEKYNIEVKVVGCQAKYISEPD--VYIGLS-------------------------------EEVEK----
C1DLF1_AZOVD/23-151TGFQDVLALAAFSGAYPRELLLIGVQPEELED--FGGSLR-------------------------------EPVRA----
D5APG3_RHOCB/26-155TGFQDVIATAQLMGYCPSRMTLIGCQPVELED--YGGSLR-------------------------------PAVAG----
Q8TS31_METAC/26-151WDLAEPLQYIKDD--IRIRVLACQKKYVSTPE--MVIGIT-------------------------------DEVQR----
T2GBP7_DESGI/25-152TDLVDTLIFCQLAGHCPEA-VIIGMEPFDYET--MHPEIS-------------------------------PLAQE----

PF06866

Q898W9_CLOTE/5-163-----------------------------------------------------HSIVGIVDSTEINIFN----NNSIRLN
Q8R6L8_CALS4/3-170-----------------------------------------------------MFVTGIVNISGFMEYM---VLQNTRLR
Q8EKU9_OCEIH/15-178-----------------------------------------------------VSITGVVNVSGFMEHS---ILQNTRLS
Q8RCE8_CALS4/5-162-----------------------------------------------------LSIVGIVDSFHAKDLN------SIRLG
Q8XIE2_CLOPE/5-164-----------------------------------------------------MSIIAIVDSSENIDLF---TSRPIRLS
Q899R5_CLOTE/6-172-----------------------------------------------------LSITGIVNISGTLEFM---VLQNTRLF
YYAC_BACSU/17-181-----------------------------------------------------LHINGIVNVSGFMEYF---VLQNTRLN
Q97HP9_CLOAB/17-181-----------------------------------------------------FSLVGVVNKEDEREHNLIELLKKCRFD
Q97CW9_CLOAB/6-171-----------------------------------------------------LSITGIVNVSGPFDFM---VLQSTRLY
Q8XH36_CLOPE/6-172-----------------------------------------------------LSILGIVNISGSLEFM---VLQNTRLY
Q97F84_CLOAB/5-164-----------------------------------------------------VSIVGIVDSCESSELF---TNRNIRLN
Q97HQ0_CLOAB/4-165-----------------------------------------------------ASFIVVFDLEDS--YCKVNFIEKLGIR
Q9K5N4_BACHD/15-179-----------------------------------------------------VHLTGIVNIGGMMEYF---VLQNTRLH

PF03418

GPR_BACHD/17-371TSDAIDYVLKHFGRELREREKPSRALAPAGMTFGERRELTDEDLPPEEKRKTFLGMMGTLPEGEKRQLI-QEVLAPLGHN
B7GKC1_ANOFW/14-366ASDTIDLLLKHLGREMKEGNRAARALAPASLVFGKKKKLTEEDLPSESDRSAFLGMVGLLDDEEKRRLI-YEVLAPIGHN
GPR_BACAN/17-367TSDTIDFILKHFGREMKEGNKPSRSLLPAGFTFGEKKKLTEEDMPDEKSRNMFLGAVGTLEDEEKRKLI-YEVLSPLGHN
D3FXK2_BACPE/17-373TSDTIDYVLKHFGREMKEGNAPSRSLAPAGMTFGEKRVLTDEDLPNDEKKQTILGMVGALPEEEKRQLI-REVLSPLGHN
GPR_BACLD/18-367TSDTIDYMLKHFGREMRD-DSPSRSLVPAGMSFGKRKVLTEEDLPDEEHRKSFLGIVGGLAEDEKRQLI-HEVLAPLGHN
K0IXM1_AMPXN/14-362TSDTIDYVFKHFGREFKEKDRPSKRLAPASLTFG-KKTLTESDMPSQTEKANLFGMIGKLDETEKRQLI-KEVLSPLGYN
GPR_BACSU/18-367ASDTVDYILKHFGREMKD-NRPSRSLVPAGMTFGKKKVLTEDDLPDQKQRQSFLGIVGTLQEDEKRQLI-HEVLSPLGHN
Q5WHG8_BACSK/16-371TSDAIDYVMKHLGKEMREGNKPSKRLAPAGMMFGEKRQLTDEDLPDEKGRQAIMGMVGGLEGPEKRQLI-QEVLAPLGHN
G2TNJ1_BACCO/13-363TSDAIDFLLKHFGKEMKESGRPSRALAPAGLSFGEKRRLTEEDLPGSEARKMFMGIVGNLDEQEKRKLI-HEVLAPLGHN
C0ZB22_BREBN/21-365VNDAITYLLGHFGQSMVESKRVFNKLALSTLP-ERKEPYTEEDLPDLESRKTFMGLVGSLPEEEKRQLI-HEVLRPLGQD
I0JP56_HALH3/16-362TSDTIDFLLKHFGREWNEKDRPSNALSPALNPF-ERKTLTEEDYPNEEQSKAVLGMFGQLGEAEKKQLI-KEVLTPLGHN
GPR_BACP2/18-370ASDTIDYVLKHFGRELKD-DRPSRSLVPAGLTFGKKKVLNEEDLPDEETRQSFLGIVGTLPEEEKRQLI-HEVLAPLGQN
GPR_OCEIH/15-366TSDTIDYVLKHFGREWKEKDDPSKSLTPAGMSFGNRK-LTDEDLPNMEKRKTVLGIVGELSDEEKRKLI-TEVLTPLGHN
N0AYB4_9BACI/17-373TSDTIDYILKHFGRELKEGNRPSKSLTPAGMSFGEKKKLTDEDLPEEQQRKTFLGMIGVLPDEEKRKLI-YEVLAPLGHN
E6TW21_BACCJ/17-373TSDTIDFLLKHLGRETREKNQPKRRLAPAGMTFGEKRKLTDEDMPGEQERQQYMGIVGALDENEKRQLI-SEVLAPIGHN
U5LCK0_9BACI/17-373TSDTIDFILKHFGRELKEGDRPSRALAPAGMNFGKRKKLTEEDLPEEQQRQTFLGIVGTLPDEEKRKLI-YEVLSPIGHN
GPR_GEOSW/17-371TSDTIDFILKHFGREMREGKRPSSALAPAGWTFGKKKRLTEEDMPSTEQRSTFLGIIGTLEEEEKRRLI-YEVLSPLGHN

PF01750

HYCI_ECOLI/20-142--------------------------------------------------------------------------------
HUPD_BRADU/27-156--------------------------------------------------------------------------------
HYBD_ECOLI/20-148--------------------------------------------------------------------------------
O66898_AQUAE/19-146--------------------------------------------------------------------------------
FRXA_PYRFU/8-132--------------------------------------------------------------------------------
O26832_METTH/37-160--------------------------------------------------------------------------------
HYDD_WOLSU/1-132--------------------------------------------------------------------------------
Y631_METJA/32-161--------------------------------------------------------------------------------
O25351_HELPY/22-151--------------------------------------------------------------------------------
Y253_METJA/23-151--------------------------------------------------------------------------------
HOXM_CUPNH/19-148--------------------------------------------------------------------------------
O28893_ARCFU/21-148--------------------------------------------------------------------------------
HYAD_ECOLI/23-152--------------------------------------------------------------------------------
FRHD_METTH/24-153--------------------------------------------------------------------------------
FRHD_METJA/45-179--------------------------------------------------------------------------------
C1DLF1_AZOVD/23-151--------------------------------------------------------------------------------
D5APG3_RHOCB/26-155--------------------------------------------------------------------------------
Q8TS31_METAC/26-151--------------------------------------------------------------------------------
T2GBP7_DESGI/25-152--------------------------------------------------------------------------------

PF06866

Q898W9_CLOTE/5-163----------FILNMAKSISHS------------------
Q8R6L8_CALS4/3-170----------TVMKMADIIAAG------------------
Q8EKU9_OCEIH/15-178----------VVMDMAKQVSSI------------------
Q8RCE8_CALS4/5-162----------FIYEIAETIANG------------------
Q8XIE2_CLOPE/5-164----------FILDMSKVIVDS------------------
Q899R5_CLOTE/6-172----------TVMQLAELISNG------------------
YYAC_BACSU/17-181----------LVMNMANVLAEG------------------
Q97HP9_CLOAB/17-181----------EVLKLARIISKI------------------
Q97CW9_CLOAB/6-171----------SVLKLADIISRG------------------
Q8XH36_CLOPE/6-172----------TVMLLANAISNG------------------
Q97F84_CLOAB/5-164----------LIFEMSKVIVQT------------------
Q97HQ0_CLOAB/4-165----------KIYKYSEAIFKT------------------
Q9K5N4_BACHD/15-179----------TVMQLADTISSS------------------

PF03418

GPR_BACHD/17-371LMVTPKEVDVFIEDMANVIASGLNAALHQGVNQDNVGAYT
B7GKC1_ANOFW/14-366LMVTPKEVDVFIEEMANILASGLNAALHHRIDQENVGAYT
GPR_BACAN/17-367LMVTPKEVDAFIEDMANVIASGLNAALHHQIDQDNTGAYT
D3FXK2_BACPE/17-373LMVTPKEVDVFIDDMANVIAQGLNAALHKKVNQDNVGSYT
GPR_BACLD/18-367LMVTPKEVDTFIDDMANVIANGLNTALHENVSQDNKGMYN
K0IXM1_AMPXN/14-362LMVTPKEVDSYIHDLAHLIATGINGALHENVNSELANSFT
GPR_BACSU/18-367LMVTPKEVDSFIDDMANVLANGLNTALHEKVSQENKGSYN
Q5WHG8_BACSK/16-371LMVTPKEIDVFIEDMAHVVAGGLNAALHGQVDQKNVGAYT
G2TNJ1_BACCO/13-363LMVTPKEVDIFMEDMANLLASGLNAALHPHVNQENTGF--
C0ZB22_BREBN/21-365LVVTPKEIDDFIEGVANVIATGLNRALHSAVNEENSGSYT
I0JP56_HALH3/16-362LMVTPKEVDGFIKDMAHVIASGINGALHPGVEDGEAQSYS
GPR_BACP2/18-370LMVTPKEVDTFIDDMANVLANGLNTALHQKISQDNMGSYN
GPR_OCEIH/15-366LMVTPKEVDGFMIDMAEVLANGINAALHEKVDVDNFANYS
N0AYB4_9BACI/17-373LMVTPKEVDVFIEDMANLLANGLNAALHQTVNQDNTGYYT
E6TW21_BACCJ/17-373LMVTPKEVDDFIEDMGNVLAQGLNAALHGSIDQENVGAYT
U5LCK0_9BACI/17-373LMVTPKEVDVFMEDMSNLVANGLNAALHSRINQENSGFYT
GPR_GEOSW/17-371LMVTPKEVDMFIEDMANLLASGLNAALHEQIDQDNTGSYT

PF01750

HYCI_ECOLI/20-142----------AVETVYQRLEGW------------------
HUPD_BRADU/27-156----------QIAPSIDLACQV------------------
HYBD_ECOLI/20-148----------MIEPALEQVLAA------------------
O66898_AQUAE/19-146----------KIPLLVEEALSQ------------------
FRXA_PYRFU/8-132----------AIPRAMELILSI------------------
O26832_METTH/37-160----------AVHDLAGMIISA------------------
HYDD_WOLSU/1-132----------ASVTMEKIVLNH------------------
Y631_METJA/32-161----------SGDKLVNTLIEI------------------
O25351_HELPY/22-151----------ALETALKAIETQ------------------
Y253_METJA/23-151----------AVDKAIEIILGE------------------
HOXM_CUPNH/19-148----------AVEDAVEKGADL------------------
O28893_ARCFU/21-148----------VVKRIVKLVTPS------------------
HYAD_ECOLI/23-152----------QLPAAEQAALAQ------------------
FRHD_METTH/24-153----------AIPRAIQMILDE------------------
FRHD_METJA/45-179----------AVDKAVEIILRE------------------
C1DLF1_AZOVD/23-151----------QLEPALRVALE-------------------
D5APG3_RHOCB/26-155----------QIDFAIAEAVRE------------------
Q8TS31_METAC/26-151----------AIPDAVSEILKE------------------
T2GBP7_DESGI/25-152----------RLPLMAEVALKE------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window