Sequence alignment for CL0101

PF01248

Q9XWS4_CAEEL/14-108---------------------------------------ENINSRLSMVMK--TGQ.YVLGYKQTLKSLLN---G..K--
RS12_HUMAN/16-111---------------------------------------TALQEVLKTALI--HDG.LARGIREAAKALDK---R..Q--
RL30E_AERPE/1-95---------------------------------------MSVEKALKDLVK--TGV.YAMGFKQSLKAVKA---G..E--
RL30_KLULA/8-102---------------------------------------ENINQKLALVVK--SGK.YSLGYKSTVKSLRQ---G..K--
RL7A_CHICK/122-216---------------------------------------AAGKGDTP.TKR--PPV.LRAGVNTVTTLVEN---K..K--
RL8B_YEAST/117-209---------------------------------------AEGKSKQDASPK--PYA.VKYGLNHVVSLIEN---K..K--
RL8_SCHPO/117-212---------------------------------------ANGKSAQDVSKK--PYN.VKYGLNHVVALIEA---K..K--
RL7A_ANOGA/128-222---------------------------------------AAGKEEPP.SKR--ANQ.LRQGINSVVKMVEQ---K..K--
RPP38_HUMAN/99-190---------------------------------------QQVSGWTP.AHV--RKQ.LAIGVNEVTRALER---R..E--
SBP2L_HUMAN/702-804---------------------------------------ERIYQKDPVRAK--ARRRLVMGLREVTKHMKL---N..K--
NHP2_YEAST/41-135---------------------------------------KKVLKTVKKASK--AKN.VKRGVKEVVKALRK---G..E--
NHP2_SCHPO/39-133---------------------------------------KKMMKTVKKASK--QKH.ILRGVKEVVKAVRK---G..E--
RS12_DROME/23-118---------------------------------------TALQEVLKKSLI--ADG.LVHGIHQACKALDK---R..Q--
RS12_CAEEL/24-119---------------------------------------GALRAVLRAAHH--ADG.LAKGLHETCKALDK---R..E--
RS12A_SCHPO/31-126---------------------------------------DALKEVLKRALV--HDG.LARGIREASKALDR---R..Q--
RS12_YEAST/26-123---------------------------------------DALKVVLRTALV--HDG.LARGLRESTKALTR---G..E--
RS122_ARATH/29-124---------------------------------------TALELTVRKSRA--YGG.VVRGLHESAKLIEK---R..N--
RS12_PLAF7/23-119---------------------------------------TAIQKVIKNAHV--HDG.LKIGIREVIKSIES---Q..E--
GA45B_HUMAN/21-121---------------------------------------AAVEELLVAAQR--QDR.LTVGVYESAKLMNV---DPDS--
GA45A_HUMAN/21-123---------------------------------------DALEEVLSKALS--QRT.ITVGVYEAAKLLNV---DPDN--
SEBP2_RAT/650-752---------------------------------------DRMYQKDPVKAK--TKRRLVLGLREVLKHLKL---R..K--
O77331_PLAF7/495-595---------------------------------------SVSHEKLLLLKK--KKR.YFLGLKECYKHICI---D..E--
RL30E_METJA/7-101---------------------------------------MDVNKAIRTAVD--TGK.VILGSKRTIKFVKH---G..E--
RL30E_METTH/1-95---------------------------------------MDIDRGIRVAVD--TGN.VILGSKRTIQSLKL---G..K--
RL30E_SULAC/3-97---------------------------------------QSFEGELKTLLR--SGK.VILGTRKTLKLLKT---G..K--
RL30_MAIZE/12-106---------------------------------------DNINNKLQLVMK--SGK.YTLGYKTVLRTLRN---S..K--
Q9VJ19_DROME/12-106---------------------------------------ESTNARLALVMK--SGK.YCLGYKQTLKTLRQ---G..K--
RL30B_SCHPO/22-116---------------------------------------DTINSKLALTMK--SGK.YVLGYKSTLKTLRS---G..K--
YLXQ_BACSU/4-96---------------------------------------MEWFPLLGLANR--ARK.VVSGEDLVIKEIRN---A..R--
Q9WZN2_THEMA/7-99---------------------------------------RKVYSYIGFAVR--ARK.IVFGKERIRAYIRS---P.RE--
RL7A_DROME/127-221---------------------------------------AKGKDVEP.KKK--PSY.VSAGTNTVTKLIEQ---K..K--
RL7A1_ARATH/112-207---------------------------------------AEAEGKPSESKK--PIV.VKYGLNHVTYLIEQ---N..K--
RL7A_ARCFU/13-107---------------------------------------NEALSLLEKVRE--SGK.VKKGTNETTKAVER---G..L--
RL7A_METJA/15-106---------------------------------------KELLDAVAKAQ.--..K.IKKGANEVTKAVER---G..I--
RL7A_SULSO/17-111---------------------------------------DKVLEAVRKAKE--SGK.IKKGTNETTKAVER---G..Q--
RL7A_AERPE/17-111---------------------------------------EKAYEAVKRARE--TGR.IKKGTNETTKAVER---G..L--
RL7A_METTH/17-111---------------------------------------DKAAEALEIARE--TGK.VSKGTNEVTKAVER---G..V--
Q9SU26_ARATH/20-114---------------------------------------ITILDLVQQATN--YKQ.LKKGANEATKTLNR---G..I--
SNU13_YEAST/18-112---------------------------------------QQILDVVQQAAN--LRQ.LKKGANEATKTLNR---G..I--
NH2L1_DROME/19-113---------------------------------------AKIMNLLQQALN--YNQ.LRKGANEATKTLNR---G..L--
NHP2_DROME/51-146---------------------------------------KKCYKLVKKAMK--HKTFLRNGLKDVQTRLRK---G..E--
NHP2_CAEEL/53-148---------------------------------------KKVYKLIKKASA--GDKTLREGIKDVQKELRR---N..E--
I6TC33_ENTHA/8-96---------------------------------------.KAMNLIGLAMR--AGK.LITGEELTIADIRK---Q..K--
M0Y8U1_HORVD/29-123---------------------------------------.ALQLVMKKSSA--HDG.LVKGLREAAKSIEK---H..A--
N1JG05_BLUG1/33-127---------------------------------------DALKGALRTALM--HDG.LARGLREASKALDR---R..E--
Q385Y8_TRYB2/32-125---------------------------------------.ALRIVLMKARE--TNG.LICGLSEVTRALDR---R..T--
Q38AC1_TRYB2/29-122---------------------------------------DAIRIVIRKALE--VNG.LVRGLSEVARALDR---R..T--
Q38BI8_TRYB2/20-112---------------------------------------.TINTKIQLVMK--SGK.YVLGTQQSLKTLRQ---G..R--
RL30E_THEKO/7-95---------------------------------------.....ELRKVQD--TGK.IVMGAKKSIHLAKV---G..G--
RL30E_METMP/2-94---------------------------------------.DINRAIRVAVD--TGN.VVLGTKQAIKNIKH---G..E--
RL30E_PYRFU/3-94---------------------------------------..LAFELRKAME--TGK.VVLGSNETIRLAKT---G..G--
RL7A_PYRFU/18-111---------------------------------------.KALQAVEIARD--TGK.IRKGTNETTKAVER---G..Q--

PF08032

Q8CXU2_LEPIN/36-110---------------------------------------------------------FIEGYREILRAQKS...GKIK..
O96263_PLAF7/86-167---------------------------------------------------------YIYGLNSVYAVLKK...N.ER..
Q6BTY4_DEBHA/128-204---------------------------------------------------------YVYGTFPVMAALMA...N.KRG.
RMTL1_DROME/141-217---------------------------------------------------------IVEGRRLIQEALQC...G.LK..
RLMB_VIBCH/5-81---------------------------------------------------------LIYGIHAVNAVLQR...D.PA..
Q92QI6_RHIME/59-133---------------------------------------------------------LLYGLHTVRAALDN...PERR..
Q7MBB6_GLOVI/92-168---------------------------------------------------------LLYGKQSVLAALQN...S.RP..
RLMB_RALSO/6-82---------------------------------------------------------LLIGFHAVTARLRH...DARS..
Y479_MYCPA/69-145---------------------------------------------------------TVLGRNPVLECLRA...G.VP..
Q7U7F6_SYNPX/177-253---------------------------------------------------------LVWGRHSALAALEA...G.RP..
Q73GK0_WOLPM/11-88---------------------------------------------------------WLYGKHTCMSALKN...KNRR..
Q8E1Z2_STRA5/15-89---------------------------------------------------------LVYGLHAVTESLRA.....NT..
Q8D323_WIGBR/4-80---------------------------------------------------------IIYGIHVIEEFIKN...KSNK..
Q6MS22_MYCMS/5-77---------------------------------------------------------LIYGKHVVFELLKK...H.QN..
Q97EF9_CLOAB/9-84---------------------------------------------------------LIEGRNAVIEALKS...D.ST..
Q6C040_YARLI/179-258---------------------------------------------------------VLYGTHAVEACLTS...H.KRRN
Q8DK28_THEEB/45-121---------------------------------------------------------LLYGRHAVLSALES...G.RP..
Q6ADI2_LEIXX/89-166---------------------------------------------------------IVTGRNSVLEALRA...R.IP..
Q890M7_CLOTE/5-80---------------------------------------------------------LIIGRNAVVEALES...H.KT..
Q6FPX7_CANGA/108-186---------------------------------------------------------YLYGVNPILAALES.....DRRG
Q7NAH8_MYCGA/23-94---------------------------------------------------------CLFGYNGVYEGLIN...N.LK..
Q9A907_CAUCR/33-109---------------------------------------------------------LAEGLKIVIEAIDC...GHAP..
RLMB_SHEON/6-82---------------------------------------------------------IIFGIHAVEALLKH...S.PE..
Q98N81_RHILO/2-76---------------------------------------------------------RLYGLHTVRAALDN...PRRK..
MRM1_SCHPO/33-108---------------------------------------------------------FVFGTHSVKNALAT...RKRE..
Q7VFD1_HELHP/2-74---------------------------------------------------------IVYGKQPILYILHT...NASC..
Q8A814_BACTN/7-81---------------------------------------------------------MIFGVRAVIEAIQA...G.KE..
Q6YQX1_ONYPE/823-895---------------------------------------------------------IIYGKNPIKEAIKA...Q.RK..
Q9PQG4_UREPA/33-108---------------------------------------------------------IIEGFKLLDEALQN.....QQ..
O25279_HELPY/4-76---------------------------------------------------------VIYGKQVIMHLLNS...H.QE..
RLMB_COXBU/6-81---------------------------------------------------------SIYGIHAVSGVLDA...A.PQ..
Q6AGD8_LEIXX/38-113---------------------------------------------------------LLEGPQAVAEALAF...R.SE..
Q9K894_BACHD/31-100---------------------------------------------------------LIEGYHLVEEALKS...T.IT..
Y1673_SYNY3/38-112---------------------------------------------------------LLEGTHLLEVALAQG.KG.FNHG
Q9CJY1_PASMU/125-200---------------------------------------------------------KVYGENACQALFAQ...R.PE..
Q8Z0C3_NOSS1/42-116---------------------------------------------------------LLEGTHLLEEACAM...D.YP..
Q7MTU3_PORGI/6-80---------------------------------------------------------MIFGLHSISEAFEA...G.KE..
RLMB_NITEU/6-82---------------------------------------------------------YIFGFHAITSRLRQ...H.PD..
Q8XJ72_CLOPE/31-104---------------------------------------------------------LIEGLRFVEEAIKS...K.VS..
YACO_BACSU/7-81---------------------------------------------------------YVIGKNAVIETLKS...D.RK..
Q74L24_LACJO/8-85---------------------------------------------------------FVYGRHAGIDFLKT.....QDAN
Q891T6_CLOTE/31-105---------------------------------------------------------IVEGFRFVEEALKS...D.YC..
Q6MIZ9_BDEBA/55-130---------------------------------------------------------VVIGTHAINEVLKV...R.PK..
O84408_CHLTR/29-103---------------------------------------------------------LLEGFREIHRALIS...G.YR..
RLMB_NEIMB/6-82---------------------------------------------------------PIYGFHAVNARLWQ...N.PK..
RLMB_ACIAD/6-82---------------------------------------------------------YYYGVHSVESLLEL...E.PE..
Q6CLR7_KLULA/125-198---------------------------------------------------------YVFGTNSVISALTA...K.....
Q8YXQ3_NOSS1/83-159---------------------------------------------------------IIYGRHPVLSALQN...Q.RG..
Q9RWC1_DEIRA/2-76---------------------------------------------------------LLYGRNPVLEALPA...G.R...
Q9X263_THEMA/2-78---------------------------------------------------------RVYGRKILEEALRN...N.VP..
Q8KBA1_CHLTE/33-106---------------------------------------------------------LAEGLRTVSELLQSLSDP.SM..
Q81L29_BACAN/31-99---------------------------------------------------------FVEGFHLVEEALKA...G.....
Q9L0Q5_STRCO/72-149---------------------------------------------------------LVVGRNPVYEALRE...G.VP..
Q6NFC4_CORDI/71-147---------------------------------------------------------LVVGRNPVVECLHA...K.VP..
O83093_TREPA/27-102---------------------------------------------------------TVCGLRAVETLGSI...H.PE..
Q74D57_GEOSL/5-80---------------------------------------------------------ILYGINSVMEALRG...S.RR..
RLMB_HAEIN/4-80---------------------------------------------------------QIYGIHAVNSILTH...S.PE..
Q6AJ92_DESPS/48-125---------------------------------------------------------LIWGIHPIVEALKY...E.PN..
Q6N4H3_RHOPA/40-113---------------------------------------------------------ILYGWHTVTAALAN...PQRK..
Q828C9_STRAW/57-135---------------------------------------------------------LAEGPQAVREAAAH...RAADAA
Q9KGF2_BACHD/5-80---------------------------------------------------------FITGKNPIIEALRS...G.RP..
RLMB_CHRVO/6-82---------------------------------------------------------LIHGFHAINARLWQ...N.PK..
RLMB_PECAS/4-80---------------------------------------------------------IIYGIHAVKALLER...D.PQ..
Q9CHW1_LACLA/29-104---------------------------------------------------------LIEGFHLLEEALKA...G.RS..
Q74ID9_LACJO/31-102---------------------------------------------------------LIEGFHLVEEALKS...H.....
Q839V3_ENTFA/43-117---------------------------------------------------------FVFGFHATVEALQQ...G.R...
Q8R7T5_THETN/6-80---------------------------------------------------------IIYGRNPVIEAIRS...G.KE..
Q73J63_TREDE/10-85---------------------------------------------------------PVCGFESCLALAKH...H.PE..
Q75B46_ASHGO/118-191---------------------------------------------------------RIYGRNSILLALQS...N.RR..
Q6AAT1_PROAC/72-148---------------------------------------------------------WVIGRNPVLEALHV...G.LP..
MRM1_YEAST/125-198---------------------------------------------------------YVYGTNSVYAALLN...P.SR..
MRM1_HUMAN/51-129---------------------------------------------------------LLFGMTPCLLALQA...A.RR..
Q7NN60_GLOVI/29-103---------------------------------------------------------LVEGTHPVAAALAG...GWELEF
Q831U7_ENTFA/31-103---------------------------------------------------------IIEGFHLVEEAVKA...N.....
Y355_MYCPN/9-79---------------------------------------------------------FLFGSKAFLEALDN...Q.LQ..
Q7TU91_PROMP/190-266---------------------------------------------------------WIWGKHSVFAALNS...E.RP..
RLMB_PSEPK/6-81---------------------------------------------------------KIYGVHAVQALLQH...H.PK..
Q6A7V4_PROAC/41-113---------------------------------------------------------LVEGAQAVREALAW.....PG..
Q7MSH0_WOLSU/29-101---------------------------------------------------------IIYGKQIFLYVLRR...H.PK..
Q92F34_LISMO/9-83---------------------------------------------------------WIGGRNPVLEVLRS...D.RD..
Q8KC03_CHLTE/18-94---------------------------------------------------------VVYGRNAVIELLQS...K.PE..
Q8CXP3_OCEIH/5-79---------------------------------------------------------VIMGRNPVMEALKS...G.RS..
Q72G19_DESVH/7-82---------------------------------------------------------VLPGLKPVLELLAS...D.PA..
Q9PR20_UREPA/3-73---------------------------------------------------------YNFGKKALLDAIGN.....KQ..
O67731_AQUAE/6-79---------------------------------------------------------VIWGRNPIIEALRA...G.RN..
RLMB_BLOFL/4-80---------------------------------------------------------LVYGIHTVESIVNQ...S.PN..
Y955_SYNY3/125-201---------------------------------------------------------LLYGHHAVLAALDG...D.RQ..
Q9XWY8_CAEEL/44-125---------------------------------------------------------ALFGLHSVLEAIRS...G.KR..
C5DY76_ZYGRC/130-203---------------------------------------------------------YVYGTNSVLAALQG...N.KR..
D7BAL1_MEISD/30-105---------------------------------------------------------LIEGAREIERALQA...G.IE..
Q2FZE0_STAA8/31-99---------------------------------------------------------LIEGVHLIEEAYQS...G.IV..
Q2G2M3_STAA8/6-79---------------------------------------------------------.IVGRHAVREAIIT...G.HP..
Q2YP21_BRUA2/57-129---------------------------------------------------------LAEGLKLVIDALEQ...D.WR..
Q32CT8_SHIDS/110-181---------------------------------------------------------.VYGENACQALFQS...R.PE..
Q5SLJ7_THET8/2-71---------------------------------------------------------WIYGRNPVLEALRA...G.R...
Q820Y2_TROWT/26-98---------------------------------------------------------.IVGINPVYEALRE...R.VP..
RLMB_XANCP/7-81---------------------------------------------------------WIVGVNAVASSVEN...D.AD..
Q8Y7Q4_LISMO/31-99---------------------------------------------------------LVEGFHLVEEALRQ...D.GL..

PF03465

PELO_HUMAN/271-370----------------------------------AAGEVKALDDFYKMLQH..EPDRAFYGLKQVEKANEA---M-----
ERF1_CAEEL/288-424----------------------------------FIQEKKLIGGYFDEISQ..DTGKYVFGVKDTLAALEM---G-----
PELO_METTH/259-352----------------------------------IASEIRNVNEFLEKLAR..DPDSVVYGKVEVMDAINM---G-----
A0A023ZGV7_YEASX/277-376----------------------------------YSKEIMVMDEFLLHLNK..DDDKAWYGEKEVVKAAEY---G-----
PELO_AERPE/250-349----------------------------------IVEAEGVLEEFLRRIAKSRD..TVAYTPGEVLAVARM---G-----
RF1_PYRHO/278-417----------------------------------VIREKKLVNEFLKHVVK..DTGLATYGEREVRRALEI---G-----
PELO_METJA/254-346----------------------------------VAKETQLIEKLLEEIAK..K.GLAVYGIDEVKKALEY---S-----
B2AWT5_PODAN/281-418----------------------------------FIQEKKLIGKYFEEISQ..DTGRICYGVEDTLKALEL---G-----
PELO_THEVO/247-338----------------------------------ISRDNEIVSAFLSSLRR..G..SGIYGSEEIRKYLEM---G-----
ERF1_TRYBB/281-420----------------------------------LVQEKKLLQGFFDQIAC..DTQLYCFGVQDTLKCLEA---G-----
D0KRD6_SULS9/245-343----------------------------------IAIGAKKMEKAMELLAK..QPELVTYGLEQVKNAIEM---G-----
Q9BMX1_EUPAE/276-413----------------------------------FVEEKNLISKYFEQIAL..DTGMIVFGVEDTLHSLEI---G-----
PELO_PYRAB/260-355----------------------------------VAQEIKLVEKVIERIAK..D.EPVAYGLKDVEEAVNY---G-----
RF1_METTH/274-407----------------------------------VMREKKLVQRFLRELIN..EDGLASYGEREVRQHLQM---G-----
RF1_ARCFU/270-403----------------------------------IIREKNLMQRFLKEVAR..D.GLAAYGEEEVRRYIEL---G-----
ERF1_SCHPO/277-416----------------------------------YVQEKKLIQRFFDEISL..DSGKYCFGVVDTMNALQE---G-----
RF1_AERPE/279-370----------------------------------YRDAVNAMEEFKLHLAK..GTGMIVYGEKDVEAALEM---G-----
RF1_SULSO/275-368----------------------------------YIEVEKLLEELKYHLAK..DDGLIIYGKEQIKKAMEI---G-----
PELO_ARCFU/246-342----------------------------------LAEEAEYIDRLLEGIAK..G.ERVAYGLDEVREAHNY---R-----
RF1_THEVO/277-410----------------------------------ISREKDLMDRFLREVKK.PDGGLAVYGEKAIRDALEQ---K-----
ERF1_BLEAM/280-415----------------------------------FIREKKVMSKFFEEVAQ..DTKKYCYGVEDTMKSLLM---G-----
PEL1_ARATH/271-370----------------------------------AAKEVKALNDFHNMLST..EPDRACYGPKHVEVANER---M-----
ERF1_GIAIN/290-432----------------------------------LIQEVKLLTEFTENIAK..DTKRVCFGITDTIRCLEM---S-----
PELO_DROME/271-370----------------------------------AAGEVKALEQFYMMLQC..EPAKAFYGKKHVLQAAES---Q-----
ERF1_STYMT/285-422----------------------------------FVAEKKLVSKFFEEISL..DTGMIVFGVQDTMKALEL---G-----
YNU6_CAEEL/271-370----------------------------------AQGEVKALNQFLELMST..EPDRAFYGFNHVNRANQE---L-----
PELO_THEAC/247-338----------------------------------IARDKEIVDEFLVAVKK..D..MGVYGRDQTESALQM---G-----
PELO_HALS3/254-356----------------------------------IAEESELIDELTTQMAT..D.GKAAYGIDEVQKAVEF---G-----
I7MKI5_TETTS/279-414----------------------------------FVQEKNVISKFFDCIAI..DSGTVVYGVQDTMQLLLD---G-----
A0A024WDX6_PLAFA/276-411----------------------------------FIQEKKLIGKFFEEIAQ..DTGKVVYGIDDTLKALEI---G-----
P79004_SACPS/277-376----------------------------------LIKEIQIMDDFFEHLNK..DDNKAWYGKEEIKRAAKL---E-----
DOM34_SCHPO/271-370----------------------------------YVQEIRVLNKFYDVMNE..DDRKAWYGPNHVLKAFEL---G-----
RF1_HALS3/281-414----------------------------------LMDDKSDMEEFFEELN...GGKLATYGFEQTRRNLIM---G-----
RF1_METJA/277-419----------------------------------LMKEREAVQRFLKELIK.EDGGLACYGEKEVLEALMM---G-----

PF15608

Q0RDF6_FRAAA/285-365------------------------------------WAGWAAVERIAAAYDIPDVIMVKPGVGETTRVLLR---R-----
F8A7B9_CELGA/759-840------------------------------------WRGWAAVVRVAQEQGIGDVNLVKPGIGETTRVLLR---R-----
E4NAQ4_KITSK/291-371------------------------------------WAGWAAVERISAEYGIDSVNLVKPGVGETTRVLLR---R-----
A1VWP9_POLNA/279-359------------------------------------AISAEFLQSTTARHRITDVNLIKPGIGEATRVLLR---R-----
Q5NWT5_AROAE/279-359------------------------------------EVSRVYMKEAMTQYGVTDENLIKPGIGEATRVLLR---R-----
Q8KL02_RHIEC/282-364------------------------------------DAAAAAVAWVMGEDAVTNINRVKPGIAEATRAILR---R-----
D3VJW4_XENNA/275-357------------------------------------QLSKTVISNLAEKYQIDSINRIKPGIAEATRAVLR---R-----
C8XAU5_NAKMY/305-385------------------------------------FAGWAAVERIRQQYGIASVNFVKPGVGEATRVLLR---R-----
F4EXE7_SELS3/265-346------------------------------------RSGLAEVERIAGDFGIRDINLVKPGIGEATRVLLR---R-----
E6UDF8_RUMA7/266-347------------------------------------ENTMEEVKAICQEYGIADINLVKPSIGEATRVLLR---R-----
C3ASG0_BACMY/237-317------------------------------------WQGMQDIASIQKHFGIENINLIKPGVGETTRVLLR---R-----
H8GG70_METAL/281-361------------------------------------AVSLDFLKAVAQQYRISHYNYIKPGIGEATRVLLR---R-----
Q9RSA8_DEIRA/269-349------------------------------------QQPVRAVLARAAELGVTDPHLVKPSVGEATRVFLR---R-----
STIP_ACIAD/297-379------------------------------------DQSQQVVHKLAQEYDIQNINRIKPSIAEATRAILR---R-----
F2JGK7_CELLD/289-369------------------------------------FNAAQSVENIRQCFDISSINRVKPGVGETTRVLLR---R-----
Q4FTP9_PSYA2/309-391------------------------------------YQTADLIDTLAAEYNITNRNRIKPTIAEATRAILR---R-----
D1BEJ8_SANKS/295-375------------------------------------WAGWKAVEAISAEHGLGDVNLVKPGVGETTRVLLR---R-----
Q2RVZ5_RHORT/280-360------------------------------------AISTAFVEAMMQRTGITDRNRVKPGIGEATRALLR---R-----
C0Z9Y7_BREBN/295-375------------------------------------WKGMRDIGRIQQELQIDDVNLIKPGVGETTRVLLR---R-----
C8W646_DESAS/311-391------------------------------------FRGLRDIERIKEEYGIGNINYIKPGVGETTRVLLR---R-----
A8MM96_ALKOO/748-828------------------------------------WQGLEDIRRIQKDFAIEDINLIKPGIGETTRVLLR---R-----
F8K488_STREN/279-359------------------------------------WAGWAAVERIGEEYGIHDVNLVKPGVGETTRVLLR---R-----
A1SUD4_PSYIN/287-367------------------------------------SMTRFFLKEMMQQHHVSNKNRIKPGIAEATRVMLR---R-----
A4J1D7_DESRM/320-400------------------------------------WLGQKDTTRVQLEYGIKSINYVKPGVGETTRVLLR---R-----
F8AVP2_FRADG/278-358------------------------------------WAGWQAVETLAKEYGIDNIGLVKPGVGETTRVLLR---R-----
D3RPA4_ALLVD/285-365------------------------------------ARSTALLADIRATFGIQNENFIKPGIGEATRVLLR---R-----
F4H5N6_CELFA/811-892------------------------------------WSGWAAVERIVEEYGIGDVNLVKPGVGETTRVLLR---R-----
H6N264_GORPV/291-371------------------------------------WSGWASMERLRDEYGVSSVNFVKPGVGETTRVLLR---R-----
Q891X7_CLOTE/298-378------------------------------------DSGIKEVNEIKNMYKISDINLIKPGVGETTRVLLR---R-----
A6WD80_KINRD/287-371------------------------------------FTGWAEVERVSEHYDIGDVNLVKPGVGETTRVLLR---R-----
A5WBK3_PSYWF/314-396------------------------------------YHAQRIIETLANHYQISNINRIKPTIAEATRAVMR---R-----
E8U3T5_DEIML/257-336------------------------------------HAPVQTALDLARAFGARDPHKVKPSIGEATRVFLR---R-----
D1A9P2_THECD/292-376------------------------------------WAGRRAVRRIGERYGIDDLNLIKPGVGETTRVLLR---R-----
B4EW79_PROMH/276-356------------------------------------..SENVVSLLANKYDISNINRIKPGIAEATRAVLR---R-----
D4L2P5_9FIRM/132-213------------------------------------.SGIDEVKQIAKTFDIDDINLIKPGIGEATRVLLR---R-----
D5CKQ8_ENTCC/276-357------------------------------------.TSRDVIAFLADEFKVDSVNRIKPGIAEATRAVLR---R-----
E3EE68_PAEPS/297-377------------------------------------WQGLRDIEAIQQAFGIRDINLVKPGVGETTRVLLR---R-----
J9STB4_9ACTO/293-373------------------------------------WSGWRSVERIQAEYGLSSINLVKPGVGETTRVLLR---R-----
M1FGD7_9ALTE/290-371------------------------------------..ADRTVAAVAKRFGVQNRNRIKPGIAEATRAVLR---R-----
Q186J5_PEPD6/281-358------------------------------------...YFDVLNIKEKYNITDINFIKPGVGETTRVLLR---R-----
Q3JCD3_NITOC/292-369------------------------------------..TRIYLNRWIDSYGIGDINHIKPGIAEATRVMLR---R-----
Q7CKQ6_YERPE/276-357------------------------------------.QSHQVVKKMAEQFEINSVNRIKPGIAEATRAVLR---R-----
R5BVZ9_9FIRM/264-345------------------------------------.QGLDEVLRIGREFKIEDVNLIKPGIGETTRVLLR---R-----
R5XB52_9CLOT/301-379------------------------------------..GNCDVKNIKQRYDIEDINFIKPGVGETTRVLLR---R-----
R7CDA0_9FIRM/265-346------------------------------------.QGIDEVINIGKNFGIDDINLIKPGIGETTRVLLR---R-----
U5LCP5_9BACI/286-365------------------------------------.RGMEEVMAIKEEYAIESTNYVKPGVGETTRVLLR---R-----

PF08228

Q6CTJ8_KLULA/13-168KRRQVYKPILENPFTNEAKLWPHVTDQKLVLELLEEKVLKRWKLLQD...MGNNEESITVGFNEIVDLLS...HGKDEY.
POP3_YEAST/14-171KRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS...KENYPWELYTDFNEIVQYLSGAHGNSDPV.
Q753G4_ASHGO/13-172KKKQVYKPILDNPYTNEAELWPHVREQSVVVELLLNAVLRPLRHARE.LG.GAPPFEVHTGYNDVMERLG..CAESGTA.
Q6FQW2_CANGA/3-151KRGGRVIPVLEDPYSNEK..WPYCTPE..QLELLDTYMDKSVLRALKNS.KPGEETGVVFDIAEILRVLQ...SESADV.
POP3_SCHPO/7-165KVKQTVKLVLRNPLSIS...WPIVDAN......TQEKLAQTLVQWLPASHKDILDSKLTVGLNSVNELLERCCQNAKDVT

PF01248

Q9XWS4_CAEEL/14-108-AKLV-IIAN-N---TP----PLRKSE....-------------------------------------------...IEY
RS12_HUMAN/16-111-AHLC-VLAS-N---CD----EPMYVK....-------------------------------------------..LVEA
RL30E_AERPE/1-95-AKAI-VIAE-N---TP----PELRRK....-------------------------------------------...LEY
RL30_KLULA/8-102-AKLI-IIAA-N---TP----VLRKSE....-------------------------------------------...LEY
RL7A_CHICK/122-216-AQLV-VIAH-D---VD----PIELVV....-------------------------------------------..FLPA
RL8B_YEAST/117-209-AKLV-LIAN-D---VD----PIELVV....-------------------------------------------..FLPA
RL8_SCHPO/117-212-AKLV-LIAS-D---VD----PIELVV....-------------------------------------------..FLPA
RL7A_ANOGA/128-222-AQLV-IIAH-D---VD----PIELVV....-------------------------------------------..YLPA
RPP38_HUMAN/99-190-LLLV-LVCK-S---VK----PAMITS....-------------------------------------------..HLIQ
SBP2L_HUMAN/702-804-IKCV-IISP-N---CE----KIQSKGGL.D-------------------------------------------EALYNV
NHP2_YEAST/41-135-KGLV-VIAG-D---IS----PADVIS....-------------------------------------------..HIPV
NHP2_SCHPO/39-133-KGLV-ILAG-D---IS----PMDVIS....-------------------------------------------..HIPV
RS12_DROME/23-118-AVLC-ILAE-S---FD----EPNYKK....-------------------------------------------..LVTA
RS12_CAEEL/24-119-AHFC-VLAE-N---CD----EPQYVK....-------------------------------------------..LVET
RS12A_SCHPO/31-126-AHLC-VLCE-S---CD----QEAYVK....-------------------------------------------..LVEA
RS12_YEAST/26-123-ALLV-VLVS-S---VT----EANIIK....-------------------------------------------..LVEG
RS122_ARATH/29-124-AQLC-VLAE-D---CN----QPDYVK....-------------------------------------------..LVKA
RS12_PLAF7/23-119-AKVC-FLSD-V---CS----EPAYKK....-------------------------------------------..LITT
GA45B_HUMAN/21-121-VVLC-LLAI-D---EE----EEDDIALQIH-------------------------------------------FTLIQS
GA45A_HUMAN/21-123-VVLC-LLAA-D---ED----DDRDVALQIH-------------------------------------------FTLIQA
SEBP2_RAT/650-752-LKCI-IISP-N---CE----KTQSKGGL.D-------------------------------------------DTLHTI
O77331_PLAF7/495-595-PKIV-FIAP-N---IE----PSLNNIFD..-------------------------------------------DTLGKI
RL30E_METJA/7-101-GKLV-VLAG-N---IP----KDLEED....-------------------------------------------...VKY
RL30E_METTH/1-95-GKLV-VMAS-N---IP----EDLKED....-------------------------------------------...IEY
RL30E_SULAC/3-97-VKGV-VVSS-T---LR----QDLKDD....-------------------------------------------...IMT
RL30_MAIZE/12-106-SKLV-IIAN-N---CP----PLRKSE....-------------------------------------------...IEY
Q9VJ19_DROME/12-106-AKLV-LIAS-N---TP----ALRKSE....-------------------------------------------...IEY
RL30B_SCHPO/22-116-AKLI-LIAA-N---AP----PLRKSE....-------------------------------------------...LEY
YLXQ_BACSU/4-96-AKLV-LLTE-D---AS----SNTAKK....-------------------------------------------...VTD
Q9WZN2_THEMA/7-99-KKLI-IIAE-D---TS----ERMKRD....-------------------------------------------...TIM
RL7A_DROME/127-221-AQLV-VIAH-D---VD----PLELVL....-------------------------------------------..FLPA
RL7A1_ARATH/112-207-AQLV-VIAH-D---VD----PIELVV....-------------------------------------------..WLPA
RL7A_ARCFU/13-107-AKLV-YIAE-D---VD----PPEIVA....-------------------------------------------..HLPL
RL7A_METJA/15-106-AKLV-IIAE-D---VK----PEEVVA....-------------------------------------------..HLPY
RL7A_SULSO/17-111-AKLV-IIAE-D---VQ----PEEIVA....-------------------------------------------..HLPL
RL7A_AERPE/17-111-AKLV-VIAE-D---VD----PPEIVM....-------------------------------------------..HLPL
RL7A_METTH/17-111-AQLV-LIAE-D---VE----PAEIVA....-------------------------------------------..HLPL
Q9SU26_ARATH/20-114-SEFI-VMAA-D---TE----PLEILL....-------------------------------------------..HLPL
SNU13_YEAST/18-112-SEFI-IMAA-D---CE----PIEILL....-------------------------------------------..HLPL
NH2L1_DROME/19-113-ADIV-VLAG-D---AE----PIEILL....-------------------------------------------..HLPL
NHP2_DROME/51-146-TGIC-IFAG-D---VT----PVDIMC....-------------------------------------------..HLPA
NHP2_CAEEL/53-148-KGIC-ILAG-N---VS----PIDVYS....-------------------------------------------..HIPG
I6TC33_ENTHA/8-96-AKIV-FVAN-D---AS----ENTKKK....-------------------------------------------...VKD
M0Y8U1_HORVD/29-123-AQLC-VLAE-D---CD----QPDYVK....-------------------------------------------..LVKA
N1JG05_BLUG1/33-127-AHMC-VLNE-A---CE----EEAYKK....-------------------------------------------..LIVA
Q385Y8_TRYB2/32-125-AHLC-VLAD-D---CE----DEEYKK....-------------------------------------------..LVTA
Q38AC1_TRYB2/29-122-AHMC-ILAT-D---CD----DEEYKK....-------------------------------------------..LIKA
Q38BI8_TRYB2/20-112-SKLV-VISA-N---CP----PIRKAE....-------------------------------------------...IEY
RL30E_THEKO/7-95-AKLI-IVAR-N---AR----PDIKED....-------------------------------------------...IYY
RL30E_METMP/2-94-GQLV-IVAD-N---CA----KDVRED....-------------------------------------------...IFY
RL30E_PYRFU/3-94-AKLI-IVAK-N---AP----KEIKDD....-------------------------------------------...IYY
RL7A_PYRFU/18-111-AKLV-IIAE-D---VD----PEEIVA....-------------------------------------------..HLPP

PF08032

Q8CXU2_LEPIN/36-110.FQNI.LFSP-E...CF----LGE.......-------------------------------------------..NEFS
O96263_PLAF7/86-167TIEEV.IVNK-N..IKL----NRKIHKQNY.-------------------------------------------.EYIFD
Q6BTY4_DEBHA/128-204SFNKL.ITHN-P...KE----SSG.......-------------------------------------------..EIFK
RMTL1_DROME/141-217.MEVL.LFSQ-K...DQ----LALV...K..-------------------------------------------..EEVG
RLMB_VIBCH/5-81RFVEA.YVLK-G...RQ----DDR.....L.-------------------------------------------.LPVLN
Q92QI6_RHIME/59-133.IIRL.SVTQ-N....A----AAR.......-------------------------------------------..LDLG
Q7MBB6_GLOVI/92-168.LNRV.WLTE-K..LRY----DPR.....F.-------------------------------------------.LRLLD
RLMB_RALSO/6-82.IDEI.YFEA-N...RR----DRR.....M.-------------------------------------------.QDFLK
Y479_MYCPA/69-145.ATAL.YVAL-G..TEA----DER.....L.-------------------------------------------.TESVS
Q7U7F6_SYNPX/177-253.IHRI.WCTP-E..MRS----AAK.....F.-------------------------------------------.LQLLR
Q73GK0_WOLPM/11-88.CIEL.LVTE-NF.YRE----HEK.......-------------------------------------------..EIKQ
Q8E1Z2_STRA5/15-89.GNKL.YLQD-D...LR----GKN.....V.-------------------------------------------.DKVKA
Q8D323_WIGBR/4-80.ILCI.LFLK-S...RK----DIK.....F.-------------------------------------------.KKLIL
Q6MS22_MYCMS/5-77MVKEI.WVKD-L.....----..........-------------------------------------------..KILN
Q97EF9_CLOAB/9-84.IEQV.LVSS-G...KS----EGS.....I.-------------------------------------------.NVILA
Q6C040_YARLI/179-258QCLKL.FVGE-G..KLG----EPV.....V.-------------------------------------------.KKIMD
Q8DK28_THEEB/45-121.CNRI.WVIP-S..LRY----DPR.....F.-------------------------------------------.HQRLN
Q6ADI2_LEIXX/89-166.GTTL.YIAA-R..VEL----DDR.....V.-------------------------------------------.KEILS
Q890M7_CLOTE/5-80.LESI.LISK-G...NN----KGT.....I.-------------------------------------------.NKIIS
Q6FPX7_CANGA/108-186YFTRL.LHHD-T....N----DKD.....SN-------------------------------------------KLTILR
Q7NAH8_MYCGA/23-94.IKKV.YLHK-E.....----.DH.......-------------------------------------------..PLLK
Q9A907_CAUCR/33-109.KIVM.YGPD-A...AD----HPM.....L.-------------------------------------------.KKAVA
RLMB_SHEON/6-82RIIEL.WLLQ-G...RE----DER.....L.-------------------------------------------.TPLIR
Q98N81_RHILO/2-76.IRKM.LVTR-N....A----AER.......-------------------------------------------..LEIE
MRM1_SCHPO/33-108.CRAL.YVQN-A...DI----HSE.....F.-------------------------------------------.EEFLN
Q7VFD1_HELHP/2-74.IEEI.YLAK-E.....----LPK.......-------------------------------------------..DIFK
Q8A814_BACTN/7-81.IDKI.LVKK-D..IQS----DLS.......-------------------------------------------.KELFA
Q6YQX1_ONYPE/823-895.IYQL.YLDE-K....I----KDH.......-------------------------------------------..LFIM
Q9PQG4_UREPA/33-108TIVSI.IINE-H...VY----NKE.....F.-------------------------------------------.ETIFK
O25279_HELPY/4-76KLQEI.YLSK-E....I----DKK.......-------------------------------------------..LFFA
RLMB_COXBU/6-81RIVKL.YVQE-N...RD----DQR.....L.-------------------------------------------.QSLVE
Q6AGD8_LEIXX/38-113LLVEL.YATP-T...AL----ERH.......-------------------------------------------.QDIAQ
Q9K894_BACHD/31-100.IETI.LVTE-S.....----........V.-------------------------------------------..TLPT
Y1673_SYNY3/38-112CFTAM.WQEK-N.....----..........-------------------------------------------..PVLA
Q9CJY1_PASMU/125-200SIVRI.WATV-E....M----AKK.....S.-------------------------------------------.GELFS
Q8Z0C3_NOSS1/42-116.LEVV.CCTP-E...WE----ANH.......-------------------------------------------.TALWD
Q7MTU3_PORGI/6-80.IDKI.FIRR-G...LK----TEQ.....T.-------------------------------------------.EAIIR
RLMB_NITEU/6-82SIKEI.YLDT-N...RH----DQR.....A.-------------------------------------------.RDLMS
Q8XJ72_CLOPE/31-104.IDSI.IFTE-S...FK----EKN.......-------------------------------------------.PDLFL
YACO_BACSU/7-81.LYKL.WMAE-N...TV----KGQ.....A.-------------------------------------------.QQVIE
Q74L24_LACJO/8-85LINKV.FLQN-G...VQ----EEF.....A.-------------------------------------------.NQVYQ
Q891T6_CLOTE/31-105.IEYI.LINE-K....S----LNK.....V.-------------------------------------------.QEFNI
Q6MIZ9_BDEBA/55-130QVKGF.WLRQ-G..FEN----SGD.....L.-------------------------------------------.RDMNE
O84408_CHLTR/29-103.CSHV.FCGE-L...IA----DKE.....I.-------------------------------------------..ALDR
RLMB_NEIMB/6-82SIVEL.YIQE-G...KS----DAR.....T.-------------------------------------------.REVLE
RLMB_ACIAD/6-82RVLTL.FTLK-G...RD----DQR.....L.-------------------------------------------.QKILE
Q6CLR7_KLULA/125-198.KREY.FVKL-H...HY----GPL.....N.-------------------------------------------.TQIQS
Q8YXQ3_NOSS1/83-159.LNRI.WVTP-R..LRY----DPR.....F.-------------------------------------------.HNLIL
Q9RWC1_DEIRA/2-76.VAEV.VLAR-G...VE----DAF.....A.-------------------------------------------.RQVQD
Q9X263_THEMA/2-78.IKKV.FFQK-M..KNP----GSY.....F.-------------------------------------------.LSLVK
Q8KBA1_CHLTE/33-106.LHAL.VFDE-K...AA----GQL.....D.-------------------------------------------.GLERF
Q81L29_BACAN/31-99.VVTE.LIVS-D.....----........Q.-------------------------------------------.TDLPK
Q9L0Q5_STRCO/72-149.ASTL.YVQQ-F..IDN----DER.....V.-------------------------------------------.REALQ
Q6NFC4_CORDI/71-147.ATTL.YIVE-G..TKN----DNR.....L.-------------------------------------------.SEAVQ
O83093_TREPA/27-102KIHRF.FFTP-V....R----AKR.....F.-------------------------------------------.GPLCA
Q74D57_GEOSL/5-80.AFEL.FVSR-E...TH----DRR.....T.-------------------------------------------.EKLLA
RLMB_HAEIN/4-80RLIEV.FVLK-G...RE----DKR.....L.-------------------------------------------.QPLLN
Q6AJ92_DESPS/48-125RISEI.IAQK-D...RR----GAK.....F.-------------------------------------------.DEIVE
Q6N4H3_RHOPA/40-113.FRKL.WLTE-N.....----AAR.......-------------------------------------------..RLAE
Q828C9_STRAW/57-135TLVEL.FATA-E....A----AER.....Y.-------------------------------------------.ADIIG
Q9KGF2_BACHD/5-80.MNKI.WIGE-G...SQ----KGQ.....M.-------------------------------------------.QKVLE
RLMB_CHRVO/6-82SLIEI.WLAG-G...RH----DAR.....A.-------------------------------------------.KAVLD
RLMB_PECAS/4-80RFLEV.FILK-G...RD----DRR.....L.-------------------------------------------.QPVIA
Q9CHW1_LACLA/29-104.IKQI.FVEE-N...KL----TKL.......-------------------------------------------..TEMI
Q74ID9_LACJO/31-102.ENYL.YVLG-T...AE----ALK.......-------------------------------------------..KLDT
Q839V3_ENTFA/43-117.GNKL.FLQE-D...AR----GEK.....I.-------------------------------------------.EQLKQ
Q8R7T5_THETN/6-80.IEKI.YVSK-T....A----GGN.....I.-------------------------------------------.SKIIG
Q73J63_TREDE/10-85KISRL.FFSE-K....R----AKQ.....F.-------------------------------------------.GEVCK
Q75B46_ASHGO/118-191EYFVR.LLHS-G...NL----DPQ.......-------------------------------------------...IAK
Q6AAT1_PROAC/72-148.VRTA.YVAE-G..AEH----DSR.....L.-------------------------------------------.REILT
MRM1_YEAST/125-198NCHSR.LLYH-G...TI----PSK.......-------------------------------------------...FLQ
MRM1_HUMAN/51-129SVARL.LLQA-GKAGLQ----GKR.......-------------------------------------------.AELLR
Q7NN60_GLOVI/29-103VCATEAWVGE-H.....----..........-------------------------------------------.PAMHT
Q831U7_ENTFA/31-103.ADVQ.WILF-N...QR----GQQ.......-------------------------------------------..EWGT
Y355_MYCPN/9-79.IKKV.NLSD-K.....----.HQ.......-------------------------------------------..KLLG
Q7TU91_PROMP/190-266.INRI.WCTS-E..IFS----SEK.....F.-------------------------------------------.YLLLK
RLMB_PSEPK/6-81RVKQI.WLSE-G...RS----EPR.....L.-------------------------------------------.ETLLA
Q6A7V4_PROAC/41-113.KVNL.LATS-D...PA----RDA.......-------------------------------------------..EHVE
Q7MSH0_WOLSU/29-101LIKSV.YLGK-E.....----VEK.......-------------------------------------------..DLFK
Q92F34_LISMO/9-83.IHKI.YVQE-G...SQ----KGV.....L.-------------------------------------------.KQVLT
Q8KC03_CHLTE/18-94SVEKI.YLQF-N...TS----HPK.....L.-------------------------------------------.KEIVI
Q8CXP3_OCEIH/5-79.VNKV.MVTE-Q...IQ----GST.....F.-------------------------------------------.QKINQ
Q72G19_DESVH/7-82RIDTV.FIRR-G...RR----TPD.....T.-------------------------------------------.DRLMD
Q9PR20_UREPA/3-73SISKV.YLLS-K.....----........N.-------------------------------------------.YELIN
O67731_AQUAE/6-79.LEKI.YVAH-D...SH----PPK.......-------------------------------------------..ELLE
RLMB_BLOFL/4-80RILIV.YIVS-N...PR----DLR.....L.-------------------------------------------.KSLIY
Y955_SYNY3/125-201.LNRI.WITS-H..LRH----DIR.....Y.-------------------------------------------.RTKIQ
Q9XWY8_CAEEL/44-125DFHSV.FLKK-AVENRA----DSDA...RI.-------------------------------------------.KEILS
C5DY76_ZYGRC/130-203EYYSR.LLHY-G...QL----DPR.......-------------------------------------------...LQK
D7BAL1_MEISD/30-105.LEQA.LVWE-G...GL----NPE.......-------------------------------------------.EQQVY
Q2FZE0_STAA8/31-99.ITQL.FAIE-P...AR----LDQ.......-------------------------------------------..QIIA
Q2G2M3_STAA8/6-79.INKI.LIQE-G...IK----KQQ.....I.-------------------------------------------.NEILK
Q2YP21_BRUA2/57-129.IKTL.VFAK-S..GKG----NKT.....V.-------------------------------------------.EQVAA
Q32CT8_SHIDS/110-181AIVRA.WFIQ-S....V----TPR.....F.-------------------------------------------.KEALR
Q5SLJ7_THET8/2-71.ARRV.LVAR-G.....----........V.-------------------------------------------EGWLLK
Q820Y2_TROWT/26-98.SIKL.LIDK-SFALKH----NPR.....V.-------------------------------------------.SKIMN
RLMB_XANCP/7-81NVREV.LIEA-G...SK----NPR.....L.-------------------------------------------.TEIEE
Q8Y7Q4_LISMO/31-99.VLEL.LVSS-G.....----........V.-------------------------------------------..SVPE

PF03465

PELO_HUMAN/271-370AIDTL-LISD-E---LF----RHQDVATRSR...........................................YVRLVD
ERF1_CAEEL/288-424AIETL-ICWE-N---LD----IVRYK.MKNSLGEDILLNLRP....DEEKDKSHFTDSETG..QDMEIIETMPLLEWFAN
PELO_METTH/259-352AVEKL-LVLD-R---VV----SRED.................................................IEGYLD
A0A023ZGV7_YEASX/277-376AISYL-LLTD-K---VL----HSDNIAQREE...........................................YLKLMD
PELO_AERPE/250-349AVDTV-LLVD-T---LL----HSPDDAVREA...........................................VDEALR
RF1_PYRHO/278-417AVDVL-LISE-G---YN----KVR.VRVKCNHCGWEELKTMSEE.EYEVYRKKITKCPKCG..SQNLTIEKWDVAEELIK
PELO_METJA/254-346AIDTL-LVSD-S---LV----RNH.................................................EIEKIID
B2AWT5_PODAN/281-418AVETL-IVFE-N---LE----VTRWV.LKDSNGAEIIIHSTKQ...QDAANRDRFMDKETG..QEMEVVSQESFLEWIAE
PELO_THEVO/247-338ALSDL-IITD-K---KF----RS...................................ETG..............RELLS
ERF1_TRYBB/281-420AVETL-IVYE-D---LN----IYRYTVVKNRGADDEETFVHVM..SEEEAKRSNIHMQESG..KTRNEIEQEDFVDWLAT
D0KRD6_SULS9/245-343AVETV-LVIE-D---LL----SS........................................DEQERLT....IERMLE
Q9BMX1_EUPAE/276-413ALDLL-MCFE-N---LE----INRYE.IRDSANDEIKIYNLNK...EQEKDPKYFKNEKTG..ADLEIIKSGPLSEWLCE
PELO_PYRAB/260-355AVDTL-LVLD-E---LL----KG...DDRE...........................................RIEEIME
RF1_METTH/274-407AVEVL-LLSE-D---LK----YQRGTY....ECASCGHRMEK....TGRDLPDTETCPSCN..DQMRLSDRRDMIDDLVE
RF1_ARCFU/270-403AVDTL-LLSE-D---LR----YER.VKYR..CPKCGKEVEVT....VREGIEKPPFCEEDN..VEMEEVERRDIVLELSE
ERF1_SCHPO/277-416AVETL-LCFA-D---LD----MIRYE.FKNSEGNPVITYMTKEQ.EEKDSTNSFLLDKDTG..AEMELVSSMLLSEWLAE
RF1_AERPE/279-370AVKTL-LIHE-S---RE----D....................................................LEEWVE
RF1_SULSO/275-368AIEAI-VIHE-D---ST----DKE..................................................LEKLAQ
PELO_ARCFU/246-342AIEVL-LVAD-E---FL----LEE....REKW.........................D................VDGLLR
RF1_THEVO/277-410MVDLL-LISE-G---IR----RVKYT.YKCPTCGEEKTFS........EEPSEWPVCDKDG..TPLELIGEDDMIEDLYK
ERF1_BLEAM/280-415AVEVI-LLFE-N---LN----FTRYV.LKNPTTGIEKTLYLT.....PEQEENHDNFIENG..EELEALEKGPLPEWIVD
PEL1_ARATH/271-370AIQTL-LITD-E---LF----RNSDVKTRKK...........................................YVNLVE
ERF1_GIAIN/290-432AVEKL-IVWD-D---LP----YHRVT.LQCVINGETSAPVIKYLLKSQMSNPKYLREVINGEEVQLDIMGDQLLLEWFVD
PELO_DROME/271-370AIETL-LISD-N---LF----RCQDVSLRKE...........................................YVNLVE
ERF1_STYMT/285-422AVETI-LLFE-E---LE----ITRYV.IKNPVKGDTRTLFLNP...TQQKDSKYFKDQASG..LDMDVISEDQLAEWLCH
YNU6_CAEEL/271-370AIETL-LVAD-S---LF----RAQDIETRRK...........................................YVRLVE
PELO_THEAC/247-338ALSDL-IITD-E---MF----RT...................................EDG..............RRSLS
PELO_HALS3/254-356AVEDL-LILD-E---RL----RLERAGE................................GDWVDVD.......VNDLVR
I7MKI5_TETTS/279-414VIENI-LCFE-E---LT----TLRVT.RKNKVTEQITHIFIPP...NELNNPKHFKDGE....HELEKIEVENLTEWLAE
A0A024WDX6_PLAFA/276-411AVELL-ILYE-G---LD----IIRLT.TKNPVTNQTKTMHIS.....PCDEKQESLYKENN..VELEVVEKISLTDWVIG
P79004_SACPS/277-376AVETL-LITD-T---VL----KSDDIDERET...........................................FLDLTY
DOM34_SCHPO/271-370AIGEL-LISD-S---LF----RSSDIATRKK...........................................WVSLVE
RF1_HALS3/281-414SVDRL-LVSE-D---LR----EDVVIYE...CPNDHEEYETI....DRRNTSPEHTCSDCG..EEATEVDREDAIDHLMS
RF1_METJA/277-419AVDTL-IVSE-E---LE----KYKVKIACNNCDYLEEKTVNKLELIKLEEELKNAQCPKCG..GALSIVEEKDYIEYLSE

PF15608

Q0RDF6_FRAAA/285-365VPWRI-LVAP.D---RV....DEL---------------------------------------------------PHVLA
F8A7B9_CELGA/759-840VPWKI-LVRE.D---AD...PRDL---------------------------------------------------RHIRQ
E4NAQ4_KITSK/291-371VPWRI-LARR.G---AG....ADL---------------------------------------------------DHVRL
A1VWP9_POLNA/279-359VPRLL-ILRD.P---SA....PDV---------------------------------------------------AHLKV
Q5NWT5_AROAE/279-359FPQRV-IVRD.C---HD....RKV---------------------------------------------------AHLVA
Q8KL02_RHIEC/282-364VPEKV-YVSS.P---TD....PEL---------------------------------------------------AALMY
D3VJW4_XENNA/275-357VPEHV-LVRS.L---ND....PDV---------------------------------------------------ALLVH
C8XAU5_NAKMY/305-385VPWKI-LVRE.A---DH....PDH---------------------------------------------------QHLRL
F4EXE7_SELS3/265-346LPWKL-LVKSRT---DE....ARL---------------------------------------------------GHLYQ
E6UDF8_RUMA7/266-347MPWKM-LVHSLD---DN....EHL---------------------------------------------------GHLYQ
C3ASG0_BACMY/237-317VPWKI-LIQG.E---NN....PDL---------------------------------------------------KHILL
H8GG70_METAL/281-361EAGRL-LLGN.P---DS....EAT---------------------------------------------------RHLLW
Q9RSA8_DEIRA/269-349QPAHL-LLRD.A---AH....PDT---------------------------------------------------LHLRE
STIP_ACIAD/297-379VPDLV-LLRD.A---DD....EDT---------------------------------------------------RLLRH
F2JGK7_CELLD/289-369VPWKI-LVKD.K---ED....KRI---------------------------------------------------KHILL
Q4FTP9_PSYA2/309-391DPECI-LLAS.A---EH....PDT---------------------------------------------------ILLRH
D1BEJ8_SANKS/295-375VPWKI-LVRA.D---AR....HEL---------------------------------------------------GHVLL
Q2RVZ5_RHORT/280-360MPERL-FLRD.P---QD....GDV---------------------------------------------------GHLVA
C0Z9Y7_BREBN/295-375VPWKI-LVDS.V---EN....PNL---------------------------------------------------AHIIM
C8W646_DESAS/311-391VPWKV-LVKD.A---AN....PDL---------------------------------------------------KHIFL
A8MM96_ALKOO/748-828VPWKI-LVRD.Y---DN....PNL---------------------------------------------------RHILL
F8K488_STREN/279-359VPWRV-LVRP.G---AG....PEL---------------------------------------------------DHVRL
A1SUD4_PSYIN/287-367VPDLL-IVQD.K---LS....PST---------------------------------------------------VHLLK
A4J1D7_DESRM/320-400IPWKI-LVRD.M---NS....PDI---------------------------------------------------KHVLL
F8AVP2_FRADG/278-358VPWKV-VVTP.E---RL....AEL---------------------------------------------------PHVLS
D3RPA4_ALLVD/285-365VPERV-IIRD.P---EA....PEV---------------------------------------------------AHLLE
F4H5N6_CELFA/811-892VPWRV-LVRP.D---AA...DADV---------------------------------------------------AHVRH
H6N264_GORPV/291-371VPWMV-LVRE.P---DL....PEH---------------------------------------------------HHIRV
Q891X7_CLOTE/298-378VPWKI-LINN.L---DN....PNL---------------------------------------------------KHIKL
A6WD80_KINRD/287-371VPWRV-LVRP.E---AELRHPDDL---------------------------------------------------AHVRL
A5WBK3_PSYWF/314-396DPEQV-LLAS.A---DH....PDT---------------------------------------------------ALLRH
E8U3T5_DEIML/257-336RPAAL-VLRA.L---.T....PDT---------------------------------------------------AHLHA
D1A9P2_THECD/292-376VPWQV-LARA.D---MLD..RREL---------------------------------------------------AHIRL
B4EW79_PROMH/276-356VPEHI-LVKE.I---AD....PDV---------------------------------------------------ALLIY
D4L2P5_9FIRM/132-213VPWKI-LIDE.R---YKG..DPQL---------------------------------------------------GHLVR
D5CKQ8_ENTCC/276-357VPDHI-FVRS.I---DD....PDV---------------------------------------------------ALLVG
E3EE68_PAEPS/297-377VPWKI-LIDR.E---DN....PNL---------------------------------------------------QHIML
J9STB4_9ACTO/293-373VPWRI-LVRA.D---DL....PEH---------------------------------------------------RHIRL
M1FGD7_9ALTE/290-371RPDCV-LVRSLG---QD....PDL---------------------------------------------------AALIH
Q186J5_PEPD6/281-358VPYKI-LVKD.L---ND....KSL---------------------------------------------------DHIFI
Q3JCD3_NITOC/292-369VPERL-LLRD.P---GA....EEV---------------------------------------------------AHLLI
Q7CKQ6_YERPE/276-357VPDHV-LVRH.I---DD....PDV---------------------------------------------------SLLVY
R5BVZ9_9FIRM/264-345VPWKV-LVHE.K---YMG..DKAL---------------------------------------------------EHILR
R5XB52_9CLOT/301-379IPYKI-LVDD.L---NN....PKL---------------------------------------------------KHILI
R7CDA0_9FIRM/265-346IPWKV-LIDE.R---YKG..NPQL---------------------------------------------------EHIVR
U5LCP5_9BACI/286-365VPWKI-LMRD.P---ES....PYV---------------------------------------------------RHIKL

PF08228

Q6CTJ8_KLULA/13-168....MLFVCN-K---------D.L.PSVLI---------------------------------------------SQLPI
POP3_YEAST/14-171....CLFVCN-K---------DPDVPLVLL---------------------------------------------QQIPL
Q753G4_ASHGO/13-172....LLFVCT-R---------DGT.PAVLL---------------------------------------------SQVPL
Q6FQW2_CANGA/3-151....YVLALW-N---------D....SMLM---------------------------------------------RQLRL
POP3_SCHPO/7-165QPAVVFILHD-Q---------D....SMLV---------------------------------------------THMPQ

PF01248

Q9XWS4_CAEEL/14-108YAMLAKTG----VHH..YNGN..N.IELGTACGRLFR.V---CTLAVTDAGDSDIIL------------------
RS12_HUMAN/16-111LCA..EHQ----INL..IKVD..DNKKLGEWVGLCKIDR---EGKPRKVVGCSCVVV------------------
RL30E_AERPE/1-95YAKLAGIP----IIV..YRGT..R.MDMGLVMGRRHG.V---SVLAVIDEGSSRILE------------------
RL30_KLULA/8-102YAMLSKTK----VYY..FQGG..N.NELGTAVGKLFR.V---GVVTILDAGDSDILT------------------
RL7A_CHICK/122-216LCR..KMG----VPY..CIIK..SKARLGRLVHRKTCTC---VAFTQVNPEDKGALA------------------
RL8B_YEAST/117-209LCK..KMG----VPY..AIIK..GKARLGTLVNQK...T---SAVAALTEVRAEDEA------------------
RL8_SCHPO/117-212LCK..KMG----VPY..AIVK..NKARLGTVIHQKTAAV---LAVTEVREEDKNELA------------------
RL7A_ANOGA/128-222LCR..KMG----VPY..CIIK..GKARLGTLVYRKTCTC---VALTQVENADKPNLA------------------
RPP38_HUMAN/99-190LSL..SRS----VPA..CQVPRLS.ERIAPVIGLK.C.V---LALAFKKNT..TDFV------------------
SBP2L_HUMAN/702-804IAMAREQE----IPF..VFAL..GRKALGRCVNKLVP.V---SVVGIFNYFGAESLF------------------
NHP2_YEAST/41-135LCE..DHS----VPY..IFIP..SKQDLGAAGATKRP.T---SVVFIVPGSNKKKDG------------------
NHP2_SCHPO/39-133LCE..DNN----VPY..LYTV..SKELLGEASNTKRP.T---SCVMIVPGGKKKDMS------------------
RS12_DROME/23-118LCN..EHQ----IPL..IRVD..SHKKLGEWSGLCKIDK---EGKPRKVCGCSVVVI------------------
RS12_CAEEL/24-119LCA..EHQ----IPL..IKVA..DKKIIGEYCGLCKYDK---EGKARKVVGCSSAVV------------------
RS12A_SCHPO/31-126LCA..ESE----TPL..IKVA..DPKVLGEWAGLCVLDR---DGNARKVVGCSCVAV------------------
RS12_YEAST/26-123LANDPENK----VPL..IKVA..DAKQLGEWAGLGKIDR---EGNARKVVGASVVVV------------------
RS122_ARATH/29-124LCA..DHS----IKL..LTVP..SAKTLGEWAGLCKIDS---EGNARKVVGCSCLVI------------------
RS12_PLAF7/23-119LCA..EKN----IPLFMVQND..S.KDLGHWAGLFKLDN---EGNARKIIGASSVAV------------------
GA45B_HUMAN/21-121FCC..DND----INI..VRVS..GMQRLAQLLGEP...A---ETQGTTEARDLHCLL------------------
GA45A_HUMAN/21-123FCC..END----INI..LRVS..NPGRLAELLLLETD.A---GPAASEGAEQPPDLH------------------
SEBP2_RAT/650-752IDCACEQN----IPF..VFAL..NRKALGRSLNKAVP.V---SIVGIFSYDGAQDQF------------------
O77331_PLAF7/495-595IAKCKEKN----IPI..VFAL..SKNLLGKCINKSRQ.S---IICIIDNDSYIKECN------------------
RL30E_METJA/7-101YAKLSNIP----VYQ..HKIT..S.LELGAVCGKPFP.V---AALLVLDEGLSNIME------------------
RL30E_METTH/1-95YAKLSEIP----VYT..HEGT..S.VELGSVCGKPFT.V---GALLIQDPGDSTILE------------------
RL30E_SULAC/3-97FSKFSDIP----IYL..YKGS..G.YELGTLCGKPFM.V---SVIGIVDEGESKILE------------------
RL30_MAIZE/12-106YAMLAKVT----VHH..FHGN..N.VDLGTACGKYFR.V---CCLSIIDPGDSDIIK------------------
Q9VJ19_DROME/12-106YAMLAKTE----VQH..YSGT..N.IELGTACGKYFR.V---CTLSITDPGDSDIIR------------------
RL30B_SCHPO/22-116YAMLSRCS----VHH..YSGN..N.IDLGTACGKLFR.V---GVLAVIDAGDSDILA------------------
YLXQ_BACSU/4-96KCN..YYK----VPY..KKVE..SRAVLGRSIGKEA..R---VVVAVTDQGFANKLI------------------
Q9WZN2_THEMA/7-99RCE..NKK----VPY..VIMF..SKEELGRLLDKP...A---VSVIGLEEDNLIDAI------------------
RL7A_DROME/127-221LCR..KMG----VPY..CIVK..GKARLGRLVRRKTCTT---LALTTVDNNDKANFG------------------
RL7A1_ARATH/112-207LCR..KME----VPY..CIVK..GKSRLGAVVHQKTASC---LCLTTVKNEDKLEFS------------------
RL7A_ARCFU/13-107LCE..EKN----VPY..IYVK..SKNDLGRAVGIEVP.C---ASAAIINEGELRKEL------------------
RL7A_METJA/15-106LCE..EKG----IPY..AYVA..SKQDLGKAAGLEVA.A---SSVAIINEGDAEELK------------------
RL7A_SULSO/17-111LCD..EKK----IPY..VYVS..SKKALGEACGLQVA.T---ASAAILEPGEAKDLV------------------
RL7A_AERPE/17-111LCD..EKK----IPY..VYVP..SKKRLGEAAGIEVA.A---ASVAIIEPGDAETLV------------------
RL7A_METTH/17-111LAE..EKE----IPY..IYIP..TKDELGAAAGLNVG.T---ASSAIVEAGDAEDLI------------------
Q9SU26_ARATH/20-114LAE..DKN----VPY..VFVP..SKQALGRACDVTRP.V---IACSVTSNEASQLKS------------------
SNU13_YEAST/18-112LCE..DKN----VPY..VFVP..SRVALGRACGVSRP.V---IAASITTNDASAIKT------------------
NH2L1_DROME/19-113LCE..DKN----VPY..VFVR..SKQALGRACGVSRP.I---VACSVTTNEGSQLKS------------------
NHP2_DROME/51-146VCE..EKG----IPY..TYTP..SRADLGAAMGVKRG.T---VALLVRQNEEYKDLY------------------
NHP2_CAEEL/53-148ICE..EKE----IPY..VYIP..SREQLGLAVGHRRP.S---ILIFVKPSGDFKELY------------------
I6TC33_ENTHA/8-96KSS..YYE----VPC..FELF..SEAEITQMIGKP...R---KVFGIVDNGFAKK..------------------
M0Y8U1_HORVD/29-123LCA..EHN----VHL..VTVP..SAKTLGEWAGLCKIDT---EGKARKVVGCSCIVV------------------
N1JG05_BLUG1/33-127LCS..EHK----IPL..IKVP..DGKQLGEWAGLCVLDR---EGNARKVVNCSCVV.------------------
Q385Y8_TRYB2/32-125LAK..QNN----IDL..VSMD..EREKLAQWAGLTRMAA---DGSVRKTLKCSCLA.------------------
Q38AC1_TRYB2/29-122LAL..QAS----IDI..IEVD..SREELAEWAGLQRR.K---QDETVKTFKCSCVA.------------------
Q38BI8_TRYB2/20-112YCTLSKTP----IHH..YSGN..N.LDLGTACGRHFR.A---CVLSITDVGDSDIT.------------------
RL30E_THEKO/7-95YAKLSGIP----VYE..FEGT..S.VELGTLLGRPHT.V---SALAVIDPGESKIL.------------------
RL30E_METMP/2-94YTQLSETP----VYT..HQAT..S.IELGAICGKPFP.V---SALLVLEPGNSAIL.------------------
RL30E_PYRFU/3-94YAKLSDIP----VYE..FEGT..S.VELGTLLGKPFV.V---ASLAIVDPGESKIL.------------------
RL7A_PYRFU/18-111LCE..EKE----IPY..IYVP..SKKELGAAAGIEVA.A---ASVAIIEPGKARDLV------------------

PF08032

Q8CXU2_LEPIN/36-110LIRSI..G----TKN--IKVP--KKI.FEKVSY.RDRPD---GLIATAFFFETG---------------------
O96263_PLAF7/86-167ELKKR..N----VSI--QYME--KYK.MNELVG.GFPHN---DIIMKTH.YRYM---------------------
Q6BTY4_DEBHA/128-204LAKRY..G----LRI--DRKD--SKNDLNVLSD.NGVHN---GIVLETKPLELP---------------------
RMTL1_DROME/141-217VAQVE.TG----TKI--YKVP--QHD.LKTWSS.LVTPP---GLMAIFDRPSDK---------------------
RLMB_VIBCH/5-81ELMRL..G----VSI--QEMS--RKA.LDDKAE.GANHQ---GLIARVKPARQL---------------------
Q92QI6_RHIME/59-133DLTAL..P----FPT--ETVM--PQE.LDRILGPDAIHQ---GVMLETQPLPHR---------------------
Q7MBB6_GLOVI/92-168AAKAG..G----AVI--DIVE--PRR.LDQLTA.GGNHQ---GVAAQAAAHPYV---------------------
RLMB_RALSO/6-82AAEAA..G----VRM--IPAD--NER.LRGIAG.TDRHQ---GVVAKAEALSLA---------------------
Y479_MYCPA/69-145RAADS..G----ISI--LEVP--RAD.LDRMTG.NHLHQ---GIALQVPPYIYA---------------------
Q7U7F6_SYNPX/177-253DAKAS..G----VLV--EEVT--WAR.LGQITG.GSVHQ---GIALQTAAAETI---------------------
Q73GK0_WOLPM/11-88YANSK..G----IKV--RLVE--NKI.LNDVLPKGANHQ---GIALNAAPILYN---------------------
Q8E1Z2_STRA5/15-89LATEK..K----VSI--SWTP--KKT.LSDMTN.GGVHQ---GFVLKVSEFAYA---------------------
Q8D323_WIGBR/4-80ISNEK..N----IKI--KFVD--KKF.LNKITN.NKKHQ---GIVAYIKNSKIL---------------------
Q6MS22_MYCMS/5-77EFDLKKTK----IKV--NVVS--ENK.LDQLLETQTQHQ---GIIAQIKDFNYT---------------------
Q97EF9_CLOAB/9-84KAKEK..G----IPV--KYVD--RKK.LDKISN.GGVHQ---GVIAISTPYNYC---------------------
Q6C040_YARLI/179-258MARKL..R----IPT--ENVD--RNT.LNLITK.HAIHN---GVALVTKPLELD---------------------
Q8DK28_THEEB/45-121EAKQQ..G----AII--DTVT--PER.LDQLCQ.RGRHQ---GIAIQVAAYNYW---------------------
Q6ADI2_LEIXX/89-166LATGR..A----IPV--LEIM--RPE.LDRLAGRDAVHQ---GVALKVPPYEYV---------------------
Q890M7_CLOTE/5-80LAKEN..R----IPI--KNVD--KKK.LDEISE.GENHQ---GVAAYTTPYKYY---------------------
Q6FPX7_CANGA/108-186LCKEK..G----IKI--DTAD--KHQ.LNLITK.SAVHN---NMVLECKPLSIP---------------------
Q7NAH8_MYCGA/23-94LIKQK..G----IEY--ELHT--IKW.FDNQYRDLPNHQ---GFVAEIDGSSLT---------------------
Q9A907_CAUCR/33-109ACLKA..G----GEV--IEVN--REI.LEKVSR.RDNPQ---AVVAVFKQVFTP---------------------
RLMB_SHEON/6-82QAKAF..G----TSI--QVTS--RKV.LDEKAE.STQHQ---GIVARVKAAKIL---------------------
Q98N81_RHILO/2-76DLAAL..T----FKA--ELVE--PRD.IDKITGSDAVHQ---GVLIEAEPLKPK---------------------
MRM1_SCHPO/33-108KLQYK...----IPI--KSVN--KEH.LNQITA.CRPHN---GVVLEASSLNVP---------------------
Q7VFD1_HELHP/2-74QLAQL..D----KPI--KRVD--MKK.AQALAH.GGNHQ---GILASIIPPSPL---------------------
Q8A814_BACTN/7-81ALKGL..L----IPV--QRVP--VER.INRIT..RKNHQ---GVVAFISSVTYQ---------------------
Q6YQX1_ONYPE/823-895FLQKH..N----IAY--QLVD--KKF.LYDLTK.QKTHQ---GVAANVCDYTFY---------------------
Q9PQG4_UREPA/33-108YTLYD..N----IQI--YKVS--GNI.IKKLSV.NIEPS---PILAVVKIKQEM---------------------
O25279_HELPY/4-76LKKAC...----PNI--IKVD--NKK.AQSLAK.GGNHQ---GVLAKVELPLAV---------------------
RLMB_COXBU/6-81KAKAL..G----VKV--ILLS--RTE.LNTLS..NEKHQ---GIVADCEEVENL---------------------
Q6AGD8_LEIXX/38-113AAAAA..G----TQV--EFVT--EQV.LGTIAD.TVTPQ---GFVAVARQFPTS---------------------
Q9K894_BACHD/31-100AWHVD..E----RDV--ILVS--DRV.MADLTE.TKTPQ---GIAAICHIPDEP---------------------
Y1673_SYNY3/38-112DRLMA.QS----VHS--YLVS--GEV.LAKMAS.TVNPD---GVVATLTMDQFW---------------------
Q9CJY1_PASMU/125-200YLAEQ..K----KAY--HVVD--SAE.LALVSG.TAHHG---GICMLVKKARPF---------------------
Q8Z0C3_NOSS1/42-116DACSR..C----DRY--EIVS--EEV.LQAIAT.TVQPD---GVVATAKRSEQQ---------------------
Q7MTU3_PORGI/6-80EAVER..C----VPV--MHVP--IEK.LDRLT..SKNHQ---GVVAILSAIEYT---------------------
RLMB_NITEU/6-82LAETT..S----TRL--ILCE--QDR.LCKMTG.TTRHQ---GVAAHVTKLRRY---------------------
Q8XJ72_CLOPE/31-104KINEN...----IKL--IQMN--EAL.LKQLCS.TENPQ---GIVGVINMQNKE---------------------
YACO_BACSU/7-81LAKKQ..G----ITI--QYVP--RKK.LDQMV..TGQHQ---GVVAQVAAYEYA---------------------
Q74L24_LACJO/8-85LARKK..N----LVV--QNAP--KNK.LDQMVN.HENHQ---GLVLTVAPFEYA---------------------
Q891T6_CLOTE/31-105NIEVI..E----NKV--YILN--ESS.FNSISG.TENSQ---GILAIVNMKEVL---------------------
Q6MIZ9_BDEBA/55-130LALKN..H----IKV--ELKA--EAA....LEKFGPSQQ---GAAIFVDGAPEF---------------------
O84408_CHLTR/29-103ELTSL..G----IEK--LYCS--KDI.LEKLSF.KENPE---NFIAVFEKKELS---------------------
RLMB_NEIMB/6-82KAANE..N----IRV--YFAD--ADR.LNAISK.GARHQ---GVVGFIDASKNH---------------------
RLMB_ACIAD/6-82LAEPF..G----ISV--QKAS--RDS.LEKLAG.LPFHQ---GVVAAVRPHPVL---------------------
Q6CLR7_KLULA/125-198LCSKN..N----IQT--EEVD--KHR.LNLYTN.YAVHN---NVVLECKPLQPP---------------------
Q8YXQ3_NOSS1/83-159QAKDN..G----AVI--DEVD--TKR.LDQITD.QANHQ---GIAAQIAPYSYI---------------------
Q9RWC1_DEIRA/2-76LARDA..G----VRV--RWLP--RIE.LDQLVG.TTQHQ---GVVAEVEELQWA---------------------
Q9X263_THEMA/2-78EVEKR..G----IKY--SFES--EER.LKNLSG.TKKHQ---GVVFDIGEYRYS---------------------
Q8KBA1_CHLTE/33-106AG......----.KA--WLAG--PNE.FKRLAQTTSP.Q---GVVAAFRKPESG---------------------
Q81L29_BACAN/31-99DWTVN..D----VEM--YIVP--EAI.VKVLRE.TETTQ---GVFAVCEKHESE---------------------
Q9L0Q5_STRCO/72-149LAAER.GG----INL--MEAP--RPE.LDRMTN.GLNHQ---GLVLQVPPYEYA---------------------
Q6NFC4_CORDI/71-147IAHSR..G----IPM--IEVP--RHE.MDLMTG.NGMHQ---GIGLQIPPYKYT---------------------
O83093_TREPA/27-102YLAAR..K----RLY--RSAN--TQE.LERLTQ.SVHHQ---GVAATIDEPRFP---------------------
Q74D57_GEOSL/5-80FAAER..G----VPV--RTRD--KRD.LARLCG.TDHHQ---GVALRVEGFAYA---------------------
RLMB_HAEIN/4-80ELYSL..G----IGV--QFVN--RQT.LDKKAD.GEVHQ---GVIARVQAAKEL---------------------
Q6AJ92_DESPS/48-125LARAA..K----VKV--TFID--SIS.LQGDGAASARHQ---GVIAKVTQADLM---------------------
Q6N4H3_RHOPA/40-113ENIDT..R----IAP--EIVR--PSE.IDRQLGPDAVHQ---GMLAEADPLQGP---------------------
Q828C9_STRAW/57-135EARDA..G----ARV--HLAD--EAV.IADIST.TVTPQ---GLVGICRFLDTP---------------------
Q9KGF2_BACHD/5-80LAKEQ..G----VLV--QHVP--KRK.LDQLIG.HENHQ---GVVASVAAYEYA---------------------
RLMB_CHRVO/6-82KAGAE..N----VKL--HIVD--KER.LDSMSG.NARHQ---GVVAMIDASMNY---------------------
RLMB_PECAS/4-80ELEAQ..G----IVI--QVAS--RQW.LDKQAE.DAVHQ---GIVAKVKEGRKY---------------------
Q9CHW1_LACLA/29-104GSEKLLTD----LSV--NLVS--KEV.LKSLAD.SESPQ---GLIAEVTKIEEV---------------------
Q74ID9_LACJO/31-102TYKLK..D----NKV--IQIT--DAI.AQHLSS.TKNSQ---DIFMVLPINQPK---------------------
Q839V3_ENTFA/43-117AAKEQ..A----VPV--KWVP--KAK.LDTMSD.HGVHQ---GMVLAITAYQYL---------------------
Q8R7T5_THETN/6-80MAKEA..G----IVV--STAD--SDT.LKRLAQ.TPNHQ---GVVAVGALYKYF---------------------
Q73J63_TREDE/10-85YLASN..K----RLY--RIVS--DDE.LEKLSE.SVHHQ---GVTAMIFEPEIP---------------------
Q75B46_ASHGO/118-191LAGQL..G----IKV--QSAQ--RHQ.LNMMTN.NAVHN---GLVLEAKPLYPQ---------------------
Q6AAT1_PROAC/72-148FAADH..G----IAL--MQAT--RGE.LDRMTG.GSNHQ---GVALRLPEYEYA---------------------
MRM1_YEAST/125-198IVDEL..K----VTT--ELVD--KHR.LNLLTN.YGVHN---NIALETKPLQPV---------------------
MRM1_HUMAN/51-129MAEAR..D----IPV--LRPR--RQK.LDTMCR.YQVHQ---GVCMEVSPLRPR---------------------
Q7NN60_GLOVI/29-103ALSGR..A----GRY--ETVA--PAV.IEALAD.TVHPS---GVVAAVRRRADA---------------------
Q831U7_ENTFA/31-103WLAEQ.ET----EKL--IFVS--DEV.LNSLSE.LPTSQ---GILAIVTLETQQ---------------------
Y355_MYCPN/9-79LIKKR..G----LRY--EMHS--SQW.FHQQFR.HINHQ---EFVCVINPNQML---------------------
Q7TU91_PROMP/190-266DLKSK..G----VLI--EEVP--WSR.LSQLTS.GAVHQ---GVALQHASTESI---------------------
RLMB_PSEPK/6-81LAAEN..R----VPV--GQAE--RRE.MDAWV..EGVHQ---GVVAEVSPSQVW---------------------
Q6A7V4_PROAC/41-113VATCR..G----VRV--VVLT--DED.VNALSD.TVTSQ---GIFAVCRQVTRR---------------------
Q7MSH0_WOLSU/29-101EISRL..G----IPL--LRVD--PKK.AQAMAR.GGNHQ---GFLMEIEAISPL---------------------
Q92F34_LISMO/9-83LAKER..K----IQV--QFVP--KQK.IEKVV..SGAHQ---GVAAQVAAYQYA---------------------
Q8KC03_CHLTE/18-94TARRL..R----IPC--GKAR--MEK.LTLLSG.TAKNQ---GVCALLTSVTFY---------------------
Q8CXP3_OCEIH/5-79LAREA..G----TIV--QKVP--RSK.LDQME..LGNHQ---GVVAYVASYTYA---------------------
Q72G19_DESVH/7-82LCREM..R----VRF--SLVE--GQV.LDKLY..AGGHQ---GVVARLFEAGYV---------------------
Q9PR20_UREPA/3-73LINKN..K----ITY--EIVN--EAW.FKQFDH.SLNHQ---NIAFKLVKKNFQ---------------------
O67731_AQUAE/6-79LAKKR..G----VKV--QRIS--RKK.VEELAG.TKKTQ---GVVALLSPVNYV---------------------
RLMB_BLOFL/4-80RIRKM..N----INI--QECT--RRV.LNIKSM.KSAHQ---GIIAEVIPMPAL---------------------
Y955_SYNY3/125-201TAKAN..G----TVV--DEVD--NFR.LNQITH.NANHQ---GIAAQVAPYHYW---------------------
Q9XWY8_CAEEL/44-125RIDEL..G----IQK--TLLT--DDQ.LDRLTE.FQLHN---GICMDASALQFS---------------------
C5DY76_ZYGRC/130-203LAKSR..N----VEL--VETD--KHR.LNLMTN.YAVHN---NIILETKPLQPP---------------------
D7BAL1_MEISD/30-105AALGRVGR----LAL--LEVS--EAV.LKKLSV.RDNPA---GLIALARMPER.---------------------
Q2FZE0_STAA8/31-99YAQ.....----.EV--FEIN--MKV.AESLSG.TVTPQ---GFFAIIEKPHY.---------------------
Q2G2M3_STAA8/6-79NAKDQ..K----IIV--QTVP--KSK.LDFLA..NAPHQ---GVAALIAPYEYA---------------------
Q2YP21_BRUA2/57-129RTFAK..G----GLV--LEVT--EKV.ISAITR.RDNLQ---MVAGVFEQ....---------------------
Q32CT8_SHIDS/110-181WMAAN..R----KAY--HVVD--EAE.LTKASG.TEHHG---GVCFLIKKR...---------------------
Q5SLJ7_THET8/2-71ELERL..G----APY--TLVP--RIE.LDTLLR.TTHHQ---GIAAEVEDPPY.---------------------
Q820Y2_TROWT/26-98YS.....D----IPH--IFVP--RST.LDRLT..DLPHQ---GVALLCKSYRP.---------------------
RLMB_XANCP/7-81QARRK..G----IDV--RRVN--TQA.LDGVGG.QVRHQ---GVAARYAAAR..---------------------
Q8Y7Q4_LISMO/31-99EWLKG..D----YDV--FEIS--TEI.SHLISE.TMTEQ---GVFAVVATSEP.---------------------

PF03465

PELO_HUMAN/271-370SVKEN--A----GTV--RIFS--SLHVSGEQL.SQLTGV---AAILRFPV-------------------------
ERF1_CAEEL/288-424NYKNF--G----AAL--EIVT--DKSQEGAQFVRGFGGI---GGLLRYRV-------------------------
PELO_METTH/259-352MVESM--G----GSV--VLIS--SEHEGGKQL.ESLGGL---AGILRFKI-------------------------
A0A023ZGV7_YEASX/277-376SVESN--G----GKA--LVLS--TLHSLGEEL.DQLTGI---ACILKYPL-------------------------
PELO_AERPE/250-349LVESM--G----GRV--IIIP--GDSPAGERL.VSFGGV---IALLRYPV-------------------------
RF1_PYRHO/278-417MAEEA--G----SDV--EIIS--LDTEEGQQFYRAFGGL---GAILRFKI-------------------------
PELO_METJA/254-346TTEEM--G----GKV--VIVS--SEHDAGKQL.KALGGI---AGLLRFPI-------------------------
B2AWT5_PODAN/281-418HYKDF--G----TTL--EFVS--DRSTEGNQFVKGFGGI---GGILRYKV-------------------------
PELO_THEVO/247-338LARSV--G----TDI--HIVS--TSNDMGEII.EKFGGY---AGILRYKV-------------------------
ERF1_TRYBB/281-420NYRKF--G----CAL--ELIT--NRSQEGTQFVRGFGGI---GGVLRYKL-------------------------
D0KRD6_SULS9/245-343DIENK--R----GEV--ILVP--KESPIYFEL.KNLTGI---LAILRFRI-------------------------
Q9BMX1_EUPAE/276-413NYSKF--G----IKL--EFIT--DKSQEGFQFVNGFGGI---GGFLRFKL-------------------------
PELO_PYRAB/260-355MARNL--R----ANV--VVVS--SEHEGGDKL.KALGGI---AAILRFKI-------------------------
RF1_METTH/274-407MAEEV--G----TEV--EIIS--TETEEGMQLLRAFGGI---GAILRYRP-------------------------
RF1_ARCFU/270-403LAEST--G----AKV--EFLS--TESEEGEMLYKAFGGI---AAILRFKP-------------------------
ERF1_SCHPO/277-416HYKDY--G----ANL--EFVS--DRSQEGMQFVKGFGGI---GAVMRYQL-------------------------
RF1_AERPE/279-370KAKSS--G----AQV--IVVP--ESLAEAEWFLKTFGGL---AGILRFRI-------------------------
RF1_SULSO/275-368DAENY--G----VKV--FVVG--DEVPEAEWVKKTFNGI---VGKLRYRL-------------------------
PELO_ARCFU/246-342EVEES--G----GKV--VIMS--TEFEPGKRL.MSLGGI---AALLRFNV-------------------------
RF1_THEVO/277-410LAKES--G----AQV--EIIS--DQSDEGKLLKQAFGGL---AAVLRFIR-------------------------
ERF1_BLEAM/280-415NYMKF--G----AGL--EFIT--DRSQEGAQFVRGFGGL---GAFLRYQV-------------------------
PEL1_ARATH/271-370SVKDS--G----GDA--FIFS--AMHVSGEQL.AQLTGI---AALLRFPL-------------------------
ERF1_GIAIN/290-432NYKNY--G----ASL--EFIT--NRSAEGTQFCSGFGGI---GGLLRWQV-------------------------
PELO_DROME/271-370SIRDA--G----GEV--KIFS--SMHISGEQL.AQLTGI---AALLRFPM-------------------------
ERF1_STYMT/285-422NYQNY--X----AQV--EFIT--DKSQEGYQFVKGFGGI---GGFLRYKV-------------------------
YNU6_CAEEL/271-370SVREQ--N----GKV--HIFS--SMHVSGEQL.AQLTGC---AAILRFPM-------------------------
PELO_THEAC/247-338IAQTV--G----TRI--HIVS--VSNDPGQIV.KKFGGF---AGILRYRV-------------------------
PELO_HALS3/254-356TVEQQ--G----GSV--TVFS--HEFAPGEQL.RNLGGI---GAVLRYRL-------------------------
I7MKI5_TETTS/279-414HYSEF--G----AEL--YFIT--DKSAEGCQFVKGFSGI---GGFLRYKV-------------------------
A0A024WDX6_PLAFA/276-411NYKKY--G----ASL--DFVT--NKSQEGAQFQKGFGGF---GGMLRYKI-------------------------
P79004_SACPS/277-376NIEQS--G----GRV--FVFS--TLQSHGEEL.GRLKGL---ACILKYPI-------------------------
DOM34_SCHPO/271-370GVKEI--N----CPV--YIFS--SLHESGKQL.DLLSGI---AAILTYPV-------------------------
RF1_HALS3/281-414IADQR--G----TET--HFIS--TDFEKGEQLLTAFGGY---AGILRYST-------------------------
RF1_METJA/277-419LCEQS--G----AKL--VTVS--SETEEGAMILNAFKGI---AAILRYKI-------------------------

PF15608

Q0RDF6_FRAAA/285-365LAADR--G----VAV--------EEM..ADL..-PFSCV---GLVRP----------------------------
F8A7B9_CELGA/759-840LAHER--G----VPV--------EPA..PDL..-PYACI---GLIHP----------------------------
E4NAQ4_KITSK/291-371LAEQR--G----VPV--------EET..DDL..-PYTCV---GLIHP----------------------------
A1VWP9_POLNA/279-359LASEK--S----VPL--------MVD..ADL..-PYQAV---SLIQS----------------------------
Q5NWT5_AROAE/279-359LAEEK--A----VPV--------ETD..ASL..-PYNAV---SIIRS----------------------------
Q8KL02_RHIEC/282-364LIDNK--G----VPY--------VVS..PRKIA-PYRAV---TLIRH----------------------------
D3VJW4_XENNA/275-357LARQK--N----VVI--------TEV..GDLIG-QYRAV---TIIKK----------------------------
C8XAU5_NAKMY/305-385LAADR--G----VPV--------EVV..PDL..-AYSCV---GLVRQ----------------------------
F4EXE7_SELS3/265-346LAKEK--G----VEI--------VEY..PLE..-NYLAC---GLIRS----------------------------
E6UDF8_RUMA7/266-347LAEEK--G----CEL--------VEY..PLK..-HYRAC---GLIKA----------------------------
C3ASG0_BACMY/237-317LAKEK--N----VPV--------EIY..KDM..-TYSCC---GIIKP----------------------------
H8GG70_METAL/281-361LAESK--S----IPI--------EVC..PDM..-PYRAA---ALIKE----------------------------
Q9RSA8_DEIRA/269-349LAAAS--G----TPV--------TMH..PDL..-PYLAA---AIIAS----------------------------
STIP_ACIAD/297-379LTQIT--K----TPV--------QVV..GDQIA-PYRAI---TLIQK----------------------------
F2JGK7_CELLD/289-369LARDR--G----VPV--------EVY..QDM..-CYSCC---GLIKD----------------------------
Q4FTP9_PSYA2/309-391LCAQR--H----IPI--------RVL..GDKIL-PYQAI---TLIKQ----------------------------
D1BEJ8_SANKS/295-375LAEQR--G----VEV--------VEV..QDL..-PYSCV---GLIHP----------------------------
Q2RVZ5_RHORT/280-360LASSK--G----IAV--------ETL..ADL..-PYSAC---AIIKT----------------------------
C0Z9Y7_BREBN/295-375LAKDR--G----VLV--------EER..SDM..-SYSCC---GIIRS----------------------------
C8W646_DESAS/311-391LAEER--G----VSV--------ECC..PDM..-SYSCC---GLVKT----------------------------
A8MM96_ALKOO/748-828LAKDR--N----VEV--------EVY..PQM..-TYGCC---GLIKP----------------------------
F8K488_STREN/279-359LARRR--G----VPL--------VET..EGL..-PYACV---GLVHP----------------------------
A1SUD4_PSYIN/287-367LAKEK--N----IDV--------VEM..NDM..-PFGAC---ALIKD----------------------------
A4J1D7_DESRM/320-400LAKDR--G----VTV--------EEH..PNL..-SYSCY---GLIKN----------------------------
F8AVP2_FRADG/278-358LCEAK--G----VPV--------EER..ADL..-PYSCV---GIIKP----------------------------
D3RPA4_ALLVD/285-365LAHEK--N----VRR--------QVD..PTL..-PYQAV---SLIKG----------------------------
F4H5N6_CELFA/811-892LAAER--G----VPV--------ETV..ADL..-PYSCV---GLIHP----------------------------
H6N264_GORPV/291-371LAAER--G----VPV--------EVR..SDL..-AYSCV---GLVKE----------------------------
Q891X7_CLOTE/298-378LAKDK--C----IPI--------EVY..KDM..-SYSCC---GVIKS----------------------------
A6WD80_KINRD/287-371LAAQR--G----VVV--------EEV..PGL..-SYSAI---GLIHP----------------------------
A5WBK3_PSYWF/314-396LCQQK--G----VAV--------TVI..GEQIL-PYQAV---TIIKK----------------------------
E8U3T5_DEIML/257-336LADAH--G----VPV--------HVA..AHL..-PYAAL---ALVHE----------------------------
D1A9P2_THECD/292-376LAAER--G----VPV--------VEVEPDAF..-PYACM---GLIRP----------------------------
B4EW79_PROMH/276-356LAKQK--N----ITV--------TEA..GKALG-QYRAV---TIIKK----------------------------
D4L2P5_9FIRM/132-213LAEEK--N----VSI--------QYY..PMK..-HYKCC---GIIKK----------------------------
D5CKQ8_ENTCC/276-357LAREK--G----IVV--------TEM..GGTLG-QYRAV---TIIKK----------------------------
E3EE68_PAEPS/297-377LAKDR--G----VPV--------EVF..EGL..-TYSCC---GIIKP----------------------------
J9STB4_9ACTO/293-373LAAER--D----VPV--------EVS..PDL..-AYSCV---GLIKE----------------------------
M1FGD7_9ALTE/290-371LCRQD--G----VDL--------IAA..PELTG-PYRAI---TLIRE----------------------------
Q186J5_PEPD6/281-358LAKEK--N----VEV--------EQM..DLK..-AYKCC---GIIKN----------------------------
Q3JCD3_NITOC/292-369LAEEK--G----VVV--------EHQ..PNM..-PFNAV---AFIK.----------------------------
Q7CKQ6_YERPE/276-357LAKQK--K----IAI--------KEV..GNELG-QYRAI---TIIKK----------------------------
R5BVZ9_9FIRM/264-345LAKEK--N----VPV--------QTY..PLK..-NYKAC---GIIKK----------------------------
R5XB52_9CLOT/301-379LAKEK--N----VEV--------EEF..DFK..-AYSCC---GIIKN----------------------------
R7CDA0_9FIRM/265-346LAEEK--H----TPV--------EYY..PLT..-HYKCC---GIIKK----------------------------
U5LCP5_9BACI/286-365LAEER--G----VEI--------VRY..PDM..-SYTCC---GLIKK----------------------------

PF08228

Q6CTJ8_KLULA/13-168LCETSDHT....VTL--VQLPRLSSAKFDDA..-.FRDVVHDGMCLVRTHAHYQ.DFAKMISTKVEPLSIPWLHS
POP3_YEAST/14-171LCYMAPMT....VKL--VQLPKSAMDTFKSV..-..SKY...GMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNA
Q753G4_ASHGO/13-172AAHVSALD....VAV--VQLPCGTLARFDEHLP-GTPHD...GMLLVPETAAVDPAFVQKVRASVERRAIPWLEP
Q6FQW2_CANGA/3-151LVAVKN......VPL--IPINKKINNKLLEHV.-GDSYA...DVLLLKKTASLDQSLANLLDS.IEQPPTPFLEP
POP3_SCHPO/7-165LVANANFYGSSKCRL--VPLGFSAQALIAKKL.-GLSRA...GAIAVQDDSPLWKYLKDLVMN.IEEPQARWLSE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window