Sequence alignment for CL0100

PF00229

TNF15_HUMAN/117-251--------------------------LHWEHELG..L----------------------AFTKNRMNYTNKF---..LLI
TNF10_HUMAN/152-280--------------------------NSWESSRS..G----------------------HSFLSNLHLRNGE---..LVI
Q90WT9_CHICK/158-285--------------------------TRWEDST...I----------------------HSHLQNITYRDGR---..LRV
TNFB_MOUSE/74-202--------------------------LLWRASTD..R----------------------AFLRHGFSLSNNS---..LLI
TNFL8_HUMAN/113-230--------------------------LSWNKDGI...----------------------...LHGVRYQDGN---..LVI
TNF10_MOUSE/156-290--------------------------ESWESSRK..G----------------------HSFLNHVLFRNGE---..LVI
TNFL9_MOUSE/164-302--------------------------LNWHSQDGAGS----------------------SYLSQGLRYEEDK---KELVV
TNFL8_MOUSE/118-235--------------------------LSWNEDGT...----------------------...IHGLIYQDGN---..LIV
TNFC_HUMAN/102-243--------------------------LGWETTKE..Q----------------------AFLTSGTQFSDAE---.GLAL
CD40L_MOUSE/137-260--------------------------LQWAKKGY..Y----------------------TMKSNLVMLENGK---.QLTV
TNF12_HUMAN/131-248--------------------------SGWEEARI..N----------------------SSSPLRYNRQIGE---..FIV
TNFB_HUMAN/77-205--------------------------LLWRANTD..R----------------------AFLQDGFSLSNNS---..LLV
Q6DHG9_DANRE/158-298--------------------------QSWESEK...G----------------------LAFLQNVELSDGE---..LVV
TNFC_MOUSE/168-305--------------------------LSWEASQE..E----------------------AFLRSGAQFSPTH---.GLAL
TNFL9_HUMAN/107-240--------------------------LSWYSDPGLAG----------------------VSLTGGLSYKEDT---KELVV
TNF11_HUMAN/185-313--------------------------SSWYHDR...G----------------------WAKISNMTFSNGK---..LIV
CD40L_FELCA/137-260--------------------------LQWAPKGY..Y----------------------TISSNLVTLENGK---.QLAV
TNF14_MOUSE/110-239--------------------------LLWETRL...G----------------------LAFLRGLTYHDGA---..LVT
CD40L_CHICK/152-272--------------------------LKWMTTS...Y----------------------APTSSLISYHEGK---..LKV
TNFL6_RAT/157-278--------------------------LEWEDTY...G----------------------TALISGVKYKKGG---..LVI
TNFA_RABIT/105-235--------------------------LQWLSQRA..N----------------------ALLANGMKLTDNQ---..LVV
F1NHP5_CHICK/157-290--------------------------.SWESSRR..G----------------------HSFLYNVELWNGE---..LVV
F1Q767_DANRE/188-315--------------------------.TWANKS...F----------------------GAHLYNMTLTNGR---..LRV
F6VXB8_MOUSE/136-270--------------------------LHWEHDLG..M----------------------AFTKNGMKYINKS---..LVI
H2Y3R5_CIOIN/179-304--------------------------.DWAPPD...S----------------------HFKGFGTRHLNND---GYFTV
TNFA_SHEEP/103-234--------------------------LRWGDSYA..N----------------------ALMANGVELKDNQ---..LVV
TNFA_CALJA/101-230--------------------------LQWLNRRA..N----------------------ALLANGVELRDNQ---..LVV
Q1L8A5_DANRE/102-233--------------------------LDWRDDQD..Q----------------------AFSSGGLKLVNRE---..III

PF00386

C1QA_MOUSE/116-241--------------------------AFSAIRQNPMTLG.N........VVIFDK....VLTNQESPYQNHT---GRFIC
C1QC_MOUSE/122-243--------------------------VFTVTRQTTQYPE.A.NA.....LVRFNS....VVTNPQGHYNPST---GKFTC
MMRN2_HUMAN/827-946--------------------------AFYASFSEGTAAL.Q........TVKFNT....TYINIGSSYFPEH---GYFRA
C1QT8_HUMAN/118-246--------------------------AFSVGRREGLHSS.DHFQ.....AVPFDT....ELVNLDGAFDLAA---GRFLC
C1QT6_HUMAN/126-254--------------------------AFSVGRKTALHSG.EDFQ.....TLLFER....VFVNLDGCFDMAT---GQFAA
MMRN2_MOUSE/821-940--------------------------AFYAGSSEGATAL.Q........MVKFNT....TSINVGSSYFPEH---GYFRA
CAPR2_DANRE/786-911--------------------------AFSAARTANFAPG.TLDQ.....PIAFDL....LHTNLGDMFDTGS---GRFTC
C1T9A_HUMAN/203-329--------------------------AFTVGLTVLSKFP.SSDM.....PIKFDK....ILYNEFNHYDTAA---GKFTC
MMRN1_HUMAN/1102-1225--------------------------AFFASHTYGMTIP.G........PILFNN....LDVNYGASYTPRT---GKFRI
C1QT4_MOUSE/30-155--------------------------AFSAARTTPLEGT.SEM......AVTFDK....VYVNIGGDFDAAT---GRFRC
C1QC_HUMAN/121-242--------------------------VFTVTRQTHQPPAPNS.......LIRFNA....VLTNPQGDYDTST---GKFTC
C1QT4_MOUSE/176-309--------------------------AFSAARTRSLVGS.DAAPGPRHRPLAFDT....ELVNIGGDFDAAA---GVFRC
C1QA_HUMAN/116-241--------------------------AFSAIRRNPPMGGN.........VVIFDT....VITNQEEPYQNHS---GRFVC
C1QA_PIG/118-243--------------------------AFSAVRQNPPTSGN.........VVIFDE....VITNQEGAYKSQL---GQFIC
C1QL3_MOUSE/128-252--------------------------AFYAGLKRQHEGYE.........VLKFDD....VVTNLGNHYDPTT---GKFTC
CO8A2_MOUSE/572-696--------------------------AFTAVLT..SPFP.ASGM.....PVRFDR....TLYNGHSGYNPAT---GIFTC
D6R934_HUMAN/121-245--------------------------AFSATRTINVPLRRDQ.......TIRFDH....VITNMNNNYEPRS---GKFTC
Q9GQV4_STRPU/36-175--------------------------AFTVERTADMSDSTTSRD.....IGAFNKNSQKIYLNIGEALDVVT---GRFKV
CO8A1_RABIT/617-741--------------------------AFTAELT..APFP.PVGA.....PIKFDR....LLYNGRQNYNPQT---GIFTC
COAA1_BOVIN/547-671--------------------------AFTVILS..KAYP.AIGT.....PIPFDK....ILYNKQQHYDPRT---GIFTC
C1QT5_MOUSE/105-232--------------------------AFSAKRSESRVPP.PADT.....PLPFDR....VLLNEQGHYDPTT---GKFTC
C1QT2_HUMAN/151-275--------------------------AFSVAVT..KSYP.RERL.....PIKFDK....ILMNEGGHYNASS---GKFVC
C1QT3_MOUSE/119-242--------------------------AFMASLATHFSNQ.NS.......GIIFSS....VETNIGNFFDVMT---GRFGA
C1QT7_MOUSE/149-273--------------------------AFSVGIT..TSYP.EERL.....PIIFNK....VLFNEGEHYNPAT---GKFIC
F1NRD4_CHICK/112-237--------------------------AFSVGLTERAPHP.NV.......PIRFTK....IFYNEQNHYDSST---GKFLC
F1QH04_DANRE/118-238--------------------------VFSYKKSQKLEKI.LQDK.....LVVFDV....PLISGIDGVLDGE---GYFDV
F1R093_DANRE/91-222--------------------------AFSASLLSSHNIK.YIGPYAEDTMIVYGK....IFTNIGNAYNTTT---GIFSA
F1R9R1_DANRE/772-890--------------------------AFFASVNSILPAT.A..K.....VVVFGQ....VLYNGQNHYNQTS---GMFLC
F7DZE7_HORSE/109-234--------------------------AFSVGLETRVTVP.NV.......PIRFTK....IFYNQQNHYDGST---GKFHC
F7EBM1_XENTR/112-237--------------------------AFSMGLSTKSSLP.NV.......PIRFTK....VFYNEQRHYDDST---GKFRC
Q4KMC6_DANRE/109-237--------------------------AFSAKLSEARTTPLTVGD.....SVRFDK....VILNEQGDYNPET---GRFTC
C1QT1_MOUSE/147-275--------------------------AFSVGRKKALHSN.DYFQ.....PVVFDT....EFVNLYKHFNMFT---GKFYC

PF08949

P5_BPPRD/122-340-------------------------PSGIKGDKGDPGAPGPAGG-----TVVVED----SGASFGESLLDTTSEPGKILV

PF05475

GP3D_CHLT2/119-264--------------------------AFNNFPITNKIQCNG------------------LFTPRNIETLLGGTEIGKFTV
Q821C4_CHLCV/119-264--------------------------AFKNFSISDKIQCNG------------------LFTKTNIGTLLGGTEIGTFTI
Q46275_CHLPN/122-267--------------------------AFKDVNITNKIQCNG------------------LFTKENIGNLDGGTEIASSSV

PF12956

Q8A8D4_BACTN/3-242MNKIVGMAALLLC...LTGCVRDNDAIYYPVGDVDIERGGPALEVGEEDVLVARSFNEEDYVLDTIAQYPNDPTLGKLTF
R7NWP5_9BACE/1-237MNKFI...VFLLCALFFGSCNEEEDSIYYPLDNVDIIKGGSEEPTGNAT.LIAESHNLESYVLDTLAVYPYDKTIGKLTF
R5UHF8_9BACE/2-242MNKIIGAAVLLLC...FCSCVKDNDAIYYPVGNVDIEKGGPALEVGSNSILVAESYNEEDYVLDTLAQYPGDPTLGKLTF
R6D787_9BACE/1-240MDKIIGVAVLLLC...LYGCAKDNDAIYYPVGNVNVENGDPALEDGKGE.LVARSYNDEDYVLDTIAQYPGDPTLGKLTF

PF16532

Q716G6_BPSFV/108-282----------------------NESDISSLDTRVQSLESQVSDHETRIDALEYAT----TRKKSEVVYSGVS-----VTI

PF00229

TNF15_HUMAN/117-251PE----S-----------------GDYFIYS--QVTFR......GMTSECSEIRQ......AGRPNKPDSITVVITKVTD
TNF10_HUMAN/152-280HE----K-----------------GFYYIYS--QTYFR...........FQEEIK......ENTKND.KQMVQYIYKYTS
Q90WT9_CHICK/158-285NQ----A-----------------GKYYVYS--QIYFRYSRDGAGARVS...................VPQLVQCINWKT
TNFB_MOUSE/74-202PT----S-----------------GLYFVYS--QVVFS......GESCSPRAI...........PTP.IYLAHEVQLFSS
TNFL8_HUMAN/113-230QF----P-----------------GLYFIIC--QLQFL.......VQCPNN...............S.VDLKLELLINKH
TNF10_MOUSE/156-290EQ----E-----------------GLYYIYS--QTYFR......FQEAEDASKMVS.....KDKVRT.KQLVQYIY.KYT
TNFL9_MOUSE/164-302DS----P-----------------GLYYVFL--ELKLSP....TFTNTGHK...............V.QGWVSLVLQAKP
TNFL8_MOUSE/118-235QF----P-----------------GLYFIVC--QLQFL.......VQCSNH...............S.VDLTLQLLINSK
TNFC_HUMAN/102-243PQ----D-----------------GLYYLYC--LVGYR......GRAPPGGGDP.........QGRS.VTLRSSLYRAGG
CD40L_MOUSE/137-260KR----E-----------------GLYYVYT--QVTFC......SNREPSS...............Q.RPFIVGLWLKPS
TNF12_HUMAN/131-248TR----A-----------------GLYYLYC--QVHFD.......EGKA...................VYLKLDLL....
TNFB_HUMAN/77-205PT----S-----------------GIYFVYS--QVVFS......GKAYSPKAT...........SSP.LYLAHEVQLFSS
Q6DHG9_DANRE/158-298PQ----A-----------------GLYYIYS--QTYFR......HTLIEEDESAREDEYGSMGESVRGKPMLQYVYKKVS
TNFC_MOUSE/168-305PQ----D-----------------GVYYLYC--HVGYR......GRTPPAGRS..........RARS.LTLRSALYRAGG
TNFL9_HUMAN/107-240AK----A-----------------GVYYVFF--QLELRRV..VAGEGSG.................S.VSLALHLQPLRS
TNF11_HUMAN/185-313NQ----D-----------------GFYYLYA--NICFR......HHETSGDLA...........TEY.LQLMVYVTKTSI
CD40L_FELCA/137-260KR----Q-----------------GLYYIYA--QVTFC......SNREASS...............Q.APFIASLCLHSP
TNF14_MOUSE/110-239ME----P-----------------GYYYVYS--KVQLS......GVGCPQGL............ANG.LPITHGLYKRTS
CD40L_CHICK/152-272EK----A-----------------GLYYIYS--QVSFC.....TKAAAS...................APFTLYIYLYLP
TNFL6_RAT/157-278NE----A-----------------GLYFVYS--KVYFR......GQSCN.................S.QPLSHKVYMRNF
TNFA_RABIT/105-235PA----D-----------------GLYLIYS--QVLFS......GQGCRS................Y.VLLTHTVSRFAV
F1NHP5_CHICK/157-290PQ----T-----------------GFYYIYS--QTYFR......FRENEDEDSGLL.....ERIKNP.KQLVQYIYKLTN
F1Q767_DANRE/188-315PQ----D-----------------GRYYLYS--QVYFR......YPSPSDSDQ..........SSVS.HQLVQCIYKKTS
F6VXB8_MOUSE/136-270PE----S-----------------GDYFIYS--QITFR......GTTSVCGDISRG.....RRPNKP.DSITMVITKVAD
H2Y3R5_CIOIN/179-304PV----A-----------------GVYFVYS--QVVFN............................V.TNLPFMVSEIGV
TNFA_SHEEP/103-234PT----D-----------------GLYLIYS--QVLFR......GHGCPST...............P.LFLTHTISRIAV
TNFA_CALJA/101-230PS----E-----------------GLYLVYS--QVLFK......GQGCPSN...............F.MLLTHSISRIAV
Q1L8A5_DANRE/102-233PD----D-----------------GIYFVYS--QVSLH.......ISCTSELT...........EEQ.VLMSHAVMRFSE

PF00386

C1QA_MOUSE/116-241AV----P-----------------GFYYFNF--QVISK------------------------------WDLCLFIKSS..
C1QC_MOUSE/122-243EV----P-----------------GLYYFVY--YTS..------------------------------..HTANLCVH..
MMRN2_HUMAN/827-946PE----R-----------------GVYLFAV--SVE..------------------------------FGPGPGTG.Q..
C1QT8_HUMAN/118-246TV----P-----------------GVYFLSL--NVH..------------------------------TWNYKETYLH..
C1QT6_HUMAN/126-254PL----R-----------------GIYFFSL--NVH..------------------------------SWNYKETYVH..
MMRN2_MOUSE/821-940PK----R-----------------GVYLFAV--SIT..------------------------------FGPGPGMG.Q..
CAPR2_DANRE/786-911PA----T-----------------GAYVFIF--HIL.K------------------------------LAISVPLYIN..
C1T9A_HUMAN/203-329HI----A-----------------GVYYFTY--HIT..------------------------------.VFSRNVQVS..
MMRN1_HUMAN/1102-1225PY----L-----------------GVYVFKY--TIESF------------------------------SAHISGF.....
C1QT4_MOUSE/30-155RV----P-----------------GAYFFSF--TAG..------------------------------KAPHKSLSVM..
C1QC_HUMAN/121-242KV----P-----------------GLYYFVY--HAS..------------------------------..HTANLCVL..
C1QT4_MOUSE/176-309RL----P-----------------GAYFFSF--TLG..------------------------------KLPRKTLSVK..
C1QA_HUMAN/116-241TV----P-----------------GYYYFTF--QVLSQ------------------------------WEICLSIVSS..
C1QA_PIG/118-243DV----P-----------------GYYYFTF--QVVSK------------------------------WDLCLYIMSS..
C1QL3_MOUSE/128-252SI----P-----------------GIYFFTY--HVLMR------------------------------GGDGTSMWAD..
CO8A2_MOUSE/572-696PV----G-----------------GVYYFAY--HVH..------------------------------.VKGTNVWVA..
D6R934_HUMAN/121-245KV----P-----------------GLYYFTY--HAS..------------------------------..SRGNLCVN..
Q9GQV4_STRPU/36-175PL----E-----------------GVYYFYY--SFSSE------------------------------TMDEETRVELFK
CO8A1_RABIT/617-741EV----P-----------------GVYYFAY--HVH..------------------------------.CKGGNVWVA..
COAA1_BOVIN/547-671KI----P-----------------GIYYFSY--HIH..------------------------------.VKGTHAWVG..
C1QT5_MOUSE/105-232QV----P-----------------GVYYFAV--HAT..------------------------------.VYRASLQFD..
C1QT2_HUMAN/151-275GV----P-----------------GIYYFTY--DIT..------------------------------.LANKHLAIG..
C1QT3_MOUSE/119-242PV----S-----------------GVYFFTF--SMM.K------------------------------HEDVEEVYVY..
C1QT7_MOUSE/149-273AF----P-----------------GIYYFSY--DIT..------------------------------.LANKHLAIG..
F1NRD4_CHICK/112-237SI----P-----------------GTYFFAY--HLT..------------------------------.VYMTDVKVS..
F1QH04_DANRE/118-238TI----T-----------------GMYYISY--QIS..------------------------------..FQQSACLK..
F1R093_DANRE/91-222PV----K-----------------GVYFFNL--VLF..------------------------------THDALSAGVK..
F1R9R1_DANRE/772-890QI----P-----------------GVYEFEF--SCI..------------------------------.GTRSLGFVT..
F7DZE7_HORSE/109-234NI----P-----------------GLYYFSY--HIT..------------------------------.VYLKDVKVS..
F7EBM1_XENTR/112-237AI----K-----------------GLYQFSY--HLT..------------------------------.VYMKDVKVG..
Q4KMC6_DANRE/109-237RV----P-----------------GVYYFAV--HAT..------------------------------.VYRSSLQFD..
C1QT1_MOUSE/147-275YV----P-----------------GIYFFSL--NVH..------------------------------TWNQKETYLH..

PF08949

P5_BPPRD/122-340KRISGGS-----------------GITVTDYGDQVEIEASGGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGA

PF05475

GP3D_CHLT2/119-264TP-KSSG-----------------SMFLVSA--DI---------------------------------IASRMEGGVVLA
Q821C4_CHLCV/119-264TP-DNAD-----------------SMFLISA--DI---------------------------------IASRMEGNVVLA
Q46275_CHLPN/122-267TP-DNAN-----------------SMFLICA--DI---------------------------------IATRMEGTVALA

PF12956

Q8A8D4_BACTN/3-242MIDLKNQQKDQNVADFNGVGKSKLTMSLGYKDGNYPSESQVPIYTSQDVTAKYAVKLRLKGELLVSGDEWMIDYVYAQLA
R7NWP5_9BACE/1-237KFDPKNAVSDVTMEGFRGEGKSEMGMSNSYYDGNFPEEYRQPIFMNDNPAKKYRVKFRLKGEFRYYTEHWYTDYIYMMLS
R5UHF8_9BACE/2-242MINLKNQSGTREVAEFNGVGKSVLTMSLGYKDGNYPVESQIPVYTSADATASYAIKLRLKGELTLTDDEWMIDYVYAQLA
R6D787_9BACE/1-240MVNLKNQLAGKEAEGFNGIGKSGLTMSLGYKNGNYPQESQIPVYTSSDVTTAYAVKLRLKGELTLSGGEWMIDYVYAQLA

PF16532

Q716G6_BPSFV/108-282PT----A-----------------PTNLVSLLKTLTPSSGTLAPFFDTVNNKMVV-------------FNENKTLFFKLS

PF00229

TNF15_HUMAN/117-251SY..PE---PTQLLMGTK.SVCEVGSN.........WFQPIYLGAMFSLQEG------DK----LMVN.-----------
TNF10_HUMAN/152-280Y...PD---PILLMKSAR.NSCWSKDAEY.......GLYSIYQGGIFELKEN------DR----IFVS.-----------
Q90WT9_CHICK/158-285SY..SQ---PILLLKGVG.TKCWAPEAEY.......GLHALYQGGLFELKAG------DE----LFVS.-----------
TNFB_MOUSE/74-202QY..PF---HVPLLSAQKSVYPGLQGP.........WVRSMYQGAVFLLSKG------DQ----LSTH.-----------
TNFL8_HUMAN/113-230....IK---KQALVTVCE.SGMQTKH..........VYQNLSQFLLDYLQVN------TT----ISVN.-----------
TNF10_MOUSE/156-290SY..PD---PIVLMKSAR.NSCWSRDAEY.......GLYSIYQGGLFELKKN------DR----IFVS.-----------
TNFL9_MOUSE/164-302QV..DD---FDNLALTVELFPCSMENKLVD....RSWSQLLLLKAGHRLSVG------LR----AYLHG-----------
TNFL8_MOUSE/118-235....IK---KQTLVTVCE.SGVQSKN..........IYQNLSQFLLHYLQVN------ST----ISVR.-----------
TNFC_HUMAN/102-243AYGPGT---PELLLEGAE.TVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRG------ER----VYVN.-----------
CD40L_MOUSE/137-260S...GS---ERILLKAANTHSSSQLC..........EQQSVHLGGVFELQAG------AS----VFVN.-----------
TNF12_HUMAN/131-248....VD---GVLALRCLEEFSATAASSLG......PQLRLCQVSGLLALRPG------SS----LRIR.-----------
TNFB_HUMAN/77-205QY..PF---HVPLLSSQKMVYPGLQEP.........WLHSMYHGAAFQLTQG------DQ----LSTH.-----------
Q6DHG9_DANRE/158-298SY..QV---PILLMKNAR.TTCWSRDSEY.......GLYSIYQAGLFQLGSG------DR----VFVT.-----------
TNFC_MOUSE/168-305AYGRGS---PELLLEGAE.TVTPVVDPIGYG...SLWYTSVGFGGLAQLRSG------ER----VYVN.-----------
TNFL9_HUMAN/107-240A...AG---AAALALTVDLPPASSEAR.........NSAFGFQGRLLHLSAG------QR----LGVH.-----------
TNF11_HUMAN/185-313KI..PS---SHTLMKGGS.TKYWSGNSEF.......HFYSINVGGFFKLRSG------EE----ISIE.-----------
CD40L_FELCA/137-260S...GS---ERVLLRAANARSSSKPC..........GQQSIHLGGVFELHPG------AS----VFVN.-----------
TNF14_MOUSE/110-239RY..PK---ELELLVSRR.SPCGRANSSR......VWWDSSFLGGVVHLEAG------EE----VVVR.-----------
CD40L_CHICK/152-272M...EE---DRLLMKGLDTHSTSTALC.........ELQSIREGGVFELRQG------DM----VFVN.-----------
TNFL6_RAT/157-278KY..PG---DLVLMEEKKLNYCTTGQI.........WAHSSYLGAVFNLTVA------DH----LYVN.-----------
TNFA_RABIT/105-235SY..PN---KVNLLSAIK.SPCHRETPEEAE..PMAWYEPIYLGGVFQLEKG------DR----LSTE.-----------
F1NHP5_CHICK/157-290.Y..PD---PILLMKSAR.TSCWSKKAEY.......GLYSIYQGGVFQLKRE------DR----IFVS.-----------
F1Q767_DANRE/188-315.Y..LN---PIQLLKGVG.TKCWAPDAEY.......ALHSVYQGGLFELRAG------DE----VFVS.-----------
F6VXB8_MOUSE/136-270SY..PE---PARLLTGSK.SVCEISNN.........WFQSLYLGATFSLEEG------DR----LMVN.-----------
H2Y3R5_CIOIN/179-304NV..DG---QSTFSRCQFSNTLTRSTPRASS..TRKRFVTCHSNGIVYMKAN------HG----VSLS.-----------
TNFA_SHEEP/103-234SY..QT---KVNILSAIK.SPCHRETLEGAE..AKPWYEPIYQGGVFQLEKG------DR----LSAE.-----------
TNFA_CALJA/101-230SY..QA---KVNLLSAIK.SPCQRETPQGAK..TNPWYEPIYLGGVFQLEKG------DR----LSAE.-----------
Q1L8A5_DANRE/102-233SY..GG---KKPLFSAIR.SICTQEPESEN.....LWYNTIYLGAAFHLREG------DR----LGTD.-----------

PF00386

C1QA_MOUSE/116-241SG--GQ...PRDSLSFSNTNNKGL..----------.FQVLAGGTVLQLRRG------DE----VWIEK-----------
C1QC_MOUSE/122-243LN--LN...LARVASFCDHMFNSK..----------..QVSSGGVLLRLQRG------DE----VWLSV-----------
MMRN2_HUMAN/827-946LV--FG...GHHRTPVCTTGQGSG..----------..STATVFAMAELQKG------ER----VWFEL-----------
C1QT8_HUMAN/118-246IM--LN...RRPAAVLYAQPSERS..----------..VMQAQSLMLLLAAG------DA----VWVRM-----------
C1QT6_HUMAN/126-254IM--HN...QKEAVILYAQPSERS..----------..IMQSQSVMLDLAYG------DR----VWVRL-----------
MMRN2_MOUSE/821-940LV--FE...GHHRVPVYSTEQRGG..----------..STATTFAMVELQKG------ER----AWFEL-----------
CAPR2_DANRE/786-911LM--RN...EEVMVSAYANDGAPD..----------.HETASNHAVLQLFQG------DQ----VWLRL-----------
C1T9A_HUMAN/203-329LV--KN...GVKILHTKDAYMSSE..----------..DQASGGIVLQLKLG------DE----VWLQV-----------
MMRN1_HUMAN/1102-1225LV--VD...GIDKLAFESENINSEIH----------CDRVLTGDALLELNYG------QE----VWLRL-----------
C1QT4_MOUSE/30-155LV--RN...RDEVQALAFDEQRRPG.----------ARRAASQSAMLQLDYG------DT----VWLRL-----------
C1QC_HUMAN/121-242LY--RS...GVKVVTFCGHTSKTN..----------..QVNSGGVLLRLQVG------EE----VWLAV-----------
C1QT4_MOUSE/176-309LM--KN...RDEVQAMIYDDGASR..----------RREMQSQSVMLPLRRG------DA----VWLLS-----------
C1QA_HUMAN/116-241SR--GQ...VRRSLGFCDTTNKGL..----------.FQVVSGGMVLQLQQG------DQ----VWVEK-----------
C1QA_PIG/118-243RR--DQ...VQQSLGFCDFNSKGL..----------.FQVVSGGTVLQLQRG------DK----VWIQR-----------
C1QL3_MOUSE/128-252LC--KN...NQVRASAIAQDADQN..----------.YDYASNSVVLHLEPG------DE----VYIKL-----------
CO8A2_MOUSE/572-696LY--KN...NVPATYTYDEYKKGY..----------.LDQASGGAVLQLRPN------DQ----VWVQM-----------
D6R934_HUMAN/121-245LM--RGRERAQKVVTFCDYAYNTF..----------..QVTTGGMVLKLEQG------EN----VFLQA-----------
Q9GQV4_STRPU/36-175LE--AGKDLKSATLQVFQSITPALVS----------PLDSASASVMVELKRD------DE----VFLRL-----------
CO8A1_RABIT/617-741LF--KN...NEPVMYTYDEYKKGF..----------.LDQASGSAVLLLRPG------DR----VFLQM-----------
COAA1_BOVIN/547-671LY--KN...GTPVMYTYDEYIKGY..----------.LDQASGSAVIDLTEN------DQ----VWLQL-----------
C1QT5_MOUSE/105-232LV--KN...GQSIASFFQYFGGWP..----------KPASLSGGAMVRLEPE------DQ----VWVQV-----------
C1QT2_HUMAN/151-275LV--HN...GQYRIRTFDANTGNH..----------..DVASGSTILALKQG------DE----VWLQI-----------
C1QT3_MOUSE/119-242LM--HN...GNTVFSMYSYETKGK..----------.SDTSSNHAVLKLAKG------DE----VWLRM-----------
C1QT7_MOUSE/149-273LV--HN...GQYRIRTFDANTGNH..----------..DVASGSTVIYLQPE------DE----VWLEI-----------
F1NRD4_CHICK/112-237LY--KK...DKAVIFTYDQFQQNN..----------.VDQASGSVLLHLSLG------DE----VWLQV-----------
F1QH04_DANRE/118-238IQ--VG...AEEKVKFCDSPKLIS..----------...GTAASVVLKLNKG------DK----VSVQS-----------
F1R093_DANRE/91-222LL--KN...DDHVVGVTDNPPTED..----------KEDTASNSVSLLLEEG------DQ----ISVKL-----------
F1R9R1_DANRE/772-890LK--KN...NRVELTPETVALNTR..----------..SLAEGKAVLSLQRG------DR----VYVEV-----------
F7DZE7_HORSE/109-234LY--KK...DKAVLFTYDQYQDKN..----------.LDQASGSVLLYLEKG------DQ----VWLQV-----------
F7EBM1_XENTR/112-237LY--RN...NKPVMFTFDQFQSNN..----------.VDQASGSVLLHLEVG------DE----VWLQI-----------
Q4KMC6_DANRE/109-237LM--KN...GHTVASYFQIFGNWS..----------KPASLSGGTLVHLIPG------DQ----VWVQM-----------
C1QT1_MOUSE/147-275IM--KN...EEEVVILYAQVSDRS..----------..IMQSQSLMMELREE------DE----VWVRL-----------

PF08949

P5_BPPRD/122-340LT--VNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYG------SS----DFVVACPASSLTAGGT

PF05475

GP3D_CHLT2/119-264LV-------REGDSKPYAISYGYSSGVPNLCSLRTRIINTGLTPTTYSLRVG------GLESGVVWVN------------
Q821C4_CHLCV/119-264LV-------KEGDSAPCAVSYGYSSGIPNVCSLRTAVSNSGANPVTFSLRVG------GMESGVVWVN------------
Q46275_CHLPN/122-267LV-------KEGDLSPCSISYGYSAGYPNIISLRATVGNKTTAPVKFSLRAG------GMDSGVVWVN------------

PF12956

Q8A8D4_BACTN/3-242SL--FQ---PYPPANFPEVFMCKGGM.KLG------TFDSFRRTCTFDITYDRSDLSFSQLYFNLFINL-----------
R7NWP5_9BACE/1-237AS--FL---PYPPAVSEDVFLCKSNE.AFA------ELNTAERLYTFDVQYDRWNLSFTELYLNIFVNL-----------
R5UHF8_9BACE/2-242GL--FQ---PYPLASFPEVFMCKGGEQSFA------TFDSFRRTWTFDITYDHSELSFSQLYFNLFVNL-----------
R6D787_9BACE/1-240SL--FQ---PYPPTAFPEVFMCKGGEQSFA------YFDSFRRTWTFDIEYNRSNLSFSQLYFNLFVNL-----------

PF16532

Q716G6_BPSFV/108-282IV--GTWPSGTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKD------------GFLAT-----------

PF00229

TNF15_HUMAN/117-251--------.VS..DISLVDYTK.EDKTFFGAFLL--------
TNF10_HUMAN/152-280--------.VT..NEHLIDMD..HEASFFGAFLV--------
Q90WT9_CHICK/158-285--------.VS...SLAIDYSD.AAASYFGAFRL--------
TNFB_MOUSE/74-202--------.TD..GISHLHFS..PSSVFFGAFAL--------
TNFL8_HUMAN/113-230--------.VD..TFQYIDTSTFPLENVLSIFLY--------
TNF10_MOUSE/156-290--------.VT..NEHLMDLD..QEASFFGAFLI--------
TNFL9_MOUSE/164-302--------AQD..AYRDWELSY.PNTTSFGLFLV--------
TNFL8_MOUSE/118-235--------.VD..NFQYVDTNTFPLDNVLSVFLY--------
TNFC_HUMAN/102-243--------.IS..HPDMVDFA..RGKTFFGAVMV--------
CD40L_MOUSE/137-260--------.VT..EASQVIHR..VGFSSFGLLKL--------
TNF12_HUMAN/131-248--------.....TLPWAHLKAAPFLTYFGLFQV--------
TNFB_HUMAN/77-205--------.TD..GIPHLVLS..PSTVFFGAFAL--------
Q6DHG9_DANRE/158-298--------.VS..NVSTIDMD..EKSSFFGAFLV--------
TNFC_MOUSE/168-305--------.IS..HPDMVDYR..RGKTFFGAVMV--------
TNFL9_HUMAN/107-240--------.LHTEARARHAWQLTQGATVLGLFRV--------
TNF11_HUMAN/185-313--------.VS..NPSLLDPD..QDATYFGAFKV--------
CD40L_FELCA/137-260--------.VT..DPSQVSHG..TGFTSFGLLKL--------
TNF14_MOUSE/110-239--------.VP..GNRLVRPRD.GTRSYFGAFMV--------
CD40L_CHICK/152-272--------.VT..DSTAVNVN..PGNTYFGMFKL--------
TNFL6_RAT/157-278--------.IS..QLSLINFE..ESKTFFGLYKL--------
TNFA_RABIT/105-235--------.VN..QPEYLDLAE.SGQVYFGIIAL--------
F1NHP5_CHICK/157-290--------.VS..NSDIVDMD..KEASFFGAFMI--------
F1Q767_DANRE/188-315--------.VS..SPTMVYGE..DSSSYFGAFRL--------
F6VXB8_MOUSE/136-270--------.VS..DISLVDYTK.EDKTFFGAFLL--------
H2Y3R5_CIOIN/179-304--------.VN..PPSVEVFLA.PQYTYFGAFLI--------
TNFA_SHEEP/103-234--------.IN..LPEYLDYAE.SGQVYFGIIAL--------
TNFA_CALJA/101-230--------.IN..LPDYLDLAE.SGQVYFGII..--------
Q1L8A5_DANRE/102-233--------.TTTALLPMVEND..NGKTFFGVFG.--------

PF00386

C1QA_MOUSE/116-241--------DPA...KGRIYQGT-EADSIFSGFLI--------
C1QC_MOUSE/122-243--------NDY...NGMVGIEG-.SNSVFSGFLL--------
MMRN2_HUMAN/827-946--------T.....QGSITKRS-LSGTAFGGFLM--------
C1QT8_HUMAN/118-246--------FQRDRDNAIYGEHG-DLYITFSGHLV--------
C1QT6_HUMAN/126-254--------FKRQRENAIYSNDF-DTYITFSGHLI--------
MMRN2_MOUSE/821-940--------I.....QGSATKGS-QPGTAFGGFLM--------
CAPR2_DANRE/786-911--------H.....RGAIYGSS-WKYSTFSGFLL--------
C1T9A_HUMAN/203-329--------TGGERFNGLFADED-.DDTTFTGFLL--------
MMRN1_HUMAN/1102-1225--------A.....KGTIPAKF-PPVTTFSGYLL--------
C1QT4_MOUSE/30-155--------H.....GAPQYALG-APGATFSGYLV--------
C1QC_HUMAN/121-242--------NDY...YDMVGIQG-.SDSVFSGFLL--------
C1QT4_MOUSE/176-309--------HDHDGYGA..YSNH-GKYITFSGFLV--------
C1QA_HUMAN/116-241--------DPK...KGHIYQGS-EADSVFSGFLI--------
C1QA_PIG/118-243--------DPN...KGRIYQGS-EADSVFSGFLI--------
C1QL3_MOUSE/128-252--------DG....GKAHGGNN-NKYSTFSGFII--------
CO8A2_MOUSE/572-696--------PSDQ.ANGLYSTEY-.IHSSFSGFLL--------
D6R934_HUMAN/121-245--------TDK...NSLLGMEG-.ANSIFSGFLL--------
Q9GQV4_STRPU/36-175--------A.....PGLLDADA-DRPLLFTGYLV--------
CO8A1_RABIT/617-741--------PSEQ.AAGLYAGQY-.VHSSFSGYLL--------
COAA1_BOVIN/547-671--------PNAG.SNGLYSPEY-.VHSSFSGFLV--------
C1QT5_MOUSE/105-232--------GVGD.YIGIYASIK-.TDSTFSGFLV--------
C1QT2_HUMAN/151-275--------FYSE.QNGLFYDPY-WTDSLFTGFLI--------
C1QT3_MOUSE/119-242--------G.....NGALHGDH-QRFSTFAGFLL--------
C1QT7_MOUSE/149-273--------FFND.QNGLFSDPG-WADSLFSGFLL--------
F1NRD4_CHICK/112-237--------YGEGNNNGVYADNI-.NDSTFMGFLL--------
F1QH04_DANRE/118-238--------TGE...STVFSRD.-.TDCTFTGFML--------
F1R093_DANRE/91-222--------IAH...RRIYTDGF-.RRNTFSGHLL--------
F1R9R1_DANRE/772-890--------SRS.......ANGI-GFSSYFSGHIL--------
F7DZE7_HORSE/109-234--------YGDGDHNGLYADNV-.NDSTFTGFLL--------
F7EBM1_XENTR/112-237--------YGDESFSGIYGDNL-.NDSTFTGILL--------
Q4KMC6_DANRE/109-237--------ALGE.YIG.FYSSS-KTDSTFTGFLV--------
C1QT1_MOUSE/147-275--------FKGERENAIFSDEF-DTYITFSGYLV--------

PF08949

P5_BPPRD/122-340ISLLIYCNVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN

PF05475

GP3D_CHLT2/119-264---------ALSNGNDILGITNTSNVSFLEVIPQTNA-----
Q821C4_CHLCV/119-264---------ALANGDSILGTTTTSNISFLEVKQQTNG-----
Q46275_CHLPN/122-267---------AMPNGEKILGVDAVSKITILEVKPQTNG-----

PF12956

Q8A8D4_BACTN/3-242---------AGQKRENRVRLRI-DKESYFELYEQSE------
R7NWP5_9BACE/1-237---------IGQKESEKVSLSI-DKESFFEIYEI..------
R5UHF8_9BACE/2-242---------AGQKREDRIRLRI-DKDSYFKIYKIKE------
R6D787_9BACE/1-240---------AGQKREDRVRLRI-DKDSYFEIYKLKE------

PF16532

Q716G6_BPSFV/108-282-------------NGSTLTIQ--SNGASFTATTIKIIAEQ--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window