Sequence alignment for CL0103

PF01263

GAL10_KLULA/363-684----RVVS------------------------------------LG-K--G.TSFE-VKL-A----NL------------
LACXC_LACLL/1-281----MTIE------------------------------------LK-N--..EYLT-VQF-K----TL------------
Q9LY79_ARATH/87-360----SRIL------------------------------------LT-D--P.AGST-AEV-L----LY------------
Q9KQJ7_VIBCH/25-292----KIVR------------------------------------VI-H--D..KAS-AAI-S----LH------------
Q9RP27_HAEIF/22-269----PVLH------------------------------------LK-H--..AVGT-AKI-S----LQ------------
Q9VRU1_DROME/25-359----KRFT------------------------------------LT-N--G.AGMS-VQL-I----TR------------
Q9RDN0_STRCO/33-363----YRWS------------------------------------LE-N--..GGTR-MKV-L----SY------------
P73504_SYNY3/14-276----YHLE------------------------------------DD-Q--S.LARL-SLV-P----GR------------
Q986V3_RHILO/14-303----ELVS------------------------------------IS-D--G.IATV-DIA-P----AA------------
Q9SVZ5_ARATH/40-321----DKII------------------------------------IR-D--R.RGRS-AEV-Y----LY------------
YEAD_ECOLI/27-288----DLIV------------------------------------VD-H--P..QVK-ASF-A----LQ------------
Q9CMU5_PASMU/26-273----PAIS------------------------------------LQ-H--..DIGS-AVI-A----LQ------------
Q9SUQ4_ARATH/25-301----DQIL------------------------------------LQ-N--P.RGAS-VKI-S----LH------------
Q9VKF7_DROME/25-355----HSYT------------------------------------LK-N--T.KGMS-VTV-I----QL------------
Q9VP02_DROME/25-355----RRYT------------------------------------LK-N--S.KGMT-VSV-I----QL------------
GALM_BACSU/14-319----PAIK------------------------------------AG-N--E.HLEM-IVV-P----EW------------
YIHR_ECOLI/19-304----QTVS------------------------------------LA-A--G.D.YH-ATI-V----TV------------
Q9K995_BACHD/17-344----RAFT------------------------------------MT-N--D.HGME-VTC-I----EY------------
Q97L65_CLOAB/18-336----KCIR------------------------------------FA-A--G.GYEA-LII-P----DV------------
Q9HJQ6_THEAC/19-286----VSLQ------------------------------------IV-S--G.K.SR-ASI-S----EI------------
Q986G3_RHILO/15-295----DEIE------------------------------------LA-D--G.RASL-VVR-P----RE------------
GALM_SHIFL/16-342----RLLT------------------------------------LR-N--N.AGMV-VTL-M----DW------------
Q9CF52_LACLA/4-275----QLLT------------------------------------LK-N--N..ELT-VQI-N----PK------------
Q9A8D6_CAUCR/39-373----EALT------------------------------------LT-N--G.AGVS-ATV-I----TY------------
GALM_HAEIN/16-338----QLIT------------------------------------LQ-N--E.NGMR-VQF-M----DW------------
Q97A31_THEVO/1-267----MDIS------------------------------------IG-D--D.S.NG-AVI-S----IV------------
Q9M6D7_CHLRE/53-318----PVVV------------------------------------LK-H--A.CGAS-AEM-Y----LF------------
GALM_STRTR/17-342----SKIS------------------------------------ME-N--N.NGVV-IST-L----TT------------
Q9RDP4_STRCO/15-319----HRWT------------------------------------LE-R--..AGVR-VRV-L----SY------------
Q9ZB17_9LACT/13-335----DLIS------------------------------------LT-N--K.AGVT-ISF-T----NL------------
GAL10_SCHPO/369-689----RLHT------------------------------------IC-F--..QDLE-VSI-A----NY------------
Q99RT5_STAAM/13-331----DLIK------------------------------------ID-N--D..ETK-IIF-T----NY------------
Q9KRP2_VIBCH/20-347----KLIE------------------------------------LT-N--R.RGMR-VVV-M----DI------------
Q9L7R7_SALTM/6-278----KTIQ------------------------------------LN-A--G.H.YQ-AKI-V----TV------------
AAPC_CENCI/34-310----EKVV------------------------------------LR-G--A.RNCC-AEI-Y----LY------------
YH10_YEAST/11-338----EVIT------------------------------------IG-D--A.KKLQ-ATI-S----EL------------
Q97T84_STRPN/18-341----LAYR------------------------------------FE-T--D.GGYQ-LEV-M----TY------------
Q9CN43_PASMU/23-271----PVLE------------------------------------LN-H--P.HLGE-AKV-A----LQ------------
Q9A381_CAUCR/1-279----.MVA------------------------------------IE-K--G.GARL-VFA-P----EV------------
O94124_RHIST/13-358----DQYT------------------------------------LI-N--KKKTLA-VMI-M----TH------------
Q9LVH6_ARATH/10-338----EIFE------------------------------------LN-N--G.T.MQ-VKI-S----NY------------
Q9M308_ARATH/24-299----DQVL------------------------------------LR-N--P.HGAS-AKI-S----LH------------
P94168_ACTPL/2-319----KTFT------------------------------------LE-N--..SFLK-ITL-S----DF------------
Q9FJY6_ARATH/46-305----PKLV------------------------------------LT-S--P.QNSE-AEI-Y----LF------------
Q98MW4_RHILO/4-274----DSQT------------------------------------LQ-G--D..GIS-AII-V----GQ------------
Q9HZ52_PSEAE/28-281----DLLL------------------------------------ID-H--P..LCQ-AVF-S----RQ------------
Q9PB74_XYLFA/16-284----PSLL------------------------------------IQ-T--P..FSH-AAI-S----LF------------
O48971_TOBAC/28-351----GIYE------------------------------------IK-K--G.D.FS-VKI-T----NY------------
Q97JD7_CLOAB/16-338----YKYT------------------------------------IS-N--K.NGMK-FSC-I----SH------------
Q9HTE2_PSEAE/30-311----DLAC------------------------------------WR-I--HTAHGE-ALI-A----QQ------------
Q9LVC5_ARATH/18-294----DKIV------------------------------------LR-E--S.RGRS-AEV-Y----LY------------
Q05765_SACPS/73-396----RFVT------------------------------------IG-A--G.TRFQ-ATF-A----NL------------
GALM_PIG/20-338----EKFQ------------------------------------LQ-S--D.Q.LR-VDI-I----SW------------
Q9CM12_PASMU/17-340----QLVT------------------------------------LS-N--A.KGMS-IQV-M----DW------------
GAL10_PACTA/363-685----RLNT------------------------------------VR-T--FNGKFE-VSI-S----NH------------
YN9A_YEAST/11-339----GVIT------------------------------------IG-D--E.KKFQ-ATI-A----PL------------
Q9V3D1_DROME/12-282----SVVV------------------------------------LD-R--G.NNTT-CTI-N----LH------------
Q9WYB8_THEMA/23-351----YQYT------------------------------------LI-N--K.NGMM-AKI-I----TY------------
YPHB_ECOLI/2-286----TIYT------------------------------------LS-H--G..SLK-LDV-S----DQ------------
Q9CFG9_LACLA/19-330----SQIT------------------------------------LS-N--..ERLT-IVV-H----DY------------
Q9VY83_DROME/24-362----RRYT------------------------------------MT-N--T.NRLS-VAI-I----QL------------
Q9STT3_ARATH/32-354----KTYK------------------------------------LT-R--G.S.LS-VTF-T----NY------------
GALM_ACICA/38-376----DLYT------------------------------------MS-N--N.NGVS-VSF-I----SF------------
Q97ES5_CLOAB/1-281----MCVR------------------------------------LE-N--E..NFK-AEL-S----ES------------
Q9LXG7_ARATH/161-485----GLYE------------------------------------LK-K--G.N.LT-VKF-T----NW------------
YMY9_YEAST/9-287----EVVL------------------------------------TH-P--ADETTS-VHI-L----KY------------

PF14486

C8TCN7_KLEPR/63-369QEGSKILT------------------------------------IH-S..KDGLTI-TLS-P----TR------------
Q6CYX0_ERWCT/66-372QEGSKVIT------------------------------------IT-S..QDGLKI-ALS-P----TR------------
D8MS65_ERWBE/63-369QEGSKIIT------------------------------------LT-S..ANGLTI-TLS-P----TR------------
D4E903_SEROD/84-389QEGSKVIT------------------------------------LT-S...PGLTI-ALS-P----TR------------
C4UXP6_YERRO/63-368QEGSKVIT------------------------------------IT-S...KGLTI-ALS-P----TR------------
A4VGA8_PSEU5/62-367QEGVSLIE------------------------------------ID-N...GTMRM-TVV-P----TR------------
Q4ZR72_PSEU2/63-368QEGVSIID------------------------------------ID-N...GTMKL-SVV-P----TR------------
A4SJ08_AERS4/64-370QEGVDLLI------------------------------------VD-N...GVMKI-TLV-P----TR------------
E7S0H9_9BURK/63-369QEGVMLVE------------------------------------ID-T...GAMKI-TVV-P----TR------------
C1DDL0_AZOVD/63-368QEGVSLID------------------------------------ID-N...GAMTI-TVV-P----TR------------
E1JSY6_DESFR/65-370QEGSTRIT------------------------------------IV-T...PELEV-SLI-P----TR------------
A6VRI9_MARMS/45-355QTGSRLIT------------------------------------LT-V..GDSV.V-RVV-P----TR------------
B2STA4_XANOP/63-368QEGSMLVE------------------------------------ID-T...GAMQL-TVV-P----TR------------
B5JRI2_9BACT/46-358QEGVDVVE------------------------------------IN-N...GKLSF-AVL-P----TR------------
A6DJS3_9BACT/68-374QEGVELVT------------------------------------IN-N...GEIEI-DII-P----TR------------
E8TDX5_MESCW/37-354ERGIRMLE------------------------------------FR-T..GSGLRF-TAL-V----DR------------
E7U952_ECOLX/28-330AKGTEAFD------------------------------------VR-T..GAGLAF-TVV-K----DR------------
A6CCQ6_9PLAN/48-358SEGVDLIT------------------------------------VN-N...GALSL-SIV-P----TR------------
A3U233_9RHOB/60-376ERGIRMLE------------------------------------FR-T..GSGLRF-TVL-V----DR------------
E7S0S6_9BURK/68-374QEGVMLVT------------------------------------ID-T...GAMKI-TVV-P----NR------------
A3ZMH7_9PLAN/47-353SQGVDVVE------------------------------------VT-S...GGFRL-RIL-P----TR------------
B2IFZ2_BEII9/79-384QEGVDLIT------------------------------------VD-N...GKLSF-SIV-P----TR------------
F2AXT9_RHOBT/49-355SEGVEIVR------------------------------------LK-N...SRMHV-DVL-P----TR------------
C6XPV1_HIRBI/37-353ERGIRILE------------------------------------FR-S..GTGLRF-TVL-I----DR------------
D2R5D2_PIRSD/48-359SAGVDMLE------------------------------------IS-N...GAITV-ELL-P----TR------------
Q2CC41_9RHOB/37-353ERGQRMLD------------------------------------FR-T..GSGLRF-TVL-V----DR------------
Q1AYM2_RUBXD/37-346GRGVRALE------------------------------------FR-T..GSGLSF-DVL-V----DR------------
E8R531_ISOPI/45-351REGVDLIE------------------------------------VE-S...GLLRF-SIV-P----TR------------
D1CHA6_THET1/37-338ARGMRVAT------------------------------------VR-T..GSGFEF-QVL-L----DR------------
D5SWV3_PLAL2/49-356SAGVDVLS------------------------------------VQ-L...GDVSF-EIL-P----TR------------
D6ZVF2_BIFLJ/35-343AHGLKAIE------------------------------------VK-N...GPLRF-VSM-A----DR------------
A4FGH2_SACEN/53-349ARGARRFQ------------------------------------VR-T..GSGLVF-DVL-P----DR------------
F0SP29_PLABD/45-353SQGVEVVE------------------------------------AN-N...GSLTA-YII-P----TR------------
C6W7A5_DYAFD/39-348GRGTRIAW------------------------------------IN-T..GGGLRF-KVV-I----DR------------
C5EMT3_9FIRM/31-332AKNMNAWE------------------------------------IK-S...GHMAF-HVM-A----DK------------
C6JDQ2_9FIRM/29-333AEGLQAYE------------------------------------VK-N...DRLSF-SVM-I----DK------------
C5EVY1_9FIRM/58-359AGGMKAVE------------------------------------VK-S...GAVRF-TAA-L----DK------------
D2QJ04_SPILD/29-338GRGTRIAW------------------------------------IN-T..GTGLRY-KVV-I----DR------------
A3HYW8_9BACT/35-344GRGVRVAW------------------------------------IN-T..GTGLRY-KVL-L----DR------------
D9RZ46_THEOJ/37-341ARGVEAVD------------------------------------VN-N..GNGLRF-TIL-L----DR------------
B6G216_9FIRM/38-339SKDCDIIE------------------------------------VT-T..GTGLIF-EIN-A----TR------------
E5VLF0_9FIRM/26-323SDGMHVLH------------------------------------IR-N..GLGMEL-MIN-A----DR------------
E4HSQ4_PROAA/36-345STGIAALR------------------------------------IS-N..SRGY.I-EAL-P----FM------------
A4AFA2_9ACTN/35-332ARGARRLR------------------------------------IV-N..GSGMEV-ELH-P----DR------------
A5ZM38_9FIRM/24-319GDGMRLYE------------------------------------AT-N..GKGLEL-TLS-P----DR------------
D1N8M9_9BACT/32-325GRGSRLIE------------------------------------FR-N..GSGLAF-TVA-P----DR------------
F2PD67_PHOMO/32-333NSGVHAVE------------------------------------IQ-N..SKG.RL-VIL-P----FM------------
A7VPY4_9CLOT/30-334AAGVETVD------------------------------------VW-N..YAGLAF-SVY-P----GR------------
A7VTY4_9CLOT/24-319GDGMRLLQ------------------------------------VR-N..GLGLEF-TVS-A----DR------------
C0W0W1_9ACTO/33-337ETGIESLT------------------------------------LT-N..SRGF.V-EIL-P----YM------------
D7GQT9_9FIRM/30-326AAGLRCAM------------------------------------IH-N...GPLEL-PLM-L----DK------------
B3W843_LACCB/26-319ATGMKAVR------------------------------------MY-N..EAGLNL-LVA-P----DR------------
D4M7N6_9BACT/32-333ARGAAVYQ------------------------------------VS-T..AGGLDF-DVL-P----DS------------
E7NWQ8_TREPH/35-339EKGIAAIE------------------------------------VR-N..GSGLNF-TVL-E----SK------------
B5QP71_LACRH/26-319ASGMKAIR------------------------------------MY-N..EAGLRL-LVT-P----DR------------
C2K0S4_LACRH/29-322AAGLKMIR------------------------------------MY-N..EAGLSM-LVA-P----DR------------
E7GTM1_CLOSY/30-326ASGLRCAL------------------------------------VQ-N...GPLEF-LLM-L----DK------------
E1JKF2_9LACO/27-315STGLKAYN------------------------------------VF-T..ESGLSM-NIL-I----DR------------
D2S5J5_GEOOG/37-338GWGAPALM------------------------------------VR-N..PAGVSF-EVL-L----DR------------
B2Z3U5_AGRRK/36-329GRGQRLLI------------------------------------GR-N..ANGVAF-EIA-V----DR------------
C5C3Q0_BEUC1/37-320GSGSRVMH------------------------------------VA-P..AGGIHA-RLL-L----DR------------
C8XH26_NAKMY/26-324GRSGGVLR------------------------------------AR-V..AGGLDL-EVL-P----DR------------
A6UBC7_SINMW/28-308VSGGEMRT------------------------------------IL-NVADAASHL-VLD-P----SS------------

PF14849

YIDC_BURCH/79-353-----LVK------------------------------------FS-T----DVYD.GEI.D....TR------------
YIDC_AERHH/67-347-----LIT------------------------------------VS-S----DVLK.LTL.D....TQ------------
YIDC_SHESA/67-342-----LIT------------------------------------VK-T----DQLD.VQI.N....PV------------
YIDC_MAGSM/86-360-----LLH------------------------------------FK-N----DLVE.GSL.S....LQ------------
YIDC_SYNFM/76-350-----SWA------------------------------------IE-D----PLYR.MNI.I....AP------------
A0M3I9_GRAFK/92-360-----STT------------------------------------IS-N----DLLE.LKI.S....NK------------
A0NSE7_9RHOB/91-371-----RVT------------------------------------ID-T----PSLE.GSV.N....LK------------
YIDC_FRATN/81-354-----SIT------------------------------------IN-T----GVFKDVKV.S....LL------------
A0RNG0_CAMFF/78-324-----IVQ------------------------------------IS-G----KTYN.ATI......DE------------
A0Y4R8_9GAMM/71-343-----VIE------------------------------------IT-T----DVFK.VKI.D....TK------------
A0Y965_9GAMM/94-374-----RIK------------------------------------VK-T----DMLE.IDI.N....TL------------
YIDC_ECOK1/60-343-----LIS------------------------------------VK-T----DVLD.LTI.N....TR------------
YIDC_PELPD/70-338-----DVT------------------------------------VR-T----GLYT.AVF.C....SR------------
YIDC_CHLPD/72-345-----LQT------------------------------------VE-N----DLFK.VTL.S....SK------------
A1ESE5_VIBCL/35-310-----TIT------------------------------------VS-T----DVLT.LSI.D....TL------------
A1JT86_YERE8/60-342-----LIT------------------------------------VK-T----DVLS.LTI.N....TR------------
A1KCP9_AZOSB/62-337-----RVK------------------------------------VV-T----DVLQ.AEV.S....AE------------
YIDC_NEIMF/55-343-----PIT------------------------------------VT-T----DTVQ.AVI.D....EK------------
YIDC_SHEAM/67-342-----LIL------------------------------------VT-T----DQLE.IQI.N....PV------------
YIDC_PSYIN/82-356-----SVT------------------------------------IA-N----DELR.LTI.S....LV------------
YIDC_MARAV/89-367-----FIT------------------------------------VT-T----DVYE.LKI.D....RV------------
A1UTM0_BARBK/88-378-----RIT------------------------------------IK-T----DELE.GSI.N....LV------------
YIDC_DESVV/71-335-----EVT------------------------------------VT-T----PLYK.AVL.H....SG------------
A1VUS5_POLNA/88-366-----QLT------------------------------------VN-T----DVLS.LTF.D....SE------------
A1VZU9_CAMJJ/78-325-----ISK------------------------------------VQ-S----KHFE.AQI......DS------------
A1WDB6_ACISJ/89-367-----RVT------------------------------------VS-T----DVLR.LSF.D....SE------------
A1WSU1_VEREI/90-364-----RVQ------------------------------------VQ-T----DLYR.LTF.D....SQ------------
YIDC_HALHL/76-353-----RVR------------------------------------VK-T----DLIE.AEI.S....TQ------------
A2SMI9_METPP/84-359-----TVT------------------------------------VS-T----DVLK.LTL.D....SR------------
A2TVU8_9FLAO/95-369-----TTT------------------------------------IS-N----DVLE.IKV.S....NK------------
A3EQG7_9BACT/54-314-----SLS------------------------------------IQ-N----KDVR.WSV.S....LR------------
A3HZF9_9BACT/83-351-----LVT------------------------------------LE-N----DLIK.VSI.S....TK------------
A3J0Y5_9FLAO/92-366-----VTE------------------------------------IK-N----EVLS.LKI.S....NK------------
A3JKS5_9ALTE/114-392-----YVH------------------------------------VI-T----DVFD.ITI.D....QV------------
A3JXJ6_9RHOB/79-358-----RLP------------------------------------LD-T----ARLE.GSI.S....LT------------
A3M8Z0_ACIBT/26-325-----LIS------------------------------------VQ-T----DLYH.LWI.N....PK------------
YIDC_RHOS1/70-368-----RVV------------------------------------ID-T----PRLQ.GSI.S....ML------------
YIDC_SHELP/68-343-----LIS------------------------------------VT-T----DQLT.LKI.N....PV------------
A3RT33_RALSL/84-353-----KIV------------------------------------VT-T----DVIR.ATV.D....TA------------
A3S812_9RHOB/79-365-----RIP------------------------------------VE-T----ARIS.GSI.S....LL------------
A3TU25_9RHOB/82-369-----RLG------------------------------------ID-T----PRLA.GSI.N....LR------------
A3UBQ3_CROAH/95-366-----VTT------------------------------------FE-N----DVLF.LKV.A....NK------------
A3UFD6_9RHOB/80-359-----RIE------------------------------------IR-T----EALS.GSL.S....LT------------
A3V0A3_VIBSP/65-340-----TIT------------------------------------VT-T----DVLT.LSI.D....TV------------
A3V4K5_9RHOB/73-362-----RIA------------------------------------IE-T----PELT.GSI.S....ML------------
A3VF89_9RHOB/85-374-----RIP------------------------------------VE-T----PKLS.GSI.S....LI------------
A3W4K6_9RHOB/74-363-----RLN------------------------------------ID-T----PSLQ.GTI.S....LQ------------
A3WNL1_9GAMM/79-352-----LIT------------------------------------VV-T----DELE.LKI.D....LN------------
A3X1F9_9BRAD/81-371-----RVK------------------------------------IH-T----PRLS.GSL.S....LT------------
A3X407_9RHOB/76-363-----RIS------------------------------------IE-S----DRIT.GSI.S....LQ------------
A3XGM2_LEEBM/97-368-----VTE------------------------------------LE-N----DVLA.LKV.S....NK------------
A3YIB8_9GAMM/75-352-----LIR------------------------------------VV-T----DALI.VSI.D....PV------------
A4AW41_MARSH/92-364-----VTT------------------------------------LE-N----ELVT.LKI.S....NK------------
A4BD89_9GAMM/80-356-----VIS------------------------------------VR-T----DTLD.VRI.S....LD------------
A4BP05_9GAMM/69-343-----RIS------------------------------------VV-T----DLFA.IEI.N....TV------------
A4CDJ1_9GAMM/72-344-----YIS------------------------------------VT-T----DVLK.VKL.D....TK------------
A4CNB4_ROBBH/96-366-----TTL------------------------------------LE-N----DVLS.LEI.S....NK------------
A4EH88_9RHOB/73-362-----RVA------------------------------------IE-T----GEFS.GSI.S....LQ------------
A4EPF1_9RHOB/75-363-----RLA------------------------------------ID-T----PRVT.GSI.A....LQ------------
YIDC_HERAR/86-359-----VIT------------------------------------IT-T----DLMK.IGI.D....TA------------
A4MW21_HAEIF/65-339-----IIT------------------------------------LE-N----DVFR.LKI.D....TL------------
YIDC_PROVI/72-345-----KMV------------------------------------VE-N----DLFR.ATI.S....SK------------
A4TZQ4_9PROT/78-357-----RIR------------------------------------IN-T----PTLH.GSL.S....VT------------
YIDC_PSEU5/82-358-----LIR------------------------------------VR-T----DVLD.LAI.D....PR------------
A4YLD0_BRASO/97-387-----RVK------------------------------------ID-T----PRLS.GSI.S....LK------------
A5EY44_DICNV/67-344-----RVR------------------------------------VK-T----DVLD.IAF.S....TQ------------
A5FHA5_FLAJ1/97-371-----FTT------------------------------------IE-N----EKIK.LKI.A....NK------------
YIDC_ACICJ/80-374-----RLA------------------------------------IS-T----PLLR.GSM.S....LV------------
YIDC_GEOUR/67-335-----DLV------------------------------------VE-T----DLFT.AVF.S....TR------------
YIDC_LEGPC/74-351-----LIQ------------------------------------VK-T----DVLD.VGI.D....LK------------
A5PCQ5_9SPHN/75-347-----RIR------------------------------------ID-S----PKVA.GSI.A....VG------------
A5VCE7_SPHWW/74-350-----RVA------------------------------------ID-T----PKLA.GSI.N....LK------------
A5VVS9_BRUO2/96-377-----RIE------------------------------------ID-T----PSLR.GSI.N....LT------------
YIDC_PSEP1/82-360-----LIR------------------------------------VK-T----DVLE.LAI.D....PV------------
A5WI37_PSYWF/86-362-----LIN------------------------------------VT-T----DRYQ.VKI.D....PV------------
A5ZDH4_9BACE/85-357-----KIS------------------------------------IQ-N----NVAE.ITF.A....TK------------
A6D430_9VIBR/65-340-----IIT------------------------------------VK-T----DVLT.LGI.N....TV------------
A6DA77_9PROT/64-307-----VAK------------------------------------IE-A----KNYE.VKI......DS------------
A6ESJ9_9BACT/103-373-----TTV------------------------------------IE-N----DVLY.LEV.S....NK------------
A6EY90_9ALTE/92-370-----LIT------------------------------------VR-T----DVYE.LKI.D....RV------------
A6FI67_9GAMM/66-346-----LIT------------------------------------IS-S----DVLE.LTI.D....TL------------
A6FLS2_9RHOB/78-359-----RVA------------------------------------IS-T----PSLD.GSI.S....LK------------
A6G3S3_9DELT/89-365-----EHR------------------------------------IA-N----ELLA.VTVDS....EP------------
A6GL25_9BURK/86-359-----TIT------------------------------------VK-T----DVLE.LQF.S....SQ------------
A6Q3D4_NITSB/79-325-----LVK------------------------------------IT-S----AKFD.LFI......DN------------
A6QAL2_SULNB/79-326-----LAT------------------------------------VT-S----NTFK.ITI......DE------------
YIDC_JANMA/85-357-----IVT------------------------------------IT-T----DLIK.ADI.D....TV------------
YIDC_KLEP7/59-343-----LIT------------------------------------VK-T----DVLE.LTI.N....TN------------
YIDC_SINMW/85-365-----RVA------------------------------------ID-T----PALS.GSI.N....LT------------
YIDC_ACTSZ/62-334-----VIT------------------------------------LQ-N----DVFR.LKV.D....TL------------
YIDC_MARMS/79-356-----LIE------------------------------------VT-T----DTLR.VAI.N....PV------------
A7GYZ3_CAMC5/72-316-----LAK------------------------------------IK-G----QNYE.AQI......DE------------
YIDC_ANADF/73-347-----LVK------------------------------------LV-G----DGFE.ATL.T....SH------------
A7HPT9_PARL1/93-373-----RVP------------------------------------IL-S----EELQ.GSV.S....LR------------
A7I143_CAMHC/78-324-----ITQ------------------------------------IK-G----KIAN.FSI......DD------------
A7IGM3_XANP2/99-378-----RAA------------------------------------IE-T----QRLK.GSI.A....LK------------
A7JWZ0_PASHA/67-339-----TIT------------------------------------VE-S----DVLR.LTI.D....TL------------
YIDC_CROS8/60-344-----LIT------------------------------------VK-T----DVLS.LTI.N....TR------------
A7V5B9_BACUN/84-357-----QVT------------------------------------IQ-N----NLAE.ITV.D....TK------------
A7ZCY9_CAMC1/70-314-----IAT------------------------------------IK-G----QSYE.AKI......DK------------
A8EV97_ARCB4/88-333-----VSV------------------------------------IK-T----AKNI.IEI......DN------------
YIDC_RICM5/71-350-----RIK------------------------------------IE-S----ESLT.GSI.S....LK------------
YIDC_SERP5/60-340-----LIT------------------------------------VN-T----DVLS.LTI.N....TR------------
YIDC_SHEPA/71-346-----LIT------------------------------------VI-T----DQLE.IKI.D....PV------------
A8ILM2_AZOC5/88-369-----RVA------------------------------------IE-T----PSLR.GSI.S....LR------------
YIDC_DINSH/79-367-----RVQ------------------------------------ID-T----PALE.GSI.S....LL------------
A8PQB3_9COXI/66-338-----FIH------------------------------------VK-T----DVLD.VWI.D....TV------------
A8TUD8_9PROT/88-367-----RIT------------------------------------IS-T----PRVQ.GSI.A....LK------------
A8UPQ4_9FLAO/98-370-----ITT------------------------------------VE-T----DVFE.LKF.S....RK------------
A8UV65_9AQUI/85-321-----TLK------------------------------------YS-M----GGFS.VEI.S....PK------------
A8UZM0_9AQUI/104-350-----FIE------------------------------------IK-T----SYGV.VKI.S....KI------------
A9C1M1_DELAS/86-361-----NVT------------------------------------IS-T----DVLR.LTF.D....SQ------------
A9DU76_9RHOB/83-371-----RVA------------------------------------IA-T----DKVS.GSI.S....LM------------
A9EHP0_9RHOB/78-366-----RLT------------------------------------IE-T----PRVS.GTI.S....LL------------
A9HKS4_GLUDA/56-342-----RLA------------------------------------ID-A----PKVA.GSI.D....LL------------
YIDC_BORPD/87-362-----QVV------------------------------------VS-T----DVLR.LTF.D....TT------------
A9IXD9_BART1/90-380-----RIA------------------------------------IK-T----NELE.GSI.N....LV------------
YIDC_COXBN/80-358-----LIT------------------------------------VR-T----DVLD.VEI.D....TQ------------
YIDC_METEP/92-379-----RVR------------------------------------ID-T----PALY.GSI.G....LK------------
B0QWJ2_HAEPR/71-343-----TIT------------------------------------IE-T----DVLR.LTV.D....TL------------
YIDC_XANCB/91-370-----AIT------------------------------------LT-S----DVL...RL.K....LD------------
YIDC_CAUSK/79-389-----RIA------------------------------------VD-T----PALS.GSI.A....LK------------
YIDC_XYLFM/76-359-----VIN------------------------------------VT-T----DVL...QL.K....LD------------
YIDC_HAES2/64-338-----VIT------------------------------------LE-N----DVFR.LKV.N....TL------------
B0VGK2_CLOAI/73-333-----IIK------------------------------------LS-N----QLMT.VTF.N....SR------------
YIDC_METRJ/93-380-----RVR------------------------------------IE-T----PALS.GSI.A....LK------------
YIDC_POLNS/81-360-----KFT------------------------------------LQ-N----DVLV.LEI.S....AS------------
B1Y0F7_LEPCP/82-364-----KVV------------------------------------LT-T----DVVK.ATF.D....SR------------
YIDC_BEII9/87-368-----RVK------------------------------------LD-T----PNLF.GSI.N....LR------------
B2PV42_PROST/59-343-----LIT------------------------------------VK-T----DVLD.LRI.N....TR------------
YIDC_PORG3/88-364-----QVE------------------------------------LA-N----GKIA.LKL.S....TK------------
B2URJ4_AKKM8/83-384-----EVN------------------------------------GR-Q----EPFITYTF.N....RI------------
B2V9H4_SULSY/78-323-----LVR------------------------------------IK-T----KEGY.IEF.S....NI------------
YIDC_ERWT9/60-343-----TIT------------------------------------VK-T----DVLS.LNI.N....TR------------
YIDC_GEOLS/69-337-----DVT------------------------------------VE-T----ERYT.AVF.S....GV------------
YIDC_CHLL2/73-345-----LVT------------------------------------VD-N----ELFT.MTL.S....SK------------
YIDC_CHLPB/77-350-----LLT------------------------------------ID-N----ELFT.AVL.S....SR------------
YIDC_RHIE6/87-366-----RVA------------------------------------ID-T----PALS.GSI.N....LA------------
B3QCI2_RHOPT/95-385-----RIK------------------------------------VE-T----PRLS.GSI.A....LK------------
YIDC_CHLP8/75-348-----IIT------------------------------------VD-N----DLFT.AEL.S....SK------------
YIDC_CHLT3/79-354-----KIQ------------------------------------IE-T----DLFT.ATL.S....TK------------
YIDC_CUPTR/88-357-----KIV------------------------------------VT-T----DTVR.AEI.D....TA------------
B4F0U1_PROMH/62-343-----LIT------------------------------------VK-T----DVLD.LRI.N....TQ------------
YIDC_PHEZH/77-357-----RVK------------------------------------ID-T----PMLT.GSL.S....LR------------
YIDC_PROA2/73-346-----LLT------------------------------------VD-N----EYFT.AVL.S....SR------------
YIDC_PELPB/72-345-----LLK------------------------------------VE-N----DLFR.ATL.S....SK------------
B4U8V7_HYDS0/77-310-----GVL------------------------------------LH-F----KDAD.VKF.A....YN------------
B4W6P1_9CAUL/77-360-----RVP------------------------------------IQ-S----GTLK.GSL.S....LQ------------
B4X1P5_9GAMM/90-373-----RIE------------------------------------VS-T----DVLR.VEI.N....PV------------
YIDC_GEOBB/76-344-----DVT------------------------------------VD-T----DLYT.AVF.S....TQ------------
B5EJI9_ACIF5/71-332-----AVS------------------------------------FQ-T----QVFT.GRI.S....LN------------
B5FEU7_VIBFM/67-341-----LIT------------------------------------IT-T----DVLT.LKV.D....TL------------
B5J3A9_9RHOB/75-355-----RIM------------------------------------ID-S----ENLT.GSL.S....LT------------
B5JPX1_9BACT/91-373-----FVS------------------------------------LE-N----DDFE.VRF.T....NY------------
B5JT26_9GAMM/80-355-----SIR------------------------------------VK-T----DVLD.IAI.N....TR------------
B5TVD7_9PAST/67-352-----TIT------------------------------------IE-S----DVLR.LTV.D....TL------------
B5WNV2_9BURK/79-353-----LVK------------------------------------FS-T----DVYS.GEI.D....TR------------
B5YLC7_THEYD/75-318-----EVS------------------------------------IE-N----DVFK.VIL.S....NE------------
B6AYD8_9RHOB/77-364-----RIA------------------------------------IE-T----GRLK.GSI.S....LL------------
B6BRA8_9PROT/69-342-----RIK------------------------------------FE-N----QSII.GSI.S....LK------------
B6BVS1_9PROT/64-333-----KIV------------------------------------VK-T----SLYE.AEI.N....TV------------
B6C620_9GAMM/76-350-----TIE------------------------------------VK-T----DLLA.IKI.G....MA------------
B6JJN8_OLICO/93-374-----RIK------------------------------------IE-T----PNLI.GSI.A....LK------------
B6R8Z5_9RHOB/90-370-----RLT------------------------------------ID-T----PSLS.GSV.N....LK------------
B7X1D2_COMTE/87-361-----DVT------------------------------------VG-S----DVMR.LTF.D....SE------------
YIDC_DESVM/76-340-----EVT------------------------------------VV-T----PLYK.AVL.H....SG------------
YIDC_METSB/81-364-----RLK------------------------------------ID-T----PAIF.GSL.S....LK------------
B8FMU7_DESAA/80-351-----DIT------------------------------------VD-T----PLYH.AVF.T....EK------------
YIDC_THISH/78-359-----RIR------------------------------------VV-T----DVLD.IEI.D....TR------------
YIDC_CAUCN/78-377-----RIE------------------------------------VD-T----PALS.GSI.A....LK------------
B8J2U4_DESDA/74-342-----DLT------------------------------------VD-T----PLYE.AVV.Y....SG------------
B8KLJ5_9GAMM/111-388-----IVQ------------------------------------VY-T----DSLQ.VAI.D....LN------------
B9D1D7_WOLRE/75-318-----IAV------------------------------------IK-G----EHFE.ARI......DE------------
B9KFP9_CAMLR/73-319-----IAV------------------------------------VK-S----EHFE.AHI......DS------------
B9KI96_ANAMF/142-427-----RVR------------------------------------LG-N----TSVR.ASI.S....LK------------
B9L9D7_NAUPA/72-316-----IAT------------------------------------VS-A----KNFQ.IKI......DS------------
YIDC_GEOSF/69-337-----NIV------------------------------------VD-T----DLFI.AVF.S....TK------------
B9NL98_9RHOB/75-368-----RVQ------------------------------------ID-T----PRLK.GSL.S....LS------------
B9R1R8_9RHOB/93-373-----RVV------------------------------------ID-T----PRLE.GSI.N....LT------------
B9XJP0_9BACT/84-382-----TLV------------------------------------VT-N----DNAV.YTF.T....SR------------
B9Z8U5_9NEIS/66-349-----RIT------------------------------------VS-T----DLYK.AEI.D....TV------------
C0BJD0_9BACT/83-354-----NVK------------------------------------IT-T----DNFS.VEV.Q....SK------------
C0DYB8_EIKCO/59-347-----PIT------------------------------------VS-T----DTLK.AVI.D....EN------------
C0N352_9GAMM/79-352-----KVH------------------------------------VK-T----DVMD.LHI.A....TQ------------
C0QIZ1_DESAH/83-349-----TIQ------------------------------------VS-N----QFYN.IAI.S....ET------------
C1AEP7_GEMAT/82-361-----QLS------------------------------------VD-T----TVVKTASA.DYRTTNQ------------
YIDC_LARHH/64-349-----TIT------------------------------------VT-T----DLVK.AQI.N....TA------------
C1DTT8_SULAA/77-322-----NIK------------------------------------VK-T----KFGY.IEF.T....PF------------
C1F9G1_ACIC5/93-378-----TTT------------------------------------VE-S----PLYR.VTF.T....NR------------
C2M324_CAPGI/89-358-----FTE------------------------------------IE-N----NLIK.LQV.S....NK------------
C3X5V7_OXAFO/83-357-----LVT------------------------------------VT-T----DVLK.VQI.N....SE------------
C3XJR0_9HELI/78-326-----IAT------------------------------------IE-A----EGFI.YKI......DK------------
C4GKM4_9NEIS/60-349-----PVS------------------------------------VE-T----DTVK.ATI.D....EK------------
C4K7P5_HAMD5/61-343-----KIT------------------------------------VT-T----DVLS.LTI.D....TQ------------
YIDC_TOLAT/62-347-----LLT------------------------------------LR-S----DVLE.LTV.D....TL------------
YIDC_DESMR/68-332-----RIT------------------------------------ID-T----PLYT.AVL.N....ST------------
C4ZKT3_THASP/75-351-----RAV------------------------------------VE-T----DLLR.AEV.S....AQ------------
YIDC_TERTT/87-365-----QIH------------------------------------IS-T----DTLD.LVI.D....TN------------
C5CSC1_VARPS/84-368-----QVN------------------------------------VT-T----DLFK.AVI.D....SE------------
C5EXY9_9HELI/76-325-----IAT------------------------------------IK-A----KNFE.YKI......DR------------
C5ZXJ0_9HELI/77-326-----ITT------------------------------------IN-G----ENFE.YQI......DR------------
YIDC_DESAD/74-338-----RLT------------------------------------VE-T----PLYS.AVI.N....SQ------------
C6C779_DICDC/59-340-----LIT------------------------------------VK-T----DVLS.LTI.N....TR------------
C6ICV7_9BACE/83-355-----FTT------------------------------------IQ-N----NLVE.ITL.D....NK------------
C6NT82_9GAMM/85-343-----SVP------------------------------------FA-T----QVYQ.GSV.S....LL------------
C6W539_DYAFD/66-333-----DLV------------------------------------IE-T----KDAR.VVF.T....NK------------
C6WTV5_METML/74-344-----NIA------------------------------------VT-T----DLYK.INI.N....TM------------
C6XBU5_METSD/72-344-----RIQ------------------------------------VE-T----DVYK.AVI.D....TT------------
C6XF04_LIBAP/70-349-----RVE------------------------------------LK-N----PSLI.GSI.N....LK------------
C6XQ56_HIRBI/83-363-----RID------------------------------------FD-A----SSVD.GSI.S....LK------------
C7BT51_PHOAA/58-340-----LIT------------------------------------VK-T----DVLS.LTI.N....TR------------
C7D7D3_9RHOB/76-363-----RIA------------------------------------IE-T----EKLS.GSI.S....LL------------
C7JEI5_ACEP3/72-355-----RVA------------------------------------IN-A----PAVQ.GTL.N....LR------------
C7LXJ6_DESBD/71-334-----KLS------------------------------------VD-T----PLYR.AVI.N....SS------------
C7M523_CAPOD/94-367-----VTV------------------------------------LE-N----KDIK.LTI.S....NR------------
C7RRI8_ACCPU/72-357-----TFT------------------------------------VK-T----DLFV.AHI.S....RI------------
C8N7Q9_9GAMM/78-349-----VIH------------------------------------VK-T----DVLE.LDI.A....NK------------
C8PZ49_9GAMM/83-358-----LIS------------------------------------VM-T----DKYD.IRI.N....PV------------
C8S4X2_9RHOB/70-359-----RLT------------------------------------ID-T----PLLQ.GSI.S....ML------------
C8X4E9_DESRD/89-350-----RVT------------------------------------VE-T----PLYK.ATI.N....AA------------
C9CUD9_9RHOB/81-369-----RLA------------------------------------IN-T----PRVE.GSI.S....LK------------
C9P930_VIBME/65-340-----TVT------------------------------------VT-T----DVLT.LSI.D....TV------------
C9PM89_9PAST/65-339-----VIT------------------------------------LE-N----DVLR.LKV.D....TL------------
C9R685_AGGAD/66-340-----IIT------------------------------------LE-N----DVFC.LKI.N....TL------------
C9RS07_FIBSS/98-377-----SVT------------------------------------VE-T----DKFI.MTL.T....NK------------
C9YCP9_9BURK/79-362-----RFE------------------------------------VS-T----DVLK.LTF.D....TL------------
D0D3Z8_9RHOB/78-366-----RLP------------------------------------ID-T----ARLG.GSI.S....LT------------
D0I2Z1_VIBHO/48-321-----LIT------------------------------------LQ-S----DVLT.LTV.D....TQ------------
D0KXN2_HALNC/87-369-----TIT------------------------------------VK-T----DVLA.LKI.S....LQ------------
D0MGR8_RHOM4/82-358-----TIT------------------------------------IE-T----DLYE.AQL.S....TK------------
D0RR44_9PROT/72-345-----RIK------------------------------------IE-N----SAVE.GSI.A....LT------------
D0Z129_LISDA/65-339-----LIT------------------------------------IK-T----DVLA.LTV.D....TL------------
D1B2U2_SULD5/83-329-----IVK------------------------------------IK-A----ASYE.MHI......DR------------
D1KCD1_9GAMM/86-354-----HTT------------------------------------VS-T----DLLT.VEI.S....HK------------
D1RD64_LEGLO/74-351-----IIH------------------------------------VK-T----DVLD.IGI.D....LQ------------
D2TY53_9ENTR/58-342-----FIT------------------------------------VK-T----DVLE.LRI.N....TR------------
D2UGY9_XANAP/85-366-----RVT------------------------------------VT-T----DVL...RL.T....MD------------
D3NRY2_AZOS1/85-363-----RVK------------------------------------ID-T----PALH.GSV.N....LV------------
D3PB77_DEFDS/67-312-----VFE------------------------------------VS-T----DYVS.ISF.D....KN------------
D3RS85_ALLVD/78-354-----PIR------------------------------------VE-T----DVLR.LEI.S....PR------------
D3SFF1_THISK/81-365-----QFT------------------------------------VR-T----DKHE.LLI.D....TR------------
D3SM35_THEAH/68-295-----TLS------------------------------------YR-L----GDFS.IKI.S....PQ------------
D3VFZ9_XENNA/54-335-----LIT------------------------------------VK-T----DVLS.LHI.N....TR------------
D4DLV5_NEIEG/57-345-----PIT------------------------------------VS-T----DTVN.AVI.D....EK------------
D4FAW5_EDWTA/70-352-----LIT------------------------------------VK-T----DVLA.LTI.N....TR------------
D4H194_DENA2/71-316-----TFD------------------------------------VL-T----DNVR.YVF.N....AN------------
D4YZ11_SPHJU/74-348-----RVA------------------------------------IR-T----PKIT.GSI.N....LK------------
D4ZD76_SHEVD/70-345-----LIT------------------------------------IH-T----DQLV.IKI.N....PV------------
D5AM40_RHOCB/67-374-----RVT------------------------------------ID-T----PALT.GSI.S....LL------------
D5BGP8_ZUNPS/95-365-----TTV------------------------------------LE-N----DVLR.LEV.A....NK------------
D5BTZ8_PUNMI/94-376-----RIL------------------------------------ID-A----PLIT.GSI.S....VM------------
D5CQJ8_SIDLE/71-344-----KID------------------------------------VT-T----DIFK.VVI.N....TT------------
D5H4L9_SALRM/114-393-----RIV------------------------------------VE-S----DLYT.VVL.S....TK------------
D5MLW8_9BACT/77-342-----EAI------------------------------------VE-T----DVVR.AVL.T....SR------------
D5QCU3_GLUHA/64-351-----RLA------------------------------------IN-T----GRVG.GSI.N....LR------------
D5QKL0_METTR/94-373-----RIA------------------------------------ID-T----PSIA.GSI.A....LV------------
D5V159_ARCNC/94-340-----VST------------------------------------IT-T----GKNI.IQI......DK------------
D5V9B9_MORCR/81-356-----LIT------------------------------------VS-T----DRYE.IKI.N....PV------------
D5X092_THIK1/88-361-----LTT------------------------------------IR-T----DLMD.VKI.S....SR------------
D6L2A6_9NEIS/51-339-----PIT------------------------------------VQ-T----DTVQ.AVI.D....EK------------
D7A2X3_STAND/89-370-----RAV------------------------------------ID-T----PRVI.GSV.A....LK------------
D7AGW1_GEOSK/67-334-----DVS------------------------------------VD-T----PAYS.VTF.S....TQ------------
D7DPN7_METS0/67-338-----RIS------------------------------------VT-T----DLYK.ADI.E....TT------------
D7HT65_PSESS/85-363-----LIH------------------------------------VK-T----DVLD.LAI.D....PV------------
D7VNI1_9SPHI/86-358-----IIT------------------------------------LQ-N----EKII.AKI.T....SK------------
D8FEY0_9DELT/74-343-----RIK------------------------------------ID-T----PLYS.AVF.S....NV------------
D8IUS2_HERSS/62-334-----TIV------------------------------------IT-T----DLVK.ASI.D....TV------------
D8JXN4_HYPDA/99-385-----RLK------------------------------------IE-T----PSLE.GSI.D....LK------------
D9PLD5_9ZZZZ/72-318-----IAT------------------------------------IK-S----KKFI.ATI......DK------------
D9QLU4_BRESC/86-370-----RIP------------------------------------VS-T----PTLQ.GSM.S....LQ------------
D9SEP3_GALCS/70-342-----IIK------------------------------------VK-T----DFLE.AEI.N....SV------------
D9YCI7_9DELT/76-344-----DLT------------------------------------VD-S----PLYE.AVF.Y....TG------------
E0E9T6_ACTPL/60-331-----TVT------------------------------------LQ-S----DVLR.LTI.D....TL------------
E0QC07_CAMCO/82-329-----IAD------------------------------------IK-S----EHFE.AQI......DS------------
E0TGR5_PARBH/75-349-----RLP------------------------------------IE-T----PTLS.GSV.N....LE------------
E1JWT9_DESFR/72-336-----TLT------------------------------------VD-T----PLYT.AVF.N....ST------------
E1QGD7_DESB2/72-341-----DVV------------------------------------VE-T----PLMR.ATF.S....TK------------
E1R6N6_SPISS/85-369-----MVS------------------------------------LD-T----KVFK.ATF.S....SR------------
E1SRS1_FERBD/67-340-----LIQ------------------------------------VQ-T----DTLK.LTI.D....AT------------
E1VCI5_HALED/89-362-----LVA------------------------------------VA-T----DVLD.IRI.D....PQ------------
E1YHJ2_9DELT/73-343-----VFE------------------------------------IN-T----PLYS.VKI.N....EK------------
E2CFI6_9RHOB/88-368-----RVT------------------------------------LD-T----PRLS.GSV.N....LV------------
E2Y0D7_PSEFL/82-367-----LIQ------------------------------------IK-T----DVLD.LAI.D....PQ------------
E3BH69_9VIBR/64-349-----TIS------------------------------------VK-T----DVLT.LSI.D....TV------------
E3I8D6_RHOVT/87-376-----RIA------------------------------------FD-T----SSLT.GSI.N....LK------------
E4PHG2_MARAH/93-371-----FIT------------------------------------VR-T----DVYD.LQI.D....RV------------
E4RXZ7_LEAB4/66-342-----EIV------------------------------------VE-N----KDIK.VTF.S....SR------------
E4TI09_CALNY/66-312-----VEK------------------------------------VS-N----GFVE.IYF.D....KH------------
E4U0E7_SULKY/78-324-----LTT------------------------------------VN-S----KEFT.LKI......DT------------
E5ANF4_BURRH/84-357-----QIH------------------------------------FK-T----DVYD.GDI.S....TV------------
E5UFL6_ALCXX/85-360-----EVV------------------------------------IT-T----DVLR.LTF.D....TL------------
E5Y3D4_BILWA/70-335-----DVK------------------------------------VE-T----PLYS.AVI.Y....SG------------
E6L9N5_CAMUP/85-332-----LAS------------------------------------VE-S----PHFK.AEI......DT------------
E6PV40_9ZZZZ/84-356-----LTT------------------------------------IR-T----DVLD.MKV.S....SE------------
E6QUQ9_9ZZZZ/65-340-----QVV------------------------------------VH-T----DVLT.AKI.D....AN------------
E6VVL3_DESAO/78-347-----AVT------------------------------------VD-T----PLYT.AVF.N....SQ------------
E6W2A4_DESIS/84-327-----DVV------------------------------------LE-N----DLII.ATF.S....TS------------
E6WXG3_PSEUU/84-365-----RIV------------------------------------AS-S----DVL...QL.V....LD------------
E6XAK3_CELAD/92-365-----TTV------------------------------------LE-N----NLVY.LRI.S....NK------------
E7C5J1_9BACT/79-427-----QLG------------------------------------VE-G----QFVA.TFT......SH------------
E7C9X2_9PROT/74-354-----RIN------------------------------------FE-N----ENVV.GSI.T....LK------------
E7RZL5_9BURK/87-360-----TIT------------------------------------LK-N----DVIE.LGI.D....TV------------
E8L3J9_9RHIZ/76-358-----RVA------------------------------------ID-T----KSIS.GSI.A....LK------------
E8LJ48_9GAMM/56-342-----LIK------------------------------------IK-S----DALE.LTV.D....LK------------
E8Q5V7_BLOVB/159-447-----IIT------------------------------------VQ-T----DVFL.LKI.N....KY------------
E8RBA3_DESPD/75-344-----DVT------------------------------------VD-T----PLYT.AVI.N....EQ------------
E8RRW7_ASTEC/75-370-----RVA------------------------------------ID-S----PALK.GSL.S....LA------------
E8T5A7_THEA1/59-297-----LVT------------------------------------VE-T----PLYT.AQF.S....TV------------
E8UFE8_TAYEM/72-346-----KIT------------------------------------VK-S----DVLN.LTF.D....TV------------
E8V6Z5_TERSS/94-374-----TTT------------------------------------IE-N----ELYR.IEF.T....NR------------
E8WL20_GEOS8/75-344-----DVT------------------------------------VD-T----DLYS.AVF.S....SQ------------
E8WWP1_ACISM/87-375-----TTV------------------------------------VE-N----ELYK.ITF.S....NK------------
E8XPB8_RAHSY/60-339-----LIT------------------------------------VN-S----DVLS.LTI.N....TR------------
F0F1E8_9NEIS/53-342-----PIT------------------------------------VN-T----DTVQ.AVI.D....EK------------
F0IH08_9FLAO/89-358-----YTE------------------------------------IE-N----ELLK.LKV.S....NK------------
F0JKI5_DESDE/78-347-----SVT------------------------------------VD-T----PLYT.AVF.T....SQ------------
F0L5H9_AGRSH/88-368-----RVA------------------------------------ID-T----NAIA.GSI.N....LT------------
F0NZP1_WEEVC/77-350-----NVT------------------------------------FE-N----EHVK.IQV.N....GR------------
F0RH16_CELLC/92-364-----TTV------------------------------------LE-N----NVLY.LRI.S....NK------------
F0RX03_SPHGB/84-372-----PFT------------------------------------FS-T----EYFI.IEF.N....PN------------
F0SF95_PLABD/95-399-----SLK------------------------------------TD-A----NTFLQVDL.T....SR------------
F2B931_9NEIS/54-342-----PIT------------------------------------VA-T----DTVS.AVI.D....EA------------
F2GD54_ALTMD/78-351-----IIE------------------------------------VK-T----DTLD.LRI.D....LL------------
F2I3Y3_PELSM/76-349-----RVK------------------------------------LD-N----AKIT.GSI.S....LV------------
F2J1Z4_POLGS/92-372-----RVT------------------------------------IE-T----PRVS.GSI.N....LA------------
F2K1U1_MARM1/82-358-----LID------------------------------------VK-T----DTLD.ISI.D....PV------------
F2LWU2_HIPMA/71-319-----LIT------------------------------------VE-T----DNYI.LKI.S....SL------------
F2PBU9_PHOMO/65-340-----LIT------------------------------------IK-T----DVLE.LTV.D....TL------------
YIDC_BUCAP/52-338-----QII------------------------------------IK-N----DVLR.LVI.N....MY------------
YIDC_WOLSU/81-328-----IAT------------------------------------VQ-G----SHFR.LEI......DS------------
YIDC_BORPE/87-362-----QVV------------------------------------IT-T----DVLR.LTF.D....SN------------
Q02A40_SOLUE/101-361-----AFV------------------------------------IN-T----DLYR.VVL.S....NQ------------
Q07TY2_RHOP5/100-389-----RVK------------------------------------IE-T----PRLS.GSI.S....LK------------
YIDC_SHEFN/68-343-----LIS------------------------------------VK-T----DQLD.IKI.S....PI------------
YIDC_ALHEH/74-349-----RVR------------------------------------VV-T----DLMD.LEI.S....TR------------
YIDC_MARMM/76-356-----RVT------------------------------------ID-A----PSVL.GSL.S....LT------------
YIDC_GRABC/70-355-----RLA------------------------------------VD-A----PRVK.GSI.S....LV------------
Q0C549_HYPNA/73-365-----RVK------------------------------------FD-A----NAVD.GTI.R....LA------------
Q0G0U0_9RHIZ/90-370-----RVT------------------------------------ID-T----PELT.GSI.N....LT------------
Q11LE5_MESSB/91-371-----RVT------------------------------------ID-T----PRLA.GTI.N....LA------------
YIDC_CYTH3/79-358-----EYK------------------------------------LE-N----KDVV.VTL.S....TK------------
YIDC_SHEDO/67-342-----LIN------------------------------------VT-T----DQLV.IKI.N....PL------------
YIDC_PSEA6/72-343-----VIS------------------------------------VT-T----DTLQ.LSI.N....TV------------
Q1GN73_SPHAL/87-365-----RIP------------------------------------IE-T----PAIR.GSI.N....LV------------
YIDC_METFK/76-348-----RIN------------------------------------VE-T----DLYK.ASI.D....TI------------
Q1IV78_KORVE/81-362-----ETV------------------------------------VE-N----AVSR.IVF.T....NR------------
YIDC_LAWIP/69-333-----DVY------------------------------------IE-T----PLYI.AKI.H....SS------------
Q1MZ43_9GAMM/64-339-----WIK------------------------------------VE-T----DVLD.IRI.D....PV------------
Q1NWR8_9DELT/82-356-----EIV------------------------------------VE-T----DLYE.AVI.S....EA------------
Q1V1M7_PELUQ/70-343-----RIQ------------------------------------FE-N----GSVV.GSI.S....LK------------
Q1YH97_MOBAS/97-376-----RVA------------------------------------ID-T----PALS.GSI.N....LT------------
Q1YZM1_PHOPR/66-338-----VIT------------------------------------IN-T----DVLA.LSV.D....TL------------
Q21QM4_RHOFD/90-368-----RLV------------------------------------VT-T----DVLK.LTF.D....TE------------
Q26CA4_FLABB/76-349-----VIT------------------------------------FE-N----DLIQ.FKI.D....SK------------
YIDC_JANSC/83-388-----RID------------------------------------ID-T----PAVE.GSI.S....LL------------
Q2BQG4_9GAMM/76-352-----LIT------------------------------------VK-T----DVLD.III.D....TK------------
Q2CI02_9RHOB/82-361-----RVA------------------------------------IE-T----PRLV.GSI.N....TA------------
Q2GAU8_NOVAD/82-357-----RIA------------------------------------ID-A----PGLK.GSI.N....LK------------
YIDC_BORA1/87-360-----EVV------------------------------------IT-T----DVLR.LTF.S....ST------------
YIDC_SYNAS/82-353-----EIT------------------------------------VD-T----PLYQ.AVF.T....TK------------
Q2N7X2_ERYLH/80-353-----RIR------------------------------------ID-A----PRVE.GSI.N....LV------------
Q2NQ71_SODGM/60-342-----LIT------------------------------------VK-T----DVLS.LKI.N....TR------------
Q2RP12_RHORT/103-381-----RIG------------------------------------ID-T----ARLH.GSI.R....LR------------
YIDC_HAHCH/87-367-----IIT------------------------------------VI-T----DVLR.VEI.D....LN------------
Q2VZ15_MAGSA/87-366-----RIA------------------------------------IQ-T----PSMH.GSI.A....LT------------
YIDC_NITMU/90-364-----KIT------------------------------------IK-T----DMVL.AEI.D....TA------------
Q30T77_SULDN/78-325-----LTT------------------------------------LK-S----NDFI.LKI......DT------------
YIDC_DESDG/73-337-----EVK------------------------------------VD-T----PLYT.AVF.Q....SQ------------
YIDC_GEOMG/71-339-----EIA------------------------------------VE-T----PDYT.AVF.S....TQ------------
YIDC_CHLCH/73-346-----VTV------------------------------------VE-N----DLFR.ATL.S....SK------------
YIDC_PELLD/77-350-----LTV------------------------------------ID-N----DLFH.AVV.S....SK------------
YIDC_THIDA/69-344-----RAV------------------------------------VE-T----DVLR.ATI.D....AN------------
YIDC_DECAR/71-344-----TFS------------------------------------IT-T----DLLK.ATI.S....AQ------------
Q47U35_COLP3/70-342-----LIT------------------------------------VT-T----DTLI.LKI.N....SQ------------
Q494B9_BLOPB/151-436-----VIT------------------------------------VK-T----DVLL.LKI.N....TY------------
Q5FPY0_GLUOX/67-351-----RIP------------------------------------VT-G----PDVQ.GSL.N....LK------------
YIDC_SILPO/77-370-----RVQ------------------------------------ID-T----PRLK.GSV.S....LL------------
YIDC_AROAE/74-349-----RMV------------------------------------VR-T----DLMV.AEV.S....AQ------------
Q5QZJ4_IDILO/54-327-----TVH------------------------------------VR-T----DVLD.VEI.D....TR------------
YIDC_METCA/72-347-----RIR------------------------------------VH-T----DVLS.LEI.D....TR------------
YIDC_MANSM/66-338-----IIS------------------------------------IQ-N----DVFT.LKV.D....TL------------
Q6APY9_DESPS/74-343-----DIV------------------------------------VD-T----DLYT.ATI.S....EA------------
Q6MGL3_BDEBA/85-341-----EFH------------------------------------FE-N----DKVS.FVM.T....SF------------
Q6SHP6_9BACT/69-344-----RVK------------------------------------IE-N----NNIK.GSI.S....LQ------------
YIDC_CHRVO/61-344-----RIQ------------------------------------VK-T----DLVE.AEI.D....TV------------
YIDC_BLOFL/67-356-----IIT------------------------------------IK-T----DVFL.LKI.N....TY------------
YIDC_HAEDU/63-334-----TIT------------------------------------VE-S----DVLR.LVI.D....TL------------
YIDC_BRAJA/93-381-----RVK------------------------------------ID-T----PRIA.GSI.S....LK------------

PF02929

BGAL_ECOLI/751-1022-------E------------------------------------LG..----.NKR-WQF-N----RQ------------
BGAL_PSEHA/760-1034-------S------------------------------------IE.N----NTFK-LVF-N----QQ------------
BGAL_ACTPL/734-998-------N------------------------------------VH.N----GQFS-YQL-D----KQ------------
Q9WXJ2_9GAMM/756-1029-------T------------------------------------IS.G----DNFT-VKM-D----KQ------------
BGAL_THEMA/715-981-------T------------------------------------VE.A----KDTV-YVF-S----KL------------
BGAM_LACSK/18-317-------G------------------------------------LK.G----PDFH-YLF-S----YQ------------
BGAM_LEULA/18-318-------G------------------------------------LQ.G----ANFH-YLF-S----YE------------
BGAL_STRTR/752-1023-------G------------------------------------IQ.G----QNFS-ILL-S----RA------------
BGAM_LACAC/17-316-------G------------------------------------IT.G----KNFH-YLF-S----YE------------
O85250_THENE/715-982-------F------------------------------------VR.S----KDTE-LVF-S----KF------------
BGA2_ECOLI/727-998-------T------------------------------------VR.G----YNFA-ITF-S----KM------------
Q9ZBD1_9PSEU/972-1248-------E------------------------------------VS.A----PDFT-YTF-D----RE------------
BGAL1_KLEPN/759-1032-------Q------------------------------------IR.A----GSQC-WTI-D----RR------------
BGAL_BACMD/763-1032-------T------------------------------------VT.G----TNFT-AIF-D----KR------------
BGAL_LACLA/719-996-------T------------------------------------VR.S----AKQK-FIF-N----KS------------
BGAL1_ENTCL/752-1025-------E------------------------------------IA.H----RQQR-WQF-D----RA------------
Q9ZBF6_STRCO/1015-1288-------E------------------------------------VT.G----RGFS-VTV-D----KR------------
BGAL_KLULA/750-1023-------S------------------------------------VE.S----SGLH-FIL-D----KL------------
BGAL_ARTSB/730-1013-------E------------------------------------LG..----...P-ATF-D----..------------
BGAL_STAXY/723-992-------K------------------------------------VSVG----KSET-YVF-N----KD------------
Q9X6Y5_BIFLN/747-1021-------G------------------------------------VR.G----AGRE-VLL-S----RT------------

PF13802

C6Z6F6_9BACE/138-207-----------------------------------------------D----EHFF----------GF------------
B3X7V0_ECOLX/148-215-----------------------------------------------D----ERFY----------GL------------
A6BU30_YERPE/147-214-----------------------------------------------N----EQYY----------GL------------
A4NG96_HAEIF/146-213-----------------------------------------------Q----EHYY----------GL------------
A6VZ15_MARMS/151-218-----------------------------------------------S----EKYY----------GL------------
A6CYB1_9VIBR/146-217-----------------------------------------------N----ELYY----------GL------------
C6CFE6_DICZE/146-213-----------------------------------------------Q----ERCY----------GL------------
A6VKN2_ACTSZ/146-213-----------------------------------------------D----ENCY----------GL------------
A0P411_9RHOB/147-215-----------------------------------------------D----ERYY----------GL------------
B4EHS8_BURCJ/151-220-----------------------------------------------G----DQVF----------GL------------
E3IFH7_GEOS0/152-221-----------------------------------------------N----EQYF----------GL------------
Q65IV9_BACLD/151-220-----------------------------------------------Q----EQYF----------GF------------
Q5WLB5_BACSK/151-220-----------------------------------------------R----ERYY----------GL------------
B2U9A1_RALPJ/149-218-----------------------------------------------G----EMYF----------GL------------
Q2BFL4_9BACI/171-240-----------------------------------------------D----DLYY----------GL------------
Q9KEZ5_BACHD/152-220-----------------------------------------------E----DRYY----------GL------------
B6R9L1_9RHOB/137-205-----------------------------------------------D----DRIY----------GL------------
B1Y1L3_LEPCP/168-237-----------------------------------------------G----EMYF----------GL------------
Q1GMW9_SILST/145-213-----------------------------------------------Q----EPVF----------GL------------
D3P7Q6_AZOS1/182-251-----------------------------------------------D----EMYF----------GL------------
C6YVN7_9GAMM/147-216-----------------------------------------------D----AMFF----------GL------------
C8N9E3_9GAMM/146-214-----------------------------------------------R----DRYY----------GL------------
D7AQU8_THEM3/149-218-----------------------------------------------N----EQYY----------GL------------
A6LTE1_CLOB8/150-217-----------------------------------------------E----MYFY----------GF------------
B7R6V8_9THEO/159-228-----------------------------------------------N----ESYY----------GL------------
D5VMK3_CAUST/152-220-----------------------------------------------G----ERYY----------GL------------
D4JL19_9FIRM/158-225-----------------------------------------------D----DAIY----------GL------------
Q74HN8_LACJO/146-213-----------------------------------------------D----EQFY----------GL------------
E6U2M1_ETHHY/145-212-----------------------------------------------D----THFY----------GL------------
A6M2D1_CLOB8/142-211-----------------------------------------------E----DYFY----------GF------------
B8CZD8_HALOH/144-211-----------------------------------------------G----ERFY----------GL------------
A5VKA3_LACRD/145-212-----------------------------------------------D----EQIY----------GL------------
C1I6Q0_9CLOT/141-208-----------------------------------------------D----MYFY----------GL------------
AGL2_BACTQ/146-213-----------------------------------------------A----DHFY----------GF------------
Q8A369_BACTN/151-214-----------------------------------------------D----EHFF----------GL------------
C6Y460_PEDHD/169-235-----------------------------------------------D----ENFY----------GL------------
E3I544_RHOVT/151-221-----------------------------------------------A----TAYY----------GF------------
C6LHD3_9FIRM/141-210-----------------------------------------------D----DCFY----------GF------------
C8P8K9_9LACO/146-213-----------------------------------------------D----EQFY----------GL------------
C7XXM5_9LACO/143-212-----------------------------------------------H----EKFY----------GF------------
C8PCW9_9LACO/137-204-----------------------------------------------D----EQFY----------GL------------
A0M5P9_GRAFK/143-209-----------------------------------------------Q----ENFF----------GL------------
D2KFL4_9FIRM/144-211-----------------------------------------------N----TYFY----------GV------------
A3XMQ1_LEEBM/143-209-----------------------------------------------G----EAFY----------GM------------
A4AR25_MARSH/143-209-----------------------------------------------S----ESFY----------GM------------
C2FW68_9SPHI/168-234-----------------------------------------------Q----EVFF----------GA------------
Q2B942_9BACI/145-212-----------------------------------------------S----DQFY----------GF------------
A5FGA0_FLAJ1/143-209-----------------------------------------------G----ECYY----------GL------------
A9E425_9FLAO/144-210-----------------------------------------------R----ESYF----------GL------------
Q26ET6_FLABB/143-209-----------------------------------------------G----ESYY----------GL------------
A6EJE2_9SPHI/149-215-----------------------------------------------G----ERFV----------GL------------
B8E1H7_DICTD/128-194-----------------------------------------------E----EAFL----------GL------------
C7XVH3_9LACO/146-213-----------------------------------------------D----EVFY----------GL------------
D2EHP2_PEDAC/142-211-----------------------------------------------T----NKFY----------GF------------
Q6A5C7_PROAC/189-256-----------------------------------------------D----DRYY----------GL------------
A6M2D3_CLOB8/141-210-----------------------------------------------N----DHFY----------GF------------
A4YW59_BRASO/151-218-----------------------------------------------D----ERHY----------GL------------
A7B0D7_RUMGN/159-228-----------------------------------------------T----DHFY----------GF------------
Q1ITZ5_KORVE/157-223-----------------------------------------------D----EHYF----------GF------------
A6NAA1_THEET/115-182-----------------------------------------------E----DHFY----------GF------------
E0U9C6_CYAP2/141-207-----------------------------------------------D----EHFY----------GF------------
A4C366_9FLAO/144-210-----------------------------------------------A----ESFY----------GL------------
A0NI45_OENOE/157-224-----------------------------------------------G----SYFY----------GL------------
C6VMU9_LACPJ/143-210-----------------------------------------------D----EYLY----------GL------------
Q8YN00_NOSS1/141-207-----------------------------------------------D----EHFY----------GF------------
C7PPD2_CHIPD/143-209-----------------------------------------------D----ECFF----------GM------------
C7G8B2_9FIRM/148-215-----------------------------------------------D----EKFY----------GL------------
A2TTB6_9FLAO/143-209-----------------------------------------------A----ESYY----------GL------------
B2J8N8_NOSP7/141-207-----------------------------------------------D----EHFY----------GF------------
Q096Z9_STIAD/169-235-----------------------------------------------D----EHYF----------GL------------
B5YCW0_DICT6/115-181-----------------------------------------------G----EAFF----------GF------------
B7GLU5_ANOFW/151-218-----------------------------------------------T----DVVY----------GL------------
Q7NP60_GLOVI/141-207-----------------------------------------------G----EHFY----------GF------------
Q2JLQ6_SYNJB/174-240-----------------------------------------------A----EHIY----------GL------------
D4IW42_BUTFI/145-212-----------------------------------------------D----DRFY----------GT------------
D0MJB1_RHOM4/128-199-----------------------------------------------G----ERFF----------GL------------
Q11WX6_CYTH3/141-207-----------------------------------------------S----EHFY----------GL------------
Q2B3F7_9BACI/171-238-----------------------------------------------G----ENFY----------GF------------
A4FJU3_SACEN/111-180-----------------------------------------------D----DAFY----------GF------------
A9B074_HERA2/125-192-----------------------------------------------S----EHFY----------GF------------
C7GHF0_9FIRM/166-226-----------------------------------------------G----ELIY----------GL------------
B5YAW0_DICT6/158-218-----------------------------------------------G----ELIY----------GL------------
Q16SF9_AEDAE/142-215-----------------------------------------------A----AVMF----------GI------------
C4G5Y4_ABIDE/167-228-----------------------------------------------D----EEFY----------GF------------
B2UN73_AKKM8/140-206-----------------------------------------------T----EHFF----------GL------------
B3WW63_SHIDY/159-219-----------------------------------------------G----ETVY----------GL------------
B1S937_9BIFI/158-218-----------------------------------------------G----EKIY----------GL------------
C1F1A5_ACIC5/161-227-----------------------------------------------N----EHYF----------GL------------
Q92F84_LISIN/142-209-----------------------------------------------G----TAIF----------GL------------
A5DNM1_PICGU/182-242-----------------------------------------------G----EKLY----------GL------------
C4GAQ3_9FIRM/169-236-----------------------------------------------D----EHFY----------GL------------
B7DQ25_9BACL/151-218-----------------------------------------------N----ARFY----------GL------------
C4GA21_9FIRM/179-248-----------------------------------------------Q----DHYY----------GF------------
A4XJ71_CALS8/158-218-----------------------------------------------G----ECVY----------GL------------
A9X936_9BACL/155-215-----------------------------------------------G----ENVY----------GL------------
A8RUC2_9CLOT/208-269-----------------------------------------------Y----EEFY----------GL------------
D1C8H0_SPHTD/151-218-----------------------------------------------G----ERYF----------GC------------
B9KC10_THENN/173-233-----------------------------------------------G----ECVY----------GL------------
D2S0G4_HALTV/126-193-----------------------------------------------D----ESFY----------GF------------
E6TRU4_BACCJ/158-218-----------------------------------------------G----ENLY----------GL------------
Q8YLG7_NOSS1/171-245-----------------------------------------------E----EHIY----------GL------------
C6WRR4_ACTMD/156-216-----------------------------------------------G----EVVY----------GM------------
Q1AU85_RUBXD/146-213-----------------------------------------------G----ERYF----------GC------------
P96793_LACPE/157-217-----------------------------------------------D----EKIY----------GL------------
Q2H3D9_CHAGB/177-237-----------------------------------------------G----ESIH----------GL------------
C8P9M9_9LACO/157-217-----------------------------------------------D----THVY----------GL------------
D9SW39_CLOC7/180-240-----------------------------------------------G----ECIY----------GF------------
C4RJD3_9ACTO/158-218-----------------------------------------------G----ETIY----------GL------------
B9XM93_9BACT/133-203-----------------------------------------------D----ESIF----------GL------------
D2KFL5_9FIRM/166-226-----------------------------------------------G----ELVY----------GL------------
C7PZM9_CATAD/157-217-----------------------------------------------D----AFVY----------GL------------
C0FZU5_9FIRM/179-240-----------------------------------------------D----ENFY----------GF------------
A7V9A7_BACUN/225-286-----------------------------------------------D----EMIF----------GC------------
E8WBI2_STRFA/161-221-----------------------------------------------G----ENVY----------GL------------
B7KDN2_CYAP7/163-238-----------------------------------------------C----EHIY----------GL------------
C6JFG5_9FIRM/171-231-----------------------------------------------G----ECVY----------GL------------
Q03T52_LACBA/157-217-----------------------------------------------D----DKVY----------GL------------
D6ZH08_MOBCV/158-218-----------------------------------------------G----ESVY----------GL------------
B1RLL6_CLOPF/139-205-----------------------------------------------C----LAYY----------GL------------
Q03WT1_LEUMM/191-261-----------------------------------------------G----TKVY----------GF------------
A8X5Y6_CAEBR/204-275-----------------------------------------------A----KHVF----------GI------------
Q47PH1_THEFY/175-236-----------------------------------------------D----ERLG----------GL------------
A9GNN9_SORC5/138-204-----------------------------------------------G----EAYL----------GF------------
B0ML18_9FIRM/181-241-----------------------------------------------G----ENIY----------GF------------
D2BD45_STRRD/176-237-----------------------------------------------D----EAFT----------GF------------
A5FLV6_FLAJ1/228-289-----------------------------------------------D----EKIF----------GC------------
D2ELQ0_PEDAC/65-125-----------------------------------------------D----ELVY----------GL------------
C2GW28_BIFLN/196-256-----------------------------------------------G----EDVY----------GL------------
Q091G4_STIAD/133-199-----------------------------------------------D----EAYL----------GF------------
A2EBD8_TRIVA/156-223-----------------------------------------------N----VRIS----------GL------------
C4XW51_CLAL4/205-265-----------------------------------------------G----EKLY----------GF------------
C6VSJ1_DYAFD/228-289-----------------------------------------------D----EKIF----------GC------------
Q7NKE3_GLOVI/167-242-----------------------------------------------Q----ERIY----------GL------------
Q928J2_LISIN/275-338-----------------------------------------------D----EAFY----------GF------------
D4DDN6_TRIVH/259-335-----------------------------------------------Y----EHVF----------GI------------
Q75EA4_ASHGO/246-317-----------------------------------------------F----KNVY----------GI------------
Q4J9M3_SULAC/59-124-----------------------------------------------K----THVL----------GL------------
A5Z7X2_9FIRM/181-249-----------------------------------------------K----EEIY----------GS------------
A7RJ81_NEMVE/252-323-----------------------------------------------V----EHVY----------GI------------
A1ZKD2_9BACT/150-213-----------------------------------------------K----EQLF----------GT------------
D3USW3_LISSS/171-233-----------------------------------------------D----EKFY----------GL------------
Q5Y9F6_HYPJE/256-332-----------------------------------------------Y----EHVY----------GI------------
B3NYF5_DROER/233-304-----------------------------------------------A----EVLF----------GI------------
A2FHI6_TRIVA/187-256-----------------------------------------------G----VHFS----------GL------------
Q6BWW5_DEBHA/248-320-----------------------------------------------F----RHVY----------GI------------
A7TJL8_VANPO/259-330-----------------------------------------------M----ENVY----------GI------------
C4R1R0_PICPG/226-297-----------------------------------------------M----SHLY----------GI------------
A9V6Y9_MONBE/163-242-----------------------------------------------G----DHLY----------GL------------
GANAB_DICDI/262-337-----------------------------------------------S----SHVY----------GI------------
D3RQI5_ALLVD/150-218-----------------------------------------------D----EGYF----------GF------------
Q9U3F8_CAEEL/211-283-----------------------------------------------F----KTAY----------GL------------
Q487N3_COLP3/169-232-----------------------------------------------T----EKLL----------GG------------
A6RYW1_BOTFB/264-340-----------------------------------------------Y----EHVF----------GI------------
Q6CFI8_YARLI/231-308-----------------------------------------------Y----NHVY----------GI------------
C5MGP0_CANTT/228-299-----------------------------------------------F----SHMY----------GI------------
B6K3T9_SCHJY/251-327-----------------------------------------------Y----EHVY----------GV------------
Q9FN05_ARATH/223-300-----------------------------------------------S----SFVY----------GI------------
D3HXG1_9BACT/143-212-----------------------------------------------N----EHFF----------GF------------
A8QEK6_BRUMA/217-288-----------------------------------------------Y----KFIY----------GL------------
D0MFY9_RHOM4/221-282-----------------------------------------------D----EKIF----------GT------------
C7ZHM8_NECH7/140-208-----------------------------------------------D----PSIY----------GL------------
A3LZG4_PICST/248-320-----------------------------------------------Y----KNLY----------GI------------
Q6CKL7_KLULA/243-314-----------------------------------------------I----SNLY----------GI------------
A5DFX8_PICGU/236-308-----------------------------------------------Y----KHVY----------GI------------
Q5A4X3_CANAL/227-298-----------------------------------------------F----SNLY----------GI------------
B0WQR7_CULQU/142-215-----------------------------------------------A----DVLY----------GI------------
A5E255_LODEL/247-318-----------------------------------------------F----LNLY----------GI------------
Q1AY53_RUBXD/205-266-----------------------------------------------G----ERLY----------GG------------
Q48999_MYCCA/174-236-----------------------------------------------D----EKFY----------GL------------
GLU2A_SCHPO/243-319-----------------------------------------------Y----GNVY----------GV------------
C5E2N2_LACTC/252-323-----------------------------------------------V----TDVF----------GI------------
D1PU92_9BACT/147-201-----------------------------------------------D----EAIF----------GL------------
C5E407_ZYGRC/242-313-----------------------------------------------F----ENLY----------GL------------
GLU2A_YEAST/268-337-----------------------------------------------S----TNVY----------GI------------
D2PSG3_KRIFD/287-350-----------------------------------------------A----ERFE----------GF------------
B3PEE6_CELJU/151-214-----------------------------------------------G----EKIL----------GG------------
A2EWL0_TRIVA/183-259-----------------------------------------------E----TKLS----------GV------------
D4A7G5_RAT/221-292-----------------------------------------------F----EHLY----------GI------------
A2DTY0_TRIVA/174-243-----------------------------------------------E----TRLS----------GL------------
Q6F1E9_MESFL/174-236-----------------------------------------------E----ELIY----------GL------------
D0NID9_PHYIT/299-382-----------------------------------------------P----RSLY----------GI------------
B9HF49_POPTR/234-312-----------------------------------------------A----EFVS----------GI------------
A9SRV0_PHYPA/216-292-----------------------------------------------S----DHVY----------GI------------
Q15TD3_PSEA6/166-229-----------------------------------------------N----EKLL----------GG------------
Q18IX5_HALWD/161-222-----------------------------------------------A----ESIF----------GL------------
D3KJT1_LISMN/468-529-----------------------------------------------E----EEYY----------GF------------
A9JRL0_XENTR/224-295-----------------------------------------------F----EYVY----------GL------------
Q6BD67_ARTGO/298-361-----------------------------------------------G----ERFE----------GF------------
A8MA12_CALMQ/134-195-----------------------------------------------G----EGIY----------GM------------
C9Z9B8_STRSW/173-240-----------------------------------------------D----ARFF----------GL------------
A2FHS3_TRIVA/198-269-----------------------------------------------S----NHIS----------GL------------
A5KR97_9FIRM/177-236-----------------------------------------------G----ENFY----------GG------------
A2FSM7_TRIVA/200-271-----------------------------------------------Q----TRLS----------GL------------
D2VG87_NAEGR/204-281-----------------------------------------------S----TNLY----------GL------------
A2DNT4_TRIVA/201-270-----------------------------------------------Q----TRLT----------GL------------
A2FNG9_TRIVA/199-270-----------------------------------------------N----LKFS----------GL------------
Q10VX8_TRIEI/195-274-----------------------------------------------D----AKYI----------GF------------
F2GBK6_ALTMD/160-223-----------------------------------------------D----EKLY----------GG------------
B7B7D0_9PORP/181-237-----------------------------------------------G----ERFY----------GG------------
D1W1N7_9BACT/179-238-----------------------------------------------D----EYFF----------GG------------
A1ZWA9_9BACT/116-179-----------------------------------------------H----EAMY----------GM------------
B8P1A4_POSPM/248-324-----------------------------------------------H----GHVY----------GI------------
B5U8Z1_HORVU/222-299-----------------------------------------------A----DFVY----------GL------------
Q9AQR9_BACTQ/128-190-----------------------------------------------D----ERIY----------GL------------
A8UJG1_9FLAO/155-218-----------------------------------------------D----EVLY----------GG------------
A1S1W2_SHEAM/165-224-----------------------------------------------D----ERFF----------GG------------
A5Z7X1_9FIRM/366-435-----------------------------------------------D----EIIF----------GT------------
A4C4Y4_9GAMM/153-212-----------------------------------------------N----EYFM----------GG------------
A5ZES3_9BACE/177-236-----------------------------------------------D----EYFY----------GG------------
D5VEX6_CAUST/152-206-----------------------------------------------Q----EAIY----------GL------------
A3TII1_9MICO/151-210-----------------------------------------------T----EQFF----------GG------------
Q04CH5_LACDB/137-196-----------------------------------------------N----EYYY----------GG------------
A9WV97_RENSM/183-242-----------------------------------------------G----EQFL----------GG------------
D2YKF2_VIBMI/210-268-----------------------------------------------S----EHFY----------GG------------
A2DUN2_TRIVA/184-245-----------------------------------------------D----AYLT----------GL------------
C4VK70_9LACO/135-194-----------------------------------------------N----EYYY----------GG------------
C2EQ16_9LACO/137-196-----------------------------------------------N----EFYF----------GG------------
A2TWU9_9FLAO/156-219-----------------------------------------------D----EVLF----------GG------------

PF04349

OPGD_XYLFA/46-531FDYEWLKE------------------------------------HARALAAAPYHSRKRVLP----TP------------
OPGG_PSEAE/36-523FSIDDVAS------------------------------------KAKDLAGDKYSAPTSNLP----SE------------
OPGG_ECOLI/23-509FSIDDVAK------------------------------------QAQSLAGKGYETPKSNLP----SV------------
OPGG_VIBCH/72-545FDNDTVVR------------------------------------LARQLAKKPYVALKDPLP----ES------------

PF02278

HYSA_STRPN/656-924PRP..SYL------------------------------------SAFN----KMDKTAMYNAEKGFGF------------
CSLA_PEDHD/336-592IEP...YH------------------------------------HQFW----NGDYVQHLR..PAYSF------------
O86516_STRCO/402-656AAPEPVGH------------------------------------HLFA----AMDRAVHR..RPAFTA------------
HYSA_STAA8/435-699KNGLTQQL------------------------------------KIYN----DMDRVTYHNKDLDFAF------------
HYSA_STRA3/617-905TKPLKSNL------------------------------------STFN----SMDRLAYYNAEKDFGF------------

PF03636

TREPP_LACLA/7-254--IIQYDK---------------KEV------------------GK.R----SYGQESLM------SL------------
Q97FP3_CLOAB/11-268--NIVEDN---------------FME------------------EK.N----KI.SESIF------SI------------
YVDK_BACSU/13-265--KIKTNT---------------FNK------------------EH.T----RL.LESLT------SL------------
Q98PT5_MYCPU/12-257--KIYQKG---------------YDP------------------LL.S----GK.TESIF------AQ------------
TREA_EMENI/63-338--QWVLTT---------------SSL------------------DQ.G----HY..QSRG------SV------------
ATH1_YEAST/132-415--ILGSNL---------------FSK------------------NTYS----RQ.....P------YV------------
Y2006_MYCTU/536-795--TLVFHG---------------YDP------------------GQ.E----RL.REALC------AV------------
Q9CF04_LACLA/14-266--KITSNQ---------------IEK------------------ED.R----RL.QESLT------SI------------
Y3401_MYCTU/13-273--QVRETK---------------LNL------------------NL.L----AQ.SESLF------AL------------
Q9L2I8_STRCO/13-273--RVRETA---------------LNL------------------DL.L----AQ.SESVF------AL------------
O87772_LACSN/11-262--TITSHE---------------LQP------------------AD.K----RL.QESMT------SL------------
Q9RJM8_STRCO/7-260--TWDYDH---------------YDA------------------AE.E----RL.RESLC------TL------------
YCJT_ECOLI/6-241--TLSEPH---------------FSQ------------------HT.L----NK.YASLM------AQ------------
Q9K109_NEIMB/12-263--TLRSAK---------------LEK------------------EH.K----RL.QESLT------SL------------

PF14498

B2WJV6_PYRTR/24-282--LWSTSP....................................AD-A----RDIYRTTY------PL------------
A6S6Y6_BOTFB/24-271--LWSTQP....................................AA-Y----QDIIRTAY------PI------------
AFCA_ASPOR/18-260--LWSSKA...............AS...................WD-T----TN...EAY------TL------------
C7ZMG8_NECH7/26-278--IWSTSP...............GTYG.................VD-D----NYILKSGY------PV------------
AFCA_ASPNC/23-266--LWSDSP....................................GN-Y----SSFITTAF------PL------------
D8QJY6_SCHCM/33-288--LWYDTP...............GTN..................WG-R----.....EYL------PI------------
Q01VL7_SOLUE/25-216--LWYQQP...............AED..................WQ-S----.....QAL------PI------------
F0BR50_9XANT/10-221--LPYAAP...............AADAQLLR...............-.----.....EGL------PI------------
C7QDB1_CATAD/65-277--LWYTSP...............GSAANIMQ...............-.----.....EGL------AV------------
D6XC25_9ACTO/46-251--LWWQAP...............ADEHSMIE...............-.----.....QGL------PV------------
F2LID8_BURGS/67-272--LSYSQA...............AGESNILF...............-.----.....EGL------PL------------
A5FLW5_FLAJ1/30-276--LWYKQP...............AEF..................FE-.----.....ESL------VL------------
B5D3Z6_9BACE/34-284--LHYNRP...............AEF..................FE-.----.....EAL------VI------------
D3IM15_9BACT/27-264--IWDNRP...............GSF..................FE-.----.....NSM------PI------------
D1W5Z9_9BACT/26-258--LWYDKP...............AQY..................FE-.----.....ESM------PI------------
D7GFE8_PROFC/6-264--IEVARP...............AAS..................PA-.----.....DAF------LL------------
D7CDJ0_STRBB/6-250--IQLTEP...............ATA..................FH-.----.....DSF------LI------------
Q5WIX9_BACSK/3-249--LTEQQP...............AQT..................WT-.----.....EAY------PI------------
A6WFR5_KINRD/6-266--LRYEGP...............ATT..................WL-.----.....EAL------PV------------
B8HAG7_ARTCA/2-255--LWYRGP...............AEK..................FV-.----.....ESL------PV------------
F0M2S8_ARTPP/7-280--LAYDAP...............AAE..................WL-.----.....EAL------PL------------
D4BRP0_BIFBR/3-260--LTFDGI...............SSC..................WE-.----.....ESI------PL------------
C7QZB0_JONDD/21-283--LSLNAP...............CTT..................WV-.----.....EAL------PL------------
Q02BM3_SOLUE/32-244--LVYTKP...............VPR..................SE-.----.....EGM------PV------------
C6VSI5_DYAFD/35-265--LHFDKL...............AKV..................WD-.----.....EAL------PL------------
B6FP44_9CLOT/51-330--IRFDEP............L..SKGKLTGSSGNFTKPGSDTDWWQ-Q----.....LSL------PI------------
D7FKT5_ECTSI/258-515--VWDDEP...............GAD..................WT-.----.....TSY------AL------------
E0RPS6_SPITD/10-238--LWSDRP...............AGV..................WR-.----.....DGY------PV------------
A6DKE0_9BACT/176-440--LRSSKP...............ANWTWGPFKKEELKDH.....WR-.----.....DAY------PI------------
C0E8Z7_9CLOT/53-300--VSKTYP...............TQYKD................WT-.----.....EAL------LG------------
B3C6V9_9BACE/31-273--IHFPET...............YAK..................WQ-.----.....EAL------LA------------
E8S9D0_MICSL/6-236--IHDTAP...............ADD..................WT-.----.....DAF------LT------------
D0MK80_RHOM4/42-285--L...QP...............AAR..................WE-.----.....EAL------VA------------
E4VX39_BACFG/35-292--VWSEKP...............AAS..................WQ-.----.....DAF------VT------------
A5ZUG0_9FIRM/11-261--LAFDRP...............AEA..................WN-.----.....EAL------PL------------
F2NU83_TRES6/4-265--IWYKNP...............AEN..................FG-.----.....EAI------SV------------
E2NCL7_9BACE/27-265--FWYAQP...............ASD..................WK-.----.....SAL------PI------------
B8I0M2_CLOCE/55-303--LFYNSM...............AGNNFSGNP............YD-L----NESFYKAL------PL------------
C9RS46_FIBSS/37-265--LWYNSD...............AGTE.................FT-.----.....NAL------PI------------
E2NAE9_9BACE/9-245--LWYQQP...............AKV..................WT-.----.....EAL------PL------------
C7PTZ7_CHIPD/24-262--LWYKQP...............AGNV.................WT-.----.....AAL------PV------------
E4RWC6_LEAB4/23-260--MWYQNP...............AGKV.................WE-.----.....KAL------PV------------
D1P8P0_9BACT/350-623--LWYNKP...............AGY..................WE-.----.....EAL------PL------------
C6CWA7_PAESJ/6-246--MIYTQP...............AAG..................WK-.----.....QGL------PL------------
C6IY46_9BACL/13-267--LWYDKP...............AAG..................WS-.----.....EGL------PV------------
B8MP90_TALSN/6-252--LWYDQP...............AQK..................WQ-.----.....DGL------PI------------
Q8A300_BACTN/31-269--LWYDKP...............ADE..................WM-.----.....KSL------PL------------
E4RVZ2_LEAB4/23-266--LLFYAP...............ARH..................FT-.----.....ESL------PL------------
D7VKY5_9SPHI/30-275--LWYDKA...............AKR..................WE-.----.....ETL------PL------------
B5JRH0_9BACT/30-280--VWFDSA...............GAS..................LT-.----.....ESI------PL------------
B5CXD0_9BACE/30-289--LWYESP...............ADATVADSPNG..........WQ-D----DAEWLKGL------PL------------
A6DGK8_9BACT/29-270--LWYKQA...............AQG..................FE-.----.....QSL------PI------------
FUCO2_ARATH/54-310--LTFGGP...............SRN..................WT-.----.....DAI------PI------------
E8RVA7_ASTEC/38-271--LSFNAP...............AAR..................WM-.----.....EAL------PV------------
E4SEI2_CALK2/8-246--IIFDKP...............ASC..................WE-.----.....EAL------PI------------
F0Z0W4_9CLOT/4-266--IWFRKE...............AEE..................WT-.----.....EAL------PI------------
E9SFF2_RUMAL/7-242--LWYKTP...............ADD..................WN-.----.....KAL------PL------------
F2JRD2_CELLD/6-242--LWYKQA...............ARN..................WN-.----.....EAL------PI------------
A6DLU8_9BACT/6-272--IFHHQP...............AGAD.................WN-.----.....RAF------PA------------
B6QLF5_PENMQ/5-248--LWYQQP...............AQC..................WN-.----.....EAL------PV------------
Q0TY74_PHANO/26-269--LYFNTP...............GSS..................LS-.----.....SSL------PI------------
Q0USM0_PHANO/26-249--IWFGKP...............GVI..................WT-.----.....DAL------PV------------
B6GAH0_9ACTN/58-310--MWYTEP...............GSFDD................WE-N----.....DAL------VI------------
D4M387_9FIRM/48-320--VWYDEP...............ATD..................WQ-T----.....QSL------AI------------
C0EAF8_9CLOT/47-316--LWYTKP...............APVNTDSKQ............WQ-Y----.....TVL------PL------------
B1V512_CLOPF/50-289--LWYDEP...............ATN..................WE-N----.....EAL------PI------------
E5CAW4_9BACE/28-255--LWYSQP...............APNEGAENIVKSRGFPYDKY.WE-R----.....WSL------PI------------
C0EIR9_9CLOT/49-264--LWYDEP...............APSSDIG..............WR-E----.....WSI------PM------------
C9LB61_RUMHA/43-318--LWYDEP...............ASKGKNILNGGSFGTTEEDNTWQ-Q----.....QTL------PI------------
E3ELM5_BIFBS/595-862--LWYKQP...............ASQTDATATAGGNYGNPDNNRWQ-Q----.....TTL------PF------------
D4XX42_9MOLU/39-315--IEFFKE...............TNNQYREG.............WE-K----.....RSL------PI------------
B6FR06_9CLOT/50-321--LWYTSP...............AKIDTAETNGGE.........WM-Q----.....QSL------PL------------
E7NUZ4_TREPH/40-298--LYYTKA...............AEQTAEG..............WE-Q----.....KSL------PI------------
D4JSM8_9FIRM/5-247--ILFTAP...............GEFDK................WE-Q----.....QCQ------PI------------
E7RS88_9BACT/30-233--LWYTAP...............VTAMQVDDP............WQ-E----.....YAL------PI------------
D1W0X5_9BACT/196-406--LWYTKP...............ATV..................WM-T----.....STL------PI------------
A7LY00_BACOV/52-260--LWYDQP...............SDN..................WM-D----.....LSL------PI------------
B3PBE3_CELJU/14-256--IAFDRP...............ATD..................WE-R----.....EGL------PI------------
B5GF62_9ACTO/53-292--LRYTAP...............ATD..................WE-T----.....QSL------PV------------
C6W772_DYAFD/35-280--LWYDQP...............AKE..................WM-T----.....QAL------PI------------
D5ENS4_CORAD/28-273--LRYDRP...............ADA..................WT-.----.....DAL------PV------------
A6DSI9_9BACT/28-279--IKHDKP...............AMMQAKEKPYHSKDPV.....WQ-K----.....YCL------PI------------
C7MHU9_BRAFD/31-251--LALDAP...............ATD..................WA-G----.....GTL------PI------------
D3EK66_GEOS4/13-265--LWYRKP...............AAK..................WE-.----.....EAL------PL------------
D9RTI1_PREMB/45-251--L.........................................WE-A----.....EGY------PI------------
E6MT30_9BACT/33-341--IWFDSPCSLKGKAVWYGGNPMAWKDGKKPEMAGNSSKNADQEWE-S----.....ASL------PI------------

PF06045

Q2RAX6_ORYSJ/1-220--MAAAAA---------------CTK------------------LPLL----LLL..VAV------AASSASSLT-----
A0SPK1_9POAL/1-190--MQ....---------------...------------------....----........------.........-----
Q2RAX6_ORYSJ/1421-1585--M.....---------------...------------------....----........------.........-----
Q0J3T7_ORYSJ/14-224--M.....---------------...------------------....----........------.........-----
O04510_ARATH/1-189--M.....---------------...------------------....----........------.........-----
O04512_ARATH/1-264--M.....---------------...------------------....----........------.........-----
O04511_ARATH/1-213--M.....---------------...------------------....----........------.........-----
Q9STV1_ARATH/1-204--M.....---------------...------------------....----........------.........-----
Q9SZK3_ARATH/1-218--MVSQKK---------------IAS------------------LFIC----FLLLLLLP------L........-----
Q6D915_ERWCT/1-203--MKRS..---------------...------------------..VL----LLVGAMLA------PYSYSAQDN-----
RHIE_DICD3/1-202--MHMNKP---------------LQA------------------WRTP----LLTLIFVL------PLTATG...-----
Q6NKW8_ARATH/1-243--MKVGAP---------------ASK------------------PGRI----IVQVFLLQ------LLLLLQSVH-----
Q84W85_ARATH/1-244--MEYGAP---------------GMK------------------AGRR----VLT.PLFV------LVFLLQGVH-----

PF07748

MA2A1_MOUSE/648-1144RYLVVYNP---------------FEQ------------------ERHS----VVSIRVNS------ATVKVLSDS.....
MA2A2_HUMAN/648-1146RFVVLFNP---------------LEQ------------------ERFS----MVSLLVNS------PRVRVLSEE.....
MA2B1_HUMAN/510-1001FQVIVYNP---------------LGR------------------KVNW----MVRLPVSE------GVFVVKDPN.....
MAN1_YEAST/670-1080ADLVEMRT---------------LTW------------------SKPE----KVSEECSL------NGSYTSSVTGY...
Q97C94_THEVO/613-1007KGLIAINN---------------SQY------------------EFNH----FVEIDNSL------ASEIPADKVVN...
Q20829_CAEEL/478-945FSVVIFNS---------------NGR------------------YFNG----TIRIPYSQ------KTAVLRDAH.....
Q82MA7_STRAW/619-1014GGPRVFNT---------------SPR------------------DRAE----VVRTSTGA------PA............
Q8XIN5_CLOPE/620-1040RSVVVFNS---------------LVF------------------ERDD----IATFDVPE------DIENPAVLDGEEEI
Q826B6_STRAW/620-1000TTPLVFNS---------------APH------------------TRDG----VPAGGART------PAVGGECALVPR..
Q97UK5_SULSO/576-965DKTFVFNS---------------LSW------------------DREE----YIEAD...------..............
Q9KEQ8_BACHD/620-1036EKWTFFHP---------------YQY------------------DTPI----LVTIPKGT------DERFVDQTGHGLSS
Q8MS44_DROME/481-1003VVVTLYNP---------------LAH------------------TSTQ----YVRVPVKN------ENYEVTDEK.....
O97043_DROME/673-1242GSFVLYNS---------------LAQ------------------KRLE----VVTLRVQH------PNVKIVNDK.....
Q7S1L0_NEUCR/663-1085ERGIALNT---------------LPW------------------YREE----LVEISKG.------..............
Q8IPB7_DROME/502-1074FALTLYNP---------------LAH------------------TVNE----YVRIPVPY------SNYRIIDNK.....
Q9X2G6_THEMA/610-1007DVLTILNA---------------SSF------------------PKKC----LFFLNEDL------AISFEGEALLKQKT
Q8Y5P1_LISMO/621-1032EKITLWNS---------------STW------------------TRPR----YIEISPEN------PADHLAFYDENNIL
Q7NPH5_GLOVI/590-1007LPVVVFNS---------------LAT------------------PRDA----PVALPAPG------NLRGARLVAVDRTG
Q972Y1_SULTO/561-945EEIYLFNS---------------LNW------------------DREE----YVEIN...------..............
Q7V4V0_PROMM/617-1007SPVLRLPR---------------DQW------------------GSAG----RQLPCQEA------KGGG..........
Q8G4Q0_BIFLO/651-1043APYASNPQ---------------YSW------------------AVRD----GGGTAVEE------SVIPVSVERGG...
O58565_PYRHO/375-852ARYIVFNP---------------NSF------------------PVSP----YIRTWESV------NGFYQRLKNG....
Q9LFR0_ARATH/644-1166HTVILFNP---------------SEQ------------------TREE----VVTVVVNR------AEISVLDSN.....
Q8Y9W8_LISMO/383-872FQFTVFNP---------------LPY------------------EKSG----VIKMTAYI------PEDNFTVEDTQGNT
Q9AJR6_BACGL/625-1043AVVSVYNG---------------AAF------------------DRTE----LVEIPVQA------GIGSQGGWLGEAGR
Q55528_SYNY3/615-1038TPLLVFNP---------------LHW------------------SQSQ----LVEIPIQE------GKHYQVYDGQTKTL
O18497_SPOFR/601-1127KKVILFNP---------------LAE------------------TRTE----VVTVRSNT------SNIRVYDTH.....
Q8SYY1_DROME/493-1012FMVTLYNP---------------LAH------------------TSTQ----YVRVPVKE------DSYQVTDEK.....
Q8A5X3_BACTN/693-1137PTLTIFNT---------------LNW------------------KRSE----MLTVYIDF------EVIPRNQFFEITDF
Q8LPJ3_ARATH/482-1007LIVLAYNP---------------LGW------------------KRVD----IVRLPVVG------GDVSVHDSE.....
MA2B2_PIG/460-989HVAMVYNP---------------LAW------------------TVTT----VITLTVSF------PEVSVTDES.....
Q8G4Q1_BIFLO/649-1036ISQFRNDG---------------ASW------------------HANR----INEPTDAL------SVLTQTLDNG....
MA2C1_RAT/621-1032KGLRHYQH---------------TAL------------------EAHR----SVGTTQGL------VGL...........
Q92A00_LISIN/399-880IPITVFHA---------------GGV------------------EATR----TVELELET------DAIHFSEMHFELIP
Q9FKW9_ARATH/497-1032LILVAYNS---------------LGW------------------NRTE----IIRIPVND------AGLSVEDSS.....
P94078_ARATH/487-1000LVVVVYNS---------------LGW------------------KREE----VVRVPVSS------ENVIVKDAS.....
Q9VLI0_DROME/480-978VVVTLYNA---------------LAH------------------TTKQ----YVRVPVKN------ENYQVTDEK.....
MAN2_DROME/616-1102KHVVMHNT---------------LPH------------------WREQ----LVDFYVSS------PFVSVTDLA.....
Q8YYK0_NOSS1/608-1041FPIFVFNS---------------LNW------------------QRSE----VVSVTLPP------PPTNQQWQVYDTTG
Q8XM34_CLOPE/630-1018EGAILVNS---------------LSW------------------SREQ----WIKLYDRW------TKVNLNSLSGEIIK
Q7U9I9_SYNPX/614-1003SPLLKLPH---------------GAW------------------HTDG----AALPQQPS------VQGG..........
MA2B2_MOUSE/487-1013YSASVYNP---------------LAW------------------KITT----IITLTVAF------PNVSVTDEL.....
Q8G4P9_BIFLO/645-1030RISQFADV---------------DPW------------------RPAS----LVSCGEPV------EVNRREDGS.....
Q8DM33_THEEB/592-1021IPVVIFNS---------------GVG------------------DRAG----VVHIDLAQ------LPQEIPSWRVYCPR
MAN1_SCHPO/664-1074EQLCLLNT---------------LPW------------------NVRG----VITETEEN------KLVYFESCDG....

PF01263

GAL10_KLULA/363-684--------------------------------------------------------------------------------
LACXC_LACLL/1-281--------------------------------------------------------------------------------
Q9LY79_ARATH/87-360--------------------------------------------------------------------------------
Q9KQJ7_VIBCH/25-292--------------------------------------------------------------------------------
Q9RP27_HAEIF/22-269--------------------------------------------------------------------------------
Q9VRU1_DROME/25-359--------------------------------------------------------------------------------
Q9RDN0_STRCO/33-363--------------------------------------------------------------------------------
P73504_SYNY3/14-276--------------------------------------------------------------------------------
Q986V3_RHILO/14-303--------------------------------------------------------------------------------
Q9SVZ5_ARATH/40-321--------------------------------------------------------------------------------
YEAD_ECOLI/27-288--------------------------------------------------------------------------------
Q9CMU5_PASMU/26-273--------------------------------------------------------------------------------
Q9SUQ4_ARATH/25-301--------------------------------------------------------------------------------
Q9VKF7_DROME/25-355--------------------------------------------------------------------------------
Q9VP02_DROME/25-355--------------------------------------------------------------------------------
GALM_BACSU/14-319--------------------------------------------------------------------------------
YIHR_ECOLI/19-304--------------------------------------------------------------------------------
Q9K995_BACHD/17-344--------------------------------------------------------------------------------
Q97L65_CLOAB/18-336--------------------------------------------------------------------------------
Q9HJQ6_THEAC/19-286--------------------------------------------------------------------------------
Q986G3_RHILO/15-295--------------------------------------------------------------------------------
GALM_SHIFL/16-342--------------------------------------------------------------------------------
Q9CF52_LACLA/4-275--------------------------------------------------------------------------------
Q9A8D6_CAUCR/39-373--------------------------------------------------------------------------------
GALM_HAEIN/16-338--------------------------------------------------------------------------------
Q97A31_THEVO/1-267--------------------------------------------------------------------------------
Q9M6D7_CHLRE/53-318--------------------------------------------------------------------------------
GALM_STRTR/17-342--------------------------------------------------------------------------------
Q9RDP4_STRCO/15-319--------------------------------------------------------------------------------
Q9ZB17_9LACT/13-335--------------------------------------------------------------------------------
GAL10_SCHPO/369-689--------------------------------------------------------------------------------
Q99RT5_STAAM/13-331--------------------------------------------------------------------------------
Q9KRP2_VIBCH/20-347--------------------------------------------------------------------------------
Q9L7R7_SALTM/6-278--------------------------------------------------------------------------------
AAPC_CENCI/34-310--------------------------------------------------------------------------------
YH10_YEAST/11-338--------------------------------------------------------------------------------
Q97T84_STRPN/18-341--------------------------------------------------------------------------------
Q9CN43_PASMU/23-271--------------------------------------------------------------------------------
Q9A381_CAUCR/1-279--------------------------------------------------------------------------------
O94124_RHIST/13-358--------------------------------------------------------------------------------
Q9LVH6_ARATH/10-338--------------------------------------------------------------------------------
Q9M308_ARATH/24-299--------------------------------------------------------------------------------
P94168_ACTPL/2-319--------------------------------------------------------------------------------
Q9FJY6_ARATH/46-305--------------------------------------------------------------------------------
Q98MW4_RHILO/4-274--------------------------------------------------------------------------------
Q9HZ52_PSEAE/28-281--------------------------------------------------------------------------------
Q9PB74_XYLFA/16-284--------------------------------------------------------------------------------
O48971_TOBAC/28-351--------------------------------------------------------------------------------
Q97JD7_CLOAB/16-338--------------------------------------------------------------------------------
Q9HTE2_PSEAE/30-311--------------------------------------------------------------------------------
Q9LVC5_ARATH/18-294--------------------------------------------------------------------------------
Q05765_SACPS/73-396--------------------------------------------------------------------------------
GALM_PIG/20-338--------------------------------------------------------------------------------
Q9CM12_PASMU/17-340--------------------------------------------------------------------------------
GAL10_PACTA/363-685--------------------------------------------------------------------------------
YN9A_YEAST/11-339--------------------------------------------------------------------------------
Q9V3D1_DROME/12-282--------------------------------------------------------------------------------
Q9WYB8_THEMA/23-351--------------------------------------------------------------------------------
YPHB_ECOLI/2-286--------------------------------------------------------------------------------
Q9CFG9_LACLA/19-330--------------------------------------------------------------------------------
Q9VY83_DROME/24-362--------------------------------------------------------------------------------
Q9STT3_ARATH/32-354--------------------------------------------------------------------------------
GALM_ACICA/38-376--------------------------------------------------------------------------------
Q97ES5_CLOAB/1-281--------------------------------------------------------------------------------
Q9LXG7_ARATH/161-485--------------------------------------------------------------------------------
YMY9_YEAST/9-287--------------------------------------------------------------------------------

PF14486

C8TCN7_KLEPR/63-369--------------------------------------------------------------------------------
Q6CYX0_ERWCT/66-372--------------------------------------------------------------------------------
D8MS65_ERWBE/63-369--------------------------------------------------------------------------------
D4E903_SEROD/84-389--------------------------------------------------------------------------------
C4UXP6_YERRO/63-368--------------------------------------------------------------------------------
A4VGA8_PSEU5/62-367--------------------------------------------------------------------------------
Q4ZR72_PSEU2/63-368--------------------------------------------------------------------------------
A4SJ08_AERS4/64-370--------------------------------------------------------------------------------
E7S0H9_9BURK/63-369--------------------------------------------------------------------------------
C1DDL0_AZOVD/63-368--------------------------------------------------------------------------------
E1JSY6_DESFR/65-370--------------------------------------------------------------------------------
A6VRI9_MARMS/45-355--------------------------------------------------------------------------------
B2STA4_XANOP/63-368--------------------------------------------------------------------------------
B5JRI2_9BACT/46-358--------------------------------------------------------------------------------
A6DJS3_9BACT/68-374--------------------------------------------------------------------------------
E8TDX5_MESCW/37-354--------------------------------------------------------------------------------
E7U952_ECOLX/28-330--------------------------------------------------------------------------------
A6CCQ6_9PLAN/48-358--------------------------------------------------------------------------------
A3U233_9RHOB/60-376--------------------------------------------------------------------------------
E7S0S6_9BURK/68-374--------------------------------------------------------------------------------
A3ZMH7_9PLAN/47-353--------------------------------------------------------------------------------
B2IFZ2_BEII9/79-384--------------------------------------------------------------------------------
F2AXT9_RHOBT/49-355--------------------------------------------------------------------------------
C6XPV1_HIRBI/37-353--------------------------------------------------------------------------------
D2R5D2_PIRSD/48-359--------------------------------------------------------------------------------
Q2CC41_9RHOB/37-353--------------------------------------------------------------------------------
Q1AYM2_RUBXD/37-346--------------------------------------------------------------------------------
E8R531_ISOPI/45-351--------------------------------------------------------------------------------
D1CHA6_THET1/37-338--------------------------------------------------------------------------------
D5SWV3_PLAL2/49-356--------------------------------------------------------------------------------
D6ZVF2_BIFLJ/35-343--------------------------------------------------------------------------------
A4FGH2_SACEN/53-349--------------------------------------------------------------------------------
F0SP29_PLABD/45-353--------------------------------------------------------------------------------
C6W7A5_DYAFD/39-348--------------------------------------------------------------------------------
C5EMT3_9FIRM/31-332--------------------------------------------------------------------------------
C6JDQ2_9FIRM/29-333--------------------------------------------------------------------------------
C5EVY1_9FIRM/58-359--------------------------------------------------------------------------------
D2QJ04_SPILD/29-338--------------------------------------------------------------------------------
A3HYW8_9BACT/35-344--------------------------------------------------------------------------------
D9RZ46_THEOJ/37-341--------------------------------------------------------------------------------
B6G216_9FIRM/38-339--------------------------------------------------------------------------------
E5VLF0_9FIRM/26-323--------------------------------------------------------------------------------
E4HSQ4_PROAA/36-345--------------------------------------------------------------------------------
A4AFA2_9ACTN/35-332--------------------------------------------------------------------------------
A5ZM38_9FIRM/24-319--------------------------------------------------------------------------------
D1N8M9_9BACT/32-325--------------------------------------------------------------------------------
F2PD67_PHOMO/32-333--------------------------------------------------------------------------------
A7VPY4_9CLOT/30-334--------------------------------------------------------------------------------
A7VTY4_9CLOT/24-319--------------------------------------------------------------------------------
C0W0W1_9ACTO/33-337--------------------------------------------------------------------------------
D7GQT9_9FIRM/30-326--------------------------------------------------------------------------------
B3W843_LACCB/26-319--------------------------------------------------------------------------------
D4M7N6_9BACT/32-333--------------------------------------------------------------------------------
E7NWQ8_TREPH/35-339--------------------------------------------------------------------------------
B5QP71_LACRH/26-319--------------------------------------------------------------------------------
C2K0S4_LACRH/29-322--------------------------------------------------------------------------------
E7GTM1_CLOSY/30-326--------------------------------------------------------------------------------
E1JKF2_9LACO/27-315--------------------------------------------------------------------------------
D2S5J5_GEOOG/37-338--------------------------------------------------------------------------------
B2Z3U5_AGRRK/36-329--------------------------------------------------------------------------------
C5C3Q0_BEUC1/37-320--------------------------------------------------------------------------------
C8XH26_NAKMY/26-324--------------------------------------------------------------------------------
A6UBC7_SINMW/28-308--------------------------------------------------------------------------------

PF14849

YIDC_BURCH/79-353--------------------------------------------------------------------------------
YIDC_AERHH/67-347--------------------------------------------------------------------------------
YIDC_SHESA/67-342--------------------------------------------------------------------------------
YIDC_MAGSM/86-360--------------------------------------------------------------------------------
YIDC_SYNFM/76-350--------------------------------------------------------------------------------
A0M3I9_GRAFK/92-360--------------------------------------------------------------------------------
A0NSE7_9RHOB/91-371--------------------------------------------------------------------------------
YIDC_FRATN/81-354--------------------------------------------------------------------------------
A0RNG0_CAMFF/78-324--------------------------------------------------------------------------------
A0Y4R8_9GAMM/71-343--------------------------------------------------------------------------------
A0Y965_9GAMM/94-374--------------------------------------------------------------------------------
YIDC_ECOK1/60-343--------------------------------------------------------------------------------
YIDC_PELPD/70-338--------------------------------------------------------------------------------
YIDC_CHLPD/72-345--------------------------------------------------------------------------------
A1ESE5_VIBCL/35-310--------------------------------------------------------------------------------
A1JT86_YERE8/60-342--------------------------------------------------------------------------------
A1KCP9_AZOSB/62-337--------------------------------------------------------------------------------
YIDC_NEIMF/55-343--------------------------------------------------------------------------------
YIDC_SHEAM/67-342--------------------------------------------------------------------------------
YIDC_PSYIN/82-356--------------------------------------------------------------------------------
YIDC_MARAV/89-367--------------------------------------------------------------------------------
A1UTM0_BARBK/88-378--------------------------------------------------------------------------------
YIDC_DESVV/71-335--------------------------------------------------------------------------------
A1VUS5_POLNA/88-366--------------------------------------------------------------------------------
A1VZU9_CAMJJ/78-325--------------------------------------------------------------------------------
A1WDB6_ACISJ/89-367--------------------------------------------------------------------------------
A1WSU1_VEREI/90-364--------------------------------------------------------------------------------
YIDC_HALHL/76-353--------------------------------------------------------------------------------
A2SMI9_METPP/84-359--------------------------------------------------------------------------------
A2TVU8_9FLAO/95-369--------------------------------------------------------------------------------
A3EQG7_9BACT/54-314--------------------------------------------------------------------------------
A3HZF9_9BACT/83-351--------------------------------------------------------------------------------
A3J0Y5_9FLAO/92-366--------------------------------------------------------------------------------
A3JKS5_9ALTE/114-392--------------------------------------------------------------------------------
A3JXJ6_9RHOB/79-358--------------------------------------------------------------------------------
A3M8Z0_ACIBT/26-325--------------------------------------------------------------------------------
YIDC_RHOS1/70-368--------------------------------------------------------------------------------
YIDC_SHELP/68-343--------------------------------------------------------------------------------
A3RT33_RALSL/84-353--------------------------------------------------------------------------------
A3S812_9RHOB/79-365--------------------------------------------------------------------------------
A3TU25_9RHOB/82-369--------------------------------------------------------------------------------
A3UBQ3_CROAH/95-366--------------------------------------------------------------------------------
A3UFD6_9RHOB/80-359--------------------------------------------------------------------------------
A3V0A3_VIBSP/65-340--------------------------------------------------------------------------------
A3V4K5_9RHOB/73-362--------------------------------------------------------------------------------
A3VF89_9RHOB/85-374--------------------------------------------------------------------------------
A3W4K6_9RHOB/74-363--------------------------------------------------------------------------------
A3WNL1_9GAMM/79-352--------------------------------------------------------------------------------
A3X1F9_9BRAD/81-371--------------------------------------------------------------------------------
A3X407_9RHOB/76-363--------------------------------------------------------------------------------
A3XGM2_LEEBM/97-368--------------------------------------------------------------------------------
A3YIB8_9GAMM/75-352--------------------------------------------------------------------------------
A4AW41_MARSH/92-364--------------------------------------------------------------------------------
A4BD89_9GAMM/80-356--------------------------------------------------------------------------------
A4BP05_9GAMM/69-343--------------------------------------------------------------------------------
A4CDJ1_9GAMM/72-344--------------------------------------------------------------------------------
A4CNB4_ROBBH/96-366--------------------------------------------------------------------------------
A4EH88_9RHOB/73-362--------------------------------------------------------------------------------
A4EPF1_9RHOB/75-363--------------------------------------------------------------------------------
YIDC_HERAR/86-359--------------------------------------------------------------------------------
A4MW21_HAEIF/65-339--------------------------------------------------------------------------------
YIDC_PROVI/72-345--------------------------------------------------------------------------------
A4TZQ4_9PROT/78-357--------------------------------------------------------------------------------
YIDC_PSEU5/82-358--------------------------------------------------------------------------------
A4YLD0_BRASO/97-387--------------------------------------------------------------------------------
A5EY44_DICNV/67-344--------------------------------------------------------------------------------
A5FHA5_FLAJ1/97-371--------------------------------------------------------------------------------
YIDC_ACICJ/80-374--------------------------------------------------------------------------------
YIDC_GEOUR/67-335--------------------------------------------------------------------------------
YIDC_LEGPC/74-351--------------------------------------------------------------------------------
A5PCQ5_9SPHN/75-347--------------------------------------------------------------------------------
A5VCE7_SPHWW/74-350--------------------------------------------------------------------------------
A5VVS9_BRUO2/96-377--------------------------------------------------------------------------------
YIDC_PSEP1/82-360--------------------------------------------------------------------------------
A5WI37_PSYWF/86-362--------------------------------------------------------------------------------
A5ZDH4_9BACE/85-357--------------------------------------------------------------------------------
A6D430_9VIBR/65-340--------------------------------------------------------------------------------
A6DA77_9PROT/64-307--------------------------------------------------------------------------------
A6ESJ9_9BACT/103-373--------------------------------------------------------------------------------
A6EY90_9ALTE/92-370--------------------------------------------------------------------------------
A6FI67_9GAMM/66-346--------------------------------------------------------------------------------
A6FLS2_9RHOB/78-359--------------------------------------------------------------------------------
A6G3S3_9DELT/89-365--------------------------------------------------------------------------------
A6GL25_9BURK/86-359--------------------------------------------------------------------------------
A6Q3D4_NITSB/79-325--------------------------------------------------------------------------------
A6QAL2_SULNB/79-326--------------------------------------------------------------------------------
YIDC_JANMA/85-357--------------------------------------------------------------------------------
YIDC_KLEP7/59-343--------------------------------------------------------------------------------
YIDC_SINMW/85-365--------------------------------------------------------------------------------
YIDC_ACTSZ/62-334--------------------------------------------------------------------------------
YIDC_MARMS/79-356--------------------------------------------------------------------------------
A7GYZ3_CAMC5/72-316--------------------------------------------------------------------------------
YIDC_ANADF/73-347--------------------------------------------------------------------------------
A7HPT9_PARL1/93-373--------------------------------------------------------------------------------
A7I143_CAMHC/78-324--------------------------------------------------------------------------------
A7IGM3_XANP2/99-378--------------------------------------------------------------------------------
A7JWZ0_PASHA/67-339--------------------------------------------------------------------------------
YIDC_CROS8/60-344--------------------------------------------------------------------------------
A7V5B9_BACUN/84-357--------------------------------------------------------------------------------
A7ZCY9_CAMC1/70-314--------------------------------------------------------------------------------
A8EV97_ARCB4/88-333--------------------------------------------------------------------------------
YIDC_RICM5/71-350--------------------------------------------------------------------------------
YIDC_SERP5/60-340--------------------------------------------------------------------------------
YIDC_SHEPA/71-346--------------------------------------------------------------------------------
A8ILM2_AZOC5/88-369--------------------------------------------------------------------------------
YIDC_DINSH/79-367--------------------------------------------------------------------------------
A8PQB3_9COXI/66-338--------------------------------------------------------------------------------
A8TUD8_9PROT/88-367--------------------------------------------------------------------------------
A8UPQ4_9FLAO/98-370--------------------------------------------------------------------------------
A8UV65_9AQUI/85-321--------------------------------------------------------------------------------
A8UZM0_9AQUI/104-350--------------------------------------------------------------------------------
A9C1M1_DELAS/86-361--------------------------------------------------------------------------------
A9DU76_9RHOB/83-371--------------------------------------------------------------------------------
A9EHP0_9RHOB/78-366--------------------------------------------------------------------------------
A9HKS4_GLUDA/56-342--------------------------------------------------------------------------------
YIDC_BORPD/87-362--------------------------------------------------------------------------------
A9IXD9_BART1/90-380--------------------------------------------------------------------------------
YIDC_COXBN/80-358--------------------------------------------------------------------------------
YIDC_METEP/92-379--------------------------------------------------------------------------------
B0QWJ2_HAEPR/71-343--------------------------------------------------------------------------------
YIDC_XANCB/91-370--------------------------------------------------------------------------------
YIDC_CAUSK/79-389--------------------------------------------------------------------------------
YIDC_XYLFM/76-359--------------------------------------------------------------------------------
YIDC_HAES2/64-338--------------------------------------------------------------------------------
B0VGK2_CLOAI/73-333--------------------------------------------------------------------------------
YIDC_METRJ/93-380--------------------------------------------------------------------------------
YIDC_POLNS/81-360--------------------------------------------------------------------------------
B1Y0F7_LEPCP/82-364--------------------------------------------------------------------------------
YIDC_BEII9/87-368--------------------------------------------------------------------------------
B2PV42_PROST/59-343--------------------------------------------------------------------------------
YIDC_PORG3/88-364--------------------------------------------------------------------------------
B2URJ4_AKKM8/83-384--------------------------------------------------------------------------------
B2V9H4_SULSY/78-323--------------------------------------------------------------------------------
YIDC_ERWT9/60-343--------------------------------------------------------------------------------
YIDC_GEOLS/69-337--------------------------------------------------------------------------------
YIDC_CHLL2/73-345--------------------------------------------------------------------------------
YIDC_CHLPB/77-350--------------------------------------------------------------------------------
YIDC_RHIE6/87-366--------------------------------------------------------------------------------
B3QCI2_RHOPT/95-385--------------------------------------------------------------------------------
YIDC_CHLP8/75-348--------------------------------------------------------------------------------
YIDC_CHLT3/79-354--------------------------------------------------------------------------------
YIDC_CUPTR/88-357--------------------------------------------------------------------------------
B4F0U1_PROMH/62-343--------------------------------------------------------------------------------
YIDC_PHEZH/77-357--------------------------------------------------------------------------------
YIDC_PROA2/73-346--------------------------------------------------------------------------------
YIDC_PELPB/72-345--------------------------------------------------------------------------------
B4U8V7_HYDS0/77-310--------------------------------------------------------------------------------
B4W6P1_9CAUL/77-360--------------------------------------------------------------------------------
B4X1P5_9GAMM/90-373--------------------------------------------------------------------------------
YIDC_GEOBB/76-344--------------------------------------------------------------------------------
B5EJI9_ACIF5/71-332--------------------------------------------------------------------------------
B5FEU7_VIBFM/67-341--------------------------------------------------------------------------------
B5J3A9_9RHOB/75-355--------------------------------------------------------------------------------
B5JPX1_9BACT/91-373--------------------------------------------------------------------------------
B5JT26_9GAMM/80-355--------------------------------------------------------------------------------
B5TVD7_9PAST/67-352--------------------------------------------------------------------------------
B5WNV2_9BURK/79-353--------------------------------------------------------------------------------
B5YLC7_THEYD/75-318--------------------------------------------------------------------------------
B6AYD8_9RHOB/77-364--------------------------------------------------------------------------------
B6BRA8_9PROT/69-342--------------------------------------------------------------------------------
B6BVS1_9PROT/64-333--------------------------------------------------------------------------------
B6C620_9GAMM/76-350--------------------------------------------------------------------------------
B6JJN8_OLICO/93-374--------------------------------------------------------------------------------
B6R8Z5_9RHOB/90-370--------------------------------------------------------------------------------
B7X1D2_COMTE/87-361--------------------------------------------------------------------------------
YIDC_DESVM/76-340--------------------------------------------------------------------------------
YIDC_METSB/81-364--------------------------------------------------------------------------------
B8FMU7_DESAA/80-351--------------------------------------------------------------------------------
YIDC_THISH/78-359--------------------------------------------------------------------------------
YIDC_CAUCN/78-377--------------------------------------------------------------------------------
B8J2U4_DESDA/74-342--------------------------------------------------------------------------------
B8KLJ5_9GAMM/111-388--------------------------------------------------------------------------------
B9D1D7_WOLRE/75-318--------------------------------------------------------------------------------
B9KFP9_CAMLR/73-319--------------------------------------------------------------------------------
B9KI96_ANAMF/142-427--------------------------------------------------------------------------------
B9L9D7_NAUPA/72-316--------------------------------------------------------------------------------
YIDC_GEOSF/69-337--------------------------------------------------------------------------------
B9NL98_9RHOB/75-368--------------------------------------------------------------------------------
B9R1R8_9RHOB/93-373--------------------------------------------------------------------------------
B9XJP0_9BACT/84-382--------------------------------------------------------------------------------
B9Z8U5_9NEIS/66-349--------------------------------------------------------------------------------
C0BJD0_9BACT/83-354--------------------------------------------------------------------------------
C0DYB8_EIKCO/59-347--------------------------------------------------------------------------------
C0N352_9GAMM/79-352--------------------------------------------------------------------------------
C0QIZ1_DESAH/83-349--------------------------------------------------------------------------------
C1AEP7_GEMAT/82-361--------------------------------------------------------------------------------
YIDC_LARHH/64-349--------------------------------------------------------------------------------
C1DTT8_SULAA/77-322--------------------------------------------------------------------------------
C1F9G1_ACIC5/93-378--------------------------------------------------------------------------------
C2M324_CAPGI/89-358--------------------------------------------------------------------------------
C3X5V7_OXAFO/83-357--------------------------------------------------------------------------------
C3XJR0_9HELI/78-326--------------------------------------------------------------------------------
C4GKM4_9NEIS/60-349--------------------------------------------------------------------------------
C4K7P5_HAMD5/61-343--------------------------------------------------------------------------------
YIDC_TOLAT/62-347--------------------------------------------------------------------------------
YIDC_DESMR/68-332--------------------------------------------------------------------------------
C4ZKT3_THASP/75-351--------------------------------------------------------------------------------
YIDC_TERTT/87-365--------------------------------------------------------------------------------
C5CSC1_VARPS/84-368--------------------------------------------------------------------------------
C5EXY9_9HELI/76-325--------------------------------------------------------------------------------
C5ZXJ0_9HELI/77-326--------------------------------------------------------------------------------
YIDC_DESAD/74-338--------------------------------------------------------------------------------
C6C779_DICDC/59-340--------------------------------------------------------------------------------
C6ICV7_9BACE/83-355--------------------------------------------------------------------------------
C6NT82_9GAMM/85-343--------------------------------------------------------------------------------
C6W539_DYAFD/66-333--------------------------------------------------------------------------------
C6WTV5_METML/74-344--------------------------------------------------------------------------------
C6XBU5_METSD/72-344--------------------------------------------------------------------------------
C6XF04_LIBAP/70-349--------------------------------------------------------------------------------
C6XQ56_HIRBI/83-363--------------------------------------------------------------------------------
C7BT51_PHOAA/58-340--------------------------------------------------------------------------------
C7D7D3_9RHOB/76-363--------------------------------------------------------------------------------
C7JEI5_ACEP3/72-355--------------------------------------------------------------------------------
C7LXJ6_DESBD/71-334--------------------------------------------------------------------------------
C7M523_CAPOD/94-367--------------------------------------------------------------------------------
C7RRI8_ACCPU/72-357--------------------------------------------------------------------------------
C8N7Q9_9GAMM/78-349--------------------------------------------------------------------------------
C8PZ49_9GAMM/83-358--------------------------------------------------------------------------------
C8S4X2_9RHOB/70-359--------------------------------------------------------------------------------
C8X4E9_DESRD/89-350--------------------------------------------------------------------------------
C9CUD9_9RHOB/81-369--------------------------------------------------------------------------------
C9P930_VIBME/65-340--------------------------------------------------------------------------------
C9PM89_9PAST/65-339--------------------------------------------------------------------------------
C9R685_AGGAD/66-340--------------------------------------------------------------------------------
C9RS07_FIBSS/98-377--------------------------------------------------------------------------------
C9YCP9_9BURK/79-362--------------------------------------------------------------------------------
D0D3Z8_9RHOB/78-366--------------------------------------------------------------------------------
D0I2Z1_VIBHO/48-321--------------------------------------------------------------------------------
D0KXN2_HALNC/87-369--------------------------------------------------------------------------------
D0MGR8_RHOM4/82-358--------------------------------------------------------------------------------
D0RR44_9PROT/72-345--------------------------------------------------------------------------------
D0Z129_LISDA/65-339--------------------------------------------------------------------------------
D1B2U2_SULD5/83-329--------------------------------------------------------------------------------
D1KCD1_9GAMM/86-354--------------------------------------------------------------------------------
D1RD64_LEGLO/74-351--------------------------------------------------------------------------------
D2TY53_9ENTR/58-342--------------------------------------------------------------------------------
D2UGY9_XANAP/85-366--------------------------------------------------------------------------------
D3NRY2_AZOS1/85-363--------------------------------------------------------------------------------
D3PB77_DEFDS/67-312--------------------------------------------------------------------------------
D3RS85_ALLVD/78-354--------------------------------------------------------------------------------
D3SFF1_THISK/81-365--------------------------------------------------------------------------------
D3SM35_THEAH/68-295--------------------------------------------------------------------------------
D3VFZ9_XENNA/54-335--------------------------------------------------------------------------------
D4DLV5_NEIEG/57-345--------------------------------------------------------------------------------
D4FAW5_EDWTA/70-352--------------------------------------------------------------------------------
D4H194_DENA2/71-316--------------------------------------------------------------------------------
D4YZ11_SPHJU/74-348--------------------------------------------------------------------------------
D4ZD76_SHEVD/70-345--------------------------------------------------------------------------------
D5AM40_RHOCB/67-374--------------------------------------------------------------------------------
D5BGP8_ZUNPS/95-365--------------------------------------------------------------------------------
D5BTZ8_PUNMI/94-376--------------------------------------------------------------------------------
D5CQJ8_SIDLE/71-344--------------------------------------------------------------------------------
D5H4L9_SALRM/114-393--------------------------------------------------------------------------------
D5MLW8_9BACT/77-342--------------------------------------------------------------------------------
D5QCU3_GLUHA/64-351--------------------------------------------------------------------------------
D5QKL0_METTR/94-373--------------------------------------------------------------------------------
D5V159_ARCNC/94-340--------------------------------------------------------------------------------
D5V9B9_MORCR/81-356--------------------------------------------------------------------------------
D5X092_THIK1/88-361--------------------------------------------------------------------------------
D6L2A6_9NEIS/51-339--------------------------------------------------------------------------------
D7A2X3_STAND/89-370--------------------------------------------------------------------------------
D7AGW1_GEOSK/67-334--------------------------------------------------------------------------------
D7DPN7_METS0/67-338--------------------------------------------------------------------------------
D7HT65_PSESS/85-363--------------------------------------------------------------------------------
D7VNI1_9SPHI/86-358--------------------------------------------------------------------------------
D8FEY0_9DELT/74-343--------------------------------------------------------------------------------
D8IUS2_HERSS/62-334--------------------------------------------------------------------------------
D8JXN4_HYPDA/99-385--------------------------------------------------------------------------------
D9PLD5_9ZZZZ/72-318--------------------------------------------------------------------------------
D9QLU4_BRESC/86-370--------------------------------------------------------------------------------
D9SEP3_GALCS/70-342--------------------------------------------------------------------------------
D9YCI7_9DELT/76-344--------------------------------------------------------------------------------
E0E9T6_ACTPL/60-331--------------------------------------------------------------------------------
E0QC07_CAMCO/82-329--------------------------------------------------------------------------------
E0TGR5_PARBH/75-349--------------------------------------------------------------------------------
E1JWT9_DESFR/72-336--------------------------------------------------------------------------------
E1QGD7_DESB2/72-341--------------------------------------------------------------------------------
E1R6N6_SPISS/85-369--------------------------------------------------------------------------------
E1SRS1_FERBD/67-340--------------------------------------------------------------------------------
E1VCI5_HALED/89-362--------------------------------------------------------------------------------
E1YHJ2_9DELT/73-343--------------------------------------------------------------------------------
E2CFI6_9RHOB/88-368--------------------------------------------------------------------------------
E2Y0D7_PSEFL/82-367--------------------------------------------------------------------------------
E3BH69_9VIBR/64-349--------------------------------------------------------------------------------
E3I8D6_RHOVT/87-376--------------------------------------------------------------------------------
E4PHG2_MARAH/93-371--------------------------------------------------------------------------------
E4RXZ7_LEAB4/66-342--------------------------------------------------------------------------------
E4TI09_CALNY/66-312--------------------------------------------------------------------------------
E4U0E7_SULKY/78-324--------------------------------------------------------------------------------
E5ANF4_BURRH/84-357--------------------------------------------------------------------------------
E5UFL6_ALCXX/85-360--------------------------------------------------------------------------------
E5Y3D4_BILWA/70-335--------------------------------------------------------------------------------
E6L9N5_CAMUP/85-332--------------------------------------------------------------------------------
E6PV40_9ZZZZ/84-356--------------------------------------------------------------------------------
E6QUQ9_9ZZZZ/65-340--------------------------------------------------------------------------------
E6VVL3_DESAO/78-347--------------------------------------------------------------------------------
E6W2A4_DESIS/84-327--------------------------------------------------------------------------------
E6WXG3_PSEUU/84-365--------------------------------------------------------------------------------
E6XAK3_CELAD/92-365--------------------------------------------------------------------------------
E7C5J1_9BACT/79-427--------------------------------------------------------------------------------
E7C9X2_9PROT/74-354--------------------------------------------------------------------------------
E7RZL5_9BURK/87-360--------------------------------------------------------------------------------
E8L3J9_9RHIZ/76-358--------------------------------------------------------------------------------
E8LJ48_9GAMM/56-342--------------------------------------------------------------------------------
E8Q5V7_BLOVB/159-447--------------------------------------------------------------------------------
E8RBA3_DESPD/75-344--------------------------------------------------------------------------------
E8RRW7_ASTEC/75-370--------------------------------------------------------------------------------
E8T5A7_THEA1/59-297--------------------------------------------------------------------------------
E8UFE8_TAYEM/72-346--------------------------------------------------------------------------------
E8V6Z5_TERSS/94-374--------------------------------------------------------------------------------
E8WL20_GEOS8/75-344--------------------------------------------------------------------------------
E8WWP1_ACISM/87-375--------------------------------------------------------------------------------
E8XPB8_RAHSY/60-339--------------------------------------------------------------------------------
F0F1E8_9NEIS/53-342--------------------------------------------------------------------------------
F0IH08_9FLAO/89-358--------------------------------------------------------------------------------
F0JKI5_DESDE/78-347--------------------------------------------------------------------------------
F0L5H9_AGRSH/88-368--------------------------------------------------------------------------------
F0NZP1_WEEVC/77-350--------------------------------------------------------------------------------
F0RH16_CELLC/92-364--------------------------------------------------------------------------------
F0RX03_SPHGB/84-372--------------------------------------------------------------------------------
F0SF95_PLABD/95-399--------------------------------------------------------------------------------
F2B931_9NEIS/54-342--------------------------------------------------------------------------------
F2GD54_ALTMD/78-351--------------------------------------------------------------------------------
F2I3Y3_PELSM/76-349--------------------------------------------------------------------------------
F2J1Z4_POLGS/92-372--------------------------------------------------------------------------------
F2K1U1_MARM1/82-358--------------------------------------------------------------------------------
F2LWU2_HIPMA/71-319--------------------------------------------------------------------------------
F2PBU9_PHOMO/65-340--------------------------------------------------------------------------------
YIDC_BUCAP/52-338--------------------------------------------------------------------------------
YIDC_WOLSU/81-328--------------------------------------------------------------------------------
YIDC_BORPE/87-362--------------------------------------------------------------------------------
Q02A40_SOLUE/101-361--------------------------------------------------------------------------------
Q07TY2_RHOP5/100-389--------------------------------------------------------------------------------
YIDC_SHEFN/68-343--------------------------------------------------------------------------------
YIDC_ALHEH/74-349--------------------------------------------------------------------------------
YIDC_MARMM/76-356--------------------------------------------------------------------------------
YIDC_GRABC/70-355--------------------------------------------------------------------------------
Q0C549_HYPNA/73-365--------------------------------------------------------------------------------
Q0G0U0_9RHIZ/90-370--------------------------------------------------------------------------------
Q11LE5_MESSB/91-371--------------------------------------------------------------------------------
YIDC_CYTH3/79-358--------------------------------------------------------------------------------
YIDC_SHEDO/67-342--------------------------------------------------------------------------------
YIDC_PSEA6/72-343--------------------------------------------------------------------------------
Q1GN73_SPHAL/87-365--------------------------------------------------------------------------------
YIDC_METFK/76-348--------------------------------------------------------------------------------
Q1IV78_KORVE/81-362--------------------------------------------------------------------------------
YIDC_LAWIP/69-333--------------------------------------------------------------------------------
Q1MZ43_9GAMM/64-339--------------------------------------------------------------------------------
Q1NWR8_9DELT/82-356--------------------------------------------------------------------------------
Q1V1M7_PELUQ/70-343--------------------------------------------------------------------------------
Q1YH97_MOBAS/97-376--------------------------------------------------------------------------------
Q1YZM1_PHOPR/66-338--------------------------------------------------------------------------------
Q21QM4_RHOFD/90-368--------------------------------------------------------------------------------
Q26CA4_FLABB/76-349--------------------------------------------------------------------------------
YIDC_JANSC/83-388--------------------------------------------------------------------------------
Q2BQG4_9GAMM/76-352--------------------------------------------------------------------------------
Q2CI02_9RHOB/82-361--------------------------------------------------------------------------------
Q2GAU8_NOVAD/82-357--------------------------------------------------------------------------------
YIDC_BORA1/87-360--------------------------------------------------------------------------------
YIDC_SYNAS/82-353--------------------------------------------------------------------------------
Q2N7X2_ERYLH/80-353--------------------------------------------------------------------------------
Q2NQ71_SODGM/60-342--------------------------------------------------------------------------------
Q2RP12_RHORT/103-381--------------------------------------------------------------------------------
YIDC_HAHCH/87-367--------------------------------------------------------------------------------
Q2VZ15_MAGSA/87-366--------------------------------------------------------------------------------
YIDC_NITMU/90-364--------------------------------------------------------------------------------
Q30T77_SULDN/78-325--------------------------------------------------------------------------------
YIDC_DESDG/73-337--------------------------------------------------------------------------------
YIDC_GEOMG/71-339--------------------------------------------------------------------------------
YIDC_CHLCH/73-346--------------------------------------------------------------------------------
YIDC_PELLD/77-350--------------------------------------------------------------------------------
YIDC_THIDA/69-344--------------------------------------------------------------------------------
YIDC_DECAR/71-344--------------------------------------------------------------------------------
Q47U35_COLP3/70-342--------------------------------------------------------------------------------
Q494B9_BLOPB/151-436--------------------------------------------------------------------------------
Q5FPY0_GLUOX/67-351--------------------------------------------------------------------------------
YIDC_SILPO/77-370--------------------------------------------------------------------------------
YIDC_AROAE/74-349--------------------------------------------------------------------------------
Q5QZJ4_IDILO/54-327--------------------------------------------------------------------------------
YIDC_METCA/72-347--------------------------------------------------------------------------------
YIDC_MANSM/66-338--------------------------------------------------------------------------------
Q6APY9_DESPS/74-343--------------------------------------------------------------------------------
Q6MGL3_BDEBA/85-341--------------------------------------------------------------------------------
Q6SHP6_9BACT/69-344--------------------------------------------------------------------------------
YIDC_CHRVO/61-344--------------------------------------------------------------------------------
YIDC_BLOFL/67-356--------------------------------------------------------------------------------
YIDC_HAEDU/63-334--------------------------------------------------------------------------------
YIDC_BRAJA/93-381--------------------------------------------------------------------------------

PF02929

BGAL_ECOLI/751-1022--------------------------------------------------------------------------------
BGAL_PSEHA/760-1034--------------------------------------------------------------------------------
BGAL_ACTPL/734-998--------------------------------------------------------------------------------
Q9WXJ2_9GAMM/756-1029--------------------------------------------------------------------------------
BGAL_THEMA/715-981--------------------------------------------------------------------------------
BGAM_LACSK/18-317--------------------------------------------------------------------------------
BGAM_LEULA/18-318--------------------------------------------------------------------------------
BGAL_STRTR/752-1023--------------------------------------------------------------------------------
BGAM_LACAC/17-316--------------------------------------------------------------------------------
O85250_THENE/715-982--------------------------------------------------------------------------------
BGA2_ECOLI/727-998--------------------------------------------------------------------------------
Q9ZBD1_9PSEU/972-1248--------------------------------------------------------------------------------
BGAL1_KLEPN/759-1032--------------------------------------------------------------------------------
BGAL_BACMD/763-1032--------------------------------------------------------------------------------
BGAL_LACLA/719-996--------------------------------------------------------------------------------
BGAL1_ENTCL/752-1025--------------------------------------------------------------------------------
Q9ZBF6_STRCO/1015-1288--------------------------------------------------------------------------------
BGAL_KLULA/750-1023--------------------------------------------------------------------------------
BGAL_ARTSB/730-1013--------------------------------------------------------------------------------
BGAL_STAXY/723-992--------------------------------------------------------------------------------
Q9X6Y5_BIFLN/747-1021--------------------------------------------------------------------------------

PF13802

C6Z6F6_9BACE/138-207--------------------------------------------------------------------------------
B3X7V0_ECOLX/148-215--------------------------------------------------------------------------------
A6BU30_YERPE/147-214--------------------------------------------------------------------------------
A4NG96_HAEIF/146-213--------------------------------------------------------------------------------
A6VZ15_MARMS/151-218--------------------------------------------------------------------------------
A6CYB1_9VIBR/146-217--------------------------------------------------------------------------------
C6CFE6_DICZE/146-213--------------------------------------------------------------------------------
A6VKN2_ACTSZ/146-213--------------------------------------------------------------------------------
A0P411_9RHOB/147-215--------------------------------------------------------------------------------
B4EHS8_BURCJ/151-220--------------------------------------------------------------------------------
E3IFH7_GEOS0/152-221--------------------------------------------------------------------------------
Q65IV9_BACLD/151-220--------------------------------------------------------------------------------
Q5WLB5_BACSK/151-220--------------------------------------------------------------------------------
B2U9A1_RALPJ/149-218--------------------------------------------------------------------------------
Q2BFL4_9BACI/171-240--------------------------------------------------------------------------------
Q9KEZ5_BACHD/152-220--------------------------------------------------------------------------------
B6R9L1_9RHOB/137-205--------------------------------------------------------------------------------
B1Y1L3_LEPCP/168-237--------------------------------------------------------------------------------
Q1GMW9_SILST/145-213--------------------------------------------------------------------------------
D3P7Q6_AZOS1/182-251--------------------------------------------------------------------------------
C6YVN7_9GAMM/147-216--------------------------------------------------------------------------------
C8N9E3_9GAMM/146-214--------------------------------------------------------------------------------
D7AQU8_THEM3/149-218--------------------------------------------------------------------------------
A6LTE1_CLOB8/150-217--------------------------------------------------------------------------------
B7R6V8_9THEO/159-228--------------------------------------------------------------------------------
D5VMK3_CAUST/152-220--------------------------------------------------------------------------------
D4JL19_9FIRM/158-225--------------------------------------------------------------------------------
Q74HN8_LACJO/146-213--------------------------------------------------------------------------------
E6U2M1_ETHHY/145-212--------------------------------------------------------------------------------
A6M2D1_CLOB8/142-211--------------------------------------------------------------------------------
B8CZD8_HALOH/144-211--------------------------------------------------------------------------------
A5VKA3_LACRD/145-212--------------------------------------------------------------------------------
C1I6Q0_9CLOT/141-208--------------------------------------------------------------------------------
AGL2_BACTQ/146-213--------------------------------------------------------------------------------
Q8A369_BACTN/151-214--------------------------------------------------------------------------------
C6Y460_PEDHD/169-235--------------------------------------------------------------------------------
E3I544_RHOVT/151-221--------------------------------------------------------------------------------
C6LHD3_9FIRM/141-210--------------------------------------------------------------------------------
C8P8K9_9LACO/146-213--------------------------------------------------------------------------------
C7XXM5_9LACO/143-212--------------------------------------------------------------------------------
C8PCW9_9LACO/137-204--------------------------------------------------------------------------------
A0M5P9_GRAFK/143-209--------------------------------------------------------------------------------
D2KFL4_9FIRM/144-211--------------------------------------------------------------------------------
A3XMQ1_LEEBM/143-209--------------------------------------------------------------------------------
A4AR25_MARSH/143-209--------------------------------------------------------------------------------
C2FW68_9SPHI/168-234--------------------------------------------------------------------------------
Q2B942_9BACI/145-212--------------------------------------------------------------------------------
A5FGA0_FLAJ1/143-209--------------------------------------------------------------------------------
A9E425_9FLAO/144-210--------------------------------------------------------------------------------
Q26ET6_FLABB/143-209--------------------------------------------------------------------------------
A6EJE2_9SPHI/149-215--------------------------------------------------------------------------------
B8E1H7_DICTD/128-194--------------------------------------------------------------------------------
C7XVH3_9LACO/146-213--------------------------------------------------------------------------------
D2EHP2_PEDAC/142-211--------------------------------------------------------------------------------
Q6A5C7_PROAC/189-256--------------------------------------------------------------------------------
A6M2D3_CLOB8/141-210--------------------------------------------------------------------------------
A4YW59_BRASO/151-218--------------------------------------------------------------------------------
A7B0D7_RUMGN/159-228--------------------------------------------------------------------------------
Q1ITZ5_KORVE/157-223--------------------------------------------------------------------------------
A6NAA1_THEET/115-182--------------------------------------------------------------------------------
E0U9C6_CYAP2/141-207--------------------------------------------------------------------------------
A4C366_9FLAO/144-210--------------------------------------------------------------------------------
A0NI45_OENOE/157-224--------------------------------------------------------------------------------
C6VMU9_LACPJ/143-210--------------------------------------------------------------------------------
Q8YN00_NOSS1/141-207--------------------------------------------------------------------------------
C7PPD2_CHIPD/143-209--------------------------------------------------------------------------------
C7G8B2_9FIRM/148-215--------------------------------------------------------------------------------
A2TTB6_9FLAO/143-209--------------------------------------------------------------------------------
B2J8N8_NOSP7/141-207--------------------------------------------------------------------------------
Q096Z9_STIAD/169-235--------------------------------------------------------------------------------
B5YCW0_DICT6/115-181--------------------------------------------------------------------------------
B7GLU5_ANOFW/151-218--------------------------------------------------------------------------------
Q7NP60_GLOVI/141-207--------------------------------------------------------------------------------
Q2JLQ6_SYNJB/174-240--------------------------------------------------------------------------------
D4IW42_BUTFI/145-212--------------------------------------------------------------------------------
D0MJB1_RHOM4/128-199--------------------------------------------------------------------------------
Q11WX6_CYTH3/141-207--------------------------------------------------------------------------------
Q2B3F7_9BACI/171-238--------------------------------------------------------------------------------
A4FJU3_SACEN/111-180--------------------------------------------------------------------------------
A9B074_HERA2/125-192--------------------------------------------------------------------------------
C7GHF0_9FIRM/166-226--------------------------------------------------------------------------------
B5YAW0_DICT6/158-218--------------------------------------------------------------------------------
Q16SF9_AEDAE/142-215--------------------------------------------------------------------------------
C4G5Y4_ABIDE/167-228--------------------------------------------------------------------------------
B2UN73_AKKM8/140-206--------------------------------------------------------------------------------
B3WW63_SHIDY/159-219--------------------------------------------------------------------------------
B1S937_9BIFI/158-218--------------------------------------------------------------------------------
C1F1A5_ACIC5/161-227--------------------------------------------------------------------------------
Q92F84_LISIN/142-209--------------------------------------------------------------------------------
A5DNM1_PICGU/182-242--------------------------------------------------------------------------------
C4GAQ3_9FIRM/169-236--------------------------------------------------------------------------------
B7DQ25_9BACL/151-218--------------------------------------------------------------------------------
C4GA21_9FIRM/179-248--------------------------------------------------------------------------------
A4XJ71_CALS8/158-218--------------------------------------------------------------------------------
A9X936_9BACL/155-215--------------------------------------------------------------------------------
A8RUC2_9CLOT/208-269--------------------------------------------------------------------------------
D1C8H0_SPHTD/151-218--------------------------------------------------------------------------------
B9KC10_THENN/173-233--------------------------------------------------------------------------------
D2S0G4_HALTV/126-193--------------------------------------------------------------------------------
E6TRU4_BACCJ/158-218--------------------------------------------------------------------------------
Q8YLG7_NOSS1/171-245--------------------------------------------------------------------------------
C6WRR4_ACTMD/156-216--------------------------------------------------------------------------------
Q1AU85_RUBXD/146-213--------------------------------------------------------------------------------
P96793_LACPE/157-217--------------------------------------------------------------------------------
Q2H3D9_CHAGB/177-237--------------------------------------------------------------------------------
C8P9M9_9LACO/157-217--------------------------------------------------------------------------------
D9SW39_CLOC7/180-240--------------------------------------------------------------------------------
C4RJD3_9ACTO/158-218--------------------------------------------------------------------------------
B9XM93_9BACT/133-203--------------------------------------------------------------------------------
D2KFL5_9FIRM/166-226--------------------------------------------------------------------------------
C7PZM9_CATAD/157-217--------------------------------------------------------------------------------
C0FZU5_9FIRM/179-240--------------------------------------------------------------------------------
A7V9A7_BACUN/225-286--------------------------------------------------------------------------------
E8WBI2_STRFA/161-221--------------------------------------------------------------------------------
B7KDN2_CYAP7/163-238--------------------------------------------------------------------------------
C6JFG5_9FIRM/171-231--------------------------------------------------------------------------------
Q03T52_LACBA/157-217--------------------------------------------------------------------------------
D6ZH08_MOBCV/158-218--------------------------------------------------------------------------------
B1RLL6_CLOPF/139-205--------------------------------------------------------------------------------
Q03WT1_LEUMM/191-261--------------------------------------------------------------------------------
A8X5Y6_CAEBR/204-275--------------------------------------------------------------------------------
Q47PH1_THEFY/175-236--------------------------------------------------------------------------------
A9GNN9_SORC5/138-204--------------------------------------------------------------------------------
B0ML18_9FIRM/181-241--------------------------------------------------------------------------------
D2BD45_STRRD/176-237--------------------------------------------------------------------------------
A5FLV6_FLAJ1/228-289--------------------------------------------------------------------------------
D2ELQ0_PEDAC/65-125--------------------------------------------------------------------------------
C2GW28_BIFLN/196-256--------------------------------------------------------------------------------
Q091G4_STIAD/133-199--------------------------------------------------------------------------------
A2EBD8_TRIVA/156-223--------------------------------------------------------------------------------
C4XW51_CLAL4/205-265--------------------------------------------------------------------------------
C6VSJ1_DYAFD/228-289--------------------------------------------------------------------------------
Q7NKE3_GLOVI/167-242--------------------------------------------------------------------------------
Q928J2_LISIN/275-338--------------------------------------------------------------------------------
D4DDN6_TRIVH/259-335--------------------------------------------------------------------------------
Q75EA4_ASHGO/246-317--------------------------------------------------------------------------------
Q4J9M3_SULAC/59-124--------------------------------------------------------------------------------
A5Z7X2_9FIRM/181-249--------------------------------------------------------------------------------
A7RJ81_NEMVE/252-323--------------------------------------------------------------------------------
A1ZKD2_9BACT/150-213--------------------------------------------------------------------------------
D3USW3_LISSS/171-233--------------------------------------------------------------------------------
Q5Y9F6_HYPJE/256-332--------------------------------------------------------------------------------
B3NYF5_DROER/233-304--------------------------------------------------------------------------------
A2FHI6_TRIVA/187-256--------------------------------------------------------------------------------
Q6BWW5_DEBHA/248-320--------------------------------------------------------------------------------
A7TJL8_VANPO/259-330--------------------------------------------------------------------------------
C4R1R0_PICPG/226-297--------------------------------------------------------------------------------
A9V6Y9_MONBE/163-242--------------------------------------------------------------------------------
GANAB_DICDI/262-337--------------------------------------------------------------------------------
D3RQI5_ALLVD/150-218--------------------------------------------------------------------------------
Q9U3F8_CAEEL/211-283--------------------------------------------------------------------------------
Q487N3_COLP3/169-232--------------------------------------------------------------------------------
A6RYW1_BOTFB/264-340--------------------------------------------------------------------------------
Q6CFI8_YARLI/231-308--------------------------------------------------------------------------------
C5MGP0_CANTT/228-299--------------------------------------------------------------------------------
B6K3T9_SCHJY/251-327--------------------------------------------------------------------------------
Q9FN05_ARATH/223-300--------------------------------------------------------------------------------
D3HXG1_9BACT/143-212--------------------------------------------------------------------------------
A8QEK6_BRUMA/217-288--------------------------------------------------------------------------------
D0MFY9_RHOM4/221-282--------------------------------------------------------------------------------
C7ZHM8_NECH7/140-208--------------------------------------------------------------------------------
A3LZG4_PICST/248-320--------------------------------------------------------------------------------
Q6CKL7_KLULA/243-314--------------------------------------------------------------------------------
A5DFX8_PICGU/236-308--------------------------------------------------------------------------------
Q5A4X3_CANAL/227-298--------------------------------------------------------------------------------
B0WQR7_CULQU/142-215--------------------------------------------------------------------------------
A5E255_LODEL/247-318--------------------------------------------------------------------------------
Q1AY53_RUBXD/205-266--------------------------------------------------------------------------------
Q48999_MYCCA/174-236--------------------------------------------------------------------------------
GLU2A_SCHPO/243-319--------------------------------------------------------------------------------
C5E2N2_LACTC/252-323--------------------------------------------------------------------------------
D1PU92_9BACT/147-201--------------------------------------------------------------------------------
C5E407_ZYGRC/242-313--------------------------------------------------------------------------------
GLU2A_YEAST/268-337--------------------------------------------------------------------------------
D2PSG3_KRIFD/287-350--------------------------------------------------------------------------------
B3PEE6_CELJU/151-214--------------------------------------------------------------------------------
A2EWL0_TRIVA/183-259--------------------------------------------------------------------------------
D4A7G5_RAT/221-292--------------------------------------------------------------------------------
A2DTY0_TRIVA/174-243--------------------------------------------------------------------------------
Q6F1E9_MESFL/174-236--------------------------------------------------------------------------------
D0NID9_PHYIT/299-382--------------------------------------------------------------------------------
B9HF49_POPTR/234-312--------------------------------------------------------------------------------
A9SRV0_PHYPA/216-292--------------------------------------------------------------------------------
Q15TD3_PSEA6/166-229--------------------------------------------------------------------------------
Q18IX5_HALWD/161-222--------------------------------------------------------------------------------
D3KJT1_LISMN/468-529--------------------------------------------------------------------------------
A9JRL0_XENTR/224-295--------------------------------------------------------------------------------
Q6BD67_ARTGO/298-361--------------------------------------------------------------------------------
A8MA12_CALMQ/134-195--------------------------------------------------------------------------------
C9Z9B8_STRSW/173-240--------------------------------------------------------------------------------
A2FHS3_TRIVA/198-269--------------------------------------------------------------------------------
A5KR97_9FIRM/177-236--------------------------------------------------------------------------------
A2FSM7_TRIVA/200-271--------------------------------------------------------------------------------
D2VG87_NAEGR/204-281--------------------------------------------------------------------------------
A2DNT4_TRIVA/201-270--------------------------------------------------------------------------------
A2FNG9_TRIVA/199-270--------------------------------------------------------------------------------
Q10VX8_TRIEI/195-274--------------------------------------------------------------------------------
F2GBK6_ALTMD/160-223--------------------------------------------------------------------------------
B7B7D0_9PORP/181-237--------------------------------------------------------------------------------
D1W1N7_9BACT/179-238--------------------------------------------------------------------------------
A1ZWA9_9BACT/116-179--------------------------------------------------------------------------------
B8P1A4_POSPM/248-324--------------------------------------------------------------------------------
B5U8Z1_HORVU/222-299--------------------------------------------------------------------------------
Q9AQR9_BACTQ/128-190--------------------------------------------------------------------------------
A8UJG1_9FLAO/155-218--------------------------------------------------------------------------------
A1S1W2_SHEAM/165-224--------------------------------------------------------------------------------
A5Z7X1_9FIRM/366-435--------------------------------------------------------------------------------
A4C4Y4_9GAMM/153-212--------------------------------------------------------------------------------
A5ZES3_9BACE/177-236--------------------------------------------------------------------------------
D5VEX6_CAUST/152-206--------------------------------------------------------------------------------
A3TII1_9MICO/151-210--------------------------------------------------------------------------------
Q04CH5_LACDB/137-196--------------------------------------------------------------------------------
A9WV97_RENSM/183-242--------------------------------------------------------------------------------
D2YKF2_VIBMI/210-268--------------------------------------------------------------------------------
A2DUN2_TRIVA/184-245--------------------------------------------------------------------------------
C4VK70_9LACO/135-194--------------------------------------------------------------------------------
C2EQ16_9LACO/137-196--------------------------------------------------------------------------------
A2TWU9_9FLAO/156-219--------------------------------------------------------------------------------

PF04349

OPGD_XYLFA/46-531--------------------------------------------------------------------------------
OPGG_PSEAE/36-523--------------------------------------------------------------------------------
OPGG_ECOLI/23-509--------------------------------------------------------------------------------
OPGG_VIBCH/72-545--------------------------------------------------------------------------------

PF02278

HYSA_STRPN/656-924--------------------------------------------------------------------------------
CSLA_PEDHD/336-592--------------------------------------------------------------------------------
O86516_STRCO/402-656--------------------------------------------------------------------------------
HYSA_STAA8/435-699--------------------------------------------------------------------------------
HYSA_STRA3/617-905--------------------------------------------------------------------------------

PF03636

TREPP_LACLA/7-254--------------------------------------------------------------------------------
Q97FP3_CLOAB/11-268--------------------------------------------------------------------------------
YVDK_BACSU/13-265--------------------------------------------------------------------------------
Q98PT5_MYCPU/12-257--------------------------------------------------------------------------------
TREA_EMENI/63-338--------------------------------------------------------------------------------
ATH1_YEAST/132-415--------------------------------------------------------------------------------
Y2006_MYCTU/536-795--------------------------------------------------------------------------------
Q9CF04_LACLA/14-266--------------------------------------------------------------------------------
Y3401_MYCTU/13-273--------------------------------------------------------------------------------
Q9L2I8_STRCO/13-273--------------------------------------------------------------------------------
O87772_LACSN/11-262--------------------------------------------------------------------------------
Q9RJM8_STRCO/7-260--------------------------------------------------------------------------------
YCJT_ECOLI/6-241--------------------------------------------------------------------------------
Q9K109_NEIMB/12-263--------------------------------------------------------------------------------

PF14498

B2WJV6_PYRTR/24-282--------------------------------------------------------------------------------
A6S6Y6_BOTFB/24-271--------------------------------------------------------------------------------
AFCA_ASPOR/18-260--------------------------------------------------------------------------------
C7ZMG8_NECH7/26-278--------------------------------------------------------------------------------
AFCA_ASPNC/23-266--------------------------------------------------------------------------------
D8QJY6_SCHCM/33-288--------------------------------------------------------------------------------
Q01VL7_SOLUE/25-216--------------------------------------------------------------------------------
F0BR50_9XANT/10-221--------------------------------------------------------------------------------
C7QDB1_CATAD/65-277--------------------------------------------------------------------------------
D6XC25_9ACTO/46-251--------------------------------------------------------------------------------
F2LID8_BURGS/67-272--------------------------------------------------------------------------------
A5FLW5_FLAJ1/30-276--------------------------------------------------------------------------------
B5D3Z6_9BACE/34-284--------------------------------------------------------------------------------
D3IM15_9BACT/27-264--------------------------------------------------------------------------------
D1W5Z9_9BACT/26-258--------------------------------------------------------------------------------
D7GFE8_PROFC/6-264--------------------------------------------------------------------------------
D7CDJ0_STRBB/6-250--------------------------------------------------------------------------------
Q5WIX9_BACSK/3-249--------------------------------------------------------------------------------
A6WFR5_KINRD/6-266--------------------------------------------------------------------------------
B8HAG7_ARTCA/2-255--------------------------------------------------------------------------------
F0M2S8_ARTPP/7-280--------------------------------------------------------------------------------
D4BRP0_BIFBR/3-260--------------------------------------------------------------------------------
C7QZB0_JONDD/21-283--------------------------------------------------------------------------------
Q02BM3_SOLUE/32-244--------------------------------------------------------------------------------
C6VSI5_DYAFD/35-265--------------------------------------------------------------------------------
B6FP44_9CLOT/51-330--------------------------------------------------------------------------------
D7FKT5_ECTSI/258-515--------------------------------------------------------------------------------
E0RPS6_SPITD/10-238--------------------------------------------------------------------------------
A6DKE0_9BACT/176-440--------------------------------------------------------------------------------
C0E8Z7_9CLOT/53-300--------------------------------------------------------------------------------
B3C6V9_9BACE/31-273--------------------------------------------------------------------------------
E8S9D0_MICSL/6-236--------------------------------------------------------------------------------
D0MK80_RHOM4/42-285--------------------------------------------------------------------------------
E4VX39_BACFG/35-292--------------------------------------------------------------------------------
A5ZUG0_9FIRM/11-261--------------------------------------------------------------------------------
F2NU83_TRES6/4-265--------------------------------------------------------------------------------
E2NCL7_9BACE/27-265--------------------------------------------------------------------------------
B8I0M2_CLOCE/55-303--------------------------------------------------------------------------------
C9RS46_FIBSS/37-265--------------------------------------------------------------------------------
E2NAE9_9BACE/9-245--------------------------------------------------------------------------------
C7PTZ7_CHIPD/24-262--------------------------------------------------------------------------------
E4RWC6_LEAB4/23-260--------------------------------------------------------------------------------
D1P8P0_9BACT/350-623--------------------------------------------------------------------------------
C6CWA7_PAESJ/6-246--------------------------------------------------------------------------------
C6IY46_9BACL/13-267--------------------------------------------------------------------------------
B8MP90_TALSN/6-252--------------------------------------------------------------------------------
Q8A300_BACTN/31-269--------------------------------------------------------------------------------
E4RVZ2_LEAB4/23-266--------------------------------------------------------------------------------
D7VKY5_9SPHI/30-275--------------------------------------------------------------------------------
B5JRH0_9BACT/30-280--------------------------------------------------------------------------------
B5CXD0_9BACE/30-289--------------------------------------------------------------------------------
A6DGK8_9BACT/29-270--------------------------------------------------------------------------------
FUCO2_ARATH/54-310--------------------------------------------------------------------------------
E8RVA7_ASTEC/38-271--------------------------------------------------------------------------------
E4SEI2_CALK2/8-246--------------------------------------------------------------------------------
F0Z0W4_9CLOT/4-266--------------------------------------------------------------------------------
E9SFF2_RUMAL/7-242--------------------------------------------------------------------------------
F2JRD2_CELLD/6-242--------------------------------------------------------------------------------
A6DLU8_9BACT/6-272--------------------------------------------------------------------------------
B6QLF5_PENMQ/5-248--------------------------------------------------------------------------------
Q0TY74_PHANO/26-269--------------------------------------------------------------------------------
Q0USM0_PHANO/26-249--------------------------------------------------------------------------------
B6GAH0_9ACTN/58-310--------------------------------------------------------------------------------
D4M387_9FIRM/48-320--------------------------------------------------------------------------------
C0EAF8_9CLOT/47-316--------------------------------------------------------------------------------
B1V512_CLOPF/50-289--------------------------------------------------------------------------------
E5CAW4_9BACE/28-255--------------------------------------------------------------------------------
C0EIR9_9CLOT/49-264--------------------------------------------------------------------------------
C9LB61_RUMHA/43-318--------------------------------------------------------------------------------
E3ELM5_BIFBS/595-862--------------------------------------------------------------------------------
D4XX42_9MOLU/39-315--------------------------------------------------------------------------------
B6FR06_9CLOT/50-321--------------------------------------------------------------------------------
E7NUZ4_TREPH/40-298--------------------------------------------------------------------------------
D4JSM8_9FIRM/5-247--------------------------------------------------------------------------------
E7RS88_9BACT/30-233--------------------------------------------------------------------------------
D1W0X5_9BACT/196-406--------------------------------------------------------------------------------
A7LY00_BACOV/52-260--------------------------------------------------------------------------------
B3PBE3_CELJU/14-256--------------------------------------------------------------------------------
B5GF62_9ACTO/53-292--------------------------------------------------------------------------------
C6W772_DYAFD/35-280--------------------------------------------------------------------------------
D5ENS4_CORAD/28-273--------------------------------------------------------------------------------
A6DSI9_9BACT/28-279--------------------------------------------------------------------------------
C7MHU9_BRAFD/31-251--------------------------------------------------------------------------------
D3EK66_GEOS4/13-265--------------------------------------------------------------------------------
D9RTI1_PREMB/45-251--------------------------------------------------------------------------------
E6MT30_9BACT/33-341--------------------------------------------------------------------------------

PF06045

Q2RAX6_ORYSJ/1-220---------------------------------------------------------PLHAAVPAKGPRP.GGSVTLHLD
A0SPK1_9POAL/1-190---------------------------------------------------------.......................
Q2RAX6_ORYSJ/1421-1585---------------------------------------------------------.......................
Q0J3T7_ORYSJ/14-224---------------------------------------------------------...GHPPATSPAGATAGVSVKVS
O04510_ARATH/1-189---------------------------------------------------------.......................
O04512_ARATH/1-264---------------------------------------------------------.............SSHGVHLHVH
O04511_ARATH/1-213---------------------------------------------------------.............SYVKLQLHDK
Q9STV1_ARATH/1-204---------------------------------------------------------............SNQDSVQLDVQ
Q9SZK3_ARATH/1-218---------------------------------------------------------SFSKPTRNLDGISARAPTVQQIR
Q6D915_ERWCT/1-203---------------------------------------------------------AVSLSVSGLN.............
RHIE_DICD3/1-202---------------------------------------------------------AVKLTLDGMN.............
Q6NKW8_ARATH/1-243---------------------------------------------------------SQRSQNKLNITKPGQNIPALTVQ
Q84W85_ARATH/1-244---------------------------------------------------------SQTSRNKFNIAKAGHKLASPPVT

PF07748

MA2A1_MOUSE/648-1144...........GKPVEVQVSAVW..................NDMRTISQAAYEVSF.LAHIPPLGLKVFKILESQSSSSH
MA2A2_HUMAN/648-1146...........GQPLAVQISAHW..................SSATEAVPDVYQVSV.PVRLPALGLGVLQLQLGLDGHRT
MA2B1_HUMAN/510-1001...........GRTVPSDVVIF....................PSSDSQAHPPELLF.SASLPALGFSTYSVAQVPRWKPQ
MAN1_YEAST/670-1080........DDY.....................................................................
Q97C94_THEVO/613-1007........VGD..........................................KKFVLVNVPPLGFSVINTNTENKFENE
Q20829_CAEEL/478-945...........KNVLESQIVETFQ................IDQLKDTDRLPYEIHV.FVRVPPLGYTTVFVEKGSKPERV
Q82MA7_STRAW/619-1014.........................................................YVEVPAGGSAPLDGAAPPRP...
Q8XIN5_CLOPE/620-1040IC.QRIDDWEK..........................................AIFFAKGIPANGYKSFKIIESTNKEVE
Q826B6_STRAW/620-1000.......ADGG.....................................................................
Q97UK5_SULSO/576-965.....................................................GKLVKVRVPSVGFSLLEPVEVRDKAVI
Q9KEQ8_BACHD/620-1036Q....QTANNE..........................................TLVLLEKSIPFAYQTISRATMVAEEVQ
Q8MS44_DROME/481-1003...........GRVVASEVVPVAWQ..............VLALEFRNNDTQHELVF...KASVDKIANYYIKKVASQETK
O97043_DROME/673-1242...........GVELNHIQINPVWNITDTYEQGLGTSVSGTVGRIRTSTRQFEVMF.VAELEPLSLSTYRVQVDEVNFKR
Q7S1L0_NEUCR/663-1085.........................................................DFALAKGVGPLLKLQQYEIMQVD
Q8IPB7_DROME/502-1074...........GVTLESQAVPIPQV..............LIDIKHRNSTAKYEIVFLATNIPALGYRTYYVEK.......
Q9X2G6_THEMA/610-1007......HDGRY..........................................VYFIDREIPPFTKVELKVRKATSEETP
Q8Y5P1_LISMO/621-1032LP.AQKLVNNT..........................................WLIQHPNLPVLGAATISVKETPNILGQ
Q7NPH5_GLOVI/590-1007KDVPVQAAGDW..........................................LHFWAAGVPGIGHKVFWLRPADAPAPA
Q972Y1_SULTO/561-945.....................................................GKFYKVKVPSIGFTAFKPEEVKEKVNV
Q7V4V0_PROMM/617-1007.....................................................TWVQLPVQQGVTAVPLQRCVSKALDVV
Q8G4Q0_BIFLO/651-1043.........NA.....................................................................
O58565_PYRHO/375-852..........S..........................................KLVYLSELPPIGFKGYEEVGERPEDFV
Q9LFR0_ARATH/644-1166...........WTCVPSQISPEV.................QHDDTKLFTGRHRLYW.KASIPALGLRTYFIANGNVECEK
Q8Y9W8_LISMO/383-872LEYTILEKTDLTEYVLNQHIDLNP...............SRPVYLPEKVFLATMLVNVNNLPALGYDTIYFNLEKETAEQ
Q9AJR6_BACGL/625-1043PL.RAEFDGSR..........................................WLVLAEDVPATGAATLRFDPSAGQQTS
Q55528_SYNY3/615-1038VN..SQITAEG..........................................SLIFLVDSPPLTCKYYWLKTKEPLSNS
O18497_SPOFR/601-1127...........KRKHVLYQIMPSIT.............IQDNGKSIVSDTTFDIMF.VATIPPLTSISYKLQEHTNTSHH
Q8SYY1_DROME/493-1012...........GGLVASELVPVPWE..............VLSLEFRNNDTQHELVF...KASVNKIATYFIKKIDKTTEV
Q8A5X3_BACTN/693-1137QG..HSLKVQP.IRYR................................REGCYYAIFAEDIPPMGYKTFEIVFKQPSTDT
Q8LPJ3_ARATH/482-1007...........GHEVESQLVPFTDEYVALR....KYHVEAYLGQSPTQVPKYWLVF.SVTVPPLGFTTYTISTAKKTDGY
MA2B2_PIG/460-989...........GRPVLAQVQD.......................SKETPSAYDLHV.LTTIPGLSYQHYIIKPIRKARED
Q8G4Q1_BIFLO/649-1036..........R.....................................................................
MA2C1_RAT/621-1032.....................................................TRLALVTVPSIGYAPAPTPTSLQPLLP
Q92A00_LISIN/399-880DELAKLPEQSFRMETSNGEEIPVVVEPLGIH..FNYDLPERKFRDSYFARKYKLTFTVEHLPAVGYQTIYAHPVAVSDDE
Q9FKW9_ARATH/497-1032...........GNTLDAQYIPMDNVTSNLR....SFYTKAYLGISSLQRPKYWLVF.KAKVPPLGWNTFFISKAS.AQGS
P94078_ARATH/487-1000...........GKEVVFQLLPLSEIALRIR....NEYVKAYLGRSPRDTAKHVLAF.TASVPPLGFSSYVISDTGRTARG
Q9VLI0_DROME/480-978...........GRVVASEIVPVPAE..............VLALEFRDSDTQHELVF...KASVDKIANYYIKKVDSKESS
MAN2_DROME/616-1102...........NNPVEAQVSPVWSWHH.........DTLTKTIHPQGSTTKYRIIF.KARVPPMGLATYVLTISDSKPEH
Q8YYK0_NOSS1/608-1041EQIISQLTEPST.........................................LLFLAKDIPSVGYRLFWLSPTSPPSPT
Q8XM34_CLOPE/630-1018KEEIEPYCEIST....................................................................
Q7U9I9_SYNPX/614-1003.....................................................TWVQLPEQRGICSVALSDGPVDSGEIA
MA2B2_MOUSE/487-1013...........GHPVSTQIQN.......................STKDPSAYDLLI.LTTIPGLNYRHYQVMHARGDQAG
Q8G4P9_BIFLO/645-1030................................................................................
Q8DM33_THEEB/592-1021GNYDLPAQLNAPQ......................................GCLTFSTPEVPGIGYTLLWLCPRSRPETL
MAN1_SCHPO/664-1074..........K................................................GILTAAHTSLKHPAAAYQKDD

PF01263

GAL10_KLULA/363-684----------------------------------------------------GA-TIV-----DIV------V-------
LACXC_LACLL/1-281----------------------------------------------------GG-QLT-----SIK------D-------
Q9LY79_ARATH/87-360----------------------------------------------------GG-QVV-----SWK------N-------
Q9KQJ7_VIBCH/25-292----------------------------------------------------GG-HVL-----SFQ------P-------
Q9RP27_HAEIF/22-269----------------------------------------------------GA-QLI-----SWK------P-------
Q9VRU1_DROME/25-359----------------------------------------------------GA-TIT-----SIK------T-------
Q9RDN0_STRCO/33-363----------------------------------------------------GG-VVE-----SLE------I-------
P73504_SYNY3/14-276----------------------------------------------------GG-LVT-----EWT------V-------
Q986V3_RHILO/14-303----------------------------------------------------GG-ALA-----SYR------W-------
Q9SVZ5_ARATH/40-321----------------------------------------------------GG-QVS-----SWK------N-------
YEAD_ECOLI/27-288----------------------------------------------------GA-HLL-----SWK------P-------
Q9CMU5_PASMU/26-273----------------------------------------------------GA-QLL-----SWQ------P-------
Q9SUQ4_ARATH/25-301----------------------------------------------------GG-QVL-----SWK------T-------
Q9VKF7_DROME/25-355----------------------------------------------------GA-TIQ-----SIN------F-------
Q9VP02_DROME/25-355----------------------------------------------------GA-IIQ-----SVC------L-------
GALM_BACSU/14-319----------------------------------------------------GS-NVI-----SLV------D-------
YIHR_ECOLI/19-304----------------------------------------------------GA-GLA-----ELT------F-------
Q9K995_BACHD/17-344----------------------------------------------------GC-IIT-----ELK------T-------
Q97L65_CLOAB/18-336----------------------------------------------------GG-NVV-----ELK------D-------
Q9HJQ6_THEAC/19-286----------------------------------------------------GS-HMD-----SLQ------I-------
Q986G3_RHILO/15-295----------------------------------------------------GA-AIL-----RYD------A-------
GALM_SHIFL/16-342----------------------------------------------------GA-TLL-----SAR------I-------
Q9CF52_LACLA/4-275----------------------------------------------------GA-ELT-----HVI------E-------
Q9A8D6_CAUCR/39-373----------------------------------------------------GA-TLQ-----SLI------A-------
GALM_HAEIN/16-338----------------------------------------------------GA-TWL-----SCK------V-------
Q97A31_THEVO/1-267----------------------------------------------------GS-HLD-----KLN------L-------
Q9M6D7_CHLRE/53-318----------------------------------------------------GA-CVT-----SWK------Q-------
GALM_STRTR/17-342----------------------------------------------------GA-TLQ-----EFL------V-------
Q9RDP4_STRCO/15-319----------------------------------------------------GG-IVQ-----SAE------V-------
Q9ZB17_9LACT/13-335----------------------------------------------------GA-RIV-----DWQ------K-------
GAL10_SCHPO/369-689----------------------------------------------------GA-LVQ-----AVR------Y-------
Q99RT5_STAAM/13-331----------------------------------------------------GA-RVV-----SWK------Y-------
Q9KRP2_VIBCH/20-347----------------------------------------------------GA-TWL-----SCT------L-------
Q9L7R7_SALTM/6-278----------------------------------------------------GA-GLA-----ELT------H-------
AAPC_CENCI/34-310----------------------------------------------------GG-QVT-----SWK------N-------
YH10_YEAST/11-338----------------------------------------------------GA-TLL-----DLK------V-------
Q97T84_STRPN/18-341----------------------------------------------------GA-TIL-----RYV------A-------
Q9CN43_PASMU/23-271----------------------------------------------------GA-QLL-----SWK------P-------
Q9A381_CAUCR/1-279----------------------------------------------------GG-AVA-----AFT------V-------
O94124_RHIST/13-358----------------------------------------------------GA-AIT-----HIL------T-------
Q9LVH6_ARATH/10-338----------------------------------------------------GT-TIT-----SLS------V-------
Q9M308_ARATH/24-299----------------------------------------------------GG-QVI-----SWR------N-------
P94168_ACTPL/2-319----------------------------------------------------GA-AWL-----SCV------V-------
Q9FJY6_ARATH/46-305----------------------------------------------------GG-CIT-----SWK------V-------
Q98MW4_RHILO/4-274----------------------------------------------------GA-ELV-----SLR------D-------
Q9HZ52_PSEAE/28-281----------------------------------------------------GA-QLL-----HFQ------P-------
Q9PB74_XYLFA/16-284----------------------------------------------------GG-QLL-----SFV------P-------
O48971_TOBAC/28-351----------------------------------------------------GT-SII-----SVL------L-------
Q97JD7_CLOAB/16-338----------------------------------------------------GA-TLT-----EIY------A-------
Q9HTE2_PSEAE/30-311----------------------------------------------------GA-QLL-----SYQ------P-------
Q9LVC5_ARATH/18-294----------------------------------------------------GS-HVT-----SWK------N-------
Q05765_SACPS/73-396----------------------------------------------------GA-SIV-----DLK------V-------
GALM_PIG/20-338----------------------------------------------------GC-TIT-----ALE------V-------
Q9CM12_PASMU/17-340----------------------------------------------------GA-TWL-----SCK------V-------
GAL10_PACTA/363-685----------------------------------------------------GA-TIV-----AAK------L-------
YN9A_YEAST/11-339----------------------------------------------------GA-TLV-----DLK------V-------
Q9V3D1_DROME/12-282----------------------------------------------------GA-TVV-----SWR------V-------
Q9WYB8_THEMA/23-351----------------------------------------------------GA-IVR-----ELW------V-------
YPHB_ECOLI/2-286----------------------------------------------------GG-VIE-----GFW------R-------
Q9CFG9_LACLA/19-330----------------------------------------------------GA-RVH-----QLL------T-------
Q9VY83_DROME/24-362----------------------------------------------------GA-TIQ-----SIQ------V-------
Q9STT3_ARATH/32-354----------------------------------------------------GA-VMT-----SLL------L-------
GALM_ACICA/38-376----------------------------------------------------GG-VIT-----QIL------T-------
Q97ES5_CLOAB/1-281----------------------------------------------------GA-ELT-----SLK------S-------
Q9LXG7_ARATH/161-485----------------------------------------------------GA-SII-----SLH------F-------
YMY9_YEAST/9-287----------------------------------------------------GA-TVY-----SWK------L-------

PF14486

C8TCN7_KLEPR/63-369----------------------------------------------------GM-NLL.....RIE------G-------
Q6CYX0_ERWCT/66-372----------------------------------------------------GM-NLL.....HAA------G-------
D8MS65_ERWBE/63-369----------------------------------------------------GM-DLL.....HVQ------G-------
D4E903_SEROD/84-389----------------------------------------------------GM-DIL.....HVN------G-------
C4UXP6_YERRO/63-368----------------------------------------------------GM-DLL.....HVV------G-------
A4VGA8_PSEU5/62-367----------------------------------------------------GM-NVL.....EAV------A-------
Q4ZR72_PSEU2/63-368----------------------------------------------------GM-NVL.....QAS------V-------
A4SJ08_AERS4/64-370----------------------------------------------------GM-GIK.....EVK------G-------
E7S0H9_9BURK/63-369----------------------------------------------------GM-NVL.....QAV------A-------
C1DDL0_AZOVD/63-368----------------------------------------------------GM-NVL.....RAV------A-------
E1JSY6_DESFR/65-370----------------------------------------------------GM-DIY.....EIK------S-------
A6VRI9_MARMS/45-355----------------------------------------------------GM-AVLDVVRKDAT------G-------
B2STA4_XANOP/63-368----------------------------------------------------GM-NVL.....RAQ------A-------
B5JRI2_9BACT/46-358----------------------------------------------------GM-GIW.....KGQ------C-------
A6DJS3_9BACT/68-374----------------------------------------------------GM-NVM.....SVR------S-------
E8TDX5_MESCW/37-354----------------------------------------------------AL-DIA.....DCD------F-------
E7U952_ECOLX/28-330----------------------------------------------------AL-DIA.....WAS------Y-------
A6CCQ6_9PLAN/48-358----------------------------------------------------GM-GVW.....KGD------F-------
A3U233_9RHOB/60-376----------------------------------------------------AM-DIA.....DCE------H-------
E7S0S6_9BURK/68-374----------------------------------------------------GM-NVA.....QAV------S-------
A3ZMH7_9PLAN/47-353----------------------------------------------------GM-GVW.....DAY------C-------
B2IFZ2_BEII9/79-384----------------------------------------------------GM-SAL.....RAQ------M-------
F2AXT9_RHOBT/49-355----------------------------------------------------GM-SIW.....RIE------C-------
C6XPV1_HIRBI/37-353----------------------------------------------------AM-DLG.....DCE------H-------
D2R5D2_PIRSD/48-359----------------------------------------------------GM-GIR.....RAW------S-------
Q2CC41_9RHOB/37-353----------------------------------------------------AM-DIA.....EVE------H-------
Q1AYM2_RUBXD/37-346----------------------------------------------------AF-DIG.....RCE------F-------
E8R531_ISOPI/45-351----------------------------------------------------GM-GLW.....RAG------W-------
D1CHA6_THET1/37-338----------------------------------------------------AM-DIW.....LAE------H-------
D5SWV3_PLAL2/49-356----------------------------------------------------GM-GLW.....KGT------V-------
D6ZVF2_BIFLJ/35-343----------------------------------------------------AL-DVC.....QFE------Y-------
A4FGH2_SACEN/53-349----------------------------------------------------GL-DLG.....AAS------F-------
F0SP29_PLABD/45-353----------------------------------------------------GM-GLW.....KIE------H-------
C6W7A5_DYAFD/39-348----------------------------------------------------AM-DIA.....EAF------Y-------
C5EMT3_9FIRM/31-332----------------------------------------------------CL-DIS.....DLS------Y-------
C6JDQ2_9FIRM/29-333----------------------------------------------------CL-DIA.....EVN------W-------
C5EVY1_9FIRM/58-359----------------------------------------------------CM-DII.....QLE------Y-------
D2QJ04_SPILD/29-338----------------------------------------------------AM-DIA.....DAF------F-------
A3HYW8_9BACT/35-344----------------------------------------------------GF-DIL.....DCF------Y-------
D9RZ46_THEOJ/37-341----------------------------------------------------NM-DIA.....FAD------F-------
B6G216_9FIRM/38-339----------------------------------------------------GM-DLG.....RCS------Y-------
E5VLF0_9FIRM/26-323----------------------------------------------------CA-DIS.....RLS------L-------
E4HSQ4_PROAA/36-345----------------------------------------------------GQ-ILW.....DAV------F-------
A4AFA2_9ACTN/35-332----------------------------------------------------AL-DIG.....QVT------L-------
A5ZM38_9FIRM/24-319----------------------------------------------------NG-DIT.....RLR------Y-------
D1N8M9_9BACT/32-325----------------------------------------------------GM-DLV.....DCS------F-------
F2PD67_PHOMO/32-333----------------------------------------------------GQ-MIW.....DAE------F-------
A7VPY4_9CLOT/30-334----------------------------------------------------GM-DIG.....RLT------Y-------
A7VTY4_9CLOT/24-319----------------------------------------------------AA-DIT.....RLS------Y-------
C0W0W1_9ACTO/33-337----------------------------------------------------GA-TIW.....AAE------F-------
D7GQT9_9FIRM/30-326----------------------------------------------------CL-DPA.....WIR------Y-------
B3W843_LACCB/26-319----------------------------------------------------GM-DIP.....ELK------V-------
D4M7N6_9BACT/32-333----------------------------------------------------GL-DVG.....RLR------W-------
E7NWQ8_TREPH/35-339----------------------------------------------------NM-DIY.....QME------Y-------
B5QP71_LACRH/26-319----------------------------------------------------GM-DIP.....ELK------V-------
C2K0S4_LACRH/29-322----------------------------------------------------GM-DIP.....ELK------V-------
E7GTM1_CLOSY/30-326----------------------------------------------------CL-DPA.....WIR------Y-------
E1JKF2_9LACO/27-315----------------------------------------------------GM-DIS.....DLK------V-------
D2S5J5_GEOOG/37-338----------------------------------------------------AL-DIG.....WAD------A-------
B2Z3U5_AGRRK/36-329----------------------------------------------------GF-DVS.....GLS------F-------
C5C3Q0_BEUC1/37-320----------------------------------------------------GM-DLG.....RAW------F-------
C8XH26_NAKMY/26-324----------------------------------------------------GF-DIG.....AAC------Y-------
A6UBC7_SINMW/28-308----------------------------------------------------AL-DIA.....AFL------V-------

PF14849

YIDC_BURCH/79-353----------------------------------------------------GG-TLA-----KLT------L...----
YIDC_AERHH/67-347----------------------------------------------------GG-DIV-----SAD------L...----
YIDC_SHESA/67-342----------------------------------------------------GG-DIV-----FAA------L...----
YIDC_MAGSM/86-360----------------------------------------------------GG-RLV-----GMD------F...----
YIDC_SYNFM/76-350----------------------------------------------------GA-RLS-----SFE------L...----
A0M3I9_GRAFK/92-360----------------------------------------------------GG-YIE-----EAR------L...----
A0NSE7_9RHOB/91-371----------------------------------------------------GG-RLD-----DIR------L...----
YIDC_FRATN/81-354----------------------------------------------------DG-AII-----SAS------L...----
A0RNG0_CAMFF/78-324----------------------------------------------------LG-RIS-----SFV------L..N----
A0Y4R8_9GAMM/71-343----------------------------------------------------GG-DIV-----ESD------L...----
A0Y965_9GAMM/94-374----------------------------------------------------GG-DII-----FAA------F...----
YIDC_ECOK1/60-343----------------------------------------------------GG-DVE-----QAL------L...----
YIDC_PELPD/70-338----------------------------------------------------GG-ALK-----SLT------L...----
YIDC_CHLPD/72-345----------------------------------------------------GA-TIK-----SVV------L...----
A1ESE5_VIBCL/35-310----------------------------------------------------GG-DVV-----SAK------L...----
A1JT86_YERE8/60-342----------------------------------------------------GG-DIE-----QAN------L...----
A1KCP9_AZOSB/62-337----------------------------------------------------GG-SIV-----RLE------L...----
YIDC_NEIMF/55-343----------------------------------------------------SG-DLR-----RLT------L...----
YIDC_SHEAM/67-342----------------------------------------------------GG-DIV-----HAA------L...----
YIDC_PSYIN/82-356----------------------------------------------------GG-DII-----KAD------L...----
YIDC_MARAV/89-367----------------------------------------------------GG-NVV-----DSS------L...----
A1UTM0_BARBK/88-378----------------------------------------------------GA-QFD-----DLF------L...----
YIDC_DESVV/71-335----------------------------------------------------GG-VLR-----QFM------L...----
A1VUS5_POLNA/88-366----------------------------------------------------GG-TLV-----HTA------F...----
A1VZU9_CAMJJ/78-325----------------------------------------------------FG-RIS-----AFY------L..K----
A1WDB6_ACISJ/89-367----------------------------------------------------GG-SLV-----HGE------L...----
A1WSU1_VEREI/90-364----------------------------------------------------GG-SLT-----HAE------L...----
YIDC_HALHL/76-353----------------------------------------------------GG-DIR-----QLD------L...----
A2SMI9_METPP/84-359----------------------------------------------------GG-DVV-----HAE------L...----
A2TVU8_9FLAO/95-369----------------------------------------------------GG-YIT-----EVK------M...----
A3EQG7_9BACT/54-314----------------------------------------------------TG-QIY-----KWT------L...----
A3HZF9_9BACT/83-351----------------------------------------------------GA-SVN-----EVE------L...----
A3J0Y5_9FLAO/92-366----------------------------------------------------GG-YIV-----EAT------V...----
A3JKS5_9ALTE/114-392----------------------------------------------------SG-NLV-----SSS------L...----
A3JXJ6_9RHOB/79-358----------------------------------------------------GG-RLD-----DLR------L...----
A3M8Z0_ACIBT/26-325----------------------------------------------------GG-DIV-----RIE------L...----
YIDC_RHOS1/70-368----------------------------------------------------GG-RLD-----DLS------L...----
YIDC_SHELP/68-343----------------------------------------------------GG-DIV-----YSA------L...----
A3RT33_RALSL/84-353----------------------------------------------------GA-ILT-----KLE------L...----
A3S812_9RHOB/79-365----------------------------------------------------GG-RVD-----DLH------L...----
A3TU25_9RHOB/82-369----------------------------------------------------GG-RID-----DLK------L...----
A3UBQ3_CROAH/95-366----------------------------------------------------GG-QIV-----EAK------M...----
A3UFD6_9RHOB/80-359----------------------------------------------------GA-RID-----DLQ------L...----
A3V0A3_VIBSP/65-340----------------------------------------------------GG-DVV-----QAN------L...----
A3V4K5_9RHOB/73-362----------------------------------------------------GG-RID-----DLA------L...----
A3VF89_9RHOB/85-374----------------------------------------------------GG-RID-----DLH------L...----
A3W4K6_9RHOB/74-363----------------------------------------------------GG-RID-----DLF------L...----
A3WNL1_9GAMM/79-352----------------------------------------------------GG-DIV-----SAK------L...----
A3X1F9_9BRAD/81-371----------------------------------------------------GA-RID-----DLL------L...----
A3X407_9RHOB/76-363----------------------------------------------------GG-RID-----DLA------L...----
A3XGM2_LEEBM/97-368----------------------------------------------------GG-FIT-----EAR------L...----
A3YIB8_9GAMM/75-352----------------------------------------------------GG-DIV-----KAS------L...----
A4AW41_MARSH/92-364----------------------------------------------------GG-QIV-----EAT------M...----
A4BD89_9GAMM/80-356----------------------------------------------------GG-DVI-----YTA------L...----
A4BP05_9GAMM/69-343----------------------------------------------------GG-GIG-----SAK------L...----
A4CDJ1_9GAMM/72-344----------------------------------------------------GG-DIV-----EAD------L...----
A4CNB4_ROBBH/96-366----------------------------------------------------GG-EIV-----EAR------M...----
A4EH88_9RHOB/73-362----------------------------------------------------GG-RID-----DLA------L...----
A4EPF1_9RHOB/75-363----------------------------------------------------GG-RID-----DLS------L...----
YIDC_HERAR/86-359----------------------------------------------------GG-EVR-----HLE------L...----
A4MW21_HAEIF/65-339----------------------------------------------------GG-DVI-----SSE------L...----
YIDC_PROVI/72-345----------------------------------------------------GA-TLT-----SLV------L...----
A4TZQ4_9PROT/78-357----------------------------------------------------GA-RLD-----DLT------L...----
YIDC_PSEU5/82-358----------------------------------------------------GG-DIV-----ELH------L...----
A4YLD0_BRASO/97-387----------------------------------------------------GA-RID-----DLA------F...----
A5EY44_DICNV/67-344----------------------------------------------------GA-SIV-----EAK------L...----
A5FHA5_FLAJ1/97-371----------------------------------------------------GG-YIV-----EAT------L...----
YIDC_ACICJ/80-374----------------------------------------------------GA-RLD-----DLV------L...----
YIDC_GEOUR/67-335----------------------------------------------------GA-GLK-----KLV------L...----
YIDC_LEGPC/74-351----------------------------------------------------NG-DIV-----KGL------L...----
A5PCQ5_9SPHN/75-347----------------------------------------------------GA-MID-----DIV------L...----
A5VCE7_SPHWW/74-350----------------------------------------------------GA-RID-----DLV------L...----
A5VVS9_BRUO2/96-377----------------------------------------------------GA-RLD-----DLY------L...----
YIDC_PSEP1/82-360----------------------------------------------------GG-DIV-----QLN------L...----
A5WI37_PSYWF/86-362----------------------------------------------------GG-DVV-----YAA------L...----
A5ZDH4_9BACE/85-357----------------------------------------------------GG-RVY-----SAT------L...----
A6D430_9VIBR/65-340----------------------------------------------------GG-DVV-----TAK------L...----
A6DA77_9PROT/64-307----------------------------------------------------LG-RIS-----SFI------L..K----
A6ESJ9_9BACT/103-373----------------------------------------------------GG-YVT-----EAR------L...----
A6EY90_9ALTE/92-370----------------------------------------------------GG-NLI-----ESS------L...----
A6FI67_9GAMM/66-346----------------------------------------------------GG-DIV-----RAD------L...----
A6FLS2_9RHOB/78-359----------------------------------------------------GG-RID-----QLS------L...----
A6G3S3_9DELT/89-365----------------------------------------------------GG-LIN-----HIE------L...----
A6GL25_9BURK/86-359----------------------------------------------------GA-QLI-----TSK------L...----
A6Q3D4_NITSB/79-325----------------------------------------------------LG-RVS-----QVI------L..E----
A6QAL2_SULNB/79-326----------------------------------------------------FG-RIA-----QYE------L..L----
YIDC_JANMA/85-357----------------------------------------------------GG-EIR-----HLE------L...----
YIDC_KLEP7/59-343----------------------------------------------------GG-DIE-----QAL------L...----
YIDC_SINMW/85-365----------------------------------------------------GA-RFD-----DLK------L...----
YIDC_ACTSZ/62-334----------------------------------------------------GG-DVI-----ESE------L...----
YIDC_MARMS/79-356----------------------------------------------------GG-DLV-----EAA------L...----
A7GYZ3_CAMC5/72-316----------------------------------------------------LG-RIS-----KFY------L..T----
YIDC_ANADF/73-347----------------------------------------------------GG-AVK-----EIV------L...----
A7HPT9_PARL1/93-373----------------------------------------------------GA-RFD-----DLK------L...----
A7I143_CAMHC/78-324----------------------------------------------------LG-RIN-----SYV------L..N----
A7IGM3_XANP2/99-378----------------------------------------------------GG-RVD-----DLL------L...----
A7JWZ0_PASHA/67-339----------------------------------------------------GG-DVI-----GSD------L...----
YIDC_CROS8/60-344----------------------------------------------------GG-DIE-----QAL------L...----
A7V5B9_BACUN/84-357----------------------------------------------------GG-RIA-----SAT------L...----
A7ZCY9_CAMC1/70-314----------------------------------------------------LG-RIA-----KFY------L..T----
A8EV97_ARCB4/88-333----------------------------------------------------LG-RVA-----QVT------L..T----
YIDC_RICM5/71-350----------------------------------------------------GL-RFD-----DLI------L...----
YIDC_SERP5/60-340----------------------------------------------------GG-DIE-----QAK------L...----
YIDC_SHEPA/71-346----------------------------------------------------GG-DIV-----YSA------L...----
A8ILM2_AZOC5/88-369----------------------------------------------------GA-RAD-----DLT------L...----
YIDC_DINSH/79-367----------------------------------------------------GG-RID-----DLS------L...----
A8PQB3_9COXI/66-338----------------------------------------------------GG-NIV-----KAN------L...----
A8TUD8_9PROT/88-367----------------------------------------------------GA-RID-----DVV------L...----
A8UPQ4_9FLAO/98-370----------------------------------------------------GG-HLA-----EVR------L...----
A8UV65_9AQUI/85-321----------------------------------------------------GG-KIV-----SFV------D...----
A8UZM0_9AQUI/104-350----------------------------------------------------GA-RVI-----SVY------L...----
A9C1M1_DELAS/86-361----------------------------------------------------GG-TLR-----HAE------L...----
A9DU76_9RHOB/83-371----------------------------------------------------GG-RID-----DLK------L...----
A9EHP0_9RHOB/78-366----------------------------------------------------GG-RLD-----DLS------L...----
A9HKS4_GLUDA/56-342----------------------------------------------------GA-RLD-----DMV------L...----
YIDC_BORPD/87-362----------------------------------------------------GA-QLI-----RAE------L...----
A9IXD9_BART1/90-380----------------------------------------------------GA-QFD-----DLH------L...----
YIDC_COXBN/80-358----------------------------------------------------GG-NIV-----SAK------L...----
YIDC_METEP/92-379----------------------------------------------------GA-RID-----DVS------L...----
B0QWJ2_HAEPR/71-343----------------------------------------------------GG-DVV-----DSD------L...----
YIDC_XANCB/91-370----------------------------------------------------GR-SVL-----DAE------L...----
YIDC_CAUSK/79-389----------------------------------------------------GA-RID-----DLW------L...----
YIDC_XYLFM/76-359----------------------------------------------------GF-SIL-----AAD------L...----
YIDC_HAES2/64-338----------------------------------------------------GG-DVI-----GSE------L...----
B0VGK2_CLOAI/73-333----------------------------------------------------GG-SIQ-----QVE------L...----
YIDC_METRJ/93-380----------------------------------------------------GG-RVD-----DVS------L...----
YIDC_POLNS/81-360----------------------------------------------------GA-NVI-----DAK------L...----
B1Y0F7_LEPCP/82-364----------------------------------------------------GG-TLV-----SIE------L...----
YIDC_BEII9/87-368----------------------------------------------------GA-RID-----DVS------L...----
B2PV42_PROST/59-343----------------------------------------------------GG-DID-----EAD------L...----
YIDC_PORG3/88-364----------------------------------------------------GG-AIR-----EVL------L...----
B2URJ4_AKKM8/83-384----------------------------------------------------GG-SIG-----TVT------L...----
B2V9H4_SULSY/78-323----------------------------------------------------GG-RIV-----SAF------D...----
YIDC_ERWT9/60-343----------------------------------------------------GG-DID-----QAQ------L...----
YIDC_GEOLS/69-337----------------------------------------------------GA-SLK-----SLT------L...----
YIDC_CHLL2/73-345----------------------------------------------------GA-TIK-----SVV------L...----
YIDC_CHLPB/77-350----------------------------------------------------GA-TLK-----SMV------L...----
YIDC_RHIE6/87-366----------------------------------------------------GA-RLD-----DLK------L...----
B3QCI2_RHOPT/95-385----------------------------------------------------GA-RID-----DLA------L...----
YIDC_CHLP8/75-348----------------------------------------------------GA-TLK-----SMV------L...----
YIDC_CHLT3/79-354----------------------------------------------------GA-TLR-----SFI------Q...----
YIDC_CUPTR/88-357----------------------------------------------------GG-IVS-----RLE------L...----
B4F0U1_PROMH/62-343----------------------------------------------------GG-TID-----EAD------L...----
YIDC_PHEZH/77-357----------------------------------------------------GA-RID-----DLY------L...----
YIDC_PROA2/73-346----------------------------------------------------GA-TLK-----SMM------L...----
YIDC_PELPB/72-345----------------------------------------------------GA-TLK-----SLV------L...----
B4U8V7_HYDS0/77-310----------------------------------------------------GG-RIT-----YYY------I...----
B4W6P1_9CAUL/77-360----------------------------------------------------GG-RID-----DLF------L...----
B4X1P5_9GAMM/90-373----------------------------------------------------GG-DIV-----RLA------L...----
YIDC_GEOBB/76-344----------------------------------------------------GG-GLK-----KFV------L...----
B5EJI9_ACIF5/71-332----------------------------------------------------GG-DIQ-----NLG------L...----
B5FEU7_VIBFM/67-341----------------------------------------------------GG-DII-----ESV------L...----
B5J3A9_9RHOB/75-355----------------------------------------------------GG-RID-----DLS------L...----
B5JPX1_9BACT/91-373----------------------------------------------------GG-AIK-----EVE------L...----
B5JT26_9GAMM/80-355----------------------------------------------------GG-NVV-----ESQ------L...----
B5TVD7_9PAST/67-352----------------------------------------------------GG-DVI-----DSD------L...----
B5WNV2_9BURK/79-353----------------------------------------------------GG-TVS-----RLS------L...----
B5YLC7_THEYD/75-318----------------------------------------------------GA-TIK-----SVE------L...----
B6AYD8_9RHOB/77-364----------------------------------------------------GG-RID-----QLA------L...----
B6BRA8_9PROT/69-342----------------------------------------------------GA-AID-----DLT------F...----
B6BVS1_9PROT/64-333----------------------------------------------------GG-DIR-----KLK------L...----
B6C620_9GAMM/76-350----------------------------------------------------SG-DLY-----EVQ------L...----
B6JJN8_OLICO/93-374----------------------------------------------------GA-RFD-----DVS------L...----
B6R8Z5_9RHOB/90-370----------------------------------------------------GA-KLD-----DLR------L...----
B7X1D2_COMTE/87-361----------------------------------------------------GG-TLK-----HSE------L...----
YIDC_DESVM/76-340----------------------------------------------------GG-VLK-----HFS------L...----
YIDC_METSB/81-364----------------------------------------------------GA-RLD-----DVS------L...----
B8FMU7_DESAA/80-351----------------------------------------------------GA-GLS-----DLT------L...----
YIDC_THISH/78-359----------------------------------------------------GG-DLV-----RAD------L...----
YIDC_CAUCN/78-377----------------------------------------------------GA-RID-----DLF------L...----
B8J2U4_DESDA/74-342----------------------------------------------------GG-ALR-----SFK------L...----
B8KLJ5_9GAMM/111-388----------------------------------------------------GG-DIV-----EVA------L...----
B9D1D7_WOLRE/75-318----------------------------------------------------LG-RIS-----KFY------L..N----
B9KFP9_CAMLR/73-319----------------------------------------------------LG-RIA-----KFY------L..S----
B9KI96_ANAMF/142-427----------------------------------------------------GA-LVD-----DVS------L...----
B9L9D7_NAUPA/72-316----------------------------------------------------LG-RIS-----SFK------L..K----
YIDC_GEOSF/69-337----------------------------------------------------GG-GLQ-----SFQ------L...----
B9NL98_9RHOB/75-368----------------------------------------------------GG-RID-----ELF------L...----
B9R1R8_9RHOB/93-373----------------------------------------------------GG-RLD-----DLR------L...----
B9XJP0_9BACT/84-382----------------------------------------------------GG-GLK-----EVE------L...----
B9Z8U5_9NEIS/66-349----------------------------------------------------GG-DLR-----RLD------L...----
C0BJD0_9BACT/83-354----------------------------------------------------GG-QIV-----LFQ------L...----
C0DYB8_EIKCO/59-347----------------------------------------------------SG-DLR-----GLD------L...----
C0N352_9GAMM/79-352----------------------------------------------------GG-DIR-----DLA------L...----
C0QIZ1_DESAH/83-349----------------------------------------------------GA-KVN-----SLT------L...----
C1AEP7_GEMAT/82-361----------------------------------------------------GA-ALV-----GAT------M...----
YIDC_LARHH/64-349----------------------------------------------------GG-DIR-----SLE------L...----
C1DTT8_SULAA/77-322----------------------------------------------------GG-RIT-----SVY------V...----
C1F9G1_ACIC5/93-378----------------------------------------------------GG-VAK-----SWI------L...----
C2M324_CAPGI/89-358----------------------------------------------------GG-QIT-----NLL------V...----
C3X5V7_OXAFO/83-357----------------------------------------------------GG-VFQ-----NLE------L...----
C3XJR0_9HELI/78-326----------------------------------------------------LG-RIA-----IVE------L..K----
C4GKM4_9NEIS/60-349----------------------------------------------------SG-DLR-----GLT------L...----
C4K7P5_HAMD5/61-343----------------------------------------------------GG-DIQ-----QAN------L...----
YIDC_TOLAT/62-347----------------------------------------------------GG-DIV-----EAK------L...----
YIDC_DESMR/68-332----------------------------------------------------GG-VLE-----QFA------L...----
C4ZKT3_THASP/75-351----------------------------------------------------GG-DIV-----RLE------L...----
YIDC_TERTT/87-365----------------------------------------------------GG-DIV-----RLA------L...----
C5CSC1_VARPS/84-368----------------------------------------------------GA-TVN-----YLE------L...----
C5EXY9_9HELI/76-325----------------------------------------------------LG-RIT-----QVL------L..K----
C5ZXJ0_9HELI/77-326----------------------------------------------------LG-RIT-----QVT------L..K----
YIDC_DESAD/74-338----------------------------------------------------GG-LLE-----SFK------L...----
C6C779_DICDC/59-340----------------------------------------------------GG-DIE-----EAD------L...----
C6ICV7_9BACE/83-355----------------------------------------------------GG-RVY-----SAL------L...----
C6NT82_9GAMM/85-343----------------------------------------------------GG-DIV-----HLG------L...----
C6W539_DYAFD/66-333----------------------------------------------------GG-VMK-----EVM------L...----
C6WTV5_METML/74-344----------------------------------------------------GG-DLR-----KLE------L...----
C6XBU5_METSD/72-344----------------------------------------------------GG-DLR-----RLE------L...----
C6XF04_LIBAP/70-349----------------------------------------------------GA-QFD-----DLN------L...----
C6XQ56_HIRBI/83-363----------------------------------------------------GA-RLD-----DLS------M...----
C7BT51_PHOAA/58-340----------------------------------------------------GG-DIE-----EAD------L...----
C7D7D3_9RHOB/76-363----------------------------------------------------GG-RLD-----DLS------L...----
C7JEI5_ACEP3/72-355----------------------------------------------------GA-RLD-----DLV------L...----
C7LXJ6_DESBD/71-334----------------------------------------------------GG-VLE-----SFE------L...----
C7M523_CAPOD/94-367----------------------------------------------------GG-QPK-----EVL------L...----
C7RRI8_ACCPU/72-357----------------------------------------------------GG-DIV-----RLE------L...----
C8N7Q9_9GAMM/78-349----------------------------------------------------GG-TIV-----HTT------L...----
C8PZ49_9GAMM/83-358----------------------------------------------------GG-DVV-----YAA------L...----
C8S4X2_9RHOB/70-359----------------------------------------------------GG-RID-----DLS------L...----
C8X4E9_DESRD/89-350----------------------------------------------------GG-VLE-----HLV------L...----
C9CUD9_9RHOB/81-369----------------------------------------------------GG-RID-----DLR------L...----
C9P930_VIBME/65-340----------------------------------------------------GG-DII-----HAL------L...----
C9PM89_9PAST/65-339----------------------------------------------------GG-DVI-----HSE------L...----
C9R685_AGGAD/66-340----------------------------------------------------GG-DVV-----SSE------L...----
C9RS07_FIBSS/98-377----------------------------------------------------GA-KVK-----SII------V...----
C9YCP9_9BURK/79-362----------------------------------------------------GG-SLV-----RSE------F...----
D0D3Z8_9RHOB/78-366----------------------------------------------------GG-RID-----ELI------L...----
D0I2Z1_VIBHO/48-321----------------------------------------------------GG-DII-----HAE------L...----
D0KXN2_HALNC/87-369----------------------------------------------------GG-VID-----EAD------L...----
D0MGR8_RHOM4/82-358----------------------------------------------------GA-TLV-----SLK------L...----
D0RR44_9PROT/72-345----------------------------------------------------GA-LID-----DVT------L...----
D0Z129_LISDA/65-339----------------------------------------------------GG-DVV-----DAK------L...----
D1B2U2_SULD5/83-329----------------------------------------------------LG-RIS-----KFY------L..N----
D1KCD1_9GAMM/86-354----------------------------------------------------GG-TVQ-----NAL------L...----
D1RD64_LEGLO/74-351----------------------------------------------------QG-DIV-----SSQ------L...----
D2TY53_9ENTR/58-342----------------------------------------------------GG-DID-----GAD------L...----
D2UGY9_XANAP/85-366----------------------------------------------------GS-SVL-----DAD------L...----
D3NRY2_AZOS1/85-363----------------------------------------------------GG-RID-----DLT------L...----
D3PB77_DEFDS/67-312----------------------------------------------------SG-DVY-----SAA------I...----
D3RS85_ALLVD/78-354----------------------------------------------------GA-TIA-----SAW------L...----
D3SFF1_THISK/81-365----------------------------------------------------GG-TIL-----RAD------L...----
D3SM35_THEAH/68-295----------------------------------------------------GG-KVV-----SWV------D...----
D3VFZ9_XENNA/54-335----------------------------------------------------GG-DIE-----EAD------L...----
D4DLV5_NEIEG/57-345----------------------------------------------------SG-DLR-----SLT------L...----
D4FAW5_EDWTA/70-352----------------------------------------------------GG-DIE-----QAD------L...----
D4H194_DENA2/71-316----------------------------------------------------TG-NIR-----EAV------I...----
D4YZ11_SPHJU/74-348----------------------------------------------------GA-RID-----DIV------L...----
D4ZD76_SHEVD/70-345----------------------------------------------------GG-DIV-----YSA------L...----
D5AM40_RHOCB/67-374----------------------------------------------------GA-RFD-----DLS------L...----
D5BGP8_ZUNPS/95-365----------------------------------------------------GG-YIE-----EAV------L...----
D5BTZ8_PUNMI/94-376----------------------------------------------------GA-RID-----DVV------L...----
D5CQJ8_SIDLE/71-344----------------------------------------------------GG-NIQ-----HLD------L...----
D5H4L9_SALRM/114-393----------------------------------------------------GG-TIE-----RFT------L...----
D5MLW8_9BACT/77-342----------------------------------------------------GG-ALK-----SWR------L...----
D5QCU3_GLUHA/64-351----------------------------------------------------GA-RLD-----DLV------L...----
D5QKL0_METTR/94-373----------------------------------------------------GG-RID-----DVS------L...----
D5V159_ARCNC/94-340----------------------------------------------------LG-RIA-----QVT------L..L----
D5V9B9_MORCR/81-356----------------------------------------------------GG-DIV-----YAA------L...----
D5X092_THIK1/88-361----------------------------------------------------GG-NLV-----YAK------L...----
D6L2A6_9NEIS/51-339----------------------------------------------------SG-DLR-----GLT------L...----
D7A2X3_STAND/89-370----------------------------------------------------GG-RID-----DLS------L...----
D7AGW1_GEOSK/67-334----------------------------------------------------GG-SIK-----RLD------L...----
D7DPN7_METS0/67-338----------------------------------------------------GG-DLR-----RLE------L...----
D7HT65_PSESS/85-363----------------------------------------------------GG-DVV-----QLR------L...----
D7VNI1_9SPHI/86-358----------------------------------------------------GG-RVK-----SVE------L...----
D8FEY0_9DELT/74-343----------------------------------------------------GP-TIK-----SFK------L...----
D8IUS2_HERSS/62-334----------------------------------------------------GG-ELK-----RLE------L...----
D8JXN4_HYPDA/99-385----------------------------------------------------GG-RLD-----DLV------L...----
D9PLD5_9ZZZZ/72-318----------------------------------------------------FG-RIS-----QFT------L..L----
D9QLU4_BRESC/86-370----------------------------------------------------GG-RID-----DLF------L...----
D9SEP3_GALCS/70-342----------------------------------------------------GG-DIQ-----RLD------F...----
D9YCI7_9DELT/76-344----------------------------------------------------GG-PLR-----SFK------L...----
E0E9T6_ACTPL/60-331----------------------------------------------------GG-DVI-----ASD------L...----
E0QC07_CAMCO/82-329----------------------------------------------------LG-RIV-----NFY------L..Q----
E0TGR5_PARBH/75-349----------------------------------------------------GL-LFD-----DLI------L...----
E1JWT9_DESFR/72-336----------------------------------------------------GG-LLS-----RFS------L...----
E1QGD7_DESB2/72-341----------------------------------------------------GG-ALR-----KVV------L...----
E1R6N6_SPISS/85-369----------------------------------------------------GA-LLT-----SMK------L...----
E1SRS1_FERBD/67-340----------------------------------------------------GG-DVV-----YAA------L...----
E1VCI5_HALED/89-362----------------------------------------------------GG-DIV-----YAA------L...----
E1YHJ2_9DELT/73-343----------------------------------------------------NA-AIT-----SFK------L...----
E2CFI6_9RHOB/88-368----------------------------------------------------GG-RID-----DIR------L...----
E2Y0D7_PSEFL/82-367----------------------------------------------------GG-DVA-----KLT------L...----
E3BH69_9VIBR/64-349----------------------------------------------------GG-DVV-----HAD------L...----
E3I8D6_RHOVT/87-376----------------------------------------------------GG-SVD-----DVT------L...----
E4PHG2_MARAH/93-371----------------------------------------------------SG-NLV-----KAR------L...----
E4RXZ7_LEAB4/66-342----------------------------------------------------GG-VIK-----QVA------L...----
E4TI09_CALNY/66-312----------------------------------------------------SG-NIN-----KVS------V...----
E4U0E7_SULKY/78-324----------------------------------------------------LG-RIS-----SVI------L..S----
E5ANF4_BURRH/84-357----------------------------------------------------GG-TLS-----RLS------L...----
E5UFL6_ALCXX/85-360----------------------------------------------------GA-QLV-----RAE------L...----
E5Y3D4_BILWA/70-335----------------------------------------------------GG-ILR-----SFT------L...----
E6L9N5_CAMUP/85-332----------------------------------------------------LG-RIS-----SFY------L..K----
E6PV40_9ZZZZ/84-356----------------------------------------------------GG-NLV-----YAR------L...----
E6QUQ9_9ZZZZ/65-340----------------------------------------------------GG-DLR-----SLI------L...----
E6VVL3_DESAO/78-347----------------------------------------------------GG-ILE-----KFI------L...----
E6W2A4_DESIS/84-327----------------------------------------------------GG-HLQ-----SLR------L...----
E6WXG3_PSEUU/84-365----------------------------------------------------GG-SVV-----QAD------L...----
E6XAK3_CELAD/92-365----------------------------------------------------GG-QII-----EAK------M...----
E7C5J1_9BACT/79-427----------------------------------------------------GG-AIK-----EVR------FLSK----
E7C9X2_9PROT/74-354----------------------------------------------------GA-LID-----DIT------F...----
E7RZL5_9BURK/87-360----------------------------------------------------GG-QIV-----SSK------L...----
E8L3J9_9RHIZ/76-358----------------------------------------------------GA-RVD-----DVS------L...----
E8LJ48_9GAMM/56-342----------------------------------------------------GG-DIV-----DAK------L...----
E8Q5V7_BLOVB/159-447----------------------------------------------------GG-NIE-----DAY------L...----
E8RBA3_DESPD/75-344----------------------------------------------------GG-GVK-----GFV------L...----
E8RRW7_ASTEC/75-370----------------------------------------------------GA-RID-----DLF------L...----
E8T5A7_THEA1/59-297----------------------------------------------------NG-KLV-----KLT------V...----
E8UFE8_TAYEM/72-346----------------------------------------------------GA-QLI-----KAD------L...----
E8V6Z5_TERSS/94-374----------------------------------------------------GA-EVK-----SWI------L...----
E8WL20_GEOS8/75-344----------------------------------------------------GA-GLK-----KFV------L...----
E8WWP1_ACISM/87-375----------------------------------------------------GA-QAT-----SWI------L...----
E8XPB8_RAHSY/60-339----------------------------------------------------GG-DIE-----QAL------L...----
F0F1E8_9NEIS/53-342----------------------------------------------------SG-DLR-----GMT------L...----
F0IH08_9FLAO/89-358----------------------------------------------------GG-QII-----ELL------V...----
F0JKI5_DESDE/78-347----------------------------------------------------GG-VLE-----KFI------L...----
F0L5H9_AGRSH/88-368----------------------------------------------------GA-RFD-----DIR------L...----
F0NZP1_WEEVC/77-350----------------------------------------------------GG-QIG-----LVQ------L...----
F0RH16_CELLC/92-364----------------------------------------------------GG-QIV-----EAK------M...----
F0RX03_SPHGB/84-372----------------------------------------------------GA-SVS-----SFK------L...----
F0SF95_PLABD/95-399----------------------------------------------------GA-AIA-----TVQ------L...----
F2B931_9NEIS/54-342----------------------------------------------------SG-DLR-----GLT------L...----
F2GD54_ALTMD/78-351----------------------------------------------------GG-DVI-----SAD------L...----
F2I3Y3_PELSM/76-349----------------------------------------------------GA-LID-----DVT------L...----
F2J1Z4_POLGS/92-372----------------------------------------------------GA-RID-----DLR------L...----
F2K1U1_MARM1/82-358----------------------------------------------------GG-DLV-----GAS------L...----
F2LWU2_HIPMA/71-319----------------------------------------------------NG-SIK-----ELT------L...----
F2PBU9_PHOMO/65-340----------------------------------------------------GG-DVV-----DAK------L...----
YIDC_BUCAP/52-338----------------------------------------------------GG-DIE-----EAS------L...----
YIDC_WOLSU/81-328----------------------------------------------------LG-RIA-----QVY------L..K----
YIDC_BORPE/87-362----------------------------------------------------GA-QLI-----RAE------L...----
Q02A40_SOLUE/101-361----------------------------------------------------GA-TVR-----SWQ------L...----
Q07TY2_RHOP5/100-389----------------------------------------------------GA-RLD-----DIA------L...----
YIDC_SHEFN/68-343----------------------------------------------------GG-DIV-----YAA------L...----
YIDC_ALHEH/74-349----------------------------------------------------GG-DIR-----RVD------L...----
YIDC_MARMM/76-356----------------------------------------------------GA-RLD-----DVR------L...----
YIDC_GRABC/70-355----------------------------------------------------GA-RFD-----DLV------L...----
Q0C549_HYPNA/73-365----------------------------------------------------GA-RID-----DLS------L...----
Q0G0U0_9RHIZ/90-370----------------------------------------------------GA-RLD-----DLR------L...----
Q11LE5_MESSB/91-371----------------------------------------------------GA-RLD-----DLL------L...----
YIDC_CYTH3/79-358----------------------------------------------------GG-TIK-----SVL------L...----
YIDC_SHEDO/67-342----------------------------------------------------GG-DIV-----YAA------L...----
YIDC_PSEA6/72-343----------------------------------------------------GG-DVI-----SAN------L...----
Q1GN73_SPHAL/87-365----------------------------------------------------GA-RID-----DIT------L...----
YIDC_METFK/76-348----------------------------------------------------GG-DLR-----RLE------L...----
Q1IV78_KORVE/81-362----------------------------------------------------GA-QVK-----SWV------L...----
YIDC_LAWIP/69-333----------------------------------------------------GG-ILS-----SFI------L...----
Q1MZ43_9GAMM/64-339----------------------------------------------------GG-DIV-----YAA------L...----
Q1NWR8_9DELT/82-356----------------------------------------------------GG-ALR-----SFR------L...----
Q1V1M7_PELUQ/70-343----------------------------------------------------GA-AID-----DLT------F...----
Q1YH97_MOBAS/97-376----------------------------------------------------GA-RLD-----DLR------L...----
Q1YZM1_PHOPR/66-338----------------------------------------------------GG-DVT-----EAK------L...----
Q21QM4_RHOFD/90-368----------------------------------------------------GA-SVV-----QTE------F...----
Q26CA4_FLABB/76-349----------------------------------------------------GA-LIQ-----EAL------L...----
YIDC_JANSC/83-388----------------------------------------------------GG-RID-----DLS------L...----
Q2BQG4_9GAMM/76-352----------------------------------------------------GG-DII-----QAA------L...----
Q2CI02_9RHOB/82-361----------------------------------------------------GG-RID-----DLK------L...----
Q2GAU8_NOVAD/82-357----------------------------------------------------GA-LVD-----DVT------L...----
YIDC_BORA1/87-360----------------------------------------------------GA-QII-----RAE------L...----
YIDC_SYNAS/82-353----------------------------------------------------GG-ALK-----SFA------L...----
Q2N7X2_ERYLH/80-353----------------------------------------------------GA-RID-----DIE------L...----
Q2NQ71_SODGM/60-342----------------------------------------------------GG-DIE-----QAF------L...----
Q2RP12_RHORT/103-381----------------------------------------------------GA-RID-----DLS------L...----
YIDC_HAHCH/87-367----------------------------------------------------GG-NVV-----EAS------L...----
Q2VZ15_MAGSA/87-366----------------------------------------------------GA-RID-----DIT------L...----
YIDC_NITMU/90-364----------------------------------------------------GG-DIR-----RLE------L...----
Q30T77_SULDN/78-325----------------------------------------------------LG-RIS-----SKV------L..L----
YIDC_DESDG/73-337----------------------------------------------------GG-VLK-----HFR------L...----
YIDC_GEOMG/71-339----------------------------------------------------GG-SLT-----RLV------L...----
YIDC_CHLCH/73-346----------------------------------------------------GA-TLK-----SLV------L...----
YIDC_PELLD/77-350----------------------------------------------------GA-TLK-----SLV------L...----
YIDC_THIDA/69-344----------------------------------------------------GG-DLR-----ELQ------L...----
YIDC_DECAR/71-344----------------------------------------------------GG-DLV-----SLE------L...----
Q47U35_COLP3/70-342----------------------------------------------------GG-DIV-----EAK------L...----
Q494B9_BLOPB/151-436----------------------------------------------------GG-DIE-----EAY------L...----
Q5FPY0_GLUOX/67-351----------------------------------------------------GA-VLD-----DLI------L...----
YIDC_SILPO/77-370----------------------------------------------------GG-RID-----ELS------L...----
YIDC_AROAE/74-349----------------------------------------------------GG-DIV-----RLE------L...----
Q5QZJ4_IDILO/54-327----------------------------------------------------GG-DVV-----STH------L...----
YIDC_METCA/72-347----------------------------------------------------GG-DLR-----QLD------L...----
YIDC_MANSM/66-338----------------------------------------------------GG-DVV-----ESS------L...----
Q6APY9_DESPS/74-343----------------------------------------------------GG-ALK-----SFV------L...----
Q6MGL3_BDEBA/85-341----------------------------------------------------GM-GLK-----GYT------I...----
Q6SHP6_9BACT/69-344----------------------------------------------------GA-IID-----DII------F...----
YIDC_CHRVO/61-344----------------------------------------------------GG-DLR-----SLK------L...----
YIDC_BLOFL/67-356----------------------------------------------------SG-NIE-----EAY------L...----
YIDC_HAEDU/63-334----------------------------------------------------GG-DVI-----ESD------L...----
YIDC_BRAJA/93-381----------------------------------------------------GG-RID-----DVA------L...----

PF02929

BGAL_ECOLI/751-1022----------------------------------------------------SG-FLS-----QMW------.-------
BGAL_PSEHA/760-1034----------------------------------------------------SG-LIE-----QWL------.-------
BGAL_ACTPL/734-998----------------------------------------------------KG-IFS-----RIE------.-------
Q9WXJ2_9GAMM/756-1029----------------------------------------------------QG-VIT-----DWL------.-------
BGAL_THEMA/715-981----------------------------------------------------TG-LLE-----QIL------.-------
BGAM_LACSK/18-317----------------------------------------------------TG-GPE-----SLR------.-------
BGAM_LEULA/18-318----------------------------------------------------RG-GLE-----SLV------.-------
BGAL_STRTR/752-1023----------------------------------------------------QN-TLV-----SAK------.-------
BGAM_LACAC/17-316----------------------------------------------------RG-GLE-----SLN------.-------
O85250_THENE/715-982----------------------------------------------------TG-LLK-----RIV------.-------
BGA2_ECOLI/727-998----------------------------------------------------SG-KPT-----SWQ------.-------
Q9ZBD1_9PSEU/972-1248----------------------------------------------------AG-TLT-----GMT------.-------
BGAL1_KLEPN/759-1032----------------------------------------------------TG-LLS-----RWS------.-------
BGAL_BACMD/763-1032----------------------------------------------------KG-QFI-----SYN------.-------
BGAL_LACLA/719-996----------------------------------------------------NG-NLS-----RWL------D-------
BGAL1_ENTCL/752-1025----------------------------------------------------SG-NLT-----QWW------.-------
Q9ZBF6_STRCO/1015-1288----------------------------------------------------TG-TIS-----SYE------.-------
BGAL_KLULA/750-1023----------------------------------------------------LG-KIE-----SLK------.-------
BGAL_ARTSB/730-1013----------------------------------------------------AG-SLV-----TLA------.-------
BGAL_STAXY/723-992----------------------------------------------------NA-SLE-----SVL------.-------
Q9X6Y5_BIFLN/747-1021----------------------------------------------------QG-GMV-----SYT------.-------

PF13802

C6Z6F6_9BACE/138-207----------------------------------------------------GE.R.M.....D.F------M-------
B3X7V0_ECOLX/148-215----------------------------------------------------GD.K.S.....G.D------L-------
A6BU30_YERPE/147-214----------------------------------------------------GE.K.A.....G.D------L-------
A4NG96_HAEIF/146-213----------------------------------------------------GE.K.T.....G.N------L-------
A6VZ15_MARMS/151-218----------------------------------------------------GE.K.T.....G.D------L-------
A6CYB1_9VIBR/146-217----------------------------------------------------GE.K.T.....G.N------L-------
C6CFE6_DICZE/146-213----------------------------------------------------GE.K.A.....G.D------L-------
A6VKN2_ACTSZ/146-213----------------------------------------------------GE.K.A.....G.D------L-------
A0P411_9RHOB/147-215----------------------------------------------------GE.K.S.....G.S------L-------
B4EHS8_BURCJ/151-220----------------------------------------------------GE.R.A.....G.E------L-------
E3IFH7_GEOS0/152-221----------------------------------------------------GE.K.S.....G.E------M-------
Q65IV9_BACLD/151-220----------------------------------------------------GE.K.T.....G.N------V-------
Q5WLB5_BACSK/151-220----------------------------------------------------GE.R.T.....G.T------L-------
B2U9A1_RALPJ/149-218----------------------------------------------------GE.R.A.....G.D------M-------
Q2BFL4_9BACI/171-240----------------------------------------------------GE.K.S.....G.T------L-------
Q9KEZ5_BACHD/152-220----------------------------------------------------GE.K.T.....G.S------L-------
B6R9L1_9RHOB/137-205----------------------------------------------------GE.K.A.....G.N------L-------
B1Y1L3_LEPCP/168-237----------------------------------------------------GE.R.S.....G.D------A-------
Q1GMW9_SILST/145-213----------------------------------------------------GE.K.T.....G.P------L-------
D3P7Q6_AZOS1/182-251----------------------------------------------------GE.R.S.....G.T------A-------
C6YVN7_9GAMM/147-216----------------------------------------------------GE.K.T.....G.S------L-------
C8N9E3_9GAMM/146-214----------------------------------------------------GE.K.A.....G.T------I-------
D7AQU8_THEM3/149-218----------------------------------------------------GE.K.A.....G.I------A-------
A6LTE1_CLOB8/150-217----------------------------------------------------GE.K.T.....G.H------L-------
B7R6V8_9THEO/159-228----------------------------------------------------GE.K.S.....G.D------I-------
D5VMK3_CAUST/152-220----------------------------------------------------GE.R.A.....G.A------M-------
D4JL19_9FIRM/158-225----------------------------------------------------GD.K.P.....G.C------L-------
Q74HN8_LACJO/146-213----------------------------------------------------GD.K.T.....G.F------L-------
E6U2M1_ETHHY/145-212----------------------------------------------------GE.K.T.....G.P------L-------
A6M2D1_CLOB8/142-211----------------------------------------------------GE.K.A.....G.Y------L-------
B8CZD8_HALOH/144-211----------------------------------------------------GE.K.T.....G.F------L-------
A5VKA3_LACRD/145-212----------------------------------------------------GD.K.T.....G.Y------L-------
C1I6Q0_9CLOT/141-208----------------------------------------------------GE.R.T.....G.S------L-------
AGL2_BACTQ/146-213----------------------------------------------------GE.K.T.....G.F------L-------
Q8A369_BACTN/151-214----------------------------------------------------GE.K.T.....G.K------M-------
C6Y460_PEDHD/169-235----------------------------------------------------GD.K.S.....G.N------M-------
E3I544_RHOVT/151-221----------------------------------------------------GE.K.T.....G.D------A-------
C6LHD3_9FIRM/141-210----------------------------------------------------GE.K.S.....G.E------F-------
C8P8K9_9LACO/146-213----------------------------------------------------GD.K.P.....G.F------L-------
C7XXM5_9LACO/143-212----------------------------------------------------GE.K.S.....G.V------L-------
C8PCW9_9LACO/137-204----------------------------------------------------GD.K.T.....G.F------L-------
A0M5P9_GRAFK/143-209----------------------------------------------------GD.K.P.....T.N------F-------
D2KFL4_9FIRM/144-211----------------------------------------------------GE.H.T.....G.H------L-------
A3XMQ1_LEEBM/143-209----------------------------------------------------GD.K.P.....V.H------L-------
A4AR25_MARSH/143-209----------------------------------------------------GD.K.A.....T.H------S-------
C2FW68_9SPHI/168-234----------------------------------------------------GD.K.A.....T.N------L-------
Q2B942_9BACI/145-212----------------------------------------------------GE.K.T.....G.F------L-------
A5FGA0_FLAJ1/143-209----------------------------------------------------GD.K.A.....T.Q------M-------
A9E425_9FLAO/144-210----------------------------------------------------GD.K.P.....D.H------L-------
Q26ET6_FLABB/143-209----------------------------------------------------GD.K.P.....A.D------N-------
A6EJE2_9SPHI/149-215----------------------------------------------------GE.K.T.....G.N------L-------
B8E1H7_DICTD/128-194----------------------------------------------------GE.K.M.....G.G------L-------
C7XVH3_9LACO/146-213----------------------------------------------------GG.K.T.....G.F------L-------
D2EHP2_PEDAC/142-211----------------------------------------------------GE.K.S.....G.K------L-------
Q6A5C7_PROAC/189-256----------------------------------------------------GE.K.S.....G.D------L-------
A6M2D3_CLOB8/141-210----------------------------------------------------GE.K.T.....G.K------L-------
A4YW59_BRASO/151-218----------------------------------------------------GD.K.A.....G.P------L-------
A7B0D7_RUMGN/159-228----------------------------------------------------GE.K.T.....G.H------L-------
Q1ITZ5_KORVE/157-223----------------------------------------------------GE.K.S.....T.P------L-------
A6NAA1_THEET/115-182----------------------------------------------------GE.K.A.....G.Y------L-------
E0U9C6_CYAP2/141-207----------------------------------------------------GE.R.T.....G.L------L-------
A4C366_9FLAO/144-210----------------------------------------------------GD.K.P.....V.E------V-------
A0NI45_OENOE/157-224----------------------------------------------------GD.R.T.....G.H------L-------
C6VMU9_LACPJ/143-210----------------------------------------------------GD.K.T.....G.Y------L-------
Q8YN00_NOSS1/141-207----------------------------------------------------GE.R.T.....G.L------L-------
C7PPD2_CHIPD/143-209----------------------------------------------------GD.K.P.....T.D------L-------
C7G8B2_9FIRM/148-215----------------------------------------------------GD.K.T.....G.V------L-------
A2TTB6_9FLAO/143-209----------------------------------------------------GD.K.P.....M.H------S-------
B2J8N8_NOSP7/141-207----------------------------------------------------GE.P.T.....G.L------L-------
Q096Z9_STIAD/169-235----------------------------------------------------GD.K.P.....G.P------L-------
B5YCW0_DICT6/115-181----------------------------------------------------GE.R.L.....G.S------L-------
B7GLU5_ANOFW/151-218----------------------------------------------------GK.K.T.....G.V------L-------
Q7NP60_GLOVI/141-207----------------------------------------------------GE.R.T.....G.L------L-------
Q2JLQ6_SYNJB/174-240----------------------------------------------------GE.R.A.....G.L------L-------
D4IW42_BUTFI/145-212----------------------------------------------------GD.K.T.....G.F------L-------
D0MJB1_RHOM4/128-199----------------------------------------------------GE.K.T.....G.R------L-------
Q11WX6_CYTH3/141-207----------------------------------------------------GD.K.S.....A.D------N-------
Q2B3F7_9BACI/171-238----------------------------------------------------GE.Q.A.....GLN------M-------
A4FJU3_SACEN/111-180----------------------------------------------------GE.T.T.....G.P------L-------
A9B074_HERA2/125-192----------------------------------------------------GE.R.T.....G.W------L-------
C7GHF0_9FIRM/166-226----------------------------------------------------GE.R.F.....S.A------F-------
B5YAW0_DICT6/158-218----------------------------------------------------GE.R.F.....G.P------F-------
Q16SF9_AEDAE/142-215----------------------------------------------------PE.H.A.....D.D------F-------
C4G5Y4_ABIDE/167-228----------------------------------------------------GE.K.F.....T.N------F-------
B2UN73_AKKM8/140-206----------------------------------------------------GD.K.P.....C.A------L-------
B3WW63_SHIDY/159-219----------------------------------------------------GE.R.F.....T.A------L-------
B1S937_9BIFI/158-218----------------------------------------------------GE.R.F.....T.N------F-------
C1F1A5_ACIC5/161-227----------------------------------------------------GD.K.T.....A.P------L-------
Q92F84_LISIN/142-209----------------------------------------------------GE.K.T.....G.A------L-------
A5DNM1_PICGU/182-242----------------------------------------------------GE.R.F.....G.P------F-------
C4GAQ3_9FIRM/169-236----------------------------------------------------GD.K.T.....G.F------L-------
B7DQ25_9BACL/151-218----------------------------------------------------GE.K.P.....G.P------L-------
C4GA21_9FIRM/179-248----------------------------------------------------GE.R.T.....G.K------I-------
A4XJ71_CALS8/158-218----------------------------------------------------GE.R.F.....T.P------F-------
A9X936_9BACL/155-215----------------------------------------------------GE.R.F.....T.A------F-------
A8RUC2_9CLOT/208-269----------------------------------------------------GE.N.F.....T.S------V-------
D1C8H0_SPHTD/151-218----------------------------------------------------GE.R.T.....G.G------L-------
B9KC10_THENN/173-233----------------------------------------------------GE.R.F.....S.P------F-------
D2S0G4_HALTV/126-193----------------------------------------------------GE.Q.P.....ELT------L-------
E6TRU4_BACCJ/158-218----------------------------------------------------GE.R.F.....T.P------F-------
Q8YLG7_NOSS1/171-245----------------------------------------------------GE.R.A.....A.P------L-------
C6WRR4_ACTMD/156-216----------------------------------------------------GE.R.F.....G.P------L-------
Q1AU85_RUBXD/146-213----------------------------------------------------GE.R.T.....S.G------L-------
P96793_LACPE/157-217----------------------------------------------------GE.R.F.....T.N------F-------
Q2H3D9_CHAGB/177-237----------------------------------------------------GE.R.F.....G.P------F-------
C8P9M9_9LACO/157-217----------------------------------------------------GE.R.F.....G.N------F-------
D9SW39_CLOC7/180-240----------------------------------------------------GE.K.F.....T.P------F-------
C4RJD3_9ACTO/158-218----------------------------------------------------GE.R.F.....G.P------F-------
B9XM93_9BACT/133-203----------------------------------------------------GE.T.T.....G.T------Y-------
D2KFL5_9FIRM/166-226----------------------------------------------------GE.R.F.....T.P------F-------
C7PZM9_CATAD/157-217----------------------------------------------------GE.R.F.....G.P------L-------
C0FZU5_9FIRM/179-240----------------------------------------------------GE.K.F.....T.D------F-------
A7V9A7_BACUN/225-286----------------------------------------------------GE.S.A.....T.G------L-------
E8WBI2_STRFA/161-221----------------------------------------------------GE.R.F.....T.P------Y-------
B7KDN2_CYAP7/163-238----------------------------------------------------GE.R.A.....A.P------L-------
C6JFG5_9FIRM/171-231----------------------------------------------------GE.R.F.....T.A------F-------
Q03T52_LACBA/157-217----------------------------------------------------GE.R.F.....G.N------F-------
D6ZH08_MOBCV/158-218----------------------------------------------------GE.R.F.....G.P------V-------
B1RLL6_CLOPF/139-205----------------------------------------------------GE.K.G.....G.D------L-------
Q03WT1_LEUMM/191-261----------------------------------------------------GE.T.F.....G.P------F-------
A8X5Y6_CAEBR/204-275----------------------------------------------------PE.H.A.....E.S------Y-------
Q47PH1_THEFY/175-236----------------------------------------------------GE.R.F.....T.P------F-------
A9GNN9_SORC5/138-204----------------------------------------------------GE.K.V.....G.P------L-------
B0ML18_9FIRM/181-241----------------------------------------------------GE.K.F.....S.T------F-------
D2BD45_STRRD/176-237----------------------------------------------------GE.S.F.....T.P------L-------
A5FLV6_FLAJ1/228-289----------------------------------------------------GE.S.F.....T.Q------F-------
D2ELQ0_PEDAC/65-125----------------------------------------------------GE.R.F.....T.S------F-------
C2GW28_BIFLN/196-256----------------------------------------------------GE.R.F.....G.A------Y-------
Q091G4_STIAD/133-199----------------------------------------------------GE.K.V.....G.P------L-------
A2EBD8_TRIVA/156-223----------------------------------------------------AE.R.V.....T.P------N-------
C4XW51_CLAL4/205-265----------------------------------------------------GE.R.F.....G.P------F-------
C6VSJ1_DYAFD/228-289----------------------------------------------------GE.S.F.....T.K------L-------
Q7NKE3_GLOVI/167-242----------------------------------------------------GE.R.A.....A.P------L-------
Q928J2_LISIN/275-338----------------------------------------------------GE.R.Y.....D.T------I-------
D4DDN6_TRIVH/259-335----------------------------------------------------PE.H.A.....D.S------M-------
Q75EA4_ASHGO/246-317----------------------------------------------------PE.H.A.....D.S------L-------
Q4J9M3_SULAC/59-124----------------------------------------------------GE.K.A.....F.E------L-------
A5Z7X2_9FIRM/181-249----------------------------------------------------GE.R.F.....N.E------L-------
A7RJ81_NEMVE/252-323----------------------------------------------------PE.H.A.....D.S------L-------
A1ZKD2_9BACT/150-213----------------------------------------------------GE.R.A.....L.P------M-------
D3USW3_LISSS/171-233----------------------------------------------------GE.K.F.....S.S------V-------
Q5Y9F6_HYPJE/256-332----------------------------------------------------PE.H.T.....G.P------L-------
B3NYF5_DROER/233-304----------------------------------------------------PE.H.A.....D.S------F-------
A2FHI6_TRIVA/187-256----------------------------------------------------GE.R.S.....A.P------L-------
Q6BWW5_DEBHA/248-320----------------------------------------------------PE.H.A.....D.D------F-------
A7TJL8_VANPO/259-330----------------------------------------------------PE.H.A.....D.S------L-------
C4R1R0_PICPG/226-297----------------------------------------------------PE.H.S.....D.R------L-------
A9V6Y9_MONBE/163-242----------------------------------------------------GD.A.S.....G.T------L-------
GANAB_DICDI/262-337----------------------------------------------------PE.H.T.....T.R------L-------
D3RQI5_ALLVD/150-218----------------------------------------------------GQ.R.D.....G.R------L-------
Q9U3F8_CAEEL/211-283----------------------------------------------------PE.H.A.....D.A------F-------
Q487N3_COLP3/169-232----------------------------------------------------GE.R.V.....L.G------M-------
A6RYW1_BOTFB/264-340----------------------------------------------------PE.H.A.....G.P------L-------
Q6CFI8_YARLI/231-308----------------------------------------------------PE.H.A.....D.R------L-------
C5MGP0_CANTT/228-299----------------------------------------------------PE.H.S.....D.S------L-------
B6K3T9_SCHJY/251-327----------------------------------------------------PE.H.A.....S.T------L-------
Q9FN05_ARATH/223-300----------------------------------------------------PE.H.A.....T.S------F-------
D3HXG1_9BACT/143-212----------------------------------------------------GE.R.M.....D.N------L-------
A8QEK6_BRUMA/217-288----------------------------------------------------PE.H.A.....D.S------F-------
D0MFY9_RHOM4/221-282----------------------------------------------------GE.S.F.....T.R------F-------
C7ZHM8_NECH7/140-208----------------------------------------------------GE.H.S.....D.S------F-------
A3LZG4_PICST/248-320----------------------------------------------------PE.H.A.....D.S------L-------
Q6CKL7_KLULA/243-314----------------------------------------------------AE.H.A.....D.S------L-------
A5DFX8_PICGU/236-308----------------------------------------------------PE.H.A.....D.S------M-------
Q5A4X3_CANAL/227-298----------------------------------------------------PE.H.A.....D.S------L-------
B0WQR7_CULQU/142-215----------------------------------------------------PE.H.A.....D.D------F-------
A5E255_LODEL/247-318----------------------------------------------------PE.H.A.....D.S------L-------
Q1AY53_RUBXD/205-266----------------------------------------------------GE.S.F.....T.R------L-------
Q48999_MYCCA/174-236----------------------------------------------------GE.K.F.....R.P------L-------
GLU2A_SCHPO/243-319----------------------------------------------------PE.H.T.....S.S------L-------
C5E2N2_LACTC/252-323----------------------------------------------------PE.H.A.....D.S------L-------
D1PU92_9BACT/147-201----------------------------------------------------GQLR.D.....T.A------M-------
C5E407_ZYGRC/242-313----------------------------------------------------PE.H.P.....A.S------F-------
GLU2A_YEAST/268-337----------------------------------------------------PE.H.A.....T.S------L-------
D2PSG3_KRIFD/287-350----------------------------------------------------GE.R.Y.....D.A------L-------
B3PEE6_CELJU/151-214----------------------------------------------------GQ.R.I.....L.G------M-------
A2EWL0_TRIVA/183-259----------------------------------------------------PA.H.T.....F.P------I-------
D4A7G5_RAT/221-292----------------------------------------------------PQ.H.A.....E.S------H-------
A2DTY0_TRIVA/174-243----------------------------------------------------PA.H.T.....L.P------L-------
Q6F1E9_MESFL/174-236----------------------------------------------------GE.K.F.....N.N------F-------
D0NID9_PHYIT/299-382----------------------------------------------------PE.H.A.....T.D------F-------
B9HF49_POPTR/234-312----------------------------------------------------PE.H.A.....T.S------L-------
A9SRV0_PHYPA/216-292----------------------------------------------------PE.R.A.....T.S------F-------
Q15TD3_PSEA6/166-229----------------------------------------------------GE.R.I.....V.G------M-------
Q18IX5_HALWD/161-222----------------------------------------------------GE.Q.F.....T.T------F-------
D3KJT1_LISMN/468-529----------------------------------------------------GE.R.Y.....N.A------L-------
A9JRL0_XENTR/224-295----------------------------------------------------PE.H.A.....D.T------H-------
Q6BD67_ARTGO/298-361----------------------------------------------------GE.R.Y.....D.R------L-------
A8MA12_CALMQ/134-195----------------------------------------------------GE.W.F.....G.R------L-------
C9Z9B8_STRSW/173-240----------------------------------------------------GG.R.A.....A.G------P-------
A2FHS3_TRIVA/198-269----------------------------------------------------AS.H.T.....L.P------L-------
A5KR97_9FIRM/177-236----------------------------------------------------GT.Q.N.....G.R------F-------
A2FSM7_TRIVA/200-271----------------------------------------------------PQ.H.T.....L.P------L-------
D2VG87_NAEGR/204-281----------------------------------------------------PE.R.A.....M.R------L-------
A2DNT4_TRIVA/201-270----------------------------------------------------PA.H.T.....L.P------L-------
A2FNG9_TRIVA/199-270----------------------------------------------------AH.H.T.....L.N------L-------
Q10VX8_TRIEI/195-274----------------------------------------------------GE.Q.G.....GTK------L-------
F2GBK6_ALTMD/160-223----------------------------------------------------GQ.R.V.....L.G------M-------
B7B7D0_9PORP/181-237----------------------------------------------------GS.T.S.....RDH------I-------
D1W1N7_9BACT/179-238----------------------------------------------------GV.Q.N.....G.R------F-------
A1ZWA9_9BACT/116-179----------------------------------------------------GS.R.G.....M.Q------M-------
B8P1A4_POSPM/248-324----------------------------------------------------PQ.H.A.....T.R------L-------
B5U8Z1_HORVU/222-299----------------------------------------------------PE.H.G....ST.E------L-------
Q9AQR9_BACTQ/128-190----------------------------------------------------GE.S.DLNQDDV.R------L-------
A8UJG1_9FLAO/155-218----------------------------------------------------GS.R.A.....L.G------M-------
A1S1W2_SHEAM/165-224----------------------------------------------------GQ.Q.N.....G.A------F-------
A5Z7X1_9FIRM/366-435----------------------------------------------------GE.R.Y.....N.H------F-------
A4C4Y4_9GAMM/153-212----------------------------------------------------GQ.Q.N.....G.S------I-------
A5ZES3_9BACE/177-236----------------------------------------------------GV.Q.N.....G.R------F-------
D5VEX6_CAUST/152-206----------------------------------------------------GQ.HQA.....G.Q------L-------
A3TII1_9MICO/151-210----------------------------------------------------GM.Q.N.....G.R------F-------
Q04CH5_LACDB/137-196----------------------------------------------------GV.Q.N.....G.H------F-------
A9WV97_RENSM/183-242----------------------------------------------------GM.Q.N.....G.R------S-------
D2YKF2_VIBMI/210-268----------------------------------------------------GQ.Q.N.....G.E------F-------
A2DUN2_TRIVA/184-245----------------------------------------------------HE.S.T.....S.S------L-------
C4VK70_9LACO/135-194----------------------------------------------------GL.Q.G.....G.H------F-------
C2EQ16_9LACO/137-196----------------------------------------------------GM.Q.N.....G.Y------F-------
A2TWU9_9FLAO/156-219----------------------------------------------------GA.R.A.....L.G------M-------

PF04349

OPGD_XYLFA/46-531----------------------------------------------------LE-RLSWDQYQSIR------Y-------
OPGG_PSEAE/36-523----------------------------------------------------FS-EMKFADYQQIR------F-------
OPGG_ECOLI/23-509----------------------------------------------------FR-DMKYADYQQIQ------F-------
OPGG_VIBCH/72-545----------------------------------------------------LA-NISYDEYRDIR------F-------

PF02278

HYSA_STRPN/656-924----------------------------------------------------GL-SLF-----SSR------T-------
CSLA_PEDHD/336-592----------------------------------------------------NV-RMV-----SKR------T-------
O86516_STRCO/402-656----------------------------------------------------GL-AMA-----SDR------I-------
HYSA_STAA8/435-699----------------------------------------------------GL-SMT-----SKN------V-------
HYSA_STRA3/617-905----------------------------------------------------AL-SLH-----SKR------T-------

PF03636

TREPP_LACLA/7-254----------------------------------------------------GN-GYL-----GLR........GA...P
Q97FP3_CLOAB/11-268----------------------------------------------------GN-GYM-----GQR........GN....
YVDK_BACSU/13-265----------------------------------------------------AN-GYM-----GVR........GN....
Q98PT5_MYCPU/12-257----------------------------------------------------GN-GYL-----GIR........AV....
TREA_EMENI/63-338----------------------------------------------------AN-GYI-----GIS........VSSVGP
ATH1_YEAST/132-415----------------------------------------------------AN-GYI-----GSRIPNIGFGYAL....
Y2006_MYCTU/536-795----------------------------------------------------GN-GYL-----GSR........GC....
Q9CF04_LACLA/14-266----------------------------------------------------GN-GYM-----GMR........GN....
Y3401_MYCTU/13-273----------------------------------------------------SN-GHI-----GLR........GN....
Q9L2I8_STRCO/13-273----------------------------------------------------SN-GHV-----GWR........GN....
O87772_LACSN/11-262----------------------------------------------------GN-EYM-----GMR........GM....
Q9RJM8_STRCO/7-260----------------------------------------------------GN-GYF-----ATR........GA....
YCJT_ECOLI/6-241----------------------------------------------------GN-GYL-----GLR........AS....
Q9K109_NEIMB/12-263----------------------------------------------------GN-GYM-----GMR........GS....

PF14498

B2WJV6_PYRTR/24-282----------------------------------------------------GN-GRL-----GAM------PVGP----
A6S6Y6_BOTFB/24-271----------------------------------------------------GN-GQL-----AAL------PFGT----
AFCA_ASPOR/18-260----------------------------------------------------GN-GKL-----GVM------PFGE----
C7ZMG8_NECH7/26-278----------------------------------------------------GN-GIL-----AGT------HFGD----
AFCA_ASPNC/23-266----------------------------------------------------GN-GRL-----GAM------PIGS----
D8QJY6_SCHCM/33-288----------------------------------------------------GN-GYI-----AAM------TPGG----
Q01VL7_SOLUE/25-216----------------------------------------------------GN-GRL-----GAM------IFGD----
F0BR50_9XANT/10-221----------------------------------------------------GN-GRL-----GAL------CGGA----
C7QDB1_CATAD/65-277----------------------------------------------------GN-GRL-----GAM------VTGD----
D6XC25_9ACTO/46-251----------------------------------------------------GN-GRL-----GAL------VSND----
F2LID8_BURGS/67-272----------------------------------------------------GN-GRL-----GAL------TGGS----
A5FLW5_FLAJ1/30-276----------------------------------------------------GN-GKM-----GST------VFGG----
B5D3Z6_9BACE/34-284----------------------------------------------------GN-GTM-----GAI------LYGG----
D3IM15_9BACT/27-264----------------------------------------------------GN-GKL-----GAM------VDGN----
D1W5Z9_9BACT/26-258----------------------------------------------------GN-GRM-----GAL------VYGG----
D7GFE8_PROFC/6-264----------------------------------------------------GN-GNL-----GVA------VHGA----
D7CDJ0_STRBB/6-250----------------------------------------------------GN-GSL-----GGT------LRGA----
Q5WIX9_BACSK/3-249----------------------------------------------------GN-GRI-----GAM------VYGG----
A6WFR5_KINRD/6-266----------------------------------------------------GD-GRL-----GAV------CWGL----
B8HAG7_ARTCA/2-255----------------------------------------------------GN-GLA-----GAT------LRGL----
F0M2S8_ARTPP/7-280----------------------------------------------------GN-GRH-----GAM------VFGG----
D4BRP0_BIFBR/3-260----------------------------------------------------GN-GRM-----GAV------LCSE----
C7QZB0_JONDD/21-283----------------------------------------------------GN-GIL-----GVM------DGAH----
Q02BM3_SOLUE/32-244----------------------------------------------------GN-GRM-----GSL------VWTT----
C6VSI5_DYAFD/35-265----------------------------------------------------GN-GTI-----GAL------IWER----
B6FP44_9CLOT/51-330----------------------------------------------------GN-SYM-----GAN------IYGE----
D7FKT5_ECTSI/258-515----------------------------------------------------GN-GYL-----GAM------LGMG----
E0RPS6_SPITD/10-238----------------------------------------------------GN-GRL-----AAL------VVGG----
A6DKE0_9BACT/176-440----------------------------------------------------GS-GRL-----GGM------VYGD----
C0E8Z7_9CLOT/53-300----------------------------------------------------GN-GYI-----GIM------VFGN----
B3C6V9_9BACE/31-273----------------------------------------------------GN-GKM-----GIM------VFGN----
E8S9D0_MICSL/6-236----------------------------------------------------GN-GEL-----GLM------VHGR----
D0MK80_RHOM4/42-285----------------------------------------------------GN-GTL-----GIL------VYGD----
E4VX39_BACFG/35-292----------------------------------------------------GN-GSH-----GTM------VMGQ----
A5ZUG0_9FIRM/11-261----------------------------------------------------GN-GSM-----GAM------SYGR----
F2NU83_TRES6/4-265----------------------------------------------------GN-GRI-----GAT------VFGG----
E2NCL7_9BACE/27-265----------------------------------------------------GN-GRI-----GGM------IFGD----
B8I0M2_CLOCE/55-303----------------------------------------------------GN-GRI-----GAM------VYGN----
C9RS46_FIBSS/37-265----------------------------------------------------GN-GYM-----GGL------IYGG----
E2NAE9_9BACE/9-245----------------------------------------------------GN-SRL-----GAM------VYGG----
C7PTZ7_CHIPD/24-262----------------------------------------------------GN-GRI-----AGM------VFGN----
E4RWC6_LEAB4/23-260----------------------------------------------------GN-GFI-----GGM------VYGN----
D1P8P0_9BACT/350-623----------------------------------------------------GN-GRL-----GVM------HSGS----
C6CWA7_PAESJ/6-246----------------------------------------------------GN-GQL-----GAV------LHGG----
C6IY46_9BACL/13-267----------------------------------------------------GN-GRI-----GAI------VMAA----
B8MP90_TALSN/6-252----------------------------------------------------GN-GHM-----GAV------IISQ----
Q8A300_BACTN/31-269----------------------------------------------------GN-GRL-----GVM------IYGG----
E4RVZ2_LEAB4/23-266----------------------------------------------------GN-GRL-----GAM------VFGQ----
D7VKY5_9SPHI/30-275----------------------------------------------------GN-GLI-----GMM------PDGG----
B5JRH0_9BACT/30-280----------------------------------------------------GN-GRL-----GAS------FFGM----
B5CXD0_9BACE/30-289----------------------------------------------------GN-GSL-----GAV------VFGD----
A6DGK8_9BACT/29-270----------------------------------------------------GN-GRL-----GAM------VFGD----
FUCO2_ARATH/54-310----------------------------------------------------GN-GRL-----GAT------IWGG----
E8RVA7_ASTEC/38-271----------------------------------------------------GN-GRL-----GAM------VYGG----
E4SEI2_CALK2/8-246----------------------------------------------------GN-GSL-----GAM------IYGG----
F0Z0W4_9CLOT/4-266----------------------------------------------------GN-GFL-----GAM------VFGR----
E9SFF2_RUMAL/7-242----------------------------------------------------GN-GRI-----GAM------VFSQ----
F2JRD2_CELLD/6-242----------------------------------------------------GN-GAL-----GGM------IFGG----
A6DLU8_9BACT/6-272----------------------------------------------------GN-GRL-----GAM------VFGD----
B6QLF5_PENMQ/5-248----------------------------------------------------GN-GRL-----GVM------VYGR----
Q0TY74_PHANO/26-269----------------------------------------------------GN-GRV-----AAA------AYGT----
Q0USM0_PHANO/26-249----------------------------------------------------GN-GRL-----GAV------IHGG----
B6GAH0_9ACTN/58-310----------------------------------------------------GN-GKT-----GAI------LFGQ----
D4M387_9FIRM/48-320----------------------------------------------------GN-GYM-----GSL------VFGG----
C0EAF8_9CLOT/47-316----------------------------------------------------GN-GYM-----GGM------VFGG----
B1V512_CLOPF/50-289----------------------------------------------------GN-GYM-----GGM------IFGS----
E5CAW4_9BACE/28-255----------------------------------------------------GN-GYM-----GAC------IFGR----
C0EIR9_9CLOT/49-264----------------------------------------------------GN-GYM-----GVN------LFGG----
C9LB61_RUMHA/43-318----------------------------------------------------GN-SFM-----GAN------VYGE----
E3ELM5_BIFBS/595-862----------------------------------------------------GN-GKI-----GGT------VWGE----
D4XX42_9MOLU/39-315----------------------------------------------------GN-GAL-----GAT------IFGH----
B6FR06_9CLOT/50-321----------------------------------------------------GN-GNL-----GNL------IFGG----
E7NUZ4_TREPH/40-298----------------------------------------------------GN-GFI-----GAS------IFGG----
D4JSM8_9FIRM/5-247----------------------------------------------------GN-GYM-----GAS------FFGG----
E7RS88_9BACT/30-233----------------------------------------------------GN-GQL-----GAM------IYGG----
D1W0X5_9BACT/196-406----------------------------------------------------GN-GQF-----GGC------VMGG----
A7LY00_BACOV/52-260----------------------------------------------------GN-GQL-----GAM------IFGG----
B3PBE3_CELJU/14-256----------------------------------------------------GN-GAM-----GAV------ISGG----
B5GF62_9ACTO/53-292----------------------------------------------------GN-GAL-----GAS------VFGT----
C6W772_DYAFD/35-280----------------------------------------------------GN-GHV-----GAM------FFGG----
D5ENS4_CORAD/28-273----------------------------------------------------GN-GSM-----GAM------VFGG----
A6DSI9_9BACT/28-279----------------------------------------------------GN-GKI-----GAM------VYGG----
C7MHU9_BRAFD/31-251----------------------------------------------------GN-GRV-----GAT------FWGD----
D3EK66_GEOS4/13-265----------------------------------------------------GN-GRL-----GAM------VFGG----
D9RTI1_PREMB/45-251----------------------------------------------------GN-GRL-----AAS------VFHG----
E6MT30_9BACT/33-341----------------------------------------------------GN-GSV-----GAN------IFGS----

PF06045

Q2RAX6_ORYSJ/1-220HRQ.....------------------------------------VMV-----DN-GIV-----QVT------LSNP----
A0SPK1_9POAL/1-190........------------------------------------VVV-----DN-GLV-----QVS------LSRP----
Q2RAX6_ORYSJ/1421-1585........------------------------------------.NC-----DN-QTV-----IVK------VNSS----
Q0J3T7_ORYSJ/14-224DRY.....------------------------------------VEI-----KN-GIF-----ELT------LSNP----
O04510_ARATH/1-189........------------------------------------...-----EN-RFL-----QLT------LSNP----
O04512_ARATH/1-264DRYTEMVQ------------------------------------VVM-----DN-GIL-----QVT------LSKP----
O04511_ARATH/1-213GNH.....------------------------------------VVM-----DN-GIA-----RVT------LSKP----
Q9STV1_ARATH/1-204ESH.....------------------------------------VVM-----GN-GKV-----KVT------ISKP----
Q9SZK3_ARATH/1-218SRHHGTRE------------------------------------VIV-----DN-GII-----RVS------FSNP----
Q6D915_ERWCT/1-203........------------------------------------TVL-----DN-GLL-----KVT------FGED----
RHIE_DICD3/1-202........------------------------------------STL-----DN-GLL-----KVR------FGAD----
Q6NKW8_ARATH/1-243LRRVGHDT------------------------------------VVV-----DN-GIV-----QVT------FSNP----
Q84W85_ARATH/1-244LKKVGDNQ------------------------------------VVV-----DN-GII-----DVT------FSSP----

PF07748

MA2A1_MOUSE/648-1144..LADYVLYNNDGLAENGI.............FHVKNMVDAGDAITI.....EN-PFL-----AIW------FDRS----
MA2A2_HUMAN/648-1146LPSSVRIYLHGRQLSVSRHE...........AFPLRVIDSGTSDFAL.....SN-RYM-----QVW------FSGL----
MA2B1_HUMAN/510-1001ARAPQPIPRR...............................SWSPALT...IEN-EHI-----RAT------FDPD----
MAN1_YEAST/670-1080............................................IVL.....AN-GKL-----KVI------ICKK----
Q97C94_THEVO/613-1007IKIRKIKGK...................................YII.....EN-KII-----KLI------INSV----
Q20829_CAEEL/478-945HFNNRKKFN.................................TNVEI.....QN-EYL-----IAG------FDSQ----
Q82MA7_STRAW/619-1014............................................VTVTGRVLDN-GLV-----RVE------VAED----
Q8XIN5_CLOPE/620-1040N...........................................VSLNEKEAEN-DFL-----RIK------FNEE----
Q826B6_STRAW/620-1000............................................YVM.....EN-GRL-----RVE------IDAH----
Q97UK5_SULSO/576-965NENNAE......................................YLV.....EN-KYF-----RVR------ISKS----
Q9KEQ8_BACHD/620-1036MLSQ........................................VNFEERRWET-PWY-----QLE------WNDE----
Q8MS44_DROME/481-1003NVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVV.....QT-SQV-----KLV------IDNK----
O97043_DROME/673-1242NIATIYCDDCTESQPASVSPPEEI...ESSPTSVFEARGKPAGDIQL.....EN-PHM-----RLL------FDEK----
Q7S1L0_NEUCR/663-1085DGVKLHKLSN................................GVFVL.....EN-KRL-----KVR------VEA.----
Q8IPB7_DROME/502-1074.........LDSTEGNTR...............SKALPKRTSSVTVI.....GN-SHI-----QLG------FDTN----
Q9X2G6_THEMA/610-1007SELRET......................................NIM.....EN-EFL-----RVH------VNDD----
Q8Y5P1_LISMO/621-1032SS..........................................FNYNNKQLET-PFY-----QIK------WNEV----
Q7NPH5_GLOVI/590-1007T...........................................TGL.....EN-AYL-----RVE------VDPR----
Q972Y1_SULTO/561-945KEFEDY......................................YQI.....EN-KFF-----VLK------LGKE----
Q7V4V0_PROMM/617-1007DGLPVRGVVQ...............................IQSLDQGGWRISN-GLL-----QAD------FGAE----
Q8G4Q0_BIFLO/651-1043............................................IIL.....DN-GRL-----RVR------IEAD----
O58565_PYRHO/375-852NIVEREKD....................................FIL.....EN-SYL-----RVT------VSKR----
Q9LFR0_ARATH/644-1166...ATPSKLKYASEFDPFPC...........PPPYSCSKLDNDVTEI.....RN-EHQ-----TLV------FDVK----
Q8Y9W8_LISMO/383-872EPTQSAATK..................................I........EN-EFY-----EIQ------LAAN----
Q9AJR6_BACGL/625-1043VKA.........................................FEWADGVLRT-PHY-----ELA------FDEA----
Q55528_SYNY3/615-1038QQLESFSQD...................................PIL.....NN-GLL-----KVE------ISLD----
O18497_SPOFR/601-1127CVIFCNNCEQYQKSNVF..................QIKKMMPGDIQL.....EN-AVL-----KLL------VNRN----
Q8SYY1_DROME/493-1012DITVNTQTEQSVNEEESNVKVPKRF..KKVHSLKTDLETLDDQETIV.....QN-SLI-----KLV------IDNN----
Q8A5X3_BACTN/693-1137GTITINNAS..................................I........EN-HFY-----KLQ------LNPD----
Q8LPJ3_ARATH/482-1007SSKSYVSNILKG............................EQSIINI.....GH-GHL-----KLS------FSTD----
MA2B2_PIG/460-989SQEAAATVPSTIQFGLKL...............RRQDGQVGRNLVPV.....KN-SCY-----TVF------LDKD----
Q8G4Q1_BIFLO/649-1036............................................VLL.....AN-GVL-----SVT------IEAD----
MA2C1_RAT/621-1032QQPVFVMQET...............................DGSVTL.....DN-GII-----RVR------LDPT----
Q92A00_LISIN/399-880KELTGD......................................LQL.....EN-QYL-----KVE------IAPN----
Q9FKW9_ARATH/497-1032NNHKHSSVMLSP............................MNNTTEI.....GP-GNL-----KMV------FSSD----
P94078_ARATH/487-1000LSASYVTSGSM..............................NQNVEV.....GQ-GNL-----KLR------YSEE----
Q9VLI0_DROME/480-978N........GVRVISQPK................ANAETYDDEETIV.....QT-SLI-----KLV------LDNK----
MAN2_DROME/616-1102..TSYASNLLLRKNPTSLPL............GQYPEDVKFGDPREISLRVGNG-..P-----TLA------FSE.----
Q8YYK0_NOSS1/608-1041SPTSLD......................................YVL.....EN-EHL-----RVI------VDPD----
Q8XM34_CLOPE/630-1018............................................LKVSENNLEN-GLV-----KVE------FNEN----
Q7U9I9_SYNPX/614-1003PRHPVSVVQ...................................VSPEIWRVSN-GLV-----EFE------CSPV----
MA2B2_MOUSE/487-1013TRELVAPRANTLKFSLKL...............RNQPSQEGKRLVPV.....MN-DCY-----ILL------FDQD----
Q8G4P9_BIFLO/645-1030............................................ATL.....DN-GLL-----CVH------VAAD----
Q8DM33_THEEB/592-1021PTPPLG......................................YVL.....EN-NYL-----HVE------IDPA----
MAN1_SCHPO/664-1074N...........................................FIL.....VN-DHL-----RVT------IAPN----

PF01263

GAL10_KLULA/363-684--N---G.....CS-V-----------VASLDN...ETEY----------------------------------------
LACXC_LACLL/1-281--K---D....GLE-Y-----------LWQADP.....EY----------------------------------------
Q9LY79_ARATH/87-360--E---RRE....K-L-----------LYMSTKA......----------------------------------------
Q9KQJ7_VIBCH/25-292--K---G....QAD-L-----------LWMSSQ.......----------------------------------------
Q9RP27_HAEIF/22-269--Q---NAKQ...D-V-----------LWLSEVE......----------------------------------------
Q9VRU1_DROME/25-359--P---DASGQIDD-V-----------TLGFDD...LAGY----------------------------------------
Q9RDN0_STRCO/33-363--P---DRRGRYAN-V-----------SLGFDN...LDDY----------------------------------------
P73504_SYNY3/14-276--Q---G.....QP-I-----------LYFDRE.......----------------------------------------
Q986V3_RHILO/14-303--W---R.NGAALD-W-----------LRPADPG...AIR----------------------------------------
Q9SVZ5_ARATH/40-321--E---NGE....E-L-----------LVMSSKA......----------------------------------------
YEAD_ECOLI/27-288--A---G.EE...E-V-----------LWLSNN.......----------------------------------------
Q9CMU5_PASMU/26-273--K---GSAH...D-V-----------LWLSEIE......----------------------------------------
Q9SUQ4_ARATH/25-301--D---KGD....E-L-----------LFNSTKA......----------------------------------------
Q9VKF7_DROME/25-355--P---DGSKKVED-V-----------CLGFDD...IAGY----------------------------------------
Q9VP02_DROME/25-355--P---DAYKKVDD-V-----------CLGFDD...IASY----------------------------------------
GALM_BACSU/14-319--K---T...TNVQ-L-----------LREPET...AESF----------------------------------------
YIHR_ECOLI/19-304--Q---GCHLVIPH-K-----------PEEMPL.....AH----------------------------------------
Q9K995_BACHD/17-344--P---DRHGNLEN-I-----------VLGFDR...MDDY----------------------------------------
Q97L65_CLOAB/18-336--T---N...KGVT-I-----------LRTPKKDLKFEDF----------------------------------------
Q9HJQ6_THEAC/19-286--D---G.LDILLH-S-----------YDGSP......TH----------------------------------------
Q986G3_RHILO/15-295--L---RPGRAPTP-V-----------LEPSRG......L----------------------------------------
GALM_SHIFL/16-342--P---LSDGSVRE-A-----------LLGCAS...PECY----------------------------------------
Q9CF52_LACLA/4-275--N---K...NKFD-F-----------IWNGSE..WP...----------------------------------------
Q9A8D6_CAUCR/39-373--P---GRDGEKAD-I-----------ALGFAD...AAGY----------------------------------------
GALM_HAEIN/16-338--P---VND.TLRE-V-----------LLGCK....VDNY----------------------------------------
Q97A31_THEVO/1-267--N---G.TAILLE-R-----------YDDSP......TH----------------------------------------
Q9M6D7_CHLRE/53-318--P---SGD....E-V-----------LYVRPDA......----------------------------------------
GALM_STRTR/17-342--P---METGALKN-I-----------VLGFSD...FEDY----------------------------------------
Q9RDP4_STRCO/15-319--P---DRDGHTAD-V-----------VLGFAD...LDGY----------------------------------------
Q9ZB17_9LACT/13-335--D---G.....KH-L-----------ILGFDS...AKEY----------------------------------------
GAL10_SCHPO/369-689--K---G.....RN-L-----------VNGFND...FSRY----------------------------------------
Q99RT5_STAAM/13-331--H---D.....NN-I-----------VLGNVVE..ADEF----------------------------------------
Q9KRP2_VIBCH/20-347--P---MGD.ESRE-V-----------LLGVSS...MDDF----------------------------------------
Q9L7R7_SALTM/6-278--H---GRHVVIPH-K-----------PEEIPM.....AH----------------------------------------
AAPC_CENCI/34-310--D---NGE....E-L-----------LFLSSKA......----------------------------------------
YH10_YEAST/11-338--N---.....NES-I-----------VLGYPD...IHGY----------------------------------------
Q97T84_STRPN/18-341--P---DKAGNFAN-V-----------ILGFDD...FDSY----------------------------------------
Q9CN43_PASMU/23-271--K---SEQQ...D-I-----------LWLSPIE......----------------------------------------
Q9A381_CAUCR/1-279--D---G.....RE-V-----------LRPTAP..QVDDA----------------------------------------
O94124_RHIST/13-358--P---DRTGTVRD-V-----------MIGFDD...FESY----------------------------------------
Q9LVH6_ARATH/10-338--P---DKNGKLGD-V-----------VLGFDS...VDPY----------------------------------------
Q9M308_ARATH/24-299--E---LGE....E-L-----------LFTSNKA......----------------------------------------
P94168_ACTPL/2-319--K---HPK.GERE-V-----------LVTTS....AENW----------------------------------------
Q9FJY6_ARATH/46-305--A---SGK....D-L-----------LFVRPDA......----------------------------------------
Q98MW4_RHILO/4-274--G---Q....GSE-F-----------LWQAGP.....EW----------------------------------------
Q9HZ52_PSEAE/28-281--Q---G....ERP-L-----------LWCASE.......----------------------------------------
Q9PB74_XYLFA/16-284--S---G....GEE-V-----------IWLSPL.......----------------------------------------
O48971_TOBAC/28-351--P---DKHGKIGD-V-----------VLGYDT...IEEY----------------------------------------
Q97JD7_CLOAB/16-338--L---DKNKKPVN-V-----------LLEFDK...SDYY----------------------------------------
Q9HTE2_PSEAE/30-311--H---E....QPP-L-----------VWLSDE.......----------------------------------------
Q9LVC5_ARATH/18-294--E---NGE....E-L-----------LHLSSKA......----------------------------------------
Q05765_SACPS/73-396--N---.....GQS-V-----------VLGYEN...EEGY----------------------------------------
GALM_PIG/20-338--K---DRQGRASD-V-----------VLGFAE...LKEY----------------------------------------
Q9CM12_PASMU/17-340--P---VQN.QLRE-V-----------LLGCQ....LEDY----------------------------------------
GAL10_PACTA/363-685--N---G.....IK-L-----------NLGFDN...LKGY----------------------------------------
YN9A_YEAST/11-339--N---.....GQS-V-----------VQGYSN...VQDY----------------------------------------
Q9V3D1_DROME/12-282--N---N.....QE-Q-----------LFVSKL.......----------------------------------------
Q9WYB8_THEMA/23-351--P---DSSGTLSD-V-----------VLGFDT...LQEY----------------------------------------
YPHB_ECOLI/2-286--D---T.....TP-L-----------LRPGKK....SGV----------------------------------------
Q9CFG9_LACLA/19-330--P---DKNGTFEN-I-----------LLSKND...SETY----------------------------------------
Q9VY83_DROME/24-362--P---DAYHQLSD-V-----------VLGFDD...VAGY----------------------------------------
Q9STT3_ARATH/32-354--P---DRHGKQDD-V-----------VLGFDT...VDGY----------------------------------------
GALM_ACICA/38-376--P---DAQGKQNN-I-----------VLGFDD...LKGY----------------------------------------
Q97ES5_CLOAB/1-281--K---N...TDNE-Y-----------IWTANS.....SY----------------------------------------
Q9LXG7_ARATH/161-485--P---DKNGKMDD-I-----------VLGYDS...VKTY----------------------------------------
YMY9_YEAST/9-287--K---S.....EE-Q-----------LWLSTA.......----------------------------------------

PF14486

C8TCN7_KLEPR/63-369--F...G-----SR.M-----------GWDSPV.KEVVNP----------------------------------------
Q6CYX0_ERWCT/66-372--K...N-----IR.L-----------GWDSPV.DEVVNP----------------------------------------
D8MS65_ERWBE/63-369--H...G-----VR.L-----------GWDSPV.NEVVNP----------------------------------------
D4E903_SEROD/84-389--S...G-----VR.L-----------GWDSPV.TEVVNP----------------------------------------
C4UXP6_YERRO/63-368--N...N-----VR.L-----------GWDSPV.KEVVNP----------------------------------------
A4VGA8_PSEU5/62-367--G...D-----VR.L-----------GWDSPV.QEVVNP----------------------------------------
Q4ZR72_PSEU2/63-368--G...D-----VR.M-----------GWDSPV.KDVVNP----------------------------------------
A4SJ08_AERS4/64-370--A...D-----LR.L-----------GWDSPV.KEVVNP----------------------------------------
E7S0H9_9BURK/63-369--G...D-----VR.L-----------GWHSPV.KEVVNP----------------------------------------
C1DDL0_AZOVD/63-368--G...D-----VR.L-----------GWDSPV.AEVVNP----------------------------------------
E1JSY6_DESFR/65-370--G...G-----IR.F-----------GWKSPV.DEIVNP----------------------------------------
A6VRI9_MARMS/45-355--K...E-----VR.F-----------GWDSPV.KEVVHP----------------------------------------
B2STA4_XANOP/63-368--G...S-----VR.L-----------GWDSPV.SEVVNP----------------------------------------
B5JRI2_9BACT/46-358--G...E-----IA.L-----------GWDSPV.KAPVHP----------------------------------------
A6DJS3_9BACT/68-374--K...D-----IT.L-----------GWDSPV.KEIVHP----------------------------------------
E8TDX5_MESCW/37-354--K...G-----QA.I-----------GWHSPS.G.FRHP----------------------------------------
E7U952_ECOLX/28-330--K...D-----TA.L-----------SFITPN.G.VVAP----------------------------------------
A6CCQ6_9PLAN/48-358--Q...G-----TP.L-----------GWESPV.KSPVNP----------------------------------------
A3U233_9RHOB/60-376--N...G-----RA.I-----------GWHSPA.G.FRHP----------------------------------------
E7S0S6_9BURK/68-374--G...K-----VR.L-----------GWKSPV.HEIVNP----------------------------------------
A3ZMH7_9PLAN/47-353--D...G-----ER.V-----------GWNSPV.PGPVHP----------------------------------------
B2IFZ2_BEII9/79-384--G...D-----IR.L-----------GWDSPV.KEIVNP----------------------------------------
F2AXT9_RHOBT/49-355--D...G-----IR.F-----------GWHSPV.NGPVHP----------------------------------------
C6XPV1_HIRBI/37-353--N...G-----RA.I-----------GWNSPS.G.FRNP----------------------------------------
D2R5D2_PIRSD/48-359--STPSG-----VAIF-----------GWESPV.RGPVHP----------------------------------------
Q2CC41_9RHOB/37-353--K...G-----RS.I-----------GWHAPT.G.FRAP----------------------------------------
Q1AYM2_RUBXD/37-346--G...G-----RS.L-----------CWLSGV.G.TSGP----------------------------------------
E8R531_ISOPI/45-351--G...D-----FE.L-----------QWRSPIIDGPIHP----------------------------------------
D1CHA6_THET1/37-338--A...G-----RP.L-----------AWLHPA...LGGP----------------------------------------
D5SWV3_PLAL2/49-356--S...G-----FP.L-----------QWNSPV.SRPVHP----------------------------------------
D6ZVF2_BIFLJ/35-343--R...G-----EN.L-----------TFLSKP.G.LNGR----------------------------------------
A4FGH2_SACEN/53-349--R...G-----VP.L-----------AWISPA.G.HVGP----------------------------------------
F0SP29_PLABD/45-353--G...E-----TR.V-----------GWDAPA.ERPVHP----------------------------------------
C6W7A5_DYAFD/39-348--N...Q-----HS.L-----------AWISHG.G.VTSP----------------------------------------
C5EMT3_9FIRM/31-332--K...G-----MN.M-----------SFMAKP.G.LMGR----------------------------------------
C6JDQ2_9FIRM/29-333--K...G-----YN.I-----------SFLSKP.G.LTGR----------------------------------------
C5EVY1_9FIRM/58-359--K...G-----NN.L-----------NFLSKP.G.LQNR----------------------------------------
D2QJ04_SPILD/29-338--N...Q-----HS.L-----------AWLSHT.G.ITPP----------------------------------------
A3HYW8_9BACT/35-344--N...E-----SS.L-----------SWISHA.G.VFAP----------------------------------------
D9RZ46_THEOJ/37-341--R...G-----VN.L-----------AYITKN.G.IVAP----------------------------------------
B6G216_9FIRM/38-339--N...S-----IP.I-----------SYQGYN.RE.VHP----------------------------------------
E5VLF0_9FIRM/26-323--D...G-----KN.L-----------SYTSVV.G.NVAP----------------------------------------
E4HSQ4_PROAA/36-345--D...G-----QS.L-----------RMDNMF.D.MPVP----------------------------------------
A4AFA2_9ACTN/35-332--D...G-----IP.I-----------AWISPT.E.ITAP----------------------------------------
A5ZM38_9FIRM/24-319--K...G-----IN.M-----------SYFSPC.G.YVAP----------------------------------------
D1N8M9_9BACT/32-325--R...G-----IP.L-----------VFRAPA.G.YVSG----------------------------------------
F2PD67_PHOMO/32-333--L...G-----TD.L-----------CMKNMF.S...EP----------------------------------------
A7VPY4_9CLOT/30-334--R...G-----VP.V-----------SYLAKP.G.VASP----------------------------------------
A7VTY4_9CLOT/24-319--E...G-----VN.Y-----------SYISPS.G.YVAP----------------------------------------
C0W0W1_9ACTO/33-337--D...G-----RD.L-----------RMTNMF.S...QP----------------------------------------
D7GQT9_9FIRM/30-326--K...G-----IN.L-----------SLLTKP.G.LQGR----------------------------------------
B3W843_LACCB/26-319--H...G-----TN.V-----------SFMSST.G.LVNS----------------------------------------
D4M7N6_9BACT/32-333--R...G-----VN.V-----------NYMTKN.G.YDAP----------------------------------------
E7NWQ8_TREPH/35-339--K...G-----IN.L-----------AFYYKN.R.MVAP----------------------------------------
B5QP71_LACRH/26-319--H...G-----VN.I-----------AFMSAT.G.LVNS----------------------------------------
C2K0S4_LACRH/29-322--H...G-----TN.I-----------SFVSVT.G.FVNS----------------------------------------
E7GTM1_CLOSY/30-326--K...G-----LN.M-----------SFLSKP.G.LQGR----------------------------------------
E1JKF2_9LACO/27-315--D...G-----KN.V-----------SFLSHT.G.LVNS----------------------------------------
D2S5J5_GEOOG/37-338--R...G-----IP.L-----------GWRGPR.GRASAT----------------------------------------
B2Z3U5_AGRRK/36-329--R...G-----TN.V-----------GWHSPT.Q.MVFP----------------------------------------
C5C3Q0_BEUC1/37-320--A...G-----QP.I-----------SWTAAP.G.PRSR----------------------------------------
C8XH26_NAKMY/26-324--S...G-----WP.L-----------AWVSPV.AD.ARP----------------------------------------
A6UBC7_SINMW/28-308--D...G-----VD.L-----------SPRAAI......P----------------------------------------

PF14849

YIDC_BURCH/79-353-.K---..KQ..GD-G...........KQPD.....L..Y.---------------------------------------
YIDC_AERHH/67-347-.L---..AH.KLE-E...........GKDQ........P.---------------------------------------
YIDC_SHESA/67-342-.V---..SH.KLE-Q...........GKDQ........P.---------------------------------------
YIDC_MAGSM/86-360-.L---..QH.TDV-L...........GGKP.....I..S.---------------------------------------
YIDC_SYNFM/76-350-.K---..KH.RKA-V...........QPDS.....P..P.---------------------------------------
A0M3I9_GRAFK/92-360-.K---..NF....-............KTYD.....SI.P.---------------------------------------
A0NSE7_9RHOB/91-371-.K---..DY.HET-V...........NKSS.....P..T.---------------------------------------
YIDC_FRATN/81-354-.K---..DY.SIS-L...........DDKT........P.---------------------------------------
A0RNG0_CAMFF/78-324-ES---..KFKDEN-D.............KQ..........---------------------------------------
A0Y4R8_9GAMM/71-343-.L---..QY.EEV-K...........GEET........P.---------------------------------------
A0Y965_9GAMM/94-374-.P---..KH.YAK-L...........DTPE.....I..P.---------------------------------------
YIDC_ECOK1/60-343-.P---..AY.PKE-L...........NSTQ........P.---------------------------------------
YIDC_PELPD/70-338-.K---..NY.REK-N...........LPDA.....Q..A.---------------------------------------
YIDC_CHLPD/72-345-.K---..QH....-............LDGH.....LK.Q.---------------------------------------
A1ESE5_VIBCL/35-310-.N---..QY.SEE-L...........NSPE........S.---------------------------------------
A1JT86_YERE8/60-342-.L---..AY.PDA-L...........GSDK........T.---------------------------------------
A1KCP9_AZOSB/62-337-.E---..KH..RA-T...........TDRS.....R..G.---------------------------------------
YIDC_NEIMF/55-343-.L---..KY..KA-T...........GDEN.....K..P.---------------------------------------
YIDC_SHEAM/67-342-.L---..TH.KLE-Q...........NEEA........P.---------------------------------------
YIDC_PSYIN/82-356-.L---..QH.DAT-L...........DSDT........P.---------------------------------------
YIDC_MARAV/89-367-.L---..QY.DES-L...........DSEQ........P.---------------------------------------
A1UTM0_BARBK/88-378-.K---..KY.HLT-V...........DKTS.....P..Q.---------------------------------------
YIDC_DESVV/71-335-.S---..RY.HMG-I...........DRDA.....A..P.---------------------------------------
A1VUS5_POLNA/88-366-.N---..KY..KD-M...........THKD.....Q..G.---------------------------------------
A1VZU9_CAMJJ/78-325-DK---..KYQNEK-G.............EF..........---------------------------------------
A1WDB6_ACISJ/89-367-.L---..QY..PE-M...........EDKT.....K..P.---------------------------------------
A1WSU1_VEREI/90-364-.L---..EH..AD-M...........ADKT.....R..R.---------------------------------------
YIDC_HALHL/76-353-.L---..KH.QKA-S...........DDPT........P.---------------------------------------
A2SMI9_METPP/84-359-.L---..TQ..VD-Q...........NDRT.....R..N.---------------------------------------
A2TVU8_9FLAO/95-369-.L---..QH....-............STYD.....SI.P.---------------------------------------
A3EQG7_9BACT/54-314-.L---..HY....-............HHSS........DH---------------------------------------
A3HZF9_9BACT/83-351-.K---..EY....-............KSWT.....QE.P.---------------------------------------
A3J0Y5_9FLAO/92-366-.L---..GF....-............DQFE.....KN.SN---------------------------------------
A3JKS5_9ALTE/114-392-.L---..QY.DRE-L...........NGDE........P.---------------------------------------
A3JXJ6_9RHOB/79-358-.K---..DY.TVS-L...........DSD......E..I.---------------------------------------
A3M8Z0_ACIBT/26-325-.L---..SH.DKS-K...........DSNQ........P.---------------------------------------
YIDC_RHOS1/70-368-.K---..SY.HET-L...........DPQS.....Q..I.---------------------------------------
YIDC_SHELP/68-343-.V---..GH.KLE-Q...........DKEE........P.---------------------------------------
A3RT33_RALSL/84-353-.L---..TQKDHD-G....................N..P.---------------------------------------
A3S812_9RHOB/79-365-.K---..DY.NTT-I...........EDDA.....P..I.---------------------------------------
A3TU25_9RHOB/82-369-.K---..DY.LTS-L...........DADA.....T..R.---------------------------------------
A3UBQ3_CROAH/95-366-.K---..NF....-............KTYD.....SI.P.---------------------------------------
A3UFD6_9RHOB/80-359-.L---..RY.E.T-E...........VDSG.....V..P.---------------------------------------
A3V0A3_VIBSP/65-340-.N---..DY.SAE-F...........DSED........T.---------------------------------------
A3V4K5_9RHOB/73-362-.T---..DY.RET-L...........DEDA.....P..I.---------------------------------------
A3VF89_9RHOB/85-374-.S---..DY.RVS-L...........DKGS.....D..T.---------------------------------------
A3W4K6_9RHOB/74-363-.K---..NY.RET-I...........DPAS.....D..I.---------------------------------------
A3WNL1_9GAMM/79-352-.L---..EF.AAT-L...........DSEE........R.---------------------------------------
A3X1F9_9BRAD/81-371-.T---..KY.RET-V...........DPAS.....P..A.---------------------------------------
A3X407_9RHOB/76-363-.K---..DY.RIT-N...........DAPE........I.---------------------------------------
A3XGM2_LEEBM/97-368-.K---..NF....-............KSYD.....SV.P.---------------------------------------
A3YIB8_9GAMM/75-352-.P---..EY.KKA-Q...........ASNE........P.---------------------------------------
A4AW41_MARSH/92-364-.R---..NF....-............VTYD.....SV.P.---------------------------------------
A4BD89_9GAMM/80-356-.P---..EY.PYS-L...........ETPN.....I..P.---------------------------------------
A4BP05_9GAMM/69-343-.L---..KH.ATS-T...........DDPA........P.---------------------------------------
A4CDJ1_9GAMM/72-344-.I---..QY.PEK-Q...........HGDV........P.---------------------------------------
A4CNB4_ROBBH/96-366-.K---..QF....-............VNHD.....SL.P.---------------------------------------
A4EH88_9RHOB/73-362-.T---..NY.RET-I...........DEDA.....E..V.---------------------------------------
A4EPF1_9RHOB/75-363-.K---..DY.RET-L...........ADGS.....P..I.---------------------------------------
YIDC_HERAR/86-359-.L---..KH..HE-S...........GDES.....K..N.---------------------------------------
A4MW21_HAEIF/65-339-.L---..KY.DAE-L...........DSKT........P.---------------------------------------
YIDC_PROVI/72-345-.K---..KH....-............LDGA.....LQ.P.---------------------------------------
A4TZQ4_9PROT/78-357-.A---..GY.HET-A...........DPTS.....K..E.---------------------------------------
YIDC_PSEU5/82-358-.P---..QY.PRR-Q...........DRPD.....V..P.---------------------------------------
A4YLD0_BRASO/97-387-.V---..QY.RET-V...........DPNS.....P..A.---------------------------------------
A5EY44_DICNV/67-344-.L---..NY.AFT-I...........DNKS........P.---------------------------------------
A5FHA5_FLAJ1/97-371-.K---..EF....-............KKFE.....KN.SG---------------------------------------
YIDC_ACICJ/80-374-.T---..RY.HQT-V...........KKTS.....P..L.---------------------------------------
YIDC_GEOUR/67-335-.K---..RY.KET-S...........GPGG.....R..E.---------------------------------------
YIDC_LEGPC/74-351-.L---..DY.PLS-V...........EDKN.....K..P.---------------------------------------
A5PCQ5_9SPHN/75-347-.K---..DY.AAS-P...........DGDS.....E..P.---------------------------------------
A5VCE7_SPHWW/74-350-.K---..AY.RET-V...........AKNA.....P..P.---------------------------------------
A5VVS9_BRUO2/96-377-.K---..KY.HET-V...........SDKS.....P..E.---------------------------------------
YIDC_PSEP1/82-360-.P---..KY.PRR-Q...........DHPN.....I..P.---------------------------------------
A5WI37_PSYWF/86-362-.R---..DY.NAK-L...........HSDN........S.---------------------------------------
A5ZDH4_9BACE/85-357-.K---..EY....-............MAQD.....KKTP.---------------------------------------
A6D430_9VIBR/65-340-.N---..EY.ATE-L...........ESSE........P.---------------------------------------
A6DA77_9PROT/64-307-QN---..KFNTEK-G.............QH..........---------------------------------------
A6ESJ9_9BACT/103-373-.K---..EF....-............KTYD.....SI.P.---------------------------------------
A6EY90_9ALTE/92-370-.L---..QH.DRS-L...........DSEE........S.---------------------------------------
A6FI67_9GAMM/66-346-.L---..EH.ATE-L...........DAEE........R.---------------------------------------
A6FLS2_9RHOB/78-359-.K---..NY.RET-L...........EPGS.....D..T.---------------------------------------
A6G3S3_9DELT/89-365-.L---DDQF.RNR-E...........TNEG.....E..D.---------------------------------------
A6GL25_9BURK/86-359-.L---..NH..PA-A...........ENPD.....L..P.---------------------------------------
A6Q3D4_NITSB/79-325-EK---..KYKNES-G.............SQ..........---------------------------------------
A6QAL2_SULNB/79-326-EA---..KYKDAE-G.............HN..........---------------------------------------
YIDC_JANMA/85-357-.L---..TH..HE-S...........SDST.....K..D.---------------------------------------
YIDC_KLEP7/59-343-.L---..AY.PKT-L...........KSTE........P.---------------------------------------
YIDC_SINMW/85-365-.K---..GY.RET-V...........DPKS.....P..V.---------------------------------------
YIDC_ACTSZ/62-334-.L---..NY.AQE-L...........NGEE........R.---------------------------------------
YIDC_MARMS/79-356-.L---..QY.KKE-L...........GQPD........P.---------------------------------------
A7GYZ3_CAMC5/72-316-EK---..KYETAD-G.............NK..........---------------------------------------
YIDC_ANADF/73-347-.Q---..GE.KFR-R...........DREG.....K..P.---------------------------------------
A7HPT9_PARL1/93-373-.L---..KY.NVT-V...........DPES.....P..E.---------------------------------------
A7I143_CAMHC/78-324-ES---..KYKNDD-K.............MQ..........---------------------------------------
A7IGM3_XANP2/99-378-.T---..EY.HET-V...........DPKS.....P..N.---------------------------------------
A7JWZ0_PASHA/67-339-.L---..KH.NAE-L...........HSNT........P.---------------------------------------
YIDC_CROS8/60-344-.L---..AY.PKE-L...........GSSE........P.---------------------------------------
A7V5B9_BACUN/84-357-.K---..EY....-............MGQD.....KTTP.---------------------------------------
A7ZCY9_CAMC1/70-314-ED---..KYKTED-G.............NK..........---------------------------------------
A8EV97_ARCB4/88-333-EE---..KYKDEN-G.............AQ..........---------------------------------------
YIDC_RICM5/71-350-.K---..KY.KQD-L...........SKNS.....P..E.---------------------------------------
YIDC_SERP5/60-340-.L---..AY.PDT-L...........GSST........P.---------------------------------------
YIDC_SHEPA/71-346-.L---..SH.KLE-E...........KGDD........P.---------------------------------------
A8ILM2_AZOC5/88-369-.S---..QF.RET-V...........DPKS.....P..N.---------------------------------------
YIDC_DINSH/79-367-.R---..NY.NET-L...........EPDS.....P..I.---------------------------------------
A8PQB3_9COXI/66-338-.L---..HY.PQY-PN..........QPRS.....T..P.---------------------------------------
A8TUD8_9PROT/88-367-.T---..DY.RVT-I...........DPKS.....P..P.---------------------------------------
A8UPQ4_9FLAO/98-370-.K---..NF....-............VDYD.....SV.P.---------------------------------------
A8UV65_9AQUI/85-321-.E---..QF....-........................G.---------------------------------------
A8UZM0_9AQUI/104-350-.N---..QY....-........................N.---------------------------------------
A9C1M1_DELAS/86-361-.L---..KY..AD-S...........VHKD.....K..P.---------------------------------------
A9DU76_9RHOB/83-371-.N---..DY.QTT-L...........DENA.....E..V.---------------------------------------
A9EHP0_9RHOB/78-366-.K---..DY.RVS-L...........EEDA.....A..I.---------------------------------------
A9HKS4_GLUDA/56-342-.R---..DY.HET-V...........AKGS.....P..Q.---------------------------------------
YIDC_BORPD/87-362-.L---..KY..PT-S...........GQPN.....K..P.---------------------------------------
A9IXD9_BART1/90-380-.K---..KY.RVT-V...........DKKS.....P..E.---------------------------------------
YIDC_COXBN/80-358-.P---..KY.PVS-L...........EEKQ.....T..P.---------------------------------------
YIDC_METEP/92-379-.K---..NY.HET-V...........SDES.....P..R.---------------------------------------
B0QWJ2_HAEPR/71-343-.L---..KY.NAE-L...........DSNT........P.---------------------------------------
YIDC_XANCB/91-370-.L---..QF.PQT-K...........D.GT.....E..P.---------------------------------------
YIDC_CAUSK/79-389-.K---..RY.TQT-A...........DKNS.....P..P.---------------------------------------
YIDC_XYLFM/76-359-.L---..RF.PQS-K...........DRGA.....K..P.---------------------------------------
YIDC_HAES2/64-338-.L---..NY.DAE-L...........HSSA........P.---------------------------------------
B0VGK2_CLOAI/73-333-.H---..NFIMH.-............DSTK..........---------------------------------------
YIDC_METRJ/93-380-.K---..NY.HET-I...........DPKS.....P..E.---------------------------------------
YIDC_POLNS/81-360-.L---......KS-L...........TAEN.....K..P.---------------------------------------
B1Y0F7_LEPCP/82-364-.L---..KY..AD-P...........SSAS.....G..H.---------------------------------------
YIDC_BEII9/87-368-.K---..AY.RET-V...........AKDS.....P..N.---------------------------------------
B2PV42_PROST/59-343-.L---..AY.PAT-L...........HSES........P.---------------------------------------
YIDC_PORG3/88-364-.R---..DY....-............KTYD.....GK.P.---------------------------------------
B2URJ4_AKKM8/83-384-.H---........-..........................---------------------------------------
B2V9H4_SULSY/78-323-.N---..RY....-........................N.---------------------------------------
YIDC_ERWT9/60-343-.L---..TY.PDK-L...........GSDQ........P.---------------------------------------
YIDC_GEOLS/69-337-.K---..GF.RET-N...........KPGA.....A..Q.---------------------------------------
YIDC_CHLL2/73-345-.K---..NH....-............LDGQ.....LK.P.---------------------------------------
YIDC_CHLPB/77-350-.K---..KH....-............LNAN.....RE.R.---------------------------------------
YIDC_RHIE6/87-366-.K---..GY.HET-V...........DDSS.....P..I.---------------------------------------
B3QCI2_RHOPT/95-385-.M---..QY.RET-V...........DPKS.....P..P.---------------------------------------
YIDC_CHLP8/75-348-.K---..KH....-............LDVN.....GK.P.---------------------------------------
YIDC_CHLT3/79-354-.K---..DY....-............LNYK.....HE.P.---------------------------------------
YIDC_CUPTR/88-357-.L---..KEHEKD-G....................K..P.---------------------------------------
B4F0U1_PROMH/62-343-.L---..AY.PAE-L...........NSKT........P.---------------------------------------
YIDC_PHEZH/77-357-.D---..RF.RQT-V...........EKDS.....P..P.---------------------------------------
YIDC_PROA2/73-346-.K---..KH....-............LDSS.....RE.Q.---------------------------------------
YIDC_PELPB/72-345-.K---..KH....-............LDGN.....RL.P.---------------------------------------
B4U8V7_HYDS0/77-310-.K---..NF....-........................K.---------------------------------------
B4W6P1_9CAUL/77-360-.T---..DY.KET-Q...........DKPE.....P..V.---------------------------------------
B4X1P5_9GAMM/90-373-.P---..DY.PKH-I...........DTPD.....Q..P.---------------------------------------
YIDC_GEOBB/76-344-.K---..KY.KET-V...........GPQG.....K..D.---------------------------------------
B5EJI9_ACIF5/71-332-.R---..HY.PQA-V...........DDTA........P.---------------------------------------
B5FEU7_VIBFM/67-341-.N---..KY.DAE-L...........DSKA........K.---------------------------------------
B5J3A9_9RHOB/75-355-.K---..DY.RVT-L...........DSDA.....D..L.---------------------------------------
B5JPX1_9BACT/91-373-.K---..KH.RKA-L...........DSEE........N.---------------------------------------
B5JT26_9GAMM/80-355-.L---..QY.STE-L...........GEET........L.---------------------------------------
B5TVD7_9PAST/67-352-.L---..KH.HAE-L...........HSNT........P.---------------------------------------
B5WNV2_9BURK/79-353-.V---..KQ..GD-G...........KQPD.....L..V.---------------------------------------
B5YLC7_THEYD/75-318-.K---..KY....-............KDNS........G.---------------------------------------
B6AYD8_9RHOB/77-364-.K---..DY.RVS-L...........DDDA.....P..I.---------------------------------------
B6BRA8_9PROT/69-342-.K---..EY.NVA-L...........ESDE........K.---------------------------------------
B6BVS1_9PROT/64-333-.A---..NF.QND-N...........KD.......G..L.---------------------------------------
B6C620_9GAMM/76-350-.L---..NY.PVS-L.........K.KPNE........P.---------------------------------------
B6JJN8_OLICO/93-374-.V---..KY.RET-V...........DPKS.....P..A.---------------------------------------
B6R8Z5_9RHOB/90-370-.K---..GY.RQT-I...........AKDS.....E..T.---------------------------------------
B7X1D2_COMTE/87-361-.L---..KY..SD-T...........ADDK.....K..L.---------------------------------------
YIDC_DESVM/76-340-.T---..RY.RTA-I...........TAGA.....P..A.---------------------------------------
YIDC_METSB/81-364-.K---..GY.RET-V...........DPNS.....P..N.---------------------------------------
B8FMU7_DESAA/80-351-.K---..EY.WET-Q...........AKDS.....A..P.---------------------------------------
YIDC_THISH/78-359-.P---..TY.PVS-L.........R.TPDQ........P.---------------------------------------
YIDC_CAUCN/78-377-.R---..KY.DET-T...........KKDS.....P..P.---------------------------------------
B8J2U4_DESDA/74-342-.K---..KY.QVG-L...........AADS.....P..Q.---------------------------------------
B8KLJ5_9GAMM/111-388-.A---..KF.LAE-I...........DDPE.....T..P.---------------------------------------
B9D1D7_WOLRE/75-318-DE---..KYKNAD-G.............ER..........---------------------------------------
B9KFP9_CAMLR/73-319-DE---..KYKDEN-G.............KS..........---------------------------------------
B9KI96_ANAMF/142-427-.T---..KY.QVS-T...........DKHS.....E..N.---------------------------------------
B9L9D7_NAUPA/72-316-QT---..KFNTEN-G.............KH..........---------------------------------------
YIDC_GEOSF/69-337-.K---..HY.KDK-A...........GAVG.....R..D.---------------------------------------
B9NL98_9RHOB/75-368-.K---..DY.KVS-I...........EEGA.....P..I.---------------------------------------
B9R1R8_9RHOB/93-373-.K---..DY.HET-V...........DRSS.....P..T.---------------------------------------
B9XJP0_9BACT/84-382-.L---..HY....-.............PET..........---------------------------------------
B9Z8U5_9NEIS/66-349-.L---..KH..NA-A...........EDAS.....K..P.---------------------------------------
C0BJD0_9BACT/83-354-.D---..EF....-............ENYE.....DA.P.---------------------------------------
C0DYB8_EIKCO/59-347-.L---..KH..NS-A...........GDAS.....K..T.---------------------------------------
C0N352_9GAMM/79-352-.L---..EY.AVS-S.........E.QPDT........P.---------------------------------------
C0QIZ1_DESAH/83-349-.N---..AY.RET-S...........EKDS.....P..L.---------------------------------------
C1AEP7_GEMAT/82-361-.T---..RYQALS-N...........RGRT........KE---------------------------------------
YIDC_LARHH/64-349-.L---..TQ..GA-I...........DNPD.....K..P.---------------------------------------
C1DTT8_SULAA/77-322-.E---..KY....-........................N.---------------------------------------
C1F9G1_ACIC5/93-378-.K---..KYTNDA-..............QN.....R..P.---------------------------------------
C2M324_CAPGI/89-358-.K---..NQ....-............KTYN.....GK.P.---------------------------------------
C3X5V7_OXAFO/83-357-.L---..KY..PD-N...........VDPE.....K..D.---------------------------------------
C3XJR0_9HELI/78-326-EE---..KYHKDS-KP........................---------------------------------------
C4GKM4_9NEIS/60-349-.Q---..HY..DA-T...........HDTA.....Q..S.---------------------------------------
C4K7P5_HAMD5/61-343-.L---..AY.PDT-L...........GSKK........S.---------------------------------------
YIDC_TOLAT/62-347-.L---..KQ.TEA-Q...........GSDK........P.---------------------------------------
YIDC_DESMR/68-332-.K---..NY.RET-I...........KPDS.....P..L.---------------------------------------
C4ZKT3_THASP/75-351-.K---..QH..KA-S...........GEAG.....G..N.---------------------------------------
YIDC_TERTT/87-365-.P---..QY.YAM-L...........HEKD.....N..P.---------------------------------------
C5CSC1_VARPS/84-368-.L---..KY...D-E...........ADRT.....K..H.---------------------------------------
C5EXY9_9HELI/76-325-EE---..KYHKDA-KD........................---------------------------------------
C5ZXJ0_9HELI/77-326-EE---..KYHKDA-KN........................---------------------------------------
YIDC_DESAD/74-338-.K---..KF.KAT-I...........DADS.....P..D.---------------------------------------
C6C779_DICDC/59-340-.L---..AY.PAD-L...........GSKQ........P.---------------------------------------
C6ICV7_9BACE/83-355-.K---..NY....-............MGQD.....KK.P.---------------------------------------
C6NT82_9GAMM/85-343-.K---..HY.PTS-S...........SDKA........P.---------------------------------------
C6W539_DYAFD/66-333-.K---..NY.KTY-.............DQK........P.---------------------------------------
C6WTV5_METML/74-344-.R---..KH..RA-N...........DNL......S..N.---------------------------------------
C6XBU5_METSD/72-344-.L---..KH..RA-D...........NSTT.....E..N.---------------------------------------
C6XF04_LIBAP/70-349-.R---..GY.HLD-V...........SSNS.....P..I.---------------------------------------
C6XQ56_HIRBI/83-363-.K---..RH.FET-I...........EKTE........E.---------------------------------------
C7BT51_PHOAA/58-340-.L---..AY.PDT-L...........GSNQ........P.---------------------------------------
C7D7D3_9RHOB/76-363-.K---..DY.PIE-L...........DAEE........V.---------------------------------------
C7JEI5_ACEP3/72-355-.K---..HY.RET-V...........KPDS.....P..D.---------------------------------------
C7LXJ6_DESBD/71-334-.K---..EY.KET-I...........DPGS.....K..N.---------------------------------------
C7M523_CAPOD/94-367-.K---..EF....-............KTYD.....SL.P.---------------------------------------
C7RRI8_ACCPU/72-357-.N---..DY..KD-S...........TNKQ.....K..D.---------------------------------------
C8N7Q9_9GAMM/78-349-.P---..AY.PEN-K...........NGDK........P.---------------------------------------
C8PZ49_9GAMM/83-358-.R---..EQ.TQT-L...........DSKQ........P.---------------------------------------
C8S4X2_9RHOB/70-359-.K---..GY.KES-L...........DPAS.....D..I.---------------------------------------
C8X4E9_DESRD/89-350-.K---..QY.QEA-I...........NPGA.....K..N.---------------------------------------
C9CUD9_9RHOB/81-369-.K---..DY.RET-L...........DDDS.....P..I.---------------------------------------
C9P930_VIBME/65-340-.N---..QY.ADE-L...........NSST........P.---------------------------------------
C9PM89_9PAST/65-339-.L---..KH.DAE-L...........DSNT........P.---------------------------------------
C9R685_AGGAD/66-340-.L---..KY.DAE-L...........DSNT........P.---------------------------------------
C9RS07_FIBSS/98-377-.K---..AL....-.............PDS........TG---------------------------------------
C9YCP9_9BURK/79-362-.L---..QY..LD-S...........NDKS.....R..N.---------------------------------------
D0D3Z8_9RHOB/78-366-.K---..DY.TVT-I...........DEDS.....P..K.---------------------------------------
D0I2Z1_VIBHO/48-321-.N---..QY.DAE-F...........DSDN........K.---------------------------------------
D0KXN2_HALNC/87-369-.L---..KY.PQE-Q...........DKAD........P.---------------------------------------
D0MGR8_RHOM4/82-358-.K---..KY....-............KQYD.....FETP.---------------------------------------
D0RR44_9PROT/72-345-.K---..NYNQDN-T...........GDQT........K.---------------------------------------
D0Z129_LISDA/65-339-.L---..KY.NNT-L...........GSKD........P.---------------------------------------
D1B2U2_SULD5/83-329-ES---..KYKDDK-G.............ER..........---------------------------------------
D1KCD1_9GAMM/86-354-.N---..AY.PEE-L...........DGIK........K.---------------------------------------
D1RD64_LEGLO/74-351-.L---..AY.PQS-I...........EEKN.....K..P.---------------------------------------
D2TY53_9ENTR/58-342-.L---..LY.PKE-L...........HSSD........P.---------------------------------------
D2UGY9_XANAP/85-366-.L---..MY.PQT-Q...........QPSS.....P..P.---------------------------------------
D3NRY2_AZOS1/85-363-.A---..QY.HET-P...........DPKS.....P..E.---------------------------------------
D3PB77_DEFDS/67-312-.L---..KY....-............RNKD..........---------------------------------------
D3RS85_ALLVD/78-354-.L---..DY.AVV-P.........E.RPDD........K.---------------------------------------
D3SFF1_THISK/81-365-.L---..QY.PRD-L.........QDDPLV........P.---------------------------------------
D3SM35_THEAH/68-295-.E---..KY....-........................G.---------------------------------------
D3VFZ9_XENNA/54-335-.L---..AY.PDT-L...........GSQT........P.---------------------------------------
D4DLV5_NEIEG/57-345-.L---..KY..DS-A...........EDQS.....K..P.---------------------------------------
D4FAW5_EDWTA/70-352-.L---..AY.PAT-L...........GSNT........P.---------------------------------------
D4H194_DENA2/71-316-.N---..SY....-............HSRD..........---------------------------------------
D4YZ11_SPHJU/74-348-.P---..TY.KET-I...........AKSS.....P..A.---------------------------------------
D4ZD76_SHEVD/70-345-.V---..EH.KLE-Q...........ESDE........P.---------------------------------------
D5AM40_RHOCB/67-374-.K---..HY.HEK-L...........DPAS.....P..L.---------------------------------------
D5BGP8_ZUNPS/95-365-.K---..NY....-............KTYD.....SI.P.---------------------------------------
D5BTZ8_PUNMI/94-376-.T---..DY.KET-Q...........DPES.....K..N.---------------------------------------
D5CQJ8_SIDLE/71-344-.L---..KH..KD-A...........IDKS.....K..P.---------------------------------------
D5H4L9_SALRM/114-393-.K---..EY....-............KQFN.....QEDP.---------------------------------------
D5MLW8_9BACT/77-342-.K---..SY.R..-............AADG.....Q..G.---------------------------------------
D5QCU3_GLUHA/64-351-.K---..DY.HET-V...........KPGS.....P..L.---------------------------------------
D5QKL0_METTR/94-373-.K---..NY.HET-V...........DPKS.....P..I.---------------------------------------
D5V159_ARCNC/94-340-QR---..QYINED-N.............SH..........---------------------------------------
D5V9B9_MORCR/81-356-.K---..QH.NAT-K...........DSTE........P.---------------------------------------
D5X092_THIK1/88-361-.L---..KY..ES-R...........TEPG.....K..N.---------------------------------------
D6L2A6_9NEIS/51-339-.L---..KY..DA-T...........EDKT.....K..N.---------------------------------------
D7A2X3_STAND/89-370-.K---..DY.RET-V...........DPNS.....P..I.---------------------------------------
D7AGW1_GEOSK/67-334-.K---..RY.HET-A...........GPGG.....K..N.---------------------------------------
D7DPN7_METS0/67-338-.L---..KH..RA-S...........DNVK.....T..N.---------------------------------------
D7HT65_PSESS/85-363-.P---..LY.PRR-Q...........DRPD.....V..P.---------------------------------------
D7VNI1_9SPHI/86-358-.K---..NE....-............KNFD.....GS.P.---------------------------------------
D8FEY0_9DELT/74-343-.K---..KY.RQT-V...........NPES.....P..F.---------------------------------------
D8IUS2_HERSS/62-334-.L---..KQ..PD-V...........VDPT.....K..N.---------------------------------------
D8JXN4_HYPDA/99-385-.M---..KY.RET-V...........DPNS.....A..R.---------------------------------------
D9PLD5_9ZZZZ/72-318-DE---..KYKLED-N.............KP..........---------------------------------------
D9QLU4_BRESC/86-370-.K---..NY.RQT-I...........DPTS.....P..Y.---------------------------------------
D9SEP3_GALCS/70-342-.I---..KH..LD-G...........QDKT.....K..Q.---------------------------------------
D9YCI7_9DELT/76-344-.K---..KF.QTG-L...........APDS.....P..L.---------------------------------------
E0E9T6_ACTPL/60-331-.L---..AH.NAE-L...........NSQT........P.---------------------------------------
E0QC07_CAMCO/82-329-DK---..KYQNEK-G.............EA..........---------------------------------------
E0TGR5_PARBH/75-349-.K---..TY.RAT-L...........AADS.....P..P.---------------------------------------
E1JWT9_DESFR/72-336-.K---..QY.RQT-I...........AADS.....P..L.---------------------------------------
E1QGD7_DESB2/72-341-.K---..DYFAKP-G...........QQGG........E.---------------------------------------
E1R6N6_SPISS/85-369-.K---..EH....-F...........ENGE........P.---------------------------------------
E1SRS1_FERBD/67-340-.P---..EH.KVE-Q...........GGDE........A.---------------------------------------
E1VCI5_HALED/89-362-.P---..QH.KYA-E...........DTDQ........P.---------------------------------------
E1YHJ2_9DELT/73-343-.K---..KY.NET-I...........DVDS.....P..K.---------------------------------------
E2CFI6_9RHOB/88-368-.K---..DY.HET-V...........DKSS.....P..T.---------------------------------------
E2Y0D7_PSEFL/82-367-.P---..LY.PRR-Q...........DHPE.....I..P.---------------------------------------
E3BH69_9VIBR/64-349-.N---..QY.AEQ-M...........DKPD........P.---------------------------------------
E3I8D6_RHOVT/87-376-.K---..EY.RQT-V...........DPNS.....P..P.---------------------------------------
E4PHG2_MARAH/93-371-.L---..DY.DDT-L...........NSEK........P.---------------------------------------
E4RXZ7_LEAB4/66-342-.K---..DY.KTY-ADYIGG......KDKA........E.---------------------------------------
E4TI09_CALNY/66-312-.I---..KY....-............RDKK..........---------------------------------------
E4U0E7_SULKY/78-324-NK---..KHNGKD-G.............KL..........---------------------------------------
E5ANF4_BURRH/84-357-.V---..KE..GD-G...........KQPN.....L..Y.---------------------------------------
E5UFL6_ALCXX/85-360-.L---..KY..PA-T...........GQAD.....K..P.---------------------------------------
E5Y3D4_BILWA/70-335-.K---..HY.DET-I...........KADS.....P..K.---------------------------------------
E6L9N5_CAMUP/85-332-DK---..KYLNED-K.............SQ..........---------------------------------------
E6PV40_9ZZZZ/84-356-.L---..DYTSHA-D...........AKDD..........---------------------------------------
E6QUQ9_9ZZZZ/65-340-.T---..KY..HE-T...........GAPN.....Q..P.---------------------------------------
E6VVL3_DESAO/78-347-.K---..NY.RET-I...........KPDS.....P..N.---------------------------------------
E6W2A4_DESIS/84-327-.K---..EH.QED-G...........RGGA........M.---------------------------------------
E6WXG3_PSEUU/84-365-.L---..QF.PRD-R...........NGDG.....T..A.---------------------------------------
E6XAK3_CELAD/92-365-.K---..NF....-............TTYD.....SI.P.---------------------------------------
E7C5J1_9BACT/79-427-ED---..RFRKFD-P.....TIRAKLNLEE........VR---------------------------------------
E7C9X2_9PROT/74-354-.K---..KY.NET-L...........GSDK........K.---------------------------------------
E7RZL5_9BURK/87-360-.L---..KH.IHD-T...........RNPD.....S..G.---------------------------------------
E8L3J9_9RHIZ/76-358-.K---..NY.HQT-V...........DPRS.....P..I.---------------------------------------
E8LJ48_9GAMM/56-342-.C---..KV.KQE-L...........GKDD........P.---------------------------------------
E8Q5V7_BLOVB/159-447-.L---..KY.LDN-L...........NSQQ........P.---------------------------------------
E8RBA3_DESPD/75-344-.K---..SY.RST-N...........AEDA.....G..P.---------------------------------------
E8RRW7_ASTEC/75-370-.K---..QY.KET-L...........KADS.....P..N.---------------------------------------
E8T5A7_THEA1/59-297-.K---..KY....-........................N.---------------------------------------
E8UFE8_TAYEM/72-346-.L---..KH.HSA-E...........DKAL........P.---------------------------------------
E8V6Z5_TERSS/94-374-.K---..RY.KDN-..............KG.....V..P.---------------------------------------
E8WL20_GEOS8/75-344-.K---..KY.KDV-A...........GPKG.....Q..D.---------------------------------------
E8WWP1_ACISM/87-375-.K---..KY.KDS-..............YG.....Q..P.---------------------------------------
E8XPB8_RAHSY/60-339-.K---..AY.PTT-L...........GSDQ........P.---------------------------------------
F0F1E8_9NEIS/53-342-.N---..QY..NS-A...........ADEQ.....Q..K.---------------------------------------
F0IH08_9FLAO/89-358-.K---..NQ....-............KTYQ.....GK.P.---------------------------------------
F0JKI5_DESDE/78-347-.K---..NY.RET-I...........QKDS.....P..F.---------------------------------------
F0L5H9_AGRSH/88-368-.K---..GY.HET-V...........DDSS.....P..I.---------------------------------------
F0NZP1_WEEVC/77-350-.K---..EH....-............LAFDSLKGVDAQP.---------------------------------------
F0RH16_CELLC/92-364-.K---..NF....-............VTYD.....SL.P.---------------------------------------
F0RX03_SPHGB/84-372-.K---..EH....-L...........DDGE........P.---------------------------------------
F0SF95_PLABD/95-399-.N---..DPRYRE-L...........TDRE.....Q..P.---------------------------------------
F2B931_9NEIS/54-342-.L---..KY..NS-A...........DDEG.....K..P.---------------------------------------
F2GD54_ALTMD/78-351-.L---..KF.PVE-Q...........GSDI........P.---------------------------------------
F2I3Y3_PELSM/76-349-.K---..NY.QES-L...........DENS.....K..Q.---------------------------------------
F2J1Z4_POLGS/92-372-.K---..DY.RET-V...........DPKS.....P..T.---------------------------------------
F2K1U1_MARM1/82-358-.L---..QY.KKT-L...........DASD........P.---------------------------------------
F2LWU2_HIPMA/71-319-.K---..KY....-............SINK.....A..N.---------------------------------------
F2PBU9_PHOMO/65-340-.L---..KY.NNT-L...........GSKD........P.---------------------------------------
YIDC_BUCAP/52-338-.L---..DY.KTQ-L...........NSPE........N.---------------------------------------
YIDC_WOLSU/81-328-DA---..KFLKEQ-..............KE..........---------------------------------------
YIDC_BORPE/87-362-.L---..KY..PS-S...........SQSD.....K..P.---------------------------------------
Q02A40_SOLUE/101-361-.K---..RYKGND-S....................K..P.---------------------------------------
Q07TY2_RHOP5/100-389-.V---..QF.RET-V...........DPKS.....P..A.---------------------------------------
YIDC_SHEFN/68-343-.V---..EH.KRE-I...........DSSD........P.---------------------------------------
YIDC_ALHEH/74-349-.L---..QH.GTT-A...........TDDT........P.---------------------------------------
YIDC_MARMM/76-356-.R---..RH.TET-............IDDD.....T..P.---------------------------------------
YIDC_GRABC/70-355-.R---..DY.HET-V...........DKNS.....P..L.---------------------------------------
Q0C549_HYPNA/73-365-.K---..QF.YTT-V...........EREA.....E....---------------------------------------
Q0G0U0_9RHIZ/90-370-.K---..HY.HET-V...........DDSS.....P..T.---------------------------------------
Q11LE5_MESSB/91-371-.K---..DY.RVT-V...........DKDS.....P..N.---------------------------------------
YIDC_CYTH3/79-358-.K---..NY....-............FTWD.....KK.Q.---------------------------------------
YIDC_SHEDO/67-342-.V---..KH.KTE-I...........DKND........P.---------------------------------------
YIDC_PSEA6/72-343-.L---..KY.PLE-Q...........GSQG........T.---------------------------------------
Q1GN73_SPHAL/87-365-.T---..KY.RQT-I...........KKDS.....P..A.---------------------------------------
YIDC_METFK/76-348-.R---..EH..KD-D...........EDQT.....K..N.---------------------------------------
Q1IV78_KORVE/81-362-.K---..NY.KDD-..............HG.....N..P.---------------------------------------
YIDC_LAWIP/69-333-.K---..KY.KVN-L...........DNTS.....P..L.---------------------------------------
Q1MZ43_9GAMM/64-339-.K---..QY.PLS-V...........DQQD.....V..P.---------------------------------------
Q1NWR8_9DELT/82-356-.K---..EF.RET-V...........DPDS.....P..A.---------------------------------------
Q1V1M7_PELUQ/70-343-.K---..EY.NIE-L...........NRNE........K.---------------------------------------
Q1YH97_MOBAS/97-376-.K---..NY.HET-V...........DDSS.....P..T.---------------------------------------
Q1YZM1_PHOPR/66-338-.L---..AY.DNE-L...........DSAD........P.---------------------------------------
Q21QM4_RHOFD/90-368-.V---..RH..AD-M...........ADKS.....K..H.---------------------------------------
Q26CA4_FLABB/76-349-.K---..SY....-............KTYD.....SL.P.---------------------------------------
YIDC_JANSC/83-388-.R---..NY.FTE-V...........DGD......Q..I.---------------------------------------
Q2BQG4_9GAMM/76-352-.P---..QY.KAA-L...........GS.E.....L..P.---------------------------------------
Q2CI02_9RHOB/82-361-.T---..AY.HET-L...........DPDS.....P..L.---------------------------------------
Q2GAU8_NOVAD/82-357-.A---..RH.REG-V...........DRNS.....A..P.---------------------------------------
YIDC_BORA1/87-360-.L---..KY..PA-T...........AGSD.....Q..P.---------------------------------------
YIDC_SYNAS/82-353-.K---..NY.RET-L...........AVNS.....K..P.---------------------------------------
Q2N7X2_ERYLH/80-353-.K---..DH.RAT-V...........DEDS.....G..P.---------------------------------------
Q2NQ71_SODGM/60-342-.L---..SY.PDK-L...........GSPQ........P.---------------------------------------
Q2RP12_RHORT/103-381-.V---..DY.RET-V...........DPQS.....P..E.---------------------------------------
YIDC_HAHCH/87-367-.L---..QY.PIS-L...........KNPT........P.---------------------------------------
Q2VZ15_MAGSA/87-366-.V---..KY.RET-P...........AADS.....R..E.---------------------------------------
YIDC_NIT