Sequence alignment for CL0098

PF09936

B5EBC8_GEOBB/4-189-------AAN--FSIA---LVHYPVYDKHKDVVATSVTNLDIHD-MSRLT--------------RTFGL-DR--------
Q3A2E8_PELCD/2-183-------STP--VAVA---LVHYPIVDRRGDTVSTAVTNLDLHD-IARTA--------------RTYGV-DR--------
A1AMZ9_PELPD/5-189-------SAN--LAIA---LLHHPVYNKRRELVTTALTNLDLHD-IARSS--------------RTFGL-SR--------
A5G7Z4_GEOUR/8-192-------APN--VSIA---LLHYPVYDKNQQVVATAVTNLDLHD-IARSA--------------KTFGL-YR--------
Y054_AQUAE/17-201-------NEN--VFIA---LLHYPAMDKDGKIIVTSFTTMDLHD-IARPA--------------RAYEI-NK--------
A7HKS2_FERNB/2-186-------LNK--VYTA---LIHYPVLGRDGRIITTAVTNLDIHD-IARSS--------------RTYNV-KK--------
A0LMM3_SYNFM/1-185-------MAR--LYAA---LVHYPVLNRRGEIIASAITNLDLHD-LARAG--------------RTYDV-RA--------
TRMD_DESDG/242-423-------GRN--LYCA---LVHYPVVNKENKSVAVSLTNLDIHD-IGRCS--------------CTFGL-GG--------
Q2LVU3_SYNAS/10-194-------PPP--YYLV---LLHYPVYDKNGCVVTTAVANMDVHD-IARAA--------------RTYGV-QR--------
Q1MRV0_LAWIP/191-372-------GRN--LHCV---LLHYPVMLGDQTIGATSLTNLDVHD-IARCA--------------KTYGL-GS--------
Q0AWV8_SYNWW/3-187-------KAK--VYIA---LLHYPMYNKRMEIITTSITNLDLHD-ISRVA--------------RTYDV-DA--------
A8ZV19_DESOH/6-188-------PVR--LYIA---LVHHPVLGRQAETIASAVTNLDLHD-IARAA--------------KTYGA-AG--------
Q24UB0_DESHY/1-185-------MGD--LYVA---LLHAPVYNKNMETIATSITNLDIHD-IARST--------------TTYGV-KR--------
A6LNY5_THEM4/2-186-------LSK--IYLS---LLHYPILGRDGKIISTAVTNLDIHD-IARTS--------------RTYKL-KR--------
A1HN71_9FIRM/2-187-------KTA--VYVG---LVHYPVYNKRSEVITTAITNFDIHD-IARTA--------------RTYSI-KQ--------
A8F3G0_THELT/2-186-------LND--VRIA---LIHYPVLGKDGKIISSAVTNLDVHD-IARTA--------------RTYNL-RK--------
Q0F054_9PROT/1-176-------MAD--VAVA---LVHHPILNRSGGTGSTAITPIDVHD-FARSC--------------AFYGV-GP--------
Q3AC73_CARHZ/1-185-------MGN--VYLA---LVHHPVYNKHLEVVTTSVTNLDIHD-IARSS--------------RTYGI-KN--------
Q7P719_FUSNV/2-186-------RNK--VYLS---LVHYPVYNRNKDIVCTSVTNFDIHD-ISRSC--------------GTYEI-KG--------
B3E5S7_GEOLS/2-186-------SVN--LAVA---LLHYPVYNKHRQLVTTAFTNLDIHD-IARTA--------------RTFGL-SR--------
Q6AJE7_DESPS/14-197-------AKN--VSIA---LVHHPVVNKVGEIIGSAVTNLDLHD-IARVA--------------RTYGV-GQ--------
A5IM13_THEP1/2-186-------LEK--VYVA---LIHYPIKGKDGSIISTAVTNLDVHD-IARTA--------------RTYNL-KG--------
A1VFE5_DESVV/242-423-------GRN--LYCA---LVHYPVVLKEKNSGATSLTNLDIHD-IGRSS--------------CTYGL-GG--------
A9BF02_PETMO/2-186-------FDK--LYVA---LIHYPILKKDGSIVSTAVTNFDVHD-ISRTC--------------KTYNV-KN--------
Q39RN9_GEOMG/8-192-------NAN--VSVA---LLHHPVYDKNRQVVSTAVTNLDIHD-IARSA--------------RTFGL-LS--------
Q1NQ21_9DELT/248-432-------LGR--LDIA---LVHYPVYNRTGEVIGSAVTNLDIHD-IARCG--------------RTYGI-GR--------
Q6ML98_BDEBA/8-193-------VPR--LAIG---LVHYPVRDSKQKTVATNITNFDIHD-IARAA--------------TVFGV-EK--------
Q74FG2_GEOSL/8-193-------RPA--VSVA---LVHYPVYDKNRQVVATAVTNLDIHD-ISRSA--------------RTFGL-NH--------

PF00588

Q8CXU2_LEPIN/126-265-------PIL--VI.E---GVEKP---------------GNLGT-ILRTA--------------EGAGF.HT--------
Q7NBG1_MYCGA/4-151-------KIN--VVLY---RPQDP---------------RNAGN-IARSC--------------VGFNA..T--------
Q6BHP1_DEBHA/1290-1434-------DLI--VVSS---LVDKP---------------PNLGG-ICRLC--------------DVLGA..G--------
Q8I3K9_PLAF7/198-344-------KFL--LVLD---RIRYA---------------YNLGK-ILNVA--------------YSFNI.DC--------
Y324_MYCLE/160-301-------ALL--VALD---NISDP---------------RNLGA-IVRSV--------------AAFSG.HG--------
Q22484_CAEEL/1071-1214-------SLI--VVAS---LVDKP---------------NNLGG-ICRTS--------------EIFGV.DT--------
O74022_9EURY/1-150-------MIS--VVLV---EPEGP---------------ANIGM-IARTM--------------KNFGF.SR--------
Q7TU01_RHOBA/25-165-------PAH--VVLY---QPEIP---------------QNTGN-IGRTC--------------VAVGA..K--------
MRM1_SCHPO/147-297-------PLY--VYVD---GITDP---------------QNMGA-VIRSA--------------YILGA.KG--------
Q6ME25_PARUW/89-224-------PIS--IYLD---NLRSA---------------HNVGS-IIRTV--------------EAFSL.GS--------
Q8R6H6_FUSNN/88-229-------SLV--LILD---EIQDP---------------RNFGA-IIRSA--------------EVFKV.DL--------
Q729V9_DESVH/1-141-------MMH--IVLY---HPEIP---------------PNTGN-VARLC--------------AATRT..R--------
Q74D44_GEOSL/15-165-------RVA--IVLV---EPQSP---------------GNVGM-VCRAM--------------KNMGL.GE--------
Y516_BORBU/78-219-------AFI--LLLD---EIEDP---------------QNFGA-ILRTA--------------EQFSI..D--------
Q898S5_CLOTE/9-150-------NLN--IVLF---QPEIP---------------QNTGN-IARTC--------------VLTDS..K--------
Q6FZ54_BARQU/2-143-------MLH--IALF---QPDIA---------------GNTGT-ILRLS--------------ACFGL..H--------
Q7UG85_RHOBA/132-272-------GLI--LVLD---RVEKP---------------GNLGA-VFRSA--------------DAAGV.SA--------
Q6YR72_ONYPE/92-232-------DKI--LVLD---DIQDP---------------ANLGA-LMRSA--------------SAFGF.NQ--------
Y881_MYCTU/130-275-------RTV--AVLE---GVNDH---------------ENLGS-IFRNA--------------AGLSV.DA--------
Q6XK16_SPICI/109-253-------QNI--LLLE---NIQDP---------------GNVGT-LIRTG--------------LGFGF.TN--------
Q6MS22_MYCMS/92-234-------SLV--LILD---QIHDS---------------YNFGA-IIRSC--------------SLLNV.DG--------
Q8A814_BACTN/97-238-------PFF--VMLD---GITDV---------------RNFGA-IARTC--------------ECAAV.DA--------
Q7UFJ5_RHOBA/144-289-------SLA--LALV---GLSDP---------------ENVGS-LLRSA--------------AALGV.RD--------
TRMH_SHIFL/19-159-------DLT--VCME---QVHKP---------------HNVSA-IIRTA--------------DAVGV.HE--------
Q73T60_MYCPA/69-206-------PLH--VAIE---NFGHD---------------ANIGS-VVRTA--------------NAFAV.HT--------
Q9RWT9_DEIRA/12-159-------SLA--VVLV---SPKTP---------------GNIGA-AARAM--------------LNMGA.SD--------
Q9RXS5_DEIRA/10-149-------LLH--VVLF---EPEKA---------------GNVGN-VARTC--------------SVLGA..E--------
Q9UXD5_SULSF/1-149-------MIR--VVLV---EPEGE---------------YNIGF-VARLC--------------KNFLV.DE--------
Q74D57_GEOSL/96-237-------GLI--LVLD---GIQDP---------------HNLGA-LIRSA--------------ACAGA.HG--------
Y380_HAEIN/4-151-------NIR--IVLI---ETSHS---------------GNIGS-AARAM--------------KTMGL.TQ--------
Q7VBF1_PROMA/9-160-------PLK--IILV---EPLGE---------------INLGS-IARLC--------------ENFGV.DE--------
Q8IJ98_PLAF7/52-193-------KTY--VVIY---NIGKK---------------KNVGC-IVRSC--------------VAFNV.HK--------
Q9PQM3_UREPA/1-151-------MLN--IVLF---EPEII---------------LNTGN-IARMC--------------VGFDA.NL--------
O67731_AQUAE/93-233-------SFF--IVID---HITDP---------------QNVGN-LLRTC--------------EVLGG.VG--------
Q6F981_ACIAD/122-259-------KDT--LILE---NIQDP---------------GNVGT-LLRSA--------------AAANI.KQ--------
Q7M8R3_WOLSU/2-143-------KLQ--IVLV---EPRIP---------------QNTGN-IGRLC--------------AATQS..A--------
Q73GK0_WOLPM/102-244-------STI--VILD---QVTDT---------------HNIGS-ILRTS--------------ACFNV.DA--------
Q8PVX0_METMA/11-163-------NIR--VVLV---EPMYQ---------------GNVGS-VARAM--------------KNFGY.SD--------
Q8FF07_ECOL6/222-362-------DCV--LALE---NESNP---------------HNLGG-MMRSC--------------AHFGV.KG--------
Q7V131_PROMP/7-159-------NLN--VVLV---EPNGP---------------LNVGS-IARLC--------------SNFDV.NE--------
Q7WLL7_BORBR/7-163-------RVR--FIMT---QPSHP---------------GNVGS-AARAI--------------KTMGF.GE--------
Q8TXY9_METKA/2-150-------DVR--VVLV---EPKYD---------------GNIGH-VARVM--------------KNFGV.KE--------
Y052_BORBU/34-174-------YLT--FVLE---DIFQS---------------QNASA-TIRTG--------------EILGL.SD--------
Q9AAX1_CAUCR/6-147-------IMR--IALF---QPGIP---------------QNVGA-CIRLT--------------ACFGL..G--------
Q9CC19_MYCLE/108-251-------QLV--VAAV---EISEP---------------GNAGT-VIRIA--------------DAMGA.AA--------
TSNR_STRAJ/116-258-------GDV--VVLD---GVKIV---------------GNIGA-IVRTS--------------LALGA.SG--------
Q8XDF6_ECO57/1-142-------MLN--IVLY---EPEIP---------------PNTGN-IIRLC--------------ANTGF..R--------
Q9A8W1_CAUCR/124-265-------GFL--VMLD---QITDP---------------QNIGA-IFRSA--------------AAFGA.KG--------
Q72QT0_LEPIC/71-212-------GAF--LILD---RIQDP---------------GNLGN-ILRTA--------------ECFGV.TN--------
Q7P7P4_FUSNV/111-252-------NNL--VILD---DVSDP---------------GNLGT-IIRIC--------------DATNF.KD--------
Q6NHA0_CORDI/3-144-------KLH--IVFD---NPVIP---------------NNTGN-AIRTS--------------AVTGA..S--------
Q8G5E6_BIFLO/133-283-------PQI--AAFW---QVRDP---------------GNAGT-VIRAA--------------DAAGC.DA--------
Q8FA35_ECOL6/9-160-------RIT--IILV---APARA---------------ENIGA-AARAM--------------KTMGF.SE--------
Q8YNM2_NOSS1/5-155-------GVR--IVLV---EPSGP---------------LNVGA-IARVM--------------KNFGL.AH--------
Q8KC03_CHLTE/108-249-------PLL--VILQ---GLEDP---------------HNVGA-IIRTA--------------EAVAA.DA--------
Q7NRY2_CHRVO/3-154-------NIR--VVLA---RPNHP---------------GNIGS-AARAM--------------KTMGL.SR--------
Q8GYL4_ARATH/196-346-------HRV--LVLD---SIQDP---------------GNLGT-LVRSA--------------MAFNW.DG--------
Q720L1_LISMF/107-248-------KKL--LLVD---AVQDP---------------GNVGT-LIRTA--------------DAAGY.DC--------
Y1673_SYNY3/120-261-------RLG--LVLE---RLQDP---------------GNLGT-ILRTA--------------AATGV.EG--------
Q98R32_MYCPU/82-224-------ETI--LILD---HLEDP---------------YNFGA-ILRSA--------------NAFGI.KN--------
Q6KIH0_MYCMO/89-225-------KRI--LVLE---NINDP---------------GNLGT-LVRSA--------------FAFGF.ND--------
TARB1_HUMAN/1463-1606-------RLI--VVAS---LIDKP---------------TNLGG-LCRTC--------------EVFGA.SV--------
Q824D7_CHLCV/116-256-------PFY--LIIE---QVEKP---------------GNVGA-ILRIA--------------DGVGA.DG--------
Q9CHW1_LACLA/110-250-------AKF--LLLE---NVQDP---------------GNVGT-MIRTA--------------DAAGF.SA--------
Q82FA2_STRAW/107-239-------APV--VVLD---NPRNL---------------GNAGA-VIRLA--------------AGFGA.TG--------
Q6MIZ9_BDEBA/141-282-------SMV--LILD---GIEDP---------------HNLGA-ILRTS--------------WLVGA.QG--------
O27877_METTH/10-161-------NIS--VVFV---EPETP---------------GNIGF-LARAM--------------KNFGL.RT--------
Q8Z0C3_NOSS1/123-264-------GVV--LALE---TIQDP---------------GNLGT-IIRTA--------------AAAGA.SG--------
Q8ECQ8_SHEON/21-159-------AVY--IGLV---NPKTP---------------TNVGG-IMRAS--------------GCYGV.DA--------
Q7MSH0_WOLSU/110-249-------DRL--LVLH---GVSDS---------------GNIGG-IFRSA--------------YCLGM.EG--------
RLMB_SALTI/95-236-------PFL--LILD---GVTDP---------------HNLGA-CLRSA--------------DAAGV.HA--------
Q9PR20_UREPA/90-231-------ALV--LILD---EIEDP---------------RNFGA-IIRTA--------------NGFGV.DA--------
Q72GY4_THET2/109-248-------PLV--LVLL---GLEKP---------------GNLGA-ILRAA--------------DGAGA..D--------
Q6MNP1_BDEBA/47-187-------DTA--VVLE---GIYDR---------------GNISA-VMRSA--------------EGLGF.GN--------
Q9LXE4_ARATH/154-296-------SVC--LVVE---GLSDF---------------GNISA-AFRSA--------------DALGI.QS--------
Q73J63_TREDE/100-245-------EHV--LMLD---EIGNA---------------NNLGA-IIRSA--------------AFFGI.EN--------
Q6SFH7_9BACT/10-160-------QFK--IVLC---RTSHP---------------GNIGS-SARAI--------------KTMGF.TH--------
Q6MTA0_MYCMS/106-249-------NNI--LLLD---QIQDP---------------GNLGT-LIRSA--------------ASFNF..K--------
Q8YIL5_BRUME/130-270-------SLV--VVLC---GISNH---------------DNVGS-IFRNA--------------AAFEA.DC--------
O83093_TREPA/117-262-------EFV--VLLD---RVGDA---------------HNLGA-IIRSA--------------AFFGV.HS--------
Q9PQG4_UREPA/113-253-------DNI--LLLD---NIQDP---------------GNLGT-ILRTC--------------FAFNI.KQ--------
Q820Y2_TROWT/113-259-------PLF--IACD---QVTDP---------------RNLGA-IVRSA--------------AAFRA.SA--------
Q6YQX1_ONYPE/907-1048-------QKF--LILD---AINDP---------------HNLGA-ILRTV--------------EACAL.DG--------
Q8PJZ3_XANAC/6-157-------RIR--FVLV---GTQHP---------------GNIGA-AARAM--------------KTMGV.SR--------
YACO_BACSU/97-238-------PFF--LILD---ELEDP---------------HNLGS-IMRTA--------------DAVGA.HG--------
TRML_SYNY3/1-143-------MVK--LVLV---NPQIP---------------PNTGN-IARTC--------------AATGT..E--------
Q6MMA4_BDEBA/107-249-------PLV--FVLD---NIRSA---------------FNVGS-IFRTA--------------ECLGA.EK--------
Q729J5_DESVH/23-164-------DLT--LVLA---NIHDP---------------HNVSA-IYRSC--------------DAFGV.AQ--------
Q6UCQ6_9PROT/107-248-------SII--FLLD---QLDDP---------------QNVGA-IFRSA--------------LAFNI.DG--------
Q9F5K6_STRVR/126-272-------FLG--VLFD---RPTSP---------------GNIGS-IIRSA--------------DALGA.HG--------
Q8A2Z0_BACTN/24-168-------PLV--VVLD---DIRSL---------------HNIGS-VFRTS--------------DAFRI.EC--------
Q97B79_THEVO/10-160-------RIW--VVLV---QPKYQ---------------GNIGA-VARSM--------------KNSGL.SK--------
Q8R700_THETN/26-168-------DLV--VFVD---DVTNE---------------HNFSA-ILRTC--------------DAVGV.MR--------
Y2399_ARCFU/77-217-------SFI--LFLD---NVVDQ---------------RNIGA-CIRTA--------------EFFGA.AG--------
Q92JA7_RICCN/2-149-------NPI--IILV---APQMG---------------ANIGA-TARAM--------------KNFGL.NE--------
Q98QQ8_MYCPU/1-149-------MIN--IVLY---QPEIP---------------PNTGN-IIRTC--------------FATSS..K--------
Q72G19_DESVH/97-239-------PLI--IALD---QVQDP---------------GNAGT-LARSL--------------YALGG.AG--------
Q6MA83_PARUW/115-255-------PFF--VVAE---AIEKP---------------GNLGT-ILRSS--------------DAVGI.DG--------
Q87R44_VIBPA/101-237-------GLM--IALD---GVSDP---------------GNLGT-IIRVA--------------DWYGI.KH--------
Q8XZH6_RALSO/113-250-------HDC--VILD---GIQDA---------------GNVGS-ILRCA--------------AAAGV.RD--------
Q73RN5_TREDE/119-253-------GVY--VYAE---DIRTP---------------FNIGS-IFRTA--------------ESFGV.EK--------
Q727W7_DESVH/4-156-------GLT--VVMV---KTRFP---------------ENVGM-VARAC--------------VNMGA.QD--------
Q7U8A3_SYNPX/2-151-------TVV--VVLV---EPAGP---------------LNIGS-VARLC--------------ANFGV.DA--------
Q8XJ72_CLOPE/109-249-------ELV--VLVD---KVQDP---------------GNMGT-IIRTA--------------HAAGA.AG--------
Q8R9C5_THETN/105-242-------GVY--VIAD---NVQDP---------------GNLGT-IIRTA--------------DAFGA.DA--------
Q7TU91_PROMP/282-424-------PII--VALD---GVTDP---------------HNFGA-IIRSA--------------EAFDC.KG--------
Q6FAL4_ACIAD/3-155-------HVR--IVMV---NTTLP---------------ANIGS-ALRAM--------------KTMGL.SQ--------
Q98QQ7_MYCPU/101-239-------SNI--LFLN---NLQDP---------------TNIGT-LLRSA--------------LSFNF.KN--------
Q89I93_BRAJA/15-167-------GPI--VILV---EPQLG---------------ENIGM-AARAM--------------GNFAL.SR--------
Q8GYT1_ARATH/5-144-------ESY--VVVH---NIAKR---------------HNVGT-LARSA--------------TAFGV.TE--------
Q8D323_WIGBR/95-236-------YFF--LILD---GIMDP---------------RNLGS-CIRSA--------------YIFGV.QA--------
Q72H04_THET2/88-229-------PLL--VALD---GVTDP---------------RNYGA-MIRSA--------------LALGA.HG--------
TRML_GEOSE/2-145-------ALH--VVLF---QPEIP---------------ANTGN-IARTC--------------AATNT..A--------
Y252_MYCGE/95-238-------STL--VMLD---EIQDP---------------YNFGA-ILRTC--------------LASEV.DG--------
Q72JF4_THET2/3-156-------RVR--IVLV---EPQEP---------------MNLGA-VARAM--------------RNFGL.SR--------
Q8KD02_CHLTE/16-159-------PVT--LMLY---NIRSM---------------WNVGA-MFRTA--------------DAAGI.DE--------
Q7NWF9_CHRVO/117-255-------AAR--VMLE---DIQDP---------------GNLGT-ILRTA--------------AAAGV.YD--------
Q72N93_LEPIC/2-144-------SLY--IGLY---RPEIP---------------PNTGN-IARLC--------------VALGA..E--------
Q6MHK3_BDEBA/6-165-------EIR--IVLV---RTIYE---------------RNIGA-TSRAM--------------SNMGI.EK--------
Q828C9_STRAW/145-290-------RLV--AVLA---HVRDP---------------GNAGT-VLRCA--------------DAAGA.EA--------
Q7NIP3_GLOVI/2-151-------NVR--IVLV---ATQGA---------------RNLGA-IARVI--------------KNFDL.SE--------
Q98NQ0_RHILO/12-164-------GPA--IILV---EPQLG---------------ENIGM-VARAM--------------ANFGL.SE--------
Q6MEY4_PARUW/104-242-------QNI--LVLD---GINDP---------------GNLGT-LMRTA--------------LAFGW.NG--------
Q7BKE9_PRB01/91-232-------PLI--LILD---NIIDP---------------RNLGA-CIRSA--------------AVIGV.DA--------
Y1476_METJA/4-155-------MIS--VILV---NPKYS---------------GNVGS-IARVM--------------MNFGF.EE--------
Q8K8I3_STRP3/17-159-------RNH--IVLF---QPQIP---------------QNTGN-IARTC--------------AATNA..P--------
Q9X263_THEMA/90-230-------PLI--VLLD---QIQDP---------------HNLGA-IVRTS--------------VGAGA.NG--------
Q73MR5_TREDE/110-250-------AFV--VILD---SVTDP---------------HNTGS-IIRSA--------------DQFGI.DG--------
Q8EPH3_OCEIH/102-242-------NLI--ILLD---AIQDP---------------GNMGT-IIRTA--------------DAAGV.DA--------
Q8PHE1_XANAC/153-294-------VLA--LWLD---GVGNP---------------HNFGA-ILRSS--------------AHFGV.AG--------
Q6F190_MESFL/4-147-------QVN--IVLY---EPEIA---------------QNVAA-IIRTC--------------VATNA..K--------
Q6MMJ6_BDEBA/113-244-------GLE--VI.S---PLGDP---------------SNLGA-LARSS--------------LAFGA.SK--------
TRML_MYCGE/5-150-------VIN--IVLF---CPEIP---------------NNTGN-IVRSC--------------TAFKA..N--------
Q6MR30_BDEBA/7-149-------LFR--IVLI---EPEIP---------------QNTGN-IGRTC--------------VGTNC..E--------
Q6AF11_LEIXX/119-263-------RRI--VVLE---DIVDH---------------TNVGA-IFRSV--------------AGLGA.DA--------
Q6GHU8_STAAR/105-242-------QQV--LLID---RVQDP---------------GNLGT-LIRTA--------------DAAGM.DA--------
Q89IY5_BRAJA/156-297-------GMV--LVLD---QITDP---------------HNVGA-ILRSA--------------AAFAV.KA--------
Q7TUD5_PROMP/21-161-------NLT--VLVE---AVNKP---------------HNLSA-ILRTC--------------DAAGVFEA--------
Q6AJ92_DESPS/144-286-------PRI--IVCD---SLQDP---------------HNLGA-IVRSA--------------LASGA.IG--------

PF14419

O28057_ARCFU/168-343-------KIS--FVQM---PYLED-----------TKAALEIGERIGRAA--------------QAFEI-KE--------
D3S2R7_FERPA/167-342-------KIS--FVQM---PYLED-----------LRGAKQIGERIGRAA--------------QSFEI-KE--------
D2RFH8_ARCPA/167-342-------KIS--LVQM---PYLED-----------ISAAKEMGEKIGRSA--------------QAFEV-KE--------
F2KQY0_ARCVS/173-346-------KIS--IVQL---PYLE.-----------.KGAFELGERIGRAV--------------QAFEI-KE--------
Q9V2I9_PYRAB/172-346-------KLT--IVQM---PYWGD-----------YKTARAFGEKIGRAA--------------QAFEV-KE--------
O57783_PYRHO/172-346-------KLT--IVQM---PYWGD-----------YKTARAFGEKIGRAA--------------QAFEV-KE--------
Q8TZR0_PYRFU/172-346-------KLT--IVQM---PYWGD-----------YKTARAFGEKIGRAA--------------QAFEV-KE--------
F0LM29_THEBM/169-343-------KVS--IVQM---PYWGD-----------YKACRNFGEKIGRAA--------------QAFEV-KE--------
Q5JGM1_PYRKO/169-344-------KVT--LVQM---PYWGD-----------YKACRKFGEKIGRAA--------------QAFEV-KE--------
B6YU66_THEON/169-344-------KVT--LVQM---PYWGD-----------YKACRSFGEKIGRAA--------------QAFEV-KE--------
C5A405_THEGJ/173-348-------KLT--IVQM---PYWGD-----------YKACRLFGEKIGRAA--------------QAFEV-KE--------
E3GWV1_METFV/168-342-------KIT--IVQL---PYWGD-----------YKVCRKMGEKIGRAA--------------QAFEI-KE--------
C9RGK2_METVM/168-343-------KVV--VVQM---PYLGE-----------KIVCKKFGEAIGRSA--------------QGFEI-KE--------
C7P975_METFA/169-344-------KVV--IVQM---PYLGE-----------KIVCKRFGEAIGRAA--------------QGFEV-KE--------
D3S697_METSF/168-343-------KVV--IVQM---PYLGE-----------KIVCKRFGEAIGRAA--------------QGFEV-KE--------
D5VTY7_METIM/171-346-------RVV--IVQL---PYLGE-----------KKVCRKFGEAIGRAA--------------QGFEV-KE--------
Y421_METJA/168-343-------KVV--IVQM---PYLGE-----------KIVCKRFGEAIGRAA--------------QGFEV-KE--------
Q8TVD0_METKA/167-340-------KLE--LAQI---PYLGD-----------PRAAYSMGERIGRAV--------------QGFEL-KS--------
Q9YCV6_AERPE/169-342-------RVA--VVQM---PYLGP-----------LDACRNMGVRIGREV--------------QNFEV-RE--------
A3MX62_PYRCJ/175-347-------KVA--IGQM---VYEGD-----------DEAVKKMGERIGRAA--------------QTFEV-AE--------
A2BJY2_HYPBU/183-356-------RIA--IVQM---PYLGP-----------LDACKTMGVRIGREV--------------QNFEV-GE--------
B1Y9Z5_THENV/175-347-------KMA--VGQF---VYEGD-----------EEAVRKMGERIGRAA--------------QTFEV-GE--------
A1S137_THEPD/177-355-------KLV--VAHE---PYLGP-----------PDASYVMGTRIGREV--------------QVFEV-GK--------
A4WLE1_PYRAR/175-347-------KVA--LGQF---VYEGD-----------EEAVRKMGERIGRAV--------------QTFEV-GE--------
Q8ZTN2_PYRAE/175-347-------KVA--LGQF---VYEGD-----------EEAVRKMGERIGRAV--------------QTFEV-GE--------
A1RRY5_PYRIL/175-347-------KVA--IGQF---IYEGD-----------EEAVRKMGERIGRAA--------------QTFEV-GE--------
E0SSC1_IGNAA/177-354-------RFV--VVHE---PYLGP-----------EDASYTMGVRIGREV--------------QTYEV-GE--------
A8AC59_IGNH4/171-344-------KVV--VVQE---PYLGP-----------LEGVKEVSKRVGRVL--------------QSFGV-GT--------

PF02590

RLMH_STRPQ/1-158------MKVK--LICV---GKLKE---------------RYLKDGISEYQ--------------KRLSRFCQ.....---
RLMH_XANCP/1-154------MKCR--LIAT---GERAP---------------AWVAQGFAEYQ--------------KRLSHWMP.....---
RLMH_THEMA/1-150------MRVR--IAVI---GKL.D---------------GFIKEGIKHYE--------------KFLRRFCK.....---
RLMH_CLOPE/1-158------MNIT--VISV---GKLKE---------------KYLKQAIDEYS--------------KRLSRYCK.....---
RLMH_MYCPU/1-144------MKIN--IISV---GTLSK---------------EF.QVIFDDYI--------------KKINFYSN.....---
RLMH_UREPA/1-158------MMIK--IISV---GKLKQ---------------KAFVDLINDYL--------------KRINHYLK.....---
RLMH_CAUCR/2-153------MKIT--ILTV---GKLGR---------------MVEAQLALDYA--------------SRATASGRALALG---
RLMH_CLOAB/1-158------MNIT--LITV---GKLKE---------------KYLKDAVNEYA--------------KRLQKYCK.....---
RLMH_LACLA/1-158------MKIK--LVVV---GKLKE---------------KYLKDGIAEYV--------------KRMGTMLP.....---
RLMH_DEIRA/1-144------MRLH--LITV---GEPKL---------------AYARSGWDEYE--------------KRLRRYHK.....---
RLMH_PSEAE/1-154------MRLR--LIAV---GSRMP---------------RWVEEGWQEYV--------------KRLPAELS.....---
RLMH_YERPE/1-154------MKLQ--LVAV---GTKMP---------------DWVQTGFIEYL--------------RRFPKDMP.....---
RLMH_STRPN/1-158------MKIK--VVTV---GKLKE---------------KYLKDGIAEYS--------------KRISRFAK.....---
RLMH_HELPY/1-149------MRCV--VYSI---AKSSP---------------...LELVKIYQ--------------KQCRQFDC.....---
Y5620_ARATH/39-192------LPIR--VITV---GKKRS---------------EGVRLLVDEYK--------------IKLKPYCS.....---
RLMH_ACIAD/1-157------MKIR--ILTI---GQKMP---------------AWVLTGFEDYF--------------KRIQPFVQ.....---
RLMH_NEIMA/1-154------MNIT--VLAV---GTKMP---------------RWVDEAVAEYA--------------KRFGRDVA.....---
RLMH_DESTE/1-158------MHIT--LLCV---GKLKE---------------DFLLLAQKEYL--------------KRLSPYAR.....---
RLMH_LISIN/1-158------MNIQ--IVTV---GKLKE---------------KYLVQGIAEYL--------------KRLSAYAK.....---
RLMH_AGRT5/1-158------MRIS--IFAV---GRLKS---------------GPEKDLAARYI--------------ERLAKTGPAIGLE---
RLMH_XYLFA/2-155------MKCL--LIAT---GERVP---------------TWVAQGFAEYH--------------KRLSYWLP.....---
RLMH_FUSNN/1-154------MNIN--IICI---GKIKD---------------KYINDGIAEFS--------------KRMTSFVS.....---
RLMH_RALSO/1-154------MQLL--IVAV---GHKMP---------------RWIEDGFAEYA--------------KRMPPELR.....---
RLMH_BACSU/1-158------MNIN--IVTI---GKLKE---------------KYLKQGIEEYT--------------KRLSAYAK.....---
RLMH_RHILO/1-158------MKIS--VHAV---GRMKA---------------GPERELADRYF--------------ERFAKSGPAVGLE---
RLMH1_THETN/1-132------MNYK--FFII---AKKIE---------------PFYQEAIEEYF--------------KRLQRFCS.....---
RLMH_STAHO/1-158------MKIT--ILAV---GKLKE---------------KYWKQAIAEYE--------------KRLGAYSK.....---
RLMH_RHIME/1-158------MRIG--LFAV---GRLKA---------------GPEKDLAGRYL--------------DRFAKAGPAVGLE---
RLMH_CAMJE/5-152------LQVN--IFCI---.QKSD---------------EF.KTCSEKYS--------------KLISKYAT.....---
RLMH_BACHD/1-158------MNIS--IISV---GKLKE---------------KYLKQGIAEYT--------------KRLGAYAK.....---

PF01994

TRM56_METTH/55-175------WGGP..FSVV---YRRNW----------------------QGVI--------------DSWKKDGG--------
TRM56_HALSA/58-177------FGGP..FDVE---RTTEL----------------------NATI--------------EDW...PG--------
TRM56_SULTO/47-168------WGGK.YFSIE---FVKNP----------------------KKVV--------------RDWRNSGG--------
TRM56_AERPE/62-182------WGGP..FTVE---CGVSG----------------------RRYV--------------RMWREGGG--------
TRM56_HALMA/58-177------FGGP..FDVA---STEEP----------------------KRLI--------------RDF...EG--------
TRM56_METHJ/53-171------FGGE..FFVE---DKVGW----------------------NSCI--------------KRWKQDGG--------
Q2EMT5_METVO/53-191------WGGD..FQFK---VADSW----------------------KSYV--------------KEFKKNNG--------
TRM56_METBU/55-174------WGGD..FYVE---NDVNW----------------------KSEI--------------EKWKEEGG--------
TRM56_HALWD/60-180------FGGP..FDVE---RTDGL----------------------NATI--------------REW...SG--------
TRM56_UNCMA/55-177------WGGD..FWVR---AGVSY----------------------RSEI--------------RQWKEKGG--------
TRM56_PYRAB/55-175------WGGP..FFVK---FEKSW----------------------RKVM--------------KEF...DG--------
TRM56_METM5/54-177------WGGD..FKFE---VVKSW----------------------RTYA--------------KRFKD.NG--------
TRM56_METST/54-174------WGGD..FEVE---YQKAY----------------------RPVI--------------KEHKQKGF--------
TRM56_THEAC/53-169------FGGS..FSIK---TGCNW----------------------IQEF--------------KHF...QG--------
TRM56_METJA/54-175------WGGN..FEFV---VEKHW----------------------RKYI--------------REFKK.RG--------
TRM56_METKA/59-178------WGGP..FTVQ---WVGNW----------------------RRVI--------------KDWKRSGG--------
TRM56_METAC/55-174------WGGD..FYIK---NNVNF----------------------KQEI--------------RAWKEEGG--------
TRM56_THEPD/59-180------WGGD..FKVL---TTRDP----------------------RETV--------------ANWKKNGG--------
TRM56_NATPD/58-177------FGGP..FEVE---LTTEP----------------------RALV--------------RDW...AG--------
TRM56_THEVO/53-169------FGGN..FFIK---SGVDW----------------------KREF--------------RNF...KG--------
TRM56_SULSO/37-159------WGGSSYFLVK---EIENG----------------------KSIV--------------NEWKEKGG--------
TRM56_PYRKO/57-179------WGGP..FEIE---FNPSW----------------------KKIL--------------REWKD.RG--------
TRM56_SULAC/4-130------WGGKSYFKVE---FVDNP----------------------KKIV--------------KSWREKGG--------
TRM56_METTP/54-172------WGGS..FSVT---DGIAW----------------------RDEL--------------RRFRDSGG--------
TRM56_CENSY/54-172------WGGG..FEVE---LIDSW----------------------RALL--------------RS.KKGSA--------
Q2QAM0_9EURY/57-176------FGGH..FTAE---HHSKP----------------------LGYL--------------RHFAKQGG--------
TRM56_ARCFU/54-168------WGGD..FFIK---.AVSW----------------------KKLL--------------REF...DG--------
Q2V9D2_9CREN/30-151------WGGQQEFEVE---LVNDW----------------------RSLI--------------KSWKRNAG--------
TRM56_HYPBU/65-185------WGGS..MELA---CGVNS----------------------RRYV--------------LEWKRAGG--------
TRM56_PICTO/53-168------FGGS..FEVK---TGIEW----------------------KSFM--------------KKF...HG--------
TRM56_METS5/50-170------WGGK.YFRIE---MISNP----------------------KKLV--------------NDWKATGG--------

PF09895

A4YJ17_METS5/38-141-------------------GTAAQ---------------AGIPD-VGRLA--------------LKTGK.SL--------
A4WL82_PYRAR/38-137-------------------GAAAQ---------------Q.IGD-LFKLA--------------FKLGG.EV--------
A3MX89_PYRCJ/38-139-------------------GAAAQ---------------Q.IGD-LFKLA--------------FKMGG.EV--------
Q980M7_SULSO/40-148-------------------GTAAQ---------------SGVPE-VNKLA--------------FKYNK.PI--------
A8A923_IGNH4/41-144-------------------GAAAQ---------------IGVPE-VSKLA--------------YKLDK.AF--------
Q4JAZ5_SULAC/39-144-------------------GVASN---------------VGVPE-VNKLA--------------FKLGK.TF--------
Q975T6_SULTO/38-143-------------------GVAAQ---------------AGVPE-VSKLA--------------YKNNK.SF--------
Q6M1A6_METMP/36-139-------------------GSAAQ---------------NGIPI-AQKMA--------------IKLNK.NL--------
Q8TUU2_METKA/37-134-------------------SRAAL---------------DGITQ-VLEHP--------------EERGRVPV--------
A2BLW0_HYPBU/2-112-------------------GAAAS---------------SGIPE-VARLA--------------LKLGA.SF--------
A1RRR7_PYRIL/38-139-------------------GAAAQ---------------Q.IGD-LFKLA--------------FKMGG.EV--------
Y2001_AERPE/40-147-------------------GGAAQ---------------SGVPE-AMRLA--------------LKLGK.SL--------
A3DN09_STAMF/37-140-------------------GAAAQ---------------IGVPE-AYKIA--------------YRQKK.SL--------
A1RX98_THEPD/41-156-------------------GPAAQ---------------VGIPE-AQKLA--------------LRHNC.NL--------
A8MCI7_CALMQ/39-143-------------------GSAAQ---------------QGVPE-AFKIA--------------LKYSS.SL--------
Q8TXR0_METKA/39-151-------------------GSAAQ---------------EGVPK-AQRIC--------------LEAGV.EL--------
Y1199_METJA/39-142-------------------ASAAQ---------------SGIPT-LHKMA--------------YKLGK.NV--------
Q8ZTS8_PYRAE/38-139-------------------GAAAQ---------------Q.IGD-LFKLA--------------FKMGG.EV--------

PF02598

Q6C565_YARLI/46-384-------SVT--LVVP---STCIS----ETVVKSYQQAVHTAYQ-IARAA--------------VAYNVDEIVIYEPSER
Q6BHG5_DEBHA/25-381-------QYS--ICVP---STIIS----AANAKNLEQITSIAYQ-IAKAA--------------TIYNVAEVVVLDVPTS
CI114_HUMAN/74-365-------TLS--VALP---GSILD----..NAQSPELRTYLAGQ-IARAC--------------AIFCVDEIVVFDEE..
O59417_PYRHO/2-253-------SWH--VFIP---DSLLE----..ETSDLKLKAYKVGQ-IARAC--------------AIFGVEHIWIYKA...
Q8MSZ6_DROME/73-371-------TLS--IAVP---GSILE----..NAQSNELRAYVAGQ-IARAA--------------CIFRVNEVIVFDDVGI
Q6NRR6_XENLA/72-362-------TVS--VALP---GSIMD----..NAQSPELRTYLAGQ-IARAC--------------AIFCIDEIVIFDET..
Q8ILD7_PLAF7/85-440-------DVC--VAIP---STIIN----..NKSDV.IKSYLTSF-LARIF--------------TIFSISKIYIYDDYLE
Q8ZT54_PYRAE/1-258-------MFS--IAIP---HDFLS----..EIPDEAGKVRKLGY-LARAA--------------AIFKAEYIIIYHY...
O28353_ARCFU/1-247-------MLS--IAIP---SSALI----..NERDEKIKTYKVGL-IARAA--------------AVFRVDEIIIYYD...
O26109_METTH/5-258-------DLS--IFIP---DSLTA----..ETGDLKIKTYKVVL-IARAA--------------SIFGVKRIVIYHD...
Q9UXA9_SULSF/26-261-------PLN--VVLF---LSIFD----..VENSLLEVTLKLSF-ILRVT--------------TTFRVNKIYWITD...
YMP6_CAEEL/67-369-------TIS--IAVP---GQFLN----..NAQSAELRTYMAGQ-IARAA--------------TLYRVDEIIIYDESCR
YM91_YEAST/19-314-------HYS--LCIP---TTLVS----..DCRNLSQITHKVYQ-VAKFA--------------SLFNVSEVVILED...
Q7SI54_NEUCR/48-343-------TIS--VAVP---TSVIT----..DCVTREQRTTWAGR-IARAC--------------AVFSVDEIVIYDD...
Q8TZ04_METKA/1-250-------MVA--VAFP---WSLFS----..EETDPKIYAYRVGT-LARAL--------------AIYRVEEVYLYGD...
Q6FIJ5_CANGA/41-365-------NYA--VCIP---TSVLD----..NCQNLSQKTYVVYQ-LARTL--------------TLFNVAEVVVLDLKQ.
Y1688_HALSA/2-280-------TRS--VLVP---SSLVR----..EAEDKREATRKLGY-VARAA--------------AVFRIDRVVVFPD...
YG5X_YEAST/39-337-------KYS--ICIP---TTVID----..NCNNLEQVTFTAYQ-IARTA--------------VLFNVQEIIVLDQ...
Q7RF09_PLAYO/162-498-------DVS--VAIP---ATIIN----..NKNDV.IKSYLSSY-LARIF--------------TIFSISKIYIYDDGFE
Q6CLH1_KLULA/48-407-------NHS--ICIP---TTVLD----..SCKNLEQITYTLYQ-IARSA--------------CIYNVAEIVILKAESE
YGWG_SCHPO/17-306-------TIS--LALP---ISSLN----..VAYNLQLKTSFVWK-ISRIV--------------SLYGIDEIILLEDP..
Q6NLH7_ARATH/99-388-------TVS--IAIA---GSIIH----..NTQSLELATRLAGQ-IARAA--------------TIFRIDEIVVFDNK..
Q751R3_ASHGO/60-408-------NYT--LCIP---TSILD----..NCANLEQVTHALYQ-IAKAA--------------TLFNVGEIVVLDLGTD

PF04452

Q83AE1_COXBU/37-252VTLDS.RNYHYLLNVL---RLREGHKIILFN.GDGNNYGGRITRIQKKQV.EITID........SKEAGRTE--------
Q7D102_AGRT5/16-233QEATG.EQFNYLANVL---RMTDGAEILLFN.GRDGEWKAKLSFPSRKKI.SLVPL........EQTRPQPD--------
Q6D078_ERWCT/19-238AELSD.DAANHIGRVL---RMNTGQSLQLFD.GSNHVFDAEIIAAGKKSV.RVSFT........AGKLEDKE--------
Q73XZ7_MYCPA/18-242AVLGG.DEGFHAATVR---RIRPGERLVLGD.RAGGLARCEVEHAGRDGL.RARVL........ERWTVAPP--------
Q8DX86_STRA5/14-241VTIEDKDTIKHMFNVM---RLTEDDQVVLVF.DDAIKRLAKVVDSSAHRF...QIL........EELDNNVE--------
Q72R34_LEPIC/17-226FHLNK.EEISHLKALR---IFSEDKNLRVLN.GIGTEWIYEIPGNSVQGI..............FKKTITHL--------
Q9A2Z1_CAUCR/16-232VVPTV.DQSRYLTSVM---RLSVGAELLLFN.GRDGEWRATLVEATKRGC.LLKAE........EQTRPMTL--------
Q8K5R0_STRP3/14-241VTITDKDTIKHMFQVM---RLTDEAEVVLVF.DDGVKYLAKVTSSMAHEL...EII........EALPDQVE--------
Q8G5Y7_BIFLO/28-259LTLPA.HIKRHAVQAM---RLKAGDSLQLSD.GNGLRIQAVMADPEAGLA..............EVVEVGRE--------
Q6NAN3_RHOPA/23-243VPLER.DQSNYLGNVL---RLGAGAAVLAFN.GRDGEWRATIAGRKRPEA..LEVA........EQTRPQDR--------
Q8P6T0_XANCP/18-239VTLPE.ESANHLLRVL---RLREGDACVLFN.GDGSDYHARITVAGKREA.RAVVE........RVEAVSNE--------
Q7VKS8_HAEDU/18-238CSLSE.DATNHIGRVL---RMNVGEKIILFD.GSNHIFHAVLETVQKKQI.QVKIL........HSELDDRE--------
Q71ZK0_LISMF/17-245LSITG.ENFHHITRVM---RMKESDQVFIVF.PSKKTCIAAITAINDDEV.FLNLV........KWLEEDTE--------
Q8FVR3_BRUSU/16-233FDAGA.QAAHYLTHVL---RMKEGDEVLVFN.GRDGEWKASLQPEGRKRL.LLEPL........EQTRPQPK--------
Q7ND55_GLOVI/19-229ARLDP.AQSHYLRQVL---RLRDGASCIVGD.GLGNTWQATLAGDTVRLG..............SLLPRTGE--------
Q6FA41_ACIAD/16-235TLLTE.SVFHHWVRVL---RAQVNDCAIFFN.GQGGEYQVTLQEINKKNA.TVSID........QFNPVDRT--------
Q9CCN1_MYCLE/18-246AVVGG.DEGFHAVTVR---RIRPGEELVLGD.GVGGLAHCLVERAGRDGL.YARVL........GHWTVAPG--------
Q8XVR6_RALSO/18-244VTLPE.SVARHI.HVL---RLAVGDDVCLFD.GSGQEFRARLDAINRRDA.TASLA........DATQPDTE--------
Q83GJ2_TROWT/19-230VFLSD.REQRHACLSR---RIRVGEEIGLTD.TMGRTANARVTVSSQPGT.ITARI........MNLTLHKP--------
Q8EPW6_OCEIH/16-246IRIIG.DDVHHIQRVM---RAQVGEKLICVS.DNGRAALTYIIKLSDDYV.DVEIE........KWLEESNE--------
Q6NG15_CORDI/26-247VVLDG.AEGRHAVSVK---RMTAGEQIKLID.GRGGWATATVASTSGKSTLNLQVF........ECNEEATP--------
Q6KI62_MYCMO/14-223FILDE.KVLNHI.KVL---RIKNDFFICNYN...NEFYKCKLENKIAIIV..............EKLNIDNE--------
Q6E297_ARATH/69-288VRVQG.SEFWHMAKVL---RLKQEDRVELFN.GKGGLVEGCIQSIDKTGV.DFIAQ........EDQKVILP--------
Q89ZP8_BACTN/13-229YELPE.EEAQHCTRVL---RLGIGDEITLTD.GKGHFYKAEITVATNKRC.LVAIK........ETIFQEPL--------
Q9ZIA2_CLOAT/16-241AYIYG.DDVKHIYKVL---RLKVGEKVSIND.CNSHEFLGEIEQINKENV.KVKII........ENLDINNE--------
Q7U7K3_SYNPX/18-237VHITD.HRADHLRQVL---RSAVGESIRIGV.VGGKRGDARVEASDATGV.TLRVA............LNEP--------
Q9RDD9_STRCO/21-243YVLDG.PEGRHAVSVK---RLRAGEDVVLTD.GRGHWAEGTVKAAEGKDRLVVTVP.......GGVREEPAE--------
Q6G8Z0_STAAS/16-244FFITKKEDIHHITNVM---RYDVGSKIILTF.NDQTVYLCEIADITSDKI.AVDLK........EKQNINTE--------
Q7PAV9_RICSI/18-235IELASDHHVHYVKTVL---RLKVNDGLRLFN.GTDGEFLAQINDIGKNNL.SVRLK........EQLKKPYT--------
Q8KAZ3_CHLTE/18-236AIIDG.EEFHHLARVL---RCQPGDVVPITD.GAGFAAELMVGSIGKHSL.DGAIC........NPRTVPPP--------
RSME2_BORBU/16-236IIVKDAKIYHHLVNVR---RLKKGDKLNILL.KDKELRASEIVKIGSNFI.KFTTN........KIDKIEKN--------
Q82BY2_STRAW/19-243YVLDG.AEGRHAVSVK---RLRPGEDVVLTD.GAGRWADCVVLGTEGKDRLIVQMD........SVTEEPPE--------
Q6MAP1_PARUW/18-233VLLKD.NEFHHLAHVM---RAKKGERVELVN.GKSILAQATVLDIHKGQA.VLLID........HIKTERMD--------
Q6G0I7_BARQU/22-239IKIEG.QKASYLIHVL---RMQEGAEILLFN.GQDGEWLAKLITIKKRFV.VVKLI........HQERLQTA--------
Q87EY9_XYLFT/18-239IILPE.LVANHLLRVL---RLCEGDTCVLFN.GDGHDYLARLIATGRREA.WARIE........GVSEVCNE--------
RSME_BACSU/19-247FSITG.EEVHHIVNVM---RMNEGDQIICCS.QDGFEAKCELQSVSKDKV.SCLVI........EWTNENRE--------
RSME_SHIFL/18-237IALCE.DAANHIGRVL---RMGPGQALQLFD.GSNQVFDAEITSASKKSV.EVKVL........EGQIDDRE--------
Q833H7_ENTFA/16-244YKVAD.ENYHHIVRVM---RMTPNDRCYLVF.QNKTAILAEIVEIDSTSV.YFKEI........SKEEMDKE--------
Q6HDL0_BACHK/16-243IRIVG.DDVHHIARVM---RMSAGDHIYCCV..NGRTAVCSIDEITSEFI.NTAIV........EWVEASSE--------
Q89DB6_BRAJA/24-242VPLDR.DQSNYLGNVL---RLAAGAEVLAFN.GRDGEWQAAIEGRKRPDG..LVIL........QQTRPQDR--------
Q9PQJ0_UREPA/14-231VYFYD.SDVHHIKNVM---RMRLHDKVIVIN..KTKAFVAEIINLEPLHA...TII........KPYTLNCE--------
Q8XIT7_CLOPE/16-241AKITG.EDVKHIYKVL---RVKPGEKVVVNN.LESEEFLGEVEEVNKQEV.SIKIL........EKLDVNNE--------
Q9CJ96_LACLA/18-245FIIENQAAAHHIFTVM---RAKSGDQIRLVF.TDGEIGLSEVISPSDQSV...KLI........KLLTESSE--------
Q7MT38_PORGI/15-239DRLPD.DEAGHILRVL---RMQAGDRLRLTD.GRGSFFDAVIETADRKSC.YVSVC........GQEPWQKP--------
Q9RH08_ZYMMB/27-242IIPDR.AQAHYLLSVM---RFKMGSQLVLFD.NLTGEWLGEVIEAGRKHL.QLKIT........HHLNEKES--------
RSME_SYNY3/80-299VTLTT.AQLHYLQRVL---RLQKGDGFMVLD.GGGGVWRAQLNDLAHGTA...QLL........ETVSEQNE--------
Q8RB65_THETN/16-239AYVDG.KDFHHLIHVL---RYKVGDKIVVSD..MAEEHLGRIEKIEKDRA.ILFLE........EKMEGNAE--------
Q9RU73_DEIRA/24-239MRLGP.QETRHL.HVL---RLRPGERVQVFD.GRGGEAVAVLSELDAGHA.LLHLDP.....AAAAHSRGAE--------
Q7VHH3_HELHP/14-232VSVND.ENVNYLMKVR---RVQLGETLALRNLNDDNLYTYELSEIDKKAL.TLRLQ........ASQNAPSN--------
Q72R98_LEPIC/18-253FSIQDPKKINHICNIL---NKREGDRLKAGL.IDTDLGQFFLEKINKNQI..VGIY........KPILVPRP--------
Q74G06_GEOSL/16-240VVVRG.DLFRHMARSL---RLKIDTEVILAD.GKEAECTGVITAMGRDSL.TVTIS........ERRQIRGD--------
Q7P2R8_FUSNV/14-232ILVVDIGDINHIKNVF---RKVKGDKIRAVD..GANEYLCEIEKIDEKEI.KLKIL........EKIKDSFS--------
RSME_MYCBO/18-242AVVDG.DEGFHAATVR---RIRPGEQLVLGD.GVGRLARCVVEQAGRGGL.RARVL........RRWSVPPV--------
Q6F738_ACIAD/16-235WRIHSARQLSHLHKQL---NIQVDDTLKVGI.RNGKRYLTRIVAIEEQEI.RVTPI............QQEA--------
Q8DS03_STRMU/14-241VTITDKDTIKHMFNVM---RLTEDDEVVLVF.DDGIKRLARVTNVQEHTF...EIV........DELSDNVE--------
Q8YX66_NOSS1/19-231VLLTT.QQKHYLKRVL---RLREGDRFIVMD.GLGKWWLANLTEEQAQVL..............EELAVKTE--------
RSME_AQUAE/13-228LLILREGEVKHF.RVR---RIEKDEEFGVIH..EGKIYVCKVRREDKREI.SCEIV........EELETKLP--------
Q9F9G9_9GAMM/17-236VELGA.SASHHIGKVL---RMAVADELVVFN.GRGGEWLARISAISKKAV.CIEPL........TFTDEDRC--------
Q892R3_CLOTE/16-241AIILD.EDVKHIYKVL---RLTTEDEVIINN.CEGEEFLGEISYIDKKEV.IVNIK........EKLDINNE--------
Q6MI96_BDEBA/16-247VNFTG.DVFHHIFDVC---RQEIGSKFEVLT.EDSKAYFVEVTHVSKKNA.TARVL........EERIIPAL--------
Q987U8_RHILO/16-233FDADQ.QQSHYLIHVL---RLGEGAEILLFN.GRDGEWSAAIAAKSKKAV.RLRVQ........TLQRPQPP--------
Q7VZC1_BORPE/18-240VALPE.ALAHHAVRVL---RLRAGAALVLFD.GAGGEYPATL.EIEGKAA.WAQLG........AHVPREAE--------
Q7RMG7_PLAYO/19-251LFKTDGRQTSHLKNIL---KVKLNQIIKVGV.INKGKGEGIILEENPKFY.IIKLL..........TPIHL.--------
Q8FNF6_COREF/18-236VTVTG.PEGRHAVTVK---RITPGERVMLID.GHGTARTCQVTAVSGRDRMDVVVE........SVEEIPPP--------
Q8DNP5_STRR6/18-245VTIEDKETSKHMFQVM---RLKEEDEVTLVF.DDGIKRLARVLDMENRQF...ELV........QELNDNVE--------
Q8CSC8_STAES/19-247FFIENKEDYHHIVNVM---RYKEGQNIIVTF.SDENVFKCKIISINDQSI.EIKLV........EKQQINTE--------
Q73J56_TREDE/35-272VFYKNDERYLHIKKIL---NLKEGDVFKAGI.INGKIGEAQISHLSEEKI.VFSFCPNPPDKGIADNGADKV--------
Q7V223_PROMP/22-248LKLTN.NEARYINKVM---RIKIGKEIFITN.GEGSLWKAINLEDNYIKI..NDIN........NPYLFQEK--------
Q7U730_SYNPX/24-238VPLER.SEQHYLRRVL---RCRVGDTIDVVD.GCGSLWQAQLISADALRV.SVPAD........QIEPVRVP--------
Q92RS8_RHIME/22-239HEATR.EQFNYLINVL---RLGEGSSLLVFN.GRDGEWRAEIAMPSRKQA.VLVAV........EQTRPQPA--------
Q82WB5_NITEU/17-247ITLNS.DTSHHAAQVL---RLKPGDAVTLFD.GTGGEFSGRLEQISKSGC.QVRIE........CHLPVERE--------
Q87LK2_VIBPA/18-237IALSE.DAAGHIGRVL---RMKEGQEVLLFD.GSGAEFPAVISEVSKKNV.LVDVT........ERVESNIE--------
RSME_BUCAP/20-240ISLSK.SYTHYIKKVL---RMKKKDKLEIFN.NTNYIFFSEILEINNHTI.EIIIL........KKQIKNLE--------
RSME_MYCH2/14-226FILTN.LTLNHI.KTV---RIKNENFICVYQ...NEFYLVRLVPNSNKAE....II........EKIKGNNE--------
Q6AEC1_LEIXX/18-236LTLTG.PEARHAVTVN---RTRPGERILIGN.GRGLVAAGEVLVATGSEL.TIDVA........ALDRIQRR--------
Q7V7G0_PROMM/24-244LSLKQ.DEVHYLRRVL---RLRNGQAVALVD.GVGHFWEAHLQAGDFLKL.DTSPS........SPSLQQPR--------
Q6AMJ0_DESPS/17-250IQITD.HRAKHIVKVL---RSQVGDRVRVGV.IDGGRGMAKIVAIKPKFP.FSVDL........DIQLETTL--------
RSME_HELPY/14-226LKIEG.ESYTHLYRSR---RVKSASRLDLRNLKDGFLYTYEHAEITKKHA.LLKLV........GARLLEVM--------
Q7P147_CHRVO/16-235LSLPD.AVVRHV.QVL---RLNAGDAITLFN.GRGGEYQAALSAVMKRDA.HCVIE........RFDDVSRE--------
Q72BF1_DESVH/15-234YALTG.QEARHLTKVV---RVHAGDLIRLLD.GAGREGVFRVTGTSRNSV.ELTP.........ESITTHPE--------
RSME_HAEIN/18-238CYLSE.DAANHVARVL---RMTEGEQLELFD.GSNHIYPAKIIESNKKSV.KVEIL........GRELADKE--------
Q8EWP2_MYCPE/13-228VWFDD.NDLKHF.KSL---RINNEDIIDCID.QNNSLVKVKIKSLDPIKS.EIIEI........KENKLSNK--------
RSME1_BORBU/15-233ISLND.TRAEHLVKIL---KLKDNDKFKFGI.LGEKNIYHCIYKKDKKLF.FKKIF........KVGESNKL--------
Q8EIK7_SHEON/18-237LNLDE.DGAAHIGKVL---RMGNGEQISLFN.GDGHDYLAEIIDAAKKSV.TVKVL........SCEANPSE--------
RSME_BUCAI/27-247YFLSD.ENRHYVTKVL---RMKIEDILEIFN.NTHYIFFAKIIDISKKII.KIQTF........KKILKNLE--------
Q8NNB5_CORGL/18-236IELAG.PEGRHAVTVK---RIQVGEKISLID.GRGTARTCTVTALQGKDRLNAVVD........LVEEIPAP--------
Q7VBR8_PROMA/24-246IDLTG.QESHYLARVL---RLRYGDHINIVD.GVGHLWTADFIKEDLIKL.HSDLS........NPEVTESK--------
Q73FW1_WOLPM/18-226LALNP.QQSHYICNVM---RLKKYDNLSLFN.GKDGEWLGEVVNISRKLT.EVTPK........ECTKQQQY--------
Q73LI5_TREDE/15-246IRLDK.KDYNYLVSVR---RIKEGQVLKISL.NGVKPASAEVFKINTEKK.YIELR.......LLKEEFAFD--------
Q98Q27_MYCPU/14-222FILTN.EILNHI.KVA---RVQNKNFICIYE...QVFYLCKLEGKKALII..............EKIDANHE--------
RSME_TREPA/18-242LSFRD.SRFCHIKRVL---KLSAGACFKAGI.INGVKGSARISLATEKYL.VAVFE..............KL--------
Q6A996_PROAC/19-238VEITG.AEGHHAGSVR---RIRVGESVLVTD.GQGHAVRGPAIEVTKGSV.SVETV........EILHTPAT--------
Q9X1A0_THEMA/14-217VIFDE.REAHHM.RVV---RLKEGDVIEATD.GNGFSYTCILKSLKKKTA.AAKIV........KVEEKEKE--------
Q9KD69_BACHD/16-244VTITG.DDVKHIIKVM---RMTIGDELICSD.GHGRTVRCEIEKANDSEV.LARVI........EPLIPNTE--------
Q6F1G3_MESFL/14-235FFIINNNDVHHIKNVV---KLKNDEIIECVY..EKEVYQTKIIDLTIENN.VIVEI........INKVETTI--------
Q8DI45_THEEB/47-258VTLTA.EQQHYLYHVL---RLKVGDELWILD.GQGQRWLGQIQGKTVKLL..............RPDCRETE--------

PF04013

TRMYL_VIBCH/1-199-------MRSFILRAR---SAPTDSQRLLDE-IGG.KCHTEILAHCMMNS----------------LFTAQS--------
TRMY_PYRAB/1-203-------MRVFIIKAN---EAHTANDFSLKD-LPGTSGRIDLICRALNSA----------------FHLSHS--------
TRMY_PYRHO/1-202-------MRVFIVKAN---EAHTDYDFSLKD-LPGTSGRIDLICRALNSA----------------FHLSHS--------
TRMY_METJA/1-202-------MREFIFKAN---KTITSSDINLKD-LPGSCGRLDLLCRCVSDA----------------FFLSHD--------
TRMY_AERPE/1-186-------MSLYVVISP---TGRTDGNIPARG-YAGPSGRLDVIARAYNAI----------------LEP...--------
TRMY_ARCFU/95-288-------VRGFLIVGN---KAFT.QPFSLND-LPG.AGRMDVLCRCTSQA----------------LFISHG--------
TRMY_HALSA/1-193-------MRQFVVLGH---DAPTTPDFPLDD-LPGAAGRLDVLCRCVSAA----------------LFVSHG--------

PF04252

Q9YC91_AERPE/71-273PAIVVELLEDTPSRWLLEELLESYLFAVQMG--YRFAVTGATNP......--------------........--------
Q9V144_PYRAB/2-195PYLVIEHLEEIS.EWL...LLEYKHVAEWWG--DKLIFTNVKPE......--------------........--------
YO021_YEAST/1-212MKYIIEHMEEGFSEWV...ILEYSQILREVG--AENLILSSLPESTTEKD--------------IPQRLLKL--------

PF01746

RG9D3_MOUSE/135-308TQHMSKKELSRLAGQI---RRLYGSNKKASR--PFWICLTGFSTASPLYE--------------ECLRMND.--------
RG9D2_HUMAN/110-276DHLMVLKDIKKLHKQI---QRCYAENRRALH--PVQFYLTSHGGQLKKNM--------------DENDKGWV--------
Q9BI62_CAEEL/175-352LSRLSPRGRGLTALQL---QYLITENRRNPD--PFRLHFVNYDSKNSSIQ--------------DLEKSKLQ--------
Q9UZ22_PYRAB/108-288WDKHIPKEKSKIILQL---RETYGVMRRMMW--PKMLAITWLNDEVKERL--------------KIPLEKIK--------
Q9FGI9_ARATH/127-293AHLMSESEISSLVQQI---MYCYAVNGRSTS--PCHLWLTGVQGKMSTEL--------------DKLP....--------
RG9D2_DROME/104-271DDLMQERDIVKCVKQC---LRIYTINRRSPQ--PGNLHFTGIRRNGHIHE--------------SFKKNE..--------
TRMD_STRLI/21-232VGKARARGQLGVHVHD---LRDWTYDRHNTV--DDTPYGGGPGMVMKTEP--------------WGDALDSV--------
TRMD_SHIFL/22-221TGRAVKNGLLSIQSWS---PRDFTHDRHRTV--DDRPYGGGPGMLMMVQP--------------LRDAIHAA--------
TRMD_MYCLE/21-224PGKAIESGLVDVQVHD---LRRWTHDVHHSV--DDVPYGGGPGMVMKAPV--------------WGEALDEI--------
Q19789_CAEEL/96-260DDLMIEKDQKRTVQQI---GWCYTANRHSPD--PFQFHVVGFDGPSRKIY--------------D.......--------
TRMD_HELPY/22-221LKRALEKNLFELEVLN---LRDFSANKYQKA--DHTLIGGGAGQILDPEM--------------VENALHSV--------
TRMD_MYCGE/22-216MLQAQKANLVQFEVVN---WRNFCNDKHKTV--DDMAYGGGSGMVLKAEP--------------IINCLNFY--------
TRMD_BORBU/22-219MKKAINKGIVSFELVD---VRDFSKDKHKRC--DDLPYGGGAGMVLKAEP--------------ISFALEHV--------
TRMD_MYCPN/22-216MAQAQKAKLVEFEVIN---WRQYCKDKHQTV--DDMAYGGGGGMVLKAEP--------------ILKALKAC--------
Q97Z49_SULSO/105-260MDLLQDEEKISLEQQI---LVSIKTIREYLF--DYNLKLAHTPDSFKLE.--------------........--------
TRMD_SYNY3/22-218LGKALEKAIASVNLIN---PRDFTTDKHRRV--DDEPYGGGVGMVIKPEP--------------IFAAVESL--------
Q9YET3_AERPE/129-296KFMHTEEELSKLRLQI---AVALSEVRKYLW--DPHLVLTNMDPQTS...--------------........--------
MRRP1_MOUSE/207-375DNYMKPSELQNTVSQL---LESEGWNRRNVD--PFHIYFCNLKIDSAYHR--------------ELVKRYRE--------
TRM10_YEAST/104-276DELMNDKEIVSLSNQV---TRAYSANRRANH--FAEIKVAPFDKRLKQRF--------------ETTLKNT.--------
O58442_PYRHO/158-338WDKHIPKEKDKITLQV---RETYAVMRRMYY--PRKFAITWINEEYKKKN--------------KLPLEKIV--------
TRMD_AQUAE/27-222VKQAIKKGKVEVYPID---LREFAPKGQ..V--DDVPYGGLPGMVLKPEP--------------IYEAYDYV--------
TRMD_BACSU/22-221LQKAQEKDAVQFQVVN---FREYSDNKHNTV--DDYPYGGGAGMVLKPQP--------------VFDAVEDL--------
TRM10_SCHPO/104-273DDLMNDKEINSLCQQV---TRCHSANRTALH--PVELFATNFGGRLKTRQ--------------DFVLKGQQ--------

PF09936

B5EBC8_GEOBB/4-189----------------------------------------------------------------------YYI--VTPVE
Q3A2E8_PELCD/2-183----------------------------------------------------------------------FYV--ITPVV
A1AMZ9_PELPD/5-189----------------------------------------------------------------------FYI--VTPSL
A5G7Z4_GEOUR/8-192----------------------------------------------------------------------YYV--ITPVA
Y054_AQUAE/17-201----------------------------------------------------------------------YYI--VQPID
A7HKS2_FERNB/2-186----------------------------------------------------------------------YYV--VTHLP
A0LMM3_SYNFM/1-185----------------------------------------------------------------------CYV--VTPLR
TRMD_DESDG/242-423----------------------------------------------------------------------YYI--TTPIE
Q2LVU3_SYNAS/10-194----------------------------------------------------------------------YYI--VTPLE
Q1MRV0_LAWIP/191-372----------------------------------------------------------------------VTI--VTPLQ
Q0AWV8_SYNWW/3-187----------------------------------------------------------------------FFL--VHPSP
A8ZV19_DESOH/6-188----------------------------------------------------------------------YFV--VTPLE
Q24UB0_DESHY/1-185----------------------------------------------------------------------YYI--VHPAE
A6LNY5_THEM4/2-186----------------------------------------------------------------------YYL--VTNLP
A1HN71_9FIRM/2-187----------------------------------------------------------------------YFI--IHPLE
A8F3G0_THELT/2-186----------------------------------------------------------------------YYI--VTNLR
Q0F054_9PROT/1-176----------------------------------------------------------------------VYI--VHPAP
Q3AC73_CARHZ/1-185----------------------------------------------------------------------YYI--VHPSS
Q7P719_FUSNV/2-186----------------------------------------------------------------------YRL--VVPVD
B3E5S7_GEOLS/2-186----------------------------------------------------------------------YYL--VTPSE
Q6AJE7_DESPS/14-197----------------------------------------------------------------------YYL--TTPYE
A5IM13_THEP1/2-186----------------------------------------------------------------------YYI--VTNLR
A1VFE5_DESVV/242-423----------------------------------------------------------------------FYV--TTPLE
A9BF02_PETMO/2-186----------------------------------------------------------------------YFL--VTNLP
Q39RN9_GEOMG/8-192----------------------------------------------------------------------YYI--VTPVP
Q1NQ21_9DELT/248-432----------------------------------------------------------------------FYL--VTPYA
Q6ML98_BDEBA/8-193----------------------------------------------------------------------YYI--IHPMK
Q74FG2_GEOSL/8-193----------------------------------------------------------------------YYL--VTPVE

PF00588

Q8CXU2_LEPIN/126-265----------------------------------------------------------------------VLV..ADPKL
Q7NBG1_MYCGA/4-151----------------------------------------------------------------------LHL..IHPFG
Q6BHP1_DEBHA/1290-1434----------------------------------------------------------------------LLT..LNDIN
Q8I3K9_PLAF7/198-344----------------------------------------------------------------------LYY..TK.HT
Y324_MYCLE/160-301----------------------------------------------------------------------ILI..PQRRS
Q22484_CAEEL/1071-1214----------------------------------------------------------------------LVV..ADVLV
O74022_9EURY/1-150----------------------------------------------------------------------LVL..INPNL
Q7TU01_RHOBA/25-165----------------------------------------------------------------------LWI..VEPAS
MRM1_SCHPO/147-297----------------------------------------------------------------------ILL..SK.KH
Q6ME25_PARUW/89-224----------------------------------------------------------------------IYF.....ST
Q8R6H6_FUSNN/88-229----------------------------------------------------------------------III..PERNS
Q729V9_DESVH/1-141----------------------------------------------------------------------LHL..IEPLG
Q74D44_GEOSL/15-165----------------------------------------------------------------------LRI..VK.GC
Y516_BORBU/78-219----------------------------------------------------------------------LVI..TTQKR
Q898S5_CLOTE/9-150----------------------------------------------------------------------LHL..IKPLG
Q6FZ54_BARQU/2-143----------------------------------------------------------------------VHI..IEPAG
Q7UG85_RHOBA/132-272----------------------------------------------------------------------VLL..SD.CP
Q6YR72_ONYPE/92-232----------------------------------------------------------------------VFA..SF.HS
Y881_MYCTU/130-275----------------------------------------------------------------------VVF...GTGC
Q6XK16_SPICI/109-253----------------------------------------------------------------------IIL...YNHT
Q6MS22_MYCMS/92-234----------------------------------------------------------------------III..LDKKQ
Q8A814_BACTN/97-238----------------------------------------------------------------------VII..PARGS
Q7UFJ5_RHOBA/144-289----------------------------------------------------------------------ILL...GPHT
TRMH_SHIFL/19-159----------------------------------------------------------------------VHA..VWPGS
Q73T60_MYCPA/69-206----------------------------------------------------------------------VHI..VGRRR
Q9RWT9_DEIRA/12-159----------------------------------------------------------------------LRI..VAPRC
Q9RXS5_DEIRA/10-149----------------------------------------------------------------------LHL..IRPFG
Q9UXD5_SULSF/1-149----------------------------------------------------------------------LYI..VNPRA
Q74D57_GEOSL/96-237----------------------------------------------------------------------VII..PRDRA
Y380_HAEIN/4-151----------------------------------------------------------------------LCL..VSPKS
Q7VBF1_PROMA/9-160----------------------------------------------------------------------LRL..VSPRC
Q8IJ98_PLAF7/52-193----------------------------------------------------------------------IFI..VG.KR
Q9PQM3_UREPA/1-151----------------------------------------------------------------------HLV..RP.YG
O67731_AQUAE/93-233----------------------------------------------------------------------ALI..SKDRT
Q6F981_ACIAD/122-259----------------------------------------------------------------------VVC...TKGS
Q7M8R3_WOLSU/2-143----------------------------------------------------------------------LHL..IHPLG
Q73GK0_WOLPM/102-244----------------------------------------------------------------------LVL..PH.NH
Q8PVX0_METMA/11-163----------------------------------------------------------------------LVL.....MN
Q8FF07_ECOL6/222-362----------------------------------------------------------------------VVV.....QD
Q7V131_PROMP/7-159----------------------------------------------------------------------LRI..VSPKC
Q7WLL7_BORBR/7-163----------------------------------------------------------------------LVL..VAPRF
Q8TXY9_METKA/2-150----------------------------------------------------------------------LFL..VRPRS
Y052_BORBU/34-174----------------------------------------------------------------------VHV..IE...
Q9AAX1_CAUCR/6-147----------------------------------------------------------------------LDV..IEPCS
Q9CC19_MYCLE/108-251----------------------------------------------------------------------VIF...GGYT
TSNR_STRAJ/116-258----------------------------------------------------------------------IIL..VDSDI
Q8XDF6_ECO57/1-142----------------------------------------------------------------------LHI..IEPMG
Q9A8W1_CAUCR/124-265----------------------------------------------------------------------VIL..QD.RH
Q72QT0_LEPIC/71-212----------------------------------------------------------------------IIL..PE.RE
Q7P7P4_FUSNV/111-252----------------------------------------------------------------------IIL...TKST
Q6NHA0_CORDI/3-144----------------------------------------------------------------------LHL..IEPLG
Q8G5E6_BIFLO/133-283----------------------------------------------------------------------VIF..VD.DC
Q8FA35_ECOL6/9-160----------------------------------------------------------------------LRI..VDSQA
Q8YNM2_NOSS1/5-155----------------------------------------------------------------------LVL..VSPQC
Q8KC03_CHLTE/108-249----------------------------------------------------------------------VIM..IEGKG
Q7NRY2_CHRVO/3-154----------------------------------------------------------------------LYL..VEPK.
Q8GYL4_ARATH/196-346----------------------------------------------------------------------AFL...LPGC
Q720L1_LISMF/107-248----------------------------------------------------------------------VVL...GKGS
Y1673_SYNY3/120-261----------------------------------------------------------------------IWL..TA.DC
Q98R32_MYCPU/82-224----------------------------------------------------------------------IIY..PIKRA
Q6KIH0_MYCMO/89-225----------------------------------------------------------------------VIV.....EG
TARB1_HUMAN/1463-1606----------------------------------------------------------------------LVV..GSLQC
Q824D7_CHLCV/116-256----------------------------------------------------------------------VIL..CD.PI
Q9CHW1_LACLA/110-250----------------------------------------------------------------------VIL..LG.ET
Q82FA2_STRAW/107-239----------------------------------------------------------------------VVT....TGT
Q6MIZ9_BDEBA/141-282----------------------------------------------------------------------VLI..PEDRA
O27877_METTH/10-161----------------------------------------------------------------------LIL..INPCE
Q8Z0C3_NOSS1/123-264----------------------------------------------------------------------LLL...SQDS
Q8ECQ8_SHEON/21-159----------------------------------------------------------------------VFY..TGKRY
Q7MSH0_WOLSU/110-249----------------------------------------------------------------------VIL..TNLSS
RLMB_SALTI/95-236----------------------------------------------------------------------VIV..PKDRS
Q9PR20_UREPA/90-231----------------------------------------------------------------------IIY..KKHHQ
Q72GY4_THET2/109-248----------------------------------------------------------------------LVL..VA.EG
Q6MNP1_BDEBA/47-187----------------------------------------------------------------------FHV..IETQE
Q9LXE4_ARATH/154-296----------------------------------------------------------------------VHV..VSCDS
Q73J63_TREDE/100-245----------------------------------------------------------------------IVL..TKEDK
Q6SFH7_9BACT/10-160----------------------------------------------------------------------LTL..VNPKQ
Q6MTA0_MYCMS/106-249----------------------------------------------------------------------TVI..ASPNS
Q8YIL5_BRUME/130-270----------------------------------------------------------------------VLM...DETC
O83093_TREPA/117-262----------------------------------------------------------------------LVV..SDCRQ
Q9PQG4_UREPA/113-253----------------------------------------------------------------------VIF..NN..C
Q820Y2_TROWT/113-259----------------------------------------------------------------------VLI..GKNRS
Q6YQX1_ONYPE/907-1048----------------------------------------------------------------------VIM..SKKHQ
Q8PJZ3_XANAC/6-157----------------------------------------------------------------------LVL..VAPER
YACO_BACSU/97-238----------------------------------------------------------------------IVI..PKRRA
TRML_SYNY3/1-143----------------------------------------------------------------------LHL..VGPLG
Q6MMA4_BDEBA/107-249----------------------------------------------------------------------IYL.....CG
Q729J5_DESVH/23-164----------------------------------------------------------------------VHL..YYTDT
Q6UCQ6_9PROT/107-248----------------------------------------------------------------------IIL..TNTNS
Q9F5K6_STRVR/126-272----------------------------------------------------------------------LIV..AG.HA
Q8A2Z0_BACTN/24-168----------------------------------------------------------------------IYL..CGITA
Q97B79_THEVO/10-160----------------------------------------------------------------------LII.....VG
Q8R700_THETN/26-168----------------------------------------------------------------------VYY..FSEAK
Y2399_ARCFU/77-217----------------------------------------------------------------------VVL..PK.RR
Q92JA7_RICCN/2-149----------------------------------------------------------------------LRI..VAPR.
Q98QQ8_MYCPU/1-149----------------------------------------------------------------------LHI..IKPIA
Q72G19_DESVH/97-239----------------------------------------------------------------------LIV..PRHNA
Q6MA83_PARUW/115-255----------------------------------------------------------------------LIV..CD.RC
Q87R44_VIBPA/101-237----------------------------------------------------------------------IIA...STDC
Q8XZH6_RALSO/113-250----------------------------------------------------------------------VFM...TTGC
Q73RN5_TREDE/119-253----------------------------------------------------------------------VFL...SHDC
Q727W7_DESVH/4-156----------------------------------------------------------------------IVL..VDPER
Q7U8A3_SYNPX/2-151----------------------------------------------------------------------LRL..VNPRC
Q8XJ72_CLOPE/109-249----------------------------------------------------------------------IVM...TKGT
Q8R9C5_THETN/105-242----------------------------------------------------------------------VFT..IN.NS
Q7TU91_PROMP/282-424----------------------------------------------------------------------IIV..PQRRS
Q6FAL4_ACIAD/3-155----------------------------------------------------------------------LVL..VAPKT
Q98QQ7_MYCPU/101-239----------------------------------------------------------------------IIY.....DN
Q89I93_BRAJA/15-167----------------------------------------------------------------------LRI..VNPRD
Q8GYT1_ARATH/5-144----------------------------------------------------------------------LIL..VGRRD
Q8D323_WIGBR/95-236----------------------------------------------------------------------VII..RKNRS
Q72H04_THET2/88-229----------------------------------------------------------------------VVS..EERRA
TRML_GEOSE/2-145----------------------------------------------------------------------LHL..IRPLG
Y252_MYCGE/95-238----------------------------------------------------------------------IIF..KKNNQ
Q72JF4_THET2/3-156----------------------------------------------------------------------LYVVNPPPRV
Q8KD02_CHLTE/16-159----------------------------------------------------------------------IVI..TGYTA
Q7NWF9_CHRVO/117-255----------------------------------------------------------------------VFL..SK.GC
Q72N93_LEPIC/2-144----------------------------------------------------------------------LHI..VGQAS
Q6MHK3_BDEBA/6-165----------------------------------------------------------------------LIL..IDPKC
Q828C9_STRAW/145-290----------------------------------------------------------------------VVL..TD.AS
Q7NIP3_GLOVI/2-151----------------------------------------------------------------------LWL..VAPEC
Q98NQ0_RHILO/12-164----------------------------------------------------------------------LRL..VNPRD
Q6MEY4_PARUW/104-242----------------------------------------------------------------------IYL..LPTSC
Q7BKE9_PRB01/91-232----------------------------------------------------------------------MII..NKHHC
Y1476_METJA/4-155----------------------------------------------------------------------LRI..VGDKS
Q8K8I3_STRP3/17-159----------------------------------------------------------------------LHI..IKPMG
Q9X263_THEMA/90-230----------------------------------------------------------------------III..PKDKS
Q73MR5_TREDE/110-250----------------------------------------------------------------------IIV..PENKS
Q8EPH3_OCEIH/102-242----------------------------------------------------------------------VVL...GDGC
Q8PHE1_XANAC/153-294----------------------------------------------------------------------LLL..PAGST
Q6F190_MESFL/4-147----------------------------------------------------------------------LHI..IEPLG
Q6MMJ6_BDEBA/113-244----------------------------------------------------------------------MIL..TEESC
TRML_MYCGE/5-150----------------------------------------------------------------------LHL..IKPYG
Q6MR30_BDEBA/7-149----------------------------------------------------------------------LHI..VGKMG
Q6AF11_LEIXX/119-263----------------------------------------------------------------------VLV...SPRC
Q6GHU8_STAAR/105-242----------------------------------------------------------------------VIM...EKGT
Q89IY5_BRAJA/156-297----------------------------------------------------------------------IVT..TA.RH
Q7TUD5_PROMP/21-161----------------------------------------------------------------------NFI..SEKDK
Q6AJ92_DESPS/144-286----------------------------------------------------------------------VLL..TRERS

PF14419

O28057_ARCFU/168-343----------------------------------------------------------------------LII--APHDY
D3S2R7_FERPA/167-342----------------------------------------------------------------------LII--APYNY
D2RFH8_ARCPA/167-342----------------------------------------------------------------------LVI--APFGY
F2KQY0_ARCVS/173-346----------------------------------------------------------------------LII--APFGY
Q9V2I9_PYRAB/172-346----------------------------------------------------------------------LII--APKEK
O57783_PYRHO/172-346----------------------------------------------------------------------LII--APKEK
Q8TZR0_PYRFU/172-346----------------------------------------------------------------------LII--APKEK
F0LM29_THEBM/169-343----------------------------------------------------------------------LII--APKEK
Q5JGM1_PYRKO/169-344----------------------------------------------------------------------LII--APKEK
B6YU66_THEON/169-344----------------------------------------------------------------------LII--APKEK
C5A405_THEGJ/173-348----------------------------------------------------------------------LII--APKER
E3GWV1_METFV/168-342----------------------------------------------------------------------LII--SPKEK
C9RGK2_METVM/168-343----------------------------------------------------------------------LII--SPKEK
C7P975_METFA/169-344----------------------------------------------------------------------LII--APKEK
D3S697_METSF/168-343----------------------------------------------------------------------LII--APKEK
D5VTY7_METIM/171-346----------------------------------------------------------------------LII--APKEK
Y421_METJA/168-343----------------------------------------------------------------------LII--APKEK
Q8TVD0_METKA/167-340----------------------------------------------------------------------YIV--TPYEP
Q9YCV6_AERPE/169-342----------------------------------------------------------------------LVV--APTGL
A3MX62_PYRCJ/175-347----------------------------------------------------------------------LAI--LLHKQ
A2BJY2_HYPBU/183-356----------------------------------------------------------------------LVI--APIGL
B1Y9Z5_THENV/175-347----------------------------------------------------------------------LAV--LLHKP
A1S137_THEPD/177-355----------------------------------------------------------------------LYV--TPVGA
A4WLE1_PYRAR/175-347----------------------------------------------------------------------LVI--LLHKP
Q8ZTN2_PYRAE/175-347----------------------------------------------------------------------LTI--LLHKP
A1RRY5_PYRIL/175-347----------------------------------------------------------------------LTI--LLYKQ
E0SSC1_IGNAA/177-354----------------------------------------------------------------------LVV--APIGS
A8AC59_IGNH4/171-344----------------------------------------------------------------------YYA--ALTEE

PF02590

RLMH_STRPQ/1-158---------------------------------------------------------------------.FEMIELTDER
RLMH_XANCP/1-154---------------------------------------------------------------------.LELVEIEPGL
RLMH_THEMA/1-150---------------------------------------------------------------------.PEVLEIKRVH
RLMH_CLOPE/1-158---------------------------------------------------------------------.LEIIELPDEK
RLMH_MYCPU/1-144---------------------------------------------------------------------.VNLIKIKEFK
RLMH_UREPA/1-158---------------------------------------------------------------------.CQEIVVSDEP
RLMH_CAUCR/2-153---------------------------------------------------------------------PVDILEVEARK
RLMH_CLOAB/1-158---------------------------------------------------------------------.LNIIELQDEK
RLMH_LACLA/1-158---------------------------------------------------------------------.LEIIELADEK
RLMH_DEIRA/1-144---------------------------------------------------------------------.VQVSRVSGKT
RLMH_PSEAE/1-154---------------------------------------------------------------------.LELVEIPLNT
RLMH_YERPE/1-154---------------------------------------------------------------------.FELAEIPAGK
RLMH_STRPN/1-158---------------------------------------------------------------------.FEMIELSDEK
RLMH_HELPY/1-149---------------------------------------------------------------------ELELVDLFPKN
Y5620_ARATH/39-192---------------------------------------------------------------------.FEDSLVRSNP
RLMH_ACIAD/1-157---------------------------------------------------------------------.TQVIELPMAK
RLMH_NEIMA/1-154---------------------------------------------------------------------.YALKEIKPEK
RLMH_DESTE/1-158---------------------------------------------------------------------.IELVEVREES
RLMH_LISIN/1-158---------------------------------------------------------------------.VSIVEVPDEK
RLMH_AGRT5/1-158---------------------------------------------------------------------FSRVIEVGESR
RLMH_XYLFA/2-155---------------------------------------------------------------------.LELVEIEPSL
RLMH_FUSNN/1-154---------------------------------------------------------------------.LNIIELKEYN
RLMH_RALSO/1-154---------------------------------------------------------------------.IELREIKPEQ
RLMH_BACSU/1-158---------------------------------------------------------------------.IDIIELPDEK
RLMH_RHILO/1-158---------------------------------------------------------------------FAGITEIAEGR
RLMH1_THETN/1-132---------------------------------------------------------------------....ISLSICK
RLMH_STAHO/1-158---------------------------------------------------------------------.IEMIEVPDEK
RLMH_RHIME/1-158---------------------------------------------------------------------LARVVETAESR
RLMH_CAMJE/5-152---------------------------------------------------------------------.LKEINVFNKK
RLMH_BACHD/1-158---------------------------------------------------------------------.IELIEVPDEK

PF01994

TRM56_METTH/55-175----------------------------------------------------------------------EVI-------
TRM56_HALSA/58-177----------------------------------------------------------------------VVV-------
TRM56_SULTO/47-168----------------------------------------------------------------------IVV-------
TRM56_AERPE/62-182----------------------------------------------------------------------EVV-------
TRM56_HALMA/58-177----------------------------------------------------------------------RVV-------
TRM56_METHJ/53-171----------------------------------------------------------------------VVV-------
Q2EMT5_METVO/53-191----------------------------------------------------------------------VVA-------
TRM56_METBU/55-174----------------------------------------------------------------------KVC-------
TRM56_HALWD/60-180----------------------------------------------------------------------TVI-------
TRM56_UNCMA/55-177----------------------------------------------------------------------FVV-------
TRM56_PYRAB/55-175----------------------------------------------------------------------VKV-------
TRM56_METM5/54-177----------------------------------------------------------------------IVV-------
TRM56_METST/54-174----------------------------------------------------------------------EII-------
TRM56_THEAC/53-169----------------------------------------------------------------------IRV-------
TRM56_METJA/54-175----------------------------------------------------------------------IVV-------
TRM56_METKA/59-178----------------------------------------------------------------------SVV-------
TRM56_METAC/55-174----------------------------------------------------------------------KVC-------
TRM56_THEPD/59-180----------------------------------------------------------------------IVV-------
TRM56_NATPD/58-177----------------------------------------------------------------------TVV-------
TRM56_THEVO/53-169----------------------------------------------------------------------IRV-------
TRM56_SULSO/37-159----------------------------------------------------------------------TII-------
TRM56_PYRKO/57-179----------------------------------------------------------------------IIV-------
TRM56_SULAC/4-130----------------------------------------------------------------------LVV-------
TRM56_METTP/54-172----------------------------------------------------------------------KIV-------
TRM56_CENSY/54-172----------------------------------------------------------------------SIV-------
Q2QAM0_9EURY/57-176----------------------------------------------------------------------QIV-------
TRM56_ARCFU/54-168----------------------------------------------------------------------LKV-------
Q2V9D2_9CREN/30-151----------------------------------------------------------------------NVV-------
TRM56_HYPBU/65-185----------------------------------------------------------------------EVI-------
TRM56_PICTO/53-168----------------------------------------------------------------------TKV-------
TRM56_METS5/50-170----------------------------------------------------------------------KVV-------

PF09895

A4YJ17_METS5/38-141----------------------------------------------------------------------IIL--PDLKD
A4WL82_PYRAR/38-137----------------------------------------------------------------------LVF--NDIND
A3MX89_PYRCJ/38-139----------------------------------------------------------------------LVF--NDIGD
Q980M7_SULSO/40-148----------------------------------------------------------------------LVL--PELKD
A8A923_IGNH4/41-144----------------------------------------------------------------------FVF--PDIDD
Q4JAZ5_SULAC/39-144----------------------------------------------------------------------ISL--PDLKD
Q975T6_SULTO/38-143----------------------------------------------------------------------IIL--PDLKD
Q6M1A6_METMP/36-139----------------------------------------------------------------------MFL--EDIDD
Q8TUU2_METKA/37-134----------------------------------------------------------------------MVV--DDLDD
A2BLW0_HYPBU/2-112----------------------------------------------------------------------TIL--GTVKE
A1RRR7_PYRIL/38-139----------------------------------------------------------------------LVF--NDIAD
Y2001_AERPE/40-147----------------------------------------------------------------------VVL--PELRD
A3DN09_STAMF/37-140----------------------------------------------------------------------IVL--PEIND
A1RX98_THEPD/41-156----------------------------------------------------------------------IVL--SDLPE
A8MCI7_CALMQ/39-143----------------------------------------------------------------------VVL--PTIKD
Q8TXR0_METKA/39-151----------------------------------------------------------------------LFF--QDLEE
Y1199_METJA/39-142----------------------------------------------------------------------LFF--EELDD
Q8ZTS8_PYRAE/38-139----------------------------------------------------------------------LVF--NDIND

PF02598

Q6C565_YARLI/46-384PDIKQEKT........................KKSETSSFGKPKIVFNSDASNDHKPELSER.......AVTLASLLQFF
Q6BHG5_DEBHA/25-381SKKQDLAEKEAAKVVELGSN.KGGKKIKFNFSDEDILKPTAVEKTKEPETPVDLSSDLNENN.......TLLFATLLQYF
CI114_HUMAN/74-365..........................................GQDAKTVEGEFTGVGKKGQA.......CVQLARILQYL
O59417_PYRHO/2-253..........................................................GGRD.......GRLIKTLLEYV
Q8MSZ6_DROME/73-371AT.....................................ARETKRSYEADGEGSSTGTVRSS.......SLQLARILQYL
Q6NRR6_XENLA/72-362..........................................GEGSKSVEGDFEGVGKKGQA.......CVQLARILQYL
Q8ILD7_PLAF7/85-440QEHLINKQKNYGDYQNEKYKKDIKNNSNNVNKNMHMNLKKDSNDNDHNTFDNIVNNEKNKEESPKYSYLCKYMHYNLQYL
Q8ZT54_PYRAE/1-258.......................................................GTPRRED.......IDFAKTVLEYL
O28353_ARCFU/1-247.........................................................PILDE.......SDFIAEILEYL
O26109_METTH/5-258.........................................................DADGE.......ARFIRDILTYM
Q9UXA9_SULSF/26-261.......................................................SLNSRKL.......EKIITDITKYA
YMP6_CAEEL/67-369MTD...................................EAVNAYYNGTWQGNLIPAETNYEG.......CFYLAKILEYL
YM91_YEAST/19-314.................................................NSQVDATKKKIST.......AKLILALLQYF
Q7SI54_NEUCR/48-343................................................SPVESRPASTDHEGYTGDVDPAHFLEHLLNYL
Q8TZ04_METKA/1-250.......................................................GVGTRRN.......AERLRKLLEYQ
Q6FIJ5_CANGA/41-365.........................................EKQNSIIEKDDTKKEKKRMSD.......AMLLASLLQYF
Y1688_HALSA/2-280......................................................EDGERQWG.......GGFVETVLRYA
YG5X_YEAST/39-337............................................SKDKKHEKKSRSKETISD.......CLLLATLLQYF
Q7RF09_PLAYO/162-498INCNERNEIKNTI..............SQKTNKEHFSCSSRENNEKNENNKNNKNNKKFEYSY.....LCKYLHFNLQYL
Q6CLH1_KLULA/48-407TNKGESDRKNDKK..............QGAKIKFDDGNNTNNASTEYLEDSEKEDGKKRLSK.......PMLMASLLQFF
YGWG_SCHPO/17-306..........................................EYVQNTQVHTLSSDAYLKDP.......TKFLTDLLCYF
Q6NLH7_ARATH/99-388...........................................SSSEIESAATNASDSNESG.......ASFLVRILKYL
Q751R3_ASHGO/60-408TDAAAPHLAA....................SELEPRKRKIKFEDVTEKTETSNKKSASRLSG.......AMLIATLLQYF

PF04452

Q83AE1_COXBU/37-252-----------------------------------------------------------SSLF.....IELGQGISRS.E
Q7D102_AGRT5/16-233-----------------------------------------------------------AAE......LHYLFAPLKV.G
Q6D078_ERWCT/19-238-----------------------------------------------------------SPLH.....LHLGQVMSRG.E
Q73XZ7_MYCPA/18-242-----------------------------------------------------------NPP......VTVVQALPKS.E
Q8DX86_STRA5/14-241-----------------------------------------------------------MPVQ.....VTIASGFPKG.D
Q72R34_LEPIC/17-226-----------------------------------------------------------KSER....VSAVATAIPKG.N
Q9A2Z1_CAUCR/16-232-----------------------------------------------------------GPD......LDLIVAMVKR.G
Q8K5R0_STRP3/14-241-----------------------------------------------------------LPVK.....VTIASGFPKG.D
Q8G5Y7_BIFLO/28-259-----------------------------------------------------------PEPLT...RLALIQALAKT.G
Q6NAN3_RHOPA/23-243-----------------------------------------------------------LPD......VAYVFAPLKH.A
Q8P6T0_XANCP/18-239-----------------------------------------------------------PPLA.....ITLLQGIARG.E
Q7VKS8_HAEDU/18-238-----------------------------------------------------------SNLP.....IHLGQVISRG.D
Q71ZK0_LISMF/17-245-----------------------------------------------------------LPIE.....ITIASGLPKG.D
Q8FVR3_BRUSU/16-233-----------------------------------------------------------PSE......LIYCFAPLKQ.G
Q7ND55_GLOVI/19-229-----------------------------------------------------------LPLP.....VTIACAVPKG.D
Q6FA41_ACIAD/16-235-----------------------------------------------------------PAFK.....AILGQVMSKG.D
Q9CCN1_MYCLE/18-246-----------------------------------------------------------LPP......ATVVQALPKA.E
Q8XVR6_RALSO/18-244-----------------------------------------------------------ARYA.....ITLAQGIAGG.D
Q83GJ2_TROWT/19-230-----------------------------------------------------------NRVT.....VSLLQALCRR.A
Q8EPW6_OCEIH/16-246-----------------------------------------------------------LPVS.....VTIAQGIPKG.D
Q6NG15_CORDI/26-247-----------------------------------------------------------TPT......VTVFQAIPKS.E
Q6KI62_MYCMO/14-223-----------------------------------------------------------FKNE.....VVLAMALINP.K
Q6E297_ARATH/69-288-----------------------------------------------------------QGMQW...QVFAAFGTLKG.G
Q89ZP8_BACTN/13-229-----------------------------------------------------------WPCH.....LHIAMAPTKNMD
Q9ZIA2_CLOAT/16-241-----------------------------------------------------------SPLN.....VYLYQGFPKA.A
Q7U7K3_SYNPX/18-237-----------------------------------------------------------PPPRH...RFDIVLALPRP.K
Q9RDD9_STRCO/21-243-----------------------------------------------------------QPR......ITVVQALPKG.D
Q6G8Z0_STAAS/16-244-----------------------------------------------------------LPVD.....VTICSGLIKA.D
Q7PAV9_RICSI/18-235-----------------------------------------------------------EST......LTLAVAIIKQ.D
Q8KAZ3_CHLTE/18-236-----------------------------------------------------------KTQ......VTVALSLLKSPQ
RSME2_BORBU/16-236-----------------------------------------------------------NFE......ISIFISSLKG.R
Q82BY2_STRAW/19-243-----------------------------------------------------------EPR......ITVVQALPKG.D
Q6MAP1_PARUW/18-233-----------------------------------------------------------SSR......LILAQAYVKP.D
Q6G0I7_BARQU/22-239-----------------------------------------------------------PSN......LIYCFAPLKN.A
Q87EY9_XYLFT/18-239-----------------------------------------------------------SPLA.....ITLVQAITRG.E
RSME_BACSU/19-247-----------------------------------------------------------LPIK.....VYIASGLPKG.D
RSME_SHIFL/18-237-----------------------------------------------------------SPLH.....IHLGQVMSRG.E
Q833H7_ENTFA/16-244-----------------------------------------------------------LPIE.....VTIACGLPKG.D
Q6HDL0_BACHK/16-243-----------------------------------------------------------LPVF.....VTIASGLPKG.D
Q89DB6_BRAJA/24-242-----------------------------------------------------------LAD......LTYVFAPLKH.A
Q9PQJ0_UREPA/14-231-----------------------------------------------------------LATK.....IDLFQASIKP.N
Q8XIT7_CLOPE/16-241-----------------------------------------------------------SNLN.....ITLFQGMPKA.A
Q9CJ96_LACLA/18-245-----------------------------------------------------------LPVQ.....ITVAVGFPKG.D
Q7MT38_PORGI/15-239-----------------------------------------------------------WRDR.....ITIAIAPTKQSE
Q9RH08_ZYMMB/27-242-----------------------------------------------------------IPD......LWLLTAPIKK.G
RSME_SYNY3/80-299-----------------------------------------------------------LPLP.....VTLAIALPKG.S
Q8RB65_THETN/16-239-----------------------------------------------------------SPLE.....VFLFQGILKA.D
Q9RU73_DEIRA/24-239-----------------------------------------------------------YPQP.....VTLAIALLKG.D
Q7VHH3_HELHP/14-232-----------------------------------------------------------IKSH.....LHLLWAIIEP.K
Q72R98_LEPIC/18-253-----------------------------------------------------------RFPE.....VHILMAINRP.P
Q74G06_GEOSL/16-240-----------------------------------------------------------GDGL....WLTLCQGLPKG.D
Q7P2R8_FUSNV/14-232-----------------------------------------------------------LDIE.....IDAGISILKG.D
RSME_MYCBO/18-242-----------------------------------------------------------RPP......VTVVQALPKS.E
Q6F738_ACIAD/16-235-----------------------------------------------------------CPAKL...PVTLIVAMPRP.K
Q8DS03_STRMU/14-241-----------------------------------------------------------LPVQ.....VVIASGFPKG.D
Q8YX66_NOSS1/19-231-----------------------------------------------------------LPVA.....ITLMIALPKG.S
RSME_AQUAE/13-228-----------------------------------------------------------PKD......ITLYQSVTVDLK
Q9F9G9_9GAMM/17-236-----------------------------------------------------------APLA.....VTVALPMIKG.E
Q892R3_CLOTE/16-241-----------------------------------------------------------SSIQ.....VYLFQGMPKA.N
Q6MI96_BDEBA/16-247-----------------------------------------------------------KEPH.....LHLVLSLSRF.P
Q987U8_RHILO/16-233-----------------------------------------------------------LPD......LIYCFAPLKQ.G
Q7VZC1_BORPE/18-240-----------------------------------------------------------LPGR.....ITLVQGLPAG.D
Q7RMG7_PLAYO/19-251-----------------------------------------------------------EKSQNNFLPIDVVLCIPRP.K
Q8FNF6_COREF/18-236-----------------------------------------------------------DPR......VTIVQAIPKS.E
Q8DNP5_STRR6/18-245-----------------------------------------------------------LPVQ.....VTIASGFPKG.D
Q8CSC8_STAES/19-247-----------------------------------------------------------LPQN.....ITICSGLIKA.D
Q73J56_TREDE/35-272-----------------------------------------------------------ETRPLPLPPIKIILGFPRP.I
Q7V223_PROMP/22-248-----------------------------------------------------------EKIL.....LGIAVVIPK..N
Q7U730_SYNPX/24-238-----------------------------------------------------------R........LGLGLSLIR..R
Q92RS8_RHIME/22-239-----------------------------------------------------------PCD......LVYLFAPLKV.G
Q82WB5_NITEU/17-247-----------------------------------------------------------SPLM.....IELAQAVCAN.E
Q87LK2_VIBPA/18-237-----------------------------------------------------------SPLD.....LHLGQVISRG.D
RSME_BUCAP/20-240-----------------------------------------------------------SPLL.....IHLGQVISKN.E
RSME_MYCH2/14-226-----------------------------------------------------------PKNK.....VVLALAILKT.K
Q6AEC1_LEIXX/18-236-----------------------------------------------------------EPA......ITLVQALAKG.D
Q7V7G0_PROMM/24-244-----------------------------------------------------------HRQQ.....LGLAVVLPK..R
Q6AMJ0_DESPS/17-250-----------------------------------------------------------PEEKP...VIDLVLALPRP.I
RSME_HELPY/14-226-----------------------------------------------------------ASKK.....THLILSVIEI.K
Q7P147_CHRVO/16-235-----------------------------------------------------------TPLW.....LGLAQGISGG.D
Q72BF1_DESVH/15-234-----------------------------------------------------------PVSR.....AVLAVGWGKA.V
RSME_HAEIN/18-238-----------------------------------------------------------SHLK.....IHLGQVISRG.E
Q8EWP2_MYCPE/13-228-----------------------------------------------------------PYD......ITCFLGVIKK.Q
RSME1_BORBU/15-233-----------------------------------------------------------KK.......LYVLIGMIRP.I
Q8EIK7_SHEON/18-237-----------------------------------------------------------SPLN.....LHLGQVISRG.D
RSME_BUCAI/27-247-----------------------------------------------------------SPLH.....IHLGQVISKN.E
Q8NNB5_CORGL/18-236-----------------------------------------------------------NPQ......VTIVQAIPKS.E
Q7VBR8_PROMA/24-246-----------------------------------------------------------KNPL.....ICLAVVVPK..Q
Q73FW1_WOLPM/18-226-----------------------------------------------------------EEN......LYLYCAMVKS.A
Q73LI5_TREDE/15-246-----------------------------------------------------------AEPYKPRAEIILMQWLIKG.N
Q98Q27_MYCPU/14-222-----------------------------------------------------------FKNQ.....VILAMSVINT.K
RSME_TREPA/18-242-----------------------------------------------------------EYEDCALFPLHLVIGFPRP.I
Q6A996_PROAC/19-238-----------------------------------------------------------THR......WVAVQALPKS.D
Q9X1A0_THEMA/14-217-----------------------------------------------------------PTEK.....LSVVVPIGRW.E
Q9KD69_BACHD/16-244-----------------------------------------------------------LPIR.....VTIAQALPKG.D
Q6F1G3_MESFL/14-235-----------------------------------------------------------SNVK.....KVLIAGVLRE.Q
Q8DI45_THEEB/47-258-----------------------------------------------------------LSTE.....IILCLALLKA.A

PF04013

TRMYL_VIBCH/1-199-----------------------------------------------------------HRED-----VVIHLVLESTRD
TRMY_PYRAB/1-203-----------------------------------------------------------FRKN-----VRVYVTLLGPPD
TRMY_PYRHO/1-202-----------------------------------------------------------FRKN-----VRVYVTLLGPPS
TRMY_METJA/1-202-----------------------------------------------------------IRRD-----VVFYAVLYGQPN
TRMY_AERPE/1-186-----------------------------------------------------------...N-----ATLAALLMGGPL
TRMY_ARCFU/95-288-----------------------------------------------------------IRRD-----VEVYLLLLGPPS
TRMY_HALSA/1-193-----------------------------------------------------------IRDD-----VEVFLVLG....

PF04252

Q9YC91_AERPE/71-273-----------------------------------------------------------.L--------VYAAVRRAG-V
Q9V144_PYRAB/2-195-----------------------------------------------------------.E--------REVLAKIGS-V
YO021_YEAST/1-212-----------------------------------------------------------GL--------RWTTKDLKG-I

PF01746

RG9D3_MOUSE/135-308-----------------------------------------------------------..........GFSAYLLDV-T
RG9D2_HUMAN/110-276-----------------------------------------------------------..........NWKDIHIKP-E
Q9BI62_CAEEL/175-352-----------------------------------------------------------...SIR....KSHVFNPIV-T
Q9UZ22_PYRAB/108-288-----------------------------------------------------------...AYE....GPTSELLKD-N
Q9FGI9_ARATH/127-293-----------------------------------------------------------..........GFEKWFIEK-E
RG9D2_DROME/104-271-----------------------------------------------------------..........GWENWHVQY-Y
TRMD_STRLI/21-232-----------------------------------------------------------LADGYETGCGEPALVVPTP-S
TRMD_SHIFL/22-221-----------------------------------------------------------KAAAGE....GAKVIYLSP-Q
TRMD_MYCLE/21-224-----------------------------------------------------------...CFD....ETLLVIPTP-A
Q19789_CAEEL/96-260-----------------------------------------------------------..........GNEHNLNQD-I
TRMD_HELPY/22-221-----------------------------------------------------------KN........PKHTIFLSA-V
TRMD_MYCGE/22-216-----------------------------------------------------------KA.P......NSHVVLLSP-E
TRMD_BORBU/22-219-----------------------------------------------------------...ESA....KKTTIFLSP-S
TRMD_MYCPN/22-216-----------------------------------------------------------...RTP....QSKVVLLSP-E
Q97Z49_SULSO/105-260-----------------------------------------------------------..........GRNKIEILN-Y
TRMD_SYNY3/22-218-----------------------------------------------------------PVLS......KREVILMTP-Q
Q9YET3_AERPE/129-296-----------------------------------------------------------..........GWISEVLGD-N
MRRP1_MOUSE/207-375-----------------------------------------------------------..........KWDKLLLTA-T
TRM10_YEAST/104-276-----------------------------------------------------------...NYE....NWNHFKFLP-D
O58442_PYRHO/158-338-----------------------------------------------------------...SYE....GTTAEFLKE-R
TRMD_AQUAE/27-222-----------------------------------------------------------VE.NYG....KPFVLITEP-W
TRMD_BACSU/22-221-----------------------------------------------------------TSKAAA....APRIILVCP-Q
TRM10_SCHPO/104-273-----------------------------------------------------------N.........NWKRYNPTT-K

PF09936

B5EBC8_GEOBB/4-189EQRKLVEKIRE-------H----WLSGWGSTYNPKRKMALE-------------------TLQMEASVDT-AIAD--IEK
Q3A2E8_PELCD/2-183EQQTLVRRILA-------H----WHEGHGAAYNPHRGEALS-------------------LIRVVASLDE-ALAD--WRS
A1AMZ9_PELPD/5-189EQRRLAERITG-------H----WQEGWGATYNPDRREALS-------------------IVRICATLQQ-AVAE--YQT
A5G7Z4_GEOUR/8-192EQRTLSERIRS-------H----WLDGWGATYNPKRKAALE-------------------LMQVVDSLDM-ALDD--LEK
Y054_AQUAE/17-201AQRIVIQRQIN-------Y----WLSEEGRKANPTRYEIVQ-------------------LVRLAYTLDE-VIED--IEK
A7HKS2_FERNB/2-186AQQDIVKKVLG-------Y----WTEGYGKTYNPNRSDALS-------------------IVELKSYVEE-VIED--IEK
A0LMM3_SYNFM/1-185DQQALSERLLK-------H----WNEGIARELLPERVEALR-------------------RIKVVEDIRA-AADD--IAS
TRMD_DESDG/242-423DQRRLLDGLLR-------H----WTDGPGVSANPDRGTALR-------------------LVRGVSTVEE-AIGD--IEQ
Q2LVU3_SYNAS/10-194AQVSLVEKIIA-------H----WKNGYGAVFNPSRREAFQ-------------------RVCVKTSLDD-VLEN--VAD
Q1MRV0_LAWIP/191-372DQQNILEKIIT-------H----WTVGAGGKSNPDRAEAFK-------------------LVNIASDLQS-SLDT--IEN
Q0AWV8_SYNWW/3-187NQQELIRDIIS-------Y----WQDGYGGQYNPDRKDAFN-------------------IIKSAETLEE-VQEY--LES
A8ZV19_DESOH/6-188DQKRLVKRIIA-------H----WTDGSGSRYNPLRAQAFE-------------------LMRVCDSLAE-AAAL--VTA
Q24UB0_DESHY/1-185AQRALAQRIMG-------Y----WQEGFGAEYNPNRQEAFA-------------------RVKLASELAE-VEEE--IFK
A6LNY5_THEM4/2-186AQQDIVKKVLN-------Y----WLNGFGKEYNPNRSEALS-------------------LVKLVGYFED-VIDD--IKN
A1HN71_9FIRM/2-187NQLALAKEILN-------Y----WQEGYGGEYNPDRREAFR-------------------VVETITSIEE-AARL--IAE
A8F3G0_THELT/2-186AQQEVVKTVLE-------Y----WIDSYGRERNFSRTQALE-------------------LVDIKSYLEE-VIEE--IEN
Q0F054_9PROT/1-176GMHAMVHDMLD-------Y----YRSGAGGKRNPARSEVLS-------------------AVRMVKSLEE-AQAE--...
Q3AC73_CARHZ/1-185TMKQLINKVLN-------F----WQEGYGASYNPDRKEAFR-------------------IVKLVDSLED-VMLD--IEK
Q7P719_FUSNV/2-186AQKKLTERIIG-------Y----WQDGTGGQYNKDREEAFR-------------------VTDVTESIED-VIKE--IEK
B3E5S7_GEOLS/2-186EQQQLIQRIVT-------H----WDSGWGADYNPDRREALS-------------------IVRPVPSLQD-ALAD--MQQ
Q6AJE7_DESPS/14-197DQQKLIGEIIA-------H----WQTGHGGTYNPARKEALS-------------------IVSMAGSIDA-VIET--IEQ
A5IM13_THEP1/2-186AQQDMVSKMLK-------F----WREGFGSRYNPSRAESLK-------------------LVKLKSYLED-VLED--IES
A1VFE5_DESVV/242-423DQRRLLDTLLR-------H----WTLGPGSRSNPDRAEALG-------------------RIKGVDDVRA-AIED--IAR
A9BF02_PETMO/2-186AQRKIVEKVLD-------Y----WLNGYGGEFNPNRKEALE-------------------IFKIKNYLED-VIEE--IEK
Q39RN9_GEOMG/8-192GQQELAGRIVR-------H----WQEGWGATYNPKRKAALE-------------------LIKIAATLND-ALED--MQE
Q1NQ21_9DELT/248-432DQQELVAELLA-------H----WLHGKGGELNPARKSALE-------------------LVEVVADLAQ-LYQR--VTA
Q6ML98_BDEBA/8-193EQLMFVDRVLD-------H----WRTGQGSKFNPMRKTALG-------------------NVKAVESVEK-AFED--WNV
Q74FG2_GEOSL/8-193GQKELAGRIIR-------H----WREGWGASYNPKRKAALD-------------------LVRISNSIEE-VLEE--LGN

PF00588

Q8CXU2_LEPIN/126-265D..LFNPN...-------.----VIRA.STGA.LFTLE..V-------------------YL...GEIKL.IYEI..LKK
Q7NBG1_MYCGA/4-151F.FITDER...-------.----FKRA.GLDY.WDHLN.LK-------------------QY...ADFDD.FIKQ..NQI
Q6BHP1_DEBHA/1290-1434V..KNHPQ...-------.----FKNV.AVTA.DYWMP.MV-------------------EVK.PSEIIC.FLKE..KKK
Q8I3K9_PLAF7/198-344A.DPYNPK...-------.----VMEI.TKGT.HLNIP..H-------------------IF...GNYQE.LEQL..CKE
Y324_MYCLE/160-301A..SVTAV...-------.----AWRT.SAGA.AARIP.VA-------------------RA...TNLTR.ALKV..WAD
Q22484_CAEEL/1071-1214A.QDANFK...-------.----ALSM.SSEN.WQKIE.GV-------------------KR...TNLLP.YLQN..LRA
O74022_9EURY/1-150T.EESYAY...-------.----AVHA......RDVLENAL-------------------IL...DSFEK.ALEL..FDF
Q7TU01_RHOBA/25-165F.QFDEKR...-------.----LRRA.GLDY.WQYLD.WE-------------------PV...PSWDA.LCER..LNP
MRM1_SCHPO/147-297N.TFLSPV...-------.----VSKA.SAGA.LEVFN.IS-------------------HV...KNPMV.FLRN..SVL
Q6ME25_PARUW/89-224Q.TPYTNHK..-------Q----VQNV.SMGA.YQWVK.CY-------------------QN...EDLND.......LTQ
Q8R6H6_FUSNN/88-229V..RINET...-------.----VVKT.STGA.IEYVN.IS-------------------KV...TNLSD.TINK..LKK
Q729V9_DESVH/1-141F.SLDDRY...-------.----LKRA.GLDY.WPHVP.LT-------------------VW...ASWED.FLSR..GVE
Q74D44_GEOSL/15-165R..LDHPE...-------.----ALKF.AVSA.RDLLERAR-------------------VF...ESLED.ALSD..TEL
Y516_BORBU/78-219S.AKDNST...-------.----VLRT.SSGA.SQYVK.KM-------------------TV...TNINN.TINL..LKN
Q898S5_CLOTE/9-150F.SLDEKH...-------.----LKRA.GLDY.WSQLS.LE-------------------IH...ESYED.LRKK..YKD
Q6FZ54_BARQU/2-143F.SLSDRN...-------.----LKRA.GMDY.LEYAS.LN-------------------RH...IDWQS.FMST..MKH
Q7UG85_RHOBA/132-272S.DRFNPN...-------.----AIRG.SLGA.VFTVP..S-------------------AS...GSESQ.MEAF..LKT
Q6YR72_ONYPE/92-232A.DFYHEK...-------.----TIRS.SQGA.LFSLS.L.-------------------KR...GNTKS.FLEE..IKE
Y881_MYCTU/130-275A.DPLYRR...-------.----AVRV.SMGH.ALLVP.YA-------------------RA...ADWPT.ELMT..LKE
Q6XK16_SPICI/109-253V.DLFNDK...-------.----VLRA.SQGA.IFKVA..I-------------------KE...ANLIE.IKNF..QLN
Q6MS22_MYCMS/92-234V..QVNST...-------.----VLKT.SSGS.AFDIK.IC-------------------KT...NNLNN.AIKI..LKN
Q8A814_BACTN/97-238V..SVNAD...-------.----AMKT.SAGA.LHTLP.VC-------------------RE...QNLRA.TLQY..LKD
Q7UFJ5_RHOBA/144-289I.SPMTRR...-------.----VIRV.SMAS.VFRHR.FY-------------------RF...DNPVG.QLRD..LAN
TRMH_SHIFL/19-159R....MRT...-------.----MASA.AAGS.NSWVQ.VK-------------------TH...RTIGD.AVAH..LKG
Q73T60_MYCPA/69-206W..........-------.----NRRG.AMVT.DRYQR.LC-------------------HH...DSTAE.LLDF..AAA
Q9RWT9_DEIRA/12-159D.YLDSQA...-------.----VAMAVHAGD.LLRSA..K-------------------IY...PTLRE.ALAD..RDL
Q9RXS5_DEIRA/10-149F.HLHDRE...-------.----FRRA.VMDY.LQGVT.LH-------------------EY...AGWSD.FQAQ..LPD
Q9UXD5_SULSF/1-149N....ISE...-------.----AFRF.SAGG.REILEKAK-------------------IV...NTFDK.AIND..VDI
Q74D57_GEOSL/96-237A..GVTAS...-------.----VEKI.SAGA.TETIP.VA-------------------QV...TNVVQ.ALET..LKE
Y380_HAEIN/4-151V....DEQ...-------.----SYAL.SAGA.ENIVKNAR-------------------VV...DSFDE.AVDD..CSL
Q7VBF1_PROMA/9-160..DPMNIE...-------.----TQKM.AVHG.KRFLKNAC-------------------IY...SNLLD.AVND..CVR
Q8IJ98_PLAF7/52-193K.KEINF....-------.----..FG.NMGT.YDYIT.IE-------------------YF...DNIYE.LKEY..LT.
Q9PQM3_UREPA/1-151F.ILDKKRFHK-------D----FIRA.STNH.LNALK.LY-------------------EY...DDFNE.FINK..NNI
O67731_AQUAE/93-233S..PINET...-------.----VVKA.SSGA.VFHLK.IS-------------------KV...SSLSR.ELKN..FQK
Q6F981_ACIAD/122-259A.SLWSPR...-------.----VLRA.GMGA.HFSLY.TF-------------------EN...IELDM.ILEQ.....
Q7M8R3_WOLSU/2-143F.TLSQKE...-------.----IKRA.GMDY.WEHLE.LY-------------------EW...SSLEA.FTEAHPFGE
Q73GK0_WOLPM/102-244S.PSENAS...-------.----IAKA.ASGA.LDIVP.LI-------------------YV...TNIVK.TMQY..LKK
Q8PVX0_METMA/11-163P.CELEGQ...-------.----ARAM.SSHA.RDVLEGAR-------------------IV...STLEE.AVKG..ADL
Q8FF07_ECOL6/222-362A.ALLESG...-------A----AIRT.AEGG.AEHVQ.PI-------------------TG...DNIVN.VLDD..FRQ
Q7V131_PROMP/7-159..DIFSLE...-------.----AKKM.ALKG.YRYIDNCK-------------------IF...NSIEQ.AIFD..CDL
Q7WLL7_BORBR/7-163P.DMTAQP...-------E----AVAL.ASGA.LDVLERAA-------------------VH...DTLEE.ALAP..VTL
Q8TXY9_METKA/2-150E...LGEV...-------.----AIAR.AMHA.LDLLENAV-------------------IV...NTLEE.AIED..VEA
Y052_BORBU/34-174K.KNKHTL...-------.----NPDV.TLGS.SQWIN.LN-------------------KY...KNAKF.AIDR..LKS
Q9AAX1_CAUCR/6-147F.PLNDKS...-------.----LKRA.ALDY.GSLSH.LT-------------------RH...DSWET.FLKA..PER
Q9CC19_MYCLE/108-251V.DPYNGK...-------.----CLRS.SAGS.IFSIT.VV-------------------VA...SDAYA.AVTE..LRA
TSNR_STRAJ/116-258T.SIADRR...-------.----LQRA.SRGY.VFSLP..V-------------------VL...SGREE.AIAF..IRD
Q8XDF6_ECO57/1-142F.AWDDKR...-------.----LRRA.GLDY.HEFTA.VT-------------------RH...HDFRA.FLEA...EN
Q9A8W1_CAUCR/124-265A.PALSGV...-------.----LAKT.AVGA.VDKAP.YA-------------------RV...VNLSR.ALEE..LAD
Q72QT0_LEPIC/71-212S.AGITPV...-------.----VEKV.ASGA.LSFLK.IF-------------------TV...KNLAN.TLEL..LKE
Q7P7P4_FUSNV/111-252V.DAYNEK...-------.----VIRA.SMGS.ILNVN..L-------------------YY...LEKSE.IINF..LKE
Q6NHA0_CORDI/3-144F.NFEDKN...-------.----LKRA.GLDY.HDLAD.VH-------------------IH...SNFDA.CMNA..LPH
Q8G5E6_BIFLO/133-283V.DVLNPK...-------.----VIRS.TAGS.LFHLP.V.-------------------LA...MSTDE.FFTW..TGD
Q8FA35_ECOL6/9-160H...LEPA...-------.----ARWV.AHGS.GDIIDNIK-------------------VF...KTLAE.SLHD..VDF
Q8YNM2_NOSS1/5-155..DPLSED...-------.----AMRM.AVHA.KEILESAI-------------------TV...PTLPA.ALHG..CVR
Q8KC03_CHLTE/108-249A..PISAT...-------.----VHKA.SAGA.LSHMR.VC-------------------KV...KSVVK.ALDL..LRE
Q7NRY2_CHRVO/3-154...VFPSE...-------E----ANAL.ASGA.VDLLENAT-------------------VV...GSLRE.ALSD..VTV
Q8GYL4_ARATH/196-346C.DPYNDK...-------.----ALRA.SRGA.SFQLP..I-------------------VS...GNWNH..LKL..LEN
Q720L1_LISMF/107-248A.DLYNPK...-------.----VIRS.TQGS.HFHIP..V-------------------IQ...ADLFD.WIAN..LEE
Y1673_SYNY3/120-261V.DPTSPK...-------.----VLRS.SAGS.SLLLP.QQ-------------------QL...QSLPP.LLEK..FHT
Q98R32_MYCPU/82-224V..DINST...-------.----VLKV.SSGG.FVNLR.FY-------------------KS...NSISA.TIDK..LKK
Q6KIH0_MYCMO/89-225V.DIYNHK...-------.----FLQA.SQGA.FFYVN.LI-------------------KV...KNAVD.FLKS..LH.
TARB1_HUMAN/1463-1606I...SDKQ...-------.----FQHL.SVSA.EQWLP..L-------------------VEVKPPQLID.YLQQ..KKT
Q824D7_CHLCV/116-256V.DLYNPN...-------.----VIRS.SLGT.VFTLP..I-------------------WS...ATLDE.VLQT..IAE
Q9CHW1_LACLA/110-250A.DIYSPK...-------.----VMRS.MQGS.NFHLP.L.-------------------VR...MAKED.CFAQ..LKK
Q82FA2_STRAW/107-239L.DPWHPT...-------.----VVRG.GAGL.HFATA.VE-------------------RL.........TVDE..LPP
Q6MIZ9_BDEBA/141-282V..GLTPT...-------.----VHKV.ACGG.VEHVP.VE-------------------ET...TNFAN.YAEE..LKK
O27877_METTH/10-161L....EDE...-------.----AYYQ.AMHA.RDIVEGAL-------------------IY...RDLSE.MIDS..LEP
Q8Z0C3_NOSS1/123-264V.DLDNPK...-------.----VLRA.SAGQ.WFRLA.TA-------------------VS...EDLKA.TVQL..CQQ
Q8ECQ8_SHEON/21-159EYAARGPQ...-------.----QYNADTQSA.AERIP.LT-------------------GV...TSLLD.AIPA.....
Q7MSH0_WOLSU/110-249F.SIES.....-------.----AIRT.SSGA.LLELP.FG-------------------IV...KNPWD.LINE..LRG
RLMB_SALTI/95-236A..QLNAT...-------.----AKKV.ACGA.AESVP.LI-------------------RV...TNLAR.TMRM..LQE
Q9PR20_UREPA/90-231A..SINDL...-------.----VIKT.SMGA.INYIY.MI-------------------EV...NNLSN.TIKN..LQD
Q72GY4_THET2/109-248V.DLFSPQ...-------.----VIRN.STGA.VFALP..V-------------------YP...VAEEE.AARF..LEE
Q6MNP1_BDEBA/47-187K....FKE...-------.----ANRV.TQGA.DKWVE.VK-------------------KW...KKTAD.CVKA..LKN
Q9LXE4_ARATH/154-296S.KRYNGN...-------.----.RHV.SMGA.EKWLD.IE-------------------FW...DTPKE.CFKV..LKS
Q73J63_TREDE/100-245Q.ASITTS...-------.----AYRV.AQGG.MEFVK.IF-------------------KV...SSTAW.FLRQ..CRG
Q6SFH7_9BACT/10-160F..PHAEA...-------.----NALA..AGA.EDILANAT-------------------IV...STIED.ALKD..SHL
Q6MTA0_MYCMS/106-249V.NFHNQK...-------.----VLRS.TQGN.LFQVN..L-------------------VN...EYLVT.VINQ..LHD
Q8YIL5_BRUME/130-270C.DPLYRK...-------.----AIRV.SVGA.ALKVP.YF-------------------HG...GTIDD.INAA..LAE
O83093_TREPA/117-262Q.AQVTSA...-------.----TYRV.AQGG.MEFVQ.LL-------------------RC...TNAQE.VLEM..CAG
Q9PQG4_UREPA/113-253V.DLYNPK...-------.----TIKA.SMGA.IFKIN.FL-------------------RF...NDSKL.ALNF.LLKN
Q820Y2_TROWT/113-259A..RVTPM...-------.----VWKA.SAGA.VGKLP.IA-------------------EV...GNLTR.YIVR..FRE
Q6YQX1_ONYPE/907-1048V..PLNST...-------.----VAKI.SCGA.LEYTK.VF-------------------LV...TNLHQTILKL..KKN
Q8PJZ3_XANAC/6-157A...LDED...-------.----AYRR.SAGA.EDVLSQAP-------------------IF...ATLGE.AVAD..CTL
YACO_BACSU/97-238V..GLTTT...-------.----VAKA.STGA.IEHIP.VA-------------------RV...TNLAR.TLEE..MKE
TRML_SYNY3/1-143F.ELGDRY...-------.----LKRA.GLDY.WPYVD.LH-------------------YH...NSCEE.FITH..WRG
Q6MMA4_BDEBA/107-249Y.TPLPTQW..-------K----VEKT.AMGT.QEYLA.WE-------------------EA...PKLLE.CLEE..LKD
Q729J5_DESVH/23-164A...FPSL...-------.----SGKT.SASA.RKWVD.TV-------------------RH...QDRDS.LMST..LRA
Q6UCQ6_9PROT/107-248V..TENSF...-------.----LAKT.ASSA.LDKVP.FI-------------------KI...QNISS.CIKI..LKD
Q9F5K6_STRVR/126-272A.DVYDPK...-------.----SVRS.STGS.LFSLP.AV-------------------RV...PSPGE.VMDWVEARR
Q8A2Z0_BACTN/24-168T..PPHPE...-------.----MHKT.ALGA.EFTVD.WK-------------------YV...NNAVD.AVDN..LRK
Q97B79_THEVO/10-160N.RPDDEA...-------.----FARS..MGG.RQILENAE-------------------IV...DSLEE.IVHR..FTI
Q8R700_THETN/26-168K.GIEINE...-------.----AVSM.AANR.WLFIE..R-------------------VY....DREK.AIKE..IKE
Y2399_ARCFU/77-217V.GSIQEG...-------.----AVKA.SAGA.VFHIP.IA-------------------RV...ENFAS.AIKK..LKK
Q92JA7_RICCN/2-149..DGWPNE...-------.----QARSNAVGA.VNIIDHAK-------------------IF...DSLED.SIKD..LEY
Q98QQ8_MYCPU/1-149F.DLNPRF...-------.----LKRS.AAGHLLSEIQ.HE-------------------VH...DSYND.FLAK..YQN
Q72G19_DESVH/97-239A..YLGAG...-------.----AHRA.AAGA.LEKLP.VA-------------------RV...ANLAR.ALDE..AAE
Q6MA83_PARUW/115-255T.DIYNPN...-------.----VVRA.SVGT.LFTVP..T-------------------VE...ARGED.ILLW..LNK
Q87R44_VIBPA/101-237A.DPYNPK...-------.----TISA.TMGS.FGRVQ..V-------------------SL...VDLPS.YLAE.....
Q8XZH6_RALSO/113-250A.FAWSAK...-------.----TLRA.AMGA.HFHLN.VV-------------------EH...CTFES.......VHA
Q73RN5_TREDE/119-253V.SPDSPK...-------.----AKRT.AMGC.TEYLP..W-------------------ER...ADLES.......LPD
Q727W7_DESVH/4-156W.EIDKAR...-------.----PLAT.AKGE.PLLER.VK-------------------VV...GTLSE.AVAD..CTA
Q7U8A3_SYNPX/2-151E..VLCDD...-------.----ALRM.AVHA.TPLLRQAT-------------------IH...PDLEA.AIGD..CSR
Q8XJ72_CLOPE/109-249V.DIYNDK...-------.----TLRS.TMGS.IFYIP..I-------------------VE...DDSLD.FVKS..LKK
Q8R9C5_THETN/105-242V.DIYNPK...-------.----VLRA.SMGS.IFHIP...-------------------VI...ATANE.VLYK..LKG
Q7TU91_PROMP/282-424A..GLTGT...-------.----VAKV.AAGA.LEHIP.VS-------------------RV...VNLNR.AIDE..LKK
Q6FAL4_ACIAD/3-155Y...PHPD...-------.----IDAL.AAGA.QDLVEKIK-------------------IV...DTLEQ.AIQD..CHI
Q98QQ7_MYCPU/101-239L.DIYNPK...-------.----IIRA.SQGA.IFALN.FF-------------------KS...KNHQK.TLKY..LQE
Q89I93_BRAJA/15-167...GWPNI...-------A----AQRA.AAGA.DYILEKVE-------------------LF...DTVGE.AVAD..LDL
Q8GYT1_ARATH/5-144F.NAFG.....-------.----.....SHGS.ASHIR.FR-------------------HF...HSLIE.ARNY..LKE
Q8D323_WIGBR/95-236A..KISSA...-------.----VKKV.ASGS.LDLIP.LI-------------------YV...TNLVR.TINL..LKK
Q72H04_THET2/88-229A..PLSPL...-------.----ALKA.SAGA.ALKLP.VV-------------------KV...KNLPR.TLKA..LKE
TRML_GEOSE/2-145F.STDDKM...-------.----LRRA.GLDY.WEFVN.IH-------------------YY...DSLDH.FFQQ..NQN
Y252_MYCGE/95-238V..PINNT...-------.----VMKT.SMGS.VFYQN.LV-------------------QV...ANLSY.TITK..LKE
Q72JF4_THET2/3-156G.PPWAKE...-------.----AYWL.AVHA.EEVLE.K.-------------------.....AQVAGSLLEA..LRG
Q8KD02_CHLTE/16-159T..PPRKE...-------.----IDKT.ALGA.QETVP.WR-------------------HF...ADPVE.AITV..LKR
Q7NWF9_CHRVO/117-255V.DVFSPK...-------.----VLRA.GMGA.HFALR.IH-------------------EH...ADLAG.ELSR..FGG
Q72N93_LEPIC/2-144F.DLSEKA...-------.----ARRA.GLDY.WDKVK.IY-------------------FH...SSLEE.YKVA..LPS
Q6MHK3_BDEBA/6-165E.ITYEAQ...-------.----QAAA..TGQTGLQNR..T-------------------TY...ASWDE.FMKQ..EPE
Q828C9_STRAW/145-290V.DLYNPK...-------.----SVRA.SVGS.LFHLP.VA-------------------VG...VPVDQ.AVAG..LKD
Q7NIP3_GLOVI/2-151..SPKDEE...-------.----ARHM.AVHA.ADVLDQAR-------------------IV...ASLSQ.ALAD..CTR
Q98NQ0_RHILO/12-164...GWPSE...-------K----ARAA.ASRA.DHVIDAVK-------------------VF...DDLAS.ALAD..LNF
Q6MEY4_PARUW/104-242..DPYNEK...-------.----VLRS.ARGA.HFKIP..L-------------------RR...GNINE..LEL..LAK
Q7BKE9_PRB01/91-232A..PINSI...-------.----AHKV.SVGG.AEVIK.IF-------------------HV...TNLVN.CLKY..LQG
Y1476_METJA/4-155I...INNE...-------.----AYMM.AVHA.REILDNAK-------------------FY...NTFDE.AIGD..LDF
Q8K8I3_STRP3/17-159F.PIDDRK...-------.----MKRA.GLDY.WDKLE.LH-------------------FY...DHLEQ.FINQ..CHG
Q9X263_THEMA/90-230V..KVTET...-------.----VVKV.SAGT.VFRAR.IA-------------------VV...TNLAR.TIEE..LKE
Q73MR5_TREDE/110-250A.GGFEI....-------.----ISKV.SAGA.LAWVP.FV-------------------EV...TNLVR.TVER..LKK
Q8EPH3_OCEIH/102-242V.DIFNDK...-------.----VIRA.TQGS.IFHIP..I-------------------YT...ATLEQ.EIHM..LQT
Q8PHE1_XANAC/153-294L..GLSGA...-------.----AARV.AEGG.AEAVP.LV-------------------QL...PDTAT.ALAQ..LRQ
Q6F190_MESFL/4-147F.IFKKEE...-------.----MNRA.SAGT.FDLVE.YQ-------------------LY...DDWED.FCEK..NPS
Q6MMJ6_BDEBA/113-244S..PYHPK...-------.----AIKA.SAGA.LLKLP.LF-------------------KI...GKFAD.FVSN..NDQ
TRML_MYCGE/5-150F.FLNDKR...-------.----MVRA.GLNC.WDKIQ.LF-------------------EH...KSWEH.FLQA..TTE
Q6MR30_BDEBA/7-149F.EINDTN...-------.----LKRA.GLDY.WPHLT.WY-------------------RH...ETFED.WWKH..VED
Q6AF11_LEIXX/119-263A.DPLYRR...-------.----SVRV.SMGT.VLQVP.WT-------------------RI...PEWDE.AAPL..LRD
Q6GHU8_STAAR/105-242T.DPYQDK...-------.----VLRA.SQGS.VFHLP..V-------------------MT...QDLDT.FITQ..FNG
Q89IY5_BRAJA/156-297S.PEATGV...-------.----LAKA.ASGA.LELVP.VV-------------------TV...QNLAR.ALTA..LNE
Q7TUD5_PROMP/21-161V.KTFNST...-------.----.....AQGS.QKWVK.LN-------------------NH...ETTIS.AVSE..LKK
Q6AJ92_DESPS/144-286A..PLGGT...-------.----AAKS.SAGA.ISHMD.IC-------------------QV...TNLVK.SLAE..LKK

PF14419

O28057_ARCFU/168-343VNAFELEYFIK-------G----VRRGQIARYKIQERAYAR-------------------EVRKVPVFVRDLYQT--ARD
D3S2R7_FERPA/167-342VNAYELLEFLK-------G----VRRGQTARLKIQRKSYAR-------------------EVREVPVYVHDLYQT--VRD
D2RFH8_ARCPA/167-342VNAYELEAFIR-------G----VRRGQFSRLEIQKKAYAR-------------------EVREVPVYVQDLYQT--ARD
F2KQY0_ARCVS/173-346ANAYELEQFIK-------G----VRKGQIARFEVQKRAYDR-------------------DVRKVPVLLQDLYQT--ARD
Q9V2I9_PYRAB/172-346MNAYELMAFLR-------G----VKEGQESRYQIQKEAYPW-------------------EVEKVPVTVWDLYQV--IRD
O57783_PYRHO/172-346MNAYELMAFIR-------G----VKEGQESRYQIQKEAYPW-------------------EVEKVPVTVWDLYQV--IRD
Q8TZR0_PYRFU/172-346MNAYELMAFIR-------G----VKEGQESRYQIQKEAYPW-------------------EVEKVPVSVWDLYQV--IRD
F0LM29_THEBM/169-343IDGYELMEFLR-------G----VKIGQESRYQIQREAYPW-------------------KIEKVPVYVWDLYQV--IRD
Q5JGM1_PYRKO/169-344MDAYELMEFLR-------G----IKIGQESRYQIQREAYPW-------------------KVEKVPVSVWDLYQV--VRD
B6YU66_THEON/169-344MDAFELMEFIK-------G----VKIGQESRYQIQREAYPW-------------------KVEKVPVSVWDLYQV--VRD
C5A405_THEGJ/173-348MDAYELMEFIR-------G----VKIGQESRYQIQRDAYPW-------------------NVEKVPVTVWDLYQV--VRD
E3GWV1_METFV/168-342MDAYELMEFIR-------G----VKKGQRSRYLIQKDAYPW-------------------DVRKIPVSVWDLYQV--IRD
C9RGK2_METVM/168-343VNAYELMEFIK-------G----VKIGQQSRYEIQKRAYPF-------------------DIKLVPITVQDLYQV--VRD
C7P975_METFA/169-344VNAYELMEFIK-------G----VKIGQHSRYEIQKRAYPF-------------------EIKLVPVTVQDLYQV--VRD
D3S697_METSF/168-343VDAYELMEFIK-------G----VKIGQHSRYEIQKRAYPF-------------------EIKLVPVTVQDLYQV--VRD
D5VTY7_METIM/171-346VNAFELMEFIK-------G----VQIGQKSRHEIQKRAYPF-------------------KVKEVPISVQDMYQV--FRE
Y421_METJA/168-343VDAYELMEFIK-------G----VKIGQHSRYEIQKRAYPF-------------------EIKLVPVTVQDLYQV--VRD
Q8TVD0_METKA/167-340VNAVELLHFLR-------G----LRDGVKSRMDVQRESYGR-------------------EFRRTELLLYDLYQL--IRL
Q9YCV6_AERPE/169-342VDARQLAEFLQ-------G----VFEGVESRFEVQRKSYHR-------------------RARRVPVYLQDLHQL--VRD
A3MX62_PYRCJ/175-347IPARTLRVFLE-------A----VEAGVESRYQIQTRSYGR-------------------PVHKVPISVYELYQY--VRS
A2BJY2_HYPBU/183-356VDALQLKTFLE-------G----VFEGIESRYQVQVKSYGR-------------------QVYKVPVYVQDLYQL--VRS
B1Y9Z5_THENV/175-347VSGRTLRIFLE-------A----VEEGIESRYQIQAKSYGR-------------------PVRRVPLYVHELYQY--VRD
A1S137_THEPD/177-355VDAYSLYSFLR-------G----AFEGQRSRFELQKRSYGR-------------------EVVKTEVYVQDMYQF--ARS
A4WLE1_PYRAR/175-347IPARTLRLFAE-------A----VEEGIESRYQIQTRSYGR-------------------PVWKVPVHVYELYQW--VRD
Q8ZTN2_PYRAE/175-347VQGRALRAFIQ-------A----VEEGIESRYQIQVKSYGR-------------------AVWKVPVYVYELYQY--VRA
A1RRY5_PYRIL/175-347TSGKTLRLFLE-------A----VEEGIESRYQIQVKSYGR-------------------AVWKVPIYVYELYQY--VRD
E0SSC1_IGNAA/177-354VDAYSMYHFLR-------G----LFEGIESRYDIQRKSYGR-------------------EVHRVRVSIQDMYQF--IRS
A8AC59_IGNH4/171-344ADGDQLAEFLR-------G----VREGAESRRRQREKSEGK-------------------A.NRLQIKVFDMYHL--VAS

PF02590

RLMH_STRPQ/1-158TPDKASFADNQ-------L----IMSKEAQRI-HKKI.---------------------------.GERD-FVIA--LAI
RLMH_XANCP/1-154R...GKGRDAQ-------R----AIDDEGRRV-LAAL.---------------------------.PKNA-HVVA--LDV
RLMH_THEMA/1-150R......GSIE-------E----IVRKETEDL-TNRI.---------------------------.LPGS-FVMV--MDK
RLMH_CLOPE/1-158TPDNASEKEEL-------Q----IKEKEGKLI-LSKI.---------------------------.KDNM-HVIA--MDL
RLMH_MYCPU/1-144......SNNKD-------L----IIKNETMAI-LEKI.---------------------------.PKNS-KVFL--CSL
RLMH_UREPA/1-158EPVQISNKSLE-------Q----IKSKEASKI-FKNI.---------------------------.NQND-FVIA--LII
RLMH_CAUCR/2-153P..G.......-------.----.KAAEAEVL-RPHL.---------------------------..EGA-YVVA--CDE
RLMH_CLOAB/1-158TPEKASLKEEK-------L----IKEKEGEKI-LSSI.---------------------------.KDNS-YVVS--MDL
RLMH_LACLA/1-158IPDNASEKEAE-------A----LKKREGEKI-LSRI.---------------------------.QAGD-QLAI--LAI
RLMH_DEIRA/1-144...........-------.----.QQAESEAI-LKA..---------------------------.AGKS-PLIL--LDP
RLMH_PSEAE/1-154R...GKNADVA-------R----LIRQEGEAM-LARV.---------------------------.QPGE-RVVT--LEV
RLMH_YERPE/1-154R...GKNADIK-------R----ILEKEGELM-LAAV.---------------------------.GKNN-RIVT--LDI
RLMH_STRPN/1-158TPDKASESENQ-------K----ILEIEGQRI-LSKI.---------------------------.ADRD-FVIV--LAI
RLMH_HELPY/1-149T...ANAQKVS-------K----KLAQKSYSL-AFEPY---------------------------LNPKA-KNIA--LHP
Y5620_ARATH/39-192R....NAQDVR-------A----QVEDEEVAM-MKLI.---------------------------.GSDD-WVVV--LDE
RLMH_ACIAD/1-157RGKNDSDADIL-------K----YCQIEGESI-LAAL.---------------------------.KPNE-VLIA--LEV
RLMH_NEIMA/1-154R...GAGVNAA-------Q----GMAAEEKRI-LEAI.---------------------------.PQGA-FLVV--LDE
RLMH_DESTE/1-158LPASGRAGALE-------A----VLKKEGTRL-LERI.---------------------------.PDNC-VTIA--LDR
RLMH_LISIN/1-158APEVLSDAEMK-------Q----VKDKEGVRI-LAKI.---------------------------.PDDA-HVIA--LAI
RLMH_AGRT5/1-158......ASNAE-------T----RKREEAAML-EKHL.---------------------------.ADGA-VLVL--LDE
RLMH_XYLFA/2-155R...GKNHDPQ-------Q----AIEDEGRRV-MAAL.---------------------------.PKQP-YAVT--LDV
RLMH_FUSNN/1-154.....KEDNIN-------I----SIEKESLEI-LKQI.---------------------------SKSNS-YNIL--LDL
RLMH_RALSO/1-154R...SGSRTAA-------T----VMQLEAARI-EAAL.---------------------------.PKGC-RIVA--LDE
RLMH_BACSU/1-158APENLSDQDMK-------I----IKDKEGDRI-LSKI.---------------------------.SPDA-HVIA--LAI
RLMH_RHILO/1-158.....SQSAIE-------R----QRD.EGSRL-QAQL.---------------------------.QPGT-ALIL--LDE
RLMH1_THETN/1-132......NSKKL-------P----VKDLE....-.....---------------------------...KS-YKIL--ITP
RLMH_STAHO/1-158APETMSDKEIE-------K----VKEKEGQRL-LAQI.---------------------------.KPQA-TVIT--LEI
RLMH_RHIME/1-158......AANAE-------T----RKREEAGQL-EKAL.---------------------------.ADGS-LLVL--LDE
RLMH_CAMJE/5-152IALAQNLNAIE-------A----KKSYEEAFM-PYK..---------------------------...KG-YCIA--LDE
RLMH_BACHD/1-158APEQLSDTEME-------H----VKQKEGERI-LAKL.---------------------------.HPDT-YVIA--LAI

PF01994

TRM56_METTH/55-175-----------------------HLTMYGLPA-RDVVPGIM..................DNGKD...KLI-VVGG--ARV
TRM56_HALSA/58-177-----------------------HLTMYGEQL-QSVDDEIRT................THREEP...VLV-VVGG--EKV
TRM56_SULTO/47-168-----------------------HLTMYGIPI-DNIMEKII..................NKNTK...ILV-VVGS--EKV
TRM56_AERPE/62-182-----------------------HLTMYGVNV-DDVAPVIA..................ASPRR...KLV-VVGA--EKV
TRM56_HALMA/58-177-----------------------HLTMYGEPV-QEVEADVR...................EANTAEPLLV-VVGA--EKV
TRM56_METHJ/53-171-----------------------HLTMFGLNL-PDVEEEIR...................TKEK...ILV-IVGA--EKV
Q2EMT5_METVO/53-191-----------------------HLTMYGENI-NEIMPEIIGRVYPTEGTESNKCENQKEEPKN...LLV-IIGA--EKV
TRM56_METBU/55-174-----------------------HLSMYGINL-PDAAGEIK...................LCDK...LMI-VVGA--EKV
TRM56_HALWD/60-180-----------------------HLTMYGERV-QDVTEVIR..................ETCLHHQPLLI-IIGG--EKV
TRM56_UNCMA/55-177-----------------------HLTMYGINL-PGCLEQIQ...................EQFKGRGVMI-IVGA--EKV
TRM56_PYRAB/55-175-----------------------HLTMYGIHI-DDIIDELREK...............LREGRD...FMV-IVGA--EKV
TRM56_METM5/54-177-----------------------HLTMYGENI-NKIMTEIRED..............ISKTNKN...LLL-IIGA--EKV
TRM56_METST/54-174-----------------------HLTMYGKHV-EDVVPTIR..................DNNRD...KLI-IVGG--SRV
TRM56_THEAC/53-169-----------------------HLTMYGRRI-NDVIDEIR..................NSGKD...VMV-LVGS--EKV
TRM56_METJA/54-175-----------------------HLTMYGANI-NEIMPEIRE................ISRDKD...ILV-IVGA--EKV
TRM56_METKA/59-178-----------------------HLTMYGLHI-DDVIGELR...................GENE...LLV-IVGA--GKV
TRM56_METAC/55-174-----------------------HLSMYGVNL-PDVTGELK...................KCKK...LMI-VVGA--EKV
TRM56_THEPD/59-180-----------------------HLTMYGENI-SEELINLIS.................GQGKD...ILV-VVGG--EKV
TRM56_NATPD/58-177-----------------------HLTMYGQRI-QDVEADIR...................EAHASGPVLI-VVGA--EKV
TRM56_THEVO/53-169-----------------------HLTMYGRPL-EDVVKEIR..................ESKKD...VMI-LVGS--EKV
TRM56_SULSO/37-159-----------------------HLTMYGINI-NDFQDRFE.....................KIKYPLLI-IVGA--EKV
TRM56_PYRKO/57-179-----------------------HLTMYGIHI-DDAIPRIKDE...............LKSGKD...LLI-VVGA--EKV
TRM56_SULAC/4-130-----------------------HLTMYGKMI-DDMIDEITK.................ASKNFTLPLLV-VIGS--EKV
TRM56_METTP/54-172-----------------------HLTMYGRRI-DEVIGEIR...................SCER...IMV-VVGA--EKV
TRM56_CENSY/54-172-----------------------HLTMYGETI-DAAIGSLR...................RKEK...ILA-VVGA--GKV
Q2QAM0_9EURY/57-176-----------------------HLTMYGEDF-ESTTPKIP...................TDAP...IAV-VVGG--AKV
TRM56_ARCFU/54-168-----------------------HLTMYGIPL-PQKLEEIK...................RADK...VLV-VVGA--EKV
Q2V9D2_9CREN/30-151-----------------------HLTMYGINL-NKTLPQIK...................VKSN...ILV-VVGA--SKV
TRM56_HYPBU/65-185-----------------------HLTMYGLHV-DDVIEEIK..................RSSKP...KLI-IVGA--EKV
TRM56_PICTO/53-168-----------------------NLTMYGEPI-EKRIDEIK...................SGDD...ILV-LVGA--EKV
TRM56_METS5/50-170-----------------------HLTMYGINL-PHVQEKLK...................ELDK...ILV-IVGA--EKV

PF09895

A4YJ17_METS5/38-141AIELLGSRRVY-------L----LSPLADREV----------------------------.........D-QLD.-----
A4WL82_PYRAR/38-137AVEVLKPDVVY-------A----LG..SKGAK----------------------------P.........-VEQ.-----
A3MX89_PYRCJ/38-139VVEVVKPDVVF-------A----LTRPDKDTR----------------------------P.........-VEK.-----
Q980M7_SULSO/40-148AIELLKPEITL-------L----VSQNAEKQI----------------------------D.F......N-DMI.-----
A8A923_IGNH4/41-144ALELLKPQRVY-------T----VSREYGEEV----------------------------.........E-RVE.-----
Q4JAZ5_SULAC/39-144AIELLSPDLVI-------L----LTSQAQKIL----------------------------E.T......Q-VFN.-----
Q975T6_SULTO/38-143AIEIFKPEVVY-------L----FTQSAEKTF----------------------------T.K......D-LLK.-----
Q6M1A6_METMP/36-139AVEILNPERVI-------L----IADSKIAEE----------------------------K.I......D-FKS.-----
Q8TUU2_METKA/37-134ALEVVDGRVAL-------L----DPSADEGIK----------------------------K.........-.LK.-----
A2BLW0_HYPBU/2-112AIEVFKPDHVV-------V----VSRDYGEPV----------------------------VPEEYAS..K-LLE.-----
A1RRR7_PYRIL/38-139AVDILKPDIIY-------A----LGRPDRDTK----------------------------P.........-IEK.-----
Y2001_AERPE/40-147AVNLLSPTHVL-------A----VTPSRAERL----------------------------VGP......G-GLE.-----
A3DN09_STAMF/37-140IIEVLGISEVY-------Y----LDERGEEIE----------------------------I........N-NLK.-----
A1RX98_THEPD/41-156VVELLRPNVIL-------V----AVPGKYGGR----------------------------ELS......E-VLKE-----
A8MCI7_CALMQ/39-143AVDLFKPDNIL-------V----IRRPGPQVK----------------------------PLT......E-FMN.-----
Q8TXR0_METKA/39-151ALKALSPDVTY-------M----AEDAEHGGA----------------------------KPLDFDAVVE-EIE.-----
Y1199_METJA/39-142AIEVLRPEKVF-------L----IGNKSICDE----------------------------K.V......D-FNE.-----
Q8ZTS8_PYRAE/38-139AVDVLRPDVIF-------A----LGKPEKDAR----------------------------P.........-IEK.-----

PF02598

Q6C565_YARLI/46-384VTPDYLRKSIF----TPET----TTTNFEYAKKLPKL.LLP-------------------FM...ESRDARYKEGMSIPM
Q6BHG5_DEBHA/25-381MTPPYLVKSVF----ANNQ----FHTKFKYAQKLPKISTLP-------------------FM.SNNHVSKDFKEGLTIPK
CI114_HUMAN/74-365ECPQYLRKAFF----...P----KHQDLQFAGLLNPLDSPH-------------------HM..RQDEESEFREGIVVDR
O59417_PYRHO/2-253ETPQYLRKRIF----...P----IMPELRYAGVMPPLQIPS-------------------HKEKTSPRIGEIREGFAFRR
Q8MSZ6_DROME/73-371ECPQYLRKYFF----...P----LHKDLKYSGLLNPLDTPH-------------------HL..RQQSKFRYREGVICDK
Q6NRR6_XENLA/72-362ECPQYLRKSFF----...P----KHPDLQFAGLLNPLDSPH-------------------HV..RMDEESEYREGVVLDR
Q8ILD7_PLAF7/85-440ETPQYLRKHLF----...P----ITNFLKNSGIMNPVDAPH-------------------HL..RSDEWLPFREGVVLQK
Q8ZT54_PYRAE/1-258VTPPYLRKKVY----...K----IDNRLKLAGLLPPLKIPS-------------------HTVPVEPRIGEIREGIVERW
O28353_ARCFU/1-247ETPQYLRKHIF----...P----LKKSLKYAGLLPPLAIPS-------------------HR.SKHLKVGELREGVVRHV
O26109_METTH/5-258DTPQYLRRKVF----...P----IMRELKHVGILPPLRTPH-------------------HP.TGKPVTGEYRQGLTVKR
Q9UXA9_SULSF/26-261LLPPYLKKYV.----...P----ISRNLKKVGLMSPLGIPY-------------------HFIFKQAVEGEIRLG.....
YMP6_CAEEL/67-369ECPQYLRKDLF----...P----IQKPLKNAGLLNPLDAQH-------------------HL.KYDEKTLRFREGVVLKK
YM91_YEAST/19-314VTPPYLRNTVF----N.EK----FRPYLTAASKLPRLSTLP-------------------FTRYQKQDHGRYREGLTIKM
Q7SI54_NEUCR/48-343ETPPFMRKLLF----...P----MHPNLRSQGLLPNLDMPH-------------------HP..YKGEWMPYREGLTLEA
Q8TZ04_METKA/1-250ECPQYLRKRVF----...R----LDRDLRYAGVMPPLRAPH-------------------HK.VHSPKEGEVREGYVVRR
Q6FIJ5_CANGA/41-365VTPPYLIKSVF----K.KE----YLPYFKEASKLPRLSALP-------------------FMRYMEEN..RYREGLAIRM
Y1688_HALSA/2-280ATPPYLRKEAF----...D----TRDELAYAGVLPPLRLSS-------------------WTGSDSSGSGSLRQGIVTQV
YG5X_YEAST/39-337VTPPNLLDTTF----K.KK----NKLYLKCASTFPPLNQLP-------------------FM..NASAEQHYKEGLSI..
Q7RF09_PLAYO/162-498ETPQYLRKHLF----...P----ITNFLKHSGIMSPVDAPH-------------------HL..RSDEWLPFREGVVIKK
Q6CLH1_KLULA/48-407ITPPYLVNSVF----K.KD----YMKYFTYAKQLPRIPSLP-------------------FMRFYQDNNGRYREGLAIRM
YGWG_SCHPO/17-306ETPFFMRKELF----...P----LNPHLKYTSCFPLLPLRN-------------------DKASTVNIEFPYREGIVTHP
Q6NLH7_ARATH/99-388ETPQYLRKSLF----...P----KQNDLRYVGMLPPLDAPH-------------------HL..RKHEWEQYREGVTLSE
Q751R3_ASHGO/60-408VTPRYLVSSVF----K.KK----YSSYFNCAAKLPRLSALP-------------------FMRHLQTDQGRYREGLSVNM

PF04452

Q83AE1_COXBU/37-252KMDYAIQKAVE----LGVN----RIVPLITERTSTKP....-------------------.KTQKLAHWQGVLIS--GCE
Q7D102_AGRT5/16-233RMDYLVQKAVE----MGAG----LLQPVMTQHV.......Q-------------------GKIHNSEKLRANAIE--AAE
Q6D078_ERWCT/19-238KMEFTIQKSIE----LGVN----VITPLLSERCGVKL.DAD-------------------RMEKKISQWQKIAVA--ACE
Q73XZ7_MYCPA/18-242RSELAVELATE----AGAD----GFLAWQAARCVANW.HGP-------------------RVDKGLRRWRAVAKA--AAR
Q8DX86_STRA5/14-241KLDFVTQKATE----LGAA----AIWGFPADWSVVKW.DGK-------------------KLAKKEDKLAKIALG--AAE
Q72R34_LEPIC/17-226RLEWLLQKGTE----LGLT----HFYFLNFEQS.......D-------------------RKDFNLNRAQKIVEE--ASI
Q9A2Z1_CAUCR/16-232RVETIVEKAAE----LGAR----RVRLTITRRT.......N-------------------VDFVKLGRLDAIAME--AAE
Q8K5R0_STRP3/14-241KLDTIAQKVTE----LGAS----ALWGYPADWSVVKW.DGK-------------------KLAKKEDKLAKIVLG--AAE
Q8G5Y7_BIFLO/28-259HDEQAIDMATQ----IGVD----QVVPWQADRSIAKW....-------------------KVGRTDKKWNSVLDA--ATE
Q6NAN3_RHOPA/23-243RLDYMAQKAVE----MGAG----RLQPVLTQHT.......Q-------------------VHRLNTDRMRANVIE--AAE
Q8P6T0_XANCP/18-239KMDLILQKATE----LGVT----AVVPVNAERTEVKL.DAA-------------------RLEKRMAHWRSVIVS--ACE
Q7VKS8_HAEDU/18-238RMEFTIQKSVE----LGVK----IITPLWSERCGVKL.NDE-------------------RQDKKLQQWQKIAIA--ACE
Q71ZK0_LISMF/17-245KLELIIQKSTE----LGAH----KFIPYKAERSVVKW.DDK-------------------KVIKKIERLQKIAQE--AAE
Q8FVR3_BRUSU/16-233QLDYMMQKAVE----MGAG----VLQPVITQHT.......Q-------------------VPRLGTERIRANAIE--AAE
Q7ND55_GLOVI/19-229RWDWLLQKSTE----LGAD----RIVPLVCERSVVQP....-------------------.DAKRHKRWQAIVRE--AAE
Q6FA41_ACIAD/16-235RMDYAIQKATE----LGVS----KIQLLTSERCEMRL.KYD-------------------RDQKKIDHWQSIAIA--ACE
Q9CCN1_MYCLE/18-246RSELAIEMATE----AGAD----AFVAWQSDRCVASW.YGV-------------------RVDKGLRRWRAVARA--AAR
Q8XVR6_RALSO/18-244KMDWLIEKAVE----LGVH----AIAPLQTERGVVRL.SGE-------------------RAVKRVQHWQALVQA--ACE
Q83GJ2_TROWT/19-230SAESAVRSAVE----LGVD----RIVPWKSDRS........-------------------.FNSSSRRWSSIARE--AAK
Q8EPW6_OCEIH/16-246KFDLILQKGTE----LGAD----AFIPFQAERSVALWNDEK-------------------KYHKKVKRFQKILKE--ASE
Q6NG15_CORDI/26-247RSELAVDLLTQ----GGAD----AIVPWEAHRCVAKW.VGA-------------------KRSKGVLKWQQAAIA--AAK
Q6KI62_MYCMO/14-223NFELVLQKATE----LGAT----KIIPFISKFSNFKK...D-------------------FALKKIERWNEIILN--ASS
Q6E297_ARATH/69-288RADWLIEKCTE----LGAS----SVTPLLTERSPIIS....-------------------..ENRVDRLERVSFA--AAK
Q89ZP8_BACTN/13-229RNEWLAEKATE----IGFD----ELTFLNCRFS.......E-------------------RKVIKTERIEKILIS--AIK
Q9ZIA2_CLOAT/16-241KMDIIVQKNTE----LGIR----EIIPLITQRVVVKN..EK-------------------SELKKVDRWNRIAFE--AAK
Q7U7K3_SYNPX/18-237MLRRILRTVAE----YGVC----NLHLINSARV.EKS.FWQ-------------------TPLLTANKVEEALMA--GME
Q9RDD9_STRCO/21-243RGELAVETMTE----VGVD----AIVPWAASRCITQW.KGE-------------------RGLKALGKWRATARE--AGK
Q6G8Z0_STAAS/16-244KYEWLLQKATE----LGAS----SFIAVSMERSIVKL.NEA-------------------KVAKKIERWQKIIKE--AAE
Q7PAV9_RICSI/18-235KLMLAINMATQ----LGIT----KIIPLITRWC.......Q-------------------FRSVNIERLTKCVIE--ATE
Q8KAZ3_CHLTE/18-236RFDLFLEKATE----LGAA----RIVPMITKRTVSTP.DSG-------------------KVGRKLERWRGIVQS--AAR
RSME2_BORBU/16-236KIDLVLRQVVE----IGVS----EINIINADRSVSKI.DIN-------------------NASAKILRFSKIIDE--ALK
Q82BY2_STRAW/19-243RGELAVETMTE----TGVD----AIVPWAAARCITQW.KGD-------------------RGQKALAKWRSTARE--AGK
Q6MAP1_PARUW/18-233RLAFILEKGTE----LGVD----EFWLFPGQLSS....QKE-------------------IYPHQQERAQSLIIA--AMK
Q6G0I7_BARQU/22-239RLDYMVQKAVE----MGVS----ILQPVITHHT.......Q-------------------VTRINRTRMEANVVE--ASE
Q87EY9_XYLFT/18-239KMDLIVQKATE----LGVV----AIVPVDTERSGVRL.DSE-------------------RVAKRLAHWNNVVIS--ACE
RSME_BACSU/19-247KLEWIIQKGTE----LGAH----AFIPFQAARSVVKL.DDK-------------------KAKKKRERWTKIAKE--AAE
RSME_SHIFL/18-237KMEFTIQKSIE----LGVS----LITPLFSERCGVKL.DSE-------------------RLNKKLQQWQKIAIA--ACE
Q833H7_ENTFA/16-244KLEWIVQKGTE----LGGN----QFIGFPAKTSVVKW.DHK-------------------KRAAKEKRLQKIATE--AAE
Q6HDL0_BACHK/16-243KLELIFQKGTE----LGAA----AFLPFQASRSIVKW.DAK-------------------KADKKVERLRKIVKE--AAE
Q89DB6_BRAJA/24-242RLDYMVQKAIE----MGAA----GLQPVLTRFT.......Q-------------------ASRVNTERMRANVVE--ASE
Q9PQJ0_UREPA/14-231NFEWIVQKACE----LGVN----SIYQTIFKRT......YN-------------------HSLIKTNRILTIIKE--ACE
Q8XIT7_CLOPE/16-241KMDLIVQKCVE----LGVS----EIIPTITDRVDVKL...K-------------------GEFKKLDRLNKIALE--ACK
Q9CJ96_LACLA/18-245KLDFIVEKSTE----LGAT----AIWSAPFKASVSKW.DKK-------------------KLTKKQEKLEKVALG--AAE
Q7MT38_PORGI/15-239RMEWMLEKLVE----IGVD----EVVFIESEHS.......E-------------------RRRIKAERLERIAIS--AMK
Q9RH08_ZYMMB/27-242RIDWIYEKACE----LGVA----RITPVITQRT.......I-------------------VDRVNLERLQAHIVE--AAE
RSME_SYNY3/80-299GFEEIIRPCTE----LGAT----AFQPLLTERTLLKP....-------------------.SQNKLERWQRIVTE--AAE
Q8RB65_THETN/16-239KMDLIVQKCTE----IGVK----RIIPFVSEFSVVDI.KRA-------------------NIDKKVERWKKISEE--ACK
Q9RU73_DEIRA/24-239KLADVVRAATE----LGAA----RIQLLITAHAE....ARD-------------------IGAQKLVRLRRIAGE--AAR
Q7VHH3_HELHP/14-232IIEKTLPMLNE----LGVS----RISFFYAAFS......QG-------------------HFKLSLPRMEKILIQ--SCQ
Q72R98_LEPIC/18-253TIRKILQLAGT----WGVT----SIHFFISKNS..RKDYLT-------------------SPIWNQNEIESELLE--GME
Q74G06_GEOSL/16-240KMELILQKSTE----LGVS----EVVPFLAERSVPRI.SPE-------------------REQERLRRWQRVAEE--AAR
Q7P2R8_FUSNV/14-232KMDLTIQKLTE----LGIN----KIIPISVKRCIVKL....-------------------..DKKKDRWDIISKE--ALK
RSME_MYCBO/18-242RSELAIELATE----AGAD----AFLAWQAARCVANW.DGA-------------------RVDKGLRRWRAVVRS--AAR
Q6F738_ACIAD/16-235VLRRLIMDSVT----LGVE----RICLTHSYRV.DKS.YWQ-------------------TPFLQ..QLDDYITL--GLE
Q8DS03_STRMU/14-241KLEFLAQKTTE----LGAH----ALWAFPADWSVVKW.DSK-------------------KLLKKADKLTKIAQG--AAE
Q8YX66_NOSS1/19-231GFDEVVRSCTE----LGVA----CIAPVLSDRTLLNP....-------------------.STQKLERWRRIASE--AAE
RSME_AQUAE/13-228TMDTIVRQATE----LGVL----TFVPIISERS..FQ.KEE-------------------AILKKTEKWKRIVIE--AMK
Q9F9G9_9GAMM/17-236RMDYAIQKATE----LGAT----ALVILDTERCEVRL.KGE-------------------RQEKKLGHWQQVAIS--ACE
Q892R3_CLOTE/16-241KMDLIVQKNCE----LGVR----EITPVITERVVVKQ..YG-------------------GEYKKLDRLEKIAIE--SSK
Q6MI96_BDEBA/16-247VMDAIMEKAVE----MGVT----SIQPFFSEFSFLRK.GEK-------------------LSDNKTDRWDKIVKS--ATQ
Q987U8_RHILO/16-233RLDYLVQKAVE----MGAG----ILQPVITQHT.......Q-------------------VAKPSIDRLRANVVE--AAE
Q7VZC1_BORPE/18-240KMDWVVEKAVE----LGAW----RVSPIAAQRSVLQL.NGA-------------------RAEKRLAHWQRIAQA--AAE
Q7RMG7_PLAYO/19-251VLNKALQQLSS----VGVK----KIIIVFSEYS.NKC.YES-------------------SKMLKNDEIKFALQL--GLE
Q8FNF6_COREF/18-236RSELTVDLLTQ----AGAD----RIVAWQSQRTIAKW..AG-------------------KEAKSLTKWQAAAEA--AAK
Q8DNP5_STRR6/18-245KLEFIAQKVTE----LGAS----QIWAFPADWSVAKW.DGK-------------------KLGKKVEKLEKIALG--AAE
Q8CSC8_STAES/19-247KYEWMIQKATE----MGAN----EFIAVAMERSVVKL.NDS-------------------KVEKKLSRWQKIIKE--AAE
Q73J56_TREDE/35-272QLRRILRDAAS----LGFA----EIVLCGTDLG.ERS.YLK-------------------SNLSSPEEIKKYLLD--GIS
Q7V223_PROMP/22-248GVEDILKMCTE----IGID----FIQPLYSDRQVKKY...T-------------------NFSNKLIRWNSIVNE--AVE
Q7U730_SYNPX/24-238GFEDALRMACE----LGVD----EIQPLRADRS......TP-------------------QAEHRPERWATILQE--AVE
Q92RS8_RHIME/22-239RLDYLVQKAVE----MGAG----VLQPVMTQHV.......Q-------------------GKIGSLERVRANVIE--AAE
Q82WB5_NITEU/17-247KMDWIIQKAIE----QGAT----RIQPLITRRTLIRL.TGE-------------------RADKREQHWQKIIIA--ACE
Q87LK2_VIBPA/18-237KMEFTIQKSVE----LGVN----TITPLISERCGVKL.DQK-------------------RFEKKLAQWQKIAIS--ACE
RSME_BUCAP/20-240KMNFSIQKSVE----LGVN----TITPLFSEYCNFQN.KLI-------------------CFPKKKIHWENIVIS--SCE
RSME_MYCH2/14-226SFEFAIQKAVE----IGVN----EIWPFYSKNVSQKL..SG-------------------DLEKKLKRWEQICLH--SAQ
Q6AEC1_LEIXX/18-236RDERAIQAATE----LGAD----AVIPWAAARSVSRW.EGT-------------------KIAKGRERWATIVRE--AGK
Q7V7G0_PROMM/24-244GFEEVLRMSCE----LGVN----LIQPLRSDRC......TP-------------------QAEERPLRWRVILRE--AVE
Q6AMJ0_DESPS/17-250MLRRILSQVTS----LGVG----RIFLIDSQRV.EKS.FWQ-------------------ASLLQNEQYREHLLI--GLE
RSME_HELPY/14-226NIEKILPFLNQ----LGVS----KLSLFYADFSQR...NEK-------------------IDIAKLERFQKILIH--SCE
Q7P147_CHRVO/16-235KMEFTLQKGVE----MGVS----VFQPIAAGRSVVKL.SGE-------------------RADKRVARWQEIVVS--ACE
Q72BF1_DESVH/15-234RRSWLMEKAVE----LEAS----AIWLWQAEHS.....QSP-------------------VPDDIKESWLAQMVA--GAK
RSME_HAEIN/18-238RMEFTIQKSVE----LGVN----VITPLWSERCGVKL.DAE-------------------RMDKKIQQWQKIAIA--ACE
Q8EWP2_MYCPE/13-228NFELAVVKLSE----LNIK----KIIPVYFDYS......QR-------------------NINLNYQRLDILIKE--SQK
RSME1_BORBU/15-233VAKRIIKELAS----IGTY----KIIFFNTELT.EKS.YLN-------------------SKIFKNNDCEKHLIA--GAM
Q8EIK7_SHEON/18-237RMEFTIQKSVE----LGVN----TITPLFSDRCGVKL.SGE-------------------RLDKKIQQWQKIVIS--ACE
RSME_BUCAI/27-247KMDFTIQKSIE----IGVK----TITPLFFENDHFQK.KRI-------------------NFSNKIKRWEKIAIS--ACR
Q8NNB5_CORGL/18-236RSELTIDLLTQ----AGAD----RIVAWQASRCVAKW..GG-------------------KEAKSLAKWQVAAEA--AAK
Q7VBR8_PROMA/24-246DFDDILRMSTE----IGID----VLQPIISDRSV....VRN-------------------FQSERVKRWDSIINE--AVE
Q73FW1_WOLPM/18-226ALNNIVRQATE----MGVI----CIQFISTERTVVKN....-------------------...INLSRAKLQAIE--AAE
Q73LI5_TREDE/15-246HMDIAVRQAAE----AGCS----LIVPVLGEFSV....VKK-------------------ENINQTERRERIIRE--ARQ
Q98Q27_MYCPU/14-222RFELTIQKAAE----LGVS----LFIPMLSQNVEQKL..GN-------------------DIDKKLQRWKTIALN--ACE
RSME_TREPA/18-242QLRRILRDVSS----LGIS----SIHLVGTELG.ERS.YLD-------------------SGLAHMEKMHTYLIR--GLE
Q6A996_PROAC/19-238RAELAVATLTE----MGVH----EILAWQADRSIVRW.KGD-------------------KQAKGVARWQAAARE--ATK
Q9X1A0_THEMA/14-217RTRFLIEKCVE----LGVD----EIFFHKFERS........-------------------QHEISLDKAKIVVRE--AAK
Q9KD69_BACHD/16-244KLDYIVQKGTE----LGAQ----AFWPFSASRSIVKW.DEK-------------------KGRKKTERLMKIAKE--AAE
Q6F1G3_MESFL/14-235KWDYLLQKSTE----LGVD----EIIPVIFKRNVVKI.DEK-------------------KIDQKLQRWQAICDT--AAK
Q8DI45_THEEB/47-258NFEQVLQQATE----LGVK----RIVPIQTARSLLQP....-------------------.SINKYQRWQRILQE--AAE

PF04013

TRMYL_VIBCH/1-199YSRTITVEANE----ISDV----GGFHEAALIA---------------------------LLVKALDASVG....--MGK
TRMY_PYRAB/1-203PPKSLRFEGPE----LKPK----ILNPDELSTA---------------------------KIIGKALERGKDIKR--KST
TRMY_PYRHO/1-202PPKTIRFEGPK----LRPK----ILNPDELSIA---------------------------KVIIKALNAGKNLKG--SST
TRMY_METJA/1-202PPVCIKFVGSE----LKK.----.VSPDERNIA---------------------------IFIKKALKKFEELDE--EQR
TRMY_AERPE/1-186PPRLLIAPLSC----KDI.----.VRS.ERSFM---------------------------IEASRALRGR.....--...
TRMY_ARCFU/95-288PPKSILIKGDE----VRR.----.MSPDERNVA---------------------------GHIKKAL.AV.....--ECG
TRMY_HALSA/1-193DEVTVRIDAGA----VQY.----.MHPDERNVA---------------------------GLLKQALDAKT...E--AIG

PF04252

Q9YC91_AERPE/71-273PVFMERGYS------LNRP----GCILLDLWSPKRLEPEEA-------------------SSAS-----YIIVGG--IMG
Q9V144_PYRAB/2-195ITESITRLP------FDRS----KVIVLDLQAEEELKPEDI-------------------EEDT-----IIVVGG--ILG
YO021_YEAST/1-212NEDFKDLEL------LKDG----RVCLLDPRATIDLQPEDA-------------------TKFD-----YFVFGG--ILG

PF01746

RG9D3_MOUSE/135-308.....EEDCFSL...FPLE....TLVYLTPDSEHSLEDIDQ-------------------ST.......VYVIGG--LVD
RG9D2_HUMAN/110-276.......HYSEL...IKKE....DLIYLTSDSPNILKELDE-------------------SK.......AYVIGG--LVD
Q9BI62_CAEEL/175-352.....ENGLE......TYENHSKNVIYLSPDATEELESVDD-------------------DK.......IYVIGG--IVD
Q9UZ22_PYRAB/108-288GI................K....RVVLLDPNADEVLSSNDL-------------------KEK......AFIIGG--IVD
Q9FGI9_ARATH/127-293SRCYIEAMA......DQKD....NLVYLTADSETVLDDLDP-------------------KH.......IYIIGG--LVD
RG9D2_DROME/104-271....FDRGHTDI...FEHS....QLVYLTCESDRVLDKLQP-------------------GC.......TYVIGG--LVD
TRMD_STRLI/21-232GRPFTQELAVHL...SERP....WLIFTPARYEGIDRRVVD-------------------EYATRMPVYEVSIGD--YVL
TRMD_SHIFL/22-221GRKLDQAGVSEL...ATNQ....KLILVCGRYEGIDERVIQ-------------------TEID....EEWSIGD--YVL
TRMD_MYCLE/21-224GALFTQATAQCW...STER....HLVFACGRYEGIDQRVVD-------------------DAVRRMRVEEVSIGD--YVL
Q19789_CAEEL/96-260..HLHQEKLENL...FKPE....EIVYLTSESENVLSDLDD-------------------TK.......VYVIGG--IVD
TRMD_HELPY/22-221GKPFKQTDAMRL...AQKK....HVVLVCGRYEGFDERSIE-------------------LGAD....EVFCIGD--FIL
TRMD_MYCGE/22-216GEQFSQNCAKKL...TKYE....HLILLSGHYEGFDQRIYK-------------------YIDQ.....IVSLGD--FVL
TRMD_BORBU/22-219GIKYSQELAYSL...SKRE....EIVIICGRYEGIDQRIID-------------------LYVD....FEISIGD--YVL
TRMD_MYCPN/22-216GQQFSQPMAQAL...TQTE....HLILICGHYEGFDYRLYK-------------------HVDQ.....IISLGD--FVL
Q97Z49_SULSO/105-260...............IPKD....NAIVLNPYGDTIANEEII-------------------RNTK.....FFIIGG--IVD
TRMD_SYNY3/22-218GQPMDQALFREL...TNYD....QLVLICGHYEGVDERVCQ-------------------LVTR.....EVSLGD--FVL
Q9YET3_AERPE/129-296KVTISQSKPSEILWSMDAD....RVVILRPDAPQPLSGSEV-------------------LAAD.....AFLIGG--IVD
MRRP1_MOUSE/207-375.....EKSPVDL...FPKD....SIIYLTADSPNVMTTFKH-------------------DK.......IYIIGS--FVD
TRM10_YEAST/104-276DKIMFGDEHI......SKD....KIVYLTADTEEKLEKLEP-------------------GM.......RYIVGG--IVD
O58442_PYRHO/158-338GI................N....RVVLLDPNADEALSEKDL-------------------EEK......AFIIGG--IVD
TRMD_AQUAE/27-222GEKLNQKLVNEL...SKKE....RIMIICGRYEGVDERVKK-------------------IVDM.....EISLGD--FIL
TRMD_BACSU/22-221GERFTQKKAEQL...AKEE....HLLFICGHYEGYDERIRE-------------------HLVT....DEISIGD--FVL
TRM10_SCHPO/104-273..SYLEEFE......SQKE....KLVYLSADSDNTITELDE-------------------DK.......IYIIGA--IVD

PF09936

B5EBC8_GEOBB/4-189RTGRR-------------------------------PKVVVTG----AT.G.RDNSV------SFA--------------
Q3A2E8_PELCD/2-183FAGPT-------------------------------AEPVLTG----AS...RTDGI------GVD--------------
A1AMZ9_PELPD/5-189GFNAP-------------------------------VRTVITG----AA.Q.RSNSI------DWT--------------
A5G7Z4_GEOUR/8-192SHGKR-------------------------------AKIVVTG----AQ.G.RANSI------SSA--------------
Y054_AQUAE/17-201ERGRR-------------------------------PLLVGTD----AR.T.YPNTV------KYS--------------
A7HKS2_FERNB/2-186EEGQK-------------------------------PIIMFTS----AK.V.RPNTI------SYE--------------
A0LMM3_SYNFM/1-185VHGLR-------------------------------PGIWATT----AG.K.GERRL------THR--------------
TRMD_DESDG/242-423RTGQR-------------------------------PTVIATS----AR...GAGDT------GFE--------------
Q2LVU3_SYNAS/10-194LSGKE-------------------------------VRLVVTG----AG.L.SDNVI------TCK--------------
Q1MRV0_LAWIP/191-372YTGQS-------------------------------PLLIGTT----AC...KYGVL------LPC--------------
Q0AWV8_SYNWW/3-187MNGEK-------------------------------VFTVATD----AR.L.YANTI------SYS--------------
A8ZV19_DESOH/6-188DTGTA-------------------------------PLVAATT----AR.L.HPGAV------TME--------------
Q24UB0_DESHY/1-185EQGRR-------------------------------PLKIATD----AR.R.YPHTL------GYA--------------
A6LNY5_THEM4/2-186VESKK-------------------------------PIIMFTS----AK.W.RDNTI------TFE--------------
A1HN71_9FIRM/2-187REGKP-------------------------------PFIVTTD----AR.K.YPNTI------SYW--------------
A8F3G0_THELT/2-186ETNKK-------------------------------PVMFFTS----AK.K.RPNTL------TYA--------------
Q0F054_9PROT/1-176...GD-------------------------------YRLWYTS----AAPP.GAACT------EPS--------------
Q3AC73_CARHZ/1-185IEGKK-------------------------------PLTVSTD----AR.L.YPNTV------SYN--------------
Q7P719_FUSNV/2-186IEGQK-------------------------------PLIITTS----AR.T.FDNSI------SYK--------------
B3E5S7_GEOLS/2-186VHHQP-------------------------------VNIIATG----AA.R.RPDAV------SFT--------------
Q6AJE7_DESPS/14-197QHGRK-------------------------------PTVIATS----AK.V.SENTL------AYD--------------
A5IM13_THEP1/2-186VEGER-------------------------------PLIFFTS----AK.K.RENDI------SFE--------------
A1VFE5_DESVV/242-423RTGQV-------------------------------PYVVGTS----AK...GAGNA------TPA--------------
A9BF02_PETMO/2-186NEGER-------------------------------PKIVFTS----AK.A.RNNVV------SFE--------------
Q39RN9_GEOMG/8-192RFGRP-------------------------------VRLVTTG----AR.L.HPRSV------TFS--------------
Q1NQ21_9DELT/248-432RRGEA-------------------------------PLVVGTS----ARPQ.GGGQM------EYR--------------
Q6ML98_BDEBA/8-193...PE-------------------------------ALTIATT----ARTEWAKHKY------SFA--------------
Q74FG2_GEOSL/8-193EYGAP-------------------------------ARLVTTG----AR.Q.HPRSI------GYE--------------

PF00588

Q8CXU2_LEPIN/126-265N.Q.Y-------------------------------RT..LAV....TP..-.EATK......HYY...........NA.
Q7NBG1_MYCGA/4-151D...E-------------------------------NL..FLF....TK..-..KAN......NYL..........SNI.
Q6BHP1_DEBHA/1290-1434E.G.Y-------------------------------TL..IGL....EQ..-..TDK......SVEL........NSDL.
Q8I3K9_PLAF7/198-344H.K.L-------------------------------IP..IVA....HT..-..KGQ......NID...........TFF
Y324_MYCLE/160-301Q.G.L-------------------------------RV..IGL....DH..-.DGDT......ALD...........DL.
Q22484_CAEEL/1071-1214N.G.Y-------------------------------TV..IAA....EQT.-.TDSV......MMH...........DF.
O74022_9EURY/1-150T....-------------------------------....VGT....TGKP-GKRFI......PHR...........APL
Q7TU01_RHOBA/25-165E.R.F-------------------------------FF..FSK........-..FAK......RTV..........WEA.
MRM1_SCHPO/147-297K.G.W-------------------------------KV..IG.TKPALPD.-.NKDQ......IYTP.........HKIK
Q6ME25_PARUW/89-224P...I-------------------------------IA..LET....SE..-..EAI......NLY...........EF.
Q8R6H6_FUSNN/88-229L.D.Y-------------------------------WV..YGA....AG..-.EANI......SYN...........EE.
Q729V9_DESVH/1-141G...R-------------------------------RL..VTT....SA..-.RGGT......AVH...........RF.
Q74D44_GEOSL/15-165S....-------------------------------....VAT....TR..-.RHGKYRQEIFSPK...........EI.
Y516_BORBU/78-219Y.G.F-------------------------------WI..YTG....DI..-..KGQ......DIN...........KI.
Q898S5_CLOTE/9-150G...K-------------------------------FY..FST....TH..-..STK......TYS...........DV.
Q6FZ54_BARQU/2-143FNRRL-------------------------------LL..LST........-..KAE......TCY..........TQI.
Q7UG85_RHOBA/132-272H.G.Y-------------------------------RV..AAM....RV..-..EGS......RPL..........FDS.
Q6YR72_ONYPE/92-232K.N.Y-------------------------------SI..FSA....FP..-..QKA......NITME......DAKKY.
Y881_MYCTU/130-275S.G.F-------------------------------RL..LAM....TP..-..HGN......ACK..............
Q6XK16_SPICI/109-253R...Y-------------------------------KI..ITT....GL..-..KRQ......SVF...........LQD
Q6MS22_MYCMS/92-234N.N.F-------------------------------WI..YAT....NLN.-.QNST......DMT...........KI.
Q8A814_BACTN/97-238S.G.F-------------------------------RI..VAA....TE..-..KGD.....YDYT...........KA.
Q7UFJ5_RHOBA/144-289A.G.I-------------------------------AS..IAT....LL..-..DDT......AIP..............
TRMH_SHIFL/19-159Q.G.M-------------------------------QI..LAT....HLS.-.DNAV......DFR...........EI.
Q73T60_MYCPA/69-206A.G.L-------------------------------TV..VAV....DNV.-.PGAA......RLE...........ET.
Q9RWT9_DEIRA/12-159SVGTS-------------------------------AR..IRA....DL..-..PAP......RHP...........AQV
Q9RXS5_DEIRA/10-149A...A-------------------------------RV..FAF....ST..-..HAT....................EYH
Q9UXD5_SULSF/1-149K....-------------------------------....IAT....SSIA-DNNGD......ILR...........KSI
Q74D57_GEOSL/96-237E.G.F-------------------------------WA..FGT....AD..-.SAAS......SLY...........SH.
Y380_HAEIN/4-151V....-------------------------------....IGT....SA..-..RLR......HLQ..........NTLI
Q7VBF1_PROMA/9-160V...V-------------------------------AT..CGR....ID..-.HGDI......PLH...........TSK
Q8IJ98_PLAF7/52-193KHD.I-------------------------------LL..YAC....EIS.-.VNAL......SITT.........NPY.
Q9PQM3_UREPA/1-151S.G.D-------------------------------EI..YFF....TR..-..YGT......KTP..........CDY.
O67731_AQUAE/93-233M.G.G-------------------------------WV..FAV....EK..-..GGK......DIR...........EV.
Q6F981_ACIAD/122-259....F-------------------------------DIPVFVT....SS..-.HHAT......NLY...........DQ.
Q7M8R3_WOLSU/2-143S...H-------------------------------FL..LTT........-..KAK......RAY..........FEA.
Q73GK0_WOLPM/102-244V.G.Y-------------------------------WC..YGF....DC..-..NAK......ENID.........EIK.
Q8PVX0_METMA/11-163L...I-------------------------------GT..TGV....SSL.-.KTGE......HIR..........LPLY
Q8FF07_ECOL6/222-362A.G.Y-------------------------------TV..VTT....SS..-.EQGK......PLF...........KT.
Q7V131_PROMP/7-159V...I-------------------------------AT..FGR....IDL.-.SNDI......ECE...........SPE
Q7WLL7_BORBR/7-163A...F-------------------------------AL..TAR....VR..-.DLGP......PPCD........IREAA
Q8TXY9_METKA/2-150AIATT-------------------------------AV..LAS....TP..-..ARN......PMM...........PWE
Y052_BORBU/34-174D.G.Y-------------------------------SI..VAT....SL..-..NPK......SINL.........ENL.
Q9AAX1_CAUCR/6-147VDGRL-------------------------------LL..FTT........-.KGAT......PFH...........RF.
Q9CC19_MYCLE/108-251A.G.L-------------------------------QV..LAT....MV..-..DGE......TSL...........DE.
TSNR_STRAJ/116-258S.G.M-------------------------------QL..MTL........-..KAD......GDI...........SVK
Q8XDF6_ECO57/1-142P...Q-------------------------------RL..FAL....TT..-..KGT......PAH...........SA.
Q9A8W1_CAUCR/124-265L.G.W-------------------------------RA..VAL....AG..-..EAE......QSL...........DA.
Q72QT0_LEPIC/71-212N.G.Y-------------------------------WI..VST....SD..-..RGT......E.DW.........SKL.
Q7P7P4_FUSNV/111-252N.N.Y-------------------------------SI..IST....YLD.-.KTAI......PYN...........KI.
Q6NHA0_CORDI/3-144S....-------------------------------RV..FAF....SS..-..HAT......TWY..........TDI.
Q8G5E6_BIFLO/133-283H.N.M-------------------------------DV..WAA....DV..-..YGT......EERKPESLPAVLADKA.
Q8FA35_ECOL6/9-160T....-------------------------------....VAT....TA..-..RSR......AKYHYYATPVELVPLLE
Q8YNM2_NOSS1/5-155A...I-------------------------------AT..SGR....DN..-.DWGL......TLE...........TPR
Q8KC03_CHLTE/108-249R.G.F-------------------------------SI..VAA....DM..-..EAE......HNH..........TDI.
Q7NRY2_CHRVO/3-154A...C-------------------------------AL..TSR....RR..-.ELTT......PLST........PRQTT
Q8GYL4_ARATH/196-346EFQMK-------------------------------LL..AGH....PATT-TQKLK......PVS...........KL.
Q720L1_LISMF/107-248E.G.V-------------------------------PV..IGA....VLD.-.DQAK......SLN...........DM.
Y1673_SYNY3/120-261Q.G.L-------------------------------QL..IAT....VP..-..QAT......QTL..........WEI.
Q98R32_MYCPU/82-224Q.G.Y-------------------------------WI..YSS....SLD.-.PTSE......DIN...........KI.
Q6KIH0_MYCMO/89-225..N.Y-------------------------------QI..YVT....TL..-..RSD......AFEYD.......AVEN.
TARB1_HUMAN/1463-1606E.G.Y-------------------------------TI..IGV....EQT.-.AKSL......DLT...........QY.
Q824D7_CHLCV/116-256E.K.W-------------------------------QV..FAT....SP..-..RAS......TMYF.........C.E.
Q9CHW1_LACLA/110-250A.G.I-------------------------------SI..LTT....TL..-..SAN......SVSY.........K.I.
Q82FA2_STRAW/107-239G....-------------------------------PV..FAL....DP..-..EGD......DIR...........GL.
Q6MIZ9_BDEBA/141-282Q.G.Y-------------------------------WI..YGL....SP..-..RGK.....RSIF...........EL.
O27877_METTH/10-161D...F-------------------------------LVGTTGV....PG..-..GSY......NVD...........RIP
Q8Z0C3_NOSS1/123-264A.G.M-------------------------------QV..VAT....LP..-..TAK......LTY..........WEI.
Q8ECQ8_SHEON/21-159..G.T-------------------------------QL..VCV....DLV.-.LGAT......PLP...........EF.
Q7MSH0_WOLSU/110-249A.G.F-------------------------------TL..YGA....AL..-..EGE......IPN...........GK.
RLMB_SALTI/95-236E.N.I-------------------------------WI..VGT....AG..-.EADH......TLY...........QS.
Q9PR20_UREPA/90-231E.G.F-------------------------------WV..YAT....SL..-.LKSQ......PYE...........KV.
Q72GY4_THET2/109-248Q.N.L-------------------------------PL..VAA....TP..-..EGE......RLY..........WEG.
Q6MNP1_BDEBA/47-187Q.G.Y-------------------------------KI..YVT....HLD.-.ANAK......PLH...........EI.
Q9LXE4_ARATH/154-296R.G.Y-------------------------------RI..ATT....HLG.-.MDTV......SIY...........DM.
Q73J63_TREDE/100-245R...L-------------------------------TC..IGT....DL..-..RAH......HEI..........ADLG
Q6SFH7_9BACT/10-160IIG.F-------------------------------TA..RQR....ELS.-.QEHK......NIR...........EI.
Q6MTA0_MYCMS/106-249N.N.Y-------------------------------II..IGT....SLH.-.DDSK......PLS...........KV.
Q8YIL5_BRUME/130-270A.G.F-------------------------------NL..LAL....TP..-.SAPR......SIY...........EA.
O83093_TREPA/117-262K...M-------------------------------TR..VGA....SPHA-FRSLT......RLS...........NI.
Q9PQG4_UREPA/113-253K...F-------------------------------YL..IAT....ILD.-.KNAI......SLN...........EI.
Q820Y2_TROWT/113-259Y.G.G-------------------------------FV..LGL....DS..-..NSK......TPI...........DKS
Q6YQX1_ONYPE/907-1048Q...V-------------------------------LI..VGT....DS..-.NSSQ......SFH...........QI.
Q8PJZ3_XANAC/6-157V...I-------------------------------GC..TAR....ARR.-.VALE......ELL..........PDEG
YACO_BACSU/97-238R.G.I-------------------------------WV..VGT....DA..-.SARE......DFR...........NM.
TRML_SYNY3/1-143Q.G.G-------------------------------NL..LGF....SV..-..TGT......VNF..........WDY.
Q6MMA4_BDEBA/107-249E.G.Y-------------------------------RIVALET....AA..-..SAS......DLF...........EK.
Q729J5_DESVH/23-164S.G.H-------------------------------QV..LAT....SCS.-.PVAK......PVA...........DY.
Q6UCQ6_9PROT/107-248S.G.Y-------------------------------WI..YGL....DM..-.KAER......SIT...........ET.
Q9F5K6_STRVR/126-272AAG.T-------------------------------PIVLVGT....DE..-..HGD.....CDVF...........DF.
Q8A2Z0_BACTN/24-168E.G.Y-------------------------------IV..YSI....EQA.-.EGSI......MLD...........RL.
Q97B79_THEVO/10-160VAG.T-------------------------------SS..TAS....SNL.-.KRFR......RLP..........VDP.
Q8R700_THETN/26-168REN.L-------------------------------QV..VVT....WLD.-.ESSK......DFR...........EI.
Y2399_ARCFU/77-217L.G.F-------------------------------TT..LAA....DL..-..DGE......DLE...........AV.
Q92JA7_RICCN/2-149L...Y-------------------------------ATTCIKR....AM..-..NKD......YVF...........SQN
Q98QQ8_MYCPU/1-149E.NIF-------------------------------YI..TRY........-..SQK......SYS...........DI.
Q72G19_DESVH/97-239A.G.Y-------------------------------AI..YGA....MCG.-.EGSV......NAF...........TA.
Q6MA83_PARUW/115-255Q.G.I-------------------------------DI..LAA....TP..-..HAE......KEF..........TQV.
Q87R44_VIBPA/101-237..ANL-------------------------------PV..YGA....FL..-..EGE......SVH...........KT.
Q8XZH6_RALSO/113-250R...L-------------------------------HVPLLAT....SS..-.HARH......AVF...........DM.
Q73RN5_TREDE/119-253....L-------------------------------PL..IVL....ET..-..GGT......DIS...........KF.
Q727W7_DESVH/4-156V....-------------------------------....WGT....TART-GGWRR......EIL...........TPE
Q7U8A3_SYNPX/2-151V....-------------------------------....IAT....CGRL-DHGGI......PLQ...........TPD
Q8XJ72_CLOPE/109-249E.G.Y-------------------------------KL..VVS....SL..-..QGK.....NNFF...........EE.
Q8R9C5_THETN/105-242K.G.V-------------------------------KV..FAT....HL..-..KGE......KFV..........HEV.
Q7TU91_PROMP/282-424K.G.F-------------------------------II..IGL....SG..-..DGQ.....VPIS...........EF.
Q6FAL4_ACIAD/3-155V....-------------------------------....FGT....SA..-..RSR......TIPWP......LLDARP
Q98QQ7_MYCPU/101-239K.N.Y-------------------------------EI..IGT....FLH.-.SDST......NLY...........QN.
Q89I93_BRAJA/15-167L...F-------------------------------AT..TAR....PH..-.DQAK......PVVG........PEAA.
Q8GYT1_ARATH/5-144EKD.C-------------------------------DI..CGV....EIA.-.DGAS......AVN...........EH.
Q8D323_WIGBR/95-236Y.N.I-------------------------------QI..IGT....SR..-..KAQ.....LDIC...........NK.
Q72H04_THET2/88-229E.G.L-------------------------------WV..YGL....DV..-..RGE......KAP..........WEL.
TRML_GEOSE/2-145G.DFY-------------------------------YI.........TK..-..FGK......RYY..........TSY.
Y252_MYCGE/95-238I.G.F-------------------------------WT..VVS....TLDP-IWKPI......DYR...........KV.
Q72JF4_THET2/3-156A...Q-------------------------------LV..VAT....TG..-..RPR......EVYP.........APVA
Q8KD02_CHLTE/16-159E.S.K-------------------------------KI..FGL....EI..-.AENS......RSY...........SSL
Q7NWF9_CHRVO/117-255R....-------------------------------KL..VTH....LE..-..GSS......SLY...........GH.
Q72N93_LEPIC/2-144GTN.L-------------------------------YL..ISI........-..YGK......RSY..........TNV.
Q6MHK3_BDEBA/6-165S...I-------------------------------KVAFTAR....DG..-..KGR......QVRDVD....EVLKDIA
Q828C9_STRAW/145-290A.G.V-------------------------------RI..LAA........-..DGA......GDD...........DL.
Q7NIP3_GLOVI/2-151VAG.T-------------------------------TA..RTR....TV..-..SDP......PLL............PA
Q98NQ0_RHILO/12-164V...F-------------------------------AT..TAR....QR..-.DGFK......AVRG........PVEA.
Q6MEY4_PARUW/104-242Q.GNF-------------------------------QT..LVA....DL..-..KGQ......ILK...........ST.
Q7BKE9_PRB01/91-232I.N.I-------------------------------NI..YGL....SE..-..HAS......KSH..........TDY.
Y1476_METJA/4-155V....-------------------------------....IAT....SGA.-.RGGDRNLKRVPIT...........PK.
Q8K8I3_STRP3/17-159Q...L-------------------------------HL..ISK....FAVN-NYSQA......TYA...........DG.
Q9X263_THEMA/90-230K.G.V-------------------------------WT..YAS....DI..-..DGT......PIY...........EE.
Q73MR5_TREDE/110-250E.G.F-------------------------------WI..YGA....DA..-..GGK......ALP...........NL.
Q8EPH3_OCEIH/102-242Q.G.F-------------------------------TI..LAT....AL..-.HDAV......EYT...........EV.
Q8PHE1_XANAC/153-294A.G.F-------------------------------AI..AAT....LV..-.DGGQ......DVF...........AA.
Q6F190_MESFL/4-147....I-------------------------------DL..FCI....SR..-..YGE......KPH..........SDF.
Q6MMJ6_BDEBA/113-244I....-------------------------------....YAL....DM..-..KGE......SVA...........NF.
TRML_MYCGE/5-150N.KTI-------------------------------WL..LTK........-..SGD......KTP..........DQIC
Q6MR30_BDEBA/7-149P.SRI-------------------------------WL..FTT........-..KTQ......RTY..........FEP.
Q6AF11_LEIXX/119-263A.G.F-------------------------------EIAALAL....AD..-..EAV......ALD...........EY.
Q6GHU8_STAAR/105-242P....-------------------------------.V..YGT....AL..-.ENAV......AYK...........EV.
Q89IY5_BRAJA/156-297R.G.F-------------------------------QT..VGL....DS..-..EGS......EDL..........SNV.
Q7TUD5_PROMP/21-161K.G.F-------------------------------KL..YGT....TLN.-.ERST......DYR...........NF.
Q6AJ92_DESPS/144-286V.G.A-------------------------------WV..FGA....IKD.-.ADAV......SLF...........DA.

PF14419

O28057_ARCFU/168-343KRR.K-------------------------------RNVLIIT----DP-----TGR------QIS-----------DVK
D3S2R7_FERPA/167-342KRR.R-------------------------------RNVLIVT----DP-----TGK------QLS-----------DIK
D2RFH8_ARCPA/167-342KRR.K-------------------------------NNILIVT----DP-----VGK------QIK-----------DVK
F2KQY0_ARCVS/173-346KRK.K-------------------------------RNLLIVT----DP-----TGK------QIK-----------NVK
Q9V2I9_PYRAB/172-346KRR.N-------------------------------RRLIIIT----DP-----KGP------TLN-----------EVK
O57783_PYRHO/172-346KRR.N-------------------------------RRLIIIT----DP-----KGP------TLN-----------EVK
Q8TZR0_PYRFU/172-346KRR.S-------------------------------RRLIIIT----DP-----KGP------TLN-----------EVK
F0LM29_THEBM/169-343KRR.N-------------------------------KRLLIIT----DP-----KGH------TLA-----------EVK
Q5JGM1_PYRKO/169-344KRR.N-------------------------------KRLLIIT----DP-----KGP------TLA-----------EVK
B6YU66_THEON/169-344KRR.N-------------------------------KRLLIIT----DP-----KGP------SLA-----------EVK
C5A405_THEGJ/173-348KRR.K-------------------------------KRLLIIT----DP-----KGP------TLA-----------EVK
E3GWV1_METFV/168-342KRR.K-------------------------------NRTIIIT----DP-----LGD------IVS-----------NVK
C9RGK2_METVM/168-343KRR.D-------------------------------NRLLIIT----DP-----KGD------ELS-----------KIR
C7P975_METFA/169-344KRR.N-------------------------------NRLLIIT----DP-----KGD------ELS-----------KIK
D3S697_METSF/168-343KRR.D-------------------------------NRLLIIT----DP-----KGD------ELS-----------KIK
D5VTY7_METIM/171-346KKR.K-------------------------------NRLIIVT----DP-----KGE------DIN-----------KIK
Y421_METJA/168-343KRR.D-------------------------------NRLLIIT----DP-----KGD------ELS-----------KIK
Q8TVD0_METKA/167-340..K.R-------------------------------DALIIGT----DP-----KGD------PYT-----------EIR
Q9YCV6_AERPE/169-342..R.R-------------------------------GEPIIVM----EP-----EGE------HIS-----------RVA
A3MX62_PYRCJ/175-347..R.A-------------------------------GEPLIVT----DP-----KGD------YVT-----------AVK
A2BJY2_HYPBU/183-356..R.F-------------------------------NEPIIVF----EP-----EGD------PVS-----------KRA
B1Y9Z5_THENV/175-347..R.H-------------------------------GEPIVVT----DP-----KGD------YIT-----------HVK
A1S137_THEPD/177-355..R.L-------------------------------GKPLIIF----EP-----EGE------PVS-----------RVA
A4WLE1_PYRAR/175-347..R.A-------------------------------GEPLIVT----DP-----KGD------YVT-----------HAK
Q8ZTN2_PYRAE/175-347..R.E-------------------------------GEPIVVT----DP-----KGD------YIT-----------HVK
A1RRY5_PYRIL/175-347..R.V-------------------------------GEPLVVT----DP-----KGD------YIT-----------HVK
E0SSC1_IGNAA/177-354..H.M-------------------------------GEPIIVF----EP-----EGE------PIS-----------KLA
A8AC59_IGNH4/171-344..RGK-------------------------------KDLVVVF----EP-----EGK------SFE-----------EVM

PF02590

RLMH_STRPQ/1-158EGKQF-------------------------------PSETFSE----LISGVTVKGY-----------------------
RLMH_XANCP/1-154PGRPL-------------------------------SSEQLAQ----RMEHWRGQGR-----------------------
RLMH_THEMA/1-150RGEEV-------------------------------SSEEFAD----FLKDLEMKGK-----------------------
RLMH_CLOPE/1-158KGNEI-------------------------------TSEKFSK----YIENCGVMGN-----------------------
RLMH_MYCPU/1-144NAEQY-------------------------------SSEKFAL----FLQE.....D-----------------------
RLMH_UREPA/1-158ESNII-------------------------------SSETLAK----KIQQWLNTFS-----------------------
RLMH_CAUCR/2-153HGKAW-------------------------------KSRAFAD----HLARLRDDGN-----------------------
RLMH_CLOAB/1-158KGKMF-------------------------------SSEEFSA----FIDDLGVRGN-----------------------
RLMH_LACLA/1-158QGKLM-------------------------------SSEEVAD----FVKKAEVYGT-----------------------
RLMH_DEIRA/1-144RGKQF-------------------------------SSEKLSE----YLDAEALGGH-----------------------
RLMH_PSEAE/1-154EGRPW-------------------------------STEQLAR----ELDRWRLDAR-----------------------
RLMH_YERPE/1-154PGTPW-------------------------------ETPQLAQ----QLERWKQDGR-----------------------
RLMH_STRPN/1-158EGKTF-------------------------------FSEEFSK----QLEETSIKGF-----------------------
RLMH_HELPY/1-149KAQRG-------------------------------DSFAFSK----MLEN.....H-----------------------
Y5620_ARATH/39-192RGRDI-------------------------------DSEQMAE----LLGDAGNSGA-----------------------
RLMH_ACIAD/1-157GGREL-------------------------------STEKLAD----TMKSWMLEGH-----------------------
RLMH_NEIMA/1-154RGKAP-------------------------------TSVELAE----HLKSWRQNGE-----------------------
RLMH_DESTE/1-158KGMML-------------------------------SSKEFAG----YLAELGLRGQ-----------------------
RLMH_LISIN/1-158DGKMK-------------------------------SSEEFAA----DLDKLATYGK-----------------------
RLMH_AGRT5/1-158RGKAL-------------------------------DSPAFAS----LFGDLRDSGK-----------------------
RLMH_XYLFA/2-155KGKSL-------------------------------NSEQLAK----RMEHWRGLGR-----------------------
RLMH_FUSNN/1-154EGKEI-------------------------------NSENMSK----YIENLKNIGI-----------------------
RLMH_RALSO/1-154RGKDL-------------------------------TTAALAD----ALTGWQREG.-----------------------
RLMH_BACSU/1-158EGKMK-------------------------------TSEELAD----TIDKLATYGK-----------------------
RLMH_RHILO/1-158RGKSL-------------------------------SSQDLAN----RIGQLRDGGR-----------------------
RLMH1_THETN/1-132QGKTI-------------------------------SSEKFAL----KIKDLEMKSI-----------------------
RLMH_STAHO/1-158QGKML-------------------------------SSEGLAK----ELQQRMTQGQ-----------------------
RLMH_RHIME/1-158RGKAL-------------------------------DSEAFAR----LLGTLRDSGK-----------------------
RLMH_CAMJE/5-152KGKDL-------------------------------TSIEFAK----LIQD.....K-----------------------
RLMH_BACHD/1-158EGSMK-------------------------------SSEELAD----TMDRLATYGK-----------------------

PF01994

TRM56_METTH/55-175PGKVY-------------------------------SLADYNV----GVTNQPHSEV-----------------------
TRM56_HALSA/58-177PGDVY-------------------------------EAADWNV----GVTNQPHSEV-----------------------
TRM56_SULTO/47-168EGWYY-------------------------------YNSDYNI----AIGNQPHSEV-----------------------
TRM56_AERPE/62-182ERFYY-------------------------------EEADWNV----SVGTQPHSEV-----------------------
TRM56_HALMA/58-177PFEVY-------------------------------EHADWNV----GVTNQPHSEV-----------------------
TRM56_METHJ/53-171PGDLY-------------------------------QMADYNV----AVTNQPHSEI-----------------------
Q2EMT5_METVO/53-191PREAY-------------------------------ELADYNV----SVGNQPHSEV-----------------------
TRM56_METBU/55-174PTEIY-------------------------------DLADWNV----AIGNQPHSEV-----------------------
TRM56_HALWD/60-180PSDVY-------------------------------EWADWNI----AVTNQPHSEV-----------------------
TRM56_UNCMA/55-177PGDIY-------------------------------GLADYNV----AVGNQPHSEI-----------------------
TRM56_PYRAB/55-175PREVY-------------------------------ELADYNV----AIGNQPHSEV-----------------------
TRM56_METM5/54-177PREAY-------------------------------DLANYNL----SVGNQPHSEV-----------------------
TRM56_METST/54-174PTDVY-------------------------------EAADWNL----SVTNQPHSEV-----------------------
TRM56_THEAC/53-169PIEAY-------------------------------EIADYNV----SVTNQPISEV-----------------------
TRM56_METJA/54-175PKEVY-------------------------------ELADYNV----SVGNQPHSEV-----------------------
TRM56_METKA/59-178PAEVF-------------------------------ELSDYNV----AIGHQPHSEV-----------------------
TRM56_METAC/55-174PPEIY-------------------------------QLANWNV----AVGSQPHSEV-----------------------
TRM56_THEPD/59-180PRWLF-------------------------------EEADFNV----AIGNQPHSEV-----------------------
TRM56_NATPD/58-177PFDVY-------------------------------EQADYNV----GVTNQPHSEV-----------------------
TRM56_THEVO/53-169PFEAY-------------------------------EIADYNV----SVTNQPISEV-----------------------
TRM56_SULSO/37-159EGWYY-------------------------------HNADYNI----AIGNQPHSEV-----------------------
TRM56_PYRKO/57-179PREVY-------------------------------EMADYNV----AVGNQPHSEV-----------------------
TRM56_SULAC/4-130EGWYY-------------------------------YNSDYNI----GIGNQPHSEV-----------------------
TRM56_METTP/54-172PPDVY-------------------------------DIADWNV----AVGNQPHSEV-----------------------
TRM56_CENSY/54-172PRDVY-------------------------------ELADYNV----SIGGQPHSEI-----------------------
Q2QAM0_9EURY/57-176PGEIY-------------------------------KLANYNI----AVGHQPHSEV-----------------------
TRM56_ARCFU/54-168PPEVY-------------------------------ELCDLNI----SIGTQPHSEV-----------------------
Q2V9D2_9CREN/30-151PREVY-------------------------------SMTDYNV----AIGHQPHSEV-----------------------
TRM56_HYPBU/65-185PPFFY-------------------------------EYADYNV----AIGHQPHSEV-----------------------
TRM56_PICTO/53-168PIDAY-------------------------------LIADYNI----SVTNQPHSEV-----------------------
TRM56_METS5/50-170EGWYY-------------------------------HMADFNV----AISNQPHSEV-----------------------

PF09895

A4YJ17_METS5/38-141-----------------------------------------------........LT-----------------------
A4WL82_PYRAR/38-137-----------------------------------------------........AE-----------------------
A3MX89_PYRCJ/38-139-----------------------------------------------........VE-----------------------
Q980M7_SULSO/40-148-----------------------------------------------........KH-----------------------
A8A923_IGNH4/41-144-----------------------------------------------........AE-----------------------
Q4JAZ5_SULAC/39-144-----------------------------------------------........DK-----------------------
Q975T6_SULTO/38-143-----------------------------------------------........DK-----------------------
Q6M1A6_METMP/36-139-----------------------------------------------........IG-----------------------
Q8TUU2_METKA/37-134-----------------------------------------------........PS-----------------------
A2BLW0_HYPBU/2-112-----------------------------------------------........RK-----------------------
A1RRR7_PYRIL/38-139-----------------------------------------------........VD-----------------------
Y2001_AERPE/40-147-----------------------------------------------.......GLE-----------------------
A3DN09_STAMF/37-140-----------------------------------------------........KS-----------------------
A1RX98_THEPD/41-156-----------------------------------------------LEGKTSGGEA-----------------------
A8MCI7_CALMQ/39-143-----------------------------------------------........IN-----------------------
Q8TXR0_METKA/39-151-----------------------------------------------........QE-----------------------
Y1199_METJA/39-142-----------------------------------------------........VG-----------------------
Q8ZTS8_PYRAE/38-139-----------------------------------------------........VE-----------------------

PF02598

Q6C565_YARLI/46-384ILNKNVKSKISKQKRNVKKAEAKGIELQPPTVDGATPYINIGAAEPHELEYG..QTVPVGVRVTVDTKE...........
Q6BHG5_DEBHA/25-381ATPKVTKKNKKVSA...............LKKLSVTKYVNIGDAEPFVLDH....EVPVNVRVTVDLKN...........
CI114_HUMAN/74-365PTRPGHG.............................SFVNCGMKKEVKIDK....NLEPGLRVTVRLNQQQHP......D
O59417_PYRHO/2-253GKK.................................IFADIGLDRPALVKG.....IAEEGRGTFKIIS...........
Q8MSZ6_DROME/73-371KAKEGH..............................SYANVGLLNDVLVDK....AIEPGVRVTVKMEPQSE.......S
Q6NRR6_XENLA/72-362PTKSSKG.............................SFVNCGMRKEVQIDK....QLQAGVRVTVHLQQENV.......E
Q8ILD7_PLAF7/85-440SSNG................................IIVDVGLFSNVLIENV..NYINIGTRVTVLFQSNSYELFQKKNP
Q8ZT54_PYRAE/1-258DGYY................................SLIYIGGGKYAKVPK....PYPIGTRLLVRIEGTTS........
O28353_ARCFU/1-247APDGT...............................RWVDVGIDALAPMKS....DAEKGARVTVRICS...........
O26109_METTH/5-258VKKG................................TLVDIGADKLALCRE....KLTVNRIMSFRVVR...........
Q9UXA9_SULSF/26-261....................................YKGDFGLNKKLNSSS...........KTILITD...........
YMP6_CAEEL/67-369RSKDGRG.............................PICNIGLEKEFEIDSD.AVQLPPYTRVTVEIKNLTE.......Q
YM91_YEAST/19-314QKPTLARKKIGK...................VFKQTKYINIGKSKALALQS...QLVPINARVTIDTIT...........
Q7SI54_NEUCR/48-343QPKGGKG.............................TVVDIGLEDTVTIDE....ELPPKTRVTLKMPVG..........
Q8TZ04_METKA/1-250SRNG................................ALVDVGADRLARTRW....RFKPHERVTVRIVS...........
Q6FIJ5_CANGA/41-365SKPDPKSKKE......................FKQTKYINIGESDALELKS...QLVPINVRVTVDIID...........
Y1688_HALSA/2-280GSEGR...............................VRVNCGMQHPISLHEPPGMAVSEGERVTIRVSS...........
YG5X_YEAST/39-337ARDSSKGKSD......................DALTNLVYIGKNQIITLSN...QNIPNTARVTVDTER...........
Q7RF09_PLAYO/162-498NSNS................................IIVDVGLFSNVLVENI..YNINIGTRVTILFDSYAFNNFKNKNT
Q6CLH1_KLULA/48-407SKPGERGKSKK....................SFDQTKYINIGKDKNLELKG...QLVPINVRVTVDTIE...........
YGWG_SCHPO/17-306SPQAKNK.............................YIINAGLSHNVIVSSP..SVLAPRTRVTVRLKAQSPN......E
Q6NLH7_ARATH/99-388KAPNSEG.............................TLVDVGLSKSVVVDQ....VLGPGIRVTVAMGTDH.........
Q751R3_ASHGO/60-408AKPAAAKKPS.......................TRTKYINIGKDTMLELRS...QQVPVNVRVTVDTVN...........

PF04452

Q83AE1_COXBU/37-252QSGRC-------------------------------CIPELMQAQ.SLSDWL.SQKR------EGLS........LVCHP
Q7D102_AGRT5/16-233QCGIL-------------------------------SLPEVAEPV.KLKEML.ETWP------ED.R........RIIYC
Q6D078_ERWCT/19-238QSGRN-------------------------------CVPLVRPAM.TLEAWC.AEQD------NALK........LNLHP
Q73XZ7_MYCPA/18-242QSRRP-------------------------------HIPTVDGVL.STASLT.SRIR------DEVAAG...AVVLALHE
Q8DX86_STRA5/14-241QSKRN-------------------------------RLPQVRLFE.KKADFQ.AELA------GFDK.......IFIAYE
Q72R34_LEPIC/17-226QSKRI-------------------------------FLPEIVSPV.SLKEFL.ISQK------KQN.........LSIYR
Q9A2Z1_CAUCR/16-232QTGRL-------------------------------DVPEVADPE.KLDKIL.DAWD------PA.R........RLVFC
Q8K5R0_STRP3/14-241QSKRN-------------------------------VVPEVHLFE.QKAEFL.KNLS------SFDH.......IFIAYE
Q8G5Y7_BIFLO/28-259QSRRA-------------------------------FKPQLEACA.SSKEVV.AICR------RACVHG...DVVIVLHQ
Q6NAN3_RHOPA/23-243QCGIL-------------------------------SLAEVGEPI.GLDRFL.AGRA------NGER........LLVFC
Q8P6T0_XANCP/18-239QSGRA-------------------------------RIPSLAPPS.SLQDAA.RASD------AQAL.......RLTLDP
Q7VKS8_HAEDU/18-238QCERN-------------------------------QVPQIRPIM.KLTDWC.KEQD------EMLK........LNLHP
Q71ZK0_LISMF/17-245QSHRT-------------------------------IIPEVHYAA.SFKELM.FDHV------HYDF.......VIAAYE
Q8FVR3_BRUSU/16-233QCGVL-------------------------------SLPDCREAL.RFDRFL.DQWD------TS.R........RLIFC
Q7ND55_GLOVI/19-229QSERA-------------------------------VLPVVEPPA.LFGMFL.RHPA------RGTR........LICTA
Q6FA41_ACIAD/16-235QCGMN-------------------------------RVPEILPPV.SLNEWI.NTAT------LPNT.......KLVLAP
Q9CCN1_MYCLE/18-246QSRRA-------------------------------HIPSVDGVL.TTAALL.QRIR------DEVAAG...ATVLALHE
Q8XVR6_RALSO/18-244QCGRA-------------------------------RVPAVSPVA.PLRDWLAAAKA------SARA.......RVMLSP
Q83GJ2_TROWT/19-230QSRRA-------------------------------WFPVVKADI.PSERLV.EEIG------DSLA........IILDP
Q8EPW6_OCEIH/16-246QSHRN-------------------------------RIPSLHSVM.NLKQIL.DEAS------AYTV.......KLFAYE
Q6NG15_CORDI/26-247QSRRT-------------------------------RIPEIAEPM.TTAQIA.EQLE------QFDV.......VLVLHE
Q6KI62_MYCMO/14-223QSFRN-------------------------------KVPILEKPL.DFSQVL.DLNY------EYK.........YIAYE
Q6E297_ARATH/69-288QCQRL-------------------------------HQMVLNPPI.KFGTLL.DHIL------KSKL.......CLVATA
Q89ZP8_BACTN/13-229QSLKA-------------------------------RLPKLNEMT.DFDKFI.AQEF------QGQK........FIAHC
Q9ZIA2_CLOAT/16-241QSKRS-------------------------------VIPKVKDIA.SFNSAI.EELK------EMDL.......VLVPYE
Q7U7K3_SYNPX/18-237RARDT-------------------------------VAPVVHQHR.LFRPFV.EDQL------S...........TICAG
Q9RDD9_STRCO/21-243QSRRV-------------------------------RFPDVADAA.SSKQVA.SLLA------AADF.......AAVLHE
Q6G8Z0_STAAS/16-244QSYRL-------------------------------VIPSIQFES.NLKLIC.DTID------NYDY.......ILIAYE
Q7PAV9_RICSI/18-235QSERL-------------------------------TPPIIEKAI.TIQDYL.KKNN------N...........LMLYA
Q8KAZ3_CHLTE/18-236QSRRY-------------------------------HLPELMSPL.TFREAL.VLDG------YDLR........LIAHE
RSME2_BORBU/16-236QSGNK-------------------------------IVPKINFYN.NFFYLP.YSFC------TTRY........YVAHP
Q82BY2_STRAW/19-243QSRRV-------------------------------RFPEVAGAM.TSKQVA.ALLA------TADL.......AAVLHE
Q6MAP1_PARUW/18-233QCGRL-------------------------------TLPKILFKP.ALNQWD.SIFS------QA..........FFGDL
Q6G0I7_BARQU/22-239QCGIL-------------------------------SLPECVPAV.SLVELL.ACWD------ET.Q........PLFFC
Q87EY9_XYLFT/18-239QCGRT-------------------------------RVPEVQMPR.ALQVLP.EILD------PDTL.......RLILDP
RSME_BACSU/19-247QSYRN-------------------------------EVPRVMDVH.SFQQLL.QRMQ------DFDK.......CVVAYE
RSME_SHIFL/18-237QCGRN-------------------------------RVPEIRPAM.DLEAWC.AEQD------EGLK........LNLHP
Q833H7_ENTFA/16-244QSHRQ-------------------------------QTPSVSLVE.KTQEII.AQFD------SYDT.......VLVAYE
Q6HDL0_BACHK/16-243QSHRS-------------------------------EIPEVHAPA.SFKQLL.SMSG------EYDV.......CLVAYE
Q89DB6_BRAJA/24-242QCGIL-------------------------------SIATVAEPV.PLERFL.SQRA------AG.R........LLIFC
Q9PQJ0_UREPA/14-231QARRN-------------------------------HLVNYYAQF.SFNELL.KYLR------DYDL.......ILIAYE
Q8XIT7_CLOPE/16-241QSKRT-------------------------------VIPEVLEPM.DFKGVL.EKID------ELDL.......MVIPYE
Q9CJ96_LACLA/18-245QSRRQ-------------------------------MIPELQLFE.QFTDLL.DKFS------DFDQ.......VLIAYE
Q7MT38_PORGI/15-239QSLKA-------------------------------SFPVIQVNI.PIQTVI.ADTP------KTAV.......RLIAYV
Q9RH08_ZYMMB/27-242QCGRT-------------------------------SLSEVTEAC.SLISLL.AEWP------ED.R........ALFFA
RSME_SYNY3/80-299QSERQ-------------------------------WLPPVAAPL.TFGQFV.EKVA------GPETL......ALLCVT
Q8RB65_THETN/16-239QSGRN-------------------------------IIPEISAPV.SFKEAI.EKAM------ECDL.......AIIPYE
Q9RU73_DEIRA/24-239QSERR-------------------------------IVPDVLEPV.PLTKLTWEGQL------............LTAHP
Q7VHH3_HELHP/14-232QCGRS-------------------------------DLMELELYK.NFHRIC.EEYT------DF..........YAFDF
Q72R98_LEPIC/18-253QGKNI-------------------------------FLPKVCF...DFQNQI.ENIL------IKKLKELDFTFRFILDR
Q74G06_GEOSL/16-240QAGCP-------------------------------AVPRVQLAR.GLTEAV.RGTD------HDLK........LLLWE
Q7P2R8_FUSNV/14-232QC.QG-------------------------------VVPTAIDEI.KKIDKL.DLKD------YDLI........LVPYE
RSME_MYCBO/18-242QSRRA-------------------------------RIPPVDGVL.STPMLV.QRVR------EEVAAG...AAVLVLHE
Q6F738_ACIAD/16-235QAGDT-------------------------------IVPDIQLYK.RFKPFV.EDVL------PS..........LIAPL
Q8DS03_STRMU/14-241QSKRN-------------------------------IIPQVKFFE.KKSDFL.TQLA------VFNK.......IFVAYE
Q8YX66_NOSS1/19-231QSERA-------------------------------FVPTILEPL.TFSDAV.NNIT------AVHR........YICEA
RSME_AQUAE/13-228QSRRP-------------------------------IPMEIKKPV.RLSDLI.PESE------EN..........IILDN
Q9F9G9_9GAMM/17-236QCGLN-------------------------------RVPVVHGVL.SLRDWL.TSDL------PALK........LIAHP
Q892R3_CLOTE/16-241QCKRT-------------------------------LIPKVNNPV.EFKDLL.EELK------IMDL.......IVVPYE
Q6MI96_BDEBA/16-247QSGRG-------------------------------DLMKVHPAI.PFEKIS.DLIN------RNGSG.....VGLFAYE
Q987U8_RHILO/16-233QCGIL-------------------------------AVPEVREAE.KFERLL.AGWD------KE.R........RLVFC
Q7VZC1_BORPE/18-240QCGRN-------------------------------RLMAVDAPQ.ALAAWL.AQAP------GAAL.......RLLCHP
Q7RMG7_PLAYO/19-251QAMCT-------------------------------SFPKVYVHY.TFSSFF.MNIQ------N...........YCDEN
Q8FNF6_COREF/18-236QSRRA-------------------------------TIPEVVGVV.DTAGVD.KLIE------EADL.......AIILHE
Q8DNP5_STRR6/18-245QSKRN-------------------------------IVPSIKLFE.KKADFL.AQLD------QFDS.......IIVAYE
Q8CSC8_STAES/19-247QSYRL-------------------------------TIPNIKFKS.NLKEIY.GMIS------QYDY.......VLIAYE
Q73J56_TREDE/35-272QAGQT-------------------------------MLPAFSFCN.SVKEAL.KDLK------AASFKG....SKVLLDI
Q7V223_PROMP/22-248QCERL-------------------------------WRPSILSGI.NLFDWI.NSLE------NKDI........ISVSV
Q7U730_SYNPX/24-238QCERL-------------------------------WLPTLKPAC.KLAQWP.NSSD------P...........VAVGV
Q92RS8_RHIME/22-239QCGVL-------------------------------GIPAVEEPR.KLEDLL.IDWP------RD.R........RIVFC
Q82WB5_NITEU/17-247QCGRN-------------------------------QIPLLLPLM.PLSHWLEQKLA------EKYKNDNPAGHDIMLSP
Q87LK2_VIBPA/18-237QCGRN-------------------------------VVPEIRPIM.SLEQWC.QEEY------DGLK........LNLHP
RSME_BUCAP/20-240QCHRN-------------------------------NIPEIKNPE.YILPWC.KRTY------ENET.......KIVFSP
RSME_MYCH2/14-226QSFRN-------------------------------LIPKINLPI.NYKDLL.EQAK------NFPV.......KLISFE
Q6AEC1_LEIXX/18-236QSLRP-------------------------------WTPEVGELS.TTRQIA.ALAV------THRV........LVLEP
Q7V7G0_PROMM/24-244QSEQL-------------------------------WQPELLPIA.EASALW.KSPP------DHAV........FALAT
Q6AMJ0_DESPS/17-250QAVAT-------------------------------RLPEVSIYP.KFKGFM.DELL------VK..........DLDDY
RSME_HELPY/14-226QCGRS-------------------------------ALMELEVFS.NTKEAL.KAYP------KA..........SVLDF
Q7P147_CHRVO/16-235QSGRN-------------------------------TVPQVLPIL.TLNEWL.AQRQ------EADI.......RLILSP
Q72BF1_DESVH/15-234QSANP-------------------------------WLPALQTLPGGIEELL.RASS------DFER.......RFMLWE
RSME_HAEIN/18-238QCGRN-------------------------------IVPEIRPLM.KLQDWC.AEND------GALK........LNLHP
Q8EWP2_MYCPE/13-228QCNRI-------------------------------AKLEIDEPI.TFNDMV.NKLN------DFNC.......NFIAYE
RSME1_BORBU/15-233QGKIT-------------------------------YLPKIKIIK.NLKESL.K...------............YIQQE
Q8EIK7_SHEON/18-237QSGRS-------------------------------QVPVVRPAM.ELQQWC.SEPT------SALK........LNLHP
RSME_BUCAI/27-247QCNRN-------------------------------IIPKIKIPM.NVFHWC.ENNQ------NNDK.......KIIFHP
Q8NNB5_CORGL/18-236QSRRA-------------------------------TIPEILGVV.GEEGVE.KLID------ESDL.......AIILHE
Q7VBR8_PROMA/24-246QSEQL-------------------------------WKPKLKEII.CFNEWI.DIYR------KSTL........MALGT
Q73FW1_WOLPM/18-226QSGRI-------------------------------SIPEILPPI.NFCELP.DSQS------KN..........FVLCD
Q73LI5_TREDE/15-246QSGSV-------------------------------VNTKILPAQ.ELKAAL.DSVL------DYTANR...KTAFIMLS
Q98Q27_MYCPU/14-222QSFRN-------------------------------KVMEITYPK.SFNEVI.EMEV------KNK.........YIAHE
RSME_TREPA/18-242QAGGT-------------------------------KLPLITVSE.SVRTFC.SQHT------H...........ILGDS
Q6A996_PROAC/19-238QSRRF-------------------------------LVPQV.ELA.QTREVV.KRIC------NAQA.......AYVLHE
Q9X1A0_THEMA/14-217QCKRY-------------------------------LFPKV.....SFLEKL.EFSG------NV..........ITLDL
Q9KD69_BACHD/16-244QSYRE-------------------------------RIPSIETPL.AFSKLL.QEIS------GFTK.......TIVAYE
Q6F1G3_MESFL/14-235QAKRT-------------------------------TIPVVNNLITNLKDLK.NNLC------DL.N........LVAWE
Q8DI45_THEEB/47-258QSERL-------------------------------YVPALSDPL.SVAEMV.SLTP------KG..........YIASL

PF04013

TRMYL_VIBCH/1-199EQTRV-------------------------------VQPGLTVRTISFEALLGELAE------H.HS-------LYMMDK
TRMY_PYRAB/1-203EEI.K-------------------------------VLPGIYVSNMSFEDVIRVVIK------R.FP-------LYILEE
TRMY_PYRHO/1-202KEL.E-------------------------------VLPGVYVSNMTFEDVIRKNIR------..MN-------LYVLEE
TRMY_METJA/1-202KDWNQ-------------------------------STPGIYVRRLGFRNLVLEKLE------EGKN-------IYYLHM
TRMY_AERPE/1-186.....-------------------------------.RSCFTVNDEGVEALASLLRR------.FKP-------RILLAE
TRMY_ARCFU/95-288KSWKK-------------------------------VHSGVYVSRKGLEELIEELSE------K.YS-------IIYLKE
TRMY_HALSA/1-193HQEAS-------------------------------SSPGIHVSKRGFEAVLDAVSG------...P-------VVALHE

PF04252

Q9YC91_AERPE/71-273DHPPK-------------------------------GRTYLLSSQVYTACAK-RNLG------PEQ---------LSVDG
Q9V144_PYRAB/2-195DAIPR-------------------------------GRTKKFITSKMEGVKV-RHIG------SVQ---------YSIDG
YO021_YEAST/1-212DHPPR-------------------------------DRTKELKTAYPNLLIS-RRLG------DKQ---------MTTDT

PF01746

RG9D3_MOUSE/135-308ESIQK-------------------------------KV....TFQKAREYSV-K..T------A.R---------LPIQE
RG9D2_HUMAN/110-276HNHHK-------------------------------GL....TYKQASDYGI-N..H------A.Q---------LPLGN
Q9BI62_CAEEL/175-352RVPEP-------------------------------GIPKHASLEASQSAGV-F..A------R.K---------LPIDR
Q9UZ22_PYRAB/108-288MKGDK-------------------------------KGTTAKIGEVLEREGI-DVLR------R.K---------IVLRG
Q9FGI9_ARATH/127-293RNRFK-------------------------------GI....TMTKAQEQGI-K..T------A.K---------LPIGE
RG9D2_DROME/104-271HNHFK-------------------------------GL....CHSRATSAGL-T..T------A.R---------LPLSE
TRMD_STRLI/21-232AGGEA-------------------------------AVLVVTEAVARLLPGV-LGNA------E.S---------HRDDS
TRMD_SHIFL/22-221SGGEL-------------------------------PAMTLIDSVSRFIPGV-LGHE------A.S---------ATEDS
TRMD_MYCLE/21-224PGGES-------------------------------AAVVMIEAVLRLVAGV-LGNP------A.S---------HRDDS
Q19789_CAEEL/96-260HNSQK-------------------------------GL....CYRIAQEKGF-G..H------A.K---------LPLDE
TRMD_HELPY/22-221TGGEL-------------------------------GALCLIDSIARHIQGV-LGNA------Q.S---------LENES
TRMD_MYCGE/22-216SGGEL-------------------------------VALSVIDATVRLIKGV-I.ND------Q.S---------LICES
TRMD_BORBU/22-219SSGEI-------------------------------AALVLIDSVYRLLDGV-I.NP------N.S---------LLEES
TRMD_MYCPN/22-216SGGEL-------------------------------VALSVIDATVRLIKGV-I.ND------Q.S---------LIHES
Q97Z49_SULSO/105-260KGRRL-------------------------------KN...ATYELSRRYGY-DELP------QVK---------ISLRN
TRMD_SYNY3/22-218TCGEI-------------------------------PALTLINGVIRLLPGT-VGKE------A.S---------LIAES
Q9YET3_AERPE/129-296RIPRP-------------------------------GVSRILDNLVPW..GV-...P------R.R---------IELRG
MRRP1_MOUSE/207-375KNTQT-------------------------------GT....SLAKAKRLNI-A..T------E.C---------LPLDK
TRM10_YEAST/104-276KNRYK-------------------------------EL....CLKKAQKMGI-P..T------R.R---------LPIDE
O58442_PYRHO/158-338MKGDK-------------------------------KGTTAKIGEVLKKEGI-EVLR------R.K---------IVLRG
TRMD_AQUAE/27-222SGGEI-------------------------------VALAVIDAVSRVLPGV-LSEP------Q.S---------IQEDS
TRMD_BACSU/22-221TGGEL-------------------------------PAMMIADSVVRLLPGV-LGKE------A.S---------HIEDS
TRM10_SCHPO/104-273KNRYK-------------------------------NL....CQNKASEQGI-K..T------A.K---------LPIDE

PF09936

B5EBC8_GEOBB/4-189---DLKTLIDQDPQQP----------------------------------------------------------------
Q3A2E8_PELCD/2-183---ACRALL...DKIP----------------------------------------------------------------
A1AMZ9_PELPD/5-189---SLRQRL.DEQQNP----------------------------------------------------------------
A5G7Z4_GEOUR/8-192---QLGELF.RDAAQP----------------------------------------------------------------
Y054_AQUAE/17-201---WLRNEI.QKRDRD----------------------------------------------------------------
A7HKS2_FERNB/2-186---EGKKII.LNDERP----------------------------------------------------------------
A0LMM3_SYNFM/1-185---EARRLL.VEDAKP----------------------------------------------------------------
TRMD_DESDG/242-423---SVRRML...REKP----------------------------------------------------------------
Q2LVU3_SYNAS/10-194---SLKSMI.EQNEVA----------------------------------------------------------------
Q1MRV0_LAWIP/191-372---DVKEML...LQQP----------------------------------------------------------------
Q0AWV8_SYNWW/3-187---QLKNMV.FNEEKS----------------------------------------------------------------
A8ZV19_DESOH/6-188---YLKDRL...NASP----------------------------------------------------------------
Q24UB0_DESHY/1-185---AVRDKI.ENGEEP----------------------------------------------------------------
A6LNY5_THEM4/2-186---EGRKII.LETSRP----------------------------------------------------------------
A1HN71_9FIRM/2-187---ELRRRI.HEGGRP----------------------------------------------------------------
A8F3G0_THELT/2-186---QAREFI.KKTDRP----------------------------------------------------------------
Q0F054_9PROT/1-176---ALPKM.....DGK----------------------------------------------------------------
Q3AC73_CARHZ/1-185---FLRKKI.KDDENP----------------------------------------------------------------
Q7P719_FUSNV/2-186---DLSKQI.FENDKP----------------------------------------------------------------
B3E5S7_GEOLS/2-186---ALRRKL.QDKDQQ----------------------------------------------------------------
Q6AJE7_DESPS/14-197---KVREKL..GLNEP----------------------------------------------------------------
A5IM13_THEP1/2-186---EGRRII.IETEKP----------------------------------------------------------------
A1VFE5_DESVV/242-423---SVRAML...EERP----------------------------------------------------------------
A9BF02_PETMO/2-186---ELKNQI.KDSDHP----------------------------------------------------------------
Q39RN9_GEOMG/8-192---DLQHLI.TERDQP----------------------------------------------------------------
Q1NQ21_9DELT/248-432---QLRQRL..AAGQP----------------------------------------------------------------
Q6ML98_BDEBA/8-193---ELRNEM.HVAKKP----------------------------------------------------------------
Q74FG2_GEOSL/8-193---QMASIMAHDREHP----------------------------------------------------------------

PF00588

Q8CXU2_LEPIN/126-265...DLK...-....GK----------------------------------------------------------------
Q7NBG1_MYCGA/4-151...DFKEYL-.DHDQR----------------------------------------------------------------
Q6BHP1_DEBHA/1290-1434...KFP...-....QK----------------------------------------------------------------
Q8I3K9_PLAF7/198-344KKNKIKNN.-..NING----------------------------------------------------------------
Y324_MYCLE/160-301...DGT...-....DP----------------------------------------------------------------
Q22484_CAEEL/1071-1214...VFP...-....KK----------------------------------------------------------------
O74022_9EURY/1-150MPWELVGLI-KDYPGE----------------------------------------------------------------
Q7TU01_RHOBA/25-165...EFA...-....LG----------------------------------------------------------------
MRM1_SCHPO/147-297.TE.LM...-...NEP----------------------------------------------------------------
Q6ME25_PARUW/89-224...IFP...-....EH----------------------------------------------------------------
Q8R6H6_FUSNN/88-229...DYS...-....NK----------------------------------------------------------------
Q729V9_DESVH/1-141...TYA...-....PD----------------------------------------------------------------
Q74D44_GEOSL/15-165...VSKFAA-NLAGNR----------------------------------------------------------------
Y516_BORBU/78-219...KIN...-...DKK----------------------------------------------------------------
Q898S5_CLOTE/9-150...EFE...-....EG----------------------------------------------------------------
Q6FZ54_BARQU/2-143...YYR...-....EN----------------------------------------------------------------
Q7UG85_RHOBA/132-272...DLR...-....GK----------------------------------------------------------------
Q6YR72_ONYPE/92-232.........-....PK----------------------------------------------------------------
Y881_MYCTU/130-275...LPEAIA-AVSHER----------------------------------------------------------------
Q6XK16_SPICI/109-253CHCQFKQ..-...NER----------------------------------------------------------------
Q6MS22_MYCMS/92-234...DFA...-....NK----------------------------------------------------------------
Q8A814_BACTN/97-238...DYT...-....GP----------------------------------------------------------------
Q7UFJ5_RHOBA/144-289...LIDLSN-AIQSKR----------------------------------------------------------------
TRMH_SHIFL/19-159...DYT...-....RP----------------------------------------------------------------
Q73T60_MYCPA/69-206...TLP...-....RE----------------------------------------------------------------
Q9RWT9_DEIRA/12-159RGLVRE...-...AAA----------------------------------------------------------------
Q9RXS5_DEIRA/10-149TRAGFK...-....RG----------------------------------------------------------------
Q9UXD5_SULSF/1-149..RPWEILP-LIQGKK----------------------------------------------------------------
Q74D57_GEOSL/96-237...DLT...-....GN----------------------------------------------------------------
Y380_HAEIN/4-151EPRECAEKV-VAYKGK----------------------------------------------------------------
Q7VBF1_PROMA/9-160NALQWLLET-.NPKDP----------------------------------------------------------------
Q8IJ98_PLAF7/52-193....EH...-....KD----------------------------------------------------------------
Q9PQM3_UREPA/1-151...QYQNII-.QHN..----------------------------------------------------------------
O67731_AQUAE/93-233...DIP...-....LP----------------------------------------------------------------
Q6F981_ACIAD/122-259...DLT...-....KP----------------------------------------------------------------
Q7M8R3_WOLSU/2-143...SLP...-....PS----------------------------------------------------------------
Q73GK0_WOLPM/102-244...SFE...-....KK----------------------------------------------------------------
Q8PVX0_METMA/11-163TVKEVREKL-KGCSGT----------------------------------------------------------------
Q8FF07_ECOL6/222-362...SLP...-....AK----------------------------------------------------------------
Q7V131_PROMP/7-159DISKWISSF-.VEINN----------------------------------------------------------------
Q7WLL7_BORBR/7-163.GLARRHLD-DTEAGV----------------------------------------------------------------
Q8TXY9_METKA/2-150VREAFSD..-...YEK----------------------------------------------------------------
Y052_BORBU/34-174...TIN...-....NK----------------------------------------------------------------
Q9AAX1_CAUCR/6-147...SFE...-....PG----------------------------------------------------------------
Q9CC19_MYCLE/108-251...AKPL..-..LGKP----------------------------------------------------------------
TSNR_STRAJ/116-258ELGDNP...-....DR----------------------------------------------------------------
Q8XDF6_ECO57/1-142..VNYQ...-....DG----------------------------------------------------------------
Q9A8W1_CAUCR/124-265...VLD...-...SQP----------------------------------------------------------------
Q72QT0_LEPIC/71-212...PDL...-....NE----------------------------------------------------------------
Q7P7P4_FUSNV/111-252...KLK...-....EK----------------------------------------------------------------
Q6NHA0_CORDI/3-144...EYK...-....DG----------------------------------------------------------------
Q8G5E6_BIFLO/133-283...AVE...-....AP----------------------------------------------------------------
Q8FA35_ECOL6/9-160EKSSWM...-....SH----------------------------------------------------------------
Q8YNM2_NOSS1/5-155IALPWLLE.-.ETGQP----------------------------------------------------------------
Q8KC03_CHLTE/108-249...DWK...-....RP----------------------------------------------------------------
Q7NRY2_CHRVO/3-154.PELIARA.-.RDGEQ----------------------------------------------------------------
Q8GYL4_ARATH/196-346...SVEFAQ-SLAEKP----------------------------------------------------------------
Q720L1_LISMF/107-248...TKR...-....DT----------------------------------------------------------------
Y1673_SYNY3/120-261...DFQ...-....RP----------------------------------------------------------------
Q98R32_MYCPU/82-224...SFN...-....NP----------------------------------------------------------------
Q6KIH0_MYCMO/89-225.....P...-....KW----------------------------------------------------------------
TARB1_HUMAN/1463-1606...CFP...-....EK----------------------------------------------------------------
Q824D7_CHLCV/116-256...NYN...-....QP----------------------------------------------------------------
Q9CHW1_LACLA/110-250...INE...-....PH----------------------------------------------------------------
Q82FA2_STRAW/107-239...KLP...-....DD----------------------------------------------------------------
Q6MIZ9_BDEBA/141-282...ELP...-....DK----------------------------------------------------------------
O27877_METTH/10-161LRPSQLADA-IRPSSG----------------------------------------------------------------
Q8Z0C3_NOSS1/123-264...DWR...-....KP----------------------------------------------------------------
Q8ECQ8_SHEON/21-159...VHP...-....ER----------------------------------------------------------------
Q7MSH0_WOLSU/110-249...SFA...-....SK----------------------------------------------------------------
RLMB_SALTI/95-236...KMP...-....GR----------------------------------------------------------------
Q9PR20_UREPA/90-231...DYA...-....NK----------------------------------------------------------------
Q72GY4_THET2/109-248...DYR...-....GG----------------------------------------------------------------
Q6MNP1_BDEBA/47-187...DFS...-....GK----------------------------------------------------------------
Q9LXE4_ARATH/154-296...DWS...-....CP----------------------------------------------------------------
Q73J63_TREDE/100-245RLIEKD...-....EA----------------------------------------------------------------
Q6SFH7_9BACT/10-160...ASKLKS-ESHSKK----------------------------------------------------------------
Q6MTA0_MYCMS/106-249...KFDS..-...DDK----------------------------------------------------------------
Q8YIL5_BRUME/130-270...TIC...-....ER----------------------------------------------------------------
O83093_TREPA/117-262...LSP...-...EEA----------------------------------------------------------------
Q9PQG4_UREPA/113-253...TIK...-....QK----------------------------------------------------------------
Q820Y2_TROWT/113-259VFLKKED..-...KRA----------------------------------------------------------------
Q6YQX1_ONYPE/907-1048...PKN...-....SS----------------------------------------------------------------
Q8PJZ3_XANAC/6-157AQRALAKA.-.GEPAE----------------------------------------------------------------
YACO_BACSU/97-238...DGN...-....MP----------------------------------------------------------------
TRML_SYNY3/1-143...TYQ...-....ST----------------------------------------------------------------
Q6MMA4_BDEBA/107-249...FES...-....EP----------------------------------------------------------------
Q729J5_DESVH/23-164...DLT...-....RP----------------------------------------------------------------
Q6UCQ6_9PROT/107-248...TFP...-....KK----------------------------------------------------------------
Q9F5K6_STRVR/126-272...DFT...-....QP----------------------------------------------------------------
Q8A2Z0_BACTN/24-168...ELDK..-...TKK----------------------------------------------------------------
Q97B79_THEVO/10-160..ETFWKQM-ESQTGK----------------------------------------------------------------
Q8R700_THETN/26-168...NYT...-....KP----------------------------------------------------------------
Y2399_ARCFU/77-217...SLL...-....LP----------------------------------------------------------------
Q92JA7_RICCN/2-149LPLDYPN..-...SEK----------------------------------------------------------------
Q98QQ8_MYCPU/1-149...DFKLET-FDGKKD----------------------------------------------------------------
Q72G19_DESVH/97-239...TLR...-....TP----------------------------------------------------------------
Q6MA83_PARUW/115-255...DLT...-....SP----------------------------------------------------------------
Q87R44_VIBPA/101-237...DFS...-....AE----------------------------------------------------------------
Q8XZH6_RALSO/113-250...PLN...-....KP----------------------------------------------------------------
Q73RN5_TREDE/119-253...EFP...-....KK----------------------------------------------------------------
Q727W7_DESVH/4-156KAGPEMAAS-LADGER----------------------------------------------------------------
Q7U8A3_SYNPX/2-151TAINWLLA.-..GDPP----------------------------------------------------------------
Q8XJ72_CLOPE/109-249...NLQ...-....GK----------------------------------------------------------------
Q8R9C5_THETN/105-242...EID...-....KG----------------------------------------------------------------
Q7TU91_PROMP/282-424...KEK...-....AP----------------------------------------------------------------
Q6FAL4_ACIAD/3-155AAELSMDAV-ITRQQE----------------------------------------------------------------
Q98QQ7_MYCPU/101-239...SFD...-....KK----------------------------------------------------------------
Q89I93_BRAJA/15-167..AAEISGH-VATGGK----------------------------------------------------------------
Q8GYT1_ARATH/5-144...PFK...-....RN----------------------------------------------------------------
Q8D323_WIGBR/95-236...KLK...-....QS----------------------------------------------------------------
Q72H04_THET2/88-229...DYA...-....RP----------------------------------------------------------------
TRML_GEOSE/2-145...DFSD..-..PSKE----------------------------------------------------------------
Y252_MYCGE/95-238...DFA...-.....K----------------------------------------------------------------
Q72JF4_THET2/3-156PAWEVADRV-AAFPGE----------------------------------------------------------------
Q8KD02_CHLTE/16-159TAGDFP...-......----------------------------------------------------------------
Q7NWF9_CHRVO/117-255...DLT...-....GP----------------------------------------------------------------
Q72N93_LEPIC/2-144...SYR...-....KG----------------------------------------------------------------
Q6MHK3_BDEBA/6-165DKAPQFQVE-SDVPYV----------------------------------------------------------------
Q828C9_STRAW/145-290...DDELDK-GTMGGP----------------------------------------------------------------
Q7NIP3_GLOVI/2-151EGARWLRA.-..DKGT----------------------------------------------------------------
Q98NQ0_RHILO/12-164..GRVLRAR-HGMGQR----------------------------------------------------------------
Q6MEY4_PARUW/104-242...VSK...-....KR----------------------------------------------------------------
Q7BKE9_PRB01/91-232...NFT...-....EA----------------------------------------------------------------
Y1476_METJA/4-155...ELADKI-LEVKGN----------------------------------------------------------------
Q8K8I3_STRP3/17-159.........-....DS----------------------------------------------------------------
Q9X263_THEMA/90-230...DFT...-....FP----------------------------------------------------------------
Q73MR5_TREDE/110-250...TFP...-....KK----------------------------------------------------------------
Q8EPH3_OCEIH/102-242...SVH...-....NK----------------------------------------------------------------
Q8PHE1_XANAC/153-294...ALP...-....QR----------------------------------------------------------------
Q6F190_MESFL/4-147...DFNS..-..YQKP----------------------------------------------------------------
Q6MMJ6_BDEBA/113-244...KWP...-....KN----------------------------------------------------------------
TRML_MYCGE/5-150MTNKLP...-....NE----------------------------------------------------------------
Q6MR30_BDEBA/7-149...QYQ...-....SG----------------------------------------------------------------
Q6AF11_LEIXX/119-263...AVAP..-...PER----------------------------------------------------------------
Q6GHU8_STAAR/105-242...TSS...-....DS----------------------------------------------------------------
Q89IY5_BRAJA/156-297...ALR...-....EP----------------------------------------------------------------
Q7TUD5_PROMP/21-161...DYS...-....EN----------------------------------------------------------------
Q6AJ92_DESPS/144-286...DLN...-....VP----------------------------------------------------------------

PF14419

O28057_ARCFU/168-343EELVRRI.....RFAD----------------------------------------------------------------
D3S2R7_FERPA/167-342EELKKAF.....RRAD----------------------------------------------------------------
D2RFH8_ARCPA/167-342DDLKRDL.....KYAD----------------------------------------------------------------
F2KQY0_ARCVS/173-346DELGRKM.....FYAD----------------------------------------------------------------
Q9V2I9_PYRAB/172-346EKLAKDM.....YYAK----------------------------------------------------------------
O57783_PYRHO/172-346DKLARDM.....YYAK----------------------------------------------------------------
Q8TZR0_PYRFU/172-346DKLAKDM.....YYAK----------------------------------------------------------------
F0LM29_THEBM/169-343DELAKDM.....YYAK----------------------------------------------------------------
Q5JGM1_PYRKO/169-344EKLAKDM.....HYAK----------------------------------------------------------------
B6YU66_THEON/169-344DKLARDM.....YYAK----------------------------------------------------------------
C5A405_THEGJ/173-348DKLAKDL.....HYAK----------------------------------------------------------------
E3GWV1_METFV/168-342NKLKKDL.....KFSK----------------------------------------------------------------
C9RGK2_METVM/168-343DNLQKDL.....RKKK----------------------------------------------------------------
C7P975_METFA/169-344DKLSYDL.....RKKR----------------------------------------------------------------
D3S697_METSF/168-343DKLAYDL.....RKKR----------------------------------------------------------------
D5VTY7_METIM/171-346DKLAKDM.....RGKR----------------------------------------------------------------
Y421_METJA/168-343DKLAYDL.....RKKR----------------------------------------------------------------
Q8TVD0_METKA/167-340KTLGEAL.....READ----------------------------------------------------------------
Q9YCV6_AERPE/169-342DRLWEMF.....RGSR----------------------------------------------------------------
A3MX62_PYRCJ/175-347ERLAQLF.....ARE.----------------------------------------------------------------
A2BJY2_HYPBU/183-356KDLYELL.....RSGR----------------------------------------------------------------
B1Y9Z5_THENV/175-347DKLADLF.....RED.----------------------------------------------------------------
A1S137_THEPD/177-355GEVADFIIRKVFKEKE----------------------------------------------------------------
A4WLE1_PYRAR/175-347ERLAELF.....KSG.----------------------------------------------------------------
Q8ZTN2_PYRAE/175-347ERLAELF.....ARD.----------------------------------------------------------------
A1RRY5_PYRIL/175-347DKLAELF.....KAE.----------------------------------------------------------------
E0SSC1_IGNAA/177-354NEVSEFIVKSV.KAGK----------------------------------------------------------------
A8AC59_IGNH4/171-344EDLGRAL.....RKAR----------------------------------------------------------------

PF02590

RLMH_STRPQ/1-158--------------ST----------------------------------------------------------------
RLMH_XANCP/1-154--------------.D----------------------------------------------------------------
RLMH_THEMA/1-150--------------.D----------------------------------------------------------------
RLMH_CLOPE/1-158--------------SN----------------------------------------------------------------
RLMH_MYCPU/1-144--------------.N----------------------------------------------------------------
RLMH_UREPA/1-158--------------HD----------------------------------------------------------------
RLMH_CAUCR/2-153--------------RR----------------------------------------------------------------
RLMH_CLOAB/1-158--------------SS----------------------------------------------------------------
RLMH_LACLA/1-158--------------GN----------------------------------------------------------------
RLMH_DEIRA/1-144--------------GE----------------------------------------------------------------
RLMH_PSEAE/1-154--------------.T----------------------------------------------------------------
RLMH_YERPE/1-154--------------.D----------------------------------------------------------------
RLMH_STRPN/1-158--------------ST----------------------------------------------------------------
RLMH_HELPY/1-149--------------LN----------------------------------------------------------------
Y5620_ARATH/39-192--------------SR----------------------------------------------------------------
RLMH_ACIAD/1-157--------------.D----------------------------------------------------------------
RLMH_NEIMA/1-154--------------.H----------------------------------------------------------------
RLMH_DESTE/1-158--------------NK----------------------------------------------------------------
RLMH_LISIN/1-158--------------SK----------------------------------------------------------------
RLMH_AGRT5/1-158--------------RD----------------------------------------------------------------
RLMH_XYLFA/2-155--------------.N----------------------------------------------------------------
RLMH_FUSNN/1-154--------------SS----------------------------------------------------------------
RLMH_RALSO/1-154--------------GD----------------------------------------------------------------
RLMH_BACSU/1-158--------------SK----------------------------------------------------------------
RLMH_RHILO/1-158--------------KV----------------------------------------------------------------
RLMH1_THETN/1-132--------------TD----------------------------------------------------------------
RLMH_STAHO/1-158--------------SD----------------------------------------------------------------
RLMH_RHIME/1-158--------------RD----------------------------------------------------------------
RLMH_CAMJE/5-152--------------NE----------------------------------------------------------------
RLMH_BACHD/1-158--------------SK----------------------------------------------------------------

PF01994

TRM56_METTH/55-175--------------SS----------------------------------------------------------------
TRM56_HALSA/58-177--------------AG----------------------------------------------------------------
TRM56_SULTO/47-168--------------AA----------------------------------------------------------------
TRM56_AERPE/62-182--------------AA----------------------------------------------------------------
TRM56_HALMA/58-177--------------AS----------------------------------------------------------------
TRM56_METHJ/53-171--------------AG----------------------------------------------------------------
Q2EMT5_METVO/53-191--------------AA----------------------------------------------------------------
TRM56_METBU/55-174--------------AA----------------------------------------------------------------
TRM56_HALWD/60-180--------------AG----------------------------------------------------------------
TRM56_UNCMA/55-177--------------AA----------------------------------------------------------------
TRM56_PYRAB/55-175--------------AA----------------------------------------------------------------
TRM56_METM5/54-177--------------AA----------------------------------------------------------------
TRM56_METST/54-174--------------AA----------------------------------------------------------------
TRM56_THEAC/53-169--------------SA----------------------------------------------------------------
TRM56_METJA/54-175--------------AA----------------------------------------------------------------
TRM56_METKA/59-178--------------AA----------------------------------------------------------------
TRM56_METAC/55-174--------------AA----------------------------------------------------------------
TRM56_THEPD/59-180--------------AA----------------------------------------------------------------
TRM56_NATPD/58-177--------------AG----------------------------------------------------------------
TRM56_THEVO/53-169--------------SA----------------------------------------------------------------
TRM56_SULSO/37-159--------------AA----------------------------------------------------------------
TRM56_PYRKO/57-179--------------AA----------------------------------------------------------------
TRM56_SULAC/4-130--------------SA----------------------------------------------------------------
TRM56_METTP/54-172--------------AA----------------------------------------------------------------
TRM56_CENSY/54-172--------------SA----------------------------------------------------------------
Q2QAM0_9EURY/57-176--------------AA----------------------------------------------------------------
TRM56_ARCFU/54-168--------------AA----------------------------------------------------------------
Q2V9D2_9CREN/30-151--------------AA----------------------------------------------------------------
TRM56_HYPBU/65-185--------------AA----------------------------------------------------------------
TRM56_PICTO/53-168--------------AA----------------------------------------------------------------
TRM56_METS5/50-170--------------AS----------------------------------------------------------------

PF09895

A4YJ17_METS5/38-141--------------QD----------------------------------------------------------------
A4WL82_PYRAR/38-137--------------GR----------------------------------------------------------------
A3MX89_PYRCJ/38-139--------------GR----------------------------------------------------------------
Q980M7_SULSO/40-148--------------DK----------------------------------------------------------------
A8A923_IGNH4/41-144--------------GV----------------------------------------------------------------
Q4JAZ5_SULAC/39-144--------------NK----------------------------------------------------------------
Q975T6_SULTO/38-143--------------NR----------------------------------------------------------------
Q6M1A6_METMP/36-139--------------KR----------------------------------------------------------------
Q8TUU2_METKA/37-134--------------D.----------------------------------------------------------------
A2BLW0_HYPBU/2-112--------------GR----------------------------------------------------------------
A1RRR7_PYRIL/38-139--------------GK----------------------------------------------------------------
Y2001_AERPE/40-147--------------GR----------------------------------------------------------------
A3DN09_STAMF/37-140--------------S.----------------------------------------------------------------
A1RX98_THEPD/41-156--------------SR----------------------------------------------------------------
A8MCI7_CALMQ/39-143--------------GR----------------------------------------------------------------
Q8TXR0_METKA/39-151--------------RE----------------------------------------------------------------
Y1199_METJA/39-142--------------EN----------------------------------------------------------------
Q8ZTS8_PYRAE/38-139--------------GR----------------------------------------------------------------

PF02598

Q6C565_YARLI/46-384.....NKVVSATEAYG......QDTGYSVR.VATDFSHIFTMPSTPEGYDYTVWCPGGEFRQSELAPETQPKPI......
Q6BHG5_DEBHA/25-381.....KKIVSPLQAYGL.IGSKSSFGYHVR.YCANFSSIFTQCSFPEGYTSTIYVNCDDYFNSNDTIEARNSIN......
CI114_HUMAN/74-365CKTYHGKVVSSQDPRT...KAGLYWGYTVR.LASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLP............
O59417_PYRHO/2-253...VKPLRVVPAEPPG.......YWGYKVHWSKKSLAKTLKNADL....DVVIATSRRGVDVRDAEVPLE..........
Q8MSZ6_DROME/73-371CRKQRGTLVSPDEPRR...ETGVYWGYQVR.IAHSMSEIFTKSPYATGYDVTVGTSDRGTNVHEVPNRSY..........
Q6NRR6_XENLA/72-362QRVQKGIVVSPQHPRT...EGGLYWGYRVR.LASCLSAVFTECPFKDGYDLTMGTSEHGSNVETVSLP............
Q8ILD7_PLAF7/85-440NVLFTGKLIHPSVPKL....YNLYWGYSIE.ILKNLSDIFKLQV.....DYLIGTSERGKFIDDSMVSFR..........
Q8ZT54_PYRAE/1-258RPDTYRAAVYRGAPPD.......YWGYKID........VRPLQNLSEGFDTVILTGKEGKSICEAKPKIG..........
O28353_ARCFU/1-247...KTPLRVEEAEPQE.......YWGYRVK..KLRLEELVKRKNL.......VVTSRKCEVVKPPALRRD..........
O26109_METTH/5-258..LGKEILIEPDEPED......RYWGYEVLDTRRNLAESLKTVGA....DVVVATSRNASPITSILDEVKT.........
Q9UXA9_SULSF/26-261.....SLKAGYIDYRG.....FYYTGVKNE..FIDFKKVFN.......FDNLIIASRSGKNPLQAKEQLT..........
YMP6_CAEEL/67-369CKLYRGSITSGATVTR...ETGLYWGYSVR.LMTGLQKVLQAKKF....DIVAGVSPRGKLASQMDVCIL..........
YM91_YEAST/19-314.....RKIVSPQEAYGDFTGLDSQYGYYTR.IASSFTDLFMKGPLKEGYTQSVYVPLTTRDTSIPELSSLP.........
Q7SI54_NEUCR/48-343.EYGSPEPVHPAVPRT...EGGYFWGYTVR.KAATLSDVFTQSPYEEGYDLSIGTSERGQSLHRAFPEHK..........
Q8TZ04_METKA/1-250...EDPLEVEPAEPEE.......YWGYRVR.IVNELNEVLREFK.....EGIIVTSRYGEDVREVEFKSP..........
Q6FIJ5_CANGA/41-365.....KKVVAPEEAYGDYVGPKASYGYHVR.IAKSFADLFMGSSFPSGYTQTVWCNSGDYYYDESTKKHNKVEVHIPRLS
Y1688_HALSA/2-280.....RRPVRAKLVDD......PLPGFSVE..RTGLGDALDRSDA....GVRIATSRHGEPLSVASLGGYR.........
YG5X_YEAST/39-337.....KEVVSPIDAYK.....GKPLGYHVR.MASTLNEV......SEGYTKIVWVNSGDFHYDEELSKYHKVETKLPY..
Q7RF09_PLAYO/162-498KNLFIGKVIHPSMPKL....YNIYWGYTIH.ILKNLTDVFDIQV.....DCIIGTSERGDPIQDLKTQIK..........
Q6CLH1_KLULA/48-407.....QKVVSPEEAYGDFVGAKASFGYHVR.VAKSFADLFTQSPFPQGYTQTVWINSGDFFFDETLKKNVKVQTQIPSIE
YGWG_SCHPO/17-306EGQLQGDIVSFSAPRE...KGGHYWGYKVR..SCLSSQLCKSSPYKGGYDFVVQINSQTSAITSKELEAS..........
Q6NLH7_ARATH/99-388DLDLVRQIVPPSKPRE...EAGMYWGYKVR.YASQLSSVFKECPFEGGYDYLIGTSEHGLVISSSELKIP..........
Q751R3_ASHGO/60-408.....KNVVSPAEAYGDYSGANAAYGYSVR.VARTFADIFLGAGFAGGYTQSLWVNSADFFFDPAAQSSVRLDSKIPHVQ

PF04452

Q83AE1_COXBU/37-252NAQNSLADFKTTSQ..----------------------------------------------------------------
Q7D102_AGRT5/16-233DEGDAGQNPLPILQAV----------------------------------------------------------------
Q6D078_ERWCT/19-238RATQSINTLPLPID..----------------------------------------------------------------
Q73XZ7_MYCPA/18-242S...ATDRLTDVPVAQ----------------------------------------------------------------
Q8DX86_STRA5/14-241ESAKE.GELSALAQNL----------------------------------------------------------------
Q72R34_LEPIC/17-226LDPQGEWKLKPEFFQ.----------------------------------------------------------------
Q9A2Z1_CAUCR/16-232DEGGDARPMIEALSGT----------------------------------------------------------------
Q8K5R0_STRP3/14-241ETAKA.GQLATLAREV----------------------------------------------------------------
Q8G5Y7_BIFLO/28-259DATDTWSGVEEKVAQL----------------------------------------------------------------
Q6NAN3_RHOPA/23-243DEDAEIADPVAALQAA----------------------------------------------------------------
Q8P6T0_XANCP/18-239HGEHRLGTLAVQPGQ.----------------------------------------------------------------
Q7VKS8_HAEDU/18-238RAKYTIRQLPQIPTA.----------------------------------------------------------------
Q71ZK0_LISMF/17-245ESARE.GEDSALANLF----------------------------------------------------------------
Q8FVR3_BRUSU/16-233DEGHESDDPLSILTGL----------------------------------------------------------------
Q7ND55_GLOVI/19-229R.........GVRPPL----------------------------------------------------------------
Q6FA41_ACIAD/16-235EKEQQNVLKNAQS...----------------------------------------------------------------
Q9CCN1_MYCLE/18-246S...ATDRLSDVFADI----------------------------------------------------------------
Q8XVR6_RALSO/18-244RGSEPLTQWAVQSRER----------------------------------------------------------------
Q83GJ2_TROWT/19-230G.......SNTRLSSL----------------------------------------------------------------
Q8EPW6_OCEIH/16-246EEAKTEKMSSNLVNTL----------------------------------------------------------------
Q6NG15_CORDI/26-247D...AAVPFATVDVST----------------------------------------------------------------
Q6KI62_MYCMO/14-223NTDLSKELNTNLFCS.----------------------------------------------------------------
Q6E297_ARATH/69-288EAKPLLNAVNSSAKES----------------------------------------------------------------
Q89ZP8_BACTN/13-229Y........EGEKPQL----------------------------------------------------------------
Q9ZIA2_CLOAT/16-241N.........QEKVGM----------------------------------------------------------------
Q7U7K3_SYNPX/18-237RPCWLAEMGSALALSA----------------------------------------------------------------
Q9RDD9_STRCO/21-243S...GDVPLSDAELPA----------------------------------------------------------------
Q6G8Z0_STAAS/16-244EEAKD.GELSNFKQTL----------------------------------------------------------------
Q7PAV9_RICSI/18-235N...EHEKEENSILRI----------------------------------------------------------------
Q8KAZ3_CHLTE/18-236S.....ENAFPSFEPA----------------------------------------------------------------
RSME2_BORBU/16-236SGMILSKNESFDNFG.----------------------------------------------------------------
Q82BY2_STRAW/19-243DTEHGTEPFATAQLPT----------------------------------------------------------------
Q6MAP1_PARUW/18-233DPHAPFLAAANEGSSY----------------------------------------------------------------
Q6G0I7_BARQU/22-239DEAHKLHNPLPLLKKH----------------------------------------------------------------
Q87EY9_XYLFT/18-239KSEHRLSTLSRLTPV.----------------------------------------------------------------
RSME_BACSU/19-247ESSKQ.GEISAFSAIV----------------------------------------------------------------
RSME_SHIFL/18-237RASNSINTLPLPVE..----------------------------------------------------------------
Q833H7_ENTFA/16-244ESAKQ.GEKSQLAQVL----------------------------------------------------------------
Q6HDL0_BACHK/16-243EEAKQ.GEKSNFAKAL----------------------------------------------------------------
Q89DB6_BRAJA/24-242DEAAEVENPVQSLQGA----------------------------------------------------------------
Q9PQJ0_UREPA/14-231NEKQNLLNNAFKEELT----------------------------------------------------------------
Q8XIT7_CLOPE/16-241N.........ATGYGI----------------------------------------------------------------
Q9CJ96_LACLA/18-245ESAKM.GEKTMFKQAL----------------------------------------------------------------
Q7MT38_PORGI/15-239DEAVRAEITQGRGYPS----------------------------------------------------------------
Q9RH08_ZYMMB/27-242DETG.GEPMIEALSKR----------------------------------------------------------------
RSME_SYNY3/80-299R.........LNSPML----------------------------------------------------------------
Q8RB65_THETN/16-239K.........EEKKRL----------------------------------------------------------------
Q9RU73_DEIRA/24-239GSQERLTDLLTWDA..----------------------------------------------------------------
Q7VHH3_HELHP/14-232GGVDICNFTPCQNHSK----------------------------------------------------------------
Q72R98_LEPIC/18-253KGFTFTQVFKEKK.ID----------------------------------------------------------------
Q74G06_GEOSL/16-240DERTTTLAGVLAAAQT----------------------------------------------------------------
Q7P2R8_FUSNV/14-232N.........EKEIFI----------------------------------------------------------------
RSME_MYCBO/18-242E...ATERIVDIAAAQ----------------------------------------------------------------
Q6F738_ACIAD/16-235RPAFVAHPYAETAMPH----------------------------------------------------------------
Q8DS03_STRMU/14-241ESAKI.GESAALAREL----------------------------------------------------------------
Q8YX66_NOSS1/19-231R.........GEYVHL----------------------------------------------------------------
RSME_AQUAE/13-228FYEGVKPKDVNLEAK.----------------------------------------------------------------
Q9F9G9_9GAMM/17-236GEKSFSAAALQGQT..----------------------------------------------------------------
Q892R3_CLOTE/16-241N.........QQGFGM----------------------------------------------------------------
Q6MI96_BDEBA/16-247G.........PSTLSI----------------------------------------------------------------
Q987U8_RHILO/16-233DEDASTNNPLPALRAV----------------------------------------------------------------
Q7VZC1_BORPE/18-240EAELDLAGALARHAAH----------------------------------------------------------------
Q7RMG7_PLAYO/19-251TIKVCAHTDIKKKNEH----------------------------------------------------------------
Q8FNF6_COREF/18-236E...ASQPFRELNFTG----------------------------------------------------------------
Q8DNP5_STRR6/18-245ESAKE.GEAAALLQAV----------------------------------------------------------------
Q8CSC8_STAES/19-247EQAKH.GELSQFKQTI----------------------------------------------------------------
Q73J56_TREDE/35-272GDFPSLSTFRMTKGE.----------------------------------------------------------------
Q7V223_PROMP/22-248TRDDSTDNLNHWLKKK----------------------------------------------------------------
Q7U730_SYNPX/24-238TRRADTPALRDWLNQT----------------------------------------------------------------
Q92RS8_RHIME/22-239DEGNDSQNPLPILEGI----------------------------------------------------------------
Q82WB5_NITEU/17-247AAHQRLVELSPPRTGE----------------------------------------------------------------
Q87LK2_VIBPA/18-237RAKYSINTLPTPVE..----------------------------------------------------------------
RSME_BUCAP/20-240SATFTINELPEKIN..----------------------------------------------------------------
RSME_MYCH2/14-226RAKNNINIPDNPQ...----------------------------------------------------------------
Q6AEC1_LEIXX/18-236S...AGGRLTDVTPDA----------------------------------------------------------------
Q7V7G0_PROMM/24-244TRRQGLIDLQLLMEGL----------------------------------------------------------------
Q6AMJ0_DESPS/17-250SALIVADPAGTNTFSE----------------------------------------------------------------
RSME_HELPY/14-226KGETLPASADF.....----------------------------------------------------------------
Q7P147_CHRVO/16-235RGDRSLAQLAERPA..----------------------------------------------------------------
Q72BF1_DESVH/15-234GETPEALLEAKDVGGV----------------------------------------------------------------
RSME_HAEIN/18-238RAHYSIKTLPTIPAG.----------------------------------------------------------------
Q8EWP2_MYCPE/13-228HQDLSEWNKIKNNSNL----------------------------------------------------------------
RSME1_BORBU/15-233NFEIKILLEKNSEKNL----------------------------------------------------------------
Q8EIK7_SHEON/18-237RAAHGINGLDLSHT..----------------------------------------------------------------
RSME_BUCAI/27-247KSTLTMKCLTEPIK..----------------------------------------------------------------
Q8NNB5_CORGL/18-236E...ATAAIRELEFSG----------------------------------------------------------------
Q7VBR8_PROMA/24-246TRIDNAIPFESLLNDI----------------------------------------------------------------
Q73FW1_WOLPM/18-226ETGKADKVLKGKK...----------------------------------------------------------------
Q73LI5_TREDE/15-246EKKVGSFSFFDCLSAE----------------------------------------------------------------
Q98Q27_MYCPU/14-222KAKDFLTKSSFET...----------------------------------------------------------------
RSME_TREPA/18-242THQKLILDTKNTLTDL----------------------------------------------------------------
Q6A996_PROAC/19-238S...ASEPLVHQELPA----------------------------------------------------------------
Q9X1A0_THEMA/14-217DASQNLLDANLEG...----------------------------------------------------------------
Q9KD69_BACHD/16-244EEAKE.GRLMTFAACL----------------------------------------------------------------
Q6F1G3_MESFL/14-235K.........EKNIEL----------------------------------------------------------------
Q8DI45_THEEB/47-258A..........APELL----------------------------------------------------------------

PF04013

TRMYL_VIBCH/1-199KGDSIRDIKIGP...-----------------------------------------------------------------
TRMY_PYRAB/1-203DGKDITEVEFPKN..-----------------------------------------------------------------
TRMY_PYRHO/1-202GGADIMKVKFPRN..-----------------------------------------------------------------
TRMY_METJA/1-202NGEDVENVDIE....-----------------------------------------------------------------
TRMY_AERPE/1-186KGGDISSHWGEMCSS-----------------------------------------------------------------
TRMY_ARCFU/95-288DGVDISNAQLPP...-----------------------------------------------------------------
TRMY_HALSA/1-193DG.DALAAVDPLA..-----------------------------------------------------------------

PF04252

Q9YC91_AERPE/71-273AVKTAILVAEG.YRLD----------------------------------------------------------------
Q9V144_PYRAB/2-195ASIVAKLIAEG.KRLE----------------------------------------------------------------
YO021_YEAST/1-212AIRTTQLIIKDRIAFE----------------------------------------------------------------

PF01746

RG9D3_MOUSE/135-308Y.......MIK-RQNE----------------------------------------------------------------
RG9D2_HUMAN/110-276F.......VKM-NS..----------------------------------------------------------------
Q9BI62_CAEEL/175-352Y.......VDF-KSG.----------------------------------------------------------------
Q9UZ22_PYRAB/108-288D.......VVG-VPNR----------------------------------------------------------------
Q9FGI9_ARATH/127-293Y.......MKM-SS..----------------------------------------------------------------
RG9D2_DROME/104-271H.......VDM-KT..----------------------------------------------------------------
TRMD_STRLI/21-232FAPGAMANLLE-GPVH----------------------------------------------------------------
TRMD_SHIFL/22-221F....AEGLLD-CPHY----------------------------------------------------------------
TRMD_MYCLE/21-224H.SPDLGRLLE-GPSY----------------------------------------------------------------
Q19789_CAEEL/96-260H.......LLM-KS..----------------------------------------------------------------
TRMD_HELPY/22-221F....ENHYLE-APNF----------------------------------------------------------------
TRMD_MYCGE/22-216F....NDNLLD-FPVY----------------------------------------------------------------
TRMD_BORBU/22-219F..GVKNGLLE-YPHY----------------------------------------------------------------
TRMD_MYCPN/22-216F....NNYLLD-FPAY----------------------------------------------------------------
Q97Z49_SULSO/105-260S.......TVG-VPDR----------------------------------------------------------------
TRMD_SYNY3/22-218F....STDLLD-YPHY----------------------------------------------------------------
Q9YET3_AERPE/129-296S.......VAG-VPER----------------------------------------------------------------
MRRP1_MOUSE/207-375Y.......LQW-EIG.----------------------------------------------------------------
TRM10_YEAST/104-276Y.......INL-EG..----------------------------------------------------------------
O58442_PYRHO/158-338D.......VIG-VPDR----------------------------------------------------------------
TRMD_AQUAE/27-222F....QNRWLG-YPVY----------------------------------------------------------------
TRMD_BACSU/22-221F....STGLLE-HPHY----------------------------------------------------------------
TRM10_SCHPO/104-273Y.......IKI-TD..----------------------------------------------------------------

PF09936

B5EBC8_GEOBB/4-189---------------------FLL--LLG-------------T-G-WGLIEQVF-------NKSD.LV--LEPIRG-A..
Q3A2E8_PELCD/2-183---------------------LML--VFG-------------T-G-WGLAPELF-------ECGW.KV--LEPIRG-R..
A1AMZ9_PELPD/5-189---------------------HLL--LLG-------------T-G-WGLTEECF-------QAAD.FI--LEPISG-A..
A5G7Z4_GEOUR/8-192---------------------YLL--LFG-------------T-G-WGMTEEIF-------NRAD.YV--LEPIKG-R..
Y054_AQUAE/17-201---------------------WLI--VFG-------------T-G-HGIPPDLM-------NTFD.YI--LEPIYG-A..
A7HKS2_FERNB/2-186---------------------VLL--LFG-------------T-G-WGMPKELE-------DMCD.YS--LEPIRG-K..
A0LMM3_SYNFM/1-185---------------------YLL--LFG-------------T-G-WGLAPAVF-------DQVD.AV--LEPIAG-M..
TRMD_DESDG/242-423---------------------VLL--LFG-------------T-A-HGLAPDVL-------ERCD.GI--LRPIRS-L..
Q2LVU3_SYNAS/10-194---------------------CII--VFG-------------T-G-SGLAAEIL-------DRAD.YR--LSAIKG-P..
Q1MRV0_LAWIP/191-372---------------------IAL--LFG-------------T-G-HGLTPDTL-------NSCF.GV--LRPLRW-I..
Q0AWV8_SYNWW/3-187---------------------FLL--LFG-------------T-G-WGIQKEIM-------ESCD.YI--LQPIEA-K..
A8ZV19_DESOH/6-188---------------------VLL--VFG-------------T-A-WGLAPSVL-------DQAD.CV--LEPLAG-K..
Q24UB0_DESHY/1-185---------------------LLL--LFG-------------T-G-WGLLREVM-------EECD.II--LEPIYG-P..
A6LNY5_THEM4/2-186---------------------VLI--LFG-------------T-G-WGMPDEIL-------EQCD.YA--LEPVRG-R..
A1HN71_9FIRM/2-187---------------------CLL--LFG-------------T-G-WGIQKEVM-------EQFDYYI--LEPIYG-S..
A8F3G0_THELT/2-186---------------------VLI--LFG-------------T-S-WGLPNEVL-------QICD.YA--LEPIRA-D..
Q0F054_9PROT/1-176---------------------HLI--VFG-------------T-G-WGLDAKNM-------PHAN.GW--LSPIEG-V..
Q3AC73_CARHZ/1-185---------------------YLL--LFG-------------T-G-WGLVREVM-------ESAT.YI--LEPIYG-P..
Q7P719_FUSNV/2-186---------------------YLL--LFG-------------T-G-WGLTDEVM-------AMSD.YI--LEPIRA-K..
B3E5S7_GEOLS/2-186---------------------HLL--LLG-------------T-G-WGLADEIF-------EQAT.TI--LEPIQG-H..
Q6AJE7_DESPS/14-197---------------------ILL--LFG-------------T-A-HGLAPEVM-------NRVD.FV--LPPIDG-G..
A5IM13_THEP1/2-186---------------------VLI--LLG-------------T-G-WGLPDEIL-------EISD.YV--LEPIRA-Q..
A1VFE5_DESVV/242-423---------------------VLL--VFG-------------T-G-HGLAPEVL-------EGCD.AI--LRPLRW-M..
A9BF02_PETMO/2-186---------------------FLI--LFG-------------T-G-WGMPEEIR-------EISD.YD--LEPIRA-N..
Q39RN9_GEOMG/8-192---------------------YLL--LFG-------------T-G-WGLVEEVF-------EKAD.LV--LEPIQG-A..
Q1NQ21_9DELT/248-432---------------------ALL--LLG-------------T-A-WGLAAQAL-------DGID.CF--LPPIDG-A..
Q6ML98_BDEBA/8-193---------------------VFM--LFG-------------T-G-FGLTEDLI-------RSSS.GV--LESIRG-APP
Q74FG2_GEOSL/8-193---------------------YLI--VFG-------------T-G-WGLTEDFF-------DRAD.FV--LAPIQG-P..

PF00588

Q8CXU2_LEPIN/126-265---------------------IAL--VFG-------------SEQ-YGLSTYAR-------NNSD-.E..YVSLPM.F--
Q7NBG1_MYCGA/4-151---------------------IYL--VFG-------------QET-NGLPDQLL-------NKYQ-DN..LVKIPM.H--
Q6BHP1_DEBHA/1290-1434---------------------SLI--LLG-------------REK-EGVPGDLL-------AELD-.F..CVEIKQ.V--
Q8I3K9_PLAF7/198-344---------------------ICL--ILG-------------SES-TGPHTDVF-------KYAH-.P...IQLPM.H--
Y324_MYCLE/160-301---------------------LAV--VVG-------------SEG-KGLSRLVR-------HSCD-.E..VVSIPM.A--
Q22484_CAEEL/1071-1214---------------------AVI--VMG-------------DEK-EGVPVNLL-------RAVD-.Q..TVEIKQ.V--
O74022_9EURY/1-150---------------------VGI--FFG-------------RES-IGLKNEEL-------DAMD-.V..TLTIPT.S--
Q7TU01_RHOBA/25-165---------------------DVL--VFG-------------RET-SGLPASIL-------KPDD-PR..SLRLPM.R--
MRM1_SCHPO/147-297---------------------KIL--VLG-------------SE.-KGLRTNIL-------TQCS-.H..YVSIPGGD--
Q6ME25_PARUW/89-224---------------------FTL--VVG-------------NEE-YGCSQEIL-------TKAH-.Y..LIEIPL.R--
Q8R6H6_FUSNN/88-229---------------------VVL--VLG-------------NEG-SGIRKKVR-------EHCD-.K..LIKIPM.Y--
Q729V9_DESVH/1-141---------------------DML--VFG-------------PET-TGLPQEVL-------DLTP-.H..RVCIPI.W--
Q74D44_GEOSL/15-165---------------------AAL--VFG-------------RED-NGLTTDEL-------SLCR-.W..HATIPS.S--
Y516_BORBU/78-219---------------------IAL--ILG-------------NEG-KGVHKLIK-------ENSD-.F..LIRIPT.S--
Q898S5_CLOTE/9-150---------------------DFI--VFG-------------RET-SGLPDYVR-------EDNR-.D.TCIKVPMIK--
Q6FZ54_BARQU/2-143---------------------DVL--LFG-------------RES-AGVPDYVH-------EAVD-.H..SLKIPM.Q--
Q7UG85_RHOBA/132-272---------------------VAV--VLG-------------SEA-DGLADRWA-------GDSI-.D..PVALPM.A--
Q6YR72_ONYPE/92-232---------------------KVL--VLG-------------NEG-QGISLETE-------ALSD-.Y..FVNICT..--
Y881_MYCTU/130-275---------------------IAL--LVG-------------AEG-PGLTAAAL-------RISD-.V..RVRIPM.S--
Q6XK16_SPICI/109-253---------------------YIL--ALG-------------NEG-HGLSTTLQ-------EISD-.Y..NVQIKI.N--
Q6MS22_MYCMS/92-234---------------------TAV--IIG-------------NEQ-KGVSELLT-------KNSD-.F..NIYVPS.N--
Q8A814_BACTN/97-238---------------------MCI--IMG-------------AED-TGVSYDHL-------ALCD-.E..WVKIPM.L--
Q7UFJ5_RHOBA/144-289---------------------RIL--MVG-------------NEA-NGLPREIA-------EAAT-.H..RSTLPM.R--
TRMH_SHIFL/19-159---------------------TCI--LMG-------------QEK-TGITQEAL-------ALAD-.Q..DIIIPM.I--
Q73T60_MYCPA/69-206---------------------CLL--VFG-------------QEG-PGITDDTR-------TGAT-.L..TVSIAQ.F--
Q9RWT9_DEIRA/12-159---------------------PAL--VFG-------------PEE-TGLINSDL-------EQCQ-.V..TVRIPT..--
Q9RXS5_DEIRA/10-149---------------------DYL--LFG-------------PES-RGLPVWLR-------DALP-....KLKLPQ.P--
Q9UXD5_SULSF/1-149---------------------IAL--IFG-------------RES-VGLTREEI-------FKCD-.F..LLYIPA.N--
Q74D57_GEOSL/96-237---------------------VVI--VIG-------------GEG-EGVRPLVR-------KKCD-.F..LVAIPL.K--
Y380_HAEIN/4-151---------------------IAI--VFG-------------RER-IGLTNEEL-------LKCH-.Y..HLNIPA.N--
Q7VBF1_PROMA/9-160---------------------IAI--IFG-------------RED-RGLSNSEL-------QIAQ-.K..IITLKT.S--
Q8IJ98_PLAF7/52-193---------------------TAF--LFG-------------NEG-TGIHDNVL-------KICD-.K..IIYIPQ.Y--
Q9PQM3_UREPA/1-151---------------------VYL--VFG-------------KES-TGIDHNIL-------KKYP-HN..WIRIPT.S--
O67731_AQUAE/93-233---------------------VAL--VLG-------------SED-KGVSKSVL-------DISD-.Q..IVTIPM.K--
Q6F981_ACIAD/122-259---------------------CVW--ILG-------------NEG-QGASEYAL-------SHAQ-.A...ITIPQ.P--
Q7M8R3_WOLSU/2-143---------------------AYL--YFG-------------RED-AGLPQVLL-------EAHP-QA..MLKIPM.K--
Q73GK0_WOLPM/102-244---------------------RVI--IFG-------------SEE-KGMRRLVK-------ENCD-.Y..LLKIPM.S--
Q8PVX0_METMA/11-163---------------------IAL--LFG-------------RED-NGFSNDEL-------KGFD-.M..LVTVPT.S--
Q8FF07_ECOL6/222-362---------------------MVL--VLG-------------QEY-EGLPDAAR-------DPND-.L..RVKIDG.T--
Q7V131_PROMP/7-159---------------------LGI--LFG-------------RED-RGLSNNEL-------LFAH-.K..ILNIKT.S--
Q7WLL7_BORBR/7-163---------------------VAI--VLG-------------TER-AGLTNAQI-------ELCH-.R..ICHIPA.N--
Q8TXY9_METKA/2-150---------------------IAV--VFG-------------PED-RGLRTWEV-------ELCD-.A..TLHIPT.S--
Y052_BORBU/34-174---------------------MAI--FFG-------------TEL-TGLSAEVL-------GAAD-.L..YVKIPM.Y--
Q9AAX1_CAUCR/6-147---------------------DTL--LFG-------------NES-RGAPEEVH-------AAAH-.G..RIVIPI.R--
Q9CC19_MYCLE/108-251---------------------TAW--LFG-------------SEP-HGLSTEIA-------EAAD-.Y..RVRIPM.V--
TSNR_STRAJ/116-258---------------------LAL--LFG-------------SEK-GGPSDLFE-------EASS-.A..SVSIPM.M--
Q8XDF6_ECO57/1-142---------------------DYL--MFG-------------PET-RGLPASIL-------DALP-.AEQKIR