Sequence alignment for CL0100

PF00229

TNF15_HUMAN/117-251-LHWEHELG..L----------------------AFTKNRMNYTNKF---..LLIPE----SGDYFIYS--QVTFR....
TNF10_HUMAN/152-280-NSWESSRS..G----------------------HSFLSNLHLRNGE---..LVIHE----KGFYYIYS--QTYFR....
Q90WT9_CHICK/158-285-TRWEDST...I----------------------HSHLQNITYRDGR---..LRVNQ----AGKYYVYS--QIYFRYSRD
TNFB_MOUSE/74-202-LLWRASTD..R----------------------AFLRHGFSLSNNS---..LLIPT----SGLYFVYS--QVVFS....
TNFL8_HUMAN/113-230-LSWNKDGI...----------------------...LHGVRYQDGN---..LVIQF----PGLYFIIC--QLQFL....
TNF10_MOUSE/156-290-ESWESSRK..G----------------------HSFLNHVLFRNGE---..LVIEQ----EGLYYIYS--QTYFR....
TNFL9_MOUSE/164-302-LNWHSQDGAGS----------------------SYLSQGLRYEEDK---KELVVDS----PGLYYVFL--ELKLSP...
TNFL8_MOUSE/118-235-LSWNEDGT...----------------------...IHGLIYQDGN---..LIVQF----PGLYFIVC--QLQFL....
TNFC_HUMAN/102-243-LGWETTKE..Q----------------------AFLTSGTQFSDAE---.GLALPQ----DGLYYLYC--LVGYR....
CD40L_MOUSE/137-260-LQWAKKGY..Y----------------------TMKSNLVMLENGK---.QLTVKR----EGLYYVYT--QVTFC....
TNF12_HUMAN/131-248-SGWEEARI..N----------------------SSSPLRYNRQIGE---..FIVTR----AGLYYLYC--QVHFD....
TNFB_HUMAN/77-205-LLWRANTD..R----------------------AFLQDGFSLSNNS---..LLVPT----SGIYFVYS--QVVFS....
Q6DHG9_DANRE/158-298-QSWESEK...G----------------------LAFLQNVELSDGE---..LVVPQ----AGLYYIYS--QTYFR....
TNFC_MOUSE/168-305-LSWEASQE..E----------------------AFLRSGAQFSPTH---.GLALPQ----DGVYYLYC--HVGYR....
TNFL9_HUMAN/107-240-LSWYSDPGLAG----------------------VSLTGGLSYKEDT---KELVVAK----AGVYYVFF--QLELRRV..
TNF11_HUMAN/185-313-SSWYHDR...G----------------------WAKISNMTFSNGK---..LIVNQ----DGFYYLYA--NICFR....
CD40L_FELCA/137-260-LQWAPKGY..Y----------------------TISSNLVTLENGK---.QLAVKR----QGLYYIYA--QVTFC....
TNF14_MOUSE/110-239-LLWETRL...G----------------------LAFLRGLTYHDGA---..LVTME----PGYYYVYS--KVQLS....
CD40L_CHICK/152-272-LKWMTTS...Y----------------------APTSSLISYHEGK---..LKVEK----AGLYYIYS--QVSFC....
TNFL6_RAT/157-278-LEWEDTY...G----------------------TALISGVKYKKGG---..LVINE----AGLYFVYS--KVYFR....
TNFA_RABIT/105-235-LQWLSQRA..N----------------------ALLANGMKLTDNQ---..LVVPA----DGLYLIYS--QVLFS....
F1NHP5_CHICK/157-290-.SWESSRR..G----------------------HSFLYNVELWNGE---..LVVPQ----TGFYYIYS--QTYFR....
F1Q767_DANRE/188-315-.TWANKS...F----------------------GAHLYNMTLTNGR---..LRVPQ----DGRYYLYS--QVYFR....
F6VXB8_MOUSE/136-270-LHWEHDLG..M----------------------AFTKNGMKYINKS---..LVIPE----SGDYFIYS--QITFR....
H2Y3R5_CIOIN/179-304-.DWAPPD...S----------------------HFKGFGTRHLNND---GYFTVPV----AGVYFVYS--QVVFN....
TNFA_SHEEP/103-234-LRWGDSYA..N----------------------ALMANGVELKDNQ---..LVVPT----DGLYLIYS--QVLFR....
TNFA_CALJA/101-230-LQWLNRRA..N----------------------ALLANGVELRDNQ---..LVVPS----EGLYLVYS--QVLFK....
Q1L8A5_DANRE/102-233-LDWRDDQD..Q----------------------AFSSGGLKLVNRE---..IIIPD----DGIYFVYS--QVSLH....

PF00386

C1QA_MOUSE/116-241-AFSAIRQNPMTLG.N........VVIFDK....VLTNQESPYQNHT---GRFICAV----PGFYYFNF--QVISK----
C1QC_MOUSE/122-243-VFTVTRQTTQYPE.A.NA.....LVRFNS....VVTNPQGHYNPST---GKFTCEV----PGLYYFVY--YTS..----
MMRN2_HUMAN/827-946-AFYASFSEGTAAL.Q........TVKFNT....TYINIGSSYFPEH---GYFRAPE----RGVYLFAV--SVE..----
C1QT8_HUMAN/118-246-AFSVGRREGLHSS.DHFQ.....AVPFDT....ELVNLDGAFDLAA---GRFLCTV----PGVYFLSL--NVH..----
C1QT6_HUMAN/126-254-AFSVGRKTALHSG.EDFQ.....TLLFER....VFVNLDGCFDMAT---GQFAAPL----RGIYFFSL--NVH..----
MMRN2_MOUSE/821-940-AFYAGSSEGATAL.Q........MVKFNT....TSINVGSSYFPEH---GYFRAPK----RGVYLFAV--SIT..----
CAPR2_DANRE/786-911-AFSAARTANFAPG.TLDQ.....PIAFDL....LHTNLGDMFDTGS---GRFTCPA----TGAYVFIF--HIL.K----
C1T9A_HUMAN/203-329-AFTVGLTVLSKFP.SSDM.....PIKFDK....ILYNEFNHYDTAA---GKFTCHI----AGVYYFTY--HIT..----
MMRN1_HUMAN/1102-1225-AFFASHTYGMTIP.G........PILFNN....LDVNYGASYTPRT---GKFRIPY----LGVYVFKY--TIESF----
C1QT4_MOUSE/30-155-AFSAARTTPLEGT.SEM......AVTFDK....VYVNIGGDFDAAT---GRFRCRV----PGAYFFSF--TAG..----
C1QC_HUMAN/121-242-VFTVTRQTHQPPAPNS.......LIRFNA....VLTNPQGDYDTST---GKFTCKV----PGLYYFVY--HAS..----
C1QT4_MOUSE/176-309-AFSAARTRSLVGS.DAAPGPRHRPLAFDT....ELVNIGGDFDAAA---GVFRCRL----PGAYFFSF--TLG..----
C1QA_HUMAN/116-241-AFSAIRRNPPMGGN.........VVIFDT....VITNQEEPYQNHS---GRFVCTV----PGYYYFTF--QVLSQ----
C1QA_PIG/118-243-AFSAVRQNPPTSGN.........VVIFDE....VITNQEGAYKSQL---GQFICDV----PGYYYFTF--QVVSK----
C1QL3_MOUSE/128-252-AFYAGLKRQHEGYE.........VLKFDD....VVTNLGNHYDPTT---GKFTCSI----PGIYFFTY--HVLMR----
CO8A2_MOUSE/572-696-AFTAVLT..SPFP.ASGM.....PVRFDR....TLYNGHSGYNPAT---GIFTCPV----GGVYYFAY--HVH..----
D6R934_HUMAN/121-245-AFSATRTINVPLRRDQ.......TIRFDH....VITNMNNNYEPRS---GKFTCKV----PGLYYFTY--HAS..----
Q9GQV4_STRPU/36-175-AFTVERTADMSDSTTSRD.....IGAFNKNSQKIYLNIGEALDVVT---GRFKVPL----EGVYYFYY--SFSSE----
CO8A1_RABIT/617-741-AFTAELT..APFP.PVGA.....PIKFDR....LLYNGRQNYNPQT---GIFTCEV----PGVYYFAY--HVH..----
COAA1_BOVIN/547-671-AFTVILS..KAYP.AIGT.....PIPFDK....ILYNKQQHYDPRT---GIFTCKI----PGIYYFSY--HIH..----
C1QT5_MOUSE/105-232-AFSAKRSESRVPP.PADT.....PLPFDR....VLLNEQGHYDPTT---GKFTCQV----PGVYYFAV--HAT..----
C1QT2_HUMAN/151-275-AFSVAVT..KSYP.RERL.....PIKFDK....ILMNEGGHYNASS---GKFVCGV----PGIYYFTY--DIT..----
C1QT3_MOUSE/119-242-AFMASLATHFSNQ.NS.......GIIFSS....VETNIGNFFDVMT---GRFGAPV----SGVYFFTF--SMM.K----
C1QT7_MOUSE/149-273-AFSVGIT..TSYP.EERL.....PIIFNK....VLFNEGEHYNPAT---GKFICAF----PGIYYFSY--DIT..----
F1NRD4_CHICK/112-237-AFSVGLTERAPHP.NV.......PIRFTK....IFYNEQNHYDSST---GKFLCSI----PGTYFFAY--HLT..----
F1QH04_DANRE/118-238-VFSYKKSQKLEKI.LQDK.....LVVFDV....PLISGIDGVLDGE---GYFDVTI----TGMYYISY--QIS..----
F1R093_DANRE/91-222-AFSASLLSSHNIK.YIGPYAEDTMIVYGK....IFTNIGNAYNTTT---GIFSAPV----KGVYFFNL--VLF..----
F1R9R1_DANRE/772-890-AFFASVNSILPAT.A..K.....VVVFGQ....VLYNGQNHYNQTS---GMFLCQI----PGVYEFEF--SCI..----
F7DZE7_HORSE/109-234-AFSVGLETRVTVP.NV.......PIRFTK....IFYNQQNHYDGST---GKFHCNI----PGLYYFSY--HIT..----
F7EBM1_XENTR/112-237-AFSMGLSTKSSLP.NV.......PIRFTK....VFYNEQRHYDDST---GKFRCAI----KGLYQFSY--HLT..----
Q4KMC6_DANRE/109-237-AFSAKLSEARTTPLTVGD.....SVRFDK....VILNEQGDYNPET---GRFTCRV----PGVYYFAV--HAT..----
C1QT1_MOUSE/147-275-AFSVGRKKALHSN.DYFQ.....PVVFDT....EFVNLYKHFNMFT---GKFYCYV----PGIYFFSL--NVH..----

PF08949

P5_BPPRD/122-340PSGIKGDKGDPGAPGPAGG-----TVVVED----SGASFGESLLDTTSEPGKILVKRISGGSGITVTDYGDQVEIEASGG

PF05475

GP3D_CHLT2/119-264-AFNNFPITNKIQCNG------------------LFTPRNIETLLGGTEIGKFTVTP-KSSGSMFLVSA--DI-------
Q821C4_CHLCV/119-264-AFKNFSISDKIQCNG------------------LFTKTNIGTLLGGTEIGTFTITP-DNADSMFLISA--DI-------
Q46275_CHLPN/122-267-AFKDVNITNKIQCNG------------------LFTKENIGNLDGGTEIASSSVTP-DNANSMFLICA--DI-------

PF00229

TNF15_HUMAN/117-251..GMTSECSEIRQ......AGRPNKPDSITVVITKVTDSY..PE---PTQLLMGTK.SVCEVGSN.........WFQPIY
TNF10_HUMAN/152-280.......FQEEIK......ENTKND.KQMVQYIYKYTSY...PD---PILLMKSAR.NSCWSKDAEY.......GLYSIY
Q90WT9_CHICK/158-285GAGARVS...................VPQLVQCINWKTSY..SQ---PILLLKGVG.TKCWAPEAEY.......GLHALY
TNFB_MOUSE/74-202..GESCSPRAI...........PTP.IYLAHEVQLFSSQY..PF---HVPLLSAQKSVYPGLQGP.........WVRSMY
TNFL8_HUMAN/113-230...VQCPNN...............S.VDLKLELLINKH....IK---KQALVTVCE.SGMQTKH..........VYQNLS
TNF10_MOUSE/156-290..FQEAEDASKMVS.....KDKVRT.KQLVQYIY.KYTSY..PD---PIVLMKSAR.NSCWSRDAEY.......GLYSIY
TNFL9_MOUSE/164-302.TFTNTGHK...............V.QGWVSLVLQAKPQV..DD---FDNLALTVELFPCSMENKLVD....RSWSQLLL
TNFL8_MOUSE/118-235...VQCSNH...............S.VDLTLQLLINSK....IK---KQTLVTVCE.SGVQSKN..........IYQNLS
TNFC_HUMAN/102-243..GRAPPGGGDP.........QGRS.VTLRSSLYRAGGAYGPGT---PELLLEGAE.TVTPVLDPARRQGYGPLWYTSVG
CD40L_MOUSE/137-260..SNREPSS...............Q.RPFIVGLWLKPSS...GS---ERILLKAANTHSSSQLC..........EQQSVH
TNF12_HUMAN/131-248...EGKA...................VYLKLDLL........VD---GVLALRCLEEFSATAASSLG......PQLRLCQ
TNFB_HUMAN/77-205..GKAYSPKAT...........SSP.LYLAHEVQLFSSQY..PF---HVPLLSSQKMVYPGLQEP.........WLHSMY
Q6DHG9_DANRE/158-298..HTLIEEDESAREDEYGSMGESVRGKPMLQYVYKKVSSY..QV---PILLMKNAR.TTCWSRDSEY.......GLYSIY
TNFC_MOUSE/168-305..GRTPPAGRS..........RARS.LTLRSALYRAGGAYGRGS---PELLLEGAE.TVTPVVDPIGYG...SLWYTSVG
TNFL9_HUMAN/107-240VAGEGSG.................S.VSLALHLQPLRSA...AG---AAALALTVDLPPASSEAR.........NSAFGF
TNF11_HUMAN/185-313..HHETSGDLA...........TEY.LQLMVYVTKTSIKI..PS---SHTLMKGGS.TKYWSGNSEF.......HFYSIN
CD40L_FELCA/137-260..SNREASS...............Q.APFIASLCLHSPS...GS---ERVLLRAANARSSSKPC..........GQQSIH
TNF14_MOUSE/110-239..GVGCPQGL............ANG.LPITHGLYKRTSRY..PK---ELELLVSRR.SPCGRANSSR......VWWDSSF
CD40L_CHICK/152-272.TKAAAS...................APFTLYIYLYLPM...EE---DRLLMKGLDTHSTSTALC.........ELQSIR
TNFL6_RAT/157-278..GQSCN.................S.QPLSHKVYMRNFKY..PG---DLVLMEEKKLNYCTTGQI.........WAHSSY
TNFA_RABIT/105-235..GQGCRS................Y.VLLTHTVSRFAVSY..PN---KVNLLSAIK.SPCHRETPEEAE..PMAWYEPIY
F1NHP5_CHICK/157-290..FRENEDEDSGLL.....ERIKNP.KQLVQYIYKLTN.Y..PD---PILLMKSAR.TSCWSKKAEY.......GLYSIY
F1Q767_DANRE/188-315..YPSPSDSDQ..........SSVS.HQLVQCIYKKTS.Y..LN---PIQLLKGVG.TKCWAPDAEY.......ALHSVY
F6VXB8_MOUSE/136-270..GTTSVCGDISRG.....RRPNKP.DSITMVITKVADSY..PE---PARLLTGSK.SVCEISNN.........WFQSLY
H2Y3R5_CIOIN/179-304........................V.TNLPFMVSEIGVNV..DG---QSTFSRCQFSNTLTRSTPRASS..TRKRFVTCH
TNFA_SHEEP/103-234..GHGCPST...............P.LFLTHTISRIAVSY..QT---KVNILSAIK.SPCHRETLEGAE..AKPWYEPIY
TNFA_CALJA/101-230..GQGCPSN...............F.MLLTHSISRIAVSY..QA---KVNLLSAIK.SPCQRETPQGAK..TNPWYEPIY
Q1L8A5_DANRE/102-233...ISCTSELT...........EEQ.VLMSHAVMRFSESY..GG---KKPLFSAIR.SICTQEPESEN.....LWYNTIY

PF00386

C1QA_MOUSE/116-241--------------------------WDLCLFIKSS..SG--GQ...PRDSLSFSNTNNKGL..----------.FQVLA
C1QC_MOUSE/122-243--------------------------..HTANLCVH..LN--LN...LARVASFCDHMFNSK..----------..QVSS
MMRN2_HUMAN/827-946--------------------------FGPGPGTG.Q..LV--FG...GHHRTPVCTTGQGSG..----------..STAT
C1QT8_HUMAN/118-246--------------------------TWNYKETYLH..IM--LN...RRPAAVLYAQPSERS..----------..VMQA
C1QT6_HUMAN/126-254--------------------------SWNYKETYVH..IM--HN...QKEAVILYAQPSERS..----------..IMQS
MMRN2_MOUSE/821-940--------------------------FGPGPGMG.Q..LV--FE...GHHRVPVYSTEQRGG..----------..STAT
CAPR2_DANRE/786-911--------------------------LAISVPLYIN..LM--RN...EEVMVSAYANDGAPD..----------.HETAS
C1T9A_HUMAN/203-329--------------------------.VFSRNVQVS..LV--KN...GVKILHTKDAYMSSE..----------..DQAS
MMRN1_HUMAN/1102-1225--------------------------SAHISGF.....LV--VD...GIDKLAFESENINSEIH----------CDRVLT
C1QT4_MOUSE/30-155--------------------------KAPHKSLSVM..LV--RN...RDEVQALAFDEQRRPG.----------ARRAAS
C1QC_HUMAN/121-242--------------------------..HTANLCVL..LY--RS...GVKVVTFCGHTSKTN..----------..QVNS
C1QT4_MOUSE/176-309--------------------------KLPRKTLSVK..LM--KN...RDEVQAMIYDDGASR..----------RREMQS
C1QA_HUMAN/116-241--------------------------WEICLSIVSS..SR--GQ...VRRSLGFCDTTNKGL..----------.FQVVS
C1QA_PIG/118-243--------------------------WDLCLYIMSS..RR--DQ...VQQSLGFCDFNSKGL..----------.FQVVS
C1QL3_MOUSE/128-252--------------------------GGDGTSMWAD..LC--KN...NQVRASAIAQDADQN..----------.YDYAS
CO8A2_MOUSE/572-696--------------------------.VKGTNVWVA..LY--KN...NVPATYTYDEYKKGY..----------.LDQAS
D6R934_HUMAN/121-245--------------------------..SRGNLCVN..LM--RGRERAQKVVTFCDYAYNTF..----------..QVTT
Q9GQV4_STRPU/36-175--------------------------TMDEETRVELFKLE--AGKDLKSATLQVFQSITPALVS----------PLDSAS
CO8A1_RABIT/617-741--------------------------.CKGGNVWVA..LF--KN...NEPVMYTYDEYKKGF..----------.LDQAS
COAA1_BOVIN/547-671--------------------------.VKGTHAWVG..LY--KN...GTPVMYTYDEYIKGY..----------.LDQAS
C1QT5_MOUSE/105-232--------------------------.VYRASLQFD..LV--KN...GQSIASFFQYFGGWP..----------KPASLS
C1QT2_HUMAN/151-275--------------------------.LANKHLAIG..LV--HN...GQYRIRTFDANTGNH..----------..DVAS
C1QT3_MOUSE/119-242--------------------------HEDVEEVYVY..LM--HN...GNTVFSMYSYETKGK..----------.SDTSS
C1QT7_MOUSE/149-273--------------------------.LANKHLAIG..LV--HN...GQYRIRTFDANTGNH..----------..DVAS
F1NRD4_CHICK/112-237--------------------------.VYMTDVKVS..LY--KK...DKAVIFTYDQFQQNN..----------.VDQAS
F1QH04_DANRE/118-238--------------------------..FQQSACLK..IQ--VG...AEEKVKFCDSPKLIS..----------...GTA
F1R093_DANRE/91-222--------------------------THDALSAGVK..LL--KN...DDHVVGVTDNPPTED..----------KEDTAS
F1R9R1_DANRE/772-890--------------------------.GTRSLGFVT..LK--KN...NRVELTPETVALNTR..----------..SLAE
F7DZE7_HORSE/109-234--------------------------.VYLKDVKVS..LY--KK...DKAVLFTYDQYQDKN..----------.LDQAS
F7EBM1_XENTR/112-237--------------------------.VYMKDVKVG..LY--RN...NKPVMFTFDQFQSNN..----------.VDQAS
Q4KMC6_DANRE/109-237--------------------------.VYRSSLQFD..LM--KN...GHTVASYFQIFGNWS..----------KPASLS
C1QT1_MOUSE/147-275--------------------------TWNQKETYLH..IM--KN...EEEVVILYAQVSDRS..----------..IMQS

PF08949

P5_BPPRD/122-340GGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALT--VNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTT

PF05475

GP3D_CHLT2/119-264--------------------------IASRMEGGVVLALV-------REGDSKPYAISYGYSSGVPNLCSLRTRIINTGL
Q821C4_CHLCV/119-264--------------------------IASRMEGNVVLALV-------KEGDSAPCAVSYGYSSGIPNVCSLRTAVSNSGA
Q46275_CHLPN/122-267--------------------------IATRMEGTVALALV-------KEGDLSPCSISYGYSAGYPNIISLRATVGNKTT

PF00229

TNF15_HUMAN/117-251LGAMFSLQEGDK----LMVN.-------------------.VS..DISLVDYTK.EDKTFFGAFLL--------
TNF10_HUMAN/152-280QGGIFELKENDR----IFVS.-------------------.VT..NEHLIDMD..HEASFFGAFLV--------
Q90WT9_CHICK/158-285QGGLFELKAGDE----LFVS.-------------------.VS...SLAIDYSD.AAASYFGAFRL--------
TNFB_MOUSE/74-202QGAVFLLSKGDQ----LSTH.-------------------.TD..GISHLHFS..PSSVFFGAFAL--------
TNFL8_HUMAN/113-230QFLLDYLQVNTT----ISVN.-------------------.VD..TFQYIDTSTFPLENVLSIFLY--------
TNF10_MOUSE/156-290QGGLFELKKNDR----IFVS.-------------------.VT..NEHLMDLD..QEASFFGAFLI--------
TNFL9_MOUSE/164-302LKAGHRLSVGLR----AYLHG-------------------AQD..AYRDWELSY.PNTTSFGLFLV--------
TNFL8_MOUSE/118-235QFLLHYLQVNST----ISVR.-------------------.VD..NFQYVDTNTFPLDNVLSVFLY--------
TNFC_HUMAN/102-243FGGLVQLRRGER----VYVN.-------------------.IS..HPDMVDFA..RGKTFFGAVMV--------
CD40L_MOUSE/137-260LGGVFELQAGAS----VFVN.-------------------.VT..EASQVIHR..VGFSSFGLLKL--------
TNF12_HUMAN/131-248VSGLLALRPGSS----LRIR.-------------------.....TLPWAHLKAAPFLTYFGLFQV--------
TNFB_HUMAN/77-205HGAAFQLTQGDQ----LSTH.-------------------.TD..GIPHLVLS..PSTVFFGAFAL--------
Q6DHG9_DANRE/158-298QAGLFQLGSGDR----VFVT.-------------------.VS..NVSTIDMD..EKSSFFGAFLV--------
TNFC_MOUSE/168-305FGGLAQLRSGER----VYVN.-------------------.IS..HPDMVDYR..RGKTFFGAVMV--------
TNFL9_HUMAN/107-240QGRLLHLSAGQR----LGVH.-------------------.LHTEARARHAWQLTQGATVLGLFRV--------
TNF11_HUMAN/185-313VGGFFKLRSGEE----ISIE.-------------------.VS..NPSLLDPD..QDATYFGAFKV--------
CD40L_FELCA/137-260LGGVFELHPGAS----VFVN.-------------------.VT..DPSQVSHG..TGFTSFGLLKL--------
TNF14_MOUSE/110-239LGGVVHLEAGEE----VVVR.-------------------.VP..GNRLVRPRD.GTRSYFGAFMV--------
CD40L_CHICK/152-272EGGVFELRQGDM----VFVN.-------------------.VT..DSTAVNVN..PGNTYFGMFKL--------
TNFL6_RAT/157-278LGAVFNLTVADH----LYVN.-------------------.IS..QLSLINFE..ESKTFFGLYKL--------
TNFA_RABIT/105-235LGGVFQLEKGDR----LSTE.-------------------.VN..QPEYLDLAE.SGQVYFGIIAL--------
F1NHP5_CHICK/157-290QGGVFQLKREDR----IFVS.-------------------.VS..NSDIVDMD..KEASFFGAFMI--------
F1Q767_DANRE/188-315QGGLFELRAGDE----VFVS.-------------------.VS..SPTMVYGE..DSSSYFGAFRL--------
F6VXB8_MOUSE/136-270LGATFSLEEGDR----LMVN.-------------------.VS..DISLVDYTK.EDKTFFGAFLL--------
H2Y3R5_CIOIN/179-304SNGIVYMKANHG----VSLS.-------------------.VN..PPSVEVFLA.PQYTYFGAFLI--------
TNFA_SHEEP/103-234QGGVFQLEKGDR----LSAE.-------------------.IN..LPEYLDYAE.SGQVYFGIIAL--------
TNFA_CALJA/101-230LGGVFQLEKGDR----LSAE.-------------------.IN..LPDYLDLAE.SGQVYFGII..--------
Q1L8A5_DANRE/102-233LGAAFHLREGDR----LGTD.-------------------.TTTALLPMVEND..NGKTFFGVFG.--------

PF00386

C1QA_MOUSE/116-241GGTVLQLRRGDE----VWIEK-------------------DPA...KGRIYQGT-EADSIFSGFLI--------
C1QC_MOUSE/122-243GGVLLRLQRGDE----VWLSV-------------------NDY...NGMVGIEG-.SNSVFSGFLL--------
MMRN2_HUMAN/827-946VFAMAELQKGER----VWFEL-------------------T.....QGSITKRS-LSGTAFGGFLM--------
C1QT8_HUMAN/118-246QSLMLLLAAGDA----VWVRM-------------------FQRDRDNAIYGEHG-DLYITFSGHLV--------
C1QT6_HUMAN/126-254QSVMLDLAYGDR----VWVRL-------------------FKRQRENAIYSNDF-DTYITFSGHLI--------
MMRN2_MOUSE/821-940TFAMVELQKGER----AWFEL-------------------I.....QGSATKGS-QPGTAFGGFLM--------
CAPR2_DANRE/786-911NHAVLQLFQGDQ----VWLRL-------------------H.....RGAIYGSS-WKYSTFSGFLL--------
C1T9A_HUMAN/203-329GGIVLQLKLGDE----VWLQV-------------------TGGERFNGLFADED-.DDTTFTGFLL--------
MMRN1_HUMAN/1102-1225GDALLELNYGQE----VWLRL-------------------A.....KGTIPAKF-PPVTTFSGYLL--------
C1QT4_MOUSE/30-155QSAMLQLDYGDT----VWLRL-------------------H.....GAPQYALG-APGATFSGYLV--------
C1QC_HUMAN/121-242GGVLLRLQVGEE----VWLAV-------------------NDY...YDMVGIQG-.SDSVFSGFLL--------
C1QT4_MOUSE/176-309QSVMLPLRRGDA----VWLLS-------------------HDHDGYGA..YSNH-GKYITFSGFLV--------
C1QA_HUMAN/116-241GGMVLQLQQGDQ----VWVEK-------------------DPK...KGHIYQGS-EADSVFSGFLI--------
C1QA_PIG/118-243GGTVLQLQRGDK----VWIQR-------------------DPN...KGRIYQGS-EADSVFSGFLI--------
C1QL3_MOUSE/128-252NSVVLHLEPGDE----VYIKL-------------------DG....GKAHGGNN-NKYSTFSGFII--------
CO8A2_MOUSE/572-696GGAVLQLRPNDQ----VWVQM-------------------PSDQ.ANGLYSTEY-.IHSSFSGFLL--------
D6R934_HUMAN/121-245GGMVLKLEQGEN----VFLQA-------------------TDK...NSLLGMEG-.ANSIFSGFLL--------
Q9GQV4_STRPU/36-175ASVMVELKRDDE----VFLRL-------------------A.....PGLLDADA-DRPLLFTGYLV--------
CO8A1_RABIT/617-741GSAVLLLRPGDR----VFLQM-------------------PSEQ.AAGLYAGQY-.VHSSFSGYLL--------
COAA1_BOVIN/547-671GSAVIDLTENDQ----VWLQL-------------------PNAG.SNGLYSPEY-.VHSSFSGFLV--------
C1QT5_MOUSE/105-232GGAMVRLEPEDQ----VWVQV-------------------GVGD.YIGIYASIK-.TDSTFSGFLV--------
C1QT2_HUMAN/151-275GSTILALKQGDE----VWLQI-------------------FYSE.QNGLFYDPY-WTDSLFTGFLI--------
C1QT3_MOUSE/119-242NHAVLKLAKGDE----VWLRM-------------------G.....NGALHGDH-QRFSTFAGFLL--------
C1QT7_MOUSE/149-273GSTVIYLQPEDE----VWLEI-------------------FFND.QNGLFSDPG-WADSLFSGFLL--------
F1NRD4_CHICK/112-237GSVLLHLSLGDE----VWLQV-------------------YGEGNNNGVYADNI-.NDSTFMGFLL--------
F1QH04_DANRE/118-238ASVVLKLNKGDK----VSVQS-------------------TGE...STVFSRD.-.TDCTFTGFML--------
F1R093_DANRE/91-222NSVSLLLEEGDQ----ISVKL-------------------IAH...RRIYTDGF-.RRNTFSGHLL--------
F1R9R1_DANRE/772-890GKAVLSLQRGDR----VYVEV-------------------SRS.......ANGI-GFSSYFSGHIL--------
F7DZE7_HORSE/109-234GSVLLYLEKGDQ----VWLQV-------------------YGDGDHNGLYADNV-.NDSTFTGFLL--------
F7EBM1_XENTR/112-237GSVLLHLEVGDE----VWLQI-------------------YGDESFSGIYGDNL-.NDSTFTGILL--------
Q4KMC6_DANRE/109-237GGTLVHLIPGDQ----VWVQM-------------------ALGE.YIG.FYSSS-KTDSTFTGFLV--------
C1QT1_MOUSE/147-275QSLMMELREEDE----VWVRL-------------------FKGERENAIFSDEF-DTYITFSGYLV--------

PF08949

P5_BPPRD/122-340GNYLLRVKYGSS----DFVVACPASSLTAGGTISLLIYCNVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN

PF05475

GP3D_CHLT2/119-264TPTTYSLRVGGLESGVVWVN---------------------ALSNGNDILGITNTSNVSFLEVIPQTNA-----
Q821C4_CHLCV/119-264NPVTFSLRVGGMESGVVWVN---------------------ALANGDSILGTTTTSNISFLEVKQQTNG-----
Q46275_CHLPN/122-267APVKFSLRAGGMDSGVVWVN---------------------AMPNGEKILGVDAVSKITILEVKPQTNG-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window