Sequence alignment for CL0100

PF00229

TNF15_HUMAN/117-251LHWEHELG..L----------------------AFTKNRMNYTNKF..LLIPESGDYFIYSQVTFR......GMTSECSE
TNF10_HUMAN/152-280NSWESSRS..G----------------------HSFLSNLHLRNGE..LVIHEKGFYYIYSQTYFR...........FQE
Q90WT9_CHICK/158-285TRWEDST...I----------------------HSHLQNITYRDGR..LRVNQAGKYYVYSQIYFRYSRDGAGARVS...
TNFB_MOUSE/74-202LLWRASTD..R----------------------AFLRHGFSLSNNS..LLIPTSGLYFVYSQVVFS......GESCSPRA
TNFL8_HUMAN/113-230LSWNKDGI...----------------------...LHGVRYQDGN..LVIQFPGLYFIICQLQFL.......VQCPNN.
TNF10_MOUSE/156-290ESWESSRK..G----------------------HSFLNHVLFRNGE..LVIEQEGLYYIYSQTYFR......FQEAEDAS
TNFL9_MOUSE/164-302LNWHSQDGAGS----------------------SYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSP....TFTNTGHK.
TNFL8_MOUSE/118-235LSWNEDGT...----------------------...IHGLIYQDGN..LIVQFPGLYFIVCQLQFL.......VQCSNH.
TNFC_HUMAN/102-243LGWETTKE..Q----------------------AFLTSGTQFSDAE.GLALPQDGLYYLYCLVGYR......GRAPPGGG
CD40L_MOUSE/137-260LQWAKKGY..Y----------------------TMKSNLVMLENGK.QLTVKREGLYYVYTQVTFC......SNREPSS.
TNF12_HUMAN/131-248SGWEEARI..N----------------------SSSPLRYNRQIGE..FIVTRAGLYYLYCQVHFD.......EGKA...
TNFB_HUMAN/77-205LLWRANTD..R----------------------AFLQDGFSLSNNS..LLVPTSGIYFVYSQVVFS......GKAYSPKA
Q6DHG9_DANRE/158-298QSWESEK...G----------------------LAFLQNVELSDGE..LVVPQAGLYYIYSQTYFR......HTLIEEDE
TNFC_MOUSE/168-305LSWEASQE..E----------------------AFLRSGAQFSPTH.GLALPQDGVYYLYCHVGYR......GRTPPAGR
TNFL9_HUMAN/107-240LSWYSDPGLAG----------------------VSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRV..VAGEGSG...
TNF11_HUMAN/185-313SSWYHDR...G----------------------WAKISNMTFSNGK..LIVNQDGFYYLYANICFR......HHETSGDL
CD40L_FELCA/137-260LQWAPKGY..Y----------------------TISSNLVTLENGK.QLAVKRQGLYYIYAQVTFC......SNREASS.
TNF14_MOUSE/110-239LLWETRL...G----------------------LAFLRGLTYHDGA..LVTMEPGYYYVYSKVQLS......GVGCPQGL
CD40L_CHICK/152-272LKWMTTS...Y----------------------APTSSLISYHEGK..LKVEKAGLYYIYSQVSFC.....TKAAAS...
TNFL6_RAT/157-278LEWEDTY...G----------------------TALISGVKYKKGG..LVINEAGLYFVYSKVYFR......GQSCN...
TNFA_RABIT/105-235LQWLSQRA..N----------------------ALLANGMKLTDNQ..LVVPADGLYLIYSQVLFS......GQGCRS..
F1NHP5_CHICK/157-290.SWESSRR..G----------------------HSFLYNVELWNGE..LVVPQTGFYYIYSQTYFR......FRENEDED
F1Q767_DANRE/188-315.TWANKS...F----------------------GAHLYNMTLTNGR..LRVPQDGRYYLYSQVYFR......YPSPSDSD
F6VXB8_MOUSE/136-270LHWEHDLG..M----------------------AFTKNGMKYINKS..LVIPESGDYFIYSQITFR......GTTSVCGD
H2Y3R5_CIOIN/179-304.DWAPPD...S----------------------HFKGFGTRHLNNDGYFTVPVAGVYFVYSQVVFN..............
TNFA_SHEEP/103-234LRWGDSYA..N----------------------ALMANGVELKDNQ..LVVPTDGLYLIYSQVLFR......GHGCPST.
TNFA_CALJA/101-230LQWLNRRA..N----------------------ALLANGVELRDNQ..LVVPSEGLYLVYSQVLFK......GQGCPSN.
Q1L8A5_DANRE/102-233LDWRDDQD..Q----------------------AFSSGGLKLVNRE..IIIPDDGIYFVYSQVSLH.......ISCTSEL

PF00386

C1QA_MOUSE/116-241AFSAIRQNPMTLG.N........VVIFDK....VLTNQESPYQNHTGRFICAVPGFYYFNFQVISK--------------
C1QC_MOUSE/122-243VFTVTRQTTQYPE.A.NA.....LVRFNS....VVTNPQGHYNPSTGKFTCEVPGLYYFVYYTS..--------------
MMRN2_HUMAN/827-946AFYASFSEGTAAL.Q........TVKFNT....TYINIGSSYFPEHGYFRAPERGVYLFAVSVE..--------------
C1QT8_HUMAN/118-246AFSVGRREGLHSS.DHFQ.....AVPFDT....ELVNLDGAFDLAAGRFLCTVPGVYFLSLNVH..--------------
C1QT6_HUMAN/126-254AFSVGRKTALHSG.EDFQ.....TLLFER....VFVNLDGCFDMATGQFAAPLRGIYFFSLNVH..--------------
MMRN2_MOUSE/821-940AFYAGSSEGATAL.Q........MVKFNT....TSINVGSSYFPEHGYFRAPKRGVYLFAVSIT..--------------
CAPR2_DANRE/786-911AFSAARTANFAPG.TLDQ.....PIAFDL....LHTNLGDMFDTGSGRFTCPATGAYVFIFHIL.K--------------
C1T9A_HUMAN/203-329AFTVGLTVLSKFP.SSDM.....PIKFDK....ILYNEFNHYDTAAGKFTCHIAGVYYFTYHIT..--------------
MMRN1_HUMAN/1102-1225AFFASHTYGMTIP.G........PILFNN....LDVNYGASYTPRTGKFRIPYLGVYVFKYTIESF--------------
C1QT4_MOUSE/30-155AFSAARTTPLEGT.SEM......AVTFDK....VYVNIGGDFDAATGRFRCRVPGAYFFSFTAG..--------------
C1QC_HUMAN/121-242VFTVTRQTHQPPAPNS.......LIRFNA....VLTNPQGDYDTSTGKFTCKVPGLYYFVYHAS..--------------
C1QT4_MOUSE/176-309AFSAARTRSLVGS.DAAPGPRHRPLAFDT....ELVNIGGDFDAAAGVFRCRLPGAYFFSFTLG..--------------
C1QA_HUMAN/116-241AFSAIRRNPPMGGN.........VVIFDT....VITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQ--------------
C1QA_PIG/118-243AFSAVRQNPPTSGN.........VVIFDE....VITNQEGAYKSQLGQFICDVPGYYYFTFQVVSK--------------
C1QL3_MOUSE/128-252AFYAGLKRQHEGYE.........VLKFDD....VVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMR--------------
CO8A2_MOUSE/572-696AFTAVLT..SPFP.ASGM.....PVRFDR....TLYNGHSGYNPATGIFTCPVGGVYYFAYHVH..--------------
D6R934_HUMAN/121-245AFSATRTINVPLRRDQ.......TIRFDH....VITNMNNNYEPRSGKFTCKVPGLYYFTYHAS..--------------
Q9GQV4_STRPU/36-175AFTVERTADMSDSTTSRD.....IGAFNKNSQKIYLNIGEALDVVTGRFKVPLEGVYYFYYSFSSE--------------
CO8A1_RABIT/617-741AFTAELT..APFP.PVGA.....PIKFDR....LLYNGRQNYNPQTGIFTCEVPGVYYFAYHVH..--------------
COAA1_BOVIN/547-671AFTVILS..KAYP.AIGT.....PIPFDK....ILYNKQQHYDPRTGIFTCKIPGIYYFSYHIH..--------------
C1QT5_MOUSE/105-232AFSAKRSESRVPP.PADT.....PLPFDR....VLLNEQGHYDPTTGKFTCQVPGVYYFAVHAT..--------------
C1QT2_HUMAN/151-275AFSVAVT..KSYP.RERL.....PIKFDK....ILMNEGGHYNASSGKFVCGVPGIYYFTYDIT..--------------
C1QT3_MOUSE/119-242AFMASLATHFSNQ.NS.......GIIFSS....VETNIGNFFDVMTGRFGAPVSGVYFFTFSMM.K--------------
C1QT7_MOUSE/149-273AFSVGIT..TSYP.EERL.....PIIFNK....VLFNEGEHYNPATGKFICAFPGIYYFSYDIT..--------------
F1NRD4_CHICK/112-237AFSVGLTERAPHP.NV.......PIRFTK....IFYNEQNHYDSSTGKFLCSIPGTYFFAYHLT..--------------
F1QH04_DANRE/118-238VFSYKKSQKLEKI.LQDK.....LVVFDV....PLISGIDGVLDGEGYFDVTITGMYYISYQIS..--------------
F1R093_DANRE/91-222AFSASLLSSHNIK.YIGPYAEDTMIVYGK....IFTNIGNAYNTTTGIFSAPVKGVYFFNLVLF..--------------
F1R9R1_DANRE/772-890AFFASVNSILPAT.A..K.....VVVFGQ....VLYNGQNHYNQTSGMFLCQIPGVYEFEFSCI..--------------
F7DZE7_HORSE/109-234AFSVGLETRVTVP.NV.......PIRFTK....IFYNQQNHYDGSTGKFHCNIPGLYYFSYHIT..--------------
F7EBM1_XENTR/112-237AFSMGLSTKSSLP.NV.......PIRFTK....VFYNEQRHYDDSTGKFRCAIKGLYQFSYHLT..--------------
Q4KMC6_DANRE/109-237AFSAKLSEARTTPLTVGD.....SVRFDK....VILNEQGDYNPETGRFTCRVPGVYYFAVHAT..--------------
C1QT1_MOUSE/147-275AFSVGRKKALHSN.DYFQ.....PVVFDT....EFVNLYKHFNMFTGKFYCYVPGIYFFSLNVH..--------------

PF00229

TNF15_HUMAN/117-251IRQ......AGRPNKPDSITVVITKVTDSY..PE---PTQLLMGTK.SVCEVGSN.........WFQPIYLGAMFSLQEG
TNF10_HUMAN/152-280EIK......ENTKND.KQMVQYIYKYTSY...PD---PILLMKSAR.NSCWSKDAEY.......GLYSIYQGGIFELKEN
Q90WT9_CHICK/158-285................VPQLVQCINWKTSY..SQ---PILLLKGVG.TKCWAPEAEY.......GLHALYQGGLFELKAG
TNFB_MOUSE/74-202I...........PTP.IYLAHEVQLFSSQY..PF---HVPLLSAQKSVYPGLQGP.........WVRSMYQGAVFLLSKG
TNFL8_HUMAN/113-230..............S.VDLKLELLINKH....IK---KQALVTVCE.SGMQTKH..........VYQNLSQFLLDYLQVN
TNF10_MOUSE/156-290KMVS.....KDKVRT.KQLVQYIY.KYTSY..PD---PIVLMKSAR.NSCWSRDAEY.......GLYSIYQGGLFELKKN
TNFL9_MOUSE/164-302..............V.QGWVSLVLQAKPQV..DD---FDNLALTVELFPCSMENKLVD....RSWSQLLLLKAGHRLSVG
TNFL8_MOUSE/118-235..............S.VDLTLQLLINSK....IK---KQTLVTVCE.SGVQSKN..........IYQNLSQFLLHYLQVN
TNFC_HUMAN/102-243DP.........QGRS.VTLRSSLYRAGGAYGPGT---PELLLEGAE.TVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRG
CD40L_MOUSE/137-260..............Q.RPFIVGLWLKPSS...GS---ERILLKAANTHSSSQLC..........EQQSVHLGGVFELQAG
TNF12_HUMAN/131-248................VYLKLDLL........VD---GVLALRCLEEFSATAASSLG......PQLRLCQVSGLLALRPG
TNFB_HUMAN/77-205T...........SSP.LYLAHEVQLFSSQY..PF---HVPLLSSQKMVYPGLQEP.........WLHSMYHGAAFQLTQG
Q6DHG9_DANRE/158-298SAREDEYGSMGESVRGKPMLQYVYKKVSSY..QV---PILLMKNAR.TTCWSRDSEY.......GLYSIYQAGLFQLGSG
TNFC_MOUSE/168-305S..........RARS.LTLRSALYRAGGAYGRGS---PELLLEGAE.TVTPVVDPIGYG...SLWYTSVGFGGLAQLRSG
TNFL9_HUMAN/107-240..............S.VSLALHLQPLRSA...AG---AAALALTVDLPPASSEAR.........NSAFGFQGRLLHLSAG
TNF11_HUMAN/185-313A...........TEY.LQLMVYVTKTSIKI..PS---SHTLMKGGS.TKYWSGNSEF.......HFYSINVGGFFKLRSG
CD40L_FELCA/137-260..............Q.APFIASLCLHSPS...GS---ERVLLRAANARSSSKPC..........GQQSIHLGGVFELHPG
TNF14_MOUSE/110-239............ANG.LPITHGLYKRTSRY..PK---ELELLVSRR.SPCGRANSSR......VWWDSSFLGGVVHLEAG
CD40L_CHICK/152-272................APFTLYIYLYLPM...EE---DRLLMKGLDTHSTSTALC.........ELQSIREGGVFELRQG
TNFL6_RAT/157-278..............S.QPLSHKVYMRNFKY..PG---DLVLMEEKKLNYCTTGQI.........WAHSSYLGAVFNLTVA
TNFA_RABIT/105-235..............Y.VLLTHTVSRFAVSY..PN---KVNLLSAIK.SPCHRETPEEAE..PMAWYEPIYLGGVFQLEKG
F1NHP5_CHICK/157-290SGLL.....ERIKNP.KQLVQYIYKLTN.Y..PD---PILLMKSAR.TSCWSKKAEY.......GLYSIYQGGVFQLKRE
F1Q767_DANRE/188-315Q..........SSVS.HQLVQCIYKKTS.Y..LN---PIQLLKGVG.TKCWAPDAEY.......ALHSVYQGGLFELRAG
F6VXB8_MOUSE/136-270ISRG.....RRPNKP.DSITMVITKVADSY..PE---PARLLTGSK.SVCEISNN.........WFQSLYLGATFSLEEG
H2Y3R5_CIOIN/179-304..............V.TNLPFMVSEIGVNV..DG---QSTFSRCQFSNTLTRSTPRASS..TRKRFVTCHSNGIVYMKAN
TNFA_SHEEP/103-234..............P.LFLTHTISRIAVSY..QT---KVNILSAIK.SPCHRETLEGAE..AKPWYEPIYQGGVFQLEKG
TNFA_CALJA/101-230..............F.MLLTHSISRIAVSY..QA---KVNLLSAIK.SPCQRETPQGAK..TNPWYEPIYLGGVFQLEKG
Q1L8A5_DANRE/102-233T...........EEQ.VLMSHAVMRFSESY..GG---KKPLFSAIR.SICTQEPESEN.....LWYNTIYLGAAFHLREG

PF00386

C1QA_MOUSE/116-241----------------WDLCLFIKSS..SG--GQ...PRDSLSFSNTNNKGL..----------.FQVLAGGTVLQLRRG
C1QC_MOUSE/122-243----------------..HTANLCVH..LN--LN...LARVASFCDHMFNSK..----------..QVSSGGVLLRLQRG
MMRN2_HUMAN/827-946----------------FGPGPGTG.Q..LV--FG...GHHRTPVCTTGQGSG..----------..STATVFAMAELQKG
C1QT8_HUMAN/118-246----------------TWNYKETYLH..IM--LN...RRPAAVLYAQPSERS..----------..VMQAQSLMLLLAAG
C1QT6_HUMAN/126-254----------------SWNYKETYVH..IM--HN...QKEAVILYAQPSERS..----------..IMQSQSVMLDLAYG
MMRN2_MOUSE/821-940----------------FGPGPGMG.Q..LV--FE...GHHRVPVYSTEQRGG..----------..STATTFAMVELQKG
CAPR2_DANRE/786-911----------------LAISVPLYIN..LM--RN...EEVMVSAYANDGAPD..----------.HETASNHAVLQLFQG
C1T9A_HUMAN/203-329----------------.VFSRNVQVS..LV--KN...GVKILHTKDAYMSSE..----------..DQASGGIVLQLKLG
MMRN1_HUMAN/1102-1225----------------SAHISGF.....LV--VD...GIDKLAFESENINSEIH----------CDRVLTGDALLELNYG
C1QT4_MOUSE/30-155----------------KAPHKSLSVM..LV--RN...RDEVQALAFDEQRRPG.----------ARRAASQSAMLQLDYG
C1QC_HUMAN/121-242----------------..HTANLCVL..LY--RS...GVKVVTFCGHTSKTN..----------..QVNSGGVLLRLQVG
C1QT4_MOUSE/176-309----------------KLPRKTLSVK..LM--KN...RDEVQAMIYDDGASR..----------RREMQSQSVMLPLRRG
C1QA_HUMAN/116-241----------------WEICLSIVSS..SR--GQ...VRRSLGFCDTTNKGL..----------.FQVVSGGMVLQLQQG
C1QA_PIG/118-243----------------WDLCLYIMSS..RR--DQ...VQQSLGFCDFNSKGL..----------.FQVVSGGTVLQLQRG
C1QL3_MOUSE/128-252----------------GGDGTSMWAD..LC--KN...NQVRASAIAQDADQN..----------.YDYASNSVVLHLEPG
CO8A2_MOUSE/572-696----------------.VKGTNVWVA..LY--KN...NVPATYTYDEYKKGY..----------.LDQASGGAVLQLRPN
D6R934_HUMAN/121-245----------------..SRGNLCVN..LM--RGRERAQKVVTFCDYAYNTF..----------..QVTTGGMVLKLEQG
Q9GQV4_STRPU/36-175----------------TMDEETRVELFKLE--AGKDLKSATLQVFQSITPALVS----------PLDSASASVMVELKRD
CO8A1_RABIT/617-741----------------.CKGGNVWVA..LF--KN...NEPVMYTYDEYKKGF..----------.LDQASGSAVLLLRPG
COAA1_BOVIN/547-671----------------.VKGTHAWVG..LY--KN...GTPVMYTYDEYIKGY..----------.LDQASGSAVIDLTEN
C1QT5_MOUSE/105-232----------------.VYRASLQFD..LV--KN...GQSIASFFQYFGGWP..----------KPASLSGGAMVRLEPE
C1QT2_HUMAN/151-275----------------.LANKHLAIG..LV--HN...GQYRIRTFDANTGNH..----------..DVASGSTILALKQG
C1QT3_MOUSE/119-242----------------HEDVEEVYVY..LM--HN...GNTVFSMYSYETKGK..----------.SDTSSNHAVLKLAKG
C1QT7_MOUSE/149-273----------------.LANKHLAIG..LV--HN...GQYRIRTFDANTGNH..----------..DVASGSTVIYLQPE
F1NRD4_CHICK/112-237----------------.VYMTDVKVS..LY--KK...DKAVIFTYDQFQQNN..----------.VDQASGSVLLHLSLG
F1QH04_DANRE/118-238----------------..FQQSACLK..IQ--VG...AEEKVKFCDSPKLIS..----------...GTAASVVLKLNKG
F1R093_DANRE/91-222----------------THDALSAGVK..LL--KN...DDHVVGVTDNPPTED..----------KEDTASNSVSLLLEEG
F1R9R1_DANRE/772-890----------------.GTRSLGFVT..LK--KN...NRVELTPETVALNTR..----------..SLAEGKAVLSLQRG
F7DZE7_HORSE/109-234----------------.VYLKDVKVS..LY--KK...DKAVLFTYDQYQDKN..----------.LDQASGSVLLYLEKG
F7EBM1_XENTR/112-237----------------.VYMKDVKVG..LY--RN...NKPVMFTFDQFQSNN..----------.VDQASGSVLLHLEVG
Q4KMC6_DANRE/109-237----------------.VYRSSLQFD..LM--KN...GHTVASYFQIFGNWS..----------KPASLSGGTLVHLIPG
C1QT1_MOUSE/147-275----------------TWNQKETYLH..IM--KN...EEEVVILYAQVSDRS..----------..IMQSQSLMMELREE

PF00229

TNF15_HUMAN/117-251DKLMVN..VS..DISLVDYTK.EDKTFFGAFLL
TNF10_HUMAN/152-280DRIFVS..VT..NEHLIDMD..HEASFFGAFLV
Q90WT9_CHICK/158-285DELFVS..VS...SLAIDYSD.AAASYFGAFRL
TNFB_MOUSE/74-202DQLSTH..TD..GISHLHFS..PSSVFFGAFAL
TNFL8_HUMAN/113-230TTISVN..VD..TFQYIDTSTFPLENVLSIFLY
TNF10_MOUSE/156-290DRIFVS..VT..NEHLMDLD..QEASFFGAFLI
TNFL9_MOUSE/164-302LRAYLHGAQD..AYRDWELSY.PNTTSFGLFLV
TNFL8_MOUSE/118-235STISVR..VD..NFQYVDTNTFPLDNVLSVFLY
TNFC_HUMAN/102-243ERVYVN..IS..HPDMVDFA..RGKTFFGAVMV
CD40L_MOUSE/137-260ASVFVN..VT..EASQVIHR..VGFSSFGLLKL
TNF12_HUMAN/131-248SSLRIR......TLPWAHLKAAPFLTYFGLFQV
TNFB_HUMAN/77-205DQLSTH..TD..GIPHLVLS..PSTVFFGAFAL
Q6DHG9_DANRE/158-298DRVFVT..VS..NVSTIDMD..EKSSFFGAFLV
TNFC_MOUSE/168-305ERVYVN..IS..HPDMVDYR..RGKTFFGAVMV
TNFL9_HUMAN/107-240QRLGVH..LHTEARARHAWQLTQGATVLGLFRV
TNF11_HUMAN/185-313EEISIE..VS..NPSLLDPD..QDATYFGAFKV
CD40L_FELCA/137-260ASVFVN..VT..DPSQVSHG..TGFTSFGLLKL
TNF14_MOUSE/110-239EEVVVR..VP..GNRLVRPRD.GTRSYFGAFMV
CD40L_CHICK/152-272DMVFVN..VT..DSTAVNVN..PGNTYFGMFKL
TNFL6_RAT/157-278DHLYVN..IS..QLSLINFE..ESKTFFGLYKL
TNFA_RABIT/105-235DRLSTE..VN..QPEYLDLAE.SGQVYFGIIAL
F1NHP5_CHICK/157-290DRIFVS..VS..NSDIVDMD..KEASFFGAFMI
F1Q767_DANRE/188-315DEVFVS..VS..SPTMVYGE..DSSSYFGAFRL
F6VXB8_MOUSE/136-270DRLMVN..VS..DISLVDYTK.EDKTFFGAFLL
H2Y3R5_CIOIN/179-304HGVSLS..VN..PPSVEVFLA.PQYTYFGAFLI
TNFA_SHEEP/103-234DRLSAE..IN..LPEYLDYAE.SGQVYFGIIAL
TNFA_CALJA/101-230DRLSAE..IN..LPDYLDLAE.SGQVYFGII..
Q1L8A5_DANRE/102-233DRLGTD..TTTALLPMVEND..NGKTFFGVFG.

PF00386

C1QA_MOUSE/116-241DEVWIEKDPA...KGRIYQGT-EADSIFSGFLI
C1QC_MOUSE/122-243DEVWLSVNDY...NGMVGIEG-.SNSVFSGFLL
MMRN2_HUMAN/827-946ERVWFELT.....QGSITKRS-LSGTAFGGFLM
C1QT8_HUMAN/118-246DAVWVRMFQRDRDNAIYGEHG-DLYITFSGHLV
C1QT6_HUMAN/126-254DRVWVRLFKRQRENAIYSNDF-DTYITFSGHLI
MMRN2_MOUSE/821-940ERAWFELI.....QGSATKGS-QPGTAFGGFLM
CAPR2_DANRE/786-911DQVWLRLH.....RGAIYGSS-WKYSTFSGFLL
C1T9A_HUMAN/203-329DEVWLQVTGGERFNGLFADED-.DDTTFTGFLL
MMRN1_HUMAN/1102-1225QEVWLRLA.....KGTIPAKF-PPVTTFSGYLL
C1QT4_MOUSE/30-155DTVWLRLH.....GAPQYALG-APGATFSGYLV
C1QC_HUMAN/121-242EEVWLAVNDY...YDMVGIQG-.SDSVFSGFLL
C1QT4_MOUSE/176-309DAVWLLSHDHDGYGA..YSNH-GKYITFSGFLV
C1QA_HUMAN/116-241DQVWVEKDPK...KGHIYQGS-EADSVFSGFLI
C1QA_PIG/118-243DKVWIQRDPN...KGRIYQGS-EADSVFSGFLI
C1QL3_MOUSE/128-252DEVYIKLDG....GKAHGGNN-NKYSTFSGFII
CO8A2_MOUSE/572-696DQVWVQMPSDQ.ANGLYSTEY-.IHSSFSGFLL
D6R934_HUMAN/121-245ENVFLQATDK...NSLLGMEG-.ANSIFSGFLL
Q9GQV4_STRPU/36-175DEVFLRLA.....PGLLDADA-DRPLLFTGYLV
CO8A1_RABIT/617-741DRVFLQMPSEQ.AAGLYAGQY-.VHSSFSGYLL
COAA1_BOVIN/547-671DQVWLQLPNAG.SNGLYSPEY-.VHSSFSGFLV
C1QT5_MOUSE/105-232DQVWVQVGVGD.YIGIYASIK-.TDSTFSGFLV
C1QT2_HUMAN/151-275DEVWLQIFYSE.QNGLFYDPY-WTDSLFTGFLI
C1QT3_MOUSE/119-242DEVWLRMG.....NGALHGDH-QRFSTFAGFLL
C1QT7_MOUSE/149-273DEVWLEIFFND.QNGLFSDPG-WADSLFSGFLL
F1NRD4_CHICK/112-237DEVWLQVYGEGNNNGVYADNI-.NDSTFMGFLL
F1QH04_DANRE/118-238DKVSVQSTGE...STVFSRD.-.TDCTFTGFML
F1R093_DANRE/91-222DQISVKLIAH...RRIYTDGF-.RRNTFSGHLL
F1R9R1_DANRE/772-890DRVYVEVSRS.......ANGI-GFSSYFSGHIL
F7DZE7_HORSE/109-234DQVWLQVYGDGDHNGLYADNV-.NDSTFTGFLL
F7EBM1_XENTR/112-237DEVWLQIYGDESFSGIYGDNL-.NDSTFTGILL
Q4KMC6_DANRE/109-237DQVWVQMALGE.YIG.FYSSS-KTDSTFTGFLV
C1QT1_MOUSE/147-275DEVWVRLFKGERENAIFSDEF-DTYITFSGYLV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window