Sequence alignment for CL0101

PF04705

J7LIM1_NOCAA/1-114-----------------------MDNLEIIENASDPAVQRILDVTKSSRAN--IKTTLIEDAEPLTQCIRA---G-VE--
J7KYH7_NOCAA/1-114-----------------------MAEFETIDNPSDPAIRRIIDVTKPSRSN--IKTTLIEDPEPLVQSINA---G-VE--
X5DQN6_9CORY/7-116-----------------------H...HIIDNPYHPVARRITDVVRRRAVA--PNVILIDDLENIVQAARS---G-VL--
D5UK31_CELFN/3-112-----------------------....DVISSRSDPQVQRIDDLVRRPRAA--TKTLLVEDPEPLTHALGA---G-LE--

PF08032

Q8CXU2_LEPIN/36-110---------------------------------------------------------FIEGYREILRAQKS...GKIK..
O96263_PLAF7/86-167---------------------------------------------------------YIYGLNSVYAVLKK...N.ER..
Q6BTY4_DEBHA/128-204---------------------------------------------------------YVYGTFPVMAALMA...N.KRG.
MRM3_DROME/141-217---------------------------------------------------------IVEGRRLIQEALQC...G.LK..
RLMB_VIBCH/5-81---------------------------------------------------------LIYGIHAVNAVLQR...D.PA..
Q92QI6_RHIME/59-133---------------------------------------------------------LLYGLHTVRAALDN...PERR..
Q7MBB6_GLOVI/92-168---------------------------------------------------------LLYGKQSVLAALQN...S.RP..
RLMB_RALSO/6-82---------------------------------------------------------LLIGFHAVTARLRH...DARS..
Y479_MYCPA/69-145---------------------------------------------------------TVLGRNPVLECLRA...G.VP..
Q7U7F6_SYNPX/177-253---------------------------------------------------------LVWGRHSALAALEA...G.RP..
Q8E1Z2_STRA5/15-89---------------------------------------------------------LVYGLHAVTESLRA.....NT..
Q8D323_WIGBR/4-80---------------------------------------------------------IIYGIHVIEEFIKN...KSNK..
Q6MS22_MYCMS/5-77---------------------------------------------------------LIYGKHVVFELLKK...H.QN..
Q97EF9_CLOAB/9-84---------------------------------------------------------LIEGRNAVIEALKS...D.ST..
Q6C040_YARLI/179-258---------------------------------------------------------VLYGTHAVEACLTS...H.KRRN
Q8DK28_THEEB/45-121---------------------------------------------------------LLYGRHAVLSALES...G.RP..
Q6ADI2_LEIXX/89-166---------------------------------------------------------IVTGRNSVLEALRA...R.IP..
Q890M7_CLOTE/5-80---------------------------------------------------------LIIGRNAVVEALES...H.KT..
Q6FPX7_CANGA/108-186---------------------------------------------------------YLYGVNPILAALES.....DRRG
Q7NAH8_MYCGA/23-94---------------------------------------------------------CLFGYNGVYEGLIN...N.LK..
Q9A907_CAUCR/33-109---------------------------------------------------------LAEGLKIVIEAIDC...GHAP..
RLMB_SHEON/6-82---------------------------------------------------------IIFGIHAVEALLKH...S.PE..
Q98N81_RHILO/2-76---------------------------------------------------------RLYGLHTVRAALDN...PRRK..
MRM1_SCHPO/33-108---------------------------------------------------------FVFGTHSVKNALAT...RKRE..
Q7VFD1_HELHP/2-74---------------------------------------------------------IVYGKQPILYILHT...NASC..
Q8A814_BACTN/7-81---------------------------------------------------------MIFGVRAVIEAIQA...G.KE..
Q6YQX1_ONYPE/823-895---------------------------------------------------------IIYGKNPIKEAIKA...Q.RK..
Q9PQG4_UREPA/33-108---------------------------------------------------------IIEGFKLLDEALQN.....QQ..
O25279_HELPY/4-76---------------------------------------------------------VIYGKQVIMHLLNS...H.QE..
RLMB_COXBU/6-81---------------------------------------------------------SIYGIHAVSGVLDA...A.PQ..
Q6AGD8_LEIXX/38-113---------------------------------------------------------LLEGPQAVAEALAF...R.SE..
Q9K894_BACHD/31-100---------------------------------------------------------LIEGYHLVEEALKS...T.IT..
Y1673_SYNY3/38-112---------------------------------------------------------LLEGTHLLEVALAQG.KG.FNHG
Q9CJY1_PASMU/125-200---------------------------------------------------------KVYGENACQALFAQ...R.PE..
Q8Z0C3_NOSS1/42-116---------------------------------------------------------LLEGTHLLEEACAM...D.YP..
Q7MTU3_PORGI/6-80---------------------------------------------------------MIFGLHSISEAFEA...G.KE..
RLMB_NITEU/6-82---------------------------------------------------------YIFGFHAITSRLRQ...H.PD..
Q8XJ72_CLOPE/31-104---------------------------------------------------------LIEGLRFVEEAIKS...K.VS..
YACO_BACSU/7-81---------------------------------------------------------YVIGKNAVIETLKS...D.RK..
Q74L24_LACJO/8-85---------------------------------------------------------FVYGRHAGIDFLKT.....QDAN
Q891T6_CLOTE/31-105---------------------------------------------------------IVEGFRFVEEALKS...D.YC..
Q6MIZ9_BDEBA/55-130---------------------------------------------------------VVIGTHAINEVLKV...R.PK..
O84408_CHLTR/29-103---------------------------------------------------------LLEGFREIHRALIS...G.YR..
RLMB_NEIMB/6-82---------------------------------------------------------PIYGFHAVNARLWQ...N.PK..
RLMB_ACIAD/6-82---------------------------------------------------------YYYGVHSVESLLEL...E.PE..
Q6CLR7_KLULA/125-198---------------------------------------------------------YVFGTNSVISALTA...K.....
Q8YXQ3_NOSS1/83-159---------------------------------------------------------IIYGRHPVLSALQN...Q.RG..
Q9RWC1_DEIRA/2-76---------------------------------------------------------LLYGRNPVLEALPA...G.R...
Q9X263_THEMA/2-78---------------------------------------------------------RVYGRKILEEALRN...N.VP..
Q8KBA1_CHLTE/33-106---------------------------------------------------------LAEGLRTVSELLQSLSDP.SM..
Q81L29_BACAN/31-99---------------------------------------------------------FVEGFHLVEEALKA...G.....
Q9L0Q5_STRCO/72-149---------------------------------------------------------LVVGRNPVYEALRE...G.VP..
Q6NFC4_CORDI/71-147---------------------------------------------------------LVVGRNPVVECLHA...K.VP..
O83093_TREPA/27-102---------------------------------------------------------TVCGLRAVETLGSI...H.PE..
Q74D57_GEOSL/5-80---------------------------------------------------------ILYGINSVMEALRG...S.RR..
RLMB_HAEIN/4-80---------------------------------------------------------QIYGIHAVNSILTH...S.PE..
Q6AJ92_DESPS/48-125---------------------------------------------------------LIWGIHPIVEALKY...E.PN..
Q6N4H3_RHOPA/40-113---------------------------------------------------------ILYGWHTVTAALAN...PQRK..
Q828C9_STRAW/57-135---------------------------------------------------------LAEGPQAVREAAAH...RAADAA
Q9KGF2_BACHD/5-80---------------------------------------------------------FITGKNPIIEALRS...G.RP..
RLMB_CHRVO/6-82---------------------------------------------------------LIHGFHAINARLWQ...N.PK..
RLMB_PECAS/4-80---------------------------------------------------------IIYGIHAVKALLER...D.PQ..
Q9CHW1_LACLA/29-104---------------------------------------------------------LIEGFHLLEEALKA...G.RS..
Q74ID9_LACJO/31-102---------------------------------------------------------LIEGFHLVEEALKS...H.....
Q839V3_ENTFA/43-117---------------------------------------------------------FVFGFHATVEALQQ...G.R...
Q8R7T5_CALS4/6-80---------------------------------------------------------IIYGRNPVIEAIRS...G.KE..
Q73J63_TREDE/10-85---------------------------------------------------------PVCGFESCLALAKH...H.PE..
Q75B46_ASHGO/118-191---------------------------------------------------------RIYGRNSILLALQS...N.RR..
Q6AAT1_PROAC/72-148---------------------------------------------------------WVIGRNPVLEALHV...G.LP..
MRM1_YEAST/125-198---------------------------------------------------------YVYGTNSVYAALLN...P.SR..
MRM1_HUMAN/51-129---------------------------------------------------------LLFGMTPCLLALQA...A.RR..
Q7NN60_GLOVI/29-103---------------------------------------------------------LVEGTHPVAAALAG...GWELEF
Q831U7_ENTFA/31-103---------------------------------------------------------IIEGFHLVEEAVKA...N.....
Y355_MYCPN/9-79---------------------------------------------------------FLFGSKAFLEALDN...Q.LQ..
Q7TU91_PROMP/190-266---------------------------------------------------------WIWGKHSVFAALNS...E.RP..
RLMB_PSEPK/6-81---------------------------------------------------------KIYGVHAVQALLQH...H.PK..
Q6A7V4_PROAC/41-113---------------------------------------------------------LVEGAQAVREALAW.....PG..
Q7MSH0_WOLSU/29-101---------------------------------------------------------IIYGKQIFLYVLRR...H.PK..
Q92F34_LISMO/9-83---------------------------------------------------------WIGGRNPVLEVLRS...D.RD..
Q8KC03_CHLTE/18-94---------------------------------------------------------VVYGRNAVIELLQS...K.PE..
Q8CXP3_OCEIH/5-79---------------------------------------------------------VIMGRNPVMEALKS...G.RS..
Q72G19_DESVH/7-82---------------------------------------------------------VLPGLKPVLELLAS...D.PA..
Q9PR20_UREPA/3-73---------------------------------------------------------YNFGKKALLDAIGN.....KQ..
O67731_AQUAE/6-79---------------------------------------------------------VIWGRNPIIEALRA...G.RN..
RLMB_BLOFL/4-80---------------------------------------------------------LVYGIHTVESIVNQ...S.PN..
Y955_SYNY3/125-201---------------------------------------------------------LLYGHHAVLAALDG...D.RQ..
Q9XWY8_CAEEL/44-125---------------------------------------------------------ALFGLHSVLEAIRS...G.KR..
C5DY76_ZYGRC/130-203---------------------------------------------------------YVYGTNSVLAALQG...N.KR..
D7BAL1_MEISD/30-105---------------------------------------------------------LIEGAREIERALQA...G.IE..
Q2FZE0_STAA8/31-99---------------------------------------------------------LIEGVHLIEEAYQS...G.IV..
Q2G2M3_STAA8/6-79---------------------------------------------------------.IVGRHAVREAIIT...G.HP..
Q2YP21_BRUA2/57-129---------------------------------------------------------LAEGLKLVIDALEQ...D.WR..
Q32CT8_SHIDS/110-181---------------------------------------------------------.VYGENACQALFQS...R.PE..
Q5SLJ7_THET8/2-71---------------------------------------------------------WIYGRNPVLEALRA...G.R...
Q820Y2_TROWT/26-98---------------------------------------------------------.IVGINPVYEALRE...R.VP..
RLMB_XANCP/7-81---------------------------------------------------------WIVGVNAVASSVEN...D.AD..
Q8Y7Q4_LISMO/31-99---------------------------------------------------------LVEGFHLVEEALRQ...D.GL..

PF01248

Q9XWS4_CAEEL/14-108---------------------------------------ENINSRLSMVMK--TGQ.YVLGYKQTLKSLLN---G..K--
RS12_HUMAN/16-111---------------------------------------TALQEVLKTALI--HDG.LARGIREAAKALDK---R..Q--
RL30E_AERPE/1-95---------------------------------------MSVEKALKDLVK--TGV.YAMGFKQSLKAVKA---G..E--
RL30_KLULA/8-102---------------------------------------ENINQKLALVVK--SGK.YSLGYKSTVKSLRQ---G..K--
RL7A_CHICK/122-216---------------------------------------AAGKGDTP.TKR--PPV.LRAGVNTVTTLVEN---K..K--
RL8B_YEAST/117-209---------------------------------------AEGKSKQDASPK--PYA.VKYGLNHVVSLIEN---K..K--
RL8_SCHPO/117-212---------------------------------------ANGKSAQDVSKK--PYN.VKYGLNHVVALIEA---K..K--
RL7A_ANOGA/128-222---------------------------------------AAGKEEPP.SKR--ANQ.LRQGINSVVKMVEQ---K..K--
RPP38_HUMAN/99-190---------------------------------------QQVSGWTP.AHV--RKQ.LAIGVNEVTRALER---R..E--
SBP2L_HUMAN/702-804---------------------------------------ERIYQKDPVRAK--ARRRLVMGLREVTKHMKL---N..K--
NHP2_YEAST/41-135---------------------------------------KKVLKTVKKASK--AKN.VKRGVKEVVKALRK---G..E--
NHP2_SCHPO/39-133---------------------------------------KKMMKTVKKASK--QKH.ILRGVKEVVKAVRK---G..E--
RS12_DROME/23-118---------------------------------------TALQEVLKKSLI--ADG.LVHGIHQACKALDK---R..Q--
RS12_CAEEL/24-119---------------------------------------GALRAVLRAAHH--ADG.LAKGLHETCKALDK---R..E--
RS12A_SCHPO/31-126---------------------------------------DALKEVLKRALV--HDG.LARGIREASKALDR---R..Q--
RS12_YEAST/26-123---------------------------------------DALKVVLRTALV--HDG.LARGLRESTKALTR---G..E--
RS122_ARATH/29-124---------------------------------------TALELTVRKSRA--YGG.VVRGLHESAKLIEK---R..N--
RS12_PLAF7/23-119---------------------------------------TAIQKVIKNAHV--HDG.LKIGIREVIKSIES---Q..E--
GA45B_HUMAN/21-121---------------------------------------AAVEELLVAAQR--QDR.LTVGVYESAKLMNV---DPDS--
GA45A_HUMAN/21-123---------------------------------------DALEEVLSKALS--QRT.ITVGVYEAAKLLNV---DPDN--
SEBP2_RAT/650-752---------------------------------------DRMYQKDPVKAK--TKRRLVLGLREVLKHLKL---R..K--
O77331_PLAF7/495-595---------------------------------------SVSHEKLLLLKK--KKR.YFLGLKECYKHICI---D..E--
RL30E_METJA/7-101---------------------------------------MDVNKAIRTAVD--TGK.VILGSKRTIKFVKH---G..E--
RL30E_METTH/1-95---------------------------------------MDIDRGIRVAVD--TGN.VILGSKRTIQSLKL---G..K--
RL30E_SULAC/3-97---------------------------------------QSFEGELKTLLR--SGK.VILGTRKTLKLLKT---G..K--
RL30_MAIZE/12-106---------------------------------------DNINNKLQLVMK--SGK.YTLGYKTVLRTLRN---S..K--
Q9VJ19_DROME/12-106---------------------------------------ESTNARLALVMK--SGK.YCLGYKQTLKTLRQ---G..K--
RL30B_SCHPO/22-116---------------------------------------DTINSKLALTMK--SGK.YVLGYKSTLKTLRS---G..K--
YLXQ_BACSU/4-96---------------------------------------MEWFPLLGLANR--ARK.VVSGEDLVIKEIRN---A..R--
Q9WZN2_THEMA/7-99---------------------------------------RKVYSYIGFAVR--ARK.IVFGKERIRAYIRS---P.RE--
RL7A_DROME/127-221---------------------------------------AKGKDVEP.KKK--PSY.VSAGTNTVTKLIEQ---K..K--
RL7A1_ARATH/112-207---------------------------------------AEAEGKPSESKK--PIV.VKYGLNHVTYLIEQ---N..K--
RL7A_ARCFU/13-107---------------------------------------NEALSLLEKVRE--SGK.VKKGTNETTKAVER---G..L--
RL7A_METJA/15-106---------------------------------------KELLDAVAKAQ.--..K.IKKGANEVTKAVER---G..I--
RL7A_SULSO/17-111---------------------------------------DKVLEAVRKAKE--SGK.IKKGTNETTKAVER---G..Q--
RL7A_AERPE/17-111---------------------------------------EKAYEAVKRARE--TGR.IKKGTNETTKAVER---G..L--
RL7A_METTH/17-111---------------------------------------DKAAEALEIARE--TGK.VSKGTNEVTKAVER---G..V--
Q9SU26_ARATH/20-114---------------------------------------ITILDLVQQATN--YKQ.LKKGANEATKTLNR---G..I--
SNU13_YEAST/18-112---------------------------------------QQILDVVQQAAN--LRQ.LKKGANEATKTLNR---G..I--
NH2L1_DROME/19-113---------------------------------------AKIMNLLQQALN--YNQ.LRKGANEATKTLNR---G..L--
NHP2_DROME/51-146---------------------------------------KKCYKLVKKAMK--HKTFLRNGLKDVQTRLRK---G..E--
NHP2_CAEEL/53-148---------------------------------------KKVYKLIKKASA--GDKTLREGIKDVQKELRR---N..E--
I6TC33_ENTHA/8-96---------------------------------------.KAMNLIGLAMR--AGK.LITGEELTIADIRK---Q..K--
M0Y8U1_HORVD/29-123---------------------------------------.ALQLVMKKSSA--HDG.LVKGLREAAKSIEK---H..A--
N1JG05_BLUG1/33-127---------------------------------------DALKGALRTALM--HDG.LARGLREASKALDR---R..E--
Q385Y8_TRYB2/32-125---------------------------------------.ALRIVLMKARE--TNG.LICGLSEVTRALDR---R..T--
Q38AC1_TRYB2/29-122---------------------------------------DAIRIVIRKALE--VNG.LVRGLSEVARALDR---R..T--
Q38BI8_TRYB2/20-112---------------------------------------.TINTKIQLVMK--SGK.YVLGTQQSLKTLRQ---G..R--
RL30E_THEKO/7-95---------------------------------------.....ELRKVQD--TGK.IVMGAKKSIHLAKV---G..G--
RL30E_METMP/2-94---------------------------------------.DINRAIRVAVD--TGN.VVLGTKQAIKNIKH---G..E--
RL30E_PYRFU/3-94---------------------------------------..LAFELRKAME--TGK.VVLGSNETIRLAKT---G..G--
RL7A_PYRFU/18-111---------------------------------------.KALQAVEIARD--TGK.IRKGTNETTKAVER---G..Q--

PF03465

PELO_HUMAN/271-370----------------------------------AAGEVKALDDFYKMLQH..EPDRAFYGLKQVEKANEA---M-----
ERF1_CAEEL/288-424----------------------------------FIQEKKLIGGYFDEISQ..DTGKYVFGVKDTLAALEM---G-----
PELO_METTH/259-352----------------------------------IASEIRNVNEFLEKLAR..DPDSVVYGKVEVMDAINM---G-----
E7QK37_YEASZ/277-376----------------------------------YSKEIMVMDEFLLHLNK..DDDKAWYGEKEVVKAAEY---G-----
PELO_AERPE/250-349----------------------------------IVEAEGVLEEFLRRIAKSRD..TVAYTPGEVLAVARM---G-----
RF1_PYRHO/278-417----------------------------------VIREKKLVNEFLKHVVK..DTGLATYGEREVRRALEI---G-----
PELO_METJA/254-346----------------------------------VAKETQLIEKLLEEIAK..K.GLAVYGIDEVKKALEY---S-----
B2AWT5_PODAN/281-418----------------------------------FIQEKKLIGKYFEEISQ..DTGRICYGVEDTLKALEL---G-----
PELO_THEVO/247-338----------------------------------ISRDNEIVSAFLSSLRR..G..SGIYGSEEIRKYLEM---G-----
ERF1_TRYBB/281-420----------------------------------LVQEKKLLQGFFDQIAC..DTQLYCFGVQDTLKCLEA---G-----
PELO_SULSO/245-343----------------------------------IAIGAKKMEKAMELLAK..QPELVTYGLEQVKNAIEM---G-----
Q9BMX1_EUPAE/276-413----------------------------------FVEEKNLISKYFEQIAL..DTGMIVFGVEDTLHSLEI---G-----
PELO_PYRAB/260-355----------------------------------VAQEIKLVEKVIERIAK..D.EPVAYGLKDVEEAVNY---G-----
RF1_METTH/274-407----------------------------------VMREKKLVQRFLRELIN..EDGLASYGEREVRQHLQM---G-----
RF1_ARCFU/270-403----------------------------------IIREKNLMQRFLKEVAR..D.GLAAYGEEEVRRYIEL---G-----
ERF1_SCHPO/277-416----------------------------------YVQEKKLIQRFFDEISL..DSGKYCFGVVDTMNALQE---G-----
RF1_AERPE/279-370----------------------------------YRDAVNAMEEFKLHLAK..GTGMIVYGEKDVEAALEM---G-----
RF1_SULSO/275-368----------------------------------YIEVEKLLEELKYHLAK..DDGLIIYGKEQIKKAMEI---G-----
PELO_ARCFU/246-342----------------------------------LAEEAEYIDRLLEGIAK..G.ERVAYGLDEVREAHNY---R-----
RF1_THEVO/277-410----------------------------------ISREKDLMDRFLREVKK.PDGGLAVYGEKAIRDALEQ---K-----
ERF1_BLEAM/280-415----------------------------------FIREKKVMSKFFEEVAQ..DTKKYCYGVEDTMKSLLM---G-----
PEL1_ARATH/271-370----------------------------------AAKEVKALNDFHNMLST..EPDRACYGPKHVEVANER---M-----
ERF1_GIAIN/290-432----------------------------------LIQEVKLLTEFTENIAK..DTKRVCFGITDTIRCLEM---S-----
PELO_DROME/271-370----------------------------------AAGEVKALEQFYMMLQC..EPAKAFYGKKHVLQAAES---Q-----
ERF1_STYMT/285-422----------------------------------FVAEKKLVSKFFEEISL..DTGMIVFGVQDTMKALEL---G-----
PELO_CAEEL/271-370----------------------------------AQGEVKALNQFLELMST..EPDRAFYGFNHVNRANQE---L-----
PELO_THEAC/247-338----------------------------------IARDKEIVDEFLVAVKK..D..MGVYGRDQTESALQM---G-----
PELO_HALSA/254-356----------------------------------IAEESELIDELTTQMAT..D.GKAAYGIDEVQKAVEF---G-----
I7MKI5_TETTS/279-414----------------------------------FVQEKNVISKFFDCIAI..DSGTVVYGVQDTMQLLLD---G-----
A0A024WDX6_PLAFA/276-411----------------------------------FIQEKKLIGKFFEEIAQ..DTGKVVYGIDDTLKALEI---G-----
P79004_SACPS/277-376----------------------------------LIKEIQIMDDFFEHLNK..DDNKAWYGKEEIKRAAKL---E-----
DOM34_SCHPO/271-370----------------------------------YVQEIRVLNKFYDVMNE..DDRKAWYGPNHVLKAFEL---G-----
RF1_HALSA/281-414----------------------------------LMDDKSDMEEFFEELN...GGKLATYGFEQTRRNLIM---G-----
RF1_METJA/277-419----------------------------------LMKEREAVQRFLKELIK.EDGGLACYGEKEVLEALMM---G-----

PF15608

Q0RDF6_FRAAA/285-365----------------------------------------------------------WAGWAAVERIAAA---Y-----
F8A7B9_CELGA/759-840----------------------------------------------------------WRGWAAVVRVAQE---Q-----
E4NAQ4_KITSK/291-371----------------------------------------------------------WAGWAAVERISAE---Y-----
A1VWP9_POLNA/279-359----------------------------------------------------------AISAEFLQSTTAR---H-----
Q5NWT5_AROAE/279-359----------------------------------------------------------EVSRVYMKEAMTQ---Y-----
Q8KL02_RHIEC/282-364----------------------------------------------------------DAAAAAVAWVMGE---D-----
D3VJW4_XENNA/275-357----------------------------------------------------------QLSKTVISNLAEK---Y-----
C8XAU5_NAKMY/305-385----------------------------------------------------------FAGWAAVERIRQQ---Y-----
F4EXE7_SELS3/265-346----------------------------------------------------------RSGLAEVERIAGD---F-----
E6UDF8_RUMA7/266-347----------------------------------------------------------ENTMEEVKAICQE---Y-----
H8GG70_METAL/281-361----------------------------------------------------------AVSLDFLKAVAQQ---Y-----
Q9RSA8_DEIRA/269-349----------------------------------------------------------QQPVRAVLARAAE---L-----
STIP_ACIAD/297-379----------------------------------------------------------DQSQQVVHKLAQE---Y-----
F2JGK7_CELLD/289-369----------------------------------------------------------FNAAQSVENIRQC---F-----
Q4FTP9_PSYA2/309-391----------------------------------------------------------YQTADLIDTLAAE---Y-----
D1BEJ8_SANKS/295-375----------------------------------------------------------WAGWKAVEAISAE---H-----
Q2RVZ5_RHORT/280-360----------------------------------------------------------AISTAFVEAMMQR---T-----
C0Z9Y7_BREBN/295-375----------------------------------------------------------WKGMRDIGRIQQE---L-----
C8W646_DESAS/311-391----------------------------------------------------------FRGLRDIERIKEE---Y-----
A8MM96_ALKOO/748-828----------------------------------------------------------WQGLEDIRRIQKD---F-----
F8K488_STREN/279-359----------------------------------------------------------WAGWAAVERIGEE---Y-----
A1SUD4_PSYIN/287-367----------------------------------------------------------SMTRFFLKEMMQQ---H-----
A4J1D7_DESRM/320-400----------------------------------------------------------WLGQKDTTRVQLE---Y-----
F8AVP2_FRADG/278-358----------------------------------------------------------WAGWQAVETLAKE---Y-----
D3RPA4_ALLVD/285-365----------------------------------------------------------ARSTALLADIRAT---F-----
F4H5N6_CELFA/811-892----------------------------------------------------------WSGWAAVERIVEE---Y-----
H6N264_GORPV/291-371----------------------------------------------------------WSGWASMERLRDE---Y-----
Q891X7_CLOTE/298-378----------------------------------------------------------DSGIKEVNEIKNM---Y-----
A6WD80_KINRD/287-371----------------------------------------------------------FTGWAEVERVSEH---Y-----
A5WBK3_PSYWF/314-396----------------------------------------------------------YHAQRIIETLANH---Y-----
E8U3T5_DEIML/257-336----------------------------------------------------------HAPVQTALDLARA---F-----
D1A9P2_THECD/292-376----------------------------------------------------------WAGRRAVRRIGER---Y-----
B4EW79_PROMH/276-356----------------------------------------------------------..SENVVSLLANK---Y-----
D4L2P5_9FIRM/132-213----------------------------------------------------------.SGIDEVKQIAKT---F-----
E3EE68_PAEPS/297-377----------------------------------------------------------WQGLRDIEAIQQA---F-----
J9STB4_9ACTN/293-373----------------------------------------------------------WSGWRSVERIQAE---Y-----
M1FGD7_9ALTE/290-371----------------------------------------------------------..ADRTVAAVAKR---F-----
Q186J5_PEPD6/281-358----------------------------------------------------------...YFDVLNIKEK---Y-----
Q3JCD3_NITOC/292-369----------------------------------------------------------..TRIYLNRWIDS---Y-----
Q7CKQ6_YERPE/276-357----------------------------------------------------------.QSHQVVKKMAEQ---F-----
R5BVZ9_9FIRM/264-345----------------------------------------------------------.QGLDEVLRIGRE---F-----
R5XB52_9CLOT/301-379----------------------------------------------------------..GNCDVKNIKQR---Y-----
R7CDA0_9FIRM/265-346----------------------------------------------------------.QGIDEVINIGKN---F-----
U5LCP5_9BACI/286-365----------------------------------------------------------.RGMEEVMAIKEE---Y-----

PF08228

Q6CTJ8_KLULA/13-168KRRQVYKPILENPFTNEAKLWPHVTDQKLVLELLEEKVLKRWKLLQD...MGNNEESITVGFNEIVDLLS...HGKDEY.
POP3_YEAST/14-171KRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS...KENYPWELYTDFNEIVQYLSGAHGNSDPV.
Q753G4_ASHGO/13-172KKKQVYKPILDNPYTNEAELWPHVREQSVVVELLLNAVLRPLRHARE.LG.GAPPFEVHTGYNDVMERLG..CAESGTA.
Q6FQW2_CANGA/3-151KRGGRVIPVLEDPYSNEK..WPYCTPE..QLELLDTYMDKSVLRALKNS.KPGEETGVVFDIAEILRVLQ...SESADV.
POP3_SCHPO/7-165KVKQTVKLVLRNPLSIS...WPIVDAN......TQEKLAQTLVQWLPASHKDILDSKLTVGLNSVNELLERCCQNAKDVT

PF05025

R5ICH0_9FIRM/3-147-----------------------------------------------------KNIPPILSPELLKVLAEM---GHGDRI
R6MWK2_9CLOT/3-142-----------------------------------------------------KKISPLISPELLKILAEM---GHGDVI
F8F334_TRECH/4-141-----------------------------------------------------.GISPVIGPDLLDTLFRM---GHGDEI
A7II16_XANP2/3-140-----------------------------------------------------KGIDPLLGPDLLATLRAM---GHGDEI
D5SWX7_PLAL2/1-146-----------------------------------------------------MLKSKLIHPDILAVLGRA---GHHARI
RBSD_PASMU/1-138-----------------------------------------------------MKKTALLNAPLSQVIATL---GHTDSL
RBSD_HAEPS/1-138-----------------------------------------------------MKKTTILNAQLSHVIATM---GHTDGL
A9HPM0_GLUDA/4-139-----------------------------------------------------.GISSLLTPDVLYALAAM---GHGDRV
E3D7F8_GARV3/3-144-----------------------------------------------------KGIDPIIPPELLKVLCEM---GHGDVL
H8L1D3_FRAAD/1-131-----------------------------------------------------MRPSGLLHAQLSGLIAGL---GHTDTL
D6XZQ8_BACIE/1-128-----------------------------------------------------MKKEGILNRDLAGIFAKL---GHTDHI
B8I9B2_CLOCE/3-141-----------------------------------------------------KGIPSILTPELLKTLMEM---GHSDEI
RBSD_LARHH/1-130-----------------------------------------------------MKKNGILNAPLSRVIAEL---GHTDYI
R7PPL8_9FIRM/1-133-----------------------------------------------------MQKIGILNSHIAKVLSDL---GHTDQI
R6HV06_9FIRM/3-139-----------------------------------------------------KNISPIISPELLKILMEM---GHSDEI
X2H1X6_9GAMM/1-138-----------------------------------------------------MRKGQLFNSDICQILSKM---GHTDQI
R5BKJ9_9FIRM/1-132-----------------------------------------------------MQKGGILNSHIAKVLADL---GHTDTI
Q12BF4_POLSJ/3-143-----------------------------------------------------KNIPPLLTPDALHALASM---GHGDDV
B7GMC2_ANOFW/4-133-----------------------------------------------------MKKRGVLNKELNTVFASL---GHTDMI
T1G8C4_HELRO/6-150-----------------------------------------------------..IPFIISPDLLHTLSSA---GHGDEI
Q161Y5_ROSDO/3-143-----------------------------------------------------KGIDPILNAEVLFALRAM---GHGDDL
G8LVS6_CLOCD/1-130-----------------------------------------------------MKKTKVLNSELSAVIASM---GHTDTI
Q7UUK8_RHOBA/1-146-----------------------------------------------------MLLSNLIHPEISAVCAAA---GHHSTI
R7N665_9FIRM/3-144-----------------------------------------------------KGIPKILSPELLKVLCEM---GHSDRL
RBSD_ACIAC/1-129-----------------------------------------------------MKRTALLHADLSRAIAAL---GHGDMI
E1RCT7_SPISS/3-141-----------------------------------------------------KGIPKIIPPDLLKILMEM---GHGDDL
A3DCF4_CLOTH/11-139-----------------------------------------------------MVETGILNRDIAAELAKL---GHTDRV
B9K2K2_AGRVS/3-138-----------------------------------------------------KTINPLLTGDLLAILADM---GHGDEI
L9KX68_TUPCH/6-148-----------------------------------------------------.GVPALLSPELLYALARM---GHGDEI
F4H9V0_GALAU/3-142-----------------------------------------------------KGIDPVISPELLKVLAEM---GHGDEI
RBSD_GEOKA/1-130-----------------------------------------------------MKKSGILNKELNTLLASL---GHTDTI
I3TF87_THEC1/6-141-----------------------------------------------------..KTPIIHPELLYELSKL---GHTDVF
F7ESI4_MONDO/5-149-----------------------------------------------------KGIPSLLSPELLFALAKM---GHGDEI
RBSD_CALS4/1-129-----------------------------------------------------MKKTELLNSEISEVVARL---GHKDLL
F6DR08_DESRL/1-131-----------------------------------------------------MKKGGILNPALNKLIAET---GHTDYI
D2BEN5_STRRD/1-128-----------------------------------------------------MKRAGILNAALSGGLARL---GHTDEL
E3QVQ1_COLGM/4-139-----------------------------------------------------KGISPVISPDLLKILAQM---GQGDEI
W0PHP3_9BURK/3-141-----------------------------------------------------KNIDPLLNADVLHALRAM---GHGDEL
D4H243_DENA2/1-131-----------------------------------------------------MKKGKLLNSRISSVISEM---GHTDML
T2KGG9_9FLAO/4-141-----------------------------------------------------.GISPLISPELLKVLAEM---GHGEEI
K0KGS5_SACES/1-128-----------------------------------------------------MKRAGILHPGLNAELARL---GHTDEV
R7G568_9PROT/4-139-----------------------------------------------------.GVPKLVSPELIKVLCEM---GHGDEI
B9K2A2_AGRVS/4-140-----------------------------------------------------.GLNPILNPELLATLRAM---GHGDEI
B8CWP6_HALOH/1-138-----------------------------------------------------MVKGGLIHPHILESVAAA---GHGAQI
RBSD_PHOLL/1-138-----------------------------------------------------MKKGVLLNSEISAVISQL---GHTDQI
A5G2I4_ACICJ/4-141-----------------------------------------------------.GIDPILTADLLHALRAM---GHGDTI
R7D1N9_9ACTN/3-144-----------------------------------------------------KGISPILPPELLSIMCEM---GHGDTL
G8PKF7_PSEUV/7-141-----------------------------------------------------KGINPIIFPELLKILHEM---GHGDEL
RBSD_DESRM/1-129-----------------------------------------------------MKKQGVLHRDLAALIASL---GHRDAI
Q128C2_POLSJ/3-144-----------------------------------------------------KGIDSLLTPELLKLLAEM---GHDDAL
H6NDH4_9BACL/4-141-----------------------------------------------------.GIPRILSPELLKVLMEM---GHGDEI
RBSD_CLONN/1-130-----------------------------------------------------MKKTPLLNSSICEVVSKM---GHTDMI
D7C1Q2_STRBB/1-133-----------------------------------------------------MKRSGIFNRQLSGAIAEL---GHTDTV
RBSD_PROMH/1-138-----------------------------------------------------MKKGVLLNSSISSVIARL---GHTDKI
RBSD_LACPL/1-130-----------------------------------------------------MKKTKVINSDLSRVIATM---GHFDKL
R5HCY6_9FIRM/3-140-----------------------------------------------------KGISPLISPELLKVLDEM---GHGDEI
A6WDZ4_KINRD/2-137-----------------------------------------------------.LTYDLLHPQLLAGLAAA---GHGDRV
D8LIE6_ECTSI/5-148-----------------------------------------------------.GISPLISPDLLVTLARM---GHGDSI
H2IYD3_RAHAC/1-138-----------------------------------------------------MKKSSLLNAEVSHVIARL---GHTDQL
FUCM_DANRE/5-147-----------------------------------------------------KGIPSVLTPELLYVLAQM---GHGDEL
R5F996_9CLOT/1-130-----------------------------------------------------MLKTGILHPQLARVLAEL---RHKDTI
R5A6P8_9CLOT/7-136-----------------------------------------------------KQ....FTPELLRLIMEM---GHGEKI
RBSD_PSELT/1-131-----------------------------------------------------MKKNGILNRELSYLIASM---GHGDIL
A9KR29_CLOPH/4-144-----------------------------------------------------.KIPKILSPELLKVLCEM---GHSDRI
W8VC37_YEREN/1-138-----------------------------------------------------MKKGALLNSDISAVISRL---GHTDQL
E3D852_GARV3/1-130-----------------------------------------------------MLTHGILNSQLAAALAKL---RHKDQF
R5WS75_9FIRM/4-144-----------------------------------------------------.NIPPILSPDLLKVLAEM---GHGDTI
F0LZN3_VIBFN/9-146-----------------------------------------------------MKKSTLLNADLSYLVATL---GHTDEI
C3Y6F8_BRAFL/4-145-----------------------------------------------------KGIPRILSPELLFVLARM---GHGDEI
RBSD_PSEPK/1-131-----------------------------------------------------MKKTPLLNVALSRVIAGM---GHGDIL
K1XXH2_MARBU/3-141-----------------------------------------------------KGIDPLLTPELLQALRAM---GHGNTI
E3HAW5_ILYPC/1-134-----------------------------------------------------MKKMRLLNSEISYEVAKL---GHTDHI
E3PV76_CLOSD/1-132-----------------------------------------------------MIRGRLLNSEIISVLAAM---GHTDQL
A5UTT7_ROSS1/1-136-----------------------------------------------------MLRYKLIHPQILAALGGA---GHGSQV
W5M9Q7_LEPOC/5-148-----------------------------------------------------KGIPSIISPDLLYALAKM---GHGDEL
D4LNS7_9FIRM/3-144-----------------------------------------------------KGIPEILSPELLKVLCEM---GHSDRL
RBSD_NATTJ/1-134-----------------------------------------------------MKKTTLLNSEISRVTSQM---GHTDGL
B7VTM7_VIBTL/17-154-----------------------------------------------------MKKSTLINSELSYLVATL---GHTDEI
R5XA15_9CLOT/1-132-----------------------------------------------------MKRHGILNSDISRVLSYM---GHTDCI
R5XIE2_9FIRM/3-141-----------------------------------------------------KGIPKIISPEILKILCEM---GHGDEI
B9K575_AGRVS/3-146-----------------------------------------------------KNLHPALNADVLHALRSM---GHGDTL
Q982U4_RHILO/3-145-----------------------------------------------------KGINPLLNADVLQALRAM---GHGDDL
M4R5G6_BIBTR/1-138-----------------------------------------------------MKKTTILNAQLSHTIATL---GHTDGL
U3GZS3_9CORY/1-127-----------------------------------------------------MLKQGLINRDLLAYAAEL---GHTDSF
C6D5S1_PAESJ/1-130-----------------------------------------------------MKKQGILNSHIAKVLADL---GHTDTL
RBSD_RHOBA/1-134-----------------------------------------------------MKRTRLLNSELSYEISRI---GHTASI
B1Y3G2_LEPCP/3-150-----------------------------------------------------KGIDPLLTPDLLKVLAEM---GHGDEI
B9J8G9_AGRRK/2-139-----------------------------------------------------KGIDPLLSPELLATLRAM---GHGDEI
F6B8R0_DESCC/1-129-----------------------------------------------------MKKHGILHRELAALIASL---GHGDAI
RBSD_OCEIH/1-130-----------------------------------------------------MKKKGMLNSEISKVLSDL---GHTDQI
F8JJP4_STREN/1-128-----------------------------------------------------MRKTGILNRHLCGALAEL---GHTDGL
C6WJV2_ACTMD/1-137-----------------------------------------------------MLRYPLLHPPLLAVLAAS---GHGSKV
RBSD_COPPD/1-130-----------------------------------------------------MKKTILINSRLSEVIASM---GHTDTI
G3T222_LOXAF/6-148-----------------------------------------------------.GVPPLLSRELLYALARM---GPGDET
K4R9V9_9ACTN/1-128-----------------------------------------------------MKRSGILNRHLSGALAEL---GHGDGV
RBSD_VIBPA/1-138-----------------------------------------------------MKKSTLINSGISYLVATL---GHTDEI
RBSD_BACCR/1-130-----------------------------------------------------MKKHGVLNSEIAAVLASL---GHTDTV
A9UVL6_MONBE/5-149-----------------------------------------------------KGIPKILPPELLFALAKM---GHGDEL
G0AFB1_COLFT/7-135-----------------------------------------------------MKKSPLLNIALSQLIASL---GHGESI
RBSD_ACTSZ/1-138-----------------------------------------------------MKKTTIINAQLSYAIATL---GHTETL
E3E7K1_PAEPS/1-142-----------------------------------------------------MKKHGILNSHISKILADL---GHTDFI
D4H283_DENA2/3-141-----------------------------------------------------KGISPFLSPELLAELHRM---GHGDEI
R6QNX9_9FIRM/3-144-----------------------------------------------------KGINPIVSPELLKALCEM---GHGDEL
G0GEK3_SPITZ/4-132-----------------------------------------------------.KRYGILNAEIASVLAHL---GHTDAI
RBSD_BACLD/1-130-----------------------------------------------------MKKHGILNSHIAKLLADL---GHTDTI
RBSD_STRU0/1-131-----------------------------------------------------MKKHGILNSDLAKIVDDL---GHTDRV
RBSD_LACC3/1-129-----------------------------------------------------MKKGTVINTQLSQVIADM---GHFDLL
A1WFB4_VEREI/3-144-----------------------------------------------------KGIDPLLSPDLLRLLAEM---GHDDAL
G8PEY8_PEDCP/1-130-----------------------------------------------------MKKTKVINSQISTLIAGM---GHMDWL
Q21X77_RHOFT/3-144-----------------------------------------------------KGINPLLTPELLKILMEM---GHDDAL
H2FT88_OCESG/1-138-----------------------------------------------------MKKTTLLNSHLSALVASL---GHTDEI
F4HBP8_GALAU/1-138-----------------------------------------------------MKKTGILNAQLSHLIATL---GHTDFL
RBSD_CHRVO/1-131-----------------------------------------------------MKKHGHLNRDIARILASM---GHTDSL
RBSD_SYMTH/1-130-----------------------------------------------------MKKTTLLNQALSEVVAGM---GHGDLL
D9R029_CLOSW/1-130-----------------------------------------------------MLKTGILHPQLARVMAEL---RHMDLL
E4U8X1_OCEP5/5-140-----------------------------------------------------KGIPPLLSPELLAALAEM---GHGDEI
F4LMF0_TREBD/1-130-----------------------------------------------------MKRLGILNSDISRVLSYM---RHTDTL
D4ZG03_SHEVD/1-138-----------------------------------------------------MRKGALLNSDLARVIALS---GHTDEI
RBSD1_STRGG/1-130-----------------------------------------------------MKRSGILNAELGEALATL---GHTDLL
FUCM_HISS2/3-141-----------------------------------------------------KGIHPAISPDLLKILAEM---GHGDEL
D3UY14_XENBS/1-138-----------------------------------------------------MKKGVLLHSDISAVISRL---GHTDQI
F4LLA6_TREBD/5-141-----------------------------------------------------..VSPVISPDLLAVLHRM---GHGDEI
B4EJ62_BURCJ/3-146-----------------------------------------------------KNLDPLLHADILHTLRAM---GHGDEI
R6EA07_9FIRM/4-146-----------------------------------------------------.GIPTRIGSDLLKALADM---GHGDLI
F4LXK2_TEPAE/1-137-----------------------------------------------------MLKTSCINPEIMSTLACC---GHGDKI
R6JSG5_9CLOT/7-146-----------------------------------------------------....ASISPELLKVLHEM---GHGDTL
K0T8W6_THAOC/9-148-----------------------------------------------------....PLLTAD.RHVLRSM---GHGDRL
R5C6U3_9FIRM/1-135-----------------------------------------------------MLKGKLIHPELIHQLALC---GHGSKI
G2TI29_BACCO/2-130-----------------------------------------------------MKKHGMLNSSITKVLADL---GHTDWL
A1VQI0_POLNA/3-144-----------------------------------------------------KGIDPLITPELLKLLMEM---GHDEAV
R6G767_9FIRM/1-130-----------------------------------------------------MKKRGILNAQLSYLLAAL---GHKDLF
B9K570_AGRVS/3-146-----------------------------------------------------KGIDPVLNAELLHALMLM---GHGDQL
D8MK90_ERWBE/1-138-----------------------------------------------------MKKGTLLNSDISSVVSRL---GHTDSL
RBSD_HISS2/1-138-----------------------------------------------------MKKTKLLNASLSHYIATL---GHTDSL
RBSD_LACJO/1-130-----------------------------------------------------MKKTGVMNSNISRVIADM---GHMDWL
R6WBJ3_9FIRM/1-146-----------------------------------------------------MKKNGIYNAKLSEVVGKM---GHGDII
W0IZS2_9BACT/3-141-----------------------------------------------------KGISPLISPDLLAVLARM---GHGDEI
Q7MJI4_VIBVY/14-152-----------------------------------------------------KGIHPALSPQLLATLSEM---GHGDEI
RBSD_VIBVY/1-138-----------------------------------------------------MKKSALLNSELSYLVATL---GHTDEI
RBSD_EXIS2/1-128-----------------------------------------------------MKRHGILNSQISKVLADL---GHTDTI
F1N1P7_BOVIN/6-148-----------------------------------------------------.GVPALLSPELLFALARM---GHGDEI
R5LEZ8_9SPIR/1-130-----------------------------------------------------MKKNGIINSDISKVLSYM---RHTDLI
D7CRD7_TRURR/4-141-----------------------------------------------------.GISPVIGPDLLATLYRM---GHGDEI
K0I412_9BURK/1-128-----------------------------------------------------MKRTALLHAELSHAIATL---GHGDML
G8QUN1_SPHPG/3-140-----------------------------------------------------KNIPSIISPELLKVLMEM---GHGDEL
E4T6S2_PALPW/3-141-----------------------------------------------------KGISPLISPELLAVMARM---GHGDEI
RBSD1_RUBXD/1-128-----------------------------------------------------MKRGGIVNAQLAGALARL---GHTDTL
D6GRT6_FILAD/1-130-----------------------------------------------------MKKSELLNSDLSYEISKM---GHTQTI
R6YDK3_9FIRM/3-141-----------------------------------------------------KGIPAILPPELLKILMEM---GHGDEL
FUCM_HAEPS/3-141-----------------------------------------------------KGIHPALSPELLKVLAEM---GHGDEI
H0W3P3_CAVPO/6-144-----------------------------------------------------.GVPALLSPELLYALARM---GHGDEI
C3Y6F6_BRAFL/5-148-----------------------------------------------------KGIPRILSPELLFVLARM---GHGDEI
V4IC28_9ACTN/1-128-----------------------------------------------------MKRSGILNRHLAGALAEL---GHGDEL
M9X3I0_MANHA/3-141-----------------------------------------------------KGIHPAISPDLLKVLAEM---GHGDEL
R6JZZ1_9CLOT/4-144-----------------------------------------------------.GIPHILSPELLKILCEM---GHSDRI
RBSD_PSESM/1-133-----------------------------------------------------MKKTPLLNIALSRVIASL---GHGDIL
RBSD_THEMA/1-134-----------------------------------------------------MKKVGILNSEISKIVADM---GHMDTL
K0J4C7_AMPXN/1-128-----------------------------------------------------MKKHGVLNRELSIVLSEL---GHTDTI
D9SWA7_CLOC7/3-144-----------------------------------------------------KGIPQILSPELLKVLCEM---GHSDRI
I1G0R8_AMPQE/5-149-----------------------------------------------------KGIPRIINPSLLSVLARM---GHGDEI
Q161J5_ROSDO/4-141-----------------------------------------------------.GIDPVLTPDLLRHLGAM---GHGDQL
RBSD_BACSU/1-130-----------------------------------------------------MKKHGILNSHLAKILADL---GHTDKI
RBSD_EDWI9/1-138-----------------------------------------------------MKKGTVLNSELSALISRL---GHTDSV
G8NVC3_GRAMM/3-141-----------------------------------------------------KGIDPLLSPELLKVLSSM---GHRHEI
RBSD_STAA8/1-133-----------------------------------------------------MKKSAVLNEHISKAIATI---GHFDLL
R5BRR7_9FIRM/1-130-----------------------------------------------------MKKRGIINAQLSGLIAGL---GHKDTF
Q28QH5_JANSC/3-146-----------------------------------------------------KGIDPRLNADVLHCLRAM---GHGDTL
B5HI15_STRPR/1-129-----------------------------------------------------MKKNGILNRHLAGALAEL---GHGDTV
D3E5A9_GEOS4/3-141-----------------------------------------------------KGISHLLSPELLKILMEM---GHADEI
M4AGZ9_XIPMA/5-148-----------------------------------------------------KGIPSVLSPELLYALAKM---GHGDEL
C4LA69_TOLAT/1-138-----------------------------------------------------MKKHVLLNAPLSHVIATM---GHTDQL
W0HY81_9GAMM/5-139-----------------------------------------------------..LSPLIGPELLKTLWEM---GHGDDI
W5XRT5_9CORY/1-129-----------------------------------------------------MLKRGLLNPQLNEAVSHL---GHTDAL
Q985Q0_RHILO/4-140-----------------------------------------------------.GIPALLGPDLLATLRAM---GHGDEI
A9CIE0_AGRFC/3-146-----------------------------------------------------KNIDPALNADVLHALRAM---GHGDTL
FUCM_HAEIN/3-141-----------------------------------------------------KGIHPALSPELLKTLAEM---GHGDEI
G0GEL8_SPITZ/4-141-----------------------------------------------------.GIPPIVGPDLLYVLHRM---GHGDEL
V5XTJ3_ENTMU/1-130-----------------------------------------------------MKKTKVINSDISRVIAQM---GHFDKL
Q15PP4_PSEA6/1-136-----------------------------------------------------MLKTAVIHPTILEALGRS---GHFAQV
Q8DN18_STRR6/4-140-----------------------------------------------------.HIPKNISPDLLKTLMEM---GHGDEI
E0SDT7_DICD3/1-138-----------------------------------------------------MKKGALLNSDISSVISRL---GHTDQI
B2UPN2_AKKM8/3-136-----------------------------------------------------KNISPLISPSLLKILAEM---GHGDEI
RBSD_STRA5/1-131-----------------------------------------------------MKKTGILNSHLAKLADDL---GHTDRV
D8J0Y3_HERSS/3-146-----------------------------------------------------KNLHPLLNADVLYALRAM---GHGDEL
RBSD_PSYIN/1-137-----------------------------------------------------MKKTALLNAELSYLVASL---GHFDEI
RBSD_AERHH/1-138-----------------------------------------------------MKRGVLLNAPLSALVARM---GHTDEI
R7CST6_9FIRM/1-133-----------------------------------------------------MNKYGILNSSIAKVLADL---GHTDKI
E6K2M3_PARDN/1-130-----------------------------------------------------MLTHGILNAQLSHALATL---RHKDRF
F8HZV5_WEIKK/1-133-----------------------------------------------------MRKTNLLNTKLSNAISEI---GHTQWL
H5WTN9_9BURK/3-145-----------------------------------------------------KGIDPLLTPDLLKVLAEM---GHGDEI
Q2K1E4_RHIEC/3-146-----------------------------------------------------KGIRAELNGDILQALCNM---GHGDYL
C6CWG2_PAESJ/4-141-----------------------------------------------------.GIPKIISPELLKILMEM---GHSDEI
R7FCF1_9FIRM/3-141-----------------------------------------------------KHIPAILTPDLLKILMEM---GYGDEI
RBSD2_RUBXD/1-131-----------------------------------------------------MKRSGILNQPLSNILASF---GHTDLL
E1SQZ3_FERBD/1-138-----------------------------------------------------MKRGALLNSHLSQLISLS---GHTDEL
F0SXR5_SYNGF/4-142-----------------------------------------------------.GISPLISPELLKILCEM---GHGDDI
I2F8D7_9BACT/1-132-----------------------------------------------------MKKSGILNKEICNLIGSM---GHTDLL
K8E678_CARML/1-130-----------------------------------------------------MKKHGILNSDISKVLSDL---GHTDQI
RBSD_BACP2/1-129-----------------------------------------------------MKKNGILNSHIAKVLADL---GHTDTI
RBSD_CLOPE/1-130-----------------------------------------------------MRKTSLLNSNISSVISKM---GHTDML
RBSD_HELMI/1-129-----------------------------------------------------MKKQGILHRDLAALIASL---GHGDLV
C8WRM8_ALIAD/1-129-----------------------------------------------------MKRSGILHGRLSQIIAEL---GHGELI
RBSD_DESAD/1-138-----------------------------------------------------MKRTGLLNSELSYIISKL---GHFDAL
A8AMU2_CITK8/1-137-----------------------------------------------------MIKSDIIHPDLLQALAQC---GHKANI
D4JSL9_9FIRM/3-144-----------------------------------------------------KNIPAILSPELLKTLCEM---GHSDRI
D7C7T7_STRBB/3-141-----------------------------------------------------KGIDPLLTPDLLYALARM---GHGDTI
U5MT14_CLOSA/1-130-----------------------------------------------------MKKTALLNSDLSSVISKM---GHTDLL
G9WJ23_9LACT/1-131-----------------------------------------------------MKKGVLLNSEISAVVADM---GHFDTL
RBSD_BACHD/1-128-----------------------------------------------------MKKHGVLNRDIARILASL---GHTDQI
L0DPF0_SINAD/1-130-----------------------------------------------------MKKGGILNPAICSLLAEL---GHMDEL
E8N1H2_ANATU/1-130-----------------------------------------------------MKKTALLNSALSEVIATL---GHGDML
M4UKW9_9GAMM/1-133-----------------------------------------------------MKKTALLNPELSYLIASL---GHFDEV
RBSD_STAEQ/1-133-----------------------------------------------------MKKTAVLNSHISSAISTL---GHYDLL
D1BQI4_VEIPT/1-132-----------------------------------------------------MQRHGILNSHIAKVLADL---GHTDTI
M9WWK1_MANHA/1-138-----------------------------------------------------MKKTLNLNAQLSHSIATL---GHTDSL
R5TNK7_9FIRM/3-146-----------------------------------------------------KGIPKILSPELLKVLCEM---GHSDRI
C4LFS0_TOLAT/3-146-----------------------------------------------------KNIPPFMDAELLWILAAM---GHGDEL
I4D7C5_DESAJ/1-129-----------------------------------------------------MKKQGVLHGELSRIIATL---GHGQSL
F6AIR2_PSEF1/1-133-----------------------------------------------------MKKTPLLNAELSAAIARL---GHGDVI
G8MES4_9BURK/3-146-----------------------------------------------------KNIDPLLNADILHALCAM---GHGDEV
I0GTY5_SELRL/1-130-----------------------------------------------------MKKSGILHAQLSACVAAL---GHKDLF
Q1R0M9_CHRSD/1-143-----------------------------------------------------MINGPLLHPPLLHALAAA---GHGAKI
I6WS14_PROPF/4-143-----------------------------------------------------...GPMTHPGLLAALGRS---GHSGKI
R6J451_9CLOT/3-144-----------------------------------------------------KGISPLLSPELLKALDEM---GHGDTL
I2F732_9BACT/1-146-----------------------------------------------------MKTKGILHNDLSREVARL---GHGDML
RBSD_LACBA/1-130-----------------------------------------------------MKKTTVINSELSTVIAGM---GHMDWL
F7YRL9_VIBA7/1-138-----------------------------------------------------MKKSTLLNSELSYLVATL---GHTDEI
R5FD09_9CLOT/1-137-----------------------------------------------------MKRHGILNSNISRVLSAM---GHTDRI
RBSD2_STRGG/1-128-----------------------------------------------------MKKSGILNRHLAGAIAEL---GHGDTV
C9Z854_STRSW/1-128-----------------------------------------------------MQRNGIIHSGLAGLIAGL---RHTDTF
A4YW09_BRASO/3-146-----------------------------------------------------KNLDPLLNADVLYALRAM---GHGDRL
RBSD_PHOPR/1-138-----------------------------------------------------MKKNALINAELSYVVATL---GHTDEI
U4KB26_9VIBR/1-138-----------------------------------------------------MKKGTLIHSELSHLVATL---GHTDEI
RBSD_VIBF1/1-138-----------------------------------------------------MKKNTLLNSELSYVIATL---GHTDEI
B9JAZ3_AGRRK/3-146-----------------------------------------------------KGISPRLNADVLHALASM---GHGDML
I0IEV2_PHYMF/1-147-----------------------------------------------------MLKTSLTHPEILGVLGRA---GHLARV
F8F0A5_TRECH/1-130-----------------------------------------------------MKKLGILNSAIATVLAHM---GHTDMI
X4QXA5_9ACTO/3-139-----------------------------------------------------KGISPKISPSLLNILARM---GHGDEI
I0HQ21_RUBGI/1-130-----------------------------------------------------MKKNGLLHPELARCIAAL---GHGDMV
RBSD_LACRD/1-130-----------------------------------------------------MKKTGIINSEVSAVVANM---GHMDWL
F2F275_SOLSS/1-128-----------------------------------------------------MKKQGILNRELAGIFARL---GHTDKI
W8T760_EUBAC/1-134-----------------------------------------------------MKKTGLINSSISAAIAGM---GHTDSI
E3DLS9_HALPG/1-130-----------------------------------------------------MKKNGIINSELSKVIAEM---GHKNSL
F0SHV6_RUBBR/1-146-----------------------------------------------------MLKHQLIHPEINAIIGRA---GHHSKI
T0K591_COLGC/4-141-----------------------------------------------------KGISPVISPDLLKVLAEM---GHGDEI
RBSD_KOSOT/1-131-----------------------------------------------------MKRSGIINREIARIAAEM---GHMDRI
F2UJC5_SALR5/5-149-----------------------------------------------------KGIPSILPPELLLALAKM---GHGDEL
D5AN92_RHOCB/3-141-----------------------------------------------------KNIDPILTADLLYTLRAM---GHGDEI
Q896U5_CLOTE/1-137-----------------------------------------------------MLKIKCLNPQLIRALAHC---GHGDKI
R6DJZ8_9FIRM/3-139-----------------------------------------------------KNIPSILSPELLKILMEM---GHGDYI
D2Q2A4_KRIFD/1-136-----------------------------------------------------MLRYPLIHPPLLGALARA---GHGSVV
B2IKF4_BEII9/3-143-----------------------------------------------------KGIDPILSPEFLSILRAM---GHGDEI
RBSD_STACT/1-133-----------------------------------------------------MKKTPLLNSQVSQAVATI---GHFDLL
RBSD_CLOBB/1-130-----------------------------------------------------MRKTALLNSDLSSVISKM---GHTDMI
R6AC27_9FIRM/1-133-----------------------------------------------------MQKIGILNSNIAKVLADL---GHTDKI
J9YYK7_9PROT/4-141-----------------------------------------------------.NIDPILSPEILHTLRSM---GHGDKL
G4L5H4_TETHN/1-130-----------------------------------------------------MKKTKVINSNLSRVISQM---GHFDKI
D2R7C7_PIRSD/1-146-----------------------------------------------------MLRSTLIHPEISRVLAAA---GHHAKI
V5WH75_9SPIO/1-130-----------------------------------------------------MKRTGILNRPLSDAIASM---GHTDSL
C9R6M5_AGGAD/1-138-----------------------------------------------------MKKTIILNAQLSHCIATL---GHTDGL
L7VKA3_CLOSH/3-144-----------------------------------------------------KGIPKILSPELLKVLCEM---GHGDRI
R5TTQ0_9FIRM/1-136-----------------------------------------------------MKQQGILNSDISRVLSYM---GHTDTI
A6VWH0_MARMS/3-144-----------------------------------------------------KNIDPLLSGELLNVLRTM---GHGDDI
I2BEN0_SHIBC/1-138-----------------------------------------------------MKKGTVLNAEISGVISRL---GHTDTL
RBSD_LACSS/1-130-----------------------------------------------------MRKTKVINTQISSVISDM---GHFDTL
R7III7_9FIRM/3-140-----------------------------------------------------KGISPLISPELLKVLCEM---GHGDEI
RBSD_EXISA/1-128-----------------------------------------------------MKKQGILNSHLAKIFADL---GHTDRV
Q3Y2W3_ENTFC/1-130-----------------------------------------------------MKKGKVINSDISRVIAQM---GHFDKL
Q7CL41_YERPE/1-130-----------------------------------------------------MRPDRILHPELAAALATL---GHTDII
C9YX65_STRSW/1-137-----------------------------------------------------MLLTDLLHPGILEALAGA---GHGSRV
E8QWG2_ISOPI/1-131-----------------------------------------------------MKKRGILNPAICSLLAEL---GHQDEL
R5ERS4_9GAMM/1-132-----------------------------------------------------MKKIGCLNSELSYVISKL---GHFDTL
R6LVN6_9FIRM/1-130-----------------------------------------------------MKKRGIINAQLAGLIAGL---GHKDTF
F0RTX8_SPHGB/3-140-----------------------------------------------------KTIPSILSPDLLKILMEM---GHGDEL
R5A403_9CLOT/3-143-----------------------------------------------------KGIPPILSPELLKVLAEM---GHGDEI
R6ND69_9CLOT/3-139-----------------------------------------------------KNISPIISPELLKILMEM---GHGDEI
RBSD_ACTP2/1-138-----------------------------------------------------MKKTAVLNAQLSGVIASL---GHTDGL
RBSD_LACAC/1-130-----------------------------------------------------MKKTGILNSDISRVVADM---GHMDWL
RBSD_CROS8/1-138-----------------------------------------------------MKKGTVLHSGISSVISRL---GHTDTV
J7TDW0_MORMO/1-138-----------------------------------------------------MKKGALLNGDVSAVIARL---GHTDHI
FUCM_KLEP7/3-139-----------------------------------------------------KTISPLISPELLKVLAEM---GHGDEI
RBSD_BACSK/1-128-----------------------------------------------------MKKLGILNRDIARVLASL---GHTDQI
I0JTG6_HALH3/1-130-----------------------------------------------------MKKHGILNREIASILARL---GHTDTI
H8H116_DEIGI/1-133-----------------------------------------------------MKRRGLLHPDLSALVARA---GHTQTI
E1R2M1_SPISS/1-129-----------------------------------------------------MKKSRILSKPLNDAIAAM---GHGDFI
F0RJP3_DEIPM/1-130-----------------------------------------------------MKKSGLLNPELSALVAQA---GHTQRI
F5YAI5_TREAZ/4-141-----------------------------------------------------.GISPVISPELLDALFRM---GHGDEL
D5E272_BACMQ/1-128-----------------------------------------------------MKRHGMINSHITKILTDL---GHTDTI
F9VK47_ARTSS/1-130-----------------------------------------------------MKKTCLLNNSISSVISKM---GHTDMI
RBSD_HAEIN/1-138-----------------------------------------------------MKKTALLNAQLSHCIATL---GHTESL
N0AWL8_9BACI/1-130-----------------------------------------------------MKKQGILNSHISEVLSRM---GHTDTI
W0LD73_9GAMM/1-138-----------------------------------------------------MKKGVLLNSEVSAVVSRL---GHTDQL
RBSD_LACLA/1-131-----------------------------------------------------MKKEGILNSELAKIADDL---GHTDQV
Q2YQE7_BRUA2/3-138-----------------------------------------------------KNINPLLTGSLLAILADM---GHGDDL
F4GKH9_SPHCD/3-139-----------------------------------------------------KGISSILSPELLKILMEM---GHGDEL
RBSD_PSEF5/1-133-----------------------------------------------------MKKTPLLNIALSRLIASL---GHGDIV
K0I3R8_9BURK/3-144-----------------------------------------------------KNIDPLLTPDLLKVLAEM---GHDDAI
W0HUD8_9GAMM/1-137-----------------------------------------------------MLKSEILHPQLLGSLAQC---GHKTLI
F0YHV1_AURAN/34-177-----------------------------------------------------.GLDPILSAELLFTLRSA---GHGDVI
RBSD_CLOTE/1-130-----------------------------------------------------MKKIGILNNEISHVISKM---GHTDSL
Q13FK6_BURXL/3-146-----------------------------------------------------KNLDPLLNADVLYALRAM---GHGDEL
D3E6C1_GEOS4/1-130-----------------------------------------------------MKKNGMLNSHIAKVLADL---GHTDTI
Q89HT9_BRADU/3-146-----------------------------------------------------KSIDPILTPDLLWLLASM---GHGDDL

PF04705

J7LIM1_NOCAA/1-114-FIEI-YGIET----QPPS---------------------------------------------------EELLELCRER
J7KYH7_NOCAA/1-114-FIEI-YFSDA----TPVD---------------------------------------------------PKIADLCEKN
X5DQN6_9CORY/7-116-IDSL-YITEG----RNPL---------------------------------------------------ALDEVVSELH
D5UK31_CELFN/3-112-VLGV-YALEG----ADVG---------------------------------------------------PGLGAAARTR

PF08032

Q8CXU2_LEPIN/36-110.FQNI.LFSPE...CFLGE.......-------------------------------------------..NEFSLIRSI
O96263_PLAF7/86-167TIEEV.IVNKN..IKLNRKIHKQNY.-------------------------------------------.EYIFDELKKR
Q6BTY4_DEBHA/128-204SFNKL.ITHNP...KESSG.......-------------------------------------------..EIFKLAKRY
MRM3_DROME/141-217.MEVL.LFSQK...DQLALV...K..-------------------------------------------..EEVGVAQVE
RLMB_VIBCH/5-81RFVEA.YVLKG...RQDDR.....L.-------------------------------------------.LPVLNELMRL
Q92QI6_RHIME/59-133.IIRL.SVTQN....AAAR.......-------------------------------------------..LDLGDLTAL
Q7MBB6_GLOVI/92-168.LNRV.WLTEK..LRYDPR.....F.-------------------------------------------.LRLLDAAKAG
RLMB_RALSO/6-82.IDEI.YFEAN...RRDRR.....M.-------------------------------------------.QDFLKAAEAA
Y479_MYCPA/69-145.ATAL.YVALG..TEADER.....L.-------------------------------------------.TESVSRAADS
Q7U7F6_SYNPX/177-253.IHRI.WCTPE..MRSAAK.....F.-------------------------------------------.LQLLRDAKAS
Q8E1Z2_STRA5/15-89.GNKL.YLQDD...LRGKN.....V.-------------------------------------------.DKVKALATEK
Q8D323_WIGBR/4-80.ILCI.LFLKS...RKDIK.....F.-------------------------------------------.KKLILISNEK
Q6MS22_MYCMS/5-77MVKEI.WVKDL...............-------------------------------------------..KILNEFDLK
Q97EF9_CLOAB/9-84.IEQV.LVSSG...KSEGS.....I.-------------------------------------------.NVILAKAKEK
Q6C040_YARLI/179-258QCLKL.FVGEG..KLGEPV.....V.-------------------------------------------.KKIMDMARKL
Q8DK28_THEEB/45-121.CNRI.WVIPS..LRYDPR.....F.-------------------------------------------.HQRLNEAKQQ
Q6ADI2_LEIXX/89-166.GTTL.YIAAR..VELDDR.....V.-------------------------------------------.KEILSLATGR
Q890M7_CLOTE/5-80.LESI.LISKG...NNKGT.....I.-------------------------------------------.NKIISLAKEN
Q6FPX7_CANGA/108-186YFTRL.LHHDT....NDKD.....SN-------------------------------------------KLTILRLCKEK
Q7NAH8_MYCGA/23-94.IKKV.YLHKE......DH.......-------------------------------------------..PLLKLIKQK
Q9A907_CAUCR/33-109.KIVM.YGPDA...ADHPM.....L.-------------------------------------------.KKAVAACLKA
RLMB_SHEON/6-82RIIEL.WLLQG...REDER.....L.-------------------------------------------.TPLIRQAKAF
Q98N81_RHILO/2-76.IRKM.LVTRN....AAER.......-------------------------------------------..LEIEDLAAL
MRM1_SCHPO/33-108.CRAL.YVQNA...DIHSE.....F.-------------------------------------------.EEFLNKLQYK
Q7VFD1_HELHP/2-74.IEEI.YLAKE.....LPK.......-------------------------------------------..DIFKQLAQL
Q8A814_BACTN/7-81.IDKI.LVKKD..IQSDLS.......-------------------------------------------.KELFAALKGL
Q6YQX1_ONYPE/823-895.IYQL.YLDEK....IKDH.......-------------------------------------------..LFIMFLQKH
Q9PQG4_UREPA/33-108TIVSI.IINEH...VYNKE.....F.-------------------------------------------.ETIFKYTLYD
O25279_HELPY/4-76KLQEI.YLSKE....IDKK.......-------------------------------------------..LFFALKKAC
RLMB_COXBU/6-81RIVKL.YVQEN...RDDQR.....L.-------------------------------------------.QSLVEKAKAL
Q6AGD8_LEIXX/38-113LLVEL.YATPT...ALERH.......-------------------------------------------.QDIAQAAAAA
Q9K894_BACHD/31-100.IETI.LVTES.............V.-------------------------------------------..TLPTAWHVD
Y1673_SYNY3/38-112CFTAM.WQEKN...............-------------------------------------------..PVLADRLMA
Q9CJY1_PASMU/125-200SIVRI.WATVE....MAKK.....S.-------------------------------------------.GELFSYLAEQ
Q8Z0C3_NOSS1/42-116.LEVV.CCTPE...WEANH.......-------------------------------------------.TALWDDACSR
Q7MTU3_PORGI/6-80.IDKI.FIRRG...LKTEQ.....T.-------------------------------------------.EAIIREAVER
RLMB_NITEU/6-82SIKEI.YLDTN...RHDQR.....A.-------------------------------------------.RDLMSLAETT
Q8XJ72_CLOPE/31-104.IDSI.IFTES...FKEKN.......-------------------------------------------.PDLFLKINEN
YACO_BACSU/7-81.LYKL.WMAEN...TVKGQ.....A.-------------------------------------------.QQVIELAKKQ
Q74L24_LACJO/8-85LINKV.FLQNG...VQEEF.....A.-------------------------------------------.NQVYQLARKK
Q891T6_CLOTE/31-105.IEYI.LINEK....SLNK.....V.-------------------------------------------.QEFNINIEVI
Q6MIZ9_BDEBA/55-130QVKGF.WLRQG..FENSGD.....L.-------------------------------------------.RDMNELALKN
O84408_CHLTR/29-103.CSHV.FCGEL...IADKE.....I.-------------------------------------------..ALDRELTSL
RLMB_NEIMB/6-82SIVEL.YIQEG...KSDAR.....T.-------------------------------------------.REVLEKAANE
RLMB_ACIAD/6-82RVLTL.FTLKG...RDDQR.....L.-------------------------------------------.QKILELAEPF
Q6CLR7_KLULA/125-198.KREY.FVKLH...HYGPL.....N.-------------------------------------------.TQIQSLCSKN
Q8YXQ3_NOSS1/83-159.LNRI.WVTPR..LRYDPR.....F.-------------------------------------------.HNLILQAKDN
Q9RWC1_DEIRA/2-76.VAEV.VLARG...VEDAF.....A.-------------------------------------------.RQVQDLARDA
Q9X263_THEMA/2-78.IKKV.FFQKM..KNPGSY.....F.-------------------------------------------.LSLVKEVEKR
Q8KBA1_CHLTE/33-106.LHAL.VFDEK...AAGQL.....D.-------------------------------------------.GLERFAG...
Q81L29_BACAN/31-99.VVTE.LIVSD.............Q.-------------------------------------------.TDLPKDWTVN
Q9L0Q5_STRCO/72-149.ASTL.YVQQF..IDNDER.....V.-------------------------------------------.REALQLAAER
Q6NFC4_CORDI/71-147.ATTL.YIVEG..TKNDNR.....L.-------------------------------------------.SEAVQIAHSR
O83093_TREPA/27-102KIHRF.FFTPV....RAKR.....F.-------------------------------------------.GPLCAYLAAR
Q74D57_GEOSL/5-80.AFEL.FVSRE...THDRR.....T.-------------------------------------------.EKLLAFAAER
RLMB_HAEIN/4-80RLIEV.FVLKG...REDKR.....L.-------------------------------------------.QPLLNELYSL
Q6AJ92_DESPS/48-125RISEI.IAQKD...RRGAK.....F.-------------------------------------------.DEIVELARAA
Q6N4H3_RHOPA/40-113.FRKL.WLTEN.....AAR.......-------------------------------------------..RLAEENIDT
Q828C9_STRAW/57-135TLVEL.FATAE....AAER.....Y.-------------------------------------------.ADIIGEARDA
Q9KGF2_BACHD/5-80.MNKI.WIGEG...SQKGQ.....M.-------------------------------------------.QKVLELAKEQ
RLMB_CHRVO/6-82SLIEI.WLAGG...RHDAR.....A.-------------------------------------------.KAVLDKAGAE
RLMB_PECAS/4-80RFLEV.FILKG...RDDRR.....L.-------------------------------------------.QPVIAELEAQ
Q9CHW1_LACLA/29-104.IKQI.FVEEN...KLTKL.......-------------------------------------------..TEMIGSEKL
Q74ID9_LACJO/31-102.ENYL.YVLGT...AEALK.......-------------------------------------------..KLDTTYKLK
Q839V3_ENTFA/43-117.GNKL.FLQED...ARGEK.....I.-------------------------------------------.EQLKQAAKEQ
Q8R7T5_CALS4/6-80.IEKI.YVSKT....AGGN.....I.-------------------------------------------.SKIIGMAKEA
Q73J63_TREDE/10-85KISRL.FFSEK....RAKQ.....F.-------------------------------------------.GEVCKYLASN
Q75B46_ASHGO/118-191EYFVR.LLHSG...NLDPQ.......-------------------------------------------...IAKLAGQL
Q6AAT1_PROAC/72-148.VRTA.YVAEG..AEHDSR.....L.-------------------------------------------.REILTFAADH
MRM1_YEAST/125-198NCHSR.LLYHG...TIPSK.......-------------------------------------------...FLQIVDEL
MRM1_HUMAN/51-129SVARL.LLQAGKAGLQGKR.......-------------------------------------------.AELLRMAEAR
Q7NN60_GLOVI/29-103VCATEAWVGEH...............-------------------------------------------.PAMHTALSGR
Q831U7_ENTFA/31-103.ADVQ.WILFN...QRGQQ.......-------------------------------------------..EWGTWLAEQ
Y355_MYCPN/9-79.IKKV.NLSDK......HQ.......-------------------------------------------..KLLGLIKKR
Q7TU91_PROMP/190-266.INRI.WCTSE..IFSSEK.....F.-------------------------------------------.YLLLKDLKSK
RLMB_PSEPK/6-81RVKQI.WLSEG...RSEPR.....L.-------------------------------------------.ETLLALAAEN
Q6A7V4_PROAC/41-113.KVNL.LATSD...PARDA.......-------------------------------------------..EHVEVATCR
Q7MSH0_WOLSU/29-101LIKSV.YLGKE.....VEK.......-------------------------------------------..DLFKEISRL
Q92F34_LISMO/9-83.IHKI.YVQEG...SQKGV.....L.-------------------------------------------.KQVLTLAKER
Q8KC03_CHLTE/18-94SVEKI.YLQFN...TSHPK.....L.-------------------------------------------.KEIVITARRL
Q8CXP3_OCEIH/5-79.VNKV.MVTEQ...IQGST.....F.-------------------------------------------.QKINQLAREA
Q72G19_DESVH/7-82RIDTV.FIRRG...RRTPD.....T.-------------------------------------------.DRLMDLCREM
Q9PR20_UREPA/3-73SISKV.YLLSK.............N.-------------------------------------------.YELINLINKN
O67731_AQUAE/6-79.LEKI.YVAHD...SHPPK.......-------------------------------------------..ELLELAKKR
RLMB_BLOFL/4-80RILIV.YIVSN...PRDLR.....L.-------------------------------------------.KSLIYRIRKM
Y955_SYNY3/125-201.LNRI.WITSH..LRHDIR.....Y.-------------------------------------------.RTKIQTAKAN
Q9XWY8_CAEEL/44-125DFHSV.FLKKAVENRADSDA...RI.-------------------------------------------.KEILSRIDEL
C5DY76_ZYGRC/130-203EYYSR.LLHYG...QLDPR.......-------------------------------------------...LQKLAKSR
D7BAL1_MEISD/30-105.LEQA.LVWEG...GLNPE.......-------------------------------------------.EQQVYAALGR
Q2FZE0_STAA8/31-99.ITQL.FAIEP...ARLDQ.......-------------------------------------------..QIIAYAQ..
Q2G2M3_STAA8/6-79.INKI.LIQEG...IKKQQ.....I.-------------------------------------------.NEILKNAKDQ
Q2YP21_BRUA2/57-129.IKTL.VFAKS..GKGNKT.....V.-------------------------------------------.EQVAARTFAK
Q32CT8_SHIDS/110-181AIVRA.WFIQS....VTPR.....F.-------------------------------------------.KEALRWMAAN
Q5SLJ7_THET8/2-71.ARRV.LVARG.............V.-------------------------------------------EGWLLKELERL
Q820Y2_TROWT/26-98.SIKL.LIDKSFALKHNPR.....V.-------------------------------------------.SKIMNYS...
RLMB_XANCP/7-81NVREV.LIEAG...SKNPR.....L.-------------------------------------------.TEIEEQARRK
Q8Y7Q4_LISMO/31-99.VLEL.LVSSG.............V.-------------------------------------------..SVPEEWLKG

PF01248

Q9XWS4_CAEEL/14-108-AKLV-IIANN---TPPLRKSE....-------------------------------------------...IEYYAMLA
RS12_HUMAN/16-111-AHLC-VLASN---CDEPMYVK....-------------------------------------------..LVEALCA..
RL30E_AERPE/1-95-AKAI-VIAEN---TPPELRRK....-------------------------------------------...LEYYAKLA
RL30_KLULA/8-102-AKLI-IIAAN---TPVLRKSE....-------------------------------------------...LEYYAMLS
RL7A_CHICK/122-216-AQLV-VIAHD---VDPIELVV....-------------------------------------------..FLPALCR..
RL8B_YEAST/117-209-AKLV-LIAND---VDPIELVV....-------------------------------------------..FLPALCK..
RL8_SCHPO/117-212-AKLV-LIASD---VDPIELVV....-------------------------------------------..FLPALCK..
RL7A_ANOGA/128-222-AQLV-IIAHD---VDPIELVV....-------------------------------------------..YLPALCR..
RPP38_HUMAN/99-190-LLLV-LVCKS---VKPAMITS....-------------------------------------------..HLIQLSL..
SBP2L_HUMAN/702-804-IKCV-IISPN---CEKIQSKGGL.D-------------------------------------------EALYNVIAMAR
NHP2_YEAST/41-135-KGLV-VIAGD---ISPADVIS....-------------------------------------------..HIPVLCE..
NHP2_SCHPO/39-133-KGLV-ILAGD---ISPMDVIS....-------------------------------------------..HIPVLCE..
RS12_DROME/23-118-AVLC-ILAES---FDEPNYKK....-------------------------------------------..LVTALCN..
RS12_CAEEL/24-119-AHFC-VLAEN---CDEPQYVK....-------------------------------------------..LVETLCA..
RS12A_SCHPO/31-126-AHLC-VLCES---CDQEAYVK....-------------------------------------------..LVEALCA..
RS12_YEAST/26-123-ALLV-VLVSS---VTEANIIK....-------------------------------------------..LVEGLANDP
RS122_ARATH/29-124-AQLC-VLAED---CNQPDYVK....-------------------------------------------..LVKALCA..
RS12_PLAF7/23-119-AKVC-FLSDV---CSEPAYKK....-------------------------------------------..LITTLCA..
GA45B_HUMAN/21-121-VVLC-LLAID---EEEEDDIALQIH-------------------------------------------FTLIQSFCC..
GA45A_HUMAN/21-123-VVLC-LLAAD---EDDDRDVALQIH-------------------------------------------FTLIQAFCC..
SEBP2_RAT/650-752-LKCI-IISPN---CEKTQSKGGL.D-------------------------------------------DTLHTIIDCAC
O77331_PLAF7/495-595-PKIV-FIAPN---IEPSLNNIFD..-------------------------------------------DTLGKIIAKCK
RL30E_METJA/7-101-GKLV-VLAGN---IPKDLEED....-------------------------------------------...VKYYAKLS
RL30E_METTH/1-95-GKLV-VMASN---IPEDLKED....-------------------------------------------...IEYYAKLS
RL30E_SULAC/3-97-VKGV-VVSST---LRQDLKDD....-------------------------------------------...IMTFSKFS
RL30_MAIZE/12-106-SKLV-IIANN---CPPLRKSE....-------------------------------------------...IEYYAMLA
Q9VJ19_DROME/12-106-AKLV-LIASN---TPALRKSE....-------------------------------------------...IEYYAMLA
RL30B_SCHPO/22-116-AKLI-LIAAN---APPLRKSE....-------------------------------------------...LEYYAMLS
YLXQ_BACSU/4-96-AKLV-LLTED---ASSNTAKK....-------------------------------------------...VTDKCN..
Q9WZN2_THEMA/7-99-KKLI-IIAED---TSERMKRD....-------------------------------------------...TIMRCE..
RL7A_DROME/127-221-AQLV-VIAHD---VDPLELVL....-------------------------------------------..FLPALCR..
RL7A1_ARATH/112-207-AQLV-VIAHD---VDPIELVV....-------------------------------------------..WLPALCR..
RL7A_ARCFU/13-107-AKLV-YIAED---VDPPEIVA....-------------------------------------------..HLPLLCE..
RL7A_METJA/15-106-AKLV-IIAED---VKPEEVVA....-------------------------------------------..HLPYLCE..
RL7A_SULSO/17-111-AKLV-IIAED---VQPEEIVA....-------------------------------------------..HLPLLCD..
RL7A_AERPE/17-111-AKLV-VIAED---VDPPEIVM....-------------------------------------------..HLPLLCD..
RL7A_METTH/17-111-AQLV-LIAED---VEPAEIVA....-------------------------------------------..HLPLLAE..
Q9SU26_ARATH/20-114-SEFI-VMAAD---TEPLEILL....-------------------------------------------..HLPLLAE..
SNU13_YEAST/18-112-SEFI-IMAAD---CEPIEILL....-------------------------------------------..HLPLLCE..
NH2L1_DROME/19-113-ADIV-VLAGD---AEPIEILL....-------------------------------------------..HLPLLCE..
NHP2_DROME/51-146-TGIC-IFAGD---VTPVDIMC....-------------------------------------------..HLPAVCE..
NHP2_CAEEL/53-148-KGIC-ILAGN---VSPIDVYS....-------------------------------------------..HIPGICE..
I6TC33_ENTHA/8-96-AKIV-FVAND---ASENTKKK....-------------------------------------------...VKDKSS..
M0Y8U1_HORVD/29-123-AQLC-VLAED---CDQPDYVK....-------------------------------------------..LVKALCA..
N1JG05_BLUG1/33-127-AHMC-VLNEA---CEEEAYKK....-------------------------------------------..LIVALCS..
Q385Y8_TRYB2/32-125-AHLC-VLADD---CEDEEYKK....-------------------------------------------..LVTALAK..
Q38AC1_TRYB2/29-122-AHMC-ILATD---CDDEEYKK....-------------------------------------------..LIKALAL..
Q38BI8_TRYB2/20-112-SKLV-VISAN---CPPIRKAE....-------------------------------------------...IEYYCTLS
RL30E_THEKO/7-95-AKLI-IVARN---ARPDIKED....-------------------------------------------...IYYYAKLS
RL30E_METMP/2-94-GQLV-IVADN---CAKDVRED....-------------------------------------------...IFYYTQLS
RL30E_PYRFU/3-94-AKLI-IVAKN---APKEIKDD....-------------------------------------------...IYYYAKLS
RL7A_PYRFU/18-111-AKLV-IIAED---VDPEEIVA....-------------------------------------------..HLPPLCE..

PF03465

PELO_HUMAN/271-370AIDTL-LISDE---LFRHQDVATRSR...........................................YVRLVDSVKEN
ERF1_CAEEL/288-424AIETL-ICWEN---LDIVRYK.MKNSLGEDILLNLRP....DEEKDKSHFTDSETG..QDMEIIETMPLLEWFANNYKNF
PELO_METTH/259-352AVEKL-LVLDR---VVSRED.................................................IEGYLDMVESM
E7QK37_YEASZ/277-376AISYL-LLTDK---VLHSDNIAQREE...........................................YLKLMDSVESN
PELO_AERPE/250-349AVDTV-LLVDT---LLHSPDDAVREA...........................................VDEALRLVESM
RF1_PYRHO/278-417AVDVL-LISEG---YNKVR.VRVKCNHCGWEELKTMSEE.EYEVYRKKITKCPKCG..SQNLTIEKWDVAEELIKMAEEA
PELO_METJA/254-346AIDTL-LVSDS---LVRNH.................................................EIEKIIDTTEEM
B2AWT5_PODAN/281-418AVETL-IVFEN---LEVTRWV.LKDSNGAEIIIHSTKQ...QDAANRDRFMDKETG..QEMEVVSQESFLEWIAEHYKDF
PELO_THEVO/247-338ALSDL-IITDK---KFRS...................................ETG..............RELLSLARSV
ERF1_TRYBB/281-420AVETL-IVYED---LNIYRYTVVKNRGADDEETFVHVM..SEEEAKRSNIHMQESG..KTRNEIEQEDFVDWLATNYRKF
PELO_SULSO/245-343AVETV-LVIED---LLSS........................................DEQERLT....IERMLEDIENK
Q9BMX1_EUPAE/276-413ALDLL-MCFEN---LEINRYE.IRDSANDEIKIYNLNK...EQEKDPKYFKNEKTG..ADLEIIKSGPLSEWLCENYSKF
PELO_PYRAB/260-355AVDTL-LVLDE---LLKG...DDRE...........................................RIEEIMEMARNL
RF1_METTH/274-407AVEVL-LLSED---LKYQRGTY....ECASCGHRMEK....TGRDLPDTETCPSCN..DQMRLSDRRDMIDDLVEMAEEV
RF1_ARCFU/270-403AVDTL-LLSED---LRYER.VKYR..CPKCGKEVEVT....VREGIEKPPFCEEDN..VEMEEVERRDIVLELSELAEST
ERF1_SCHPO/277-416AVETL-LCFAD---LDMIRYE.FKNSEGNPVITYMTKEQ.EEKDSTNSFLLDKDTG..AEMELVSSMLLSEWLAEHYKDY
RF1_AERPE/279-370AVKTL-LIHES---RED....................................................LEEWVEKAKSS
RF1_SULSO/275-368AIEAI-VIHED---STDKE..................................................LEKLAQDAENY
PELO_ARCFU/246-342AIEVL-LVADE---FLLEE....REKW.........................D................VDGLLREVEES
RF1_THEVO/277-410MVDLL-LISEG---IRRVKYT.YKCPTCGEEKTFS........EEPSEWPVCDKDG..TPLELIGEDDMIEDLYKLAKES
ERF1_BLEAM/280-415AVEVI-LLFEN---LNFTRYV.LKNPTTGIEKTLYLT.....PEQEENHDNFIENG..EELEALEKGPLPEWIVDNYMKF
PEL1_ARATH/271-370AIQTL-LITDE---LFRNSDVKTRKK...........................................YVNLVESVKDS
ERF1_GIAIN/290-432AVEKL-IVWDD---LPYHRVT.LQCVINGETSAPVIKYLLKSQMSNPKYLREVINGEEVQLDIMGDQLLLEWFVDNYKNY
PELO_DROME/271-370AIETL-LISDN---LFRCQDVSLRKE...........................................YVNLVESIRDA
ERF1_STYMT/285-422AVETI-LLFEE---LEITRYV.IKNPVKGDTRTLFLNP...TQQKDSKYFKDQASG..LDMDVISEDQLAEWLCHNYQNY
PELO_CAEEL/271-370AIETL-LVADS---LFRAQDIETRRK...........................................YVRLVESVREQ
PELO_THEAC/247-338ALSDL-IITDE---MFRT...................................EDG..............RRSLSIAQTV
PELO_HALSA/254-356AVEDL-LILDE---RLRLERAGE................................GDWVDVD.......VNDLVRTVEQQ
I7MKI5_TETTS/279-414VIENI-LCFEE---LTTLRVT.RKNKVTEQITHIFIPP...NELNNPKHFKDGE....HELEKIEVENLTEWLAEHYSEF
A0A024WDX6_PLAFA/276-411AVELL-ILYEG---LDIIRLT.TKNPVTNQTKTMHIS.....PCDEKQESLYKENN..VELEVVEKISLTDWVIGNYKKY
P79004_SACPS/277-376AVETL-LITDT---VLKSDDIDERET...........................................FLDLTYNIEQS
DOM34_SCHPO/271-370AIGEL-LISDS---LFRSSDIATRKK...........................................WVSLVEGVKEI
RF1_HALSA/281-414SVDRL-LVSED---LREDVVIYE...CPNDHEEYETI....DRRNTSPEHTCSDCG..EEATEVDREDAIDHLMSIADQR
RF1_METJA/277-419AVDTL-IVSEE---LEKYKVKIACNNCDYLEEKTVNKLELIKLEEELKNAQCPKCG..GALSIVEEKDYIEYLSELCEQS

PF15608

Q0RDF6_FRAAA/285-365DIPDVIMVKPG-------------------------------------------------------------VGETTRVL
F8A7B9_CELGA/759-840GIGDVNLVKPG-------------------------------------------------------------IGETTRVL
E4NAQ4_KITSK/291-371GIDSVNLVKPG-------------------------------------------------------------VGETTRVL
A1VWP9_POLNA/279-359RITDVNLIKPG-------------------------------------------------------------IGEATRVL
Q5NWT5_AROAE/279-359GVTDENLIKPG-------------------------------------------------------------IGEATRVL
Q8KL02_RHIEC/282-364AVTNINRVKPG-------------------------------------------------------------IAEATRAI
D3VJW4_XENNA/275-357QIDSINRIKPG-------------------------------------------------------------IAEATRAV
C8XAU5_NAKMY/305-385GIASVNFVKPG-------------------------------------------------------------VGEATRVL
F4EXE7_SELS3/265-346GIRDINLVKPG-------------------------------------------------------------IGEATRVL
E6UDF8_RUMA7/266-347GIADINLVKPS-------------------------------------------------------------IGEATRVL
H8GG70_METAL/281-361RISHYNYIKPG-------------------------------------------------------------IGEATRVL
Q9RSA8_DEIRA/269-349GVTDPHLVKPS-------------------------------------------------------------VGEATRVF
STIP_ACIAD/297-379DIQNINRIKPS-------------------------------------------------------------IAEATRAI
F2JGK7_CELLD/289-369DISSINRVKPG-------------------------------------------------------------VGETTRVL
Q4FTP9_PSYA2/309-391NITNRNRIKPT-------------------------------------------------------------IAEATRAI
D1BEJ8_SANKS/295-375GLGDVNLVKPG-------------------------------------------------------------VGETTRVL
Q2RVZ5_RHORT/280-360GITDRNRVKPG-------------------------------------------------------------IGEATRAL
C0Z9Y7_BREBN/295-375QIDDVNLIKPG-------------------------------------------------------------VGETTRVL
C8W646_DESAS/311-391GIGNINYIKPG-------------------------------------------------------------VGETTRVL
A8MM96_ALKOO/748-828AIEDINLIKPG-------------------------------------------------------------IGETTRVL
F8K488_STREN/279-359GIHDVNLVKPG-------------------------------------------------------------VGETTRVL
A1SUD4_PSYIN/287-367HVSNKNRIKPG-------------------------------------------------------------IAEATRVM
A4J1D7_DESRM/320-400GIKSINYVKPG-------------------------------------------------------------VGETTRVL
F8AVP2_FRADG/278-358GIDNIGLVKPG-------------------------------------------------------------VGETTRVL
D3RPA4_ALLVD/285-365GIQNENFIKPG-------------------------------------------------------------IGEATRVL
F4H5N6_CELFA/811-892GIGDVNLVKPG-------------------------------------------------------------VGETTRVL
H6N264_GORPV/291-371GVSSVNFVKPG-------------------------------------------------------------VGETTRVL
Q891X7_CLOTE/298-378KISDINLIKPG-------------------------------------------------------------VGETTRVL
A6WD80_KINRD/287-371DIGDVNLVKPG-------------------------------------------------------------VGETTRVL
A5WBK3_PSYWF/314-396QISNINRIKPT-------------------------------------------------------------IAEATRAV
E8U3T5_DEIML/257-336GARDPHKVKPS-------------------------------------------------------------IGEATRVF
D1A9P2_THECD/292-376GIDDLNLIKPG-------------------------------------------------------------VGETTRVL
B4EW79_PROMH/276-356DISNINRIKPG-------------------------------------------------------------IAEATRAV
D4L2P5_9FIRM/132-213DIDDINLIKPG-------------------------------------------------------------IGEATRVL
E3EE68_PAEPS/297-377GIRDINLVKPG-------------------------------------------------------------VGETTRVL
J9STB4_9ACTN/293-373GLSSINLVKPG-------------------------------------------------------------VGETTRVL
M1FGD7_9ALTE/290-371GVQNRNRIKPG-------------------------------------------------------------IAEATRAV
Q186J5_PEPD6/281-358NITDINFIKPG-------------------------------------------------------------VGETTRVL
Q3JCD3_NITOC/292-369GIGDINHIKPG-------------------------------------------------------------IAEATRVM
Q7CKQ6_YERPE/276-357EINSVNRIKPG-------------------------------------------------------------IAEATRAV
R5BVZ9_9FIRM/264-345KIEDVNLIKPG-------------------------------------------------------------IGETTRVL
R5XB52_9CLOT/301-379DIEDINFIKPG-------------------------------------------------------------VGETTRVL
R7CDA0_9FIRM/265-346GIDDINLIKPG-------------------------------------------------------------IGETTRVL
U5LCP5_9BACI/286-365AIESTNYVKPG-------------------------------------------------------------VGETTRVL

PF08228

Q6CTJ8_KLULA/13-168....MLFVCNKD.L.PSVL--------------------------------------------------ISQLPILCETS
POP3_YEAST/14-171....CLFVCNKDPDVPLVL--------------------------------------------------LQQIPLLCYMA
Q753G4_ASHGO/13-172....LLFVCTRDGT.PAVL--------------------------------------------------LSQVPLAAHVS
Q6FQW2_CANGA/3-151....YVLALWND....SML--------------------------------------------------MRQLRLLVAVK
POP3_SCHPO/7-165QPAVVFILHDQD....SML--------------------------------------------------VTHMPQLVANA

PF05025

R5ICH0_9FIRM/3-147CIGDGNFPGASMAKPNNCV...FLRADG.-----------------------------------------HGVPELLDAI
R6MWK2_9CLOT/3-142AFGDANFPAESSKA...SY...VVRADG.-----------------------------------------IPIPALLDAV
F8F334_TRECH/4-141VLADAFFTGDSL....NSR...VIRADG.-----------------------------------------LRIPDLLDGI
A7II16_XANP2/3-140AIVDANYPAEAHARR.......LVRMDG.-----------------------------------------HDAPRLVDAV
D5SWX7_PLAL2/1-146LIADGNYPASTTMGPNGTLISLNLSPGL.-----------------------------------------VTVNQVLEAI
RBSD_PASMU/1-138TICDAGLPIPKQ....IERVDLALSAGV.-----------------------------------------PSFLQTFHAV
RBSD_HAEPS/1-138TICDAGLPIPTE....QHCIDLALTKGI.-----------------------------------------PDFLSVLQAV
A9HPM0_GLUDA/4-139AIVDANFPAERIAR.R......LNRLPA.-----------------------------------------IPVPPVLDAI
E3D7F8_GARV3/3-144VLADGNFPTESVGK..DAI...VVRCDG.-----------------------------------------HGTSELLKAI
H8L1D3_FRAAD/1-131VIADAGLPVAPE....VLCIDLALVRGV.-----------------------------------------PDFVTVLDAV
D6XZQ8_BACIE/1-128VIADCGLPIPDG....VKCVDLSLKKGE.-----------------------------------------PPFLHVLHTV
B8I9B2_CLOCE/3-141VIADGNFPSGTFGK..K.....VIRLDG.-----------------------------------------HGVPEVLDAI
RBSD_LARHH/1-130VIADCGLPIPPG....VERIDLALKPGL.-----------------------------------------PAFLDTLELV
R7PPL8_9FIRM/1-133TIGDCGLPVPDN....VLKIDLALTLGK.-----------------------------------------PEFIEVVKEV
R6HV06_9FIRM/3-139VIGDGNFPAASIAQ..R.....LVRLDG.-----------------------------------------HGVPEVLDAV
X2H1X6_9GAMM/1-138AIGDAGLPIPDT....TSRIDLALTYGI.-----------------------------------------PSFMQVFELI
R5BKJ9_9FIRM/1-132CIGDCGLPVPAG....VQKIDLALTFGT.-----------------------------------------PSFEAVVRVL
Q12BF4_POLSJ/3-143AIVDANFPAARVAQ.Q..SGARLVQLAG.-----------------------------------------TSAPQVLNAV
B7GMC2_ANOFW/4-133VIADCGLPIPEG....VTRIDLSVTKGF.-----------------------------------------PSFLSILDPI
T1G8C4_HELRO/6-150VLADAHFPTSSVCR.GGCK...EIRADGC-----------------------------------------HNIPDLLDAI
Q161Y5_ROSDO/3-143IIADTNFPSDSVAR.DTVLGE.ILRID..-----------------------------------------RPAAEVVRAV
G8LVS6_CLOCD/1-130AIGDAGLPIPDS....SKRIDLAVKRNL.-----------------------------------------PPFLDVLETV
Q7UUK8_RHOBA/1-146LIADGNYPALNKRGPNAKLVSLNLSPGL.-----------------------------------------VSCDQVLKAL
R7N665_9FIRM/3-144VIADGNFPAESMGK..DAI...VIRMDG.-----------------------------------------HGTSEILEAV
RBSD_ACIAC/1-129VIGDAGLPIPPG....PLRIDLAVTPGL.-----------------------------------------PAVADVLAAV
E1RCT7_SPISS/3-141VIGDGNFPHASCAK..R.....LVRCDG.-----------------------------------------HNVPEVLDAI
A3DCF4_CLOTH/11-139LIADAGLAIPNT....TKVIDVSLDVNF.-----------------------------------------PTTVDVLKVL
B9K2K2_AGRVS/3-138VIADANFPAVTAAN.R......LVQMPG.-----------------------------------------IDACAVVEAI
L9KX68_TUPCH/6-148VLADVNFPASSICQ.CGPV...EIRADG.-----------------------------------------LDIPELLEAV
F4H9V0_GALAU/3-142VFADAHFPAHQL....HHR...VIRADG.-----------------------------------------IGIPRLLSAV
RBSD_GEOKA/1-130VIADCGLPIPNE....QARIDLSLVKGF.-----------------------------------------PPFLSVLDAV
I3TF87_THEC1/6-141VIADAGLPIPPG....KKRIDLAFAPGK.-----------------------------------------PGFLEVLGVV
F7ESI4_MONDO/5-149VLADANFPTSSICR.CGPV...EIRADG.-----------------------------------------LSVPQLLESI
RBSD_CALS4/1-129VIADSGLPIPDN....VKRIDIALTKGI.-----------------------------------------PSFRDTLNTV
F6DR08_DESRL/1-131VVTDAGLPLPENV...NTRIDFALKPGT.-----------------------------------------PTFLELLDTV
D2BEN5_STRRD/1-128LVCDSGMPLPPG....VEVVDLAFLPGI.-----------------------------------------PAFADVLDGI
E3QVQ1_COLGM/4-139VLGDAHFPAHSLCP.PHVP...ILRADG.-----------------------------------------ITISRLLAGI
W0PHP3_9BURK/3-141IISDAHFPSDSIAR.HTSIGK.LLRID..-----------------------------------------ASADRVAQAI
D4H243_DENA2/1-131VIADAGLPVPEG....SERIDLAVTAGV.-----------------------------------------PDFMTVLNTV
T2KGG9_9FLAO/4-141VFADAHFPAYTY....NTK...VLRLDG.-----------------------------------------VKIPDLLLGV
K0KGS5_SACES/1-128VVADCGLPIPPG....PAVVDLAFTFGV.-----------------------------------------PTFLQVLDGV
R7G568_9PROT/4-139VIADGNFPSETCGQR.......VVRADG.-----------------------------------------LGGVEILDAV
B9K2A2_AGRVS/4-140AIVDGNYPGLEHARR.......LVRLDG.-----------------------------------------LGLIPVLDAI
B8CWP6_HALOH/1-138LITDGNYPASTKTKEDVNKVYLNLAPGL.-----------------------------------------VNVTDVLKVL
RBSD_PHOLL/1-138TIGDAGLPIPSL....AQRIDLALTQGI.-----------------------------------------PSFISVLNVV
A5G2I4_ACICJ/4-141AIVDANFPAATCAR.R......LVAMPG.-----------------------------------------LEAGTVFRAV
R7D1N9_9ACTN/3-144VIADGNFPAASIAQ..GSR...LVRCDG.-----------------------------------------HGVPEILEAI
G8PKF7_PSEUV/7-141VLSDAHFPAYSV....CDK...VLRADG.-----------------------------------------CEATDLLQAI
RBSD_DESRM/1-129VVADSGLPVPPG....VNCIDLAVTKGI.-----------------------------------------PPLLPVLQVI
Q128C2_POLSJ/3-144VLADANFTAMSL.....GAGKPVLRLPG.-----------------------------------------HGMARTAQAV
H6NDH4_9BACL/4-141VLADANFPAASVAQ..R.....LIRCDG.-----------------------------------------HPIPELLEAI
RBSD_CLONN/1-130AIGDSGLPIPDD....TKRIDLALIKGV.-----------------------------------------PTFMQTLKAV
D7C1Q2_STRBB/1-133MVCDAGLPIPAGPGG.PAVVDLALVAGV.-----------------------------------------PSFEQVLTVL
RBSD_PROMH/1-138TIADAGLPIPSS....VERIDLALTQGI.-----------------------------------------PDFMSVLQTI
RBSD_LACPL/1-130SIGDAGMPVPSS....TEKIDLAVDNGI.-----------------------------------------PSFMQVLNNV
R5HCY6_9FIRM/3-140VLADANFPSSSIGQ....R...VIRADG.-----------------------------------------IGTAELLAAI
A6WDZ4_KINRD/2-137VLADGNFPLRAGTNPSVPVVHLNLRPGL.-----------------------------------------VTVLDVLEPL
D8LIE6_ECTSI/5-148CFADANFPSENLTS.PGKPGPITVRADG.-----------------------------------------HEVAPLLRAV
H2IYD3_RAHAC/1-138VIGDAGLPVPAA....CQRIDLALTQGV.-----------------------------------------PTFLQVLEVV
FUCM_DANRE/5-147VLADANFPTSSVCK.CGPV...EIRADG.-----------------------------------------VRIPELLKAI
R5F996_9CLOT/1-130IIGDAGLPIPKG....VERVDLGWRPGD.-----------------------------------------PAYLDVLEEI
R5A6P8_9CLOT/7-136LISDANYPWRSMGCE.......HVHVPV.-----------------------------------------EHIEELLEDI
RBSD_PSELT/1-131SIVDSGFPISED....VFCVDLSLIAGK.-----------------------------------------PKIVEIIIPL
A9KR29_CLOPH/4-144VIADGNFPAQSVGK..DAI...VIRCDG.-----------------------------------------HDVPSLLSAI
W8VC37_YEREN/1-138VIGDAGLPIPAT....TTRIDLALTQGV.-----------------------------------------PGFLQVFEVV
E3D852_GARV3/1-130VISDCGLPVPQG....VEVIDLALVFGI.-----------------------------------------PRFSDVLNAI
R5WS75_9FIRM/4-144VIGDANFAAASMAKKGI.....LVRCDG.-----------------------------------------LKATDLMDAV
F0LZN3_VIBFN/9-146TICDAGLPIAEE....TQRIDLALTHGV.-----------------------------------------PSFMDTARVI
C3Y6F8_BRAFL/4-145VFGDANFPASSICN.SGPI...EVRADG.-----------------------------------------HCIPDLLEAV
RBSD_PSEPK/1-131VIGDAGLPVPPG....VELIDLAITPGL.-----------------------------------------PDFASVLRVV
K1XXH2_MARBU/3-141AIVDANFPAASTGP.P......VIRLAG.-----------------------------------------ASVTDAANAI
E3HAW5_ILYPC/1-134CIGDAGLPIPAG....VKRIDLALERNI.-----------------------------------------PTFMGTLDVI
E3PV76_CLOSD/1-132VIADAGLPIPAT....VKRIDLALEKGL.-----------------------------------------PSFDATLALI
A5UTT7_ROSS1/1-136LIADGNYPFATGAPASAQRVYLNLAPGL.-----------------------------------------LTVTDVLAAL
W5M9Q7_LEPOC/5-148VLADANFPTSSSCR.CGPA...EIRADG.-----------------------------------------LRIPELLGAI
D4LNS7_9FIRM/3-144VIADGNFPVESMGK..NAI...TIRCDG.-----------------------------------------HGVPEILDAI
RBSD_NATTJ/1-134TISDAGPPIPQE....SERIDLALKEGV.-----------------------------------------PAFMETLETV
B7VTM7_VIBTL/17-154TICDAGLPIPDH....VTRIDLALTHGV.-----------------------------------------PSFQQTVKTM
R5XA15_9CLOT/1-132CIGDCGLPIPDE....TERIDLAVKFGV.-----------------------------------------PTFMDVLKEV
R5XIE2_9FIRM/3-141VISDANFPAASIAQ....R...LVRADG.-----------------------------------------IPAADMLEAV
B9K575_AGRVS/3-146VISDTNFPSDSVAR.QTVLGR.PLSMAN.-----------------------------------------LSAAEAVRVL
Q982U4_RHILO/3-145IIADTNFPSDSVAR.QTALGR.LLRID..-----------------------------------------ASAAEVVKAV
M4R5G6_BIBTR/1-138TICDAGLPIPRE....QVRIDLALTAGV.-----------------------------------------PSFLATLQAV
U3GZS3_9CORY/1-127VIADCGLPIPEH....VPVVDVSVEFGY.-----------------------------------------PEFFDVTGRL
C6D5S1_PAESJ/1-130VIADVGLPVPEG....VLKIDLALTLGT.-----------------------------------------PSFEDTVNAV
RBSD_RHOBA/1-134TLCDAGLPIPSG....VKRIDLAIEEGY.-----------------------------------------PTFLRTLDAI
B1Y3G2_LEPCP/3-150VIADANFTAASLAIGANGVRKPVLHVSG.-----------------------------------------AGIGRTVEAV
B9J8G9_AGRRK/2-139ALVDGNYPGLEHARR.......LIRLDG.-----------------------------------------HGVVRVLDAI
F6B8R0_DESCC/1-129VVADSGLPVPPG....VTCIDLAVTKNV.-----------------------------------------PGFLPVLEAI
RBSD_OCEIH/1-130VIADAGLPVPEG....VTKIDVALTPGT.-----------------------------------------PSFLDVLKAV
F8JJP4_STREN/1-128LVCDAGMPIPAG....PRVVDLAFRAGV.-----------------------------------------PSFAEVLDGL
C6WJV2_ACTMD/1-137LIADSNYAHRTNVHPAAEIVHLNLTPGL.-----------------------------------------LTVDQVLAPV
RBSD_COPPD/1-130AIADSGLPIPKG....VERIDLALTRDI.-----------------------------------------PRFLDTLRVI
G3T222_LOXAF/6-148ILADANFRTSSLCQCGPT....EICADG.-----------------------------------------LGIPHLLEVV
K4R9V9_9ACTN/1-128LVCDVGFPIPDR....VKVVDLAFRAGV.-----------------------------------------PSFAEVLEGL
RBSD_VIBPA/1-138TICDAGLPIPDH....VQRIDLALTHGV.-----------------------------------------PSFLDTVRVI
RBSD_BACCR/1-130VIADCGLPIPDG....VKRIDLAVEIGK.-----------------------------------------PSFLEVLQVV
A9UVL6_MONBE/5-149VLGDANFPSESVGAHTPCN...VIRCDA.-----------------------------------------LGAVDLLKAI
G0AFB1_COLFT/7-135VIGDAGLPVPPG....VPLIDLALTRGV.-----------------------------------------PGFMDTLQTI
RBSD_ACTSZ/1-138TLCDAGLPIPNS....SNRIDLALTKGI.-----------------------------------------PSFLETLYAV
E3E7K1_PAEPS/1-142VVADAGLPVPEG....VTKIDLALKLGV.-----------------------------------------PSFQDVVDVI
D4H283_DENA2/3-141VLGDAHFAGHGL....NKN...TLRADG.-----------------------------------------LTVDQLLDAI
R6QNX9_9FIRM/3-144VIADGNFPCESIGK..NAI...VIRADG.-----------------------------------------HSTTDILDAV
G0GEK3_SPITZ/4-132AIADCGLPIPVG....PQRIDVSIRKGL.-----------------------------------------PSFVDVLDEV
RBSD_BACLD/1-130VIADAGLPVPPG....VPKIDLALTLGT.-----------------------------------------PGFREVTKLI
RBSD_STRU0/1-131CIGDLGLPIPSG....VRKIDLSLKAGF.-----------------------------------------PSFQDLLDVY
RBSD_LACC3/1-129GIGDAGMPVPED....TWKIDLAVSKNL.-----------------------------------------PSFIDVLKNV
A1WFB4_VEREI/3-144VLADANFIAMRP.....GAGTPVLRLPG.-----------------------------------------VGLVRALQAV
G8PEY8_PEDCP/1-130SIGDAGMPVPLG....TPKVDLAVDKQL.-----------------------------------------PSFIDVLKNV
Q21X77_RHOFT/3-144VLGDANFTAMRF.....AAGKPVIRLPG.-----------------------------------------TSMAQVTQAI
H2FT88_OCESG/1-138TLGDAGLPVPPG....VERIDLAVSPGL.-----------------------------------------PGLEDTLAAL
F4HBP8_GALAU/1-138TICDAGLPIPQQ....SERIDLALTPAI.-----------------------------------------PSFLSVFDAV
RBSD_CHRVO/1-131VIADCGLPIPPG....VECVDLSLKLGQ.-----------------------------------------PGFIETLDSI
RBSD_SYMTH/1-130VIGDYGLPCPKG....VRRIDLALRPGI.-----------------------------------------PAFLDVVETI
D9R029_CLOSW/1-130VIGDAGLPIPKG....VERVDLGWKPGS.-----------------------------------------PSYLEVLEEI
E4U8X1_OCEP5/5-140AIVDGNYPAHSSGP....P...VIRADG.-----------------------------------------LGTPELVQAI
F4LMF0_TREBD/1-130CIGDCGLPCPQS....TELIDIALDKGE.-----------------------------------------PPFINVLKTV
D4ZG03_SHEVD/1-138TIADAGLPVPEC....CERIDLALTHGV.-----------------------------------------PAFIDTLRIV
RBSD1_STRGG/1-130LVVDAGFPVPRD....AHRIDLALAENL.-----------------------------------------PDLRTVLGLI
FUCM_HISS2/3-141VLSDAHFPAHQL....HHK...VVRADG.-----------------------------------------ISINSLLTGI
D3UY14_XENBS/1-138TISDAGLPIPLS....TQRIDLALTQGI.-----------------------------------------PDLMSVFDVV
F4LLA6_TREBD/5-141VLADAFFPGDTC....SAR...VIRADG.-----------------------------------------IGIPRLLDGI
B4EJ62_BURCJ/3-146AICDANFPAESVAE.HTVVGR.ALRIDG.-----------------------------------------ADSARVVRAV
R6EA07_9FIRM/4-146IIADDFYPPVT.....KTPGGISIQAKG.-----------------------------------------NTAAEMIDAI
F4LXK2_TEPAE/1-137LIADGNYPIESNTNTNTKKAYINLSHGI.-----------------------------------------PTVTQVLNVL
R6JSG5_9CLOT/7-146VIGDANFPAASIAAEKNHI...NIRCDG.-----------------------------------------HRATDMLDAI
K0T8W6_THAOC/9-148CVCDCNFPASQVATETVSRKHIILT....-----------------------------------------VTLKDALNAI
R5C6U3_9FIRM/1-135LIADGNYPLEEKSS..GVKIFLGLGPGV.-----------------------------------------PSVIEVLAAI
G2TI29_BACCO/2-130VIADAGLPVPKG....VPKIDLALTPGT.-----------------------------------------PSFKSVVKAV
A1VQI0_POLNA/3-144LLADANFTALSL.....GAGKPVIRLPG.-----------------------------------------AGMAQVVKAI
R6G767_9FIRM/1-130MIGDAGMPIPEG....VEVVDLVLTAGV.-----------------------------------------PTFKQVLDAV
B9K570_AGRVS/3-146VLCDINHPAETIAK.HTTYGK.LINLSG.-----------------------------------------CGLEVATAAI
D8MK90_ERWBE/1-138TIGDAGLPIPAG....PQRIDLALTHGI.-----------------------------------------PSFLQVVHTV
RBSD_HISS2/1-138VICDAGLPISNQ....VERVDLALEAGV.-----------------------------------------PGFLQTVDVV
RBSD_LACJO/1-130GVGDAGTPVPAE....TEKIDLSVRPGL.-----------------------------------------PSFIDVLEEV
R6WBJ3_9FIRM/1-146LIGDVGCPFPRHDM..TTCIDLAVTDGV.-----------------------------------------PKVTDVVKAV
W0IZS2_9BACT/3-141VLADAHFPGESF....NAR...VLRADG.-----------------------------------------LRIAGLLDGI
Q7MJI4_VIBVY/14-152LFADAHFPAHSF....SHN...VIRCDG.-----------------------------------------VGVDTLLSGV
RBSD_VIBVY/1-138TICDAGLPIPDG....VSRIDLALTHGV.-----------------------------------------PSFIETVRVM
RBSD_EXIS2/1-128VIADCGLPIPAG....VARIDLALELGT.-----------------------------------------PSFVDVVRIV
F1N1P7_BOVIN/6-148VLADVNFPSSSICR.GGPE...EIRADG.-----------------------------------------LGIPQLLEAV
R5LEZ8_9SPIR/1-130CISDLGLPCPEN....IKTIDLSLKLGY.-----------------------------------------PSFMEVLSEI
D7CRD7_TRURR/4-141VLADAHFPGDAC....NAR...VLRADG.-----------------------------------------LKVTALLEGI
K0I412_9BURK/1-128VIGDVGLPIPNG....PRRVDLALTPGI.-----------------------------------------PAVADVLRVV
G8QUN1_SPHPG/3-140VIGDGNFPAASMND..R.....VIRLDG.-----------------------------------------HGVPEIFEAI
E4T6S2_PALPW/3-141ILADAHFPGESF....NGR...VLRADG.-----------------------------------------LRIPDLLAAI
RBSD1_RUBXD/1-128VVCDAGLPIPHG....PEVVDLAFRLGI.-----------------------------------------PGFGPVLEGI
D6GRT6_FILAD/1-130LIGDCGLPIPSG....VKRIDLAVKRGV.-----------------------------------------PSFADILETV
R6YDK3_9FIRM/3-141LLADANYPRLGQPE....R...VIRCDG.-----------------------------------------HGIPELMDAI
FUCM_HAEPS/3-141VLSDAHFPAHQL....HHK...VIRADG.-----------------------------------------IQIATLLEAI
H0W3P3_CAVPO/6-144VLADANFPTSSVCH.CGPV...EIRADG.-----------------------------------------LGIPKLLEAV
C3Y6F6_BRAFL/5-148VFADANFPTSSICS.SGPI...EVRADG.-----------------------------------------HCIPALLKAV
V4IC28_9ACTN/1-128LVCDAGMPIPSG....PRVVDLAFRAGV.-----------------------------------------PSFAEVLDGL
M9X3I0_MANHA/3-141VLSDAHFPAHSI....HQN...VIRADG.-----------------------------------------LSVATLLEGI
R6JZZ1_9CLOT/4-144VIADGNFPAESMGR..DAH...VIHMEG.-----------------------------------------HGVPEILEAI
RBSD_PSESM/1-133MIVDAGMPVPPG....VELIDLALTRGV.-----------------------------------------PDFVSVLDVV
RBSD_THEMA/1-134AVVDLGFPIPQG....VKKVDLVVDRGK.-----------------------------------------PGLMEVIEIL
K0J4C7_AMPXN/1-128VIADCGLPIPPG....VKCIDLTIRQGD.-----------------------------------------PSFMKIVELL
D9SWA7_CLOC7/3-144VLSDGNFPAETMGK..NSI...VIRCDG.-----------------------------------------HNIPDLLDAI
I1G0R8_AMPQE/5-149VLADANFPSASICR.HGPE...LIRADG.-----------------------------------------HAIPPLLKAI
Q161J5_ROSDO/4-141VIADANFPAESCAN.R......IERLAG.-----------------------------------------ASATEALRAI
RBSD_BACSU/1-130VIADAGLPVPDG....VLKIDLSLKPGL.-----------------------------------------PAFQDTAAVL
RBSD_EDWI9/1-138TVGDAGLPVPDG....IQRIDLALTHGI.-----------------------------------------PRFMQVIETM
G8NVC3_GRAMM/3-141AIVDANYACDPGKVN.......VIRLDG.-----------------------------------------VPAPAALRAV
RBSD_STAA8/1-133TINDAGMPIPND....HRRIDLAVTKNL.-----------------------------------------PRFIDVLATV
R5BRR7_9FIRM/1-130MIADGGMPIPKG....VTIVDLALCGGV.-----------------------------------------PTFQQVMDAV
Q28QH5_JANSC/3-146VIADTNFPADSVAR.HTIYGE.LLRMEN.-----------------------------------------LTCGAAMEAI
B5HI15_STRPR/1-129LVCDVGMPVPSSV...PRVVDLAFRAGI.-----------------------------------------PSFADVLDGL
D3E5A9_GEOS4/3-141VLGDANFPAASHAR....R...LVRADG.-----------------------------------------HGIPALLNAI
M4AGZ9_XIPMA/5-148VLADANFPASSICA.CGPK...EIRADG.-----------------------------------------LGIPQLLEAI
C4LA69_TOLAT/1-138VICDAGLPIPAA....PERIDLAVSRGV.-----------------------------------------PKFMDVVQAV
W0HY81_9GAMM/5-139IFADAHFPAHRL....NPR...VIRADG.-----------------------------------------LRIAELLAAV
W5XRT5_9CORY/1-129VFADAGLPLPKD....VAVVDLSITFGL.-----------------------------------------PSMDDVIRAV
Q985Q0_RHILO/4-140ALVDGNYPAEEQAKR.......LIRADG.-----------------------------------------HHLIPVLDAI
A9CIE0_AGRFC/3-146VISDTNFPSDSVAR.QTTVGK.VLHIDN.-----------------------------------------VSAARAMKAI
FUCM_HAEIN/3-141VLADAHFPAHSL....HKN...VIRADG.-----------------------------------------ISIDILLEAI
G0GEL8_SPITZ/4-141VLADAFFAGDTY....GKR...IVRMDG.-----------------------------------------IRIAPLLDAI
V5XTJ3_ENTMU/1-130SIGDAGMPVPMT....TEKIDLAVTQGV.-----------------------------------------PSFMEVLRNV
Q15PP4_PSEA6/1-136VIADGNLPVAAMTGPNSTLVHLNFRPGM.-----------------------------------------LDALSVLEGI
Q8DN18_STRR6/4-140VLADANYPSASCAN....K...LIRCDG.-----------------------------------------VNIPELLDSI
E0SDT7_DICD3/1-138VIADAGLPIPET....TTRIDLALTHNV.-----------------------------------------PGFLQVLNVV
B2UPN2_AKKM8/3-136VFSDAHFPGHTF....NPT...VLRADG.-----------------------------------------LGADALLAAV
RBSD_STRA5/1-131CIGDLGLPVPNG....IPKIDLSLTSGI.-----------------------------------------PSFQEVLDIY
D8J0Y3_HERSS/3-146VLCDANFPADSVAR.QTVLGK.VLRIDG.-----------------------------------------VGTTEAARAI
RBSD_PSYIN/1-137TICDAGLPIPNE....TQRIDLALTHGV.-----------------------------------------PAFIDTVRVI
RBSD_AERHH/1-138TVCDAGLPIPAG....PERIDLALMAGT.-----------------------------------------PSLETVLTAL
R7CST6_9FIRM/1-133CIGDCGLPVPNG....VEKIDLALRFGE.-----------------------------------------PLFIEVVKEV
E6K2M3_PARDN/1-130VVSDCGLPVPEG....VEVIDLALVFGV.-----------------------------------------PRFEDVLDAI
F8HZV5_WEIKK/1-133TIGDSGLPVKDD....GRKIDLSVVRGL.-----------------------------------------PLFIDVLAAT
H5WTN9_9BURK/3-145VVADANFTAASL.....GRGKPVIHLAG.-----------------------------------------AGVQQAAQAI
Q2K1E4_RHIEC/3-146VISDMNFPSDSIAR.QTRLGR.LLTMEN.-----------------------------------------IPAPQAIDAV
C6CWG2_PAESJ/4-141VLADGNFPAVSHAQ..R.....LVRCDG.-----------------------------------------HGVPELLDAI
R7FCF1_9FIRM/3-141VIADGNFPAAALAQ..R.....LVRLDG.-----------------------------------------HGVPEVLRAV
RBSD2_RUBXD/1-131VVCDAGFPIPRD....AQRVDLAIAPDL.-----------------------------------------PDLRTVLSLI
E1SQZ3_FERBD/1-138TIADAGLPIPDE....CQRIDLALIRGV.-----------------------------------------PTFLDTLNAI
F0SXR5_SYNGF/4-142LIADANFPAASMGRI.......VLQCPG.-----------------------------------------IDACSLLAAI
I2F8D7_9BACT/1-132VISDSGLPIASD....RYRIDVSIVGGK.-----------------------------------------PGVFDVLDPV
K8E678_CARML/1-130TIGDAGLPVPEG....VLKIDLALALSD.-----------------------------------------PEFIKVFGLV
RBSD_BACP2/1-129VIADCGLPIPEG....PVKIDLSLTIGT.-----------------------------------------PSFQEVTSLL
RBSD_CLOPE/1-130AIGDCGLPIPKE....TERIDLALIKGV.-----------------------------------------PGFIETLKAI
RBSD_HELMI/1-129VVADSGLPVPPG....VPCIDLAVTKGV.-----------------------------------------PSFLPVLEAI
C8WRM8_ALIAD/1-129AVADCGLPIPPG....IELVDLAIKPGM.-----------------------------------------PSFLDVCDTI
RBSD_DESAD/1-138TVCDAGLPIPEG....VQRIDLAVSEGI.-----------------------------------------PSFIDVVKAV
A8AMU2_CITK8/1-137LIADANYSFLTNSSPQARIIWLNFSPGL.-----------------------------------------IGSVMILEKI
D4JSL9_9FIRM/3-144IIADGNFPAESMGK..NCK...VIRADG.-----------------------------------------HGVPELLDAI
D7C7T7_STRBB/3-141ALVDRNFPAHSVND.R......VIRLDG.-----------------------------------------TDVVSAGRAV
U5MT14_CLOSA/1-130AIGDCGLPIPEC....TKRIDLALIKNI.-----------------------------------------PRFIDTLKVV
G9WJ23_9LACT/1-131AIGDAGMPVPAG....TKKIDLAVTKDL.-----------------------------------------PRFDDVVKTI
RBSD_BACHD/1-128VIADCGLPIPED....VECIDVSLKQGV.-----------------------------------------PSFVEVLAEI
L0DPF0_SINAD/1-130LIVDAGYPLPPD....GHVIDLTLTPGI.-----------------------------------------PRFLDVLRAV
E8N1H2_ANATU/1-130VIGDAGLPIPAE....TYRIDLALTRNM.-----------------------------------------PPFLDTVRAV
M4UKW9_9GAMM/1-133TVCDAGLPIPST....TQRIDLALTHGV.-----------------------------------------PAFITTVQVL
RBSD_STAEQ/1-133TINDAGMPIPND....DKRIDLAVTKSL.-----------------------------------------PCFIDVLETV
D1BQI4_VEIPT/1-132CISDCGLPVPEG....VQKIDLALDFGV.-----------------------------------------PSFEQVVSII
M9WWK1_MANHA/1-138TVCDAGLPIPNT....IERIDLALTAGV.-----------------------------------------PSFLQTFDVV
R5TNK7_9FIRM/3-146VIADGNFPSESMGK..DAI...VIRCDG.-----------------------------------------HGVPEILDAI
C4LFS0_TOLAT/3-146AVVDRNFPARSIAN..ETTSGKLVSLGG.-----------------------------------------MDAPTCISGI
I4D7C5_DESAJ/1-129VIADYGLPIPPQ....IPFIDLAVSEGV.-----------------------------------------ASFWDVFNSV
F6AIR2_PSEF1/1-133VIGDAGMPIPPG....TPCIDLALTAGV.-----------------------------------------PDFVTTLKVV
G8MES4_9BURK/3-146VICDANFPADSVAR.QTVLGR.VLRLDG.-----------------------------------------VSAPRAVRAV
I0GTY5_SELRL/1-130MVGDAGMPIPPG....VTVIDLAVTKGV.-----------------------------------------PTFQQVMDAL
Q1R0M9_CHRSD/1-143LVADALYPHSTGAPATASRVYLNLCEGM.-----------------------------------------VPAQAVMDAV
I6WS14_PROPF/4-143LITDGNYPVASGAPAAAERIFLNLAPGL.-----------------------------------------LDVTRILEVL
R6J451_9CLOT/3-144VIADGNFPAKSVGK..NAK...VIRADG.-----------------------------------------HGVPELLDAV
I2F732_9BACT/1-146VITDRGFPFPRHGN..TVCIDVSVGRNL.-----------------------------------------PRFVDVVKVV
RBSD_LACBA/1-130SIGDAGMPVPMG....TQKIDLALTKQL.-----------------------------------------PSFQDVLKNV
F7YRL9_VIBA7/1-138TICDAGLPIPDE....VQRIDLALTHGI.-----------------------------------------PGFIDTVRVI
R5FD09_9CLOT/1-137AIADCGLPVPEG....TERIDLAVTFGN.-----------------------------------------PRFTDVLKAV
RBSD2_STRGG/1-128LVCDAGMPIPPG....PRVIDLAFRAGT.-----------------------------------------PSFAEVLDGL
C9Z854_STRSW/1-128VISDAGLPLAPG....TPVVDLGYRYGQ.-----------------------------------------APFLDVVQTV
A4YW09_BRASO/3-146VICDTNFPADAIAR.QTVFGE.LLRIDN.-----------------------------------------VSAARAVQAV
RBSD_PHOPR/1-138TICDAGLPIPDE....TQRIDLALIPGV.-----------------------------------------PTFIDTVKAV
U4KB26_9VIBR/1-138TICDAGLPIPPS....VRRIDLALTHGV.-----------------------------------------PEFLETVRVV
RBSD_VIBF1/1-138TICDAGLPIPDA....SQRIDLALIQGI.-----------------------------------------PTFIDTVKAT
B9JAZ3_AGRRK/3-146VVVDTNFPAESVAQ.QTMLGH.LLRIDN.-----------------------------------------VSAAEAVEAL
I0IEV2_PHYMF/1-147LITDGNYPHSTRRNPAASTVWANFRPGL.-----------------------------------------LGGATALELV
F8F0A5_TRECH/1-130TIADCGLPIPDT....TQRIDLAVKKGL.-----------------------------------------PSFLDVLDAV
X4QXA5_9ACTO/3-139VLGDANFPGEKYNT....R...VCRADG.-----------------------------------------VGIPELLDGV
I0HQ21_RUBGI/1-130VIADAGLPVPPG....PQRIDLAVRAGL.-----------------------------------------PGLEDVLAAV
RBSD_LACRD/1-130SIGDAGMPVPFG....TKKIDLAVDKEL.-----------------------------------------PSFMDVLNNV
F2F275_SOLSS/1-128VIADCGLPIPDG....VTCIDLAYKLGE.-----------------------------------------PGFIAILEVV
W8T760_EUBAC/1-134TVCDSGLPIHEN....VQRIDLALVKGV.-----------------------------------------PTFIETVEAV
E3DLS9_HALPG/1-130VVADCGLPIPQA....VKRIDLSVTKGY.-----------------------------------------PKFLKILKGV
F0SHV6_RUBBR/1-146LIADGNYPASSTLGPNAELVSLNLAPGL.-----------------------------------------VTVSQVLETL
T0K591_COLGC/4-141VLADAHFPAHSICP.PHIP...VLRADG.-----------------------------------------ITVSRLLAGI
RBSD_KOSOT/1-131TVCDCGFPIPDG....AKVVDLSIIKGF.-----------------------------------------PRLIDVLKAL
F2UJC5_SALR5/5-149VLADANFPAESVGASTPCS...VIRCDA.-----------------------------------------LGMPELLSAI
D5AN92_RHOCB/3-141VIVDANFPAESCAQ.E......LIRMPG.-----------------------------------------LSATQVMDAI
Q896U5_CLOTE/1-137LICDGNYPIDSCTSETTEKVYLQLTHGI.-----------------------------------------PMVTDVLKVL
R6DJZ8_9FIRM/3-139VIGDGNFPAVTNAQ..R.....LVRLDG.-----------------------------------------HGVPEILDAI
D2Q2A4_KRIFD/1-136LIADGNYPYATAVAPGVETIWLNLRPGQ.-----------------------------------------VPVDDVLATL
B2IKF4_BEII9/3-143AIVDANYPAEAHARR.......CVRADG.-----------------------------------------HDLPALLDAL
RBSD_STACT/1-133TINDAGMPIPND....ERRIDLAVTKAL.-----------------------------------------PRFIDVLETV
RBSD_CLOBB/1-130AIGDCGLPIPAE....SERIDLALIKGI.-----------------------------------------PTFMQTLKTT
R6AC27_9FIRM/1-133CVGDCGLPVPAG....TPKIDLALRLGE.-----------------------------------------PKFIEVVKEM
J9YYK7_9PROT/4-141ILSDSNFPAYSMNS.R......VHRLDG.-----------------------------------------VDAARAAKAI
G4L5H4_TETHN/1-130AIGDAGTPVPEQ....TEKIDLAVTCDI.-----------------------------------------PKFLDVLDNV
D2R7C7_PIRSD/1-146LIADGHYPASSKKGPNATVVSMNLMPGL.-----------------------------------------ITCDQALQAV
V5WH75_9SPIO/1-130VICDAGLPIPRE....TRRIDLALRKGI.-----------------------------------------PAFEDVLRST
C9R6M5_AGGAD/1-138TLCDAGLPIPTQ....VERIDLALTKNI.-----------------------------------------PSFLACLDAI
L7VKA3_CLOSH/3-144VIADGNFPSESVGK..NAK...VIRMDG.-----------------------------------------HGTCEVLEAI
R5TTQ0_9FIRM/1-136CIGDCGLPIPDE....TERIDLAVKFGQ.-----------------------------------------PSFMDVLEEV
A6VWH0_MARMS/3-144VLVDRNFPAASMAA.....GKPVIRLDG.-----------------------------------------VNVIQAAKAI
I2BEN0_SHIBC/1-138TIGDAGLPVPPA....TQRIDMALTHGV.-----------------------------------------PSFLAVFDVV
RBSD_LACSS/1-130SIGDAGMPVPVG....TKKIDVAIENGV.-----------------------------------------PSFIQVLTNI
R7III7_9FIRM/3-140VLADANFPAESMGQ....R...VVRADG.-----------------------------------------IGAAELLRAI
RBSD_EXISA/1-128VIADCGLPIPDG....VKRVDLSLRIGE.-----------------------------------------PSFLEVLDVV
Q3Y2W3_ENTFC/1-130SIGDAGMPVPFG....TEKIDLAVSNGL.-----------------------------------------PSFLSVLENV
Q7CL41_YERPE/1-130LVTDAGFPIPPQ....AKRIDLGFWPGT.-----------------------------------------VDVLHILRVL
C9YX65_STRSW/1-137LLADGHYPASTATGERARIVHLNLAPGL.-----------------------------------------LDVTTVLDVL
E8QWG2_ISOPI/1-131LIVDASFSLPTD....AHVIDLSLIPNL.-----------------------------------------PRFLDVFKAI
R5ERS4_9GAMM/1-132TIGDCGLPVPKG....VQRIDLAVTYGV.-----------------------------------------PSFDDVFKVV
R6LVN6_9FIRM/1-130MIGDGGMPIPKG....VEIVDLALCGGV.-----------------------------------------PTFRQVMDAI
F0RTX8_SPHGB/3-140VIGDGNFPAASLND..R.....VVRLDG.-----------------------------------------HGAEATLKAI
R5A403_9CLOT/3-143VLADGNFPAESMGK..NAI...VIRADG.-----------------------------------------HTVPEILDAV
R6ND69_9CLOT/3-139VIGDGNFPAASIAQ..R.....LVRLDG.-----------------------------------------HGVDEILDAI
RBSD_ACTP2/1-138TICDAGLPIPSE....QQCVDLALTKGV.-----------------------------------------PSFLSTLEVV
RBSD_LACAC/1-130GIGDAGTPVPKT....TEKIDLAVSAGM.-----------------------------------------PSFISVLKEV
RBSD_CROS8/1-138VVCDAGLPIPST....TERIDLALTQGV.-----------------------------------------PGFLQVVDVV
J7TDW0_MORMO/1-138TVADAGLPIPPA....TPRIDLALTQGV.-----------------------------------------PDFMSVFKVI
FUCM_KLEP7/3-139IFSDAHFPAHSM....GPQ...VIRADG.-----------------------------------------LRVSDLLQAI
RBSD_BACSK/1-128VIADCGLPIPSN....VECIDLSIRLGV.-----------------------------------------PNFVDVLTEV
I0JTG6_HALH3/1-130IIADCGLPIPEE....TRCIDVSLNLGT.-----------------------------------------PDLLTVLRAV
H8H116_DEIGI/1-133VLADTGLPVPAG....TPCIELGVTAGL.-----------------------------------------PALLDVLRAV
E1R2M1_SPISS/1-129IISDAGFPIPEG.....KRVDLAIEADK.-----------------------------------------PSITEILDLV
F0RJP3_DEIPM/1-130VLADAGLPIPPQ....VRCIDVSVSAGL.-----------------------------------------PQLLPVLQAI
F5YAI5_TREAZ/4-141VLADAFFPGDSC....NSR...VIRADG.-----------------------------------------IRVPALLEGI
D5E272_BACMQ/1-128VIADAGLPVPSD....VPKIDLSLKLGV.-----------------------------------------PSFEDVVVAV
F9VK47_ARTSS/1-130AIGDCGLPIPKE....TKRIDLALTKGI.-----------------------------------------PSFLDTLKTT
RBSD_HAEIN/1-138TICDAGLPIPLS....VERIDLALTAGV.-----------------------------------------PSFLQTLNVV
N0AWL8_9BACI/1-130VIGDCGLPIPDG....TIRIDLAIKLGN.-----------------------------------------PSFMEVLEAV
W0LD73_9GAMM/1-138TICDAGLPIPAG....VQRIDLALAQGI.-----------------------------------------PTFLQVVEVV
RBSD_LACLA/1-131CIGDLGLPVPSG....VKKIDLALTRGK.-----------------------------------------PSFQEVLDIY
Q2YQE7_BRUA2/3-138VIVDANYPAQAAGV.P......VLDFPG.-----------------------------------------ISATQVAEAV
F4GKH9_SPHCD/3-139VIGDGNFPAAAYAR..R.....LVRLDG.-----------------------------------------HGVPQILEAI
RBSD_PSEF5/1-133VIGDAGLPVPPG....VELIDLALTHGV.-----------------------------------------PDFLTTLKVL
K0I3R8_9BURK/3-144VLADANFTAMSL.....GAGKPVLRLPG.-----------------------------------------IGMARAVQAV
W0HUD8_9GAMM/1-137LIADSNYSVVTNSSPGATIVYLNFAPDM.-----------------------------------------IGSPVILEKL
F0YHV1_AURAN/34-177AVVDCNFPAVECAS..KTTTGDLITLAG.-----------------------------------------VDCPTALGAI
RBSD_CLOTE/1-130AIGDCGLPIPEE....TKRIDLALIKNI.-----------------------------------------PTFMDTLKSV
Q13FK6_BURXL/3-146VLCDANFPADSVAR.ATVTGK.LLRLDG.-----------------------------------------VDAARAIRAV
D3E6C1_GEOS4/1-130VVGDVGLPVPPG....VPKIDLALTLGT.-----------------------------------------PSFMEVVEAI
Q89HT9_BRADU/3-146VFVDANHPATRIAK..TTSSQRLIQLPG.-----------------------------------------MRMETAARAI

PF04705

J7LIM1_NOCAA/1-114--R----IPV--RLFA--TS--------V---------------------------------------------VNQV--
J7KYH7_NOCAA/1-114--R----IPI--RLVD--YT--------V---------------------------------------------VNKI--
X5DQN6_9CORY/7-116--E----VQI--HTLS--SA--------V---------------------------------------------TKRI--
D5UK31_CELFN/3-112--G----VAI--QEVA--PA--------V---------------------------------------------WNEL--

PF08032

Q8CXU2_LEPIN/36-110..G----TKN--IKVP--KK--------I.--------------------------------------------FEKV--
O96263_PLAF7/86-167..N----VSI--QYME--KY--------K.--------------------------------------------MNEL--
Q6BTY4_DEBHA/128-204..G----LRI--DRKD--SK--------ND--------------------------------------------LNVL--
MRM3_DROME/141-217.TG----TKI--YKVP--QH--------D.--------------------------------------------LKTW--
RLMB_VIBCH/5-81..G----VSI--QEMS--RK--------A.--------------------------------------------LDDK--
Q92QI6_RHIME/59-133..P----FPT--ETVM--PQ--------E.--------------------------------------------LDRI--
Q7MBB6_GLOVI/92-168..G----AVI--DIVE--PR--------R.--------------------------------------------LDQL--
RLMB_RALSO/6-82..G----VRM--IPAD--NE--------R.--------------------------------------------LRGI--
Y479_MYCPA/69-145..G----ISI--LEVP--RA--------D.--------------------------------------------LDRM--
Q7U7F6_SYNPX/177-253..G----VLV--EEVT--WA--------R.--------------------------------------------LGQI--
Q8E1Z2_STRA5/15-89..K----VSI--SWTP--KK--------T.--------------------------------------------LSDM--
Q8D323_WIGBR/4-80..N----IKI--KFVD--KK--------F.--------------------------------------------LNKI--
Q6MS22_MYCMS/5-77KTK----IKV--NVVS--EN--------K.--------------------------------------------LDQL--
Q97EF9_CLOAB/9-84..G----IPV--KYVD--RK--------K.--------------------------------------------LDKI--
Q6C040_YARLI/179-258..R----IPT--ENVD--RN--------T.--------------------------------------------LNLI--
Q8DK28_THEEB/45-121..G----AII--DTVT--PE--------R.--------------------------------------------LDQL--
Q6ADI2_LEIXX/89-166..A----IPV--LEIM--RP--------E.--------------------------------------------LDRL--
Q890M7_CLOTE/5-80..R----IPI--KNVD--KK--------K.--------------------------------------------LDEI--
Q6FPX7_CANGA/108-186..G----IKI--DTAD--KH--------Q.--------------------------------------------LNLI--
Q7NAH8_MYCGA/23-94..G----IEY--ELHT--IK--------W.--------------------------------------------FDNQ--
Q9A907_CAUCR/33-109..G----GEV--IEVN--RE--------I.--------------------------------------------LEKV--
RLMB_SHEON/6-82..G----TSI--QVTS--RK--------V.--------------------------------------------LDEK--
Q98N81_RHILO/2-76..T----FKA--ELVE--PR--------D.--------------------------------------------IDKI--
MRM1_SCHPO/33-108...----IPI--KSVN--KE--------H.--------------------------------------------LNQI--
Q7VFD1_HELHP/2-74..D----KPI--KRVD--MK--------K.--------------------------------------------AQAL--
Q8A814_BACTN/7-81..L----IPV--QRVP--VE--------R.--------------------------------------------INRI--
Q6YQX1_ONYPE/823-895..N----IAY--QLVD--KK--------F.--------------------------------------------LYDL--
Q9PQG4_UREPA/33-108..N----IQI--YKVS--GN--------I.--------------------------------------------IKKL--
O25279_HELPY/4-76...----PNI--IKVD--NK--------K.--------------------------------------------AQSL--
RLMB_COXBU/6-81..G----VKV--ILLS--RT--------E.--------------------------------------------LNTL--
Q6AGD8_LEIXX/38-113..G----TQV--EFVT--EQ--------V.--------------------------------------------LGTI--
Q9K894_BACHD/31-100..E----RDV--ILVS--DR--------V.--------------------------------------------MADL--
Y1673_SYNY3/38-112.QS----VHS--YLVS--GE--------V.--------------------------------------------LAKM--
Q9CJY1_PASMU/125-200..K----KAY--HVVD--SA--------E.--------------------------------------------LALV--
Q8Z0C3_NOSS1/42-116..C----DRY--EIVS--EE--------V.--------------------------------------------LQAI--
Q7MTU3_PORGI/6-80..C----VPV--MHVP--IE--------K.--------------------------------------------LDRL--
RLMB_NITEU/6-82..S----TRL--ILCE--QD--------R.--------------------------------------------LCKM--
Q8XJ72_CLOPE/31-104...----IKL--IQMN--EA--------L.--------------------------------------------LKQL--
YACO_BACSU/7-81..G----ITI--QYVP--RK--------K.--------------------------------------------LDQM--
Q74L24_LACJO/8-85..N----LVV--QNAP--KN--------K.--------------------------------------------LDQM--
Q891T6_CLOTE/31-105..E----NKV--YILN--ES--------S.--------------------------------------------FNSI--
Q6MIZ9_BDEBA/55-130..H----IKV--ELKA--EA--------A.--------------------------------------------...L--
O84408_CHLTR/29-103..G----IEK--LYCS--KD--------I.--------------------------------------------LEKL--
RLMB_NEIMB/6-82..N----IRV--YFAD--AD--------R.--------------------------------------------LNAI--
RLMB_ACIAD/6-82..G----ISV--QKAS--RD--------S.--------------------------------------------LEKL--
Q6CLR7_KLULA/125-198..N----IQT--EEVD--KH--------R.--------------------------------------------LNLY--
Q8YXQ3_NOSS1/83-159..G----AVI--DEVD--TK--------R.--------------------------------------------LDQI--
Q9RWC1_DEIRA/2-76..G----VRV--RWLP--RI--------E.--------------------------------------------LDQL--
Q9X263_THEMA/2-78..G----IKY--SFES--EE--------R.--------------------------------------------LKNL--
Q8KBA1_CHLTE/33-106...----.KA--WLAG--PN--------E.--------------------------------------------FKRL--
Q81L29_BACAN/31-99..D----VEM--YIVP--EA--------I.--------------------------------------------VKVL--
Q9L0Q5_STRCO/72-149.GG----INL--MEAP--RP--------E.--------------------------------------------LDRM--
Q6NFC4_CORDI/71-147..G----IPM--IEVP--RH--------E.--------------------------------------------MDLM--
O83093_TREPA/27-102..K----RLY--RSAN--TQ--------E.--------------------------------------------LERL--
Q74D57_GEOSL/5-80..G----VPV--RTRD--KR--------D.--------------------------------------------LARL--
RLMB_HAEIN/4-80..G----IGV--QFVN--RQ--------T.--------------------------------------------LDKK--
Q6AJ92_DESPS/48-125..K----VKV--TFID--SI--------S.--------------------------------------------LQGD--
Q6N4H3_RHOPA/40-113..R----IAP--EIVR--PS--------E.--------------------------------------------IDRQ--
Q828C9_STRAW/57-135..G----ARV--HLAD--EA--------V.--------------------------------------------IADI--
Q9KGF2_BACHD/5-80..G----VLV--QHVP--KR--------K.--------------------------------------------LDQL--
RLMB_CHRVO/6-82..N----VKL--HIVD--KE--------R.--------------------------------------------LDSM--
RLMB_PECAS/4-80..G----IVI--QVAS--RQ--------W.--------------------------------------------LDKQ--
Q9CHW1_LACLA/29-104LTD----LSV--NLVS--KE--------V.--------------------------------------------LKSL--
Q74ID9_LACJO/31-102..D----NKV--IQIT--DA--------I.--------------------------------------------AQHL--
Q839V3_ENTFA/43-117..A----VPV--KWVP--KA--------K.--------------------------------------------LDTM--
Q8R7T5_CALS4/6-80..G----IVV--STAD--SD--------T.--------------------------------------------LKRL--
Q73J63_TREDE/10-85..K----RLY--RIVS--DD--------E.--------------------------------------------LEKL--
Q75B46_ASHGO/118-191..G----IKV--QSAQ--RH--------Q.--------------------------------------------LNMM--
Q6AAT1_PROAC/72-148..G----IAL--MQAT--RG--------E.--------------------------------------------LDRM--
MRM1_YEAST/125-198..K----VTT--ELVD--KH--------R.--------------------------------------------LNLL--
MRM1_HUMAN/51-129..D----IPV--LRPR--RQ--------K.--------------------------------------------LDTM--
Q7NN60_GLOVI/29-103..A----GRY--ETVA--PA--------V.--------------------------------------------IEAL--
Q831U7_ENTFA/31-103.ET----EKL--IFVS--DE--------V.--------------------------------------------LNSL--
Y355_MYCPN/9-79..G----LRY--EMHS--SQ--------W.--------------------------------------------FHQQ--
Q7TU91_PROMP/190-266..G----VLI--EEVP--WS--------R.--------------------------------------------LSQL--
RLMB_PSEPK/6-81..R----VPV--GQAE--RR--------E.--------------------------------------------MDAW--
Q6A7V4_PROAC/41-113..G----VRV--VVLT--DE--------D.--------------------------------------------VNAL--
Q7MSH0_WOLSU/29-101..G----IPL--LRVD--PK--------K.--------------------------------------------AQAM--
Q92F34_LISMO/9-83..K----IQV--QFVP--KQ--------K.--------------------------------------------IEKV--
Q8KC03_CHLTE/18-94..R----IPC--GKAR--ME--------K.--------------------------------------------LTLL--
Q8CXP3_OCEIH/5-79..G----TIV--QKVP--RS--------K.--------------------------------------------LDQM--
Q72G19_DESVH/7-82..R----VRF--SLVE--GQ--------V.--------------------------------------------LDKL--
Q9PR20_UREPA/3-73..K----ITY--EIVN--EA--------W.--------------------------------------------FKQF--
O67731_AQUAE/6-79..G----VKV--QRIS--RK--------K.--------------------------------------------VEEL--
RLMB_BLOFL/4-80..N----INI--QECT--RR--------V.--------------------------------------------LNIK--
Y955_SYNY3/125-201..G----TVV--DEVD--NF--------R.--------------------------------------------LNQI--
Q9XWY8_CAEEL/44-125..G----IQK--TLLT--DD--------Q.--------------------------------------------LDRL--
C5DY76_ZYGRC/130-203..N----VEL--VETD--KH--------R.--------------------------------------------LNLM--
D7BAL1_MEISD/30-105VGR----LAL--LEVS--EA--------V.--------------------------------------------LKKL--
Q2FZE0_STAA8/31-99...----.EV--FEIN--MK--------V.--------------------------------------------AESL--
Q2G2M3_STAA8/6-79..K----IIV--QTVP--KS--------K.--------------------------------------------LDFL--
Q2YP21_BRUA2/57-129..G----GLV--LEVT--EK--------V.--------------------------------------------ISAI--
Q32CT8_SHIDS/110-181..R----KAY--HVVD--EA--------E.--------------------------------------------LTKA--
Q5SLJ7_THET8/2-71..G----APY--TLVP--RI--------E.--------------------------------------------LDTL--
Q820Y2_TROWT/26-98..D----IPH--IFVP--RS--------T.--------------------------------------------LDRL--
RLMB_XANCP/7-81..G----IDV--RRVN--TQ--------A.--------------------------------------------LDGV--
Q8Y7Q4_LISMO/31-99..D----YDV--FEIS--TE--------I.--------------------------------------------SHLI--

PF01248

Q9XWS4_CAEEL/14-108KTG----VHH..YNGN..N.--------IE--------------------------------------------LGTA--
RS12_HUMAN/16-111EHQ----INL..IKVD..DN--------KK--------------------------------------------LGEW--
RL30E_AERPE/1-95GIP----IIV..YRGT..R.--------MD--------------------------------------------MGLV--
RL30_KLULA/8-102KTK----VYY..FQGG..N.--------NE--------------------------------------------LGTA--
RL7A_CHICK/122-216KMG----VPY..CIIK..SK--------AR--------------------------------------------LGRL--
RL8B_YEAST/117-209KMG----VPY..AIIK..GK--------AR--------------------------------------------LGTL--
RL8_SCHPO/117-212KMG----VPY..AIVK..NK--------AR--------------------------------------------LGTV--
RL7A_ANOGA/128-222KMG----VPY..CIIK..GK--------AR--------------------------------------------LGTL--
RPP38_HUMAN/99-190SRS----VPA..CQVPRLS.--------ER--------------------------------------------IAPV--
SBP2L_HUMAN/702-804EQE----IPF..VFAL..GR--------KA--------------------------------------------LGRC--
NHP2_YEAST/41-135DHS----VPY..IFIP..SK--------QD--------------------------------------------LGAA--
NHP2_SCHPO/39-133DNN----VPY..LYTV..SK--------EL--------------------------------------------LGEA--
RS12_DROME/23-118EHQ----IPL..IRVD..SH--------KK--------------------------------------------LGEW--
RS12_CAEEL/24-119EHQ----IPL..IKVA..DK--------KI--------------------------------------------IGEY--
RS12A_SCHPO/31-126ESE----TPL..IKVA..DP--------KV--------------------------------------------LGEW--
RS12_YEAST/26-123ENK----VPL..IKVA..DA--------KQ--------------------------------------------LGEW--
RS122_ARATH/29-124DHS----IKL..LTVP..SA--------KT--------------------------------------------LGEW--
RS12_PLAF7/23-119EKN----IPLFMVQND..S.--------KD--------------------------------------------LGHW--
GA45B_HUMAN/21-121DND----INI..VRVS..GM--------QR--------------------------------------------LAQL--
GA45A_HUMAN/21-123END----INI..LRVS..NP--------GR--------------------------------------------LAEL--
SEBP2_RAT/650-752EQN----IPF..VFAL..NR--------KA--------------------------------------------LGRS--
O77331_PLAF7/495-595EKN----IPI..VFAL..SK--------NL--------------------------------------------LGKC--
RL30E_METJA/7-101NIP----VYQ..HKIT..S.--------LE--------------------------------------------LGAV--
RL30E_METTH/1-95EIP----VYT..HEGT..S.--------VE--------------------------------------------LGSV--
RL30E_SULAC/3-97DIP----IYL..YKGS..G.--------YE--------------------------------------------LGTL--
RL30_MAIZE/12-106KVT----VHH..FHGN..N.--------VD--------------------------------------------LGTA--
Q9VJ19_DROME/12-106KTE----VQH..YSGT..N.--------IE--------------------------------------------LGTA--
RL30B_SCHPO/22-116RCS----VHH..YSGN..N.--------ID--------------------------------------------LGTA--
YLXQ_BACSU/4-96YYK----VPY..KKVE..SR--------AV--------------------------------------------LGRS--
Q9WZN2_THEMA/7-99NKK----VPY..VIMF..SK--------EE--------------------------------------------LGRL--
RL7A_DROME/127-221KMG----VPY..CIVK..GK--------AR--------------------------------------------LGRL--
RL7A1_ARATH/112-207KME----VPY..CIVK..GK--------SR--------------------------------------------LGAV--
RL7A_ARCFU/13-107EKN----VPY..IYVK..SK--------ND--------------------------------------------LGRA--
RL7A_METJA/15-106EKG----IPY..AYVA..SK--------QD--------------------------------------------LGKA--
RL7A_SULSO/17-111EKK----IPY..VYVS..SK--------KA--------------------------------------------LGEA--
RL7A_AERPE/17-111EKK----IPY..VYVP..SK--------KR--------------------------------------------LGEA--
RL7A_METTH/17-111EKE----IPY..IYIP..TK--------DE--------------------------------------------LGAA--
Q9SU26_ARATH/20-114DKN----VPY..VFVP..SK--------QA--------------------------------------------LGRA--
SNU13_YEAST/18-112DKN----VPY..VFVP..SR--------VA--------------------------------------------LGRA--
NH2L1_DROME/19-113DKN----VPY..VFVR..SK--------QA--------------------------------------------LGRA--
NHP2_DROME/51-146EKG----IPY..TYTP..SR--------AD--------------------------------------------LGAA--
NHP2_CAEEL/53-148EKE----IPY..VYIP..SR--------EQ--------------------------------------------LGLA--
I6TC33_ENTHA/8-96YYE----VPC..FELF..SE--------AE--------------------------------------------ITQM--
M0Y8U1_HORVD/29-123EHN----VHL..VTVP..SA--------KT--------------------------------------------LGEW--
N1JG05_BLUG1/33-127EHK----IPL..IKVP..DG--------KQ--------------------------------------------LGEW--
Q385Y8_TRYB2/32-125QNN----IDL..VSMD..ER--------EK--------------------------------------------LAQW--
Q38AC1_TRYB2/29-122QAS----IDI..IEVD..SR--------EE--------------------------------------------LAEW--
Q38BI8_TRYB2/20-112KTP----IHH..YSGN..N.--------LD--------------------------------------------LGTA--
RL30E_THEKO/7-95GIP----VYE..FEGT..S.--------VE--------------------------------------------LGTL--
RL30E_METMP/2-94ETP----VYT..HQAT..S.--------IE--------------------------------------------LGAI--
RL30E_PYRFU/3-94DIP----VYE..FEGT..S.--------VE--------------------------------------------LGTL--
RL7A_PYRFU/18-111EKE----IPY..IYVP..SK--------KE--------------------------------------------LGAA--

PF03465

PELO_HUMAN/271-370--A----GTV--RIFS--SL--------HV--------------------------------------------SGEQ--
ERF1_CAEEL/288-424--G----AAL--EIVT--DK--------SQ--------------------------------------------EGAQ--
PELO_METTH/259-352--G----GSV--VLIS--SE--------HE--------------------------------------------GGKQ--
E7QK37_YEASZ/277-376--G----GKA--LVLS--TL--------HS--------------------------------------------LGEE--
PELO_AERPE/250-349--G----GRV--IIIP--GD--------SP--------------------------------------------AGER--
RF1_PYRHO/278-417--G----SDV--EIIS--LD--------TE--------------------------------------------EGQQ--
PELO_METJA/254-346--G----GKV--VIVS--SE--------HD--------------------------------------------AGKQ--
B2AWT5_PODAN/281-418--G----TTL--EFVS--DR--------ST--------------------------------------------EGNQ--
PELO_THEVO/247-338--G----TDI--HIVS--TS--------ND--------------------------------------------MGEI--
ERF1_TRYBB/281-420--G----CAL--ELIT--NR--------SQ--------------------------------------------EGTQ--
PELO_SULSO/245-343--R----GEV--ILVP--KE--------SP--------------------------------------------IYFE--
Q9BMX1_EUPAE/276-413--G----IKL--EFIT--DK--------SQ--------------------------------------------EGFQ--
PELO_PYRAB/260-355--R----ANV--VVVS--SE--------HE--------------------------------------------GGDK--
RF1_METTH/274-407--G----TEV--EIIS--TE--------TE--------------------------------------------EGMQ--
RF1_ARCFU/270-403--G----AKV--EFLS--TE--------SE--------------------------------------------EGEM--
ERF1_SCHPO/277-416--G----ANL--EFVS--DR--------SQ--------------------------------------------EGMQ--
RF1_AERPE/279-370--G----AQV--IVVP--ES--------LA--------------------------------------------EAEW--
RF1_SULSO/275-368--G----VKV--FVVG--DE--------VP--------------------------------------------EAEW--
PELO_ARCFU/246-342--G----GKV--VIMS--TE--------FE--------------------------------------------PGKR--
RF1_THEVO/277-410--G----AQV--EIIS--DQ--------SD--------------------------------------------EGKL--
ERF1_BLEAM/280-415--G----AGL--EFIT--DR--------SQ--------------------------------------------EGAQ--
PEL1_ARATH/271-370--G----GDA--FIFS--AM--------HV--------------------------------------------SGEQ--
ERF1_GIAIN/290-432--G----ASL--EFIT--NR--------SA--------------------------------------------EGTQ--
PELO_DROME/271-370--G----GEV--KIFS--SM--------HI--------------------------------------------SGEQ--
ERF1_STYMT/285-422--X----AQV--EFIT--DK--------SQ--------------------------------------------EGYQ--
PELO_CAEEL/271-370--N----GKV--HIFS--SM--------HV--------------------------------------------SGEQ--
PELO_THEAC/247-338--G----TRI--HIVS--VS--------ND--------------------------------------------PGQI--
PELO_HALSA/254-356--G----GSV--TVFS--HE--------FA--------------------------------------------PGEQ--
I7MKI5_TETTS/279-414--G----AEL--YFIT--DK--------SA--------------------------------------------EGCQ--
A0A024WDX6_PLAFA/276-411--G----ASL--DFVT--NK--------SQ--------------------------------------------EGAQ--
P79004_SACPS/277-376--G----GRV--FVFS--TL--------QS--------------------------------------------HGEE--
DOM34_SCHPO/271-370--N----CPV--YIFS--SL--------HE--------------------------------------------SGKQ--
RF1_HALSA/281-414--G----TET--HFIS--TD--------FE--------------------------------------------KGEQ--
RF1_METJA/277-419--G----AKL--VTVS--SE--------TE--------------------------------------------EGAM--

PF15608

Q0RDF6_FRAAA/285-365LRR----VPW--RILV--AP.DRV....DE--------------------------------------------LPHV--
F8A7B9_CELGA/759-840LRR----VPW--KILV--RE.DAD...PRD--------------------------------------------LRHI--
E4NAQ4_KITSK/291-371LRR----VPW--RILA--RR.GAG....AD--------------------------------------------LDHV--
A1VWP9_POLNA/279-359LRR----VPR--LLIL--RD.PSA....PD--------------------------------------------VAHL--
Q5NWT5_AROAE/279-359LRR----FPQ--RVIV--RD.CHD....RK--------------------------------------------VAHL--
Q8KL02_RHIEC/282-364LRR----VPE--KVYV--SS.PTD....PE--------------------------------------------LAAL--
D3VJW4_XENNA/275-357LRR----VPE--HVLV--RS.LND....PD--------------------------------------------VALL--
C8XAU5_NAKMY/305-385LRR----VPW--KILV--RE.ADH....PD--------------------------------------------HQHL--
F4EXE7_SELS3/265-346LRR----LPW--KLLV--KSRTDE....AR--------------------------------------------LGHL--
E6UDF8_RUMA7/266-347LRR----MPW--KMLV--HSLDDN....EH--------------------------------------------LGHL--
H8GG70_METAL/281-361LRR----EAG--RLLL--GN.PDS....EA--------------------------------------------TRHL--
Q9RSA8_DEIRA/269-349LRR----QPA--HLLL--RD.AAH....PD--------------------------------------------TLHL--
STIP_ACIAD/297-379LRR----VPD--LVLL--RD.ADD....ED--------------------------------------------TRLL--
F2JGK7_CELLD/289-369LRR----VPW--KILV--KD.KED....KR--------------------------------------------IKHI--
Q4FTP9_PSYA2/309-391LRR----DPE--CILL--AS.AEH....PD--------------------------------------------TILL--
D1BEJ8_SANKS/295-375LRR----VPW--KILV--RA.DAR....HE--------------------------------------------LGHV--
Q2RVZ5_RHORT/280-360LRR----MPE--RLFL--RD.PQD....GD--------------------------------------------VGHL--
C0Z9Y7_BREBN/295-375LRR----VPW--KILV--DS.VEN....PN--------------------------------------------LAHI--
C8W646_DESAS/311-391LRR----VPW--KVLV--KD.AAN....PD--------------------------------------------LKHI--
A8MM96_ALKOO/748-828LRR----VPW--KILV--RD.YDN....PN--------------------------------------------LRHI--
F8K488_STREN/279-359LRR----VPW--RVLV--RP.GAG....PE--------------------------------------------LDHV--
A1SUD4_PSYIN/287-367LRR----VPD--LLIV--QD.KLS....PS--------------------------------------------TVHL--
A4J1D7_DESRM/320-400LRR----IPW--KILV--RD.MNS....PD--------------------------------------------IKHV--
F8AVP2_FRADG/278-358LRR----VPW--KVVV--TP.ERL....AE--------------------------------------------LPHV--
D3RPA4_ALLVD/285-365LRR----VPE--RVII--RD.PEA....PE--------------------------------------------VAHL--
F4H5N6_CELFA/811-892LRR----VPW--RVLV--RP.DAA...DAD--------------------------------------------VAHV--
H6N264_GORPV/291-371LRR----VPW--MVLV--RE.PDL....PE--------------------------------------------HHHI--
Q891X7_CLOTE/298-378LRR----VPW--KILI--NN.LDN....PN--------------------------------------------LKHI--
A6WD80_KINRD/287-371LRR----VPW--RVLV--RP.EAELRHPDD--------------------------------------------LAHV--
A5WBK3_PSYWF/314-396MRR----DPE--QVLL--AS.ADH....PD--------------------------------------------TALL--
E8U3T5_DEIML/257-336LRR----RPA--ALVL--RA.L.T....PD--------------------------------------------TAHL--
D1A9P2_THECD/292-376LRR----VPW--QVLA--RA.DMLD..RRE--------------------------------------------LAHI--
B4EW79_PROMH/276-356LRR----VPE--HILV--KE.IAD....PD--------------------------------------------VALL--
D4L2P5_9FIRM/132-213LRR----VPW--KILI--DE.RYKG..DPQ--------------------------------------------LGHL--
E3EE68_PAEPS/297-377LRR----VPW--KILI--DR.EDN....PN--------------------------------------------LQHI--
J9STB4_9ACTN/293-373LRR----VPW--RILV--RA.DDL....PE--------------------------------------------HRHI--
M1FGD7_9ALTE/290-371LRR----RPD--CVLV--RSLGQD....PD--------------------------------------------LAAL--
Q186J5_PEPD6/281-358LRR----VPY--KILV--KD.LND....KS--------------------------------------------LDHI--
Q3JCD3_NITOC/292-369LRR----VPE--RLLL--RD.PGA....EE--------------------------------------------VAHL--
Q7CKQ6_YERPE/276-357LRR----VPD--HVLV--RH.IDD....PD--------------------------------------------VSLL--
R5BVZ9_9FIRM/264-345LRR----VPW--KVLV--HE.KYMG..DKA--------------------------------------------LEHI--
R5XB52_9CLOT/301-379LRR----IPY--KILV--DD.LNN....PK--------------------------------------------LKHI--
R7CDA0_9FIRM/265-346LRR----IPW--KVLI--DE.RYKG..NPQ--------------------------------------------LEHI--
U5LCP5_9BACI/286-365LRR----VPW--KILM--RD.PES....PY--------------------------------------------VRHI--

PF08228

Q6CTJ8_KLULA/13-168DHT....VTL--VQLPRLSS--------AK--------------------------------------------FDDA--
POP3_YEAST/14-171PMT....VKL--VQLPKSAM--------DT--------------------------------------------FKSV--
Q753G4_ASHGO/13-172ALD....VAV--VQLPCGTL--------AR--------------------------------------------FDEH--
Q6FQW2_CANGA/3-151N......VPL--IPINKKIN--------NK--------------------------------------------LLEH--
POP3_SCHPO/7-165NFYGSSKCRL--VPLGFSAQ--------AL--------------------------------------------IAKK--

PF05025

R5ICH0_9FIRM/3-147LQV----IPLD.EYVE--HPVMIMQVAEKD..RGM.EIP.IWDEY...KKIVA....K..YDARGEAA......FGSY..
R6MWK2_9CLOT/3-142LEL----FPID.TFVT--QPVKLMQVVPGD....D.YVPEVVEEY...KKILA....K..HDVG.EDK......IEYL..
F8F334_TRECH/4-141LAL----INLD.SYVE--HPVVMMQPVPGD....E.LDLSVERSY...REVID....R..R.WPGTPP......TERM..
A7II16_XANP2/3-140LSV----MPLD.TDVA--EAAFRPCAFGDC.....AREESVFSEF...EAAIA....A..REP..GFS......LVPI..
D5SWX7_PLAL2/1-146LSA----IPID.....--.HVHTMGIPADDPYAQL.GDPPVWKEF...SATMA....A...AGLS.IP......LTPI..
RBSD_PASMU/1-138VTE----MFVERAIIA--EEI.....KEKN........PKILTAL...LNSLA....Q..LEQQQGNQIE....VQYV..
RBSD_HAEPS/1-138SSE----LFIEKIVLA--EEI.....KNIN........PQIEQQL...LMVIQ....Q..IEVQQKNTIK....IEYI..
A9HPM0_GLUDA/4-139LKL----LPLD.GFVD--DPAVSMQQVGDP....DAV.PEAVADI...DATL.....R..AHGH.AAS.......RRI..
E3D7F8_GARV3/3-144LKL----MPLD.QYTS--KPVTLMEVVPGD..P.C.ETP.IWNDY...EDIIS....G..FDKRAANA......IGTL..
H8L1D3_FRAAD/1-131LVE----LVTERLTVA--RET.....ERLN........PAIWAHL...LAASG....T..QIT...........RSLC..
D6XZQ8_BACIE/1-128LAD----LEVEKMVVA--REI.....SEHN........PGLEEEL...IALGK....E................MNYI..
B8I9B2_CLOCE/3-141LKF----FPLD.PYVE--KPVALMEVVPGD..T.V.ETP.IWDVY...KEIIN....R..HEPQ.NNK......IENI..
RBSD_LARHH/1-130LAD----MQVERAVFA--NEI.....SQHN........PVIEHAA...TSMLD....G..KP............IGHV..
R7PPL8_9FIRM/1-133AKY----MQVERIYVA--KEM.....EIQN........PTQWKAL...HSVFP....V..TE............VEWVVL
R6HV06_9FIRM/3-139LKL----MPLD.TYVD--APVALMD.NNGD....G.DRPAVWDKY...EEIVK....A..NE..GDKN......FELM..
X2H1X6_9GAMM/1-138SHD----MQIERIILA--TEI.....KEKN........PQILGRI...LERIS....Q..LEQIQNNEIE....ITFF..
R5BKJ9_9FIRM/1-132KAN----MQAESIHIA--SPM.....EEMN........PHNYAVL...QELYP....Q..DR............YEWV.R
Q12BF4_POLSJ/3-143LQL----LPLD.DFVP--DAAWTMQVVGNA....TAI.PAPVAEF...ASALA....Q..AGER.PA........VSL..
B7GMC2_ANOFW/4-133VEE----LEIEAITIA--EEM.....QTHN........PVMYQEI...QKRFV....S..TT............QHTV..
T1G8C4_HELRO/6-150LKL----YPLD.PYVP--HPATVMRVVPNDPLLMSGQDPPIWQRY...IEIIK....K..YYA..SDD......VGHL..
Q161Y5_ROSDO/3-143LSV----YPID.TFVD--DAAARMEVVDEP....DTI.LPVMQEV...QQEVS....A..AGG...LT......MMSI..
G8LVS6_CLOCD/1-130LCE----LEVEEVTIA--SEM.....IEDN........PGLFKKI...NELFS....S..IK............INLV..
Q7UUK8_RHOBA/1-146LSA----IPVE.....--.AAMTMQTEADGPYALD.GDPPVWEEY...RKSFK....E...AGSK.VE......LQPL..
R7N665_9FIRM/3-144LQL----FPLD.TYVE--HPVNLMQVMPGD..A.V.ETP.IWEEY...SRIVR....Q..KDERGDAV......IGQI..
RBSD_ACIAC/1-129LSE----MQVERALVA--TEA.....VERA....GGALPGWAGAL....PVAP......................QTL..
E1RCT7_SPISS/3-141LRL----FPLD.TFVE--KPAGLLEVVAGD....S.TKPKRWDEF...RTIVK....R..HHTD.FTD......FEYI..
A3DCF4_CLOTH/11-139LKH----FSVEKLILS--QAT.....VDVS........PSRYKEY...LSLFD....E..SVP...........CEIV..
B9K2K2_AGRVS/3-138LTL----MPLD.DFVE--YPAGVMNA...P....GER.PSIYAEF...DALIE....R..AENR.KIE......LDLI..
L9KX68_TUPCH/6-148LKL----LPLD.TYVE--SPAAVMDLVPSDKERGL.QTP.VWKEY...ESILL....R..A.GC.RRS......LAKI..
F4H9V0_GALAU/3-142SPL----IELD.QYVD--APLIMMQAVAGD....Q.LDPSVEGRY...LVAMQ....T..AGESILPN......IKRI..
RBSD_GEOKA/1-130VDE----LEIEAIVLA--EEI.....KDQN........PDLYESI...RARMG....G..VP............VQFV..
I3TF87_THEC1/6-141LSN----VVVERAVLA--NEI.....KDRN........PEMHKKI...LELIE....A..NKASWKNFE.....LKYV..
F7ESI4_MONDO/5-149LKL----LPLD.TYEP--NSVMVMDVVESDKAKGL.QTPEVWQTF...RSLLS....Q..T.GF.RED......LGKM..
RBSD_CALS4/1-129LTE----LGVEKAYVA--REM.....IDKN........KKLYLEL...SEQFG....D..K.............LVII..
F6DR08_DESRL/1-131LSE----LIVERIILA--EEV.....KTIS........PEMHEEI...LKRFP....G..IS............VEYV..
D2BEN5_STRRD/1-128LAE----LVVEGATAA--REV.....RTAN........AECDALL...AARLP....G................LTYI..
E3QVQ1_COLGM/4-139TPL----LDLD.NSG.--VPVVMIEPAKND....T.YDASVEDDF...RFSLK....Y..D.....GE......VAKT..
W0PHP3_9BURK/3-141LSV----MPLD.SFVP--DPALRMEVVDDP....TQI.PEVQQDV...QALLD....A.......PLQ......LAPI..
D4H243_DENA2/1-131LSE----LQVEKYTLA--LEI.....KQKN........AHMEKSI...VKALE....S..ADS...........SEYV..
T2KGG9_9FLAO/4-141LPL----FMLD.SYDP--SPLIMMDAVPGD....T.LDANVQNSY...LNSIH....H..I.YPEAPE......IKHI..
K0KGS5_SACES/1-128LGE----LVVERALVA--TEL.....DERN........PSCAAAL...AGRLP....L................IDRV..
R7G568_9PROT/4-139LSL----IPLD.TYSD--ENFMLMQTTNGD......PTPEIWAKY...DKVAN....K..RDKNVRKA........EI..
B9K2A2_AGRVS/4-140LSV----LPID.DFVP--EAIFRSTVGKDR.....DALDPVHAEI...IACCA....V..HEP..KQP......VVPL..
B8CWP6_HALOH/1-138VEV----INIE.....--.EATVMAPSKGD.......KPAIFKEF...KRILS....S.......GTD......FNEI..
RBSD_PHOLL/1-138TQE----MQIEAAFLA--EEI.....IGHN........PLIHQLI...LTQIK....E..LEKQQGNSIT....VDYI..
A5G2I4_ACICJ/4-141LSV----LPVD.DFIP--LPLLTMQVVGDA....AAV.PPAVAEF...RQIAA....G..AGVG.AER......MGTL..
R7D1N9_9ACTN/3-144LKL----YPLD.QYVE--KPVTLMDVVPGD..D.C.ATP.IWDTY...AELIS....K..VDERGRDA......IGTI..
G8PKF7_PSEUV/7-141MPL----WELD.QYDP--ENVMMMAAVEGD....Q.LPDGLVDDY...QNAL...........PAGAQ......ITFV..
RBSD_DESRM/1-129LYE----MVVERVVIA--DEL......QVN........QSLVKSI...ADEVT....P..VS............LEVV..
Q128C2_POLSJ/3-144ISL----LPLA.EDVD--HPVAYMQVSGTE....APYCSGLQREV...LALLA....P...NLLAHQQ......AEAI..
H6NDH4_9BACL/4-141LQL----MPMD.TYAE--HPAALMEVVPGD..P.V.ETP.IWQRY...QELME....G...PLGGSPS......FEKL..
RBSD_CLONN/1-130LLE----QQVEEVIIA--HET.....KEVS........PETFENI...KKEIG....D..VK............ITFI..
D7C1Q2_STRBB/1-133LDE----LVIEGATAA--LEV.....REHN........PAATALL...EGLFP....ESA..............LELV..
RBSD_PROMH/1-138THE----MQVEAVMLA--IEI.....KNIN........PLLFSEI...TRYLH....L..LEQQQKKPIE....IIYV..
RBSD_LACPL/1-130LEE----LEVQRIYLA--EEI.....KVQN........PKMLTAI...KKRLP....D..TP............ITFI..
R5HCY6_9FIRM/3-140LPL----FPLD.QYDP--EHFVLMEVVPGD....T.VVPVIWEAY...KALLN....Y..YEP..DTE......VHKI..
A6WDZ4_KINRD/2-137LGA----VPVE.....--.AATVMASPDGA.......PVPAHDDY...ARLLG....E..RAA...........LSAV..
D8LIE6_ECTSI/5-148SKL----FPLD.TYTE--FPVQMMAAVPGD....E.LDASIEERF...STAVE....A..E.QPGMFK......VERV..
H2IYD3_RAHAC/1-138THE----MQVERAILA--EEI.....LTKN........PQLHEAL...LTQLT....Q..LEQHQGNTIA....LDYV..
FUCM_DANRE/5-147LKL----FPLD.TY.D--ESAAVMDLVPSDLLKGL.KVP.IWDQY...SELLK....Q..A.GS.DGN......MKPV..
R5F996_9CLOT/1-130LKY----IVVEGAVFA--EEA.....LTVT........PDFHKKA...LDLLP....Q..GLP...........VEYI..
R5A6P8_9CLOT/7-136LYF----FPVD.QAEA--DPVLMMESSLES.........GAFERY...QKLLS....K..EEPCVT........LKTV..
RBSD_PSELT/1-131LEE----LEIEKVLIA--EEI.....KMIS........PKYHQKL...LSIFP....K..NVQ...........IEYI..
A9KR29_CLOPH/4-144LTV----FPLD.TYVD--KPALLMEKVPGD..T.V.ETP.IWEEY...KKIVG....Q..FDERGEKA......IGSI..
W8VC37_YEREN/1-138VQE----MQVESAYLA--QEI.....IQNN........PQLHETL...LAQLT....Q..LEQHQGNQIA....LHYI..
E3D852_GARV3/1-130KAD----LVLESGIMA--KEA.....CNKK........PEEWVKE...SLGVP.....................LTYV..
R5WS75_9FIRM/4-144LSL----MPLD.EFVE--KPVLIMDKEPRH....AELECPVWGEF...KDIVA....K..YDERGAEA......CGMI..
F0LZN3_VIBFN/9-146LSE----SQIEGVVLA--EEF.....AKVS........PALHAAL...LDELK....A..EEARCNKSIA....IDYV..
C3Y6F8_BRAFL/4-145LQL----LPLK.KEYE--..AAVMDLVDADKTNGL.ETP.VWDTY...KDKLI....E..A.GN.NGE......LRKV..
RBSD_PSEPK/1-131LSE----LQVERHVLA--EEM.....QKVV........PPALVEIERLKGKLG....K................REWL..
K1XXH2_MARBU/3-141LSL----MPLD.DFVD--EAAWCMEVVGDP....SAD.LPVYKEF...RESML....K..HEGG.NFE......LKKL..
E3HAW5_ILYPC/1-134LDE----MQVEEAIIA--SEM.....KELS........PKLYTEL...LDLLNKKCQG..IK............IEEI..
E3PV76_CLOSD/1-132ASN----MVMEKVILA--EEI.....KENN........PEMLKKI...KEILS....D........KKIE....LEFV..
A5UTT7_ROSS1/1-136VDA----IPVE.....--.AAHVMVPDAGP.......EPSIFTEF...RALLP....Y........LS......LQPL..
W5M9Q7_LEPOC/5-148LKL----FPLD.TCVP--CPAAVMDVVDSDKQKGV.KVH.VWDVY...QELLH....Q..A.GS.DKP......LEKL..
D4LNS7_9FIRM/3-144LKL----FPLD.TYVE--HPVNLMEVMPGD..N.V.ETP.IWDTY...KEIVS....K..HDERGEKA......VGNI..
RBSD_NATTJ/1-134LSE----LQVEAVVLT--TET.....REVS........PQTYHKI...VDLLKQYNPD..IQ............ITEI..
B7VTM7_VIBTL/17-154LDE----SQIEGVVIA--EEF.....AKVS........PDHHAAL...IDLVK....T..EEARCGKSLS....ITYI..
R5XA15_9CLOT/1-132GDD----MKIEKIVLA--EEI.....KENN........PKVLAEI...NEYFA....G..QEI....E......VEFV..
R5XIE2_9FIRM/3-141LKL----IPLD.QYDP--EHFILMQKVPGD..DKA.DTS.AWDDY...TKILK....K..ESP..ESE......PTFC..
B9K575_AGRVS/3-146LSV----LPLD.TPLQ--NSAGRMEVMGAP....DDI.QPVQREV...QVEID....R..AEGK.PSP......MYGI..
Q982U4_RHILO/3-145LSL----YPLD.TFVD--DAAARMEIVGKP....DEI.PSVQKEV...QKEID....A..AEGK.SWP......MLPV..
M4R5G6_BIBTR/1-138LSE----MFVERVVLA--DEI.....KNAN........PLIEKQL...LAIMA....Q..LECQQGNAIQ....IDYL..
U3GZS3_9CORY/1-127LPH----IVAESVVVA--KEA.................PAAFGEE...LALYV....A..DAQ...........QEVV..
C6D5S1_PAESJ/1-130VAD----MTVEKVILA--EEI.....STAN........RDTLQFI...ERKFH....G..LE............IGRC..
RBSD_RHOBA/1-134LSE----LKVEEIVIA--SEI.....HDHN........QMLFEQM...MKLFE....A..HRM....APK....ITEV..
B1Y3G2_LEPCP/3-150IKL----LPLD.AAVE--QPVAYMQVSDTP....AGYRSRLQRDV...IAMLA....D..GGHARPEQ......CQAI..
B9J8G9_AGRRK/2-139LSV----LPID.DFVP--QAIFRATVRQDR.....DAIDPVHAEM...IEVCA....R..HVP..DIK......VVPL..
F6B8R0_DESCC/1-129MYE----LVVERAVVA--REL......ENN........PELRQAI...ADKVA....P..VE............LQTV..
RBSD_OCEIH/1-130KAD----MVIEGVTLA--REI.....KVDN........TENHKQI...QEVIN....D..IP............ITYV..
F8JJP4_STREN/1-128LAE----LVIEAATAA--TEV.....RQAN........PPTAALL...EDRFP....D................LALV..
C6WJV2_ACTMD/1-137LTA----VPVE.....--.AAHAMRPDEGG.......TPEVWADY...ERLLG....P.......DLP......LQPL..
RBSD_COPPD/1-130LSE----LCVEEAIIA--TEM.....KEKS........PETYAEL...LKILG....N..IP............IKEV..
G3T222_LOXAF/6-148VKL----LLLD.SYME--SPAAIMELVPSN..RTRGLQIPLWRHY...KYHLP....Q..AGC..TNS......LEKF..
K4R9V9_9ACTN/1-128LAE----LVVEGATAA--EEV.....REAN........PAASALL...DKHFP....K................PTLV..
RBSD_VIBPA/1-138LSE----SQIEGVIIA--EEF.....SDVS........PVLHEAL...LKELS....K..ESEETGKSIE....IKYV..
RBSD_BACCR/1-130ADD----MAIEKVTLA--EEV.....IINN........AEVNKEI...ERKLI....E..PA............FEYV..
A9UVL6_MONBE/5-149LQV----LPLD.T.TC--GPCALMEMMDMHKAAGW.KTP.IWDEY...KAAVK....E..AEGR.TID......FEEV..
G0AFB1_COLFT/7-135MTE----MQVEHHVLA--DEL.....PLHS........PQLAQQIEA.LGLVD.....................KRTL..
RBSD_ACTSZ/1-138TSE----MFVERAILA--SEI.....KEKN........PEILTAL...LAHLS....Q..LATKQGNQIP....VEFV..
E3E7K1_PAEPS/1-142AAD----MVIEKVTLA--EEI.....KQEN........EQALQYI...MRTFA....G..EQLEHSQIIEPTTVIEFC..
D4H283_DENA2/3-141LPL----FELD.AYSD--DPLVMITPVEGD....T.LDPEVETRF...RHIIE....K..H.QPDAPE......ITRI..
R6QNX9_9FIRM/3-144LSL----IPLD.TYTE--KPVALMEVVKGD..N.T.PTPAIWAEY...DKLLN....K..YEPE.HHD......IEMT..
G0GEK3_SPITZ/4-132RED----MVIEKVVFA--EEI.....KTRN........QKLHAKI...VERFP....D..TP............IAYV..
RBSD_BACLD/1-130ADE----MVVEKVTAA--QEI.....ESVN........PGQAAFL...KAEFS....N..QK............IDYI..
RBSD_STRU0/1-131LEH----VLVEKIILA--EEI.....KEQN........PEQLSQI...LRKLD....D..GVT...........VEYV..
RBSD_LACC3/1-129LSE----LQVQKVYLA--EEI.....KTEN........PEQLKQI...QQLI.....D..VP............IAFI..
A1WFB4_VEREI/3-144TSL----LPLA.EDIP--HPVAYMQVGGTE....PPYRSALQREA...VALLA....G...LGLDSGQ......AEGV..
G8PEY8_PEDCP/1-130LEE----LEVQKIYLA--EEI.....KTEN........PDQLVAI...KSLMP....N..VE............IEYV..
Q21X77_RHOFT/3-144TSV----LPLA.ADVA--HPVAFMQASGTE....PPALSALQREV...LALVE....P...ELRSGQS......AEPL..
H2FT88_OCESG/1-138LTE----LQLEAVVLA--EEI.....KTAS........PELHRRL...LAQMA....E..AAHDQGRDIA....VRYL..
F4HBP8_GALAU/1-138IEE----CFVERVVLA--EEI.....KTHN........QNIHNAL...LQRLS....Q..LEQQQNNHIQ....IDYV..
RBSD_CHRVO/1-131LAD----FQCERAVFA--IEC.....RQHN........PAVQDKA...ERMAQ....A..GAA...........LDFV..
RBSD_SYMTH/1-130LAE----LQVEAAVVA--RET.....AERN........PAVQEGL...TRLLG....G..VP............VTTV..
D9R029_CLOSW/1-130EKY----MVTEKAIFA--EEA.....LTVS........PGLHEKA...LGLLP....E..GIP...........VEYV..
E4U8X1_OCEP5/5-140LEL----MPLD.TFTD--ANVWYMD..NGE....A.AKPEIWKAF...DAVLA....D..SGE..DAR......VAAI..
F4LMF0_TREBD/1-130AAD----MRVESLVLA--EEI.....RTEN........GAVLARI...RELFP....D..TP............VEFV..
D4ZG03_SHEVD/1-138ATE----LQIESVVIA--EEM.....LVHN........PGMHTQL...LQLLD....E..IGQTQSQPIS....LSTV..
RBSD1_STRGG/1-130ADE----LVVEGVVRA--EDV.....PSHN........PRLDSWL...HERFS....G..AE............FTTR..
FUCM_HISS2/3-141TPL----FEFD.TYTE--APLIMMQAVEGD....S.LDPAVEQSY...LQTIK....S..A.VGNVPK......LARM..
D3UY14_XENBS/1-138VQE----VQVEAAILA--TEM.....IDHN........PQIHEQI...IKRIA....E..LETKQGNAIA....IEYV..
F4LLA6_TREBD/5-141LRL----MNLD.AYVS--SPVAMMAPVAGD....E.LDMSVESAY...RDVID....R..R.WPGTPP......VERI..
B4EJ62_BURCJ/3-146LSV----LPLD.TFVD--TPAWRMEVVGDA....AAV.PPVQREV...QAEID....R..AEGR.AVP......LAGI..
R6EA07_9FIRM/4-146LQL----MPLDVDYYE--HPVEYM..VPDKDAGITIERPKVWDDA...IAAVE....K..NGYS.VKQ......VGEI..
F4LXK2_TEPAE/1-137SNT----ITIE.....--.KAEVMATDDGQ.......EPLIFQEF...KKILG....T.......EAT......LYDL..
R6JSG5_9CLOT/7-146LQL----MPLD.GFVE--KPVTIMDKMEMH....RDLECPVWDEF...TDIVA....K..HDERGADA......VGFL..
K0T8W6_THAOC/9-148CSV----MPLD.FFHS--NQAIYMAPQEGV..EMPPAGKEVIDEA...SSTIR....R..LCG..DVE......IEPV..
R5C6U3_9FIRM/1-135HSV----CEIE.....--.KAQVMVPEDDR.......EPEIFGEF...RRELP....D........LE......LEEL..
G2TI29_BACCO/2-130CDD----MVIEKVIAA--EEV.....KDGN........PDQLAFL...NEQFP....N..L.............IAFV..
A1VQI0_POLNA/3-144NAL----LPLA.ADVA--HPVAFMQVSSTE....PPYLSALQREV...LDLLK....D...SLLPHQQ......AEPV..
R6G767_9FIRM/1-130LDE----VQVEGYYLA--HEI.....KEFN........PELEEYI...KAGLP....E..AE............VEYM..
B9K570_AGRVS/3-146LTL----FPLD.TFVE--APVKRMQVVGDP....GGQ.VPIFSAI...QRVVD....N..AEGR.PVK......IDAL..
D8MK90_ERWBE/1-138TEE----MQVESAIIA--EEI.....KSHN........PKLHSDL...LALLD....L..LQQHQGNTIS....IQYV..
RBSD_HISS2/1-138ISE----MFVEHAVVA--KEI.....REKN........PQIHDAL...LDSLR....K..LSEQQGNCIA....VEYV..
RBSD_LACJO/1-130LKE----LEVQKMYIA--EEI.....KTEN........PKQLEAI...KRTVP....N..VE............IEFI..
R6WBJ3_9FIRM/1-146LEE----LVIEGYIVS--EET.....KQVS........PEKYQEF...KNILD....L..EKNKGNAMN.....EETI..
W0IZS2_9BACT/3-141LPL----LELD.SYVP--DPVVMMAAVEGD....A.LDPAVEAAY...LAPLR....K..H.APERAT......ITRI..
Q7MJI4_VIBVY/14-152IPL----FELD.QYVP--KPLVMMQAVSGD....Q.LDPNVERKY...LQAMV....Q..A.NVASQQ......IERV..
RBSD_VIBVY/1-138LSE----SQIEGAIVA--TEF.....AEVS........PELYQAL...VAELQ....C..EEEKTGKVLS....LTHV..
RBSD_EXIS2/1-128ADD----MAVEQVTLA--TEI.....KAAN........PVALEAV...MKLDV....P................QDYV..
F1N1P7_BOVIN/6-148LQL----LPLD.TYVQ--SPAMVMELVPSDRKSGL.LTP.VWTSY...QSILS....R..A.GY.EFS......LGMV..
R5LEZ8_9SPIR/1-130MKD----IKIEHIILT--EEI.....KDNN........KKVYNKI...LSMFK....D..IS............KEYI..
D7CRD7_TRURR/4-141LPL----FVLD.TYVP--APLVMMAAVPGD....T.LDPNVEASF...RAVVD....R..F.YPDTPA......VARI..
K0I412_9BURK/1-128LEE----MQVEKAVIA--TEA.....MERN....GGQLPAWCQ.....LPVTP......................QAV..
G8QUN1_SPHPG/3-140LKL----FPLD.IYSD--N.AFLMEKVPGD..K.V.ETP.IWKEY...ETLGK....Q..GDPN.FKG......FHFI..
E4T6S2_PALPW/3-141LPL----FELD.EYVP--HPLVMMAAVPGD....E.LDPKVEESY...LKSIR....I..S.NPDVPA......IERI..
RBSD1_RUBXD/1-128LEE----LVVEEAVAA--REV.....EGAN........PDCHALL...ASRLP....E................LKLV..
D6GRT6_FILAD/1-130LSE----LCVEKYIVA--EEL.....HFQN........AAMEQYI...KKTMG....S..IP............SEVV..
R6YDK3_9FIRM/3-141LSL----MPLD.SYVE--HPTTFMAVLPND....P.YVPEIWDTY...RAIGA....K..HEEQ.GLR......EEAI..
FUCM_HAEPS/3-141TPL----FEYD.QYVE--RPLAMMQAVHGD....S.LDLAVEERY...LAAIA....K..I.NGKAPL......VERV..
H0W3P3_CAVPO/6-144LKL----LPLD.....--SPAVVMKLVPSDQERGL.RTT.VWEDY...EFLLL....Q..A.GY.TST......LAKI..
C3Y6F6_BRAFL/5-148LEL----LPLD.TYVE--SPAAVMDLVPGDKEKGL.KTP.VWDTY...RGLLK....E..A.GS.TTP......LEQV..
V4IC28_9ACTN/1-128LAE----LVVEGATAA--EEV.....RTAA........PATAGLL...AERLP....R................LAYV..
M9X3I0_MANHA/3-141SAL----FEFD.QYVE--APLAMMQAVKGD....T.LDPSVEERY...LNAIK....K..V.NGTAPK......IERV..
R6JZZ1_9CLOT/4-144LSL----FPLD.TYVE--HPVCLMSVTDGD..T.V.ETP.IWDQY...MTLVE....A..CDSRGRSA......IGHI..
RBSD_PSESM/1-133LSE----MQVESHVLA--REM.....ADIK........PPALQII...ESLNL....DDQLGQ...........QRWI..
RBSD_THEMA/1-134LRE----LKVERIILA--KEM.....DEKS........IQTKQEL...LKLIE....K..MNGPVE........VVTV..
K0J4C7_AMPXN/1-128HEE----MEIEQITLA--EEI.....KEQN........PSIHESL...QKLNY....P................AAYV..
D9SWA7_CLOC7/3-144LTV----FPLD.TYID--KPVNLMEVVPGD..H.V.ETP.IWDTY...KEIVK....K..HDSRGAEA......VGNI..
I1G0R8_AMPQE/5-149TSL----LPLD.TYVP--RPAMLMELVHNDKKAGL.KTP.IWEQY...KSILQ....Q..AEGK.DIG......FEMI..
Q161J5_ROSDO/4-141LSV----MPLD.TYVD--APARSMQVVGDP....EAV.PDIVAEF...QRIID....E..VADH.PAQ......IQSV..
RBSD_BACSU/1-130AEE----MAVEKVIAA--AEI.....KASN........QENAKFL...ENLFS....E..QE............IEYL..
RBSD_EDWI9/1-138TAE----MQVERAVLA--QEM.....VEAN........PDIHRQL...VTWLQ....R..LAQTQGNAIH....IDYV..
G8NVC3_GRAMM/3-141LSV----LPLE.RNDP--EGCWRMIAKSDP.....ANEQPIFLEF...QQAIA....E..FEDV.EMK......LGTL..
RBSD_STAA8/1-133LEE----MEIQKIYLA--EEI.....KEHN........PTQLQQI...KQLIS....S..EIE...........IIFI..
R5BRR7_9FIRM/1-130LEE----VEVEFYTLA--EEI.....TENN........PKLLCYI...REKLQ....G..VD............SEMV..
Q28QH5_JANSC/3-146LSV----LPLD.TFVD--DFAARMEVVDSP....DEI.PDVQGEV...QEQID....R..AEGR.PRP......MVSV..
B5HI15_STRPR/1-129LDE----LVIESATAA--LEV.....HDAN........PPAARLL...AERLP....V................LDFV..
D3E5A9_GEOS4/3-141LPL----FPLD.TYVE--SPVALMAVTPGDT...V.KTP.IWEDY...RQIVQ....Q..FHAV.PVE......FDEM..
M4AGZ9_XIPMA/5-148LKL----LPLD.TYVD--RPAAVMDLVKSDKQRRL.AVP.VWDTY...TQLLS....Q..A.GS.QSS......LEKM..
C4LA69_TOLAT/1-138TAE----MQIERVIMA--HEF.....AETS........PALHIEL...VAHLE....H..LAQEQGRAIS....FDYV..
W0HY81_9GAMM/5-139APL----FALD.SYAP--.PVVMMAPVGGD....T.LDIKVELRY...RQALF....G..A..GDGVA......VERI..
W5XRT5_9CORY/1-129MAE----LVVEGATVA--SES.................PAEFVSLVQETGKLA....D..TA............VTYI..
Q985Q0_RHILO/4-140LSV----LPVD.DAVP--EALFRASVKGNP.....SIADPVHHEI...EAICA....R..RAP..GRK......VVAL..
A9CIE0_AGRFC/3-146LSV----LPLD.TPLQ--PSVGRMEVMGAP....DQL.EPVQVEV...QQEID....A..AEGK.SAP......MYGI..
FUCM_HAEIN/3-141TPL----FEFD.AYVD--APLLMMKAVEGD....S.LDPNVETRY...LNAIE....S..A.VGFTPN......LTCL..
G0GEL8_SPITZ/4-141LSL----IPID.TYVS--DPVVMMQPVEGD....S.YDPSLFETY...WEVLV....R..R.WPETPP......ITRL..
V5XTJ3_ENTMU/1-130LSE----LEVQRIYLA--EEI.....KKEN........PDILLEI...QKEMP....E..TP............ITFI..
Q15PP4_PSEA6/1-136LEV----CPIQ.....--.GAIVMEKPPEA.......NAEIHTAY...QALLG....D........VT......WEAM..
Q8DN18_STRR6/4-140LYL----MPLD.SYVD--SSIQFMNVVSGD......DIPKIWGTY...RQMIE....G..HGTD.LKT......ITYL..
E0SDT7_DICD3/1-138TAE----MQVEAAILA--QEI.....IEKN........TQLHDAL...LKQLA....Q..LEQHQGNTIS....LHYV..
B2UPN2_AKKM8/3-136IPL----FELD.AYAT--.PVIMMAPVPGD....S.LDPAVEAKY...RKALN....Y.......DGE......IEQM..
RBSD_STRA5/1-131LEN----ILVEKVILA--EEI.....KEAN........PDQLSRL...LAKLD....N..SVS...........IEYV..
D8J0Y3_HERSS/3-146LSV----LPLD.NAVE--QPVRRMEIMGEP....ATI.PPVQQEL...QQEVN....Q..AEGR.ARP......LGSI..
RBSD_PSYIN/1-137LSE----MQITGVLLA--SEF.....KQVS........PDLHRAL...IELVE....Q..EKL.AGSRIE....LIYI..
RBSD_AERHH/1-138LTD----LVVEKVIMA--SEI.....KQIS........PAAHQAL...VDQLE....A..HAAAQGKPIT....IEYC..
R7CST6_9FIRM/1-133AKN----MQIEKIYLA--PET.....ASKN........PKQWEAL...KEVFP....E..DK............VEWVML
E6K2M3_PARDN/1-130KGE----LVLENGLMA--SEA.....QGTE........PEEWVTS...RFDLP.....................VSYV..
F8HZV5_WEIKK/1-133LSE----MKIQKAYLA--EEI.....KTDN........PEQFAAI...QALLD....D..DVE...........VVFI..
H5WTN9_9BURK/3-145LSL----LPLD.EAVA--RPVAYMHVSGKP....EGWQSALQRGV...IGSLV....Q..AGHARADQ......CQAT..
Q2K1E4_RHIEC/3-146LSV----LPLD.TPIQ--PSVGRMEVIGKP....DEI.PPIQQEV...QAIVD....R..AEGK.PSP......MYPV..
C6CWG2_PAESJ/4-141MQL----FPLD.QYVE--KPAALMQVIPGD..P.A.ETP.IWSEY...KAIIT....Q...RSGLQEP......FEEV..
R7FCF1_9FIRM/3-141MQF----FPLD.AYAK--EPVALMEVVPGD..P.A..APVIWDVY...RDIIA....A..AEPE.RCH......FEFV..
RBSD2_RUBXD/1-131NEE----FITEKVVIA--EEM.....AEFN........PPLHGWL...QKHFS....G..VE............FERR..
E1SQZ3_FERBD/1-138AGD----LQIESVVLA--EEM.....QSHS........PALLAQL...TTMLE....Q..LGQAQGQAIA....IEWV..
F0SXR5_SYNGF/4-142LKL----FPLD.HLVD--APMRLMAVEEGDQYLGI...PEIWNRF...QKVAE....T..YQY..GVK......MLQI..
I2F8D7_9BACT/1-132LEE----LEVEKVIFS--EEM.....KTVS........PKCLEET...LKHLP....E..GIE...........VEFV..
K8E678_CARML/1-130LED----MVVEEMVLA--KEI.....GVSN........QKQLKQI...KELAP....M..IP............IHYL..
RBSD_BACP2/1-129LQE----MAVEHITVA--SEI.....QEAN........ERDHLFL...KKAFS....K..P.............LHDV..
RBSD_CLOPE/1-130LEE----LQVEEVLIA--KET.....EKVS........PELFIEI...KEIIK....D..TK............ITFI..
RBSD_HELMI/1-129LSE----MVVENATVA--EEL......KPN........EQIIEAL...AGRLK....P..VQ............LHFI..
C8WRM8_ALIAD/1-129LTE----LVVEDFIVA--NEL.....AIRG........SGVVDHLRERAGVLG......................KFI..
RBSD_DESAD/1-138LME----MELESVELA--EEF.....KDVS........SDRHDEL...ISVLE....M..ESAQRGKDIP....VDYV..
A8AMU2_CITK8/1-137LGY----INVE.....--.KATLMTSPAEF.......DNTIEREY...RGLLS....E................MTELAH
D4JSL9_9FIRM/3-144LTL----FPLD.TYVE--KPVNLMQVMPGD..T.A.KTP.IWDEY...KAIVA....K..HDERGNNA......IGQI..
D7C7T7_STRBB/3-141LGL----LPLD.TFVA--EPIARMAVVGDA....AAE.PPVQTDF...VAAAE....E..ASGR.PLA......VETV..
U5MT14_CLOSA/1-130LLE----LQIEEVIIA--SEL.....ENEN........LSLYEQI...KKEIE....N..VK............ITVI..
G9WJ23_9LACT/1-131LQE----LEVQRAYVA--LEM.....KTNN........PEGLKSL...IDILG....S..QVE...........IVFI..
RBSD_BACHD/1-128LAD----MEVEGLIAA--EEV.....KEQN........PAVHRAL...TGTNI....P................IHYL..
L0DPF0_SINAD/1-130AEE----LVIESITVA--SEI.....TEFS........PKLYQEI...LKIVG....D..VD............VDEI..
E8N1H2_ANATU/1-130LSE----MQVEKVIVA--KET.....GEVS........PQVLAEL...KRLLP....D..TP............FIEV..
M4UKW9_9GAMM/1-133LSE----MQITGVLLA--SEF.....KTVS........PQLHQAL...LDLLA....E..HE.....NVD....VQYI..
RBSD_STAEQ/1-133LTE----MEIQKIYLA--EEI.....KTAN........AQQLKAI...KKLIN....D..DVE...........IKFI..
D1BQI4_VEIPT/1-132AKH----MKSEAIHVA--TEI.....KENN........PKAYAFL...ESTFP....S..EQ............YEWI.E
M9WWK1_MANHA/1-138VSE----LFVERVLLA--EEI.....KHKN........PQVLAAL...LERLT....Q..LEQTQQNKIQ....IDYV..
R5TNK7_9FIRM/3-146LQV----FPLD.TYVE--NPVNLMQLMPDDVGK.V.ETP.IWDTY...KEIVK....K..HDDRGEAA......IGNI..
C4LFS0_TOLAT/3-146LEL----MPLD.NFVP--TPVGWMDPVDQP.....GTILSVHHDV...LAACK....K..AENA.EVG......HYVI..
I4D7C5_DESAJ/1-129LTE----LSVERLTVA--QEL.....QGAH........PDLFAKI...KGATD....A..P.............IDLV..
F6AIR2_PSEF1/1-133LSE----MQVQGHLLA--RET.....LEVA........PVGLEAI...ESLTA....AGELGE...........RQLV..
G8MES4_9BURK/3-146LSV----LPLD.TFVD--HPAERMEVVGDA....SAQ.PAVQREA...QHEVD....A..AEGR.AVP......FASV..
I0GTY5_SELRL/1-130LTE----AAVEGCYLA--EEI.....EEHN........PKLHGYI...KEKLG....D..VE............YEYM..
Q1R0M9_CHRSD/1-143SQS----VAVE.....--.AITFMATAEGK.......ASETVVDC...QQRLA....GHRHGNGQTIA......WSGL..
I6WS14_PROPF/4-143KRT----VPIE.....--.RAGLMVPAADAVGIEAPEVIPAHDEY...RAALP....G........VA......FDEI..
R6J451_9CLOT/3-144LAL----LPLD.AYVD--APVSLMEVVPGD..T.C.GTPKIWDKY...KDILH....R..HEPE.HSG......IQMV..
I2F732_9BACT/1-146LEE----LEIEKVIIA--DET.....RSVS........PEIYSQL...KEIVS....K..VKNKGNDII.....EENI..
RBSD_LACBA/1-130LSE----LAVQKIYLA--EEI.....KTQN........PEQLAAI...QALLP....D..VE............VAFV..
F7YRL9_VIBA7/1-138LSE----SQIEGVIIA--EEF.....AQVS........PEHHKAL...LAELK....A..EEELCEKAIA....VTYL..
R5FD09_9CLOT/1-137SND----MKIEAVVLA--EEI.....KEQN........PQILEEI...QELFA....S..LETGFKPEK.....VEFV..
RBSD2_STRGG/1-128LDE----LVVEGATAA--EEI.....RDAN........PDAAALL...DVHFP....W................LEAV..
C9Z854_STRSW/1-128LDE----IVVEHSWVT--DKI.....REVN........PAVHTGL...RSFGL....D................PEPI..
A4YW09_BRASO/3-146LSV----LPLD.TFID--DAAVRMEVVGHP....DEV.TPVQQEV...QAAID....R..AEGK.PWP......LVGV..
RBSD_PHOPR/1-138LGE----MQIEGVVMA--EEF.....AQVS........PDLHQAL...IALIR....N..EELLCGKKIT....LSYV..
U4KB26_9VIBR/1-138LSE----LQIEGVVIA--KEF.....ADVS........PKHHQAL...LAELK....K..EEGSSGKSIA....VNYV..
RBSD_VIBF1/1-138LTE----MQIEGVIVA--EEF.....KTVS........PQMHDEL...MTLIA....A..EEAQCSKSIT....VSYI..
B9JAZ3_AGRRK/3-146LSL----MPLD.TFID--DAATRMEVVGAP....EEM.PKVQHEV...QAAID....R..AEGK.HWP......LVPV..
I0IEV2_PHYMF/1-147CDA----VPVE.....--.AVAVMEPEREGAYAMT.GDPPVWAHY...RRVLA....E..RAGFT.GG......FDAL..
F8F0A5_TRECH/1-130RED----MVVEKITLA--EEI.....KIYN........AEMYNKI...KNRFP....N..VV............IQFI..
X4QXA5_9ACTO/3-139LAL----FPLD.RYSQ--WQIGLMQTVGDD......PRPPVWETY...ADVIA....R..HEG..SYE......TRYF..
I0HQ21_RUBGI/1-130LGE----MQVESTWLA--QES.....LDRA....GGACPGWYSRH...LALTP......................RTL..
RBSD_LACRD/1-130LKE----MKVQKIYLA--EEI.....KDQN........PAQLENI...KKALP....D..VE............VAFM..
F2F275_SOLSS/1-128LED----LKVEHSYLA--EEI.....KTAN........ETIHSSI...LQKME....P................VTYI..
W8T760_EUBAC/1-134LLE----LKVEEIVVA--EEF.....ETAS........PVVYERL...LEAVE....K..L....NGAVK....ITKL..
E3DLS9_HALPG/1-130LDD----LVVEKAILA--AEI.....KEKS........PELEAEI...IALLP....N..IE............IEYI..
F0SHV6_RUBBR/1-146LTA----IPID.....--.VVNTMGIPADDPYAGQ.GDPPVWAEY...RQILK....D...AGSE.VE......LEPI..
T0K591_COLGC/4-141SPL----LELD.NYGV--VPVIMMEVVKGD....T.FDASVESDF...RKSLK....Y..D.....ME......IEKL..
RBSD_KOSOT/1-131REE----LIIEKIILA--KEI.....VDKN........PEMHNAI...LKLFS....D..AA............VDYV..
F2UJC5_SALR5/5-149LKL----LPLD.E.TS--CPCALMDLMPEHKAAGW.QTP.IWEQY...RAIVA....E..NEKR.TVD......FELV..
D5AN92_RHOCB/3-141LSV----MPLD.DFVP--EAAFHMEVVGDP....AAE.QPIFADF...RAILA....R..HEGP.AAK......LGRV..
Q896U5_CLOTE/1-137VES----INIE.....--.RAQVMTPGEGE.......EPTIFNEF...REILS....N.......EIQ......LDEL..
R6DJZ8_9FIRM/3-139LKL----MPLD.TYVD--APVSLMD..NGD..P.D.NRPEIWATY...KEIVE....K..NE..GDKN......IGLV..
D2Q2A4_KRIFD/1-136LDV----VPVE.....--.AARVMATATGE.......EPDIYSRF...RELLP....G........TT......LLPL..
B2IKF4_BEII9/3-143LSL----MPLD.RAVD--EAVFRPVPAGDA..KGLEATAALHSEY...ETLVA....K..HDP..GIK......VVPL..
RBSD_STACT/1-133VTE----MEIQKIYLA--EEI.....KMHN........PDQLKAI...KGLIA....E..DVE...........IEFI..
RBSD_CLOBB/1-130LLE----LQIEEVILA--KET.....EAVS........PDLYEEI...KEVIG....D..VK............ITFI..
R6AC27_9FIRM/1-133AKY----MEIQKVYIA--PET.....EKEN........PEQWKAL...HEVFP....E..DA............VEWVML
J9YYK7_9PROT/4-141LSV----FPLD.SFIE--SPIQRMEIDGNP....DEL.NEVHKEL...MQTTA....E..VAGD.HWK......ISSI..
G4L5H4_TETHN/1-130LEE----LEVQKIYLA--EEI.....KSEN........PDMLQQI...QRHLP....Q..TA............IEFI..
D2R7C7_PIRSD/1-146LSA----VPID.....--.EINTMNYPKDDPYTLD.SDPPVWNEY...RQTLA....K...LGMN.LE......LKPI..
V5WH75_9SPIO/1-130LEE----LEVERAVLA--EEI.....REKS........PELHHAI...LSILD....D..IP............VSYI..
C9R6M5_AGGAD/1-138VSE----IFVERVLLA--QKI.....QEKS........PEILTAL...LARLN....K..LEQQQGNRIA....IEYV..
L7VKA3_CLOSH/3-144LQL----FPLD.TYVD--HPVQLMQVVPGD..N.V.ETP.IWDEY...IKIIE....K..FDGRGGNA......ISHL..
R5TTQ0_9FIRM/1-136GAD----MKVEKIILA--EEM.....KLQN........PEILRQI...EQFFA....K..YETGFKPE......IQFV..
A6VWH0_MARMS/3-144LSV----LPLD.TFVD--QPVTRMQVVGED....ESVMPEVQQEF...AVELK....A..ADSD.NAE......MGSL..
I2BEN0_SHIBC/1-138TSE----MQVESAILA--SEI.....QHMN........PQLHADV...LSRIE....Q..LQQHQGNTIT....IHYL..
RBSD_LACSS/1-130LSE----LEVQKVYLA--NEI.....KTAN........PEQLAAI...KALIG....E..TP............IEFI..
R7III7_9FIRM/3-140LPL----FPLD.QYDE--SNFVLMSVVPGD....P.TVPVIWDEY...RATLT....A..YEP..DAK......IQTI..
RBSD_EXISA/1-128ESD----LVVERITIA--EEI.....LTHN........STIADSL...KERYT....S................IDMC..
Q3Y2W3_ENTFC/1-130LEE----LEVQSIELA--EEI.....KTMN........PEILEKI...KLLLP....D..TP............ISFI..
Q7CL41_YERPE/1-130RKE----IFVEEVRFA--SEV.....RDCH........PQLYRDV...QTLYT....G..SGAE..........FQAA..
C9YX65_STRSW/1-137LRA----IPIE.....--.SAHVMVPPKGE......PEPPAIAEY...RDRLA....P........VP......VETL..
E8QWG2_ISOPI/1-131AEE----LVIESVVVA--HEI.....HDAN........PRLFHEI...RRVIE....P..GVE...........LEEV..
R5ERS4_9GAMM/1-132DAE----AKFQKVTIA--SEA.....KEAN........PAFYQKL...HEWAK....L..NGVE..........VVEV..
R6LVN6_9FIRM/1-130LDE----AEIEQYTIA--NEI.....EEKN........PELLAYI...REKLP....N..AE............WNMV..
F0RTX8_SPHGB/3-140LQL----YPLD.SYAP--N.AFLMEKVKGD..T.V.QTP.IWASY...ETIAK....A..GDPA.FKG......FEQI..
R5A403_9CLOT/3-143LTL----LPLD.KYVE--QPAALMEVVPGD..P.V..IPTIWEEY...RTLLE....K..NGED.PQA......VEMM..
R6ND69_9CLOT/3-139LKL----MPLD.TYVE--APVALMD..NGD..P.D.NCPPIWSAY...KATVT....A..NE..GDKE......FELV..
RBSD_ACTP2/1-138LTE----LFVERILLA--EEI.....KQAN........PTIEQQL...LEMIN....K..LAQTQGRQIE....IEYV..
RBSD_LACAC/1-130LKE----LQVQKIYVA--DEI.....KDSN........PKQLENI...KRILP....D..VE............IKFI..
RBSD_CROS8/1-138TQE----MQVEAAILA--EEI.....KQHN........PQLHETL...LGQIE....R..LQQHQGNTIT....VRYV..
J7TDW0_MORMO/1-138TQE----MQVEAALMA--EDI.....QTHN........SELHDAI...VAHLK....A..LELQQGNVIQ....IQYV..
FUCM_KLEP7/3-139IPL----FELD.SYAP--.PVVMMAAVEGD....A.LDPTVEQRY...RQALS....T..Q.AP.CPD......IVRI..
RBSD_BACSK/1-128LAD----MEVELMMAA--TEV.....RTES........PSIHQEL...ENRQI....S................IRYL..
I0JTG6_HALH3/1-130TGD----MKIERATLA--EEI.....QTNN........PTVHQQV...SDCLA....D..IP............KHYT..
H8H116_DEIGI/1-133LTE----LVVEGATVA--AET.....RQRS........PEWYAGL...REVLG....E..VLEEA.........PAEL..
E1R2M1_SPISS/1-129VSD----FIYERVIVA--EEQ.....KENN........PNLYNAI...EKLCD....R..CN............VETI..
F0RJP3_DEIPM/1-130LGE----LVVETVSLA--QET.....RDHS........PGWYSEL...RGVLP....D..VP............VHEI..
F5YAI5_TREAZ/4-141LKL----INLD.YAVD--YPVIMMAAHGSD....S.LDPAVEISY...RRVVD....K..I.WPGTPA......TERI..
D5E272_BACMQ/1-128LED----MATEKIVIA--SEM.....KERN........QKAYELM...EKQNI....L................VEEV..
F9VK47_ARTSS/1-130LTE----LEIEEIIIA--KET.....EETS........PKIFNEI...KNLIG....N..AK............ITFV..
RBSD_HAEIN/1-138TNE----MYVERVVIA--EEI.....KEKN........PEILTAL...LTQLQ....K..LESHQGNQIQ....VEFV..
N0AWL8_9BACI/1-130FQD----MAVEKLTLA--NEI.....KEFN........PNVMSEV...LALTN....G..IP............AQYM..
W0LD73_9GAMM/1-138TQE----MQVENAILA--EEI.....VKQN........PLLHAAL...LAQLQ....Q..LGQHQGNTIS....VCYI..
RBSD_LACLA/1-131LEN----ILVEKVYLA--EEI.....KENN........PEQLAIL...LTKLS....A..DVE...........IVFV..
Q2YQE7_BRUA2/3-138LSL----LPLD.DFVD--RPAAVMQA...P....NEM.PAIFKEF...EAVIE....K..AEGR.KIP......VEPI..
F4GKH9_SPHCD/3-139LQL----YPLD.KYAD--N.VIMMEVPATD..P.V.ETP.IWETY...RKIAL....E...DPH.FKG......FVFE..
RBSD_PSEF5/1-133LSE----MQVERHVLA--EEI.....LLKQ........PTPLAAL...EGMTA....GGELGQ...........RQLM..
K0I3R8_9BURK/3-144ASV----LPLA.QDVP--HPVAYMQVGGTE....VPYRSALQRET...MDVLA....R...EGVASEQ......AEGV..
W0HUD8_9GAMM/1-137LTY----INVE.....--.KATLMASPDDF.......ENTIEKEY...QRLLP....F................ETEYCW
F0YHV1_AURAN/34-177ASV----LPVD.LFVD--DPLKHMSPSPGN..ELPALGKEVHDDA...RAAVG....T..YC...DAD......WQPV..
RBSD_CLOTE/1-130MME----LQVEEVQIA--NET.....QDLS........SELFKEI...KKQLG....H..AK............ITFI..
Q13FK6_BURXL/3-146LSV----LPLD.TFVD--APALRMEVVGEP....HTL.PAVQREA...QAEVN....A..AEGR.DVP......FASI..
D3E6C1_GEOS4/1-130ADD----MVVEKIVIA--EEM.....KREN........KETLHYI...EEQFQ....D..CE............IEAC..
Q89HT9_BRADU/3-146MSV----YPLD.DFDP--DPVRVMMPVDDP.....DRVPDVQRAV...LAEIE....R..AAGR.TVA......PGKL..

PF04705

J7LIM1_NOCAA/1-114------FK-GERK-------P---KTFGIAR--VPR--PSRLSDIARR---------
J7KYH7_NOCAA/1-114------FK-GERK-------A---KAFGLAR--VPR--PAKFHDIENR---------
X5DQN6_9CORY/7-116------FG-DDKR-------S---RIFALAQ--SPA--PGELSDFSD.---------
D5UK31_CELFN/3-112------FR-GERK-------P---DVVGVAR--TPR--PTSLADLAGR---------

PF08032

Q8CXU2_LEPIN/36-110------SY.RDRP-------D---GLIATAF--FFE--TG-----------------
O96263_PLAF7/86-167------VG.GFPH-------N---DIIMKTH--.YR--YM-----------------
Q6BTY4_DEBHA/128-204------SD.NGVH-------N---GIVLETK--PLE--LP-----------------
MRM3_DROME/141-217------SS.LVTP-------P---GLMAIFD--RPS--DK-----------------
RLMB_VIBCH/5-81------AE.GANH-------Q---GLIARVK--PAR--QL-----------------
Q92QI6_RHIME/59-133------LGPDAIH-------Q---GVMLETQ--PLP--HR-----------------
Q7MBB6_GLOVI/92-168------TA.GGNH-------Q---GVAAQAA--AHP--YV-----------------
RLMB_RALSO/6-82------AG.TDRH-------Q---GVVAKAE--ALS--LA-----------------
Y479_MYCPA/69-145------TG.NHLH-------Q---GIALQVP--PYI--YA-----------------
Q7U7F6_SYNPX/177-253------TG.GSVH-------Q---GIALQTA--AAE--TI-----------------
Q8E1Z2_STRA5/15-89------TN.GGVH-------Q---GFVLKVS--EFA--YA-----------------
Q8D323_WIGBR/4-80------TN.NKKH-------Q---GIVAYIK--NSK--IL-----------------
Q6MS22_MYCMS/5-77------LETQTQH-------Q---GIIAQIK--DFN--YT-----------------
Q97EF9_CLOAB/9-84------SN.GGVH-------Q---GVIAIST--PYN--YC-----------------
Q6C040_YARLI/179-258------TK.HAIH-------N---GVALVTK--PLE--LD-----------------
Q8DK28_THEEB/45-121------CQ.RGRH-------Q---GIAIQVA--AYN--YW-----------------
Q6ADI2_LEIXX/89-166------AGRDAVH-------Q---GVALKVP--PYE--YV-----------------
Q890M7_CLOTE/5-80------SE.GENH-------Q---GVAAYTT--PYK--YY-----------------
Q6FPX7_CANGA/108-186------TK.SAVH-------N---NMVLECK--PLS--IP-----------------
Q7NAH8_MYCGA/23-94------YRDLPNH-------Q---GFVAEID--GSS--LT-----------------
Q9A907_CAUCR/33-109------SR.RDNP-------Q---AVVAVFK--QVF--TP-----------------
RLMB_SHEON/6-82------AE.STQH-------Q---GIVARVK--AAK--IL-----------------
Q98N81_RHILO/2-76------TGSDAVH-------Q---GVLIEAE--PLK--PK-----------------
MRM1_SCHPO/33-108------TA.CRPH-------N---GVVLEAS--SLN--VP-----------------
Q7VFD1_HELHP/2-74------AH.GGNH-------Q---GILASII--PPS--PL-----------------
Q8A814_BACTN/7-81------T..RKNH-------Q---GVVAFIS--SVT--YQ-----------------
Q6YQX1_ONYPE/823-895------TK.QKTH-------Q---GVAANVC--DYT--FY-----------------
Q9PQG4_UREPA/33-108------SV.NIEP-------S---PILAVVK--IKQ--EM-----------------
O25279_HELPY/4-76------AK.GGNH-------Q---GVLAKVE--LPL--AV-----------------
RLMB_COXBU/6-81------S..NEKH-------Q---GIVADCE--EVE--NL-----------------
Q6AGD8_LEIXX/38-113------AD.TVTP-------Q---GFVAVAR--QFP--TS-----------------
Q9K894_BACHD/31-100------TE.TKTP-------Q---GIAAICH--IPD--EP-----------------
Y1673_SYNY3/38-112------AS.TVNP-------D---GVVATLT--MDQ--FW-----------------
Q9CJY1_PASMU/125-200------SG.TAHH-------G---GICMLVK--KAR--PF-----------------
Q8Z0C3_NOSS1/42-116------AT.TVQP-------D---GVVATAK--RSE--QQ-----------------
Q7MTU3_PORGI/6-80------T..SKNH-------Q---GVVAILS--AIE--YT-----------------
RLMB_NITEU/6-82------TG.TTRH-------Q---GVAAHVT--KLR--RY-----------------
Q8XJ72_CLOPE/31-104------CS.TENP-------Q---GIVGVIN--MQN--KE-----------------
YACO_BACSU/7-81------V..TGQH-------Q---GVVAQVA--AYE--YA-----------------
Q74L24_LACJO/8-85------VN.HENH-------Q---GLVLTVA--PFE--YA-----------------
Q891T6_CLOTE/31-105------SG.TENS-------Q---GILAIVN--MKE--VL-----------------
Q6MIZ9_BDEBA/55-130------EKFGPSQ-------Q---GAAIFVD--GAP--EF-----------------
O84408_CHLTR/29-103------SF.KENP-------E---NFIAVFE--KKE--LS-----------------
RLMB_NEIMB/6-82------SK.GARH-------Q---GVVGFID--ASK--NH-----------------
RLMB_ACIAD/6-82------AG.LPFH-------Q---GVVAAVR--PHP--VL-----------------
Q6CLR7_KLULA/125-198------TN.YAVH-------N---NVVLECK--PLQ--PP-----------------
Q8YXQ3_NOSS1/83-159------TD.QANH-------Q---GIAAQIA--PYS--YI-----------------
Q9RWC1_DEIRA/2-76------VG.TTQH-------Q---GVVAEVE--ELQ--WA-----------------
Q9X263_THEMA/2-78------SG.TKKH-------Q---GVVFDIG--EYR--YS-----------------
Q8KBA1_CHLTE/33-106------AQTTSP.-------Q---GVVAAFR--KPE--SG-----------------
Q81L29_BACAN/31-99------RE.TETT-------Q---GVFAVCE--KHE--SE-----------------
Q9L0Q5_STRCO/72-149------TN.GLNH-------Q---GLVLQVP--PYE--YA-----------------
Q6NFC4_CORDI/71-147------TG.NGMH-------Q---GIGLQIP--PYK--YT-----------------
O83093_TREPA/27-102------TQ.SVHH-------Q---GVAATID--EPR--FP-----------------
Q74D57_GEOSL/5-80------CG.TDHH-------Q---GVALRVE--GFA--YA-----------------
RLMB_HAEIN/4-80------AD.GEVH-------Q---GVIARVQ--AAK--EL-----------------
Q6AJ92_DESPS/48-125------GAASARH-------Q---GVIAKVT--QAD--LM-----------------
Q6N4H3_RHOPA/40-113------LGPDAVH-------Q---GMLAEAD--PLQ--GP-----------------
Q828C9_STRAW/57-135------ST.TVTP-------Q---GLVGICR--FLD--TP-----------------
Q9KGF2_BACHD/5-80------IG.HENH-------Q---GVVASVA--AYE--YA-----------------
RLMB_CHRVO/6-82------SG.NARH-------Q---GVVAMID--ASM--NY-----------------
RLMB_PECAS/4-80------AE.DAVH-------Q---GIVAKVK--EGR--KY-----------------
Q9CHW1_LACLA/29-104------AD.SESP-------Q---GLIAEVT--KIE--EV-----------------
Q74ID9_LACJO/31-102------SS.TKNS-------Q---DIFMVLP--INQ--PK-----------------
Q839V3_ENTFA/43-117------SD.HGVH-------Q---GMVLAIT--AYQ--YL-----------------
Q8R7T5_CALS4/6-80------AQ.TPNH-------Q---GVVAVGA--LYK--YF-----------------
Q73J63_TREDE/10-85------SE.SVHH-------Q---GVTAMIF--EPE--IP-----------------
Q75B46_ASHGO/118-191------TN.NAVH-------N---GLVLEAK--PLY--PQ-----------------
Q6AAT1_PROAC/72-148------TG.GSNH-------Q---GVALRLP--EYE--YA-----------------
MRM1_YEAST/125-198------TN.YGVH-------N---NIALETK--PLQ--PV-----------------
MRM1_HUMAN/51-129------CR.YQVH-------Q---GVCMEVS--PLR--PR-----------------
Q7NN60_GLOVI/29-103------AD.TVHP-------S---GVVAAVR--RRA--DA-----------------
Q831U7_ENTFA/31-103------SE.LPTS-------Q---GILAIVT--LET--QQ-----------------
Y355_MYCPN/9-79------FR.HINH-------Q---EFVCVIN--PNQ--ML-----------------
Q7TU91_PROMP/190-266------TS.GAVH-------Q---GVALQHA--STE--SI-----------------
RLMB_PSEPK/6-81------V..EGVH-------Q---GVVAEVS--PSQ--VW-----------------
Q6A7V4_PROAC/41-113------SD.TVTS-------Q---GIFAVCR--QVT--RR-----------------
Q7MSH0_WOLSU/29-101------AR.GGNH-------Q---GFLMEIE--AIS--PL-----------------
Q92F34_LISMO/9-83------V..SGAH-------Q---GVAAQVA--AYQ--YA-----------------
Q8KC03_CHLTE/18-94------SG.TAKN-------Q---GVCALLT--SVT--FY-----------------
Q8CXP3_OCEIH/5-79------E..LGNH-------Q---GVVAYVA--SYT--YA-----------------
Q72G19_DESVH/7-82------Y..AGGH-------Q---GVVARLF--EAG--YV-----------------
Q9PR20_UREPA/3-73------DH.SLNH-------Q---NIAFKLV--KKN--FQ-----------------
O67731_AQUAE/6-79------AG.TKKT-------Q---GVVALLS--PVN--YV-----------------
RLMB_BLOFL/4-80------SM.KSAH-------Q---GIIAEVI--PMP--AL-----------------
Y955_SYNY3/125-201------TH.NANH-------Q---GIAAQVA--PYH--YW-----------------
Q9XWY8_CAEEL/44-125------TE.FQLH-------N---GICMDAS--ALQ--FS-----------------
C5DY76_ZYGRC/130-203------TN.YAVH-------N---NIILETK--PLQ--PP-----------------
D7BAL1_MEISD/30-105------SV.RDNP-------A---GLIALAR--MPE--R.-----------------
Q2FZE0_STAA8/31-99------SG.TVTP-------Q---GFFAIIE--KPH--Y.-----------------
Q2G2M3_STAA8/6-79------A..NAPH-------Q---GVAALIA--PYE--YA-----------------
Q2YP21_BRUA2/57-129------TR.RDNL-------Q---MVAGVFE--Q..--..-----------------
Q32CT8_SHIDS/110-181------SG.TEHH-------G---GVCFLIK--KR.--..-----------------
Q5SLJ7_THET8/2-71------LR.TTHH-------Q---GIAAEVE--DPP--Y.-----------------
Q820Y2_TROWT/26-98------T..DLPH-------Q---GVALLCK--SYR--P.-----------------
RLMB_XANCP/7-81------GG.QVRH-------Q---GVAARYA--AAR--..-----------------
Q8Y7Q4_LISMO/31-99------SE.TMTE-------Q---GVFAVVA--TSE--P.-----------------

PF01248

Q9XWS4_CAEEL/14-108------CGRLFR.-------V---CTLAVTD--AGD--SDIIL--------------
RS12_HUMAN/16-111------VGLCKID-------R---EGKPRKV--VGC--SCVVV--------------
RL30E_AERPE/1-95------MGRRHG.-------V---SVLAVID--EGS--SRILE--------------
RL30_KLULA/8-102------VGKLFR.-------V---GVVTILD--AGD--SDILT--------------
RL7A_CHICK/122-216------VHRKTCT-------C---VAFTQVN--PED--KGALA--------------
RL8B_YEAST/117-209------VNQK...-------T---SAVAALT--EVR--AEDEA--------------
RL8_SCHPO/117-212------IHQKTAA-------V---LAVTEVR--EED--KNELA--------------
RL7A_ANOGA/128-222------VYRKTCT-------C---VALTQVE--NAD--KPNLA--------------
RPP38_HUMAN/99-190------IGLK.C.-------V---LALAFKK--NT.--.TDFV--------------
SBP2L_HUMAN/702-804------VNKLVP.-------V---SVVGIFN--YFG--AESLF--------------
NHP2_YEAST/41-135------GATKRP.-------T---SVVFIVP--GSN--KKKDG--------------
NHP2_SCHPO/39-133------SNTKRP.-------T---SCVMIVP--GGK--KKDMS--------------
RS12_DROME/23-118------SGLCKID-------K---EGKPRKV--CGC--SVVVI--------------
RS12_CAEEL/24-119------CGLCKYD-------K---EGKARKV--VGC--SSAVV--------------
RS12A_SCHPO/31-126------AGLCVLD-------R---DGNARKV--VGC--SCVAV--------------
RS12_YEAST/26-123------AGLGKID-------R---EGNARKV--VGA--SVVVV--------------
RS122_ARATH/29-124------AGLCKID-------S---EGNARKV--VGC--SCLVI--------------
RS12_PLAF7/23-119------AGLFKLD-------N---EGNARKI--IGA--SSVAV--------------
GA45B_HUMAN/21-121------LGEP...-------A---ETQGTTE--ARD--LHCLL--------------
GA45A_HUMAN/21-123------LLLETD.-------A---GPAASEG--AEQ--PPDLH--------------
SEBP2_RAT/650-752------LNKAVP.-------V---SIVGIFS--YDG--AQDQF--------------
O77331_PLAF7/495-595------INKSRQ.-------S---IICIIDN--DSY--IKECN--------------
RL30E_METJA/7-101------CGKPFP.-------V---AALLVLD--EGL--SNIME--------------
RL30E_METTH/1-95------CGKPFT.-------V---GALLIQD--PGD--STILE--------------
RL30E_SULAC/3-97------CGKPFM.-------V---SVIGIVD--EGE--SKILE--------------
RL30_MAIZE/12-106------CGKYFR.-------V---CCLSIID--PGD--SDIIK--------------
Q9VJ19_DROME/12-106------CGKYFR.-------V---CTLSITD--PGD--SDIIR--------------
RL30B_SCHPO/22-116------CGKLFR.-------V---GVLAVID--AGD--SDILA--------------
YLXQ_BACSU/4-96------IGKEA..-------R---VVVAVTD--QGF--ANKLI--------------
Q9WZN2_THEMA/7-99------LDKP...-------A---VSVIGLE--EDN--LIDAI--------------
RL7A_DROME/127-221------VRRKTCT-------T---LALTTVD--NND--KANFG--------------
RL7A1_ARATH/112-207------VHQKTAS-------C---LCLTTVK--NED--KLEFS--------------
RL7A_ARCFU/13-107------VGIEVP.-------C---ASAAIIN--EGE--LRKEL--------------
RL7A_METJA/15-106------AGLEVA.-------A---SSVAIIN--EGD--AEELK--------------
RL7A_SULSO/17-111------CGLQVA.-------T---ASAAILE--PGE--AKDLV--------------
RL7A_AERPE/17-111------AGIEVA.-------A---ASVAIIE--PGD--AETLV--------------
RL7A_METTH/17-111------AGLNVG.-------T---ASSAIVE--AGD--AEDLI--------------
Q9SU26_ARATH/20-114------CDVTRP.-------V---IACSVTS--NEA--SQLKS--------------
SNU13_YEAST/18-112------CGVSRP.-------V---IAASITT--NDA--SAIKT--------------
NH2L1_DROME/19-113------CGVSRP.-------I---VACSVTT--NEG--SQLKS--------------
NHP2_DROME/51-146------MGVKRG.-------T---VALLVRQ--NEE--YKDLY--------------
NHP2_CAEEL/53-148------VGHRRP.-------S---ILIFVKP--SGD--FKELY--------------
I6TC33_ENTHA/8-96------IGKP...-------R---KVFGIVD--NGF--AKK..--------------
M0Y8U1_HORVD/29-123------AGLCKID-------T---EGKARKV--VGC--SCIVV--------------
N1JG05_BLUG1/33-127------AGLCVLD-------R---EGNARKV--VNC--SCVV.--------------
Q385Y8_TRYB2/32-125------AGLTRMA-------A---DGSVRKT--LKC--SCLA.--------------
Q38AC1_TRYB2/29-122------AGLQRR.-------K---QDETVKT--FKC--SCVA.--------------
Q38BI8_TRYB2/20-112------CGRHFR.-------A---CVLSITD--VGD--SDIT.--------------
RL30E_THEKO/7-95------LGRPHT.-------V---SALAVID--PGE--SKIL.--------------
RL30E_METMP/2-94------CGKPFP.-------V---SALLVLE--PGN--SAIL.--------------
RL30E_PYRFU/3-94------LGKPFV.-------V---ASLAIVD--PGE--SKIL.--------------
RL7A_PYRFU/18-111------AGIEVA.-------A---ASVAIIE--PGK--ARDLV--------------

PF03465

PELO_HUMAN/271-370------L--.SQL-------T---GVAAILR--FPV---------------------
ERF1_CAEEL/288-424------F--VRGF-------G---GIGGLLR--YRV---------------------
PELO_METTH/259-352------L--.ESL-------G---GLAGILR--FKI---------------------
E7QK37_YEASZ/277-376------L--.DQL-------T---GIACILK--YPL---------------------
PELO_AERPE/250-349------L--.VSF-------G---GVIALLR--YPV---------------------
RF1_PYRHO/278-417------F--YRAF-------G---GLGAILR--FKI---------------------
PELO_METJA/254-346------L--.KAL-------G---GIAGLLR--FPI---------------------
B2AWT5_PODAN/281-418------F--VKGF-------G---GIGGILR--YKV---------------------
PELO_THEVO/247-338------I--.EKF-------G---GYAGILR--YKV---------------------
ERF1_TRYBB/281-420------F--VRGF-------G---GIGGVLR--YKL---------------------
PELO_SULSO/245-343------L--.KNL-------T---GILAILR--FRI---------------------
Q9BMX1_EUPAE/276-413------F--VNGF-------G---GIGGFLR--FKL---------------------
PELO_PYRAB/260-355------L--.KAL-------G---GIAAILR--FKI---------------------
RF1_METTH/274-407------L--LRAF-------G---GIGAILR--YRP---------------------
RF1_ARCFU/270-403------L--YKAF-------G---GIAAILR--FKP---------------------
ERF1_SCHPO/277-416------F--VKGF-------G---GIGAVMR--YQL---------------------
RF1_AERPE/279-370------F--LKTF-------G---GLAGILR--FRI---------------------
RF1_SULSO/275-368------V--KKTF-------N---GIVGKLR--YRL---------------------
PELO_ARCFU/246-342------L--.MSL-------G---GIAALLR--FNV---------------------
RF1_THEVO/277-410------L--KQAF-------G---GLAAVLR--FIR---------------------
ERF1_BLEAM/280-415------F--VRGF-------G---GLGAFLR--YQV---------------------
PEL1_ARATH/271-370------L--.AQL-------T---GIAALLR--FPL---------------------
ERF1_GIAIN/290-432------F--CSGF-------G---GIGGLLR--WQV---------------------
PELO_DROME/271-370------L--.AQL-------T---GIAALLR--FPM---------------------
ERF1_STYMT/285-422------F--VKGF-------G---GIGGFLR--YKV---------------------
PELO_CAEEL/271-370------L--.AQL-------T---GCAAILR--FPM---------------------
PELO_THEAC/247-338------V--.KKF-------G---GFAGILR--YRV---------------------
PELO_HALSA/254-356------L--.RNL-------G---GIGAVLR--YRL---------------------
I7MKI5_TETTS/279-414------F--VKGF-------S---GIGGFLR--YKV---------------------
A0A024WDX6_PLAFA/276-411------F--QKGF-------G---GFGGMLR--YKI---------------------
P79004_SACPS/277-376------L--.GRL-------K---GLACILK--YPI---------------------
DOM34_SCHPO/271-370------L--.DLL-------S---GIAAILT--YPV---------------------
RF1_HALSA/281-414------L--LTAF-------G---GYAGILR--YST---------------------
RF1_METJA/277-419------I--LNAF-------K---GIAAILR--YKI---------------------

PF15608

Q0RDF6_FRAAA/285-365------LA-LAAD-------R---GVAVEEM..ADL..PFSCVGLVRP---------
F8A7B9_CELGA/759-840------RQ-LAHE-------R---GVPVEPA..PDL..PYACIGLIHP---------
E4NAQ4_KITSK/291-371------RL-LAEQ-------R---GVPVEET..DDL..PYTCVGLIHP---------
A1VWP9_POLNA/279-359------KV-LASE-------K---SVPLMVD..ADL..PYQAVSLIQS---------
Q5NWT5_AROAE/279-359------VA-LAEE-------K---AVPVETD..ASL..PYNAVSIIRS---------
Q8KL02_RHIEC/282-364------MY-LIDN-------K---GVPYVVS..PRKIAPYRAVTLIRH---------
D3VJW4_XENNA/275-357------VH-LARQ-------K---NVVITEV..GDLIGQYRAVTIIKK---------
C8XAU5_NAKMY/305-385------RL-LAAD-------R---GVPVEVV..PDL..AYSCVGLVRQ---------
F4EXE7_SELS3/265-346------YQ-LAKE-------K---GVEIVEY..PLE..NYLACGLIRS---------
E6UDF8_RUMA7/266-347------YQ-LAEE-------K---GCELVEY..PLK..HYRACGLIKA---------
H8GG70_METAL/281-361------LW-LAES-------K---SIPIEVC..PDM..PYRAAALIKE---------
Q9RSA8_DEIRA/269-349------RE-LAAA-------S---GTPVTMH..PDL..PYLAAAIIAS---------
STIP_ACIAD/297-379------RH-LTQI-------T---KTPVQVV..GDQIAPYRAITLIQK---------
F2JGK7_CELLD/289-369------LL-LARD-------R---GVPVEVY..QDM..CYSCCGLIKD---------
Q4FTP9_PSYA2/309-391------RH-LCAQ-------R---HIPIRVL..GDKILPYQAITLIKQ---------
D1BEJ8_SANKS/295-375------LL-LAEQ-------R---GVEVVEV..QDL..PYSCVGLIHP---------
Q2RVZ5_RHORT/280-360------VA-LASS-------K---GIAVETL..ADL..PYSACAIIKT---------
C0Z9Y7_BREBN/295-375------IM-LAKD-------R---GVLVEER..SDM..SYSCCGIIRS---------
C8W646_DESAS/311-391------FL-LAEE-------R---GVSVECC..PDM..SYSCCGLVKT---------
A8MM96_ALKOO/748-828------LL-LAKD-------R---NVEVEVY..PQM..TYGCCGLIKP---------
F8K488_STREN/279-359------RL-LARR-------R---GVPLVET..EGL..PYACVGLVHP---------
A1SUD4_PSYIN/287-367------LK-LAKE-------K---NIDVVEM..NDM..PFGACALIKD---------
A4J1D7_DESRM/320-400------LL-LAKD-------R---GVTVEEH..PNL..SYSCYGLIKN---------
F8AVP2_FRADG/278-358------LS-LCEA-------K---GVPVEER..ADL..PYSCVGIIKP---------
D3RPA4_ALLVD/285-365------LE-LAHE-------K---NVRRQVD..PTL..PYQAVSLIKG---------
F4H5N6_CELFA/811-892------RH-LAAE-------R---GVPVETV..ADL..PYSCVGLIHP---------
H6N264_GORPV/291-371------RV-LAAE-------R---GVPVEVR..SDL..AYSCVGLVKE---------
Q891X7_CLOTE/298-378------KL-LAKD-------K---CIPIEVY..KDM..SYSCCGVIKS---------
A6WD80_KINRD/287-371------RL-LAAQ-------R---GVVVEEV..PGL..SYSAIGLIHP---------
A5WBK3_PSYWF/314-396------RH-LCQQ-------K---GVAVTVI..GEQILPYQAVTIIKK---------
E8U3T5_DEIML/257-336------HA-LADA-------H---GVPVHVA..AHL..PYAALALVHE---------
D1A9P2_THECD/292-376------RL-LAAE-------R---GVPVVEVEPDAF..PYACMGLIRP---------
B4EW79_PROMH/276-356------IY-LAKQ-------K---NITVTEA..GKALGQYRAVTIIKK---------
D4L2P5_9FIRM/132-213------VR-LAEE-------K---NVSIQYY..PMK..HYKCCGIIKK---------
E3EE68_PAEPS/297-377------ML-LAKD-------R---GVPVEVF..EGL..TYSCCGIIKP---------
J9STB4_9ACTN/293-373------RL-LAAE-------R---DVPVEVS..PDL..AYSCVGLIKE---------
M1FGD7_9ALTE/290-371------IH-LCRQ-------D---GVDLIAA..PELTGPYRAITLIRE---------
Q186J5_PEPD6/281-358------FI-LAKE-------K---NVEVEQM..DLK..AYKCCGIIKN---------
Q3JCD3_NITOC/292-369------LI-LAEE-------K---GVVVEHQ..PNM..PFNAVAFIK.---------
Q7CKQ6_YERPE/276-357------VY-LAKQ-------K---KIAIKEV..GNELGQYRAITIIKK---------
R5BVZ9_9FIRM/264-345------LR-LAKE-------K---NVPVQTY..PLK..NYKACGIIKK---------
R5XB52_9CLOT/301-379------LI-LAKE-------K---NVEVEEF..DFK..AYSCCGIIKN---------
R7CDA0_9FIRM/265-346------VR-LAEE-------K---HTPVEYY..PLT..HYKCCGIIKK---------
U5LCP5_9BACI/286-365------KL-LAEE-------R---GVEIVRY..PDM..SYTCCGLIKK---------

PF08228

Q6CTJ8_KLULA/13-168------..-.FRD-------VVHDGMCLVRTHAHYQ.DFAKMISTKVEPLSIPWLHS
POP3_YEAST/14-171------..-..SK-------Y...GMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNA
Q753G4_ASHGO/13-172------LP-GTPH-------D...GMLLVPETAAVDPAFVQKVRASVERRAIPWLEP
Q6FQW2_CANGA/3-151------V.-GDSY-------A...DVLLLKKTASLDQSLANLLDS.IEQPPTPFLEP
POP3_SCHPO/7-165------L.-GLSR-------A...GAIAVQDDSPLWKYLKDLVMN.IEEPQARWLSE

PF05025

R5ICH0_9FIRM/3-147.ER...FEFYDEA.......RK...TYCILQ--SGETAIYANVILQKGVI-------
R6MWK2_9CLOT/3-142.ER...FDFYGHT.......DT...AYCVVA--TGETARYANITLKKGVI-------
F8F334_TRECH/4-141.ER...FAFYERA.......KK...AFAVVM--TGETVKYGNIILKKGVI-------
A7II16_XANP2/3-140.AG...PSFYDRV.......RA...AYAIVA--SGERRLYGNIILRKGVI-------
D5SWX7_PLAL2/1-146.SK...WDFYEEV.......KS.TDHVLTIQ--TGDVALWANLLLKVGVR-------
RBSD_PASMU/1-138.SH...DMFKTYT.......H.A..SKAIVR--SGECSPYANIILYSGVP-------
RBSD_HAEPS/1-138.PH...NEFKHQS.......N.Q..AKAVVR--TGECSPYANVILYSGVP-------
A9HPM0_GLUDA/4-139.ER...YAFYEET.......AH...CFAVIQ--TGEGRPYGNVILAKGVI-------
E3D7F8_GARV3/3-144.ER...FAFYDEA.......KN...AYCVVA--TGERAQYANIMLRKGVV-------
H8L1D3_FRAAD/1-131.SH...EELKHAS.......R.Q..ARAVIR--TGECSPYANVILHAGVN-------
D6XZQ8_BACIE/1-128.DH...ESFKIQV.......Q.K..AKVVIR--TGEVTPYANVILQSGVI-------
B8I9B2_CLOCE/3-141.ER...FAFYERT.......KS...AYAVIA--TSEAALYANIIIKKGVV-------
RBSD_LARHH/1-130.PH...AEFKQLS.......R.G..ARAVIR--TGEASPYANVILYSGVI-------
R7PPL8_9FIRM/1-133SEH...EEFKKMT.......K.Q..SKAIIR--TGEITPFSNVIFESGVI-------
R6HV06_9FIRM/3-139.ER...FAFYDRA.......RK...AYAVIA--TGETAVYANIILKKGVV-------
X2H1X6_9GAMM/1-138.PH...EMLKKQT.......Y.N..CKAVIR--TGECTPFANIILQSGVI-------
R5BKJ9_9FIRM/1-132TDH...EAFKEAT.......K.Q..CKCIIR--TGETTPYANVILQADCI-------
Q12BF4_POLSJ/3-143.ER...FDFYERA.......QS...AYLILQ--TGEQRKYGNIVLRKGVI-------
B7GMC2_ANOFW/4-133.SH...ERLKEMM.......K.S..AKAVIR--TGEATPYANMILHSGVN-------
T1G8C4_HELRO/6-150.DR...FDFYDQA.......RK...SFAVVA--TGEVAQYGNIIIKKGIV-------
Q161Y5_ROSDO/3-143.ER...FAFYDRS.......KK...AYAVIQ--TGERRFYGCFAFRKGVV-------
G8LVS6_CLOCD/1-130.TH...SEFKEMT.......K.N..CKAVVR--TGECMPYANIILHSGVA-------
Q7UUK8_RHOBA/1-146.EK...WSFYDHV.......IT.DDHVLTIQ--TGDQQRYANLLLTLGVR-------
R7N665_9FIRM/3-144.ER...FAFYEEA.......KK...AYAIIA--TGEGALYANIMLQKGVV-------
RBSD_ACIAC/1-129.SH...EEFKRLT.......R.D..ARAVVR--TGECTPYANVILCAGVT-------
E1RCT7_SPISS/3-141.ER...FAFYERA.......KS...AYAVVS--TGDQALYACIILKKGVL-------
A3DCF4_CLOTH/11-139.EH...STLRDTL.......TKE..VKFAIR--TGDFTANSNIILVS...-------
B9K2K2_AGRVS/3-138.DR...FTFYDRS.......KA...AFAVIS--TGERRLYGNIILKKGVV-------
L9KX68_TUPCH/6-148.ER...FEFYERA.......KK...AFAVVA--TGETALYGNLILKKGVL-------
F4H9V0_GALAU/3-142.ER...FAFYEKA.......RQ...AYAIVV--TGETAKYGNILIKKGVI-------
RBSD_GEOKA/1-130.PH...EQFKAMT.......K.Q..AKAVIR--TGEATPYANIILRSGVS-------
I3TF87_THEC1/6-141.PH...EEFKAVY.......VAS..SRFVVR--TGEYTPYSNIALVAGVP-------
F7ESI4_MONDO/5-149.ER...FAFYEQA.......KK...AFAVVA--TGETALYGNIILRKGVI-------
RBSD_CALS4/1-129.DH...EQLKEMC.......K.N..AKAVIR--TGEYTPYANIVLESGVE-------
F6DR08_DESRL/1-131.PH...VQFKQKT.......K.E..ARGLVR--SGEFTPYANVILVAGVA-------
D2BEN5_STRRD/1-128.PH...SELKRLS.......R.S..SRLIVR--TGEARPYANVLLRCGVA-------
E3QVQ1_COLGM/4-139.DR...AAFYGRA.......KK...AYAIVV--TGENRKYSSVILKKGA.-------
W0PHP3_9BURK/3-141.ER...HAFYERA.......RR...AYCVIT--TSDTRSYGCFIFKKGVL-------
D4H243_DENA2/1-131.SH...EDFKELT.......K.K..AKAVIR--TGECSPYANVILYSGVV-------
T2KGG9_9FLAO/4-141.ER...FAFYERT.......IK...AYAVVV--TGETAKYGNIILKKGVT-------
K0KGS5_SACES/1-128.DH...DGFKGRV.......A.Q..ARLVIR--TGEATPYANVLLRCGVP-------
R7G568_9PROT/4-139.ER...YAFYERA.......KK...AYAVIA--TGEQAIYANIILKKGVI-------
B9K2A2_AGRVS/4-140.LG...PDFYPRV.......KA...AHTVVQ--TGEPRLYANVILKKGVI-------
B8CWP6_HALOH/1-138.GR...FEFYDKC.......VSNQDLCLVIV--TGEQRIYANILLTIGVV-------
RBSD_PHOLL/1-138.SH...NVLKEKT.......K.H..SRAVIR--TGEHSPYANIILGAGVT-------
A5G2I4_ACICJ/4-141.DR...HGFYAAA.......RD...SFVIVQ--TGDRRLYANVIATKGVI-------
R7D1N9_9ACTN/3-144.DR...FPFYDEA.......KK...AYAVIA--TSERAQYANIILQKGVV-------
G8PKF7_PSEUV/7-141.ER...FAFYEKA.......KK...AYCVVV--TGTTRKYGNVIIKKGVI-------
RBSD_DESRM/1-129.SH...EQLKSLS.......Q.R..ARAVIR--TGEWTPYANVILYSGVA-------
Q128C2_POLSJ/3-144.ER...HAFYDRV.......RR...AYAIVV--TGELQPFGNFILRKGVI-------
H6NDH4_9BACL/4-141.ER...FAFYERA.......RG...AYAVIA--TGESAQYANLILKKGVI-------
RBSD_CLONN/1-130.SH...EELKKEL.......S.N..CKAVIR--TGEQTPYANIILKSGVV-------
D7C1Q2_STRBB/1-133.PH...EDLKART.......A.T..ARLVVR--TGEARPYANVLLRCGVP-------
RBSD_PROMH/1-138.TH...EEFKTQL.......P.D..NKAVIR--TGECSPYANIVLFSGVT-------
RBSD_LACPL/1-130.PH...EEMKKDL.......A.D..CKAFVR--TGEMTPYSNILLESGVT-------
R5HCY6_9FIRM/3-140.ER...FAYYERA.......KK...AYCVVA--TGEKAQYANIILKKGVV-------
A6WDZ4_KINRD/2-137.DR...WAFYAQS.......RA.DDVALVVA--TADQRLCANLILTVGVR-------
D8LIE6_ECTSI/5-148.ER...FAFYERA.......RS...CYAVVS--TGETAKYGNIILVKGVL-------
H2IYD3_RAHAC/1-138.SH...EAFKAQT.......E.K..SRAVIR--SGECSPYANVILCAGVT-------
FUCM_DANRE/5-147.ER...FAFYERA.......KK...AFAVVA--TGETALYGNLIIKKGVI-------
R5F996_9CLOT/1-130.PH...TELKERS.......K.D..AKAIVL--TGEFTGYTNVILSAGC.-------
R5A6P8_9CLOT/7-136.GR...FDFYDRA.......SQ...AVGVVV--TADTTKGGNILITKGVV-------
RBSD_PSELT/1-131.PH...EKFKDRV.......R.E..SKGVVR--TGEQTSYSSVILVGGVT-------
A9KR29_CLOPH/4-144.ER...FAFYEEA.......KK...AYAIIA--TGEKALYANIILQKGVV-------
W8VC37_YEREN/1-138.SH...EAFKEQT.......K.Q..SRAVIR--SGECSPFANIILCSGVT-------
E3D852_GARV3/1-130.PHDGDEGFKALV.......S.Q..AKFVIR--TGETTPYSNVLLRCGVP-------
R5WS75_9FIRM/4-144.SR...KEFYKKA.......RK...AYAVVA--TTETAFYACAILQKGC.-------
F0LZN3_VIBFN/9-146.SH...EEFKART.......H.Y..SRAVVR--TGECTAYANVIFQAGVV-------
C3Y6F8_BRAFL/4-145.QQ...SEFYERA.......KK...AFAVVA--TGETALYGNIILKKDVI-------
RBSD_PSEPK/1-131.TH...EDFKVLS.......R.S..ARAVVR--TGECQPYSNIALISGVT-------
K1XXH2_MARBU/3-141.ER...MKFYEQA.......SK...AFCVVS--TSETRLYGNLLLKKGVV-------
E3HAW5_ILYPC/1-134.PH...SQLKKTS.......R.E..SKAVIR--TGECTPYANIILKSGVA-------
E3PV76_CLOSD/1-132.SH...EYFKKLS.......S.S..SKAIVR--TGECTPYANIILQSGVN-------
A5UTT7_ROSS1/1-136.GR...FAFYDAA.......RS.PDTTLVIA--TGERRVYANILLTIGVV-------
W5M9Q7_LEPOC/5-148.ER...FAFYERA.......KK...AFAVVA--TGETSLYANLIIKKGVI-------
D4LNS7_9FIRM/3-144.ER...FAFYDEA.......KT...AYCIIS--TSEKALYANIMLQKGVV-------
RBSD_NATTJ/1-134.DH...ESFKKEV.......S.N..TKAVVR--TGECTPFSNIILKSGVV-------
B7VTM7_VIBTL/17-154.TH...EEFKQRT.......H.E..SRAVIR--TGECTPYANVIFQAGVT-------
R5XA15_9CLOT/1-132.SH...VGLKEMT.......K.E..CKAVIR--TGETTPYANIILQSGCI-------
R5XIE2_9FIRM/3-141.ER...FSYYERA.......KK...AYAVII--TGEERQYANIILKKGCV-------
B9K575_AGRVS/3-146.ER...FAFYDLA.......KK...AYCVIS--TGETRFYGCFLFTKGVI-------
Q982U4_RHILO/3-145.ER...YAFYERA.......KQ...AYCVIQ--TGERRFYGCFAFRKGVI-------
M4R5G6_BIBTR/1-138.PH...SQFKQQS.......N.Q..AKAVVR--TGECSPYANIILYSGVP-------
U3GZS3_9CORY/1-127.SH...EELKRLV.......A.D..AKFVVR--TGSVVPYSNVVVRCGVP-------
C6D5S1_PAESJ/1-130.PH...EEFKRLT.......R.E..AKAVIR--TGEAKPYANVILKAGVN-------
RBSD_RHOBA/1-134.SH...VEFKQRT.......Q.A..SEAIVR--TGECTP