Sequence alignment for CL0104

PF12681

Q187Q5_PEPD6/3-120-FGGVL--------LIV------K---D--I--NKSKKFYED--V---ME------------Q--------K-----I--
Q8TUF9_METAC/12-132-FICPL--------IVA------N---N--M--EISRNFYEK--V---LD------------Q--------K-----V--
Q97LL1_CLOAB/3-123-FNCPL--------IVV------N---D--I--NISRKFYEE--V---LC------------Q--------K-----I--
A5HYY7_CLOBH/3-121-FKLAL--------LAV------K---N--V--SVSRQFYEE--L---FD------------Q--------K-----V--
A9CII6_AGRFC/3-123-FVNPI--------PFV------R---D--I--NRSKSFYRD--R---LG------------L--------K-----I--
Q81BZ3_BACCR/5-127-MKYII--------LYV------E---K--F--EECLKFYKD--I---LQ------------L--------P-----I--

PF00903

CADE_BACSU/9-123HIGYAK........LTI------R---S--L--ERSLQFYCN--V...IG------------F--------Q-----V--
YQCK_BACSU/2-115KYVHVG........VNV------V---S--L--EKSINFYEK--V...FG------------V--------K-----A--
YQJC_BACSU/3-128RLDHIG........IAV------F---S--I--KDARSFYEN--V...LG------------L--------A-----F--
LGUL_HUMAN/31-174LLQQTM........LRV------K---D--P--KKSLDFYTR--V...LG------------M--------T-----L--
D5T7F4_LEGP2/151-300AIDHLTH......NVYR------G---N--M--DKWASFYAS--I...FN------------F--------Q-----E--
CADI_MYCTU/2-114SRVQLA........LNV------D---D--L--EAAITFYSR--L...FN------------A--------E-----P--
CF30_MYCTU/11-126TPNWVD........LQT------T---D--Q--SAAKKFYTS--L...FG------------W--------G-----Y--
I7B4U0_PSEPT/143-261GLGHYV........LSV------A---D--V--DAALAFYTK--A...LG------------F--------Q-----L--
BPHC2_RHOGO/6-121KFAHVV........LQT------S---R--F--EAMRDWYCT--V...LD------------A--------H-----V--
LGUL_PSEPU/24-167VFNHTM........LRV------K---D--I--EKSLDFYTR--V...LG------------F--------K-----L--
HPPD_RAT/180-335IIDHIVG......NQPD------Q---E--M--ESASEWYLK--N...LQ------------F--------H-----R--
BPHC3_RHOGO/6-122RLAHFV........LQT------N---Q--L--PAMTQWYID--V...LG------------A--------H-----V--
LGUL_BRAJU/27-171IMQQTM........FRV------K---D--P--KASLDFYSR--V...LG------------M--------S-----L--
O24828_9GAMM/150-266RFDHCL........LYG------P---N--L--DETLNLFRD--V...LG------------F--------D-----L--
LGUL_SYNY3/2-123FLLHTM........IRV------G---D--L--DKSLQFYCD--I...LG------------M--------N-----L--
O26852_METTH/2-112KIKYAT........IIV------D---E--M--EESVKFYRD--V...MG------------F--------T-----V--
P95571_9PSED/143-280GAGHYF........YAV------P---D--I--EEGLAFYTG--I...LG------------F--------Q-----M--
LGUL_NEIMB/2-123RLLHTM........LRV------G---N--L--EKSLDFYQN--V...LG------------M--------K-----L--
Q98LB0_RHILO/89-205HLAFAEP......QLFV------C---D--I--AAACNFYRQ--K...LG------------F--------E-----T--
Q98HZ4_RHILO/7-135IQPRAEVLGGLTPYLQV------D---G--A--FKAADFYKK--A...FG------------A--------E-----Q--
FOSB_BACSU/5-117GINHLL........FSV------S---H--L--DTSIDFYQK--V...FG------------A--------K-----L--
Q9KZ01_STRCO/31-158AVTHLN.........FR------G---D--A--REALTFYRA--A...FG------------G--------D-----L--
MHQE_BACSU/5-263GLHHVT........AFA------R---D--P--QENLRFYTE--V...LG------------L--------R-----L--
P72786_SYNY3/14-143RVHHIA........LNV------K---D--M--EKSCHFYGH--I...LG------------L--------K-----P--
O53680_MYCTU/15-163GINHVA........LVC------S---D--M--ARTVDFYSN--I...LG------------M--------P-----L--
YRAH_BACSU/2-124KLLQIR........LLV------N---D--F--KKSVEFYKD--S...LG------------L--------P-----I--
FOSB_STAEP/4-116GINHIT........YSV------S---N--I--AKSIEFYRD--I...LG------------A--------D-----I--
O68311_GEOTH/148-265RIDHLL........ITA------E---R--P--HETVDFLMK--A...LN------------F--------Y-----M--
YYAH_BACSU/2-124QIEHTA........VWV------N---D--L--ERMKSFYES--Y...FN------------G--------E-----A--
YETH_BACSU/4-118QIGTVA........VYV------E---D--Q--QKAKQFWTE--K...VG------------F--------D-----I--
Q9ZNP0_COMTE/147-272WIDHCLLMCEMNPEAGI------N---T--V--EDNTRFMAE--C...MD------------F--------F-----L--
Q9ZAY0_9SPHN/150-267RFDHCA........LNG------I---D--I--AGSAKIFVE--A...LD------------F--------S-----V--
O06412_MYCTU/4-113LASRML........LRP------A---D--Y--QRSLSFYRD--Q...IG------------L--------A-----I--
LGUL_HAEIN/2-123QILHTM........LRV------G---D--L--DRSIKFYQD--V...LG------------M--------R-----L--
D5AV60_RHOCB/8-122LIDHIQ........LVV------R---D--L--PTSESFYTA--VMSVLG------------I--------P-----V--
YYCE_BACSU/11-130AQIRIA........RPT------G---Q--L--DEIIRFYEE--G...LC------------L--------K-----R--
C3JUU8_RHOER/142-267GLGHVV........LTT------D---D--D--DASLRFYRD--V...LG------------F--------K-----L--
MHQO_BACSU/7-266GIHHIT........AIV------G---H--P--QENTDFYAG--V...LG------------L--------R-----L--
HPPD_PSEUJ/158-310IIDHLTH......NVYR------G---R--M--AYWANFYEK--L...FN------------F--------R-----E--
Q45135_9MICO/152-268RLDHFN........QVT------P---D--V--PRGRKYLED--....LG------------F--------R-----V--
N9VUR8_PSEPU/150-266RFDHAL........MYG------D---E--L--PATYDLFTK--V...LG------------F--------Y-----L--
LGUL_BRAOG/17-138RFLHVV........YRV------G---D--L--DRTIQFYTE--C...FG------------M--------K-----V--
Q9I3Z1_PSEAE/3-131IVPYL.........IFN------G---N--C--REAFSCYHQ--H...LG------------G--------T-----L--
Q9KYP6_STRCO/2-118NLVSLR........VIT------D---D--V--ARLVGFYER--A...TG------------L--------R-----A--
MHQA_BACSU/5-275GIHHVS........ALT------A---D--A--QKNLDFYKK--V...LG------------L--------K-----L--
Q59693_PSEPU/147-272WLDHIALVCELNPEAGI------N---H--V--ADNVKFFMG--C...LD------------F--------Y-----L--
LGUL_SCHPO/11-150KLNHTM........IRV------K---D--L--DKSLKFYTE--V...FG------------M--------K-----L--
LGUL_SALTY/2-123RLLHTM........LRV------G---D--L--QRSIAFYTN--V...LG------------M--------K-----L--
Y3691_SHEFN/4-116SIVHIA........LVV------N---D--Y--DEAIDFYVN--K...LK------------F--------D-----L--
Q9KZG9_STRCO/4-130RLNPYL........SFD------G---D--A--RQAMEFYGQ--V...FG------------G--------T-----P--
YURT_BACSU/2-124KIVVTS........IFV------Q---D--Q--DMALEFYTE--K...LG------------F--------I-----K--
YWKD_BACSU/5-125SIHHIA........IIC------S---D--Y--EKSKAFYVH--K...LG------------F--------Q-----V--
Q52533_PSESP/147-267GIGHVL........IRA------K---D--Y--DQSMDFYQE--G...LG------------L--------R-----L--
MCE_PYRHO/7-131RIDHVG........IAV------K---N--L--EEAIKIWEG--....LG------------F--------K-----V--
P97099_CUPNE/143-262GIGHFV........RCV------P---D--T--AKAMAFYTE--V...LG------------F--------V-----L--
DNRV_STRPE/8-133APAWFD........LGS------P---D--V--AASADFYTG--L...FG------------W--------T-----A--
P73508_SYNY3/5-122VIFHLA........IPV------N---D--I--AKTKEFYCD--R...LG------------A--------K-----A--
HMAS_AMYOR/158-306GIDHFAI......CLNA------G---D--L--GPTVEYYER--A...LG------------F--------R-----Q--
O86701_STRCO/4-132SLSQCF........IAV------D---D--H--DRALAFYRD--V...LG------------L--------E-----V--
Q7AQ90_MYCLE/20-150TIDHVG........IAV------A---D--L--NAAISWYHD--H...LG------------M--------I-----L--
LGUL_YEAST/22-164LLNHTC........LRV------K---D--P--ARTVKFYTE--H...FG------------M--------K-----L--
C1KH52_SERMA/4-114SLNHLT........LAV------S---D--L--QKSVTFWHE--L...LG------------L--------T-----L--
C3LUW7_VIBCM/6-113KLNYVE........FAV------N---D--L--ESTKAFFSK--T...FG------------W--------S-----F--
Q9Z549_STRCO/4-125QFNAIS........LIV------S---D--M--AASVAFYRR--....LG------------F--------A-----F--
Q48341_STRLI/5-125TSPEPEGYTTVAPWVVT------D---D--T--GAFLDFVTQ--A...FG------------G--------E-----E--
O32376_COMTE/143-262GLGHFV........RCV------P---E--A--EKALAFYVG--V...LG------------F--------Q-----L--
O69350_RHOER/145-267GLGHVV........LPV------M---D--S--AASFDFYTE--V...LG------------F--------Y-----P--
GLOD4_CAEEL/132-248KVLRVQ........VNV------G---D--L--EKSKKYWNE--T...LG------------M--------P-----I--
YAER_ECOLI/6-126QVHHIA........IIA------T---D--Y--AVSKAFYCD--I...LG------------F--------T-----L--
O86906_SPHSX/146-261GLGHIL........ITV------S---D--I--EKSKAFYLD--L...LG------------F--------R-----M--
O28796_ARCFU/50-170KIKMVS........IYV------D---D--V--EKAFRFYTE--V...LG------------F--------K-----E--
O05205_STRLA/4-125RISLFA........VVV------E---D--M--AKSLEFYRK--....LG------------V--------E-----I--
I7MMZ2_TETTS/194-350YVDHIVG......NQPD------N---M--M--TSAADWYEK--T...LD------------F--------H-----R--
Q9I5D5_PSEAE/8-139TVASVIP......CLRY------R---D--A--PAAIDWLCR--T...FG------------F--------Q-----R--
O87625_PSEAI/152-264RLGHLI........KFS------P---D--V--DRSVDFYTQ--L...LG------------M--------K-----V--
Q50912_SPHXE/13-131KIAHIV........LFV------K---D--P--ELSAQWYSD--I...LN------------M--------K-----I--
A5W4G6_PSEP1/11-255KLAYAA........INV------T---D--L--SRSVPFYRD--I...VG------------L--------D-----L--
Q59770_RHORH/162-279RLDHLN........ITA------K---D--V--DDARNWYSD--V...LG------------F--------K-----L--
YWBC_BACSU/4-123RIDHTG........IMV------R---D--I--NASITFYEE--V...LG------------M--------K-----L--
Q9KEK2_BACHD/4-140TMNPYL........MLD------G---D--G--QAAIEFYQD--A...LN------------A--------E-----V--
O28065_ARCFU/4-128KIDHVG........VAV------K---S--L--EEAVKTYEA--....LG------------F--------G-----V--
A2YS08_ORYSI/24-146RLLHAV........YRV------G---D--L--DRTIKCYTE--C...FG------------M--------K-----L--

PF13669

A9C2R0_DELAS/14-124--QQVA--------IGG------T...D--K--QRMKRLWVD--M---LG............L........T.....Q..
A2SEJ1_METPP/12-122--QQIA--------IGG------P...D--K--QRLRALWVD--M---LG............L........S.....V..
D0LXQ3_HALO1/13-123--QQIA--------IGG------S...D--K--QTLRALWVD--L---LG............L........E.....A..
Q5P377_AROAE/12-122--QQIA--------IGG------P...S--K--ERLKTLWVD--M---LG............L........E.....V..
Q1D6F8_MYXXD/37-147--QQIA--------IGG------A...D--K--APLRKLWVD--L---LG............L........T.....P..
B8BYE7_THAPS/75-187--QQIA--------IGS------L...D--N--SSLSHLWCD--I---FG............V........S.....K..
B5Y3L3_PHATC/38-148--QQVA--------IGA------V...D--R--EPLHALWKG--I---FG............L........K.....A..
A4HEL0_LEIBR/19-133--NHVA--------IAV------PVSRS--I--VEAGEVYKR--L---FN............V........K.....V..
D4J6L0_9FIRM/18-126--HHWG--------IVL------P...T--L--EKAEAFMKT--.---FG............L........Q.....E..
D2RXZ8_HALTV/10-118--DHVG--------IAV------E...S--I--DDAEELLF.--V---LG............C........E.....K..
Q39TG0_GEOMG/11-132--LQVG--------IVV------H...D--L--EKAVRTYAD--D---FG............I........G.....P..
D3F6C9_CONWI/9-133--DQIG--------IVV------H...D--L--DRALARYER--A---LG............G........G.....P..
A6LI20_PARD8/8-119--HHIG--------LAV------R...S--I--DLTAAIYVN--.---AG............Y........K.....Q..
Q97H22_CLOAB/4-114--HHIG--------YAV------K...N--I--DSALKKFKR--.---LG............Y........V.....E..
B9JM51_AGRRK/6-125--FQMG--------IVV------P...D--M--DAALRAMTA--K---IGTGRFM..TLPPNL.......KE.....S..
C5CVE4_VARPS/9-131--RQLG--------YVV------H...D--I--EAAMDYWST--T---LG............VGPWFYNPKV.....P..
Q13K82_BURXL/9-131--RQAG--------YVV------R...D--I--EAAMDYWSR--V---LG............VGPWFYNERV.....P..
Q13I71_BURXL/19-140--TQVG--------YVV------E...N--I--DEAMRSFTT--Q---LGVGPW...FLSGPF........E.....T..
Q5UWE3_HALMA/10-117--DHIG--------IAV------E...D--I--GDAEPFLF.--A---LG............C........R.....K..
C0ZEG8_BREBN/1496-1609--HHVG--------VAV------P...E--L--GPAQIMYGT--.---LG............F........D.....A..
D4M9A6_9BACT/4-116--HHIG--------YAV------N...E--L--ESAAEKFHR--.---LG............Y........S.....P..
Q12HJ2_POLSJ/9-131--RQLG--------YVV------H...D--I--EAAMDYWSN--T---LG............V........G.....P..
D2RQ64_HALTV/17-139--SQVA--------FVV------E...D--L--EDGMDRFDG--L---LG............I........G.....P..
A5VBF6_SPHWW/10-129--DQIG--------FLV------D...D--L--DAAVARWMA--H---SG............V........G.....P..
A1TCL4_MYCVP/8-130--RQIG--------YVV------T...D--L--DRALDSWV.--A---LG............V........G.....P..
C7PR30_CHIPD/14-138--AQIC--------WVV------P...D--I--AAAVKFLAD--T---LG............I........T....GF..
A4XEN6_NOVAD/16-137--MQAA--------FIV------E...D--V--EAAAKAWIA--A---TGIGPFF.MVPHIEL........A.....E..
A5G6D6_GEOUR/8-118--HHLG--------YAT------E...S--I--ERERQFFE.--Y---MG............Y........C.....Q..
Q2YCD2_NITMU/13-126--HHFG--------LAS------R...R--P--EQTLKFLKG--.---LG............H........E.....V..
B1MB48_MYCA9/17-139--TQIA--------WVT------D...D--L--DATEAMLSA--V---FG............V........K.....K..
A0R1J5_MYCS2/10-129--CQIG--------YVV------A...D--L--DDAISRWLQ--.---MGVGPW...FVIRGM........T.....Q..
C7RS60_ACCPU/18-128--HHVG--------YAS------V...S--V--ARERDFFA.--L---LG............Y........Q.....Q..
D5URS6_TSUPD/111-214--DHVV--------LTS------P...N--S--DRIIATLCG--R---LD............F........D.....L..
D0LDW1_GORB4/120-238--DHLV--------FMC------N...D--R--DQAVALFGA--T---LG............L........D.....F..
A5V4C1_SPHWW/15-137--MQVA--------YIV------P...D--I--RQAIEQYRA--R---LKTGPWFVIDHFPLF.................
E0UKN1_CYAP2/120-235--FHIG--------VIV------P...D--L--KEAIKNFSE--V---LG............I........T.....F..
Q2G768_NOVAD/15-136--MQTA--------FVV------E...D--V--HASIAHFQK--.---.D............C........AAGPFFL..
Q744Q1_MYCPA/12-125--YHTG--------IIV------P...D--L--EAAMARLSA--L---AG............Y........R.....W..
D2AXE6_STRRD/3-112--HHIE--------LWV------P...D--L--GRAVRSWGW--L---LG...........................E..
B8FMX2_DESAA/10-131--RQVG--------YVV------K...D--I--EKAMNEWVK--.---LG............V........G....PW..
C5C099_BEUC1/20-129--HHVE--------LWV------E...D--L--PEATASWGW--L---LG............R........L.....G..
Q15VI5_PSEA6/7-112--EHVN--------LTV------T...D--P--DKTAEILCQ--L---FN............W........H.....I..
A2QUW1_ASPNC/11-144--NQVC--------IAT------P...N--F--HETLDRLGK--.---VG............M........G.....P..
Q28K59_JANSC/19-130--DHVH--------IEV------R...D--R--ARAADWCAR--V---LG............L........R.....P..
A1SVB5_PSYIN/4-112--HHLG--------IAT------D...D--I--NRTLKYVNN--I---YN............I........S....NV..
C7NIJ3_KYTSD/10-119--HHVE--------LWV------P...D--I--VRATTHWGW--L---LG............E........L.....G..
A4SXB6_POLSQ/12-122--QQIA--------IGG------E...S--K--DRLKKLWVD--M---LG............F........E.....Y..
A4XGA4_CALS8/13-134--.QIG--------IIV------R...D--I--EKTAKDFAQ--F---FG............V........E.....V..
B0RG81_CLAMS/8-115--HHVE--------LQV------R...D--L--DAALASWGW--I---LG..............................
B2HSW2_MYCMM/9-134--TQIA--------WVT------P...D--L--DATEAALTG--L---LG............A........R.....K..
B8E0B0_DICTD/13-133--.QIG--------IIV------K...D--I--EKAVEEFSR--I---FN............V........V.....KPE
F3Z5I0_9ACTN/9-118--HHVE--------IWV------P...D--L--PRAVADWAW--L---LE............AL.....GHT.....L..
R5SQY8_9FIRM/9-124--DHVG--------VAV------N...D--L--ALIKKQMKD--L---LN............L........E.....P..

PF13468

C5BVV5_BEUC1/6-191-LDHVT--------LGV------S-..H--L--YEGAERLRR..T---TG------------L--------R-----SV.
Q3IZS4_RHOS4/4-171-LDHVA--------IAA------T-..D--L--AEGTAAVEA..A---LG------------L--------S-----MG.
Q28LV8_JANSC/4-176-FDHIA--------VSS------E-..T--L--GSGARDLET..A---LG------------Q--------P-----LL.
D7BGN4_MEISD/10-187-LDHLV--------VAA------R-..T--L--EEGAAYIER..M---LG------------V--------A-----MS.
D3PMM6_MEIRD/4-173-LDHLV--------LAA------Q-..T--L--QEGVEYVQD..T---LE------------V--------V-----LP.
Q1IXF9_DEIGD/4-178-LDHLV--------IAA------R-..N--L--EEGRAWLEG..R---LG------------V--------S-----MQ.
A9HYM0_BORPD/5-178-LDHIA--------VTA------P-..S--L--AIGADFIEH..A---LG------------V--------R-----PQ.
Q47D15_DECAR/6-180-LDHIT--------VTA------F-..S--L--DAGAAFVLE..T---LG------------V--------F-----PQ.
A9B642_HERA2/8-182-IDHLV--------VTA------P-..D--L--ALGVAYIED..L---LG------------V--------P-----MQ.
D2QC41_SPILD/11-185-FDHLI--------FGS------Y-..F--L--EDGVNFIAE..Q---LG------------V--------R-----PQ.
B8IP73_METNO/4-183-LDHLV--------IVA------P-..S--L--AEGEAHVRD..R---LG------------L--------P-----MQ.
B1LV77_METRJ/4-183-LDHLV--------VVA------P-..D--L--AEGVAHVVN..C---LG------------L--------A-----MP.
C5CLJ8_VARPS/5-199-LDHLV--------IAA------A-..S--L--AEGVAWCEA..T---LG------------V--------T-----PG.
D3Q0J0_STANL/2-177-LDHLV--------LST------P-..D--L--AATVADVAR..L---TG------------V--------E-----PA.
B5HRA1_9ACTN/8-184-LDHLV--------LAT------P-..D--L--AATVADFTR..R---TG------------V--------S-----PA.
A4FK05_SACEN/2-174-LDHLV--------FAG------P-..D--L--GDAVALVEG..L---TG------------V--------R-----SV.
C7MHL9_BRAFD/7-186-LDHIV--------IAG------P-..D--L--QELVDWFHE..L---TG------------V--------T-----AA.
A6WBM6_KINRD/7-183-LDHVV--------IAG------P-..D--L--GELVDWFAA..A---TG------------V--------T-----AT.
B7FUP4_PHATC/255-429-IDHIV--------LAA------S-..D--L--EDAISQFER..K---TG------------M--------K-----PV.
B7FSM2_PHATC/69-245-IDHIF--------LGT------S-..D--F--DQAMTDFTQ..L---TG------------I--------E-----PV.
C0ZG21_BREBN/5-195-FDHLV--------HFV------H-.RT--P--QEAAEQFCQ...---AG------------F--------H-----AV.
Q8ELK5_OCEIH/5-195-FDHFV--------HVV------N-..D--P--QKAMERC.E..E---LG------------I--------H-----AV.
B1HV56_LYSSC/5-194-FDHLV--------HQV------E-..S--P--EN.IKVFFN..K---RN------------V--------H-----TV.
Q5WBL3_BACSK/5-198-FDHVI--------HYV------D-..D--A--HTLKDHFIN..K---.G------------F--------H-----TV.
B9DM11_STACT/6-192-FDHII--------HYI------K-..H--I--DE.FQYPGE..V---L.------------.--------K-----VV.
B9E9H1_MACCJ/8-191-FDHII--------HHV------H-..Y--L--NNADIDF.....---..------------L--------K-----VI.
D1CHQ7_THET1/9-194-LDHVV--------VAV------R-..D--L--AQGIARY.R..E---MG------------F--------D-----VR.
D1C9M3_SPHTD/5-190-FDHVI--------VGV------R-..D--L--EAASERY.R..A---LG------------F--------E-----VN.
A5UPV1_ROSS1/5-179-IDHVV--------ILV------H-..D--L--AAATSDY.A..A---LG------------F--------T-----VT.
B0D2X2_LACBS/11-211-LDHIV--------HLS------P-PGS--I--EETSRQF.S..D---LG------------F--------K-----VI.
B9L3L2_THERP/5-180-IDHLV--------VLV------P-..D--L--EAAIQEYRG...---AG------------F--------T-----VV.
Q0UPP1_PHANO/6-192-LDHLI--------LFV------P-.VD--P--ETNLPKVPTFFA---KN------------F--------T-----LT.
A7I5C5_METB6/53-255-IDHAV--------IVV------D-..N--L--TEARERFA...A---AG------------F--------S-----VV.
Q11EY7_CHESB/5-184-FDHLI--------LAV------N-..N--L--GQVDADF.Q..R---AG------------F--------S-----IT.
C7N101_SLAHD/3-183-LSHVI--------LKV------E-..Q--L--DKAVQEYRD..K---.G------------F--------A-----VE.
Q215A9_RHOPB/5-194-LDHIV--------HAV------H-..D--L--DAAAA.LYQ..R---AG------------F--------Q-----VG.
A7IN29_XANP2/5-195-LDHVV--------HLV------R-..D--L--DAAGE.VYD..L---LG------------F--------T-----VG.
Q92KD8_RHIME/11-203-LDHLV--------LPV------A-..D--L--ARTRQRL.A..A---LG------------F--------T-----VA.
B9JW73_AGRVS/9-199-VDHLV--------LPV------E-..T--L--EAARSRL.T..A---LG------------F--------T-----VA.
Q2W045_MAGSA/8-179-LDHVI--------IAV------R-..D--L--DKAAATF.R..A---LG------------F--------T-----LA.
Q7VS77_BORPE/8-188-VDHPV--------VAV------H-..D--L--DRTSQQY.R..K---LG------------F--------V-----VP.
Q2KVI0_BORA1/6-182-FDHAV--------IMV------R-.DR--L--DDLAPHYEQ...---QG------------F--------H-----LS.
Q13QK5_BURXL/9-186-LDHVV--------VNA------M-..F--E--TDAAASCFE..A---LG------------F--------A-----LT.
B1M8D4_METRJ/14-190-LDHVV--------INV------L-.RR--M--DE.AADLFA..A---LG------------F--------R-----LT.
E6WJ36_PANSA/10-188-LDHVV--------INV------A-..D--Q--LDAASTLFQ..R---LG------------F--------Q-----LT.
Q213B5_RHOPB/15-192-LDHVV--------INV------M-.GG--L--DEAAAQY.A..R---LG------------F--------Q-----LT.
B9JHP8_AGRRK/10-187-LDHAV--------IGV------L-.DQ--L--DA.AAAVYR..K---LG------------F--------T-----LT.
Q0K796_CUPNH/8-187-FDHAV--------VVC------P-..D--L--DAGARAW.R..R---LG------------F--------T-----LT.
Q89RQ5_BRADU/9-192-IDHAV--------VMV------K-..D--L--DKAAENY.R..Q---LG------------F--------T-----VS.
A6X474_OCHA4/8-190-VDHIF--------LLV------G-..D--L--EKSAEQY.R..R---FG------------F--------T-----LS.
Q7VV42_BORPE/8-199-LDHTG--------LIV------F-..K--L--EDARQAF.E..R---LG------------F--------T-----LTP
Q7VZU9_BORPE/17-205-LDHVG--------LYA------H-..D--M--DAAAAM.YQ..R---LG------------F--------T-----LT.
D3PXN5_STANL/9-232-LHHVG--------LLV------G-..D--M--TAAIDTF.R..D---LG------------F--------H-----IDA
C5C9I8_MICLC/6-186-MDHVS--------YAA------G-PEG--L--DATVARIAE..T---LG------------I--------E-----RI.
A6WG27_KINRD/3-181-VDHVG--------FAA------G-PEG--L--QETARSLAA..R---LG------------V--------R-----VV.
C7Q7Z4_CATAD/3-184-LDHVS--------YAV------S-NSE--L--GSTVNRLGT..L---LG------------A--------T-----FR.
D3Q658_STANL/7-189-FDHLL--------HCV------P-..D--V--EATVAKYSA..A---.G------------L--------P-----...
A4X9C2_SALTO/3-192-IDHVI--------LGA------R-..T--I--APLRELLWE..R---HG------------F--------G-----IT.
A0JUJ0_ARTS2/1-173-MDHVS--------YAC------E-QDG--L--AATTERIAT..A---LG------------V--------E-----AV.
A5VHI4_LACRD/7-201-WDHTM--------VDV------T-..N--L--QDAIDYF.N..S---KG------------L--------A-----FT.
A6T918_KLEP7/6-197-WDHAV--------QFV------N-..Q--P--EAAIEIF.A..G---QQ------------L--------R-----AV.
D0IV05_COMT2/5-180-LDHIV--------IAV------Q-..D--L--ERTIADY.Q..S---LG------------F--------N-----VL.
F2KGG4_PSEBN/11-197-IDHPL--------VTV------R-..N--H--AEALELY.R..R---MG------------F--------A-----PS.
G8PVJ3_PSEUV/4-182-FDHIT--------VIA------P-..T--L--KDGVKHVED..C---LG------------L--------Q-----VP.
Q2FVZ2_STAA8/5-191-FDHII--------HYI------D-..Q--L--DR.FSFPGD..V---..------------I--------K-----LH.
Q5HLY5_STAEQ/5-190-LDHII--------HYL------H-..Q--L--ES.FKFPGE..I---..------------L--------E-----LQ.
Q5L3B6_GEOKA/5-192-FDHLV--------HLT------E-..R--P--EQAKTAF.E..Q---WG------------F--------T-----AI.
Q63W09_BURPS/8-197-LDHLV--------VAA------R-..T--L--EEGVAYVAD..T---LG------------I--------E-----PA.
Q6AAZ6_PROAC/4-172-.DHLM--------FAA------G-PAG--L--DEDAARLGE..I---LG------------T--------S-----FI.
Q6N6G7_RHOPA/5-180-IDHVV--------VAV------A-..N--L--DQAIVDY.R..R---LG------------F--------T-----VE.
Q81NU9_BACAN/4-191-FDHLV--------HAV------H-.GT--P--EEAAKQM.Q..E---LG------------F--------H-----TA.
U5LCG2_9BACI/5-192-LDHIV--------HFI------D-.RH--P--AEAIDKL.N..Q---EG------------L--------K-----GY.
V6F093_9PROT/9-176-LDHLV--------VAA------R-..S--L--GEGIGHIAQ..R---LG------------V--------A-----PT.
V6F8Z3_9PROT/8-187-LDHAV--------IAV------R-..D--L--GLADAVF.H..R---LG------------F--------T-----LT.

PF14506

Q5M2X6_STRT2/13-137-FHTPI--------FRV------N---N--R--QENIDFYQN--T---LG------------F--------K-----L--
Q8DP81_STRR6/14-136-.IIPT--------LKA------N---N--R--KLNETFYIE--T---LG------------M--------K-----A--
Q8DVS0_STRMU/9-132-FYSPV--------LRI------N---N--R--EENIDFYQN--T---LG------------F--------K-----V--
Q8DXW5_STRA5/9-132-FKHPV--------LRV------N---N--R--DLNIAFYQE--S---LG------------F--------K-----L--
Q99Y63_STRP1/9-131-FKTPV--------LRV------N---D--R--DLNIAFYQN--N---LG------------L--------R-----L--

PF06983

Q7CRK9_AGRFC/2-118EKNTIC--------IWY....D.K---D--A--EAAARFYAETFPDSAVT---------------------A-----V--
Q92TY1_RHIME/2-118PKIISH--------LWF....P.E---N--A--REAVDFYVSTIPNSAIS---------------------G-----S--
Q837B9_ENTFA/2-127PKFSPC--------LWF....N.T---Q--A--EEAANFYTTIFEKGAIL---------------------S-----K--
Q73WJ2_MYCPA/2-116PSITPS--------LWF....D.D---N--L--EEAATFYTSVFPNSHIE---------------------G-----F--
Q82NZ5_STRAW/4-119EGFTTC--------LWF....D.G---Q--A--EEAADYYVSVFKNSRLG---------------------R-----V--
Q82XJ9_NITEU/2-119QKIATC--------LWF....DHG---E--A--GKAAEFYAATFPDSRVE---------------------R-----V--
Q6MLW9_BDEBA/2-119TELVTC--------VWF....DHG---E--A--SKAAAFYAKTFPNSEVG---------------------R-----V--
Q9X7R8_STRCO/4-119DGFTTC--------LWF....D.G---D--A--EDAAHFYVSVFKNSGIG---------------------A-----V--
Q97DK8_CLOAB/2-123EKIIPH--------LWY....D.K---E--A--KEAAEFYISLFENSKLL---------------------N-----T--
Q97DK8_CLOAB/132-253QKITPS--------LLFS.GSVTG---K--A--EEAMEFYTSIFENSEIT---------------------F-----I--
Q89SJ1_BRADU/2-118SKLVPC--------MWF....N.G---D--A--EEAAKFYVSLVPNSEIT---------------------H-----V--
Q6N1I9_RHOPA/2-118SKIVPC--------LWF....A.G---E--A--EQAAQFYVSLLPGSRID---------------------N-----I--
Q9CEE8_LACLA/17-136AKIIPS--------LWF....D.N---N--A--KEAMNYYVSVFPNSKIK---------------------N-----I--
Q88GT8_PSEPK/3-119AKNTIC--------LWY....D.H---D--A--EEAANFYARTFPDSRVV---------------------A-----V--
Q74AD9_GEOSL/5-121AKNTIC--------LWY....D.G---D--A--EDAARFYARTFPDSSVG---------------------A-----V--
Q98C01_RHILO/2-116QKITTF--------LWF....D.G---Q--A--EEAMNHYMSIFKNSKEL---------------------S-----V--
Q2G1U2_STAA8/5-129.KITTF--------LMF....N.N---Q--A--EEAVKLYTSLFEDSEII---------------------T-----M--
Q81QE2_BACAN/6-132QKITTF--------LMF....E.G---K--A--EEAMNFYTSLFEQSEIV---------------------S-----I--
Q8F7U5_LEPIN/2-119QKITPF--------LMF....D.N---N--L--GEALKLYASTFSDWKLL---------------------S-----Q--
Q8NP25_CORGL/152-272.AVIPT--------LLFGGAAQ.N---Q--A--GPAQENYVEVFPNSQLG---------------------D-----R--

PF14696

Q124D7_POLSJ/13-161WDNPMGTDGFEFIEYAA------P---D..P..QAMGALFER------MG------------F--------K--------
A5WE99_PSYWF/5-143FDNPMGLRGFDFVEFAS------P---E..P..ALVAELFEK------LG------------F--------T--------
B6IWM9_RHOCS/19-161WENPMGTDGFEFVEFAA------E---D..T..GALDRLFVA------MG------------F--------T--------
Q2NAB6_ERYLH/5-147FENPAGLDGFEFVEFCA------P---E..K..GQLEPVFEA------MG------------F--------T--------
D0J5T0_COMT2/5-143FENPMGLCGFEFVEFAS------P---A..D..GVLEPLFEK------LG------------F--------T--------
Q2SND1_HAHCH/5-146YTNPLGTDGFEFVEFGA------P---D.KAGAESLKPLFET------LG------------F--------T--------
Q0ASV8_MARMM/5-143FENPMGLCGFEFVEFTA------P---E..R..GVIEPVFQA------MG------------F--------T--------
A6VYX1_MARMS/5-143FENPVGLDGFEFVEFAG------P---N..P..EKIAEVFQL------MG------------F--------E--------
Q0BY65_HYPNA/5-146FDNPAGLDGFEFIEFSA------P---E..K..GILEPVFEG------MG------------F--------T--------
B2FKN2_STRMK/6-147FENPMGIDGFEFVEFAA------P---AGRG..QELHEYFRK------MG------------F--------S--------
D5VC74_MORCR/28-166FENPMGLCGFEFVEFAS------P---T..P..NLLEPLFEK------MG------------F--------S--------
Q63PY5_BURPS/6-154WDNPVGTDGFEFIEYTA------P---D..P..KALGQLFER------MG------------F--------T--------
Q87Z77_PSESM/10-148YENPMGLMGFEFIEFAS------P---T..P..NSLEPVFQM------MG------------F--------T--------
Q8PDA4_XANCP/6-147FENPMGIDGFEFVEFAA------P---AGQA..AQLHDYFRK------MG------------F--------T--------

PF06185

Q9CN85_PASMU/28-211QYAEHF--------VQF------R---T--F--EHNIQQLAE--I---MH------------L--------.--------
E6WA61_PANSA/8-184ELKDLE--------QDL------L---R--F--EVALQQFAE--R---LG------------L--------.--------
Q7VP39_HAEDU/11-195KMTACF--------GDL------F---L--F--SQQIEQIAN--L---AQ------------I--------.--------
A1S7G3_SHEAM/3-184.LESLL--------NSW------S---E--F--ETRILALVD--K---LG------------L--------.--------
H2ITZ6_RAHAC/6-182ELQDLT--------DDL------P---R--F--AGVLTAFAA--K---LN------------I--------.--------
F4PTK1_DICFS/6-204TLKTLI--------GDY------D---V--F--LPILFKHLY--K---CG------------L--------.--------
B2VJB7_ERWT9/11-187ELADLA--------ADL------P---R--F--TQLLTHLAQ--R---LA------------L--------.--------
Q54MZ6_DICDI/4-182..KEIV--------GDY------N---S--F--LDTIFELLI--K---GG------------F--------K--------
C9R3D1_AGGAD/12-194KQTALF--------TDF------E---D--F--EQKIHTLAQ--R---LD------------L--------.--------
E0SAV0_DICD3/24-197...SLM--------NDL------S---R--F--ETELQQLAR--Q---LE------------L--------.--------
Y1581_HAEIN/7-187NLTALS--------ADL------A---I--F--ERKIQHLAK--E---MT------------I--------.--------
I0DZQ5_PROSM/9-183ELQDLW--------NTL------P---E--F--EQKLTQMAK--V---LA------------L--------.--------
B7VI23_VIBTL/11-196EPQQMI--------ARL------D---T--F--MTKIENLGN--V---LG------------L--------.--------
Q7N560_PHOLL/9-183ELQDLV--------AEL------A---I--F--EQKLVRFKQ--R---LN------------L--------.--------
Q5E6L1_VIBF1/12-196EPQQLI--------NAL------P---S--F--MEKIQALLD--V---LE------------I--------.--------
YECM_ECOLI/9-185ELQDIA--------SDL------P---R--F--IHALDELSR--R---LG------------L--------.--------
A6VND1_ACTSZ/15-196NSTALY--------REY------V---D--F--ERKIRALAA--E---MR------------I--------.--------
B0UUF0_HISS2/18-194.....L--------DEF------E---Q--F--ERKIIELAH--F---MQ------------L--------.--------
D3VET8_XENNA/9-183ELQDLA--------VDL------A---M--F--EQKLKQFAE--D---LS------------L--------.--------
A3QD08_SHELP/12-194TFDALK--------LQW------P---T--F--SQAILDFMK--E---LG------------L--------.--------
F4HCP7_GALAU/9-190QFPELS--------AQL------I---E--A--EKLFAQILA--L---TQ------------L--------.--------
Q12LL9_SHEDO/6-186..EHLN--------SSW------N---E--F--SQQILGFID--T---LG------------L--------.--------
D3V176_XENBS/22-196ELQDLV--------ADL------A---G--F--EQKLKQFEG--H---LG------------L--------.--------
M9WWR4_MANHA/3-184...ACF--------GDL------S---Q--F--EQKIRQIAE--I---AG------------I--------.--------
F4QBC6_DICFS/15-213EDKEII--------GDY------K---L--F--LDLLFQGIK--G---LG------------I--------.--------
Q87RD4_VIBPA/11-196TPELML--------QDL------D---V--F--MDKIEEFAT--L---LK------------L--------.--------
I2BA68_SHIBC/9-185ELADIV--------DDL------P---R--F--VAKLQQFAA--R---LQ------------L--------.--------
D8MT98_ERWBE/11-187ELNDLS--------NDL------P---R--F--LHSLYQLAD--R---LE------------L--------.--------
B8F673_HAEPS/18-196NLTACF--------GDL------A---E--F--ERKIAQIAK--I---AQ------------I--------.--------
W0HX46_9ENTR/9-183.LLDLK--------IDL------V---R--F--DAELYALTN--R---LG------------I--------.--------
Q65SX5_MANSM/18-195.....Y--------GEF------S---D--F--EQKIATLAQ--E---MK------------V--------.--------
Q6LTA0_PHOPR/10-194HPEQML--------ANL------P---V--F--LDRITALAN--E---LG------------L--------.--------
Q8EF20_SHEON/12-196NYAALE--------RAW------P---A--F--ETKILSLLN--T---LG------------L--------.--------
E1SQM9_FERBD/4-183..DKMM--------ETL------P---A--F--AEKASKLAD--R---LG------------L--------.--------
J7TZ01_MORMO/9-183SLAGLM--------AEL------P---V--F--AGKIQQFAA--D---LQ------------L--------.--------
D4GGT7_PANAM/8-184ELDDLR--------EDL------A---A--F--EQRLQSFSQ--R---LG------------L--------.--------
F7YNG9_VIBA7/11-196HPEQLK--------QNL------D---K--F--MHKIQELTK--I---LH------------I--------.--------
F0LNL8_VIBFN/11-196HPVQMK--------DKL------A---E--F--MHKIQQLSE--L---LH------------M--------.--------
W0L3M1_9ENTR/9-185ELNDLV--------QDL------P---R--F--EQALLQFAE--K---LH------------L--------.--------
C5B833_EDWI9/9-185ELRELA--------ADL------V---R--F--EQALAQLAS--A---LS------------L--------.--------
Q7CIB5_YERPE/9-180ELQDLL--------ADL------P---R--F--EQQLVAFAT--Q---LN------------L--------.--------
D4ZJ81_SHEVD/8-188..QVLT--------DTW------P---I--F--CDKITIFLQ--E---LG------------L--------.--------
B4ETN6_PROMH/11-183..NNLT--------QEL------P---L--F--AKNLTLLAN--K---LS------------L--------.--------
A3MYB0_ACTP2/11-194KMTACF--------GDF------S---E--F--QQKIQQIAH--L---AM------------L--------.--------
Q083X6_SHEFN/2-197NYQHLQ--------HTW------A---D--F--SQRISAFIH--R---LG------------L--------.--------
Q9KQC7_VIBCH/11-196APQQLL--------EKL------D---V--F--IAKIEQLLD--L---LG------------L--------.--------
Q6D475_PECAS/16-190..NDLI--------TDL------A---R--F--ERDLQELAG--V---LQ------------L--------.--------
Q7MMM2_VIBVY/16-201TTQQML--------EDL------P---G--F--MQKIESLAD--L---LQ------------L--------.--------
M4RAR0_BIBTR/11-192KLTACF--------GNL------A---E--F--EQKIQQIAE--I---CG------------I--------.--------

PF12681

Q187Q5_PEPD6/3-120------------T--------LD-L-----------G-------------------------------------------
Q8TUF9_METAC/12-132------------Q--------YD-F-----------G-------------------------------------------
Q97LL1_CLOAB/3-123------------K--------YD-F-----------G-------------------------------------------
A5HYY7_CLOBH/3-121------------I--------LD-L-----------G-------------------------------------------
A9CII6_AGRFC/3-123------------L--------ED-F-----------G-------------------------------------------
Q81BZ3_BACCR/5-127------------K--------AE-H-----------G-------------------------------------------

PF00903

CADE_BACSU/9-123------------L--------KK-T-----------D............................---------------
YQCK_BACSU/2-115------------V--------KV-K-----------T............................---------------
YQJC_BACSU/3-128------------L--------HQ-E-----------T.....................VEE..QK---------------
LGUL_HUMAN/31-174------------I--------QK-C-----------DFPIMKFSLY..FLAYEDKNDIPKE..KD---------------
D5T7F4_LEGP2/151-300------------I--------RF-F-----------NI...................KGKM..TG---------------
CADI_MYCTU/2-114------------A--------KR-K-----------P............................---------------
CF30_MYCTU/11-126------------D--------DN-P-----------V.....................PGG..GG---------------
I7B4U0_PSEPT/143-261------------A--------DV-I-----------DW..................TIGDG..LS---------------
BPHC2_RHOGO/6-121------------V--------YE-G-----------H...........................G---------------
LGUL_PSEPU/24-167------------V--------DK-R-----------DFVEAKFSLY..FLALVDPATIPAD..DD---------------
HPPD_RAT/180-335------------F--------WS-V-----------DDT................QVHTEY..SS---------------
BPHC3_RHOGO/6-122------------V--------YE-N-----------P............................---------------
LGUL_BRAJU/27-171------------L--------KR-L-----------DFSEMKFSLY..FLGYEDTSTAPTD..PT---------------
O24828_9GAMM/150-266------------A--------EQ-V-----------M............................---------------
LGUL_SYNY3/2-123------------L--------RK-K-----------DYPSGEFTL.....AFVGYGKE.......---------------
O26852_METTH/2-112------------D--------SH-Y-----------D.....................LGA..SG---------------
P95571_9PSED/143-280------------S--------DV-I-----------DI..................AMGPD..IT---------------
LGUL_NEIMB/2-123------------L--------RR-K-----------DYPEGRFTL.....AFVGYGDE.......---------------
Q98LB0_RHILO/89-205------------R--------FT-Y-----------G..........................EP---------------
Q98HZ4_RHILO/7-135------------V--------FA-Y-----------P....................ADEK..GR---------------
FOSB_BACSU/5-117------------L--------VK-G-----------R............................---------------
Q9KZ01_STRCO/31-158------------T--------VV-T-----------YKDAGD...........VRDPAAAD..QV---------------
MHQE_BACSU/5-263------------V--------KK-T-----------VNFDDPGTYHFYFGNQNGDPGTIMTFFPF---------------
P72786_SYNY3/14-143------------L--------AG-E-----------EIPL..............TLKTMVE..EG---------------
O53680_MYCTU/15-163------------I--------KA-L-----------D....................LPGG..QG---------------
YRAH_BACSU/2-124------------S--------WL-E-----------N...........................E---------------
FOSB_STAEP/4-116------------L--------VE-G-----------E............................---------------
O68311_GEOTH/148-265------------S--------EK-V-----------V............................---------------
YYAH_BACSU/2-124------------N--------DL-Y-----------H....................NEKK..DF---------------
YETH_BACSU/4-118------------A--------AD-H-----------P....................MGPE..AS---------------
Q9ZNP0_COMTE/147-272------------T--------EQ-I-----------L............................---------------
Q9ZAY0_9SPHN/150-267------------T--------EE-A-----------V............................---------------
O06412_MYCTU/4-113------------A--------RE-Y-----------G............................---------------
LGUL_HAEIN/2-123------------L--------RT-S-----------ENPEYKYTL.....AFLGYEDG.......---------------
D5AV60_RHOCB/8-122------------L--------ST-E-----------N............................---------------
YYCE_BACSU/11-130------------I--------GE-F-----------S....................QHNG..YD---------------
C3JUU8_RHOER/142-267------------R--------DS-M-----------RLPPQ............MVGRPADG..DP---------------
MHQO_BACSU/7-266------------V--------KQ-T-----------VNFDDPGTYHLYFGNEGGKPGTIITFFPW---------------
HPPD_PSEUJ/158-310------------I--------RY-F-----------DI...................KGEY..TG---------------
Q45135_9MICO/152-268------------T--------ED-I-----------Q............................---------------
N9VUR8_PSEPU/150-266------------A--------EQ-V-----------L............................---------------
LGUL_BRAOG/17-138------------L--------RK-R-----------DVPEEKYSN.....AFLGFGPE.......---------------
Q9I3Z1_PSEAE/3-131------------E--------AM-L-----------PFGDSPE.........CGDIPADWK..DK---------------
Q9KYP6_STRCO/2-118------------T--------WA-T-----------ED...................FAEL..RT---------------
MHQA_BACSU/5-275------------V--------KK-S-----------VNQDEPTMYHLFYGDEVANPGTELTFFEI---------------
Q59693_PSEPU/147-272------------S--------EQ-G-----------L............................---------------
LGUL_SCHPO/11-150------------I--------DQ-W-----------VFEENEFSLS..FLAFDGPGALNHG..VE---------------
LGUL_SALTY/2-123------------L--------RT-S-----------ENPEYKYSL.....AFVGYGPE.......---------------
Y3691_SHEFN/4-116------------I--------ED-T-----------Y....................QAEQ..DK---------------
Q9KZG9_STRCO/4-130------------A--------LN-T-----------FGSA..............GMPDPAY..TD---------------
YURT_BACSU/2-124------------K--------ED-V-----------P.....................MGK..FR---------------
YWKD_BACSU/5-125------------I--------QE-T-----------Y....................REER..GS---------------
Q52533_PSESP/147-267------------S--------DI-I-----------RA..................EVRPG..YV---------------
MCE_PYRHO/7-131------------E--------EI-E-----------E.....................VPD..QK---------------
P97099_CUPNE/143-262------------S--------DI-I-----------DI..................QMGPE..MS---------------
DNRV_STRPE/8-133------------T--------VV-S-----------D.......................P..GA---------------
P73508_SYNY3/5-122------------G--------RE-T-----------D...........................K---------------
HMAS_AMYOR/158-306------------I--------FD-E-----------HI...................VVGA..QA---------------
O86701_STRCO/4-132------------R--------ND-V-----------G....................YEGM..RW---------------
Q7AQ90_MYCLE/20-150------------V--------HE-E-----------VND................DQGIRE..AM---------------
LGUL_YEAST/22-164------------L--------SR-K-----------DFEEAKFSLY..FLSFPKDDIPKNK..NG---------------
C1KH52_SERMA/4-114------------H--------AR-W-----------N............................---------------
C3LUW7_VIBCM/6-113------------V--------DY-G-----------P............................---------------
Q9Z549_STRCO/4-125------------P--------EG-S-----------E..........................GQ---------------
Q48341_STRLI/5-125------------L--------GR-V-----------S.....................TEE..GL---------------
O32376_COMTE/143-262------------S--------DV-I-----------DM..................KMGAG..VT---------------
O69350_RHOER/145-267------------R--------GA-F-----------RLP.................APPEF..GP---------------
GLOD4_CAEEL/132-248------------V--------EE-K-----------S...........................S---------------
YAER_ECOLI/6-126------------Q--------SE-V-----------Y....................REAR..DS---------------
O86906_SPHSX/146-261------------S--------DY-I-----------V.......................F..GG---------------
O28796_ARCFU/50-170------------K--------LH-T-----------P.......................E..YG---------------
O05205_STRLA/4-125------------P--------AE-A-----------D..........................SA---------------
I7MMZ2_TETTS/194-350------------F--------WS-V-----------DDS................MIHTEF..SS---------------
Q9I5D5_PSEAE/8-139------------K--------LV-V-----------PGE................DGQVLH..AE---------------
O87625_PSEAI/152-264------------S--------DR-A-----------F............................---------------
Q50912_SPHXE/13-131------------V--------AR-A-----------A....................DGPY..KG---------------
A5W4G6_PSEP1/11-255------------V--------KQ-D-----------G............................---------------
Q59770_RHORH/162-279------------R--------EA-L-----------R............................---------------
YWBC_BACSU/4-123------------K--------DR-I-----------TH..................TNGVI..EL---------------
Q9KEK2_BACHD/4-140------------I--------TI-Q-----------TYGDLPEQPNSPMASVNKDLILHAH..LK---------------
O28065_ARCFU/4-128------------E--------EI-E-----------E.....................VAE..QK---------------
A2YS08_ORYSI/24-146------------L--------RK-R-----------DVPEEKYTN.....AFLGFGPE.......---------------

PF13669

A9C2R0_DELAS/14-124............T........GT.F........Q..S............E..............R.............E.
A2SEJ1_METPP/12-122............T........GH.F........V..S............E..............R.............E.
D0LXQ3_HALO1/13-123............T........GS.Y........R..S............E..............R.............E.
Q5P377_AROAE/12-122............T........GN.F........V..S............E..............R.............E.
Q1D6F8_MYXXD/37-147............H........GT.Y........R..S............E..............R.............E.
B8BYE7_THAPS/75-187............I........GN.F........K..S............E..............K.............E.
B5Y3L3_PHATC/38-148............E........SS.V........R..I............E..............S.............E.
A4HEL0_LEIBR/19-133............S........DP.V........R..Q............E..............E.............H.
D4J6L0_9FIRM/18-126............D........YR.G........H..V............K..............A.............Y.
D2RXZ8_HALTV/10-118............I........HE.E........A..S............E..............Y.............G.
Q39TG0_GEOMG/11-132............W........QF.Y........N..L............D..............K.............S.
D3F6C9_CONWI/9-133............W........RI.W........T..Y............G..............P.............R.
A6LI20_PARD8/8-119............S........VT.I........F..D............P..............V.............Q.
Q97H22_CLOAB/4-114............E........SE.V........V...............R..............D.............E.
B9JM51_AGRRK/6-125............W........YR.G........R..M............E..............T.............M.
C5CVE4_VARPS/9-131............I........KN.Y........R..Y............N..............G.............Q.
Q13K82_BURXL/9-131............I........EN.Y........T..Y............R..............G.............QT
Q13I71_BURXL/19-140............T.......GAE.Y........R..R............K..............P.............T.
Q5UWE3_HALMA/10-117............L........IE.E........S..V............E............................G.
C0ZEG8_BREBN/1496-1609............S........DS.L........Q..D............P..............E.............Q.
D4M9A6_9BACT/4-116............S........GT.P........V..D............D..............A............IR.
Q12HJ2_POLSJ/9-131............WFYNPKVPIKN.Y........SYKG............E..............S.............H.
D2RQ64_HALTV/17-139............W........EI.Y........R..F............EPPALTDRTYRGEPHE.............Y.
A5VBF6_SPHWW/10-129............W........TV.F........R..NVTLD...GAYRGA..............P.............T.
A1TCL4_MYCVP/8-130............W........YV.I........R..E............M..............P.............Q.
C7PR30_CHIPD/14-138............P........QP.E........Q..V............R..............A.............Q.
A4XEN6_NOVAD/16-137............AT......YRR.A........P..S............E..............G.............I.
A5G6D6_GEOUR/8-118............E........GDLF........A..D............P..............V.............Q.
Q2YCD2_NITMU/13-126............A........RQ.V........Y..D............P..............L.............Q.
B1MB48_MYCA9/17-139............W........TR.I........P..DVHFGPETCTYRGA..............P.............A.
A0R1J5_MYCS2/10-129............R........VR.F........R..G............E..............P.............C.
C7RS60_ACCPU/18-128............E........GEAF........V..D............P..............I.............Q.
D5URS6_TSUPD/111-214............R........LD..........R..V............Q..............S.............W.
D0LDW1_GORB4/120-238............R........LD.R........R..I............P..............DVGAPGPETPESGEP.
A5V4C1_SPHWW/15-137............E........AQ.Y........R..G............R..............P.............S.
E0UKN1_CYAP2/120-235............T........DP.QYFHIPRLED..P............E..............P.............H.
Q2G768_NOVAD/15-136............L........DH.F........L..G............P..............D.............QF
Q744Q1_MYCPA/12-125............ITPVSYTLPFR.T........V..S............G..............T.............R.
D2AXE6_STRRD/3-112............L........GY.Q........S..F............Q..............E.............W.
B8FMX2_DESAA/10-131............F........WT.K........K..V............P..............VEDFQ....YMGKPS.
C5C099_BEUC1/20-129............Y........SA.Y.......................................D.............T.
Q15VI5_PSEA6/7-112............R........WS.G........P..A............K..............D.............D.
A2QUW1_ASPNC/11-144............F........QV.Y........H..F............N..............S.............ET
Q28K59_JANSC/19-130............H........GD.L........A..S............W..............A.............A.
A1SVB5_PSYIN/4-112............T........DI.I........Y..D............E..............L.............Q.
C7NIJ3_KYTSD/10-119............Y........QP.F........Q..D............W..............P.............G.
A4SXB6_POLSQ/12-122............K........ST.F........V..S............E..............R.............E.
A4XGA4_CALS8/13-134............P........QI.I........E..T............E..............G.............YE
B0RG81_CLAMS/8-115............E........LG.Y........A..E............D..............V.............S.
B2HSW2_MYCMM/9-134............W........VR.I........P..DVHFAPDSCSYRGK..............P.............A.
B8E0B0_DICTD/13-133IIITDVYEKAHTE........YK.G........K..P............T..............S.............A.
F3Z5I0_9ACTN/9-118............H........QE.W........D..G...........................................
R5SQY8_9FIRM/9-124............S.......LPD.E........T..V............E..............E.............Q.

PF13468

C5BVV5_BEUC1/6-191.........EGGW--------LT.EM..........P-------------------------------------------
Q3IZS4_RHOS4/4-171.........PGGA--------HP.LM..........A-------------------------------------------
Q28LV8_JANSC/4-176.........PGGE--------HP.DM..........G-------------------------------------------
D7BGN4_MEISD/10-187.........PGGQ--------HP.QM..........G-------------------------------------------
D3PMM6_MEIRD/4-173........PAGGR--------HP.LM..........G-------------------------------------------
Q1IXF9_DEIGD/4-178.........PGGE--------HA.SF..........G-------------------------------------------
A9HYM0_BORPD/5-178.........PGGA--------HP.RM..........G-------------------------------------------
Q47D15_DECAR/6-180.........VGGE--------HP.RM..........A-------------------------------------------
A9B642_HERA2/8-182.........AGGQ--------HQ.AM..........A-------------------------------------------
D2QC41_SPILD/11-185.........PGGQ--------HL.TM..........G-------------------------------------------
B8IP73_METNO/4-183.........AGGR--------HP.EM..........G-------------------------------------------
B1LV77_METRJ/4-183.........EGGR--------HR.EM..........G-------------------------------------------
C5CLJ8_VARPS/5-199.........PGGS--------HP.LM..........G-------------------------------------------
D3Q0J0_STANL/2-177.........PGGA--------HP.GL..........G-------------------------------------------
B5HRA1_9ACTN/8-184.........PGGV--------HV.GL..........G-------------------------------------------
A4FK05_SACEN/2-174.........PGGR--------HA.GK..........G-------------------------------------------
C7MHL9_BRAFD/7-186.........PGGA--------HP.T...........G-------------------------------------------
A6WBM6_KINRD/7-183.........PGGV--------HP.GT..........G-------------------------------------------
B7FUP4_PHATC/255-429.........IAGT--------IK.GL..........G-------------------------------------------
B7FSM2_PHATC/69-245.........MVVS--------LN.GL..........G-------------------------------------------
C0ZG21_BREBN/5-195.........AGGR--------HA.SW..........G-------------------------------------------
Q8ELK5_OCEIH/5-195.........QGGK--------HV.NL..........G-------------------------------------------
B1HV56_LYSSC/5-194.........NGGQ--------HT.MW..........G-------------------------------------------
Q5WBL3_BACSK/5-198.........YGGR--------HE.KR..........G-------------------------------------------
B9DM11_STACT/6-192.........PGGL--------HN.RY..........A-------------------------------------------
B9E9H1_MACCJ/8-191.........NGGK--------HE.QL..........G-------------------------------------------
D1CHQ7_THET1/9-194.........PGGR--------HE.GR..........G-------------------------------------------
D1C9M3_SPHTD/5-190.........PGGR--------HT.GL..........G-------------------------------------------
A5UPV1_ROSS1/5-179.........PGGV--------HA.DG..........A-------------------------------------------
B0D2X2_LACBS/11-211.........PGGE--------HV.GG..........L-------------------------------------------
B9L3L2_THERP/5-180.........PGGT--------HP.T...........G-------------------------------------------
Q0UPP1_PHANO/6-192.........PGGV--------HA.DG..........I-------------------------------------------
A7I5C5_METB6/53-255.........AGGE--------HG.GN..........D-------------------------------------------
Q11EY7_CHESB/5-184.........QRMD--------AG.KG..........P-------------------------------------------
C7N101_SLAHD/3-183.........YGKE--------KN.P............-------------------------------------------
Q215A9_RHOPB/5-194.........GRNV--------HP.W...........G-------------------------------------------
A7IN29_XANP2/5-195.........ARNR--------HP.W...........G-------------------------------------------
Q92KD8_RHIME/11-203.........DEAR--------HP.F...........G-------------------------------------------
B9JW73_AGRVS/9-199.........PDGH--------HP.F...........G-------------------------------------------
Q2W045_MAGSA/8-179.........TKGE--------HA.EW..........G-------------------------------------------
Q7VS77_BORPE/8-188.........PSGK--------HQ.EW..........G-------------------------------------------
Q2KVI0_BORA1/6-182.........DKSV--------HN.L...........G-------------------------------------------
Q13QK5_BURXL/9-186.........PRGY--------HS.L...........G-------------------------------------------
B1M8D4_METRJ/14-190.........PRGH--------HS.L...........G-------------------------------------------
E6WJ36_PANSA/10-188.........ERGH--------HS.L...........G-------------------------------------------
Q213B5_RHOPB/15-192.........ERGH--------HT.L...........G-------------------------------------------
B9JHP8_AGRRK/10-187.........PRGY--------HT.L...........G-------------------------------------------
Q0K796_CUPNH/8-187.........PRGY--------HT.L...........G-------------------------------------------
Q89RQ5_BRADU/9-192.........PRGT--------HSAHM..........G-------------------------------------------
A6X474_OCHA4/8-190.........PRGL--------HSKEK..........G-------------------------------------------
Q7VV42_BORPE/8-199RSMHAGALTPGGP--------VV.PW..........G-------------------------------------------
Q7VZU9_BORPE/17-205.........PLSQ--------HS.GTHAVTREVVKAG-------------------------------------------
D3PXN5_STANL/9-232PAYPALPPVPGAA--------PE.PI..........G-------------------------------------------
C5C9I8_MICLC/6-186.........KGGV--------HP.RF..........G-------------------------------------------
A6WG27_KINRD/3-181.........DGGP--------HP.RF..........G-------------------------------------------
C7Q7Z4_CATAD/3-184.........DGGV--------HP.RF..........G-------------------------------------------
D3Q658_STANL/7-189.........AHAN--------EP.FE..........G-------------------------------------------
A4X9C2_SALTO/3-192.........DGSP--------NP.D...........G-------------------------------------------
A0JUJ0_ARTS2/1-173.........KGGV--------HP.RF..........G-------------------------------------------
A5VHI4_LACRD/7-201.........PGGH--------HE.YW..........G-------------------------------------------
A6T918_KLEP7/6-197.........AGGR--------HP.GW..........G-------------------------------------------
D0IV05_COMT2/5-180.........RGGE--------HP.GR..........S-------------------------------------------
F2KGG4_PSEBN/11-197.........PVSY--------HP.W...........G-------------------------------------------
G8PVJ3_PSEUV/4-182.........FGVC--------HD.YM..........G-------------------------------------------
Q2FVZ2_STAA8/5-191.........SGGY--------HH.KY..........G-------------------------------------------
Q5HLY5_STAEQ/5-190.........NGGR--------HH.HL..........G-------------------------------------------
Q5L3B6_GEOKA/5-192.........HGGR--------HP.SW..........G-------------------------------------------
Q63W09_BURPS/8-197.........GGGA--------HP.SM..........R-------------------------------------------
Q6AAZ6_PROAC/4-172.........NGGV--------HP.SF..........G-------------------------------------------
Q6N6G7_RHOPA/5-180.........AGGE--------HP.GR..........G-------------------------------------------
Q81NU9_BACAN/4-191.........LGGE--------HT.IW..........G-------------------------------------------
U5LCG2_9BACI/5-192.........MGGR--------HP.LW..........G-------------------------------------------
V6F093_9PROT/9-176.........LGGK--------HA.RM..........G-------------------------------------------
V6F8Z3_9PROT/8-187.........PRGE--------HP.EW..........G-------------------------------------------

PF14506

Q5M2X6_STRT2/13-137---------------------LT---------------------------------------------------------
Q8DP81_STRR6/14-136---------------------LL---------------------------------------------------------
Q8DVS0_STRMU/9-132---------------------LS---------------------------------------------------------
Q8DXW5_STRA5/9-132---------------------IS---------------------------------------------------------
Q99Y63_STRP1/9-131---------------------VS---------------------------------------------------------

PF06983

Q7CRK9_AGRFC/2-118------------H--------HAPSDF.HS...GKKG-------------------------------------------
Q92TY1_RHIME/2-118------------T--------TVPAET.PS...GPPG-------------------------------------------
Q837B9_ENTFA/2-127------------T--------NYVNEEHQP....QGT-------------------------------------------
Q73WJ2_MYCPA/2-116------------N--------RTTEAG.PG....EPG-------------------------------------------
Q82NZ5_STRAW/4-119------------G--------RYPEGG.PG....PAG-------------------------------------------
Q82XJ9_NITEU/2-119------------N--------TAPGDF.PG...GQEG-------------------------------------------
Q6MLW9_BDEBA/2-119------------N--------TAPGDF.PG...GKKG-------------------------------------------
Q9X7R8_STRCO/4-119------------T--------RYPEGA.PQ....PAG-------------------------------------------
Q97DK8_CLOAB/2-123------------A--------VLDNT........PSG-------------------------------------------
Q97DK8_CLOAB/132-253------------N--------RYAEGEAKA....KNA-------------------------------------------
Q89SJ1_BRADU/2-118------------Q--------RNVSDG.PS...GKTG-------------------------------------------
Q6N1I9_RHOPA/2-118------------Q--------RSVVDT.PG...GPEG-------------------------------------------
Q9CEE8_LACLA/17-136------------E--------YYPDEKLDEHFVGMSG-------------------------------------------
Q88GT8_PSEPK/3-119------------H--------QAPADY.PS...GKQG-------------------------------------------
Q74AD9_GEOSL/5-121------------F--------RAPGDF.PS...GKKG-------------------------------------------
Q98C01_RHILO/2-116------------T--------RWPKGH.AD.....EG-------------------------------------------
Q2G1U2_STAA8/5-129------------A--------KYGENG.PG....DPG-------------------------------------------
Q81QE2_BACAN/6-132------------S--------RYDENG.PG....KEG-------------------------------------------
Q8F7U5_LEPIN/2-119------------N--------QTGD............-------------------------------------------
Q8NP25_CORGL/152-272------------A--------PYGQQTGPA....TPE-------------------------------------------

PF14696

Q124D7_POLSJ/13-161---------PIAR--------HR-------------H-------------------------------------------
A5WE99_PSYWF/5-143---------HVAN--------HR-------------S-------------------------------------------
B6IWM9_RHOCS/19-161---------QVAR--------HR-------------T-------------------------------------------
Q2NAB6_ERYLH/5-147---------HVAT--------HR-------------S-------------------------------------------
D0J5T0_COMT2/5-143---------LVAK--------HR-------------S-------------------------------------------
Q2SND1_HAHCH/5-146---------AIAR--------HK-------------R-------------------------------------------
Q0ASV8_MARMM/5-143---------HIAN--------HR-------------S-------------------------------------------
A6VYX1_MARMS/5-143---------LVAK--------HR-------------S-------------------------------------------
Q0BY65_HYPNA/5-146---------KVAR--------HR-------------S-------------------------------------------
B2FKN2_STRMK/6-147---------AVLK--------HK-------------Q-------------------------------------------
D5VC74_MORCR/28-166---------LVAK--------HR-------------S-------------------------------------------
Q63PY5_BURPS/6-154---------AVAR--------HR-------------H-------------------------------------------
Q87Z77_PSESM/10-148---------KVAT--------HR-------------S-------------------------------------------
Q8PDA4_XANCP/6-147---------AVLR--------HR-------------S-------------------------------------------

PF06185

Q9CN85_PASMU/28-211---------..DL--------SQ-Y-------------------------------------------------------
E6WA61_PANSA/8-184---------..QL--------SE-H-------------------------------------------------------
Q7VP39_HAEDU/11-195---------..AL--------DQ-F-------------------------------------------------------
A1S7G3_SHEAM/3-184---------..TD--------LK-L-------------------------------------------------------
H2ITZ6_RAHAC/6-182---------..NL--------DE-F-------------------------------------------------------
F4PTK1_DICFS/6-204---------..PV--------DQ-L-------------------------------------------------------
B2VJB7_ERWT9/11-187---------..DL--------LP-L-------------------------------------------------------
Q54MZ6_DICDI/4-182---------ENEL--------KE-L-------------------------------------------------------
C9R3D1_AGGAD/12-194---------..NL--------SE-Y-------------------------------------------------------
E0SAV0_DICD3/24-197---------..DL--------AA-F-------------------------------------------------------
Y1581_HAEIN/7-187---------..DL--------SH-Y-------------------------------------------------------
I0DZQ5_PROSM/9-183---------..SL--------ND-H-------------------------------------------------------
B7VI23_VIBTL/11-196---------..DL--------SF-A-------------------------------------------------------
Q7N560_PHOLL/9-183---------..NV--------EQ-Y-------------------------------------------------------
Q5E6L1_VIBF1/12-196---------..DL--------TQ-Y-------------------------------------------------------
YECM_ECOLI/9-185---------..NI--------TP-L-------------------------------------------------------
A6VND1_ACTSZ/15-196---------..NL--------AD-Y-------------------------------------------------------
B0UUF0_HISS2/18-194---------..RL--------DR-V-------------------------------------------------------
D3VET8_XENNA/9-183---------..YF--------TQ-Y-------------------------------------------------------
A3QD08_SHELP/12-194---------..DG--------LD-L-------------------------------------------------------
F4HCP7_GALAU/9-190---------..DR--------LH-L-------------------------------------------------------
Q12LL9_SHEDO/6-186---------..SQ--------AE-L-------------------------------------------------------
D3V176_XENBS/22-196---------..HF--------EQ-Y-------------------------------------------------------
M9WWR4_MANHA/3-184---------..DL--------AA-Y-------------------------------------------------------
F4QBC6_DICFS/15-213---------..NV--------DG-L-------------------------------------------------------
Q87RD4_VIBPA/11-196---------..DL--------SF-A-------------------------------------------------------
I2BA68_SHIBC/9-185---------..DT--------RP-L-------------------------------------------------------
D8MT98_ERWBE/11-187---------..DL--------AQ-L-------------------------------------------------------
B8F673_HAEPS/18-196---------..DL--------SQ-Y-------------------------------------------------------
W0HX46_9ENTR/9-183---------..LP--------EA-F-------------------------------------------------------
Q65SX5_MANSM/18-195---------..DL--------SL-Y-------------------------------------------------------
Q6LTA0_PHOPR/10-194---------..SL--------EQ-Y-------------------------------------------------------
Q8EF20_SHEON/12-196---------..AD--------KG-L-------------------------------------------------------
E1SQM9_FERBD/4-183---------..LR--------AG-L-------------------------------------------------------
J7TZ01_MORMO/9-183---------..DL--------TH-Y-------------------------------------------------------
D4GGT7_PANAM/8-184---------..DN--------AG-L-------------------------------------------------------
F7YNG9_VIBA7/11-196---------..DL--------ST-N-------------------------------------------------------
F0LNL8_VIBFN/11-196---------..DL--------ST-H-------------------------------------------------------
W0L3M1_9ENTR/9-185---------..DL--------SQ-F-------------------------------------------------------
C5B833_EDWI9/9-185---------..DL--------AH-F-------------------------------------------------------
Q7CIB5_YERPE/9-180---------..DL--------TQ-F-------------------------------------------------------
D4ZJ81_SHEVD/8-188---------..EQ--------LM-L-------------------------------------------------------
B4ETN6_PROMH/11-183---------..DL--------DA-Y-------------------------------------------------------
A3MYB0_ACTP2/11-194---------..DL--------SQ-F-------------------------------------------------------
Q083X6_SHEFN/2-197---------..EN--------LA-L-------------------------------------------------------
Q9KQC7_VIBCH/11-196---------..DL--------RA-N-------------------------------------------------------
Q6D475_PECAS/16-190---------..DL--------GA-F-------------------------------------------------------
Q7MMM2_VIBVY/16-201---------..DL--------SF-A-------------------------------------------------------
M4RAR0_BIBTR/11-192---------..DL--------SQ-F-------------------------------------------------------

PF12681

Q187Q5_PEPD6/3-120---------------------------------------E-H---------VS-FEN--G--F..GL.....Q..S--N.
Q8TUF9_METAC/12-132---------------------------------------E-N---------VS-FEG--G--FVIHL.....K..S--H.
Q97LL1_CLOAB/3-123---------------------------------------E-N---------VV-YEG--D--F..SL.....QLKS--H.
A5HYY7_CLOBH/3-121---------------------------------------K-N---------VT-FSG--G--F..AI.....Q..E--D.
A9CII6_AGRFC/3-123---------------------------------------S-F---------VL-FET--G--F..AI.....H..E--GR
Q81BZ3_BACCR/5-127---------------------------------------T-Y---------IE-FNT--G--T..TILAMNTR..Q--D.

PF00903

CADE_BACSU/9-123------------------------------.--------R-Q---------AE-LTA--D--G------------K--R-
YQCK_BACSU/2-115------------------------------.--------D-Y---------AK-FLL--E--T------------P--G-
YQJC_BACSU/3-128------------------------------V--------N-V---------AF-FQA--G--S------------V--K-
LGUL_HUMAN/31-174------------------------------E--------K-I---------AW-ALS--R--K------------A--T-
D5T7F4_LEGP2/151-300------------------------------L--------V-S---------RA-LGS--P--C------------G--K-
CADI_MYCTU/2-114------------------------------.--------G-Y---------AN-FAI--A--D------------P--P-
CF30_MYCTU/11-126------------------------------V--------Y-S---------MA-TLN--G--E------------A--V-
I7B4U0_PSEPT/143-261------------------------------V--------T-L---------YF-LYC--N--G------------R--H-
BPHC2_RHOGO/6-121------------------------------L--------C-F---------IT-FDE--E--H------------H--R-
LGUL_PSEPU/24-167------------------------------A--------R-H---------QW-MKS--I--P------------G--V-
HPPD_RAT/180-335------------------------------L--------R-S---------IV-VAN--Y--E------------E--S-
BPHC3_RHOGO/6-122------------------------------.--------A-M---------CF-LTT--D--E------------E--H-
LGUL_BRAJU/27-171------------------------------E--------R-T---------VW-TFG--R--P------------A--T-
O24828_9GAMM/150-266------------------------------.--------.-.---------..-APD--G--K------------R--V-
LGUL_SYNY3/2-123------------------------------.--------.-.---------..-..S--E--N------------A--V-
O26852_METTH/2-112------------------------------E--------I-T---------IL-RGE--G--E------------A--M-
P95571_9PSED/143-280------------------------------V--------R-G---------YF-LHC--N--G------------R--H-
LGUL_NEIMB/2-123------------------------------.--------.-.---------..-..T--D--S------------T--V-
Q98LB0_RHILO/89-205------------------------------P--------F-Y---------AQ-IIR--D--G------------A--R-
Q98HZ4_RHILO/7-135------------------------------T--------M-H---------IH-LHI--N--G------------S--T-
FOSB_BACSU/5-117------------------------------.--------T-T---------AY-FDM--N--G------------I--W-
Q9KZ01_STRCO/31-158------------------------------M--------F-G---------QV-STA--D--G------------P--S-
MHQE_BACSU/5-263------------------------------Q--------G-S---------GQ-GTV--G--K------------G--Q-
P72786_SYNY3/14-143------------------------------K--------V-S---------NF-ITP--D--G------------T--V-
O53680_MYCTU/15-163------------------------------Q--------H-F---------FF-DAG--N--G------------D--C-
YRAH_BACSU/2-124------------------------------M--------E-Y---------AL-FDN--G--E------------T--K-
FOSB_STAEP/4-116------------------------------.--------T-S---------AY-FNL--G--G------------I--W-
O68311_GEOTH/148-265------------------------------.--------.-.---------EN-ERS--E--T------------P--I-
YYAH_BACSU/2-124------------------------------K--------S-Y---------FI-TFD--S--G------------A--R-
YETH_BACSU/4-118------------------------------W--------L-E---------VA-PKG--A--E------------T--R-
Q9ZNP0_COMTE/147-272------------------------------.--------.-.---------VG-PEG--N--M------------Q--A-
Q9ZAY0_9SPHN/150-267------------------------------.--------.-.---------.D-EST--G--Q------------R--L-
O06412_MYCTU/4-113------------------------------.--------A-G---------TV-FFA--G--Q------------S--L-
LGUL_HAEIN/2-123------------------------------.--------.-.---------..-..E--S--A------------A--E-
D5AV60_RHOCB/8-122------------------------------.--------.-.---------GY-FIA--D--E------------L--V-
YYCE_BACSU/11-130------------------------------G--------V-M---------FG-LPH--A--D------------Y--H-
C3JUU8_RHOER/142-267------------------------------A--------W-L---------RF-LGC--N--P------------R--H-
MHQO_BACSU/7-266------------------------------A--------G-A---------RQ-GVI--G--D------------G--Q-
HPPD_PSEUJ/158-310------------------------------L--------T-S---------KA-MTA--P--D------------G--M-
Q45135_9MICO/152-268------------------------------.--------.-.---------..-DDE--G--T------------T--Y-
N9VUR8_PSEPU/150-266------------------------------.--------.-.---------..-DEN--G--T------------R--V-
LGUL_BRAOG/17-138------------------------------.--------.-.---------..-..T--S--N------------F--V-
Q9I3Z1_PSEAE/3-131------------------------------I--------M-H---------AR-LVV--G--S------------F--A-
Q9KYP6_STRCO/2-118------------------------------P--------S-G---------TL-AIG--S--T------------R--T-
MHQA_BACSU/5-275------------------------------P--------R-I---------AP-FHA--G--T------------N--S-
Q59693_PSEPU/147-272------------------------------.--------.-.---------VG-PDA--S--T------------Q--A-
LGUL_SCHPO/11-150------------------------------R--------S-.---------..-..K--R--E------------G--I-
LGUL_SALTY/2-123------------------------------.--------.-.---------..-..T--E--E------------A--V-
Y3691_SHEFN/4-116------------------------------R--------W-V---------VV-SPP--G--S------------N--G-
Q9KZG9_STRCO/4-130------------------------------K--------I-M---------HG-MLE--T--P------------S--G-
YURT_BACSU/2-124------------------------------W--------I-T---------LV-SPD--D--Q------------D--G-
YWKD_BACSU/5-125------------------------------Y--------K-L---------DL-SLN--G--S------------Y--V-
Q52533_PSESP/147-267------------------------------A--------E-A---------AF-FHT--V--G------------G--R-
MCE_PYRHO/7-131------------------------------V--------K-V---------AV-IKV--G--E------------N--R-
P97099_CUPNE/143-262------------------------------V--------P-A---------HF-LHC--N--G------------R--H-
DNRV_STRPE/8-133------------------------------G--------G-Y---------TT-FSS--D--G------------K--L-
P73508_SYNY3/5-122------------------------------A--------I-I---------LD-FYG--H--Q------------V--V-
HMAS_AMYOR/158-306------------------------------M--------N-S---------TV-VQS--A--S------------G--A-
O86701_STRCO/4-132------------------------------V--------T-L---------GS-PAQ--P--D------------V--D-
Q7AQ90_MYCLE/20-150------------------------------L--------S-A---------HG-API--G--T------------T--Q-
LGUL_YEAST/22-164------------------------------E--------P-D---------..-VFS--A--H------------G--V-
C1KH52_SERMA/4-114------------------------------.--------T-G---------AY-LTC--G--D------------L--W-
C3LUW7_VIBCM/6-113------------------------------.--------E-Y---------TA-FSN--E--G------------L--D-
Q9Z549_STRCO/4-125------------------------------P--------H-A---------EA-ALP--G--G------------I--R-
Q48341_STRLI/5-125------------------------------I--------G-H---------AE-IRV--G--D------------T--V-
O32376_COMTE/143-262------------------------------I--------P-T---------YF-LHC--N--E------------R--H-
O69350_RHOER/145-267------------------------------L--------R-I---------RF-MGV--N--E------------R--H-
GLOD4_CAEEL/132-248------------------------------R--------I-R---------MS-YGD--G--Q------------C--E-
YAER_ECOLI/6-126------------------------------W--------K-G---------DL-ALN--G--Q------------Y--V-
O86906_SPHSX/146-261------------------------------N--------K-V---------HF-THI--N--P------------R--H-
O28796_ARCFU/50-170------------------------------L--------A-I---------VV-SPE--D--P------------D--G-
O05205_STRLA/4-125------------------------------P--------H-T---------EA-VLD--G--G------------I--R-
I7MMZ2_TETTS/194-350------------------------------L--------R-S---------IV-MTD--Y--D------------Q--K-
Q9I5D5_PSEAE/8-139------------------------------L--------T-Y---------AS-PNG--A--N------------G--M-
O87625_PSEAI/152-264------------------------------.--------D-I---------LE-FLR--G--A------------A--G-
Q50912_SPHXE/13-131------------------------------G--------V-F---------LS-FGV--S--D------------H--D-
A5W4G6_PSEP1/11-255------------------------------.--------D-I---------AY-FRC--S--R------------D--H-
Q59770_RHORH/162-279------------------------------.--------.-.---------..-.TP--D--G------------D--L-
YWBC_BACSU/4-123------------------------------A--------F-L---------GF-EDG--P--E------------T--E-
Q9KEK2_BACHD/4-140------------------------------L--------G-E---------MD-LMI--S--D------------Q--C-
O28065_ARCFU/4-128------------------------------V--------R-V---------AM-LPA--G--E------------S--R-
A2YS08_ORYSI/24-146------------------------------.--------.-.---------..-..D--T--N------------F--A-

PF13669

A9C2R0_DELAS/14-124...............N..............V........D.E.........DI.LAM--G--Q------------G..AH
A2SEJ1_METPP/12-122...............N..............V........D.E.........DI.CAM--G--R------------G..AH
D0LXQ3_HALO1/13-123...............N..............V........D.E.........DI.LTL--G--T------------G..AA
Q5P377_AROAE/12-122...............N..............V........D.E.........DI.CAM--G--K------------G..PF
Q1D6F8_MYXXD/37-147...............N..............V........D.E.........DI.VTA--G--A------------G..PF
B8BYE7_THAPS/75-187...............N..............V........D.E.........DI.LRL--G--K------------EGSPH
B5Y3L3_PHATC/38-148...............N..............V........E.E.........DI.VQV--G--P------------A..PF
A4HEL0_LEIBR/19-133...............G..............V........I.T.........VF.VEM--P--N------------S....
D4J6L0_9FIRM/18-126...............D..............A........D.L.........IF.TKH--G--N------------G..VD
D2RXZ8_HALTV/10-118...............A..............F........T.W.........AT.YVL--G--D------------A..S.
Q39TG0_GEOMG/11-132...............NMHDMKMRGEKAEFSM........K.V.........AF.TDL--G--G------------.....
D3F6C9_CONWI/9-133...............N..............VPRLTYRGAD.A.........AFEMRV--A--L------------S..SS
A6LI20_PARD8/8-119...............N..............V........N.I.........CW.LIK--E--N------------M..P.
Q97H22_CLOAB/4-114...............V..............R........K.V.........YI.QFV--I--N------------G..G.
B9JM51_AGRRK/6-125...............S..............Y........A.L.........AF.GYM--G--D------------.....
C5CVE4_VARPS/9-131...............A..............H........EPH.........NS.VAL--A--N------------S...G
Q13K82_BURXL/9-131..............YE..............V........H.N.........SV.ALA--N--S------------G..P.
Q13I71_BURXL/19-140...............N..............I........R.L.........KL.AVA--F--S------------G..HM
Q5UWE3_HALMA/10-117...............R..............F........R.W.........AQ.YDF--G--R------------E..A.
C0ZEG8_BREBN/1496-1609...............N..............V........Y.L.........SM.CMK--P--G------------S....
D4M9A6_9BACT/4-116...............G..............V........R.I.........QF.FED--R--C------------G....
Q12HJ2_POLSJ/9-131...............E..............P........H.N.........SV.ALA--N--S------------G..F.
D2RQ64_HALTV/17-139...............S..............M........R.L.........AL.AQL--G--E------------T....
A5VBF6_SPHWW/10-129...............T..............V........G.I.........DVALGY--.--.------------...QG
A1TCL4_MYCVP/8-130...............R..............V........T.YRGEPCAVTLSL.ALA--N--S------------G....
C7PR30_CHIPD/14-138...............DLDMT.....YYGKVV........D.A.........GW.LTT--Q--T------------Y..NG
A4XEN6_NOVAD/16-137...............D..............F........S.V.........AL.AQS--G--G------------.....
A5G6D6_GEOUR/8-118...............G..............I........S.G.........CF.LVG--P--G------------P....
Q2YCD2_NITMU/13-126...............N..............V........N.L.........WL.CPH--S--S------------M....
B1MB48_MYCA9/17-139...............D..............F........TAT.........IA.LSY--L--D------------D....
A0R1J5_MYCS2/10-129...............E..............V........T.L.........SL.ALS--N--S------------G..D.
C7RS60_ACCPU/18-128...............G..............V........A.G.........CF.LTG--P--G------------P....
D5URS6_TSUPD/111-214...............G..............V........H.Q.........LF.FRR--G--D------------L....
D0LDW1_GORB4/120-238...............A..............T........D.V.........HQ.MFF--R--G------------G..EI
A5V4C1_SPHWW/15-137...............E..............F........D.V.........SL.ALT--Y--S------------G..SM
E0UKN1_CYAP2/120-235...............R..............H........D.P.........YV.AFS--R--Q------------G..P.
Q2G768_NOVAD/15-136YRG.......APSTAD..............V........T.I.........AM.GFA--G--H------------.....
Q744Q1_MYCPA/12-125...............E..............V........T.S.........TF.VYS--L--Q------------A....
D2AXE6_STRRD/3-112...............S..............V........G.R.........SW.ALD--.--.------------G..V.
B8FMX2_DESAA/10-131...............G..............M........E.M.........DA.ALT--N--S------------G..F.
C5C099_BEUC1/20-129...............W..............A........D.G.........AS.WRL--G--D------------A..Y.
Q15VI5_PSEA6/7-112...............G..............Y........T.V.............HV--G--S------------E..T.
A2QUW1_ASPNC/11-144VSDQKYYDEEGPDLYE..............I........D.V.........AF.AYN--S--D------------...SK
Q28K59_JANSC/19-130..............DP..............M........G.P.........LI.LKA--G--D------------G..RP
A1SVB5_PSYIN/4-112...............E..............A........Y.L.........CM.VTL--N--D------------N..N.
C7NIJ3_KYTSD/10-119...............G..............R.....................S.WRL--A--D------------T..Y.
A4SXB6_POLSQ/12-122...............N..............V........D.E.........DI.CAI--G--T------------G..AH
A4XGA4_CALS8/13-134KTHTEY..RGKPTNAR..............A........K.L.........AF.FRN--F--K------------...N.
B0RG81_CLAMS/8-115...............W..............A........D.G.........RS.LRL--G--D------------A..Y.
B2HSW2_MYCMM/9-134...............DF............VA........S.I.........SL.SYL--G--D------------.....
B8E0B0_DICTD/13-133...............R..............A........K.L.........AF.FKN--F--K------------...N.
F3Z5I0_9ACTN/9-118.........................................G.........RS.WRL--G--G------------T..Y.
R5SQY8_9FIRM/9-124...............H..............V........T.T.........SF.FKP--S--A------------Q..SE

PF13468

C5BVV5_BEUC1/6-191---------------------------------------TAH---------RV-VPL.PG..G------------.....
Q3IZS4_RHOS4/4-171---------------------------------------THN---------RL-LGL..G..D------------.....
Q28LV8_JANSC/4-176---------------------------------------THN---------RL-LSF..G.PD------------.....
D7BGN4_MEISD/10-187---------------------------------------THN---------RL-LNL..G..G------------.....
D3PMM6_MEIRD/4-173---------------------------------------THN---------RL-LNL..G..G------------.....
Q1IXF9_DEIGD/4-178---------------------------------------THN---------AL-LSL..G..P------------.....
A9HYM0_BORPD/5-178---------------------------------------THN---------LL-LRL..G..E------------.....
Q47D15_DECAR/6-180---------------------------------------THN---------LL-LRL..G..D------------.....
A9B642_HERA2/8-182---------------------------------------THN---------CL-LKL..G..E------------.....
D2QC41_SPILD/11-185---------------------------------------THN---------AV-LKL..A..D------------.....
B8IP73_METNO/4-183---------------------------------------THN---------LV-LRL..G..D------------.....
B1LV77_METRJ/4-183---------------------------------------TRN---------HL-LRL..G..D------------.....
C5CLJ8_VARPS/5-199---------------------------------------THN---------RL-LNI.AA..E------------AF.PQ
D3Q0J0_STANL/2-177---------------------------------------TRN---------YL-LGL.GG..D------------.....
B5HRA1_9ACTN/8-184---------------------------------------TRN---------HL-VSL..G..G------------.....
A4FK05_SACEN/2-174---------------------------------------TAN---------HL-LGL..G..G------------.....
C7MHL9_BRAFD/7-186---------------------------------------TAN---------AL-IALTVG..G------------EP.RP
A6WBM6_KINRD/7-183---------------------------------------TAN---------AL-VAL.TV..D------------GERRP
B7FUP4_PHATC/255-429---------------------------------------IKC---------AR-VSF..T..D------------.....
B7FSM2_PHATC/69-245---------------------------------------TKS---------AR-VGF..N..E------------.....
C0ZG21_BREBN/5-195---------------------------------------TWN---------SL-SYF..G..L------------.....
Q8ELK5_OCEIH/5-195---------------------------------------TYN---------AL-SYF..G..L------------.....
B1HV56_LYSSC/5-194---------------------------------------TYN---------TL-SYF..G..L------------.....
Q5WBL3_BACSK/5-198---------------------------------------SYN---------TL-LHF..G..M------------.....
B9DM11_STACT/6-192---------------------------------------THN---------KL-AYT..D..L------------.....
B9E9H1_MACCJ/8-191---------------------------------------TYN---------KL-SYI..D..L------------.....
D1CHQ7_THET1/9-194---------------------------------------TEN---------AI-IRF..G..L------------.....
D1C9M3_SPHTD/5-190---------------------------------------TAN---------AI-IRF..G..V------------.....
A5UPV1_ROSS1/5-179---------------------------------------THN---------AL-VAF..A..D------------.....
B0D2X2_LACBS/11-211---------------------------------------TAN---------AL-VVF..A..D------------.....
B9L3L2_THERP/5-180---------------------------------------THN---------AL-IGF..G..D------------.....
Q0UPP1_PHANO/6-192---------------------------------------TSN---------TL-ILF..A..D------------.....
A7I5C5_METB6/53-255---------------------------------------TEN---------AL-VPF.ED..G------------.....
Q11EY7_CHESB/5-184---------------------------------------SEN---------RL-IVF.ED..G------------.....
C7N101_SLAHD/3-183---------------------------------------.IN---------AL-IYF..S..K------------.....
Q215A9_RHOPB/5-194---------------------------------------THN---------RI-VQL..K..D------------.....
A7IN29_XANP2/5-195---------------------------------------TEN---------RI-VQT..P..G------------.....
Q92KD8_RHIME/11-203---------------------------------------TAN---------AC-VFF.SD..D------------.....
B9JW73_AGRVS/9-199---------------------------------------TVN---------AC-LFL..A..D------------.....
Q2W045_MAGSA/8-179---------------------------------------TAN---------YC-IMF..G..D------------.....
Q7VS77_BORPE/8-188---------------------------------------TEN---------LC-IMF..P..G------------.....
Q2KVI0_BORA1/6-182---------------------------------------SCN---------RL-IVL..D..D------------.....
Q13QK5_BURXL/9-186---------------------------------------SVN---------HL-MMF..D..G------------.....
B1M8D4_METRJ/14-190---------------------------------------SIN---------HL-MMT..A..G------------.....
E6WJ36_PANSA/10-188---------------------------------------SSN---------HL-AVF..E..E------------.....
Q213B5_RHOPB/15-192---------------------------------------SSN---------NL-AIF..G..N------------.....
B9JHP8_AGRRK/10-187---------------------------------------SIN---------HL-AVF..G..E------------.....
Q0K796_CUPNH/8-187---------------------------------------SQN---------HC-IML..R..R------------.....
Q89RQ5_BRADU/9-192---------------------------------------TGN---------YT-IMF..D..P------------.....
A6X474_OCHA4/8-190---------------------------------------TGN---------YT-IMF..P..E------------.....
Q7VV42_BORPE/8-199---------------------------------------SGN---------HC-AMF..R..N------------.....
Q7VZU9_BORPE/17-205---------------------------------------IAN---------RC-AML..G..H------------.....
D3PXN5_STANL/9-232---------------------------------------AGN---------TH-ADF..P..R------------.....
C5C9I8_MICLC/6-186---------------------------------------TQN---------AL-FPM..A..G------------.....
A6WG27_KINRD/3-181---------------------------------------TRN---------VV-LPL..S..L------------.....
C7Q7Z4_CATAD/3-184---------------------------------------TRN---------FV-LPL.AG..G------------.....
D3Q658_STANL/7-189---------------------------------------FHN---------GA-WLL..D..V------------.....
A4X9C2_SALTO/3-192---------------------------------------TAS---------WI-VPF..DTPD------------....V
A0JUJ0_ARTS2/1-173---------------------------------------TRN---------MI-IPL..A..G------------.....
A5VHI4_LACRD/7-201---------------------------------------TKN---------AL-DYF..G..L------------.....
A6T918_KLEP7/6-197---------------------------------------TRN---------AL-SYF..G..L------------.....
D0IV05_COMT2/5-180---------------------------------------THN---------AL-VVF..A..D------------.....
F2KGG4_PSEBN/11-197---------------------------------------SVT---------SL-MMF..P..S------------.....
G8PVJ3_PSEUV/4-182---------------------------------------THN---------HR-LQL..G..G------------.....
Q2FVZ2_STAA8/5-191---------------------------------------TFN---------KL-GYI..N..E------------.....
Q5HLY5_STAEQ/5-190---------------------------------------TFN---------QI-API..K..N------------.....
Q5L3B6_GEOKA/5-192---------------------------------------TYN---------AL-CCF.EH..L------------.....
Q63W09_BURPS/8-197---------------------------------------THN---------RL-FGL.WG..R------------.....
Q6AAZ6_PROAC/4-172---------------------------------------TRN---------RI-LPL.SG..P------------.....
Q6N6G7_RHOPA/5-180---------------------------------------SRN---------AL-VVF..D..D------------.....
Q81NU9_BACAN/4-191---------------------------------------TWN---------SL-SYF..D..L------------.....
U5LCG2_9BACI/5-192---------------------------------------TYN---------SV-IYF..N..S------------.....
V6F093_9PROT/9-176---------------------------------------THN---------AL-LSL.GP..D------------.....
V6F8Z3_9PROT/8-187---------------------------------------TAN---------HC-IMF..R..Q------------.....

PF14506

Q5M2X6_STRT2/13-137---------------------------------------EEN---------AL-AVF--T--D------------WSECN
Q8DP81_STRR6/14-136---------------------------------------EES---------AF-LSL--G--D------------Q.TGL
Q8DVS0_STRMU/9-132---------------------------------------EEN---------SL-VIF--G--D------------WAQAG
Q8DXW5_STRA5/9-132---------------------------------------EEN---------AI-AVF--S--A------------WQNKE
Q99Y63_STRP1/9-131---------------------------------------EEN---------AI-AIF--S--S------------WGEGQ

PF06983

Q7CRK9_AGRFC/2-118---------------------------------------DVL---------TVQFTV--A--G-----------------
Q92TY1_RHIME/2-118---------------------------------------SVT---------VIEFRL--G--D-----------------
Q837B9_ENTFA/2-127---------------------------------------SLM---------TIEFTL--A--N-----------------
Q73WJ2_MYCPA/2-116---------------------------------------TVL---------SGSFVL--D--G-----------------
Q82NZ5_STRAW/4-119---------------------------------------SVM---------VVEFVA--N--G-----------------
Q82XJ9_NITEU/2-119---------------------------------------NEL---------TVEFTV--L--G-----------------
Q6MLW9_BDEBA/2-119---------------------------------------TEL---------TVEFTV--L--G-----------------
Q9X7R8_STRCO/4-119---------------------------------------SVL---------TVEFTA--N--G-----------------
Q97DK8_CLOAB/2-123---------------------------------------DAE---------TVNFIL--A--G-----------------
Q97DK8_CLOAB/132-253---------------------------------------KIN---------FASFKL--N--N-----------------
Q89SJ1_BRADU/2-118---------------------------------------SVL---------VVEFTV--A--G-----------------
Q6N1I9_RHOPA/2-118---------------------------------------SVL---------VVEFTV--A--G-----------------
Q9CEE8_LACLA/17-136---------------------------------------KVL---------NGEFSL--N--G-----------------
Q88GT8_PSEPK/3-119---------------------------------------DVI---------TVEFTV--M--G-----------------
Q74AD9_GEOSL/5-121---------------------------------------DVL---------TVEFTV--M--G-----------------
Q98C01_RHILO/2-116---------------------------------------KVL---------VASFEL--D--G-----------------
Q2G1U2_STAA8/5-129---------------------------------------TVQ---------HSIFTL--N--G-----------------
Q81QE2_BACAN/6-132---------------------------------------TVI---------HATFTL--H--G-----------------
Q8F7U5_LEPIN/2-119---------------------------------------VVM---------SATFAI--S--G-----------------
Q8NP25_CORGL/152-272---------------------------------------ALM---------FSQFQL--D--G-----------------

PF14696

Q124D7_POLSJ/13-161---------------------------------------KDV---------TL-YRQ--G--G-----------------
A5WE99_PSYWF/5-143---------------------------------------KDV---------AL-YRQ--G--D-----------------
B6IWM9_RHOCS/19-161---------------------------------------KDV---------GL-YRQ--G--G-----------------
Q2NAB6_ERYLH/5-147---------------------------------------KDV---------HL-WRQ--G--G-----------------
D0J5T0_COMT2/5-143---------------------------------------KDV---------VL-YRQ--G--G-----------------
Q2SND1_HAHCH/5-146---------------------------------------KAI---------TL-YRQ--G--D-----------------
Q0ASV8_MARMM/5-143---------------------------------------KDV---------EL-WRQ--G--G-----------------
A6VYX1_MARMS/5-143---------------------------------------KDV---------EL-YRQ--G--G-----------------
Q0BY65_HYPNA/5-146---------------------------------------KDV---------EL-WRQ--G--G-----------------
B2FKN2_STRMK/6-147---------------------------------------RPI---------TV-YRQ--G--D-----------------
D5VC74_MORCR/28-166---------------------------------------KDV---------LL-YRQ--G--G-----------------
Q63PY5_BURPS/6-154---------------------------------------KDV---------TL-YRQ--G--D-----------------
Q87Z77_PSESM/10-148---------------------------------------KDV---------TL-YRQ--G--A-----------------
Q8PDA4_XANCP/6-147---------------------------------------RPI---------TV-YRQ--G--G-----------------

PF06185

Q9CN85_PASMU/28-211---------------------------------------EID---------HIALRV--N--T------------EQSAK
E6WA61_PANSA/8-184---------------------------------------DAD---------HVAVRC--H--Q------------YATAE
Q7VP39_HAEDU/11-195---------------------------------------QID---------HLAVRM--N--T------------IETAQ
A1S7G3_SHEAM/3-184---------------------------------------ECD---------HASLRV--N--T------------REAAD
H2ITZ6_RAHAC/6-182---------------------------------------HAD---------HISVRC--H--Q------------NTTAD
F4PTK1_DICFS/6-204---------------------------------------ESD---------HICYRV--S--S------------QENYD
B2VJB7_ERWT9/11-187---------------------------------------EVD---------HIALRC--H--Q------------NATAE
Q54MZ6_DICDI/4-182---------------------------------------PID---------HICYRV--S--T------------NEFYN
C9R3D1_AGGAD/12-194---------------------------------------EID---------HLSLRV--N--T------------EQAAQ
E0SAV0_DICD3/24-197---------------------------------------EAD---------HISLRC--H--Q------------NSTAE
Y1581_HAEIN/7-187---------------------------------------EID---------HLALRV--N--S------------EQSAK
I0DZQ5_PROSM/9-183---------------------------------------LID---------HVSVRC--H--H------------NETAE
B7VI23_VIBTL/11-196---------------------------------------QAD---------HIALRI--N--E------------TELAK
Q7N560_PHOLL/9-183---------------------------------------QAD---------HISLRC--H--D------------ISVAE
Q5E6L1_VIBF1/12-196---------------------------------------QAD---------HIALRI--N--D------------RDVAE
YECM_ECOLI/9-185---------------------------------------TAD---------HISLRC--H--Q------------NATAE
A6VND1_ACTSZ/15-196---------------------------------------VID---------HLALRV--N--S------------LEAGK
B0UUF0_HISS2/18-194---------------------------------------EID---------HIALRV--N--K------------RKSAE
D3VET8_XENNA/9-183---------------------------------------SAD---------HISLRC--N--E------------ISLAN
A3QD08_SHELP/12-194---------------------------------------ECD---------HAALRI--N--T------------NQGAD
F4HCP7_GALAU/9-190---------------------------------------AID---------HIALRV--N--D------------LDTAT
Q12LL9_SHEDO/6-186---------------------------------------ECD---------HVALRV--N--S------------LETAQ
D3V176_XENBS/22-196---------------------------------------SAD---------HISLRC--N--E------------SKIAD
M9WWR4_MANHA/3-184---------------------------------------EID---------HLAVRM--N--Q------------TETAE
F4QBC6_DICFS/15-213---------------------------------------ELD---------HLCYRV--S--L------------EEYYD
Q87RD4_VIBPA/11-196---------------------------------------QAD---------HIALRI--N--D------------PETAK
I2BA68_SHIBC/9-185---------------------------------------SAD---------HISLRC--H--Q------------NTTAA
D8MT98_ERWBE/11-187---------------------------------------EVD---------HIAVRC--N--Q------------NTTAA
B8F673_HAEPS/18-196---------------------------------------QID---------HLAVRM--N--S------------DEVAN
W0HX46_9ENTR/9-183---------------------------------------LID---------HIAVRC--H--Q------------TVTAQ
Q65SX5_MANSM/18-195---------------------------------------EID---------HLSIRV--N--T------------EDKAK
Q6LTA0_PHOPR/10-194---------------------------------------QAD---------HIALRV--N--D------------LDIAK
Q8EF20_SHEON/12-196---------------------------------------YCD---------HVALRV--N--T------------IVAAD
E1SQM9_FERBD/4-183---------------------------------------VAD---------HIALRI--T--E------------RADAE
J7TZ01_MORMO/9-183---------------------------------------QAD---------HISLRA--H--D------------TALAE
D4GGT7_PANAM/8-184---------------------------------------DVD---------HVAVRC--H--Q------------NTTAE
F7YNG9_VIBA7/11-196---------------------------------------QAD---------HIALRI--N--D------------RKLAS
F0LNL8_VIBFN/11-196---------------------------------------TLD---------HIALRI--N--D------------LELAK
W0L3M1_9ENTR/9-185---------------------------------------SAD---------HISLRC--H--Q------------NSTAE
C5B833_EDWI9/9-185---------------------------------------TAD---------HISLRC--H--Q------------TETAD
Q7CIB5_YERPE/9-180---------------------------------------CAD---------HISLRC--H--Q------------AETAE
D4ZJ81_SHEVD/8-188---------------------------------------TCD---------HAALRV--N--S------------NDAAK
B4ETN6_PROMH/11-183---------------------------------------QTD---------HISLRC--H--D------------LALAE
A3MYB0_ACTP2/11-194---------------------------------------EID---------HLAVRM--N--E------------WQTAE
Q083X6_SHEFN/2-197---------------------------------------DCD---------HAALRV--N--D------------NQTAQ
Q9KQC7_VIBCH/11-196---------------------------------------QLD---------HIALRI--N--D------------PQLAQ
Q6D475_PECAS/16-190---------------------------------------HAD---------HISLRC--H--Q------------NTTAE
Q7MMM2_VIBVY/16-201---------------------------------------QAD---------HIALRV--N--E------------NQTAQ
M4RAR0_BIBTR/11-192---------------------------------------EID---------HLAVRM--N--Q------------LETAK

PF12681

Q187Q5_PEPD6/3-120.YKA--II...GY.-----D----L.-----PI------------------------YQ.--------------------
Q8TUF9_METAC/12-132.FSD--LI...NI.-----N----KN-----DI------------------------AQ.--------------------
Q97LL1_CLOAB/3-123.FAN--MI...DI.-----D----EK-----SI------------------------KF.--------------------
A5HYY7_CLOBH/3-121.FAW--LT...NVA-----S----D.-----SV------------------------IE.--------------------
A9CII6_AGRFC/3-123SLEE--TIWRTSS.-----D----A.-----QE------------------------AY.--------------------
Q81BZ3_BACCR/5-127.VKE--LT...GL.-----P----L.-----TE------------------------GEL--------------------

PF00903

CADE_BACSU/9-123-VLL--IL---EEN-----P----SA-----VV------------------------LPERS..................
YQCK_BACSU/2-115-LNF--TL---NVA-----D----EV-----KG------------------------NQV....................
YQJC_BACSU/3-128-LEL--IE---PLT-----A----DS-----PV------------------------HLFLE..................
LGUL_HUMAN/31-174-LEL--TH---NWG-----T----ED-----DE------------------------TQSYH..................
D5T7F4_LEGP2/151-300-IKI--PL---NES-----K----DD-----LS------------------------QIE....................
CADI_MYCTU/2-114-LKL--VL---LEN-----P----GT-----GG------------------------TLN....................
CF30_MYCTU/11-126-AAI--AP---MPP-----G----AP-----EG------------------------MPP....................
I7B4U0_PSEPT/143-261-HSF--AF---AKL-----P----GS-----KR------------------------LHH....................
BPHC2_RHOGO/6-121-VAL--LG---APT-----A----LE-----PR------------------------NPG....................
LGUL_PSEPU/24-167-LEL--TH---NHG-----T----ER-----DA------------------------DFAYH..................
HPPD_RAT/180-335-IKM--PI---NEP-----A----PG-----RK------------------------KSQ....................
BPHC3_RHOGO/6-122-HRV--AL---FGP-----P----GG-----GL------------------------PERTP..................
LGUL_BRAJU/27-171-IEL--TH---NWG-----T----ES-----DP------------------------EFKGY..................
O24828_9GAMM/150-266-SQF--LT---VST-----K----AH-----DI------------------------AFIHH..................
LGUL_SYNY3/2-123-IEL--TH---NWG-----T----DK-----YD------------------------LGN....................
O26852_METTH/2-112-VEL--IK---NPT-----D----KP-----..------------------------.......................
P95571_9PSED/143-280-HTM--AI---AEA-----P----LP-----KR------------------------VHH....................
LGUL_NEIMB/2-123-LEL--TH---NWD-----T----ER-----YD------------------------LGN....................
Q98LB0_RHILO/89-205-LNL--RH---VDK-----P----PL-----AA------------------------NSA....................
Q98HZ4_RHILO/7-135-LML--GD---AYP-----E----HG-----HP------------------------HKA....................
FOSB_BACSU/5-117-LAL--NE---EPD-----I----PR-----ND------------------------IKL....................
Q9KZ01_STRCO/31-158-VMA--YD---VPS-----D----LP-----YH------------------------QGE....................
MHQE_BACSU/5-263-AGR--VY---FSV-----P----SG-----SL------------------------SFWKERLEKSGLSLEEKTLFGEK
P72786_SYNY3/14-143-IDL--FA---TPN-----L----SP-----PA------------------------VDPHQ..................
O53680_MYCTU/15-163-VAF--FW---FAD-----A----PD-----RV------------------------PGLSSPVAIPG............
YRAH_BACSU/2-124-IEL--LS---RET-----M----AE-----IV------------------------GEEKK..................
FOSB_STAEP/4-116-LAL--NE---EKN-----I----PR-----SE------------------------IKY....................
O68311_GEOTH/148-265-AAW--LF---RSY-----T----PH-----DI------------------------AIIPG..................
YYAH_BACSU/2-124-LEI--MK---KGN-----V----TD-----PP------------------------SQT....................
YETH_BACSU/4-118-LVI--YP---KAM-----M----KG-----SE------------------------QMK....................
Q9ZNP0_COMTE/147-272-ATW--MA---RST-----T----PH-----DI------------------------AFVGG..................
Q9ZAY0_9SPHN/150-267-AIF--LS---CSN-----K----AH-----DI------------------------AFIGY..................
O06412_MYCTU/4-113-LEL--AG---YGE-----P----DH-----SR------------------------GPF....................
LGUL_HAEIN/2-123-IEL--TY---NWG-----V----DK-----YE------------------------HGT....................
D5AV60_RHOCB/8-122-VSS--AD---SPA-----A----SG-----AL------------------------TGR....................
YYCE_BACSU/11-130-LEF--TQ---YEG-----G----ST-----AP------------------------VPH....................
C3JUU8_RHOER/142-267-HSL--AF---LPL-----P----NP-----TG------------------------IVH....................
MHQO_BACSU/7-266-VGV--TS---YVV-----P----KG-----AM------------------------AFWEKRLEKFNVPYTKIERFGEQ
HPPD_PSEUJ/158-310-IRI--PL---NEE-----S----SK-----GA------------------------GQI....................
Q45135_9MICO/152-268-AAW--MH---RKG-----T----VH-----DT------------------------ALTGG..................
N9VUR8_PSEPU/150-266-AQF--LS---LST-----K----AH-----DV------------------------AFIHH..................
LGUL_BRAOG/17-138-VEL--TY---NYG-----V----SS-----YD------------------------IGT....................
Q9I3Z1_PSEAE/3-131-LMA--SD---NHP-----A----YP-----YE------------------------GI.....................
Q9KYP6_STRCO/2-118-VPL--FA---PGS-----A----RP-----AD------------------------NRS....................
MHQA_BACSU/5-275-ISS--IG---LRV-----P----GT-----EA------------------------LHYWKERFEEQQVTHSGISKRAG
Q59693_PSEPU/147-272-VAF--LF---RAT-----K----PH-----DI------------------------AFLPG..................
LGUL_SCHPO/11-150-LEL--TY---NFG-----T----EK-----KE------------------------GPVYI..................
LGUL_SALTY/2-123-IEL--TY---NWG-----V----ES-----YD------------------------MGN....................
Y3691_SHEFN/4-116-VSL--LL---ARA-----S----KP-----EQ------------------------HDFIG..................
Q9KZG9_STRCO/4-130-FTL--MG---ADT-----P----PG-----ME------------------------YTP....................
YURT_BACSU/2-124-TEL--LL---EPN-----E----HP-----AA------------------------KEYQK..................
YWKD_BACSU/5-125-IEL--FS---FPD-----P----PE-----RQ------------------------TRP....................
Q52533_PSESP/147-267-HHS--LA---TGA-----V----NI-----PK------------------------VLG....................
MCE_PYRHO/7-131-IEL--LE---ATT-----E----DS-----PI------------------------AKFIE..................
P97099_CUPNE/143-262-HTI--AL---AAF-----P----IP-----KR------------------------IHH....................
DNRV_STRPE/8-133-VAA--VA---RHQ-----I----DT-----PY------------------------HRP....................
P73508_SYNY3/5-122-AHI--TL---EPL-----V----KQ-----PG------------------------IYP....................
HMAS_AMYOR/158-306-VTL--TL---IEP-----D----RN-----AD------------------------PGQ....................
O86701_STRCO/4-132-IVL--EP---PLA-----D----PN-----AS------------------------AADKQ..................
Q7AQ90_MYCLE/20-150-IQL--MA---PIN-----E----SS-----PI------------------------AKFLD..................
LGUL_YEAST/22-164-LEL--TH---NWG-----T----EK-----NP------------------------DYKIN..................
C1KH52_SERMA/4-114-VCL--SY---DEA-----R----QY-----VP------------------------PQE....................
C3LUW7_VIBCM/6-113-GGF--FK---AEL-----S----SR-----TE------------------------NGG....................
Q9Z549_STRCO/4-125-LLL--DT---EES-----I----RS-----FT------------------------PGWEP..................
Q48341_STRLI/5-125-VLA--FD---RHT-----D----WP-----AM------------------------PS.....................
O32376_COMTE/143-262-HTL--AL---AAF-----P----LP-----KR------------------------IHH....................
O69350_RHOER/145-267-HSL--AL---CPA-----P----HG-----GA------------------------PGL....................
GLOD4_CAEEL/132-248-LEI--VK---SQD-----K----ID-----RK------------------------TGF....................
YAER_ECOLI/6-126-IEL--FS---FPF-----P----PE-----RP------------------------SRP....................
O86906_SPHSX/146-261-HSL--AF---VQT-----S----DR-----IA------------------------RLG....................
O28796_ARCFU/50-170-TAL--LL---EPN-----E----NS-----IA------------------------KNYQT..................
O05205_STRLA/4-125-LAW--DT---VET-----V----RS-----YD------------------------PEWQA..................
I7MMZ2_TETTS/194-350-IKM--PI---NEP-----A----DG-----KR------------------------KSQIQ..................
Q9I5D5_PSEAE/8-139-LML--GS---SVR-----D----NA-----YG------------------------RLMRH..................
O87625_PSEAI/152-264-GDH--HM---IAF-----A----KS-----SH------------------------TGL....................
Q50912_SPHXE/13-131-IAL--FP---AEE-----G----AT-----TG------------------------KEF....................
A5W4G6_PSEP1/11-255-HNI--VL---YQA-----P----GH-----GL------------------------KRVGFELEQESDVRAAFEHFDQR
Q59770_RHORH/162-279-GAW--MS---VSS-----Q----VH-----DM------------------------AIMRD..................
YWBC_BACSU/4-123-IEL--IQ---GYS-----S----EL-----PA------------------------EGK....................
Q9KEK2_BACHD/4-140-LDV--DP---ERF-----P----QH-----SG------------------------SPV....................
O28065_ARCFU/4-128-VEL--LE---ATS-----E----DS-----AI------------------------AKFIS..................
A2YS08_ORYSI/24-146-LEL--TY---NYG-----V----DK-----YD------------------------IGA....................

PF13669

A9C2R0_DELAS/14-124KVEV..DI---M.Q.....P----LD.....ID------------------------.....------------------
A2SEJ1_METPP/12-122AVEV..DL---M.Q.....P----VD.....PD------------------------.....------------------
D0LXQ3_HALO1/13-123RVEV..DL---M.Q.....P----ID.....PN------------------------.....------------------
Q5P377_AROAE/12-122KVEV..DL---M.Q.....P----LD.....AE------------------------.....------------------
Q1D6F8_MYXXD/37-147KVEV..DL---M.Q.....P----VD.....PE------------------------.....------------------
B8BYE7_THAPS/75-187AVEI..DL---M.M.....P----ID.....PE------------------------.....------------------
B5Y3L3_PHATC/38-148AVEV..DL---M.T.....P----ID.....PE------------------------.....------------------
A4HEL0_LEIBR/19-133..KI..EL---L.H.....P----LG.....NN------------------------.....------------------
D4J6L0_9FIRM/18-126AVE....F---I.I.....P----LS....GVL------------------------.....------------------
D2RXZ8_HALTV/10-118..RL..EL---I.A.....P----ED.....GS------------------------ESFLT------------------
Q39TG0_GEOMG/11-132.VQL..EL---I.E.....P----LD.....ES------------------------I..YS------------------
D3F6C9_CONWI/9-133VPQI..EL---I.E.....A----IS.....GP------------------------SI.YT------------------
A6LI20_PARD8/8-119..TV..EL---L.A.....P----VD.....ET------------------------.....------------------
Q97H22_CLOAB/4-114.YRV..EL---V.A.....P----DG.....ED------------------------.....------------------
B9JM51_AGRRK/6-125.IQV..EL---M.Q.....P----IS.....GN------------------------.....------------------
C5CVE4_VARPS/9-131YVQV..EL---I.Q.....T----RNDVPSMYR------------------------.....------------------
Q13K82_BURXL/9-131.LQV..EL---I.Q.....T----RN.....DA------------------------PSMYR------------------
Q13I71_BURXL/19-140QVEVIQQL---DDQ.....P----SV.....YR------------------------.....------------------
Q5UWE3_HALMA/10-117.SRL..EL---I.A.....P----EA.....SD------------------------TF.LT------------------
C0ZEG8_BREBN/1496-1609.VPI..EL---I.A.....P----VD.....ET------------------------.....------------------
D4M9A6_9BACT/4-116.VKV..EL---V.A.....P----LK.....ES------------------------.....------------------
Q12HJ2_POLSJ/9-131.VQV..EL---I.Q.....T----RNDVPSMYR------------------------.....------------------
D2RQ64_HALTV/17-139..MI..EL---I.E.....P----LE.....GP------------------------SI.YT------------------
A5VBF6_SPHWW/10-129DVQI..EL---I.E.....A----TD.....AA------------------------.....------------------
A1TCL4_MYCVP/8-130DLQV..EL---I.H.....Q----HD.....DT------------------------PSIFT------------------
C7PR30_CHIPD/14-138GSFL..EL---V.Q.....P----LS.....GQ------------------------.....------------------
A4XEN6_NOVAD/16-137.IQI..EL---I.QQHCDRP----SA.....YR------------------------.....------------------
A5G6D6_GEOUR/8-118..RV..EL---L.E.....N----LP.....GS------------------------V..TL------------------
Q2YCD2_NITMU/13-126.PTV..EL---V.A.....P----AE.....GQ------------------------.....------------------
B1MB48_MYCA9/17-139.MQL..EL---I.L.....P----VS.....GT------------------------SI.YT------------------
A0R1J5_MYCS2/10-129.LQI..EL---I.Q.....Q----HG.....DT------------------------HSVFT------------------
C7RS60_ACCPU/18-128..RI..EL---L.E.....N----LP.....EA------------------------.....------------------
D5URS6_TSUPD/111-214LVEV..VL---A.E.....G----DD.....VD------------------------.....------------------
D0LDW1_GORB4/120-238IFEV..VA---G.A.....P----RP.....A.------------------------.....------------------
A5V4C1_SPHWW/15-137CVEL..IQ---Q.N.....N----WE.....TP------------------------.....------------------
E0UKN1_CYAP2/120-235.PYY..EL---I.E.....A----SG.....DG------------------------.....------------------
Q2G768_NOVAD/15-136.MQI..EL---I.Q.....P----LD.....GN------------------------PSVYR------------------
Q744Q1_MYCPA/12-125.PHV..EL---I.Q.....A----VP.....GT------------------------.....------------------
D2AXE6_STRRD/3-112YIVV..E.---Q.S.....P----AM.....TA------------------------.....------------------
B8FMX2_DESAA/10-131.IQI..EL---I.Q.....Q----LN.....DE------------------------.....------------------
C5C099_BEUC1/20-129.VVV..E.---A.G.....P----DR.....RP------------------------.....------------------
Q15VI5_PSEA6/7-112.AYL..AL---Y.K.....P----KH....SIN------------------------.....------------------
A2QUW1_ASPNC/11-144APVI..EV---M.S.....P----IK.....GK------------------------.....------------------
Q28K59_JANSC/19-130ALSL..FA---R.A.....C----AP.....PT------------------------R...D------------------
A1SVB5_PSYIN/4-112..KI..EL---V.S.....G----KQ.....VS------------------------.....------------------
C7NIJ3_KYTSD/10-119.IVI..E.---E.S.....P----DL.....TG------------------------.....------------------
A4SXB6_POLSQ/12-122EIEV..DL---M.Q.....P----FD.....VE------------------------.....------------------
A4XGA4_CALS8/13-134.IEI..EL---I.E.....P----DE.....NP------------------------.....------------------
B0RG81_CLAMS/8-115.I.....V---I.A.....R----AP.....RD------------------------.....------------------
B2HSW2_MYCMM/9-134.MQL..EL---I.S.....P----VR.....GE------------------------NI.YS------------------
B8E0B0_DICTD/13-133.VEI..EF---I.E.....P----DE.....NP------------------------.....------------------
F3Z5I0_9ACTN/9-118.LVF..E.---Q.S.....P----AL.....SG------------------------.....------------------
R5SQY8_9FIRM/9-124ACEL..EF---L.G.....S----TT.....PD------------------------.....------------------

PF13468

C5BVV5_BEUC1/6-191A.YI--NV---E.S.VI..A....RP-----AD...........LP..PPVRLFA..G.WFEGV................
Q3IZS4_RHOS4/4-171S.YL--EV---I.A..P..D....PA-----AP...........RP..P....FP..R.WFDLD................
Q28LV8_JANSC/4-176E.YF--EL---I.A..I..N....PD-----AR...........GP..D....QP..R.WFDLD................
D7BGN4_MEISD/10-187GVYL--EV---L.A..I..D....PQ-----GI...........PP..D....RP..R.WFGLDSPA.............
D3PMM6_MEIRD/4-173GVYL--EI---I.A..I..D....PQ-----AP...........AP..G....RP..R.WFELD................
Q1IXF9_DEIGD/4-178EAYL--EV---I.A..V..N....PA-----AP...........TP..P....RP..R.WFGLDTPE.............
A9HYM0_BORPD/5-178SVYL--EV---I.A..C..D....PA-----AP...........AP..Q....RP..R.WFELD................
Q47D15_DECAR/6-180STFL--EV---I.A..P..N....PA-----VP...........AA..S....RP..R.WFALDS...............
A9B642_HERA2/8-182HCYL--EV---I.A..P..D....PT-----LA...........AP..D....RP..R.WFALD................
D2QC41_SPILD/11-185TTYL--EV---I.A..I..D....PS-----LP...........RP..P....RP..R.WFGMD................
B8IP73_METNO/4-183DVYL--EV---I.A..V..D....PE-----AP...........AP..S....GP..R.WFSLDDAA.............
B1LV77_METRJ/4-183ALFL--EV---I.A..V..D....PE-----AP...........PP..S....GA..R.WFGLGDAA.............
C5CLJ8_VARPS/5-199A.YL--EI---I.A..I..E....PG-----KRP.........SRP..G....TR..R.WFDLDDPV.............
D3Q0J0_STANL/2-177S.YL--EI---I.G..P..D....PD-----QP...........DP..P....GP..R.PFDVD................
B5HRA1_9ACTN/8-184TAYL--EI---I.G..P..D....PE-----QP...........EP..M....GP..R.PFGVD................
A4FK05_SACEN/2-174RAYL--EI---I.G..P..D....PE-----AP...........EP..G....GP..R.PFGID................
C7MHL9_BRAFD/7-186H.YL--EL---I.G..P..D....PE-----RE...........GE..E....LP..K.SFNIH................
A6WBM6_KINRD/7-183H.YV--EL---I.A..P..D....PR-----AA...........VE........A..T.GFGIP................
B7FUP4_PHATC/255-429ATYI--EI---I.A..P..D....PK-----GP...........GP.......IG..E.LIKNK................
B7FSM2_PHATC/69-245CCFL--EI---V.G..P..D....PK-----QA..........DTP..M....KH..K.LSGIE................
C0ZG21_BREBN/5-195S.YV--EF---L.A..V..E....HQ-----EL...........AR..Q....SE..N.PLIRQC...............
Q8ELK5_OCEIH/5-195S.YI--EF---I.G..V..F....SE-----QL...........AN..E....AA..K.V...DHGLI............
B1HV56_LYSSC/5-194S.YI--EQ---I.A..I.YD....RD-----LFE.........QAAQYP....YS..L.HYTFK................
Q5WBL3_BACSK/5-198E.YI--EF---L.S..I..D....DR-----ALFDK.....VGAQ..................DVAYSP...........
B9DM11_STACT/6-192A.YI--EI---I.G..V..S....DE-----EKLKK.....VIKTN..E....GR..V.SFVSK................
B9E9H1_MACCJ/8-191S.YI--EF---IDA..Y..DLTLVHK-----AV...........QS..T....EE..RLSFAASL...............
D1CHQ7_THET1/9-194E.YI--EL---L.S..V..Y....DR-----AE...........AE..S....AGIGR.RTLVE................
D1C9M3_SPHTD/5-190D.YI--EL---L.T..I.AD....PE-----EA..........ERA..G....GS..S.KVLLD................
A5UPV1_ROSS1/5-179GSYL--EL---I.A..F..R....RE-----AP...........D.........H..I.WWR..................
B0D2X2_LACBS/11-211GLYL--EL---L.SFTH..E....PS-----HY...........PP..G....SP..A.RVKRDT...............
B9L3L2_THERP/5-180GAYL--EL---L.A..F..Y....ED-----NP...........A.........H..R.WHRFR................
Q0UPP1_PHANO/6-192GCYI--EL---I.S.FI..D....PP-----KA...........A.........S..H.WWGPD................
A7I5C5_METB6/53-255S.YL--EL---F.A.PV..N....PA-----MA...........T...E....MK..A.LVASGTFDAAMQQE....NAM
Q11EY7_CHESB/5-184S.YI--EI---L.F.LA..D....PE-----YR...........KT..H....RL..A.PL...................
C7N101_SLAHD/3-183GPYI--EL---L.DGSR..M....PG-----AA............K..V....LM..R.LLGKGALV.............
Q215A9_RHOPB/5-194F.FI--EI---L.S..V.AE....PE-----KI...........VP..H....RP..R.AFSFG................
A7IN29_XANP2/5-195F.FI--EL---L.Q..V.AE....PE-----KI...........PP..D....EG..T.RFSFG................
Q92KD8_RHIME/11-203T.YL--EP---L.A..V..A....SR-----EEC........EAAA..L....EG..N.AFVARDQ..............
B9JW73_AGRVS/9-199GIYL--EP---L.A..I..N....DH-----KAV........DAAI..A....NG..N.VFIRRDR..............
Q2W045_MAGSA/8-179D.YL--EL---L.A..A..V....GE-----GG...........PA..D....RV..R.TF.LD................
Q7VS77_BORPE/8-188D.YL--EI---R.G..I.GD....PN-----KF...........LA..G....VD..K......................
Q2KVI0_BORA1/6-182T.YI--EL---L.G..W..P....PG-----AP...........PA..R....KE..I......................
Q13QK5_BURXL/9-186H.YL--EL---V.G..L..P....PG-----AT...........T...............LRRE................
B1M8D4_METRJ/14-190P.YL--EL---V.G..V..P....ET-----GP...........Q........R........QD................
E6WJ36_PANSA/10-188N.YL--EL---L.G..Y..E....TA-----RG...........N...............VRQD................
Q213B5_RHOPB/15-192D.YL--EL---L.G..Y..L....PG-----RE...........TQ..R....AD..L.WA...................
B9JHP8_AGRRK/10-187T.YL--EL---L.G..F..P....PG-----DD...........KK..R....SD..L.WS...................
Q0K796_CUPNH/8-187D.YL--EL---L.H..V........T-----AP...........SP..S....RQ..Y.YWDAQ................
Q89RQ5_BRADU/9-192D.YM--EL---L.G..V..L....AA-----TE...........QN..A....PA..R.AF.LD................
A6X474_OCHA4/8-190D.YF--EL---L.G..I..V....AE-----TP...........G............N.LHQRE................
Q7VV42_BORPE/8-199G.YF--EL---L.G.LV..E....PD-----KP...........ST.......AR..R.M..LD................
Q7VZU9_BORPE/17-205G.YI--EL---V.A.VV..D....PA-----LD...........LR..G....IP.....EGLA................
D3PXN5_STANL/9-232G.FI--EL---L.A..F..A....PD-----NRDLLPAEARLVPL..................AVPDEQLAATRAALRGT
C5C9I8_MICLC/6-186RQYL--EV---VEA.LD..H....PA-----SL...........SA..P....FG..Q.LVRA.................
A6WG27_KINRD/3-181GCYV--EV---V.EVLD..H....PV-----AD...........KA..L....FG..R.AVR.E................
C7Q7Z4_CATAD/3-184S.YV--EV---V.APLD..H....PA-----TD...........AA..P....FG..K.AVKA.................
D3Q658_STANL/7-189R.YV--EI---L.T..I..V....DR-----ELFAP....SAFGKA..T....TG..W.MPTID................
A4X9C2_SALTO/3-192Q.YL--EL---L.V..T..N....DE-----REL.........GST..D....FG..R.AF.LE................
A0JUJ0_ARTS2/1-173HKYL--EV---V.E..VLDH....PA-----SD...........KA..P....FG..Q.AVRAR................
A5VHI4_LACRD/7-201N.YI--EL---L.T..I..A....NK-----EK...........AK..A....FPYEN.NSAIHDA..............
A6T918_KLEP7/6-197T.YI--EF---L.A..I.AD....PD-----EL...........RA..A....TD..KFLLSRDA...............
D0IV05_COMT2/5-180GVYF--EL---I.A..W........R-----AP...........AP..E....ER..W.WQQLQ................
F2KGG4_PSEBN/11-197N.FI--EL---I.G..V..D....DP-----SKF........GTNS..V....NG..F.CFGRQL...............
G8PVJ3_PSEUV/4-182TLYL--EV---V.A..L..D....PT-----CP...........TP..N....RA..R.WFGLDDQK.............
Q2FVZ2_STAA8/5-191N.YI--EL---L.D..V..E....NN-----EKLKK.....MAKTI..E....GG..V.AFATQ................
Q5HLY5_STAEQ/5-190S.YI--EL---L.D..V..E....NE-----SKLSN.....IAKTE..E....GR..V.SFATK................
Q5L3B6_GEOKA/5-192R.YI--EW---I.G..I..A....DE-----QT...........AK..T....CG..N.PLIDQL...............
Q63W09_BURPS/8-197A.YL--EV---I.A..A..A....PD-----APAP.......ADGQ..P....RP..R.LFGLDDPA.............
Q6AAZ6_PROAC/4-172R.YI--EI---V.E..VLDH....PA-----AE...........KA..V....FG..Q.AVRAR................
Q6N6G7_RHOPA/5-180GSYF--EL---I.A..F..D....RP-----AP...............D....FR..W.WQVLD................
Q81NU9_BACAN/4-191S.YI--EF---L.A..V..Q....HE-----EK...........AK..E....AE..N.PLVQET...............
U5LCG2_9BACI/5-192S.YI--EF---L.A..V..E....EA-----EI...........AA..S....SD..N.PLIQQL...............
V6F093_9PROT/9-176C.YL--EV---I.S..I..D....PE-----AS...........AP..E....GP..R.WFGLD................
V6F8Z3_9PROT/8-187D.YI--AL---Q.G..A..V....GE-----GE...........VA..D....EL..R.AFT..................

PF14506

Q5M2X6_STRT2/13-137SLFV-------IEE-----S----PAYRCRAVE-----------------------------------------------
Q8DP81_STRR6/14-136EKLV-------LEE-----A----PSMRTRKVE-----------------------------------------------
Q8DVS0_STRMU/9-132SLFL-------IEE-----S----PDIRTRAVK-----------------------------------------------
Q8DXW5_STRA5/9-132ASFI-------IEE-----S----PTYRTRAVN-----------------------------------------------
Q99Y63_STRP1/9-131ECFV-------IEE-----S----PSVRTRAVE-----------------------------------------------

PF06983

Q7CRK9_AGRFC/2-118VSCI--GL---NGG..PTFK----HS-----EA-----------------------------------------------
Q92TY1_RHIME/2-118QNFT--AL---EAG..PLDP----FN-----HA-----------------------------------------------
Q837B9_ENTFA/2-127QTII--GL---NGG..PEFS----FT-----PA-----------------------------------------------
Q73WJ2_MYCPA/2-116SRFI--GI---NGG..PHFR----FS-----EA-----------------------------------------------
Q82NZ5_STRAW/4-119QKFV--AL---NGG..PQFT----FS-----EA-----------------------------------------------
Q82XJ9_NITEU/2-119QSFI--GL---NGG..PNFT----PD-----QA-----------------------------------------------
Q6MLW9_BDEBA/2-119RKFV--GL---NGG..PVFK----PN-----ES-----------------------------------------------
Q9X7R8_STRCO/4-119QKFV--GL---NGG..PQFK----FN-----EA-----------------------------------------------
Q97DK8_CLOAB/2-123LPFA--AI---SAG..PFFK----FN-----PS-----------------------------------------------
Q97DK8_CLOAB/132-253TNFS--AS---DNGFDTNYC----FN-----EA-----------------------------------------------
Q89SJ1_BRADU/2-118QPLV--AL---NGG..MKME----YT-----HA-----------------------------------------------
Q6N1I9_RHOPA/2-118QPFM--AL---NGG..TPLP----FN-----HA-----------------------------------------------
Q9CEE8_LACLA/17-136LDFI--CL---DGG..PIFK----FN-----EA-----------------------------------------------
Q88GT8_PSEPK/3-119IPCV--GL---NGG..PAFK----HC-----EA-----------------------------------------------
Q74AD9_GEOSL/5-121IPCL--GL---NGG..PEFT----HN-----EA-----------------------------------------------
Q98C01_RHILO/2-116VPFL--AL---NGG..PQYK----FT-----EA-----------------------------------------------
Q2G1U2_STAA8/5-129QVFM--AI---DANSGTELP----MN-----PA-----------------------------------------------
Q81QE2_BACAN/6-132QEFM--CI---DSYVNHNFT----FT-----PA-----------------------------------------------
Q8F7U5_LEPIN/2-119KEIL--SF---NGG..PHFK----FT-----PA-----------------------------------------------
Q8NP25_CORGL/152-272QWIF--AM---DSGVEQDFT----FS-----EG-----------------------------------------------

PF14696

Q124D7_POLSJ/13-161-INF--IL---NAE----------PD-----SF------------------------AQRFARQ----------------
A5WE99_PSYWF/5-143-INL--IL---NRE----------PR-----SQ------------------------ASYFVEE----------------
B6IWM9_RHOCS/19-161-ITF--IL---NGE----------KT-----GR------------------------AAEFARA----------------
Q2NAB6_ERYLH/5-147-INL--IA---NYE----------PR-----SA------------------------AWYFARE----------------
D0J5T0_COMT2/5-143-INF--II---NRE----------PR-----SQ------------------------AAYFTAE----------------
Q2SND1_HAHCH/5-146-INF--LV---NEN----------VP-----SY------------------------FHKFSMD----------------
Q0ASV8_MARMM/5-143-INF--LI---NYE----------PD-----TQ------------------------AAFFAKE----------------
A6VYX1_MARMS/5-143-INF--IL---NKE----------KG-----SE------------------------AYYFGQE----------------
Q0BY65_HYPNA/5-146-INL--IT---NYE----------PK-----SA------------------------AWYFARE----------------
B2FKN2_STRMK/6-147-VNF--LV---NED----------PD-----SF------------------------AADFAEK----------------
D5VC74_MORCR/28-166-INF--MV---NRE----------PN-----SE------------------------AMYFAQE----------------
Q63PY5_BURPS/6-154-INF--II---NAE----------PD-----SF------------------------AQRFARL----------------
Q87Z77_PSESM/10-148-INL--IL---NNE----------PH-----SL------------------------ASYFAAE----------------
Q8PDA4_XANCP/6-147-VNF--LL---NED----------PD-----SF------------------------AADFAAA----------------

PF06185

Q9CN85_PASMU/28-211YWLT--LL---LKYG.TILS----DN-----LV-----------------------------------------------
E6WA61_PANSA/8-184RWKQ--GL---LQIG.SQFS----EA-----MI-----------------------------------------------
Q7VP39_HAEDU/11-195QWRT--LL---EQHG.ELLT----EN-----QV-----------------------------------------------
A1S7G3_SHEAM/3-184KLTE--SF---SHLG.CIIS----NN-----MI-----------------------------------------------
H2ITZ6_RAHAC/6-182RWKA--GL---EQCG.SLLN----ET-----LI-----------------------------------------------
F4PTK1_DICFS/6-204TKKE--AF---LKDGHELLS----EA-----VI-----------------------------------------------
B2VJB7_ERWT9/11-187RWKQ--GL---LRCA.TLFS----QK-----EI-----------------------------------------------
Q54MZ6_DICDI/4-182EKKE--QL---NQLG.ELLV----ET-----EI-----------------------------------------------
C9R3D1_AGGAD/12-194AWLA--LL---LKQG.SVLR----DN-----VV-----------------------------------------------
E0SAV0_DICD3/24-197QWRT--AL---LTCG.SLLS----EN-----MI-----------------------------------------------
Y1581_HAEIN/7-187NWLI--LL---LKCG.RILS----DN-----IV-----------------------------------------------
I0DZQ5_PROSM/9-183RWRK--GL---HQCG.QLLS----EN-----EI-----------------------------------------------
B7VI23_VIBTL/11-196SAHQ--AW---SEYG.STIS----EA-----MI-----------------------------------------------
Q7N560_PHOLL/9-183RWRK--GF---LQCG.SLMS----ET-----II-----------------------------------------------
Q5E6L1_VIBF1/12-196AAHQ--AW---LQQA.EEWS----NN-----EI-----------------------------------------------
YECM_ECOLI/9-185RWRR--GF---EQCG.ELLS----EN-----MI-----------------------------------------------
A6VND1_ACTSZ/15-196NWLE--RL---LKCG.TILS----DN-----LV-----------------------------------------------
B0UUF0_HISS2/18-194DWLT--LL---LKCG.TILS----GN-----IV-----------------------------------------------
D3VET8_XENNA/9-183QWRR--GF---LQCG.QLMS----EN-----II-----------------------------------------------
A3QD08_SHELP/12-194SLRE--AF---CRQG.EIIS----DN-----MI-----------------------------------------------
F4HCP7_GALAU/9-190RWQQ--AL---AADA.ELLS----DN-----QI-----------------------------------------------
Q12LL9_SHEDO/6-186QLEQ--AF---CQQG.QIIS----KN-----II-----------------------------------------------
D3V176_XENBS/22-196RWRK--GF---LQCG.QLIS----ES-----II-----------------------------------------------
M9WWR4_MANHA/3-184QWKI--LL---LDGA.TLLK----ES-----EV-----------------------------------------------
F4QBC6_DICFS/15-213VKKN--EI---LSSGHEMLT----EV-----NY-----------------------------------------------
Q87RD4_VIBPA/11-196AAHE--AW---NQYG.KVIS----QA-----KI-----------------------------------------------
I2BA68_SHIBC/9-185RWRQ--GL---EQCA.TLLS----EN-----MI-----------------------------------------------
D8MT98_ERWBE/11-187RWKS--GF---MQHG.VLFS----EK-----EI-----------------------------------------------
B8F673_HAEPS/18-196QWKA--ML---LTGS.TLLK----ES-----EV-----------------------------------------------
W0HX46_9ENTR/9-183RWYQ--GF---SQCG.RVLN----ET-----KI-----------------------------------------------
Q65SX5_MANSM/18-195SWLT--TL---LNYG.KILS----NN-----LV-----------------------------------------------
Q6LTA0_PHOPR/10-194ALHQ--AW---LAYG.DEWS----NN-----MI-----------------------------------------------
Q8EF20_SHEON/12-196ALKQ--AF---SERG.RIIS----DN-----KI-----------------------------------------------
E1SQM9_FERBD/4-183ALRD--DL---LSRG.TLLS----DK-----EI-----------------------------------------------
J7TZ01_MORMO/9-183QWLA--GF---RECG.TVLS----DN-----QI-----------------------------------------------
D4GGT7_PANAM/8-184RWQQ--GL---AKMG.QQFS----AA-----MI-----------------------------------------------
F7YNG9_VIBA7/11-196LAHA--AW---LEEG.REIS----SA-----QI-----------------------------------------------
F0LNL8_VIBFN/11-196AAHV--AW---LDEA.EEIS----CA-----QI-----------------------------------------------
W0L3M1_9ENTR/9-185RWRQ--GL---AQCG.TVLS----DA-----II-----------------------------------------------
C5B833_EDWI9/9-185RWRR--GF---LRCG.TLLT----EN-----TI-----------------------------------------------
Q7CIB5_YERPE/9-180RWRL--GL---QQCG.HLMS----ET-----LI-----------------------------------------------
D4ZJ81_SHEVD/8-188ALSH--YF---QQQG.KVIS----NN-----II-----------------------------------------------
B4ETN6_PROMH/11-183QWRN--GL---SQCG.ECIS----DN-----MI-----------------------------------------------
A3MYB0_ACTP2/11-194RWRS--IL---LENS.ELLK----ES-----EV-----------------------------------------------
Q083X6_SHEFN/2-197LLVD--EF---CQHG.KIIS----NN-----II-----------------------------------------------
Q9KQC7_VIBCH/11-196VAHQ--AW---LAYG.EEIS----CA-----QI-----------------------------------------------
Q6D475_PECAS/16-190SWKA--AL---LKAG.CLLS----EN-----QI-----------------------------------------------
Q7MMM2_VIBVY/16-201LSQQ--MW---SEQG.KVIS----QA-----NI-----------------------------------------------
M4RAR0_BIBTR/11-192IWRE--ML---LTDA.TILK----ES-----EV-----------------------------------------------

PF12681

Q187Q5_PEPD6/3-120--------------------------------------------------------------------------------
Q8TUF9_METAC/12-132--------------------------------------------------------------------------------
Q97LL1_CLOAB/3-123--------------------------------------------------------------------------------
A5HYY7_CLOBH/3-121--------------------------------------------------------------------------------
A9CII6_AGRFC/3-123--------------------------------------------------------------------------------
Q81BZ3_BACCR/5-127--------------------------------------------------------------------------------

PF00903

CADE_BACSU/9-123................................................................................
YQCK_BACSU/2-115................................................................................
YQJC_BACSU/3-128................................................................................
LGUL_HUMAN/31-174................................................................................
D5T7F4_LEGP2/151-300................................................................................
CADI_MYCTU/2-114................................................................................
CF30_MYCTU/11-126................................................................................
I7B4U0_PSEPT/143-261................................................................................
BPHC2_RHOGO/6-121................................................................................
LGUL_PSEPU/24-167................................................................................
HPPD_RAT/180-335................................................................................
BPHC3_RHOGO/6-122................................................................................
LGUL_BRAJU/27-171................................................................................
O24828_9GAMM/150-266................................................................................
LGUL_SYNY3/2-123................................................................................
O26852_METTH/2-112................................................................................
P95571_9PSED/143-280................................................................................
LGUL_NEIMB/2-123................................................................................
Q98LB0_RHILO/89-205................................................................................
Q98HZ4_RHILO/7-135................................................................................
FOSB_BACSU/5-117................................................................................
Q9KZ01_STRCO/31-158................................................................................
MHQE_BACSU/5-263GLIFDDTEDLPLAIMEDAKSGKSEWTPDGITTN...........EAITGMKGVLLYSYDPQATIQLLTESFGYTKVAEED
P72786_SYNY3/14-143................................................................................
O53680_MYCTU/15-163................................................................................
YRAH_BACSU/2-124................................................................................
FOSB_STAEP/4-116................................................................................
O68311_GEOTH/148-265................................................................................
YYAH_BACSU/2-124................................................................................
YETH_BACSU/4-118................................................................................
Q9ZNP0_COMTE/147-272................................................................................
Q9ZAY0_9SPHN/150-267................................................................................
O06412_MYCTU/4-113................................................................................
LGUL_HAEIN/2-123................................................................................
D5AV60_RHOCB/8-122................................................................................
YYCE_BACSU/11-130................................................................................
C3JUU8_RHOER/142-267................................................................................
MHQO_BACSU/7-266YVEFDDPHGLHLEIVEREEGEANTWTFGEVTPD...........VAIKGFGGATLLSEQPDKTADLLENIMGLERVGKEG
HPPD_PSEUJ/158-310................................................................................
Q45135_9MICO/152-268................................................................................
N9VUR8_PSEPU/150-266................................................................................
LGUL_BRAOG/17-138................................................................................
Q9I3Z1_PSEAE/3-131................................................................................
Q9KYP6_STRCO/2-118................................................................................
MHQA_BACSU/5-275RDILAFQDHEGQRLVLTADEEGKGYGLPVKQSGIPEEFSFRGLGPVELTVPYAEPTLHVLTNILGFTEISREPVEGQGTA
Q59693_PSEPU/147-272................................................................................
LGUL_SCHPO/11-150................................................................................
LGUL_SALTY/2-123................................................................................
Y3691_SHEFN/4-116................................................................................
Q9KZG9_STRCO/4-130................................................................................
YURT_BACSU/2-124................................................................................
YWKD_BACSU/5-125................................................................................
Q52533_PSESP/147-267................................................................................
MCE_PYRHO/7-131................................................................................
P97099_CUPNE/143-262................................................................................
DNRV_STRPE/8-133................................................................................
P73508_SYNY3/5-122................................................................................
HMAS_AMYOR/158-306................................................................................
O86701_STRCO/4-132................................................................................
Q7AQ90_MYCLE/20-150................................................................................
LGUL_YEAST/22-164................................................................................
C1KH52_SERMA/4-114................................................................................
C3LUW7_VIBCM/6-113................................................................................
Q9Z549_STRCO/4-125................................................................................
Q48341_STRLI/5-125................................................................................
O32376_COMTE/143-262................................................................................
O69350_RHOER/145-267................................................................................
GLOD4_CAEEL/132-248................................................................................
YAER_ECOLI/6-126................................................................................
O86906_SPHSX/146-261................................................................................
O28796_ARCFU/50-170................................................................................
O05205_STRLA/4-125................................................................................
I7MMZ2_TETTS/194-350................................................................................
Q9I5D5_PSEAE/8-139................................................................................
O87625_PSEAI/152-264................................................................................
Q50912_SPHXE/13-131................................................................................
A5W4G6_PSEP1/11-255GMQPTWVSAEEAKQLRQGLGFRVRERHSGLLFELFVGNMHLSNPFVPTVAKIARIGHVVIGSENFEGSRDSLVDDFGFRV
Q59770_RHORH/162-279................................................................................
YWBC_BACSU/4-123................................................................................
Q9KEK2_BACHD/4-140................................................................................
O28065_ARCFU/4-128................................................................................
A2YS08_ORYSI/24-146................................................................................

PF13669

A9C2R0_DELAS/14-124--------------------------------------------------------------------------------
A2SEJ1_METPP/12-122--------------------------------------------------------------------------------
D0LXQ3_HALO1/13-123--------------------------------------------------------------------------------
Q5P377_AROAE/12-122--------------------------------------------------------------------------------
Q1D6F8_MYXXD/37-147--------------------------------------------------------------------------------
B8BYE7_THAPS/75-187--------------------------------------------------------------------------------
B5Y3L3_PHATC/38-148--------------------------------------------------------------------------------
A4HEL0_LEIBR/19-133--------------------------------------------------------------------------------
D4J6L0_9FIRM/18-126--------------------------------------------------------------------------------
D2RXZ8_HALTV/10-118--------------------------------------------------------------------------------
Q39TG0_GEOMG/11-132--------------------------------------------------------------------------------
D3F6C9_CONWI/9-133--------------------------------------------------------------------------------
A6LI20_PARD8/8-119--------------------------------------------------------------------------------
Q97H22_CLOAB/4-114--------------------------------------------------------------------------------
B9JM51_AGRRK/6-125--------------------------------------------------------------------------------
C5CVE4_VARPS/9-131--------------------------------------------------------------------------------
Q13K82_BURXL/9-131--------------------------------------------------------------------------------
Q13I71_BURXL/19-140--------------------------------------------------------------------------------
Q5UWE3_HALMA/10-117--------------------------------------------------------------------------------
C0ZEG8_BREBN/1496-1609--------------------------------------------------------------------------------
D4M9A6_9BACT/4-116--------------------------------------------------------------------------------
Q12HJ2_POLSJ/9-131--------------------------------------------------------------------------------
D2RQ64_HALTV/17-139--------------------------------------------------------------------------------
A5VBF6_SPHWW/10-129--------------------------------------------------------------------------------
A1TCL4_MYCVP/8-130--------------------------------------------------------------------------------
C7PR30_CHIPD/14-138--------------------------------------------------------------------------------
A4XEN6_NOVAD/16-137--------------------------------------------------------------------------------
A5G6D6_GEOUR/8-118--------------------------------------------------------------------------------
Q2YCD2_NITMU/13-126--------------------------------------------------------------------------------
B1MB48_MYCA9/17-139--------------------------------------------------------------------------------
A0R1J5_MYCS2/10-129--------------------------------------------------------------------------------
C7RS60_ACCPU/18-128--------------------------------------------------------------------------------
D5URS6_TSUPD/111-214--------------------------------------------------------------------------------
D0LDW1_GORB4/120-238--------------------------------------------------------------------------------
A5V4C1_SPHWW/15-137--------------------------------------------------------------------------------
E0UKN1_CYAP2/120-235--------------------------------------------------------------------------------
Q2G768_NOVAD/15-136--------------------------------------------------------------------------------
Q744Q1_MYCPA/12-125--------------------------------------------------------------------------------
D2AXE6_STRRD/3-112--------------------------------------------------------------------------------
B8FMX2_DESAA/10-131--------------------------------------------------------------------------------
C5C099_BEUC1/20-129--------------------------------------------------------------------------------
Q15VI5_PSEA6/7-112--------------------------------------------------------------------------------
A2QUW1_ASPNC/11-144--------------------------------------------------------------------------------
Q28K59_JANSC/19-130--------------------------------------------------------------------------------
A1SVB5_PSYIN/4-112--------------------------------------------------------------------------------
C7NIJ3_KYTSD/10-119--------------------------------------------------------------------------------
A4SXB6_POLSQ/12-122--------------------------------------------------------------------------------
A4XGA4_CALS8/13-134--------------------------------------------------------------------------------
B0RG81_CLAMS/8-115--------------------------------------------------------------------------------
B2HSW2_MYCMM/9-134--------------------------------------------------------------------------------
B8E0B0_DICTD/13-133--------------------------------------------------------------------------------
F3Z5I0_9ACTN/9-118--------------------------------------------------------------------------------
R5SQY8_9FIRM/9-124--------------------------------------------------------------------------------

PF13468

C5BVV5_BEUC1/6-191.....---------------------------------------------------------------------------
Q3IZS4_RHOS4/4-171.....---------------------------------------------------------------------------
Q28LV8_JANSC/4-176.....---------------------------------------------------------------------------
D7BGN4_MEISD/10-187...LQ---------------------------------------------------------------------------
D3PMM6_MEIRD/4-173.....---------------------------------------------------------------------------
Q1IXF9_DEIGD/4-178...RR---------------------------------------------------------------------------
A9HYM0_BORPD/5-178.....---------------------------------------------------------------------------
Q47D15_DECAR/6-180.....---------------------------------------------------------------------------
A9B642_HERA2/8-182.....---------------------------------------------------------------------------
D2QC41_SPILD/11-185.....---------------------------------------------------------------------------
B8IP73_METNO/4-183..AVR---------------------------------------------------------------------------
B1LV77_METRJ/4-183..RVR---------------------------------------------------------------------------
C5CLJ8_VARPS/5-199..LQA---------------------------------------------------------------------------
D3Q0J0_STANL/2-177.....---------------------------------------------------------------------------
B5HRA1_9ACTN/8-184.....---------------------------------------------------------------------------
A4FK05_SACEN/2-174.....---------------------------------------------------------------------------
C7MHL9_BRAFD/7-186.....---------------------------------------------------------------------------
A6WBM6_KINRD/7-183.....---------------------------------------------------------------------------
B7FUP4_PHATC/255-429.....---------------------------------------------------------------------------
B7FSM2_PHATC/69-245.....---------------------------------------------------------------------------
C0ZG21_BREBN/5-195....I---------------------------------------------------------------------------
Q8ELK5_OCEIH/5-195..KSI---------------------------------------------------------------------------
B1HV56_LYSSC/5-194.....---------------------------------------------------------------------------
Q5WBL3_BACSK/5-198.FSSI---------------------------------------------------------------------------
B9DM11_STACT/6-192.....---------------------------------------------------------------------------
B9E9H1_MACCJ/8-191.....---------------------------------------------------------------------------
D1CHQ7_THET1/9-194.....---------------------------------------------------------------------------
D1C9M3_SPHTD/5-190.....---------------------------------------------------------------------------
A5UPV1_ROSS1/5-179.....---------------------------------------------------------------------------
B0D2X2_LACBS/11-211....H---------------------------------------------------------------------------
B9L3L2_THERP/5-180.....---------------------------------------------------------------------------
Q0UPP1_PHANO/6-192.....---------------------------------------------------------------------------
A7I5C5_METB6/53-255DSRFM---------------------------------------------------------------------------
Q11EY7_CHESB/5-184.....---------------------------------------------------------------------------
C7N101_SLAHD/3-183..DRL---------------------------------------------------------------------------
Q215A9_RHOPB/5-194.....---------------------------------------------------------------------------
A7IN29_XANP2/5-195.....---------------------------------------------------------------------------
Q92KD8_RHIME/11-203....A---------------------------------------------------------------------------
B9JW73_AGRVS/9-199....T---------------------------------------------------------------------------
Q2W045_MAGSA/8-179.....---------------------------------------------------------------------------
Q7VS77_BORPE/8-188.....---------------------------------------------------------------------------
Q2KVI0_BORA1/6-182.....---------------------------------------------------------------------------
Q13QK5_BURXL/9-186.....---------------------------------------------------------------------------
B1M8D4_METRJ/14-190.....---------------------------------------------------------------------------
E6WJ36_PANSA/10-188.....---------------------------------------------------------------------------
Q213B5_RHOPB/15-192.....---------------------------------------------------------------------------
B9JHP8_AGRRK/10-187.....---------------------------------------------------------------------------
Q0K796_CUPNH/8-187.....---------------------------------------------------------------------------
Q89RQ5_BRADU/9-192.....---------------------------------------------------------------------------
A6X474_OCHA4/8-190.....---------------------------------------------------------------------------
Q7VV42_BORPE/8-199.....---------------------------------------------------------------------------
Q7VZU9_BORPE/17-205.....---------------------------------------------------------------------------
D3PXN5_STANL/9-232VGALE---------------------------------------------------------------------------
C5C9I8_MICLC/6-186.....---------------------------------------------------------------------------
A6WG27_KINRD/3-181.....---------------------------------------------------------------------------
C7Q7Z4_CATAD/3-184.....---------------------------------------------------------------------------
D3Q658_STANL/7-189.....---------------------------------------------------------------------------
A4X9C2_SALTO/3-192.....---------------------------------------------------------------------------
A0JUJ0_ARTS2/1-173.....---------------------------------------------------------------------------
A5VHI4_LACRD/7-201...VE---------------------------------------------------------------------------
A6T918_KLEP7/6-197....A---------------------------------------------------------------------------
D0IV05_COMT2/5-180.....---------------------------------------------------------------------------
F2KGG4_PSEBN/11-197....G---------------------------------------------------------------------------
G8PVJ3_PSEUV/4-182..TIK---------------------------------------------------------------------------
Q2FVZ2_STAA8/5-191.....---------------------------------------------------------------------------
Q5HLY5_STAEQ/5-190.....---------------------------------------------------------------------------
Q5L3B6_GEOKA/5-192....V---------------------------------------------------------------------------
Q63W09_BURPS/8-197...TH---------------------------------------------------------------------------
Q6AAZ6_PROAC/4-172.....---------------------------------------------------------------------------
Q6N6G7_RHOPA/5-180.....---------------------------------------------------------------------------
Q81NU9_BACAN/4-191....V---------------------------------------------------------------------------
U5LCG2_9BACI/5-192....I---------------------------------------------------------------------------
V6F093_9PROT/9-176.....---------------------------------------------------------------------------
V6F8Z3_9PROT/8-187.....---------------------------------------------------------------------------

PF14506

Q5M2X6_STRT2/13-137--------------------------------------------------------------------------------
Q8DP81_STRR6/14-136--------------------------------------------------------------------------------
Q8DVS0_STRMU/9-132--------------------------------------------------------------------------------
Q8DXW5_STRA5/9-132--------------------------------------------------------------------------------
Q99Y63_STRP1/9-131--------------------------------------------------------------------------------

PF06983

Q7CRK9_AGRFC/2-118--------------------------------------------------------------------------------
Q92TY1_RHIME/2-118--------------------------------------------------------------------------------
Q837B9_ENTFA/2-127--------------------------------------------------------------------------------
Q73WJ2_MYCPA/2-116--------------------------------------------------------------------------------
Q82NZ5_STRAW/4-119--------------------------------------------------------------------------------
Q82XJ9_NITEU/2-119--------------------------------------------------------------------------------
Q6MLW9_BDEBA/2-119--------------------------------------------------------------------------------
Q9X7R8_STRCO/4-119--------------------------------------------------------------------------------
Q97DK8_CLOAB/2-123--------------------------------------------------------------------------------
Q97DK8_CLOAB/132-253--------------------------------------------------------------------------------
Q89SJ1_BRADU/2-118--------------------------------------------------------------------------------
Q6N1I9_RHOPA/2-118--------------------------------------------------------------------------------
Q9CEE8_LACLA/17-136--------------------------------------------------------------------------------
Q88GT8_PSEPK/3-119--------------------------------------------------------------------------------
Q74AD9_GEOSL/5-121--------------------------------------------------------------------------------
Q98C01_RHILO/2-116--------------------------------------------------------------------------------
Q2G1U2_STAA8/5-129--------------------------------------------------------------------------------
Q81QE2_BACAN/6-132--------------------------------------------------------------------------------
Q8F7U5_LEPIN/2-119--------------------------------------------------------------------------------
Q8NP25_CORGL/152-272--------------------------------------------------------------------------------

PF14696

Q124D7_POLSJ/13-161--------------------------------------------------------------------------------
A5WE99_PSYWF/5-143--------------------------------------------------------------------------------
B6IWM9_RHOCS/19-161--------------------------------------------------------------------------------
Q2NAB6_ERYLH/5-147--------------------------------------------------------------------------------
D0J5T0_COMT2/5-143--------------------------------------------------------------------------------
Q2SND1_HAHCH/5-146--------------------------------------------------------------------------------
Q0ASV8_MARMM/5-143--------------------------------------------------------------------------------
A6VYX1_MARMS/5-143--------------------------------------------------------------------------------
Q0BY65_HYPNA/5-146--------------------------------------------------------------------------------
B2FKN2_STRMK/6-147--------------------------------------------------------------------------------
D5VC74_MORCR/28-166--------------------------------------------------------------------------------
Q63PY5_BURPS/6-154--------------------------------------------------------------------------------
Q87Z77_PSESM/10-148--------------------------------------------------------------------------------
Q8PDA4_XANCP/6-147--------------------------------------------------------------------------------

PF06185

Q9CN85_PASMU/28-211--------------------------------------------------------------------------------
E6WA61_PANSA/8-184--------------------------------------------------------------------------------
Q7VP39_HAEDU/11-195--------------------------------------------------------------------------------
A1S7G3_SHEAM/3-184--------------------------------------------------------------------------------
H2ITZ6_RAHAC/6-182--------------------------------------------------------------------------------
F4PTK1_DICFS/6-204--------------------------------------------------------------------------------
B2VJB7_ERWT9/11-187--------------------------------------------------------------------------------
Q54MZ6_DICDI/4-182--------------------------------------------------------------------------------
C9R3D1_AGGAD/12-194--------------------------------------------------------------------------------
E0SAV0_DICD3/24-197--------------------------------------------------------------------------------
Y1581_HAEIN/7-187--------------------------------------------------------------------------------
I0DZQ5_PROSM/9-183--------------------------------------------------------------------------------
B7VI23_VIBTL/11-196--------------------------------------------------------------------------------
Q7N560_PHOLL/9-183--------------------------------------------------------------------------------
Q5E6L1_VIBF1/12-196--------------------------------------------------------------------------------
YECM_ECOLI/9-185--------------------------------------------------------------------------------
A6VND1_ACTSZ/15-196--------------------------------------------------------------------------------
B0UUF0_HISS2/18-194--------------------------------------------------------------------------------
D3VET8_XENNA/9-183--------------------------------------------------------------------------------
A3QD08_SHELP/12-194--------------------------------------------------------------------------------
F4HCP7_GALAU/9-190--------------------------------------------------------------------------------
Q12LL9_SHEDO/6-186--------------------------------------------------------------------------------
D3V176_XENBS/22-196--------------------------------------------------------------------------------
M9WWR4_MANHA/3-184--------------------------------------------------------------------------------
F4QBC6_DICFS/15-213--------------------------------------------------------------------------------
Q87RD4_VIBPA/11-196--------------------------------------------------------------------------------
I2BA68_SHIBC/9-185--------------------------------------------------------------------------------
D8MT98_ERWBE/11-187--------------------------------------------------------------------------------
B8F673_HAEPS/18-196--------------------------------------------------------------------------------
W0HX46_9ENTR/9-183--------------------------------------------------------------------------------
Q65SX5_MANSM/18-195--------------------------------------------------------------------------------
Q6LTA0_PHOPR/10-194--------------------------------------------------------------------------------
Q8EF20_SHEON/12-196--------------------------------------------------------------------------------
E1SQM9_FERBD/4-183--------------------------------------------------------------------------------
J7TZ01_MORMO/9-183--------------------------------------------------------------------------------
D4GGT7_PANAM/8-184--------------------------------------------------------------------------------
F7YNG9_VIBA7/11-196--------------------------------------------------------------------------------
F0LNL8_VIBFN/11-196--------------------------------------------------------------------------------
W0L3M1_9ENTR/9-185--------------------------------------------------------------------------------
C5B833_EDWI9/9-185--------------------------------------------------------------------------------
Q7CIB5_YERPE/9-180--------------------------------------------------------------------------------
D4ZJ81_SHEVD/8-188--------------------------------------------------------------------------------
B4ETN6_PROMH/11-183--------------------------------------------------------------------------------
A3MYB0_ACTP2/11-194--------------------------------------------------------------------------------
Q083X6_SHEFN/2-197--------------------------------------------------------------------------------
Q9KQC7_VIBCH/11-196--------------------------------------------------------------------------------
Q6D475_PECAS/16-190--------------------------------------------------------------------------------
Q7MMM2_VIBVY/16-201--------------------------------------------------------------------------------
M4RAR0_BIBTR/11-192--------------------------------------------------------------------------------

PF12681

Q187Q5_PEPD6/3-120------------------------------------QSNNFQL-YF--------E--V------------N---D---I-
Q8TUF9_METAC/12-132------------------------------------KSNNSEL-YF--------E--E------------A---D---L-
Q97LL1_CLOAB/3-123------------------------------------QSNGFEL-YF--------E--E------------D---N---I-
A5HYY7_CLOBH/3-121------------------------------------RSNNMEL-YF--------E--V------------D---D---F-
A9CII6_AGRFC/3-123------------------------------------GRRNMLL-YF--------E--H------------A---D---V-
Q81BZ3_BACCR/5-127------------------------------------QSSHFEL-GF--------V--V------------E---N---V-

PF00903

CADE_BACSU/9-123...............VTGL....-----.........YHFAIL-LP--------D--R------------K---E---L-
YQCK_BACSU/2-115.......................-----.........NHFGFQ-VD--------S--L------------E---E---V-
YQJC_BACSU/3-128................KKG....-----.........QGLHHI-AF--------L--C------------N---C---L-
LGUL_HUMAN/31-174...............NGN.S...-----.......DPRGFGHI-GI--------A--V------------P---D---V-
D5T7F4_LEGP2/151-300...................EFLH-----.....EYHGEGIQHI-AL--------N--T------------N---D---I-
CADI_MYCTU/2-114.......................-----..........HLGVE-VG--------S--S------------N---T---V-
CF30_MYCTU/11-126.......................-----...........IWNT-YI--------A--V------------D---D---V-
I7B4U0_PSEPT/143-261.......................-----...........FMLQ-AN--------G--M------------D---D---V-
BPHC2_RHOGO/6-121...................AA..-----.......GMHHTAYT-FD--------T--L------------G---D---L-
LGUL_PSEPU/24-167...............HGN.T...-----.......DPRGFGHI-CV--------S--V------------P---D---V-
HPPD_RAT/180-335...................IQEY-----V...DYNGGAGVQHI-AL--------R--T------------E---D---I-
BPHC3_RHOGO/6-122...............ATV.G...-----........LAHTAFT-FP--------T--L------------G---D---L-
LGUL_BRAJU/27-171...............HNG.NS..-----.......EPRGFGHI-GV--------T--V------------D---D---V-
O24828_9GAMM/150-266...............EEP.G...-----.......KFHHASFF-LE--------T--W------------Q---D---V-
LGUL_SYNY3/2-123.......................-----..........GFGHI-AL--------G--V------------E---D---I-
O26852_METTH/2-112.......................-----..........GFFSI-GM--------E--V------------D---D---L-
P95571_9PSED/143-280.......................-----...........FLLQ-AL--------T--L------------D---D---V-
LGUL_NEIMB/2-123.......................-----..........AYGHI-AV--------E--V------------D---D---A-
Q98LB0_RHILO/89-205.......................-----.........DDLLAA-TI--------V--V------------D---N---I-
Q98HZ4_RHILO/7-135...................A...-----........QGYTLQL-HL--------D--D------------G---D---I-
FOSB_BACSU/5-117.......................-----........SYTHIAF-TI--------E--D------------H---E---F-
Q9KZ01_STRCO/31-158...................N...-----........AFFVSVR-GE--------T--T------------E---E---I-
MHQE_BACSU/5-263QIVRLASSAAVGGVIDVHLHPEK-----RGVGGYGTVHHVAFR-TK--------K--K------------E---Q---.-
P72786_SYNY3/14-143...............SFT.....-----........RTDHLAF-DI--------A--P------------E---Q---F-
O53680_MYCTU/15-163..........IGDITSAV.S...-----.......TMNHLAFH-VP--------A--E------------R---F---.-
YRAH_BACSU/2-124...............SLE.G...-----.......EAQSKFLL-QF--------K--V------------E---D---V-
FOSB_STAEP/4-116.......................-----........SYTHIAF-TI--------S--D------------N---D---F-
O68311_GEOTH/148-265...............KDE.K...-----........LHHFAFW-LD--------E--F------------N---E---L-
YYAH_BACSU/2-124...................MT..-----.......GWAHIAFS-VG--------S--R------------E---K---V-
YETH_BACSU/4-118.......................-----............ASI-VF--------E--C------------E---D---I-
Q9ZNP0_COMTE/147-272...............PTS.G...-----........LHHIAFF-LD--------S--W------------H---D---V-
Q9ZAY0_9SPHN/150-267...............NED.A...-----.......KLHHTSFR-LD--------S--W------------N---D---V-
O06412_MYCTU/4-113.......................-----...........PGAL-WL--------Q--V------------R---D---L-
LGUL_HAEIN/2-123.......................-----..........AYGHI-AI--------G--V------------D---D---I-
D5AV60_RHOCB/8-122.......................-----.........HHLAFQ-AQ--------D--R------------E---T---V-
YYCE_BACSU/11-130...................P...-----........DSLLVFY-VP--------N--A------------V---E---L-
C3JUU8_RHOER/142-267.......................-----...........LMLE-VE--------N--S------------D---D---V-
MHQO_BACSU/7-266DFVRYRSAGDIGNVIDLKLTPIG-----RGQMGAGTVHHIAWR-AN--------D--D------------E---D---Q-
HPPD_PSEUJ/158-310...................EEFL-----....MQFNGEGIQHV-AF--------L--S------------D---D---L-
Q45135_9MICO/152-268...............NGP.R...-----........LHHVAFS-TH--------E--K------------H---N---I-
N9VUR8_PSEPU/150-266...............PEK.G...-----.......RLHHVSFH-LE--------T--W------------E---D---L-
LGUL_BRAOG/17-138.......................-----..........GFGHF-AI--------S--T------------Q---D---V-
Q9I3Z1_PSEAE/3-131...................K...-----........GCSISLN-VD--------S--K------------A---E---A-
Q9KYP6_STRCO/2-118.......................-----............VIV-EF--------L--V------------D---D---V-
MHQA_BACSU/5-275VILESGEGGAATEIHLIERNDLP-----RERQGKGSVHHVAFR-VR--------D--E------------E---E---L-
Q59693_PSEPU/147-272...............PSA.G...-----........VHHISFF-LD--------S--W------------H---D---V-
LGUL_SCHPO/11-150...............NGN.TE..-----.......PKRGFGHI-CF--------T--V------------D---N---I-
LGUL_SALTY/2-123.......................-----..........AYGHI-AL--------S--V------------D---N---A-
Y3691_SHEFN/4-116...............NQA.....-----.........GGRVFL-FL--------N--T------------D---D---F-
Q9KZG9_STRCO/4-130...................G...-----.......NTFAVSLS-GD--------D--A------------T---E---L-
YURT_BACSU/2-124...............KIF.....-----........SEGLPAT-MF--------G--V------------A---D---I-
YWKD_BACSU/5-125...................E...-----........AAGLRHL-AF--------T--V------------G---S---L-
Q52533_PSESP/147-267.......................-----..........HMMVE-LH--------S--L------------D---D---V-
MCE_PYRHO/7-131...............KRG.....-----.........EGIHHL-AI--------R--V------------E---N---I-
P97099_CUPNE/143-262.......................-----...........FMLQ-AN--------T--I------------D---D---V-
DNRV_STRPE/8-133...................YGPG-----N...DQHGMPAIWTV-YF--------A--T------------D---D---A-
P73508_SYNY3/5-122.......................-----.........RHFGLV-FP--------V--E------------A---D---W-
HMAS_AMYOR/158-306...................IDEF-----L...KDHQGAGVQHI-AF--------N--S------------N---D---A-
O86701_STRCO/4-132...............AMA.DL..-----......LAKGHLRGI-IL--------A--T------------D---D---V-
Q7AQ90_MYCLE/20-150...............KHG.....-----.........PGIQQL-AC--------R--V------------S---D---L-
LGUL_YEAST/22-164...............NGN.EE..-----.......PHRGFGHI-CF--------S--V------------S---D---I-
C1KH52_SERMA/4-114...................S...-----........DYTHYAF-TV--------A--E------------E---D---F-
C3LUW7_VIBCM/6-113.......................-----............ALL-IF--------Y--S------------S---D---I-
Q9Z549_STRCO/4-125...............PAG.G...-----.......GRHSLALL-CD--------T--P------------A---E---V-
Q48341_STRLI/5-125.......................-----.............LL-RV--------F--V------------A---D---A-
O32376_COMTE/143-262.......................-----...........FMLE-VR--------T--I------------D---E---V-
O69350_RHOER/145-267.......................-----.........IHIMVE-VD--------T--L------------D---A---V-
GLOD4_CAEEL/132-248.......................-----..........GRIAF-SY--------P--E------------D---K---L-
YAER_ECOLI/6-126...................E...-----........ACGLRHL-AF--------S--V------------D---D---I-
O86906_SPHSX/146-261.......................-----..........HFMVE-AD--------D--V------------D---A---V-
O28796_ARCFU/50-170...............SLF.....-----........RAGIPVM-VF--------G--T------------D---D---I-
O05205_STRLA/4-125...............PTG.G...-----.......HRFAIAFE-FP--------D--T------------A---S---V-
I7MMZ2_TETTS/194-350...............EYI.DF..-----......YAGPGVQHI-AL--------N--T------------S---D---V-
Q9I5D5_PSEAE/8-139...............VDE.A...-----........GGNTQSL-YL--------V--V------------A---D---P-
O87625_PSEAI/152-264.......................-----.........HHMSFE-VS--------D--L------------D---Q---I-
Q50912_SPHXE/13-131...................E...-----........HVGLMMA-GT--------S--M------------D---D---L-
A5W4G6_PSEP1/11-255SDLIEDRIVFMRCHPNPFHHTFA-----VGPASSSHFHHVNFM-VT--------D--I------------D---D---I-
Q59770_RHORH/162-279...............GMG.EE..-----......GRLHHIAYW-LE--------T--P------------E---T---L-
YWBC_BACSU/4-123.......................-----...........VHHI-AL--------L--T------------D---D---I-
Q9KEK2_BACHD/4-140.......................-----..........TIALT-TN--------N--V------------E---M---T-
O28065_ARCFU/4-128...............SRG.....-----.........EGIHHI-AV--------N--V------------E---N---I-
A2YS08_ORYSI/24-146.......................-----..........GFGHF-AI--------A--T------------E---D---V-

PF13669

A9C2R0_DELAS/14-124-------------------RKPA-----V......HTTPLNHI.GL--------W..I...---------D...D...L-
A2SEJ1_METPP/12-122-------------------KKPA-----V......HTTPLNHV.GL--------W..V...---------D...D...L-
D0LXQ3_HALO1/13-123-------------------GKPK-----V......ASPPLNHV.GL--------W..V...---------D...D...L-
Q5P377_AROAE/12-122-------------------KKPA-----V......HATPLNHV.GL--------W..I...---------D...D...L-
Q1D6F8_MYXXD/37-147-------------------KKPR-----V......HETPLNHV.GL--------W..V...---------D...D...L-
B8BYE7_THAPS/75-187-------------------KSPK-----V......HVPSLNHI.GL--------W..V...---------D...D...L-
B5Y3L3_PHATC/38-148-------------------KSPK-----V......HIPPLNHI.GL--------W..V...---------D...H...L-
A4HEL0_LEIBR/19-133-------------------SPIA-----AFL.ERNKDGGLHHI.CL--------E..V...---------A...D...I-
D4J6L0_9FIRM/18-126-------------------TEFN-----K......GKGGIAHV.AY--------L..V...---------D...D...I-
D2RXZ8_HALTV/10-118-------------------EFLE-----R......RGPGLHHV.TL--------E..V...---------A...D...L-
Q39TG0_GEOMG/11-132-------------------DFLR-----E......HGEGIHHI.AC--------G..V...---------R...N...F-
D3F6C9_CONWI/9-133-------------------EWLD-----R......HGEGLHHL.GM--------F..E...---------E...D...V-
A6LI20_PARD8/8-119-------------------SPVC-----KSL..EKNGVSPYHT.CY--------V..V...---------N...D...I-
Q97H22_CLOAB/4-114-------------------SPIN-----KT...IKKGSTPYHI.CY--------E..V...---------E...D...I-
B9JM51_AGRRK/6-125-------------------STYS-----EYL.AKFPEGGVHHL.GF--------E..V...---------D...D...F-
C5CVE4_VARPS/9-131-------------------DFLQ-----A......GRTGLQHV.AY--------W..T...---------A...D...Y-
Q13K82_BURXL/9-131-------------------DFLA-----A......GHTGLQHN.AY--------W..T...---------T...S...F-
Q13I71_BURXL/19-140-------------------ELIE-----R......SGYGFHHF.AL--------A..T...---------K...D...I-
Q5UWE3_HALMA/10-117-------------------SYLD-----N......HGPGLHHV.TL--------E..V...---------A...A...V-
C0ZEG8_BREBN/1496-1609-------------------SPCV-----RLL..EEKGTGPYHL.CY--------S..I...---------S...N...I-
D4M9A6_9BACT/4-116-------------------SPVS-----GWL..KKNGNSPYHI.CY--------E..S...---------L...D...I-
Q12HJ2_POLSJ/9-131-------------------DFLQ-----A......GRTGLQHV.AY--------W..T...---------S...D...Y-
D2RQ64_HALTV/17-139-------------------EHLE-----E......HGEGLHHVACF--------A..F...---------D...D...P-
A5VBF6_SPHWW/10-129-------------------ASPY-----RAA.DGSRLLGLHHL.AR--------I..V...---------D...D...L-
A1TCL4_MYCVP/8-130-------------------EFLD-----S......GRPGFHQL.AY--------W..T...---------D...D...F-
C7PR30_CHIPD/14-138-------------------SMFH-----DYL.ERQPEGGIQHV.AY--------RLPV...---------S...D...F-
A4XEN6_NOVAD/16-137-------------------DTIA-----K......GQTGFHHF.CI--------Y..T...---------G...D...Y-
A5G6D6_GEOUR/8-118-------------------TPWI-----N......AGVKMYHF.AY--------W..V...---------D...D...L-
Q2YCD2_NITMU/13-126-------------------GPLD-----AIL..TQASESIYHL.CY--------E..T...---------E...N...L-
B1MB48_MYCA9/17-139-------------------EFLE-----R......NSAGLHHV.CV--------E..P...---------P...D...L-
A0R1J5_MYCS2/10-129-------------------EFLA-----A......TGGGFHQL.AY--------W..A...---------R...D...F-
C7RS60_ACCPU/18-128-------------------KTLT-----PW...LASGIKMYHL.AY--------L..V...---------T...D...L-
D5URS6_TSUPD/111-214-------------------PS..-----.......GPDALWGI.AW--------R..T...---------T...D...A-
D0LDW1_GORB4/120-238-------------------...D-----A......APVELWGI.AW--------H..S...---------P...D...L-
A5V4C1_SPHWW/15-137-------------------SVYT-----EVQ..AKRGWGFHHF.GV--------S..C...---------R...D...F-
E0UKN1_CYAP2/120-235-------------------IFSA-----K......HEGKILYL.GV--------W..E...---------K...D...M-
Q2G768_NOVAD/15-136-------------------ETVE-----K......RGYGFHHF.GI--------A..C...---------E...D...V-
Q744Q1_MYCPA/12-125-------------------AWAA-----A......PGNAVHHL.GY--------W..C...---------D...D...L-
D2AXE6_STRRD/3-112-------------------PSHD-----R......CRPGLNHL.AF--------R..VIGS---------E...R...V-
B8FMX2_DESAA/10-131-------------------PSLY-----RDF.LDAGCEGIQHV.SH--------W..V...---------E...D...F-
C5C099_BEUC1/20-129-------------------GVHD-----R......QLPGLNHL.AF--------W..GGTR---------A...E...V-
Q15VI5_PSEA6/7-112-------------------GDIN-----H.....RNIGKVNHI.GI--------L..V...---------N...E...L-
A2QUW1_ASPNC/11-144-------------------SALK-----DRLDEDGNKAEVQSI.AF--------T..M...---------DT.LS...M-
Q28K59_JANSC/19-130-------------------TTIA-----F......RMTGTAFL.AF--------R......---------....D...A-
A1SVB5_PSYIN/4-112-------------------IY.V-----K......KNIQLYHT.CW--------E..V...---------D...D...I-
C7NIJ3_KYTSD/10-119-------------------REHD-----R......QRPGLNHL.AF--------H..A...---------G...DRAKV-
A4SXB6_POLSQ/12-122-------------------KKPA-----V......HQTPLNHI.GL--------W..V...---------D...D...L-
A4XGA4_CALS8/13-134-------------------STWR-----DFL..ETHGEGIHHI.GV--------F..V...---------K...N...M-
B0RG81_CLAMS/8-115-------------------APHD-----R......RAAGLSHL.AF--------H..AGSA---------A...D...V-
B2HSW2_MYCMM/9-134-------------------DFLR-----D......CGPGLHHI.CL--------E..V...---------EGPEQ...L-
B8E0B0_DICTD/13-133-------------------STWR-----EFL..DKHGEGVHHL.AF--------L..V...---------K...G...T-
F3Z5I0_9ACTN/9-118-------------------PRHD-----R......LAPGLNHL.AF--------H..AGPR---------A...A...V-
R5SQY8_9FIRM/9-124-------------------GPIA-----RYIAKNGGKNGFQHV.AL--------R..V...---------D...N...I-

PF13468

C5BVV5_BEUC1/6-191-------------------.T.A.....T......G.DHWMTW-NL........R--A...---------R---S---R.
Q3IZS4_RHOS4/4-171-------------------.RFE.....G......R.PRPSNW-IL........R--C...---------A---D---L.
Q28LV8_JANSC/4-176-------------------.TFS.....G......P.TRVTNW-IC........R--C...---------P---D---I.
D7BGN4_MEISD/10-187-------------------QRLE.....A......G.PALIHW-VA........R--T...---------D---D---I.
D3PMM6_MEIRD/4-173-------------------.RFT.....G......P.PRLLTW-VA........R--T...---------E---A---L.
Q1IXF9_DEIGD/4-178-------------------AQLA.....D......G.PRLIHW-VA........R--V...---------P---G---L.
A9HYM0_BORPD/5-178-------------------.RLAP...DA......P.PRLATW-VA........R--T...---------D---D---I.
Q47D15_DECAR/6-180-------------------IGSQ.....S......P.PSLSTW-VV........R--T...---------S---D---I.
A9B642_HERA2/8-182-------------------.SLQP...TS......A.PRLATW-VA........Q--T...---------I---L---I.
D2QC41_SPILD/11-185-------------------.NLQP...GS......P.PQLLTW-VV........R--T...---------T---D---I.
B8IP73_METNO/4-183-------------------TAWE.....N......G.CRLRAW-VA........R--T...---------A---S---I.
B1LV77_METRJ/4-183-------------------ADWD.....A......G.RRLRGF-VA........R--A...---------D---D---L.
C5CLJ8_VARPS/5-199-------------------GLVR.....R......G.PRLVHF-VA........R--V...---------P---D---A.
D3Q0J0_STANL/2-177-------------------.TVT.....E........ARVVTW-AV........R--T...---------A---D---V.
B5HRA1_9ACTN/8-184-------------------.ALA.....A........ARTVTW-AI........S--P...---------P---D---L.
A4FK05_SACEN/2-174-------------------.ELR.....E........PRLVTW-AV........Q--T...---------T---D---L.
C7MHL9_BRAFD/7-186-------------------.RLK.....K........PAVITY-AV........H--P...---------Q---G---I.
A6WBM6_KINRD/7-183-------------------.GLT............G.PRLVTY-AI........H--P...---------A---D---L.
B7FUP4_PHATC/255-429-------------------.KID.....D........LTPFHF-AI........R--T...---------S---R---A.
B7FSM2_PHATC/69-245-------------------.AGK..............LVPLHY-AV........R--H...---------D---E---T.
C0ZG21_BREBN/5-195-------------------EDEA.....K......G.EGFDQI-AL........R--T...---------N---E---M.
Q8ELK5_OCEIH/5-195-------------------LD.A.....K......E.DGAVRV-AL........R--S...---------T---D---L.
B1HV56_LYSSC/5-194-------------------.RNH.....E......R.QGFSRI-AL........R--T...---------P---N---I.
Q5WBL3_BACSK/5-198-------------------VRDE.....F......T.EGFAKI-CL........R--T...---------R---D---L.
B9DM11_STACT/6-192-------------------.IVQ.....DN....FK.QGFKAF-AL........R--T...---------D---N---I.
B9E9H1_MACCJ/8-191-------------------ERTE.....Y......T.EGFKRL-CF........R--T...---------E---D---I.
D1CHQ7_THET1/9-194-------------------.YLE.....Q.....WD.GGLIGW-AA........A--T...---------N---D---I.
D1C9M3_SPHTD/5-190-------------------.LLQ.....D......RPGALAGY-AL........A--T...---------A---D---I.
A5UPV1_ROSS1/5-179-------------------.YVA.....E......G.EGLIDV-AL........L--P...---------D---A---I.
B0D2X2_LACBS/11-211-------------------PWAN.....K......P.LGWIDY-AFWGNGSHTIR--I...---------S---D---V.
B9L3L2_THERP/5-180-------------------.AA.............G.GGIIDL-CV........L--V...---------E---G---I.
Q0UPP1_PHANO/6-192-------------------.ASF..............VGWKDW-CL........T--N...---------S---K---T.
A7I5C5_METB6/53-255-------------------RHLA.....D......G.PGPEDF-AL........S--S...---------P---G---LN
Q11EY7_CHESB/5-184-------------------..LA.....A......G.DGWGDY-SL........H--S...---------D---A---L.
C7N101_SLAHD/3-183-------------------QRLD.....T.....CG.LGYCEL-AF........E--NY.E---------T---D---L.
Q215A9_RHOPB/5-194-------------------.AFQRDFLAD......R.QGLSML-LL........Q--S...---------H---D---A.
A7IN29_XANP2/5-195-------------------.AFN.....QRFLESCG.QGLSML-AL........E--G...---------S---D---P.
Q92KD8_RHIME/11-203-------------------FRFR....QG......A.EGLSAV-VL........G--T...---------P---D---A.
B9JW73_AGRVS/9-199-------------------FRQA.....Y......S.QGLSAI-VT........A--S...---------Q---D---A.
Q2W045_MAGSA/8-179-------------------.D.......K......G.EGLMGL-VW........G--T...---------E---D---A.
Q7VS77_BORPE/8-188-------------------.FLA.....K......G.EGLYSV-AF........N--A...---------A---S---A.
Q2KVI0_BORA1/6-182-------------------..AD.....S......A.PGLEAL-VF........R--T...---------D---D---A.
Q13QK5_BURXL/9-186-------------------.ILE.....S......R.LGIDGL-VF........K--T...---------D---D---A.
B1M8D4_METRJ/14-190-------------------.VLD.....S......P.FGLNGL-VV........A--S...---------R---D---A.
E6WJ36_PANSA/10-188-------------------.LWQ.....S......P.PGLSGL-VW........K--S...---------E---D---A.
Q213B5_RHOPB/15-192-------------------.........H......P.AGLTGL-VF........K--S...---------I---D---A.
B9JHP8_AGRRK/10-187-------------------.........Y......P.TGLNGL-AF........R--T...---------T---D---A.
Q0K796_CUPNH/8-187-------------------.A.......H......G.GGCAAM-SC........K--S...---------A---D---A.
Q89RQ5_BRADU/9-192-------------------.T.......R......G.EGIERI-AF........T--A...---------V---D---S.
A6X474_OCHA4/8-190-------------------.KLA....AQ......G.EGLHAI-AC........R--I...---------D---N---A.
Q7VV42_BORPE/8-199-------------------.RY...............EGLHIV-AM........D--C...---------E---S---A.
Q7VZU9_BORPE/17-205-------------------.R..............Y.AGMHIV-AF........D--T...---------P---D---P.
D3PXN5_STANL/9-232-------------------RRLT.....R......A.EGAHIL-IF........A--T...---------A---D---A.
C5C9I8_MICLC/6-186-------------------.RTE.....Q......G.GGWMSW-AV........S--T...---------T---D---I.
A6WG27_KINRD/3-181-------------------.RTE.....Q......G.GGWFAW-AV........L--V...---------E---D---L.
C7Q7Z4_CATAD/3-184-------------------.RAE.....D......G.GGWLGW-VV........G--V...---------D---D---I.
D3Q658_STANL/7-189-------------------.RLM....GD......G.GGALNF-AV........N--V...---------T---D---V.
A4X9C2_SALTO/3-192-------------------.RTA.....D......G.PTFLNW-AV........L--T...---------D---D---I.
A0JUJ0_ARTS2/1-173-------------------.S.A.....A......G.GGWMGW-CV........E--V...---------D---D---L.
A5VHI4_LACRD/7-201-------------------DYFA.....G......I.QRITTI-AI........Q--T...---------D---N---I.
A6T918_KLEP7/6-197-------------------RLLP.....E......N.EALFRV-AL........R--S...---------D---D---I.
D0IV05_COMT2/5-180-------------------...Q.....H......G.EGLVDF-AL........L--P...---------S---E---T.
F2KGG4_PSEBN/11-197-------------------QFLD....RG......E.EGVSLV-AL........H--S...---------K---D---A.
G8PVJ3_PSEUV/4-182-------------------AEWN.....A......G.RRLRGW-VA........G--V...---------E---S---I.
Q2FVZ2_STAA8/5-191-------------------.IVQE...KY......E.QGFKNI-CL........R--T...---------N---D---I.
Q5HLY5_STAEQ/5-190-------------------.IVQ.....DH....FK.QGVKGI-CF........R--T...---------K---D---I.
Q5L3B6_GEOKA/5-192-------------------ADRQ.....E......G.NGFSQF-AF........R--T...---------N---N---I.
Q63W09_BURPS/8-197-------------------ARLE.....Q......G.PYLAHW-VA........R--VDRP---------R---E---L.
Q6AAZ6_PROAC/4-172-------------------.Q.E.....Q......G.GGWMGW-AV........S--V...---------D---D---L.
Q6N6G7_RHOPA/5-180-------------------.R.......S......G.PGLVDY-AL........L--P...---------R---N---I.
Q81NU9_BACAN/4-191-------------------VKLQ.....G......G.EGMLQI-AI........R--T...---------D---A---I.
U5LCG2_9BACI/5-192-------------------KGVK.....R......G.ERIGQL-CF........R--T...---------E---H---I.
V6F093_9PROT/9-176-------------------.RFT.....G......I.PRLVNW-VA........R--T...---------Q---S---I.
V6F8Z3_9PROT/8-187-------------------.D.......L......R.EGLHGI-SL........G--T...---------D---N---G.

PF14506

Q5M2X6_STRT2/13-137-----------------------------------GPKKINKV-VI--------K--V------------S---N-----
Q8DP81_STRR6/14-136-----------------------------------GRKKLARL-IV--------K--V------------E---N-----
Q8DVS0_STRMU/9-132-----------------------------------GTKKLNKI-II--------K--A------------S---K-----
Q8DXW5_STRA5/9-132-----------------------------------GTKKLAKI-IV--------K--S------------Q---D-----
Q99Y63_STRP1/9-131-----------------------------------GPKKVNTI-VI--------K--T------------N---Q-----

PF06983

Q7CRK9_AGRFC/2-118-------------------------------------FSFQIS-TE--------D--Q------------E---E---T-
Q92TY1_RHIME/2-118-------------------------------------YSIQVA-CD--------S--Q------------E---E---L-
Q837B9_ENTFA/2-127-------------------------------------SSFFVE-CT--------T--L------------P---Q---T-
Q73WJ2_MYCPA/2-116-------------------------------------VSFTVH-CK--------D--Q------------D---E---V-
Q82NZ5_STRAW/4-119-------------------------------------VSFQIF-CD--------D--Q------------D---E---V-
Q82XJ9_NITEU/2-119-------------------------------------VSFMVL-TN--------D--Q------------E---E---T-
Q6MLW9_BDEBA/2-119-------------------------------------VSFMVI-TE--------S--Q------------E---E---T-
Q9X7R8_STRCO/4-119-------------------------------------ISFQVT-CE--------D--Q------------D---E---V-
Q97DK8_CLOAB/2-123-------------------------------------ISLSVA-CS--------S--R------------P---E---V-
Q97DK8_CLOAB/132-253-------------------------------------FSLIIN-CK--------N--Q------------S---E---I-
Q89SJ1_BRADU/2-118-------------------------------------ISLMIH-CD--------D--Q------------A---Q---V-
Q6N1I9_RHOPA/2-118-------------------------------------VSFKID-CV--------D--Q------------A---E---V-
Q9CEE8_LACLA/17-136-------------------------------------VSFTVT-CK--------N--Q------------A---E---I-
Q88GT8_PSEPK/3-119-------------------------------------FSFQVS-TA--------D--Q------------A---E---T-
Q74AD9_GEOSL/5-121-------------------------------------FSFQVA-TV--------D--Q------------D---E---T-
Q98C01_RHILO/2-116-------------------------------------ISLSID-CK--------T--Q------------E---E---V-
Q2G1U2_STAA8/5-129-------------------------------------ISLFVT-VK--------D--T------------I---E---M-
Q81QE2_BACAN/6-132-------------------------------------MSLYVT-CD--------T--E------------E---E---I-
Q8F7U5_LEPIN/2-119-------------------------------------ISFFLS-CQ--------T--S------------K---E---V-
Q8NP25_CORGL/152-272-------------------------------------VSLMYE-AH--------G--Q------------E---E---L-

PF14696

Q124D7_POLSJ/13-161-----------------------------------HGPSVCAI-AF--------R--V------------R---D--.A-
A5WE99_PSYWF/5-143-----------------------------------HGPGACSM-GF--------R--V------------A---D--.S-
B6IWM9_RHOCS/19-161-----------------------------------HGPGACAM-AF--------R--V------------R---D--.A-
Q2NAB6_ERYLH/5-147-----------------------------------HGPSACGM-AF--------R--V------------K---D--.A-
D0J5T0_COMT2/5-143-----------------------------------HGPSACGL-AF--------R--V------------K---D--.A-
Q2SND1_HAHCH/5-146-----------------------------------HGPCACAM-AF--------R--V------------K---D--.A-
Q0ASV8_MARMM/5-143-----------------------------------HGPSACGM-GF--------R--V------------K---D--.A-
A6VYX1_MARMS/5-143-----------------------------------HGNAAAGM-GF--------R--V------------K---N--.A-
Q0BY65_HYPNA/5-146-----------------------------------HGASACGM-GF--------R--V------------R---D--.A-
B2FKN2_STRMK/6-147-----------------------------------HGPCACGF-AI--------R--F------------K---K--PG-
D5VC74_MORCR/28-166-----------------------------------HGPSACGM-AF--------R--V------------R---D--.A-
Q63PY5_BURPS/6-154-----------------------------------HGPSICAI-AF--------R--V------------Q---D--.A-
Q87Z77_PSESM/10-148-----------------------------------HGPSVCGM-AF--------R--V------------K---D--.A-
Q8PDA4_XANCP/6-147-----------------------------------HGPCACGF-AI--------R--F------------R---T--PA-

PF06185

Q9CN85_PASMU/28-211-----------------------------------NGRIIYLI-KL--------DSPLLFL.........GQSIDVIELP
E6WA61_PANSA/8-184-----------------------------------NGRPICLF-KL--------HQPLQLA.........GWQIDVIELP
Q7VP39_HAEDU/11-195-----------------------------------NGRPICLF-SL--------KQAVNFL.........GQTVNVIELP
A1S7G3_SHEAM/3-184-----------------------------------NGRPILII-KL--------HTALNLG.........PFTVPCIELP
H2ITZ6_RAHAC/6-182-----------------------------------NGRPICLF-SL--------NEPLQVG.........PLSIDLVELP
F4PTK1_DICFS/6-204-----------------------------------NGRPICTF-KL--------QQPIVWNYTNAAGQQQTRQIPLVELP
B2VJB7_ERWT9/11-187-----------------------------------AGRPIALF-EL--------ATPLDVG.........PWKISVVELP
Q54MZ6_DICDI/4-182-----------------------------------GGRMISTF-KL--------NKPIQYK.........DKSIPLIELP
C9R3D1_AGGAD/12-194-----------------------------------NGRVIYLI-QL--------NEPICFV.........GQWVDVVELP
E0SAV0_DICD3/24-197-----------------------------------NGRPICLF-TL--------HQPLTVG.........PWRIDCVELP
Y1581_HAEIN/7-187-----------------------------------NGRKIYLI-EL--------EKPVKFA.........NQFVDIIELP
I0DZQ5_PROSM/9-183-----------------------------------NGRPICLF-EL--------NKPLIIA.........SQQVYVVELP
B7VI23_VIBTL/11-196-----------------------------------NGRPIVVL-AF--------DKPLQSL.........GWKIECLELP
Q7N560_PHOLL/9-183-----------------------------------NGRPICLF-DL--------EYPIAVL.........NWQIDCVELP
Q5E6L1_VIBF1/12-196-----------------------------------NGRPIIAL-GF--------NQALTIN.........DWSIECLELP
YECM_ECOLI/9-185-----------------------------------NGRPICLF-KL--------HEPVQVA.........HWQFSIVELP
A6VND1_ACTSZ/15-196-----------------------------------NGRIIYLI-RL--------EEPLPFL.........NQFIDVIELP
B0UUF0_HISS2/18-194-----------------------------------NGRVIYLI-QL--------DNPIRFS.........DQFIDIIELP
D3VET8_XENNA/9-183-----------------------------------NGRPICLF-EL--------EQPINLL.........GWKIDCVELP
A3QD08_SHELP/12-194-----------------------------------NGRPILII-AL--------DTPMVLG.........ELTIECIELP
F4HCP7_GALAU/9-190-----------------------------------NGRPIYLY-QL--------PKPLFIL.........NQAVNIVELP
Q12LL9_SHEDO/6-186-----------------------------------NGRPIVII-AL--------DKPLILG.........EHAIDCVELP
D3V176_XENBS/22-196-----------------------------------NGRPICLF-DL--------NQPIVLL.........DWKIDCVELP
M9WWR4_MANHA/3-184-----------------------------------NGRPIGLF-AL--------IQAVEFC.........GQFVKIVELP
F4QBC6_DICFS/15-213-----------------------------------NGRRISSF-KL--------TQPILYEYQSNNGTSETKVIPLLELP
Q87RD4_VIBPA/11-196-----------------------------------NGRPIIVI-EF--------DTALESR.........GWKIECLELP
I2BA68_SHIBC/9-185-----------------------------------NGRPICLF-KL--------HQPVTVG.........HWQIDVIELP
D8MT98_ERWBE/11-187-----------------------------------NGRPVALF-EL--------ESPLSVG.........PWKISVIELP
B8F673_HAEPS/18-196-----------------------------------NGRPIGLF-TL--------NQPVHFC.........GQAVSVIELP
W0HX46_9ENTR/9-183-----------------------------------NGRNIVLF-EL--------TTPLVLK.........GQAIHCIELP
Q65SX5_MANSM/18-195-----------------------------------NGRAIYLI-EL--------EQPLLFM.........GQRVFIIELP
Q6LTA0_PHOPR/10-194-----------------------------------NGRPIIVI-GF--------HQPLNVG.........SWSIECLELP
Q8EF20_SHEON/12-196-----------------------------------NGRSILII-EL--------DNPLRLG.........SFTIDCVELP
E1SQM9_FERBD/4-183-----------------------------------NGRPILLI-QL--------HTPMQVG.........PWAIDLVELP
J7TZ01_MORMO/9-183-----------------------------------NGRPIYLF-LL--------YEPLTLL.........HWQIPVVELP
D4GGT7_PANAM/8-184-----------------------------------NGRPVCLF-KL--------HQPLQIA.........GWHIDVVELP
F7YNG9_VIBA7/11-196-----------------------------------NGRPIIVI-EF--------AVPLSAN.........GWSIECLELP
F0LNL8_VIBFN/11-196-----------------------------------NGRPIIVM-AF--------HQPLIAE.........PWRIECLELP
W0L3M1_9ENTR/9-185-----------------------------------NGRPIYLF-DL--------AVPIKVG.........PWQIDCVELP
C5B833_EDWI9/9-185-----------------------------------NGRPICLF-DL--------AQPLRVG.........PWLIDCVELP
Q7CIB5_YERPE/9-180-----------------------------------NGRPICLF-DM--------TQPLNVG.........PWLIDCIELP
D4ZJ81_SHEVD/8-188-----------------------------------NGRPILIF-EL--------NQPLIMG.........QIKIDCLELP
B4ETN6_PROMH/11-183-----------------------------------NGRPIYLF-KL--------ASPLTLL.........GQQISIVELP
A3MYB0_ACTP2/11-194-----------------------------------NGRPIALI-KL--------NQPLSFL.........GQSVSIIELP
Q083X6_SHEFN/2-197-----------------------------------NGRPILII-KL--------AAPLVIG.........KMKIQCVELP
Q9KQC7_VIBCH/11-196-----------------------------------NGRPIIVI-RF--------NQPLQVS.........HWQIECLELP
Q6D475_PECAS/16-190-----------------------------------NGRPICLF-IL--------DNSISVG.........PWQIDCIELP
Q7MMM2_VIBVY/16-201-----------------------------------NGRPIIVI-EF--------DAPLASR.........GWKIECLELP
M4RAR0_BIBTR/11-192-----------------------------------NGRLIGLF-IL--------NQPLIFC.........NQSVSIIELP

PF12681

Q187Q5_PEPD6/3-120-KQWESKIN----------R-IG---------------------------------------NIE--FLHYIK-------
Q8TUF9_METAC/12-132-DSFLQKLK----------D-ID---------------------------------------SIE--YVHGLK-------
Q97LL1_CLOAB/3-123-EAFLNKLK----------Q-NK---------------------------------------GIN--YIHSLL-------
A5HYY7_CLOBH/3-121-DAFMQKIQ----------E-YE---------------------------------------NIK--YVHQPK-------
A9CII6_AGRFC/3-123-DAAFQDI.----------.-AP---------------------------------------HVE--LIHPLE-------
Q81BZ3_BACCR/5-127-QETIEQFR----------E-QG---------------------------------------.IK--ILVEPI-------

PF00903

CADE_BACSU/9-123-GIALARLI----------E-HG.............----------------------.....IA--IGHG.D-------
YQCK_BACSU/2-115-LKHKKRLE----------K-EG.............----------------------.....FF--AREEMD-------
YQJC_BACSU/3-128-SEQLQALS----------D-QH.............----------------------.....VQ--LIDRFP-------
LGUL_HUMAN/31-174-YSACKRFE----------E-LG.............----------------------.....VK--FVKKPD-------
D5T7F4_LEGP2/151-300-YKTVNGLR----------K-QG.............----------------------.....VK--FLDVP.-------
CADI_MYCTU/2-114-HAEIARLT----------E-AG.............----------------------.....LV--TEKEIG-------
CF30_MYCTU/11-126-DAVVDKVV----------P-GG.............----------------------.....GQ--VMMPAF-------
I7B4U0_PSEPT/143-261-GLAYDKFD----------A-ER.............----------------------......A--VVMSLG-------
BPHC2_RHOGO/6-121-LDRYESLK----------S-KG.............----------------------.....IE--PKVPIQ-------
LGUL_PSEPU/24-167-VAACERFE----------A-LQ.............----------------------.....VP--FQKRLS-------
HPPD_RAT/180-335-ITTIRHLR----------E-RG.............----------------------.....ME--FLAVPS-------
BPHC3_RHOGO/6-122-IDKYLQLR----------D-KG.............----------------------.....IE--PRVPVQ-------
LGUL_BRAJU/27-171-HKACERFE----------Q-LG.............----------------------.....VE--FVKKPH-------
O24828_9GAMM/150-266-LKAADLLS----------M-TD.............----------------------.....TS--IDIGPT-------
LGUL_SYNY3/2-123-YSTCDKIR----------D-KG.............----------------------.....GK--VVREPG-------
O26852_METTH/2-112-EATLNDLR----------S-RG.............----------------------.....AR--VLMEPT-------
P95571_9PSED/143-280-GHAYDRID----------G-LGDKSTDSNLRVPAN----------------------SDIRSSR--ITATIG-------
LGUL_NEIMB/2-123-YEACERVK----------R-QG.............----------------------.....GN--VVREAG-------
Q98LB0_RHILO/89-205-KALFLEYQ----------A-AT.............----------------------.....AP--FHQTLR-------
Q98HZ4_RHILO/7-135-DFWWQRAV----------D-AG.............----------------------.....CE--VVTPLQ-------
FOSB_BACSU/5-117-EEMSAKLK----------R-LH.............----------------------.....VN--ILPGRE-------
Q9KZ01_STRCO/31-158-TAYWERLA----------E-DA.............----------------------......T--VLRPLG-------
MHQE_BACSU/5-263-AKWLPIIA----------E-NH.............----------------------.....LP--SSEILD-------
P72786_SYNY3/14-143-DQAIAVLE----------A-HG.............----------------------.....VT--IASGPV-------
O53680_MYCTU/15-163-DAYRQRLK----------D-KG.............----------------------.....VR--VGPVLN-------
YRAH_BACSU/2-124-DKTYDDLH----------E-KG.............----------------------.....VK--CENKPH-------
FOSB_STAEP/4-116-EDWYIWLK----------E-NE.............----------------------.....VN--ILEGRD-------
O68311_GEOTH/148-265-RKAGDVFS----------K-HD.............----------------------.....VP--IDVGIE-------
YYAH_BACSU/2-124-DELTDRLK----------A-DG.............----------------------.....FA--VVNGPR-------
YETH_BACSU/4-118-FGTYEKMK----------T-NG.............----------------------.....VE--FLGEPN-------
Q9ZNP0_COMTE/147-272-LKAADVMA----------K-NK.............----------------------.....VR--IDVAPT-------
Q9ZAY0_9SPHN/150-267-GHAADVIT----------R-YD.............----------------------.....IS--IDIGPT-------
O06412_MYCTU/4-113-EATQTELV----------S-RG.............----------------------.....VS--IAREPR-------
LGUL_HAEIN/2-123-YATCEAVR----------A-SG.............----------------------.....GN--VTREAG-------
D5AV60_RHOCB/8-122-DAFYRAAL----------A-HG.............----------------------.....GR--DNGAPG-------
YYCE_BACSU/11-130-AAITSKLK----------H-MG.............----------------------.....YQ--EVESEN-------
C3JUU8_RHOER/142-267-GLCLDRAL----------R-KK.............----------------------.....VK--MSATLG-------
MHQO_BACSU/7-266-LDWQRYIA----------S-HG.............----------------------.....YG--VTPVRD-------
HPPD_PSEUJ/158-310-IKTWDHLK----------S-IG.............----------------------.....MR--FMTAPP-------
Q45135_9MICO/152-268-IQICDKMG----------A-LRI............----------------------....SDR--IERGPG-------
N9VUR8_PSEPU/150-266-LRAADLIS----------M-TD.............----------------------.....TS--IDIGPT-------
LGUL_BRAOG/17-138-SKMVEAVR----------A-KG.............----------------------.....GN--VTREPG-------
Q9I3Z1_PSEAE/3-131-ERLFNALA----------E-GG.............----------------------......S--VQMPLG-------
Q9KYP6_STRCO/2-118-DAVHRNLT----------G-FV.............----------------------.....DE--FVREPT-------
MHQA_BACSU/5-275-AGWHRIIS----------R-EG.............----------------------.....FS--NSGIVE-------
Q59693_PSEPU/147-272-LKAADVMA----------K-NK.............----------------------.....VK--IDLAPT-------
LGUL_SCHPO/11-150-ESACAYLE----------S-KG.............----------------------.....VS--FKKKLS-------
LGUL_SALTY/2-123-AEACERIR----------Q-NG.............----------------------.....GN--VTREAG-------
Y3691_SHEFN/4-116-WRDYNRMQ----------L-DG.............----------------------.....IK--FVRP..-------
Q9KZG9_STRCO/4-130-RGYWEKLS----------A-GG.............----------------------......S--VAVPLE-------
YURT_BACSU/2-124-QKEYNRLK----------E-KG.............----------------------.....VT--FTTEPT-------
YWKD_BACSU/5-125-DKAVQELH----------E-KG.............----------------------.....IE--TEPIRT-------
Q52533_PSESP/147-267-GLAYDRCR----------A-AG.............----------------------.....LN--FARELG-------
MCE_PYRHO/7-131-ESKLEELK----------Q-KG.............----------------------.....YK--LIDEKP-------
P97099_CUPNE/143-262-GYAFDRLD----------A-AG.............----------------------......R--ITSLLG-------
DNRV_STRPE/8-133-DALTKRVE----------T-AG.............----------------------.....GE--VIMTPM-------
P73508_SYNY3/5-122-FAFSEQVE----------A-AG.............----------------------.....VP--YHLPPK-------
HMAS_AMYOR/158-306-VRAVKALS----------E-RG.............----------------------.....VE--FLKTPG-------
O86701_STRCO/4-132-DATFEHVR----------A-AG.............----------------------.....AE--VLQEPV-------
Q7AQ90_MYCLE/20-150-DRLTKRLR----------A-QG.............----------------------.....VR--LVYDTP-------
LGUL_YEAST/22-164-NKTCEELE----------S-QG.............----------------------.....VK--FKKRLS-------
C1KH52_SERMA/4-114-EPLSQRLE----------Q-AG.............----------------------.....VT--IWKQNK-------
C3LUW7_VIBCM/6-113-EATLEKVV----------K-NG.............----------------------.....GH--IIRPIF-------
Q9Z549_STRCO/4-125-DAFYAELT----------G-AG.............----------------------.....CK--GEREPW-------
Q48341_STRLI/5-125-DEAFSQAV----------A-AG.............----------------------.....GY--VVTSLA-------
O32376_COMTE/143-262-GFAYDRLD----------T-DG.............----------------------......L--ITSTLG-------
O69350_RHOER/145-267-GQALDRVM----------K-DG.............----------------------.....FS--VSSTLG-------
GLOD4_CAEEL/132-248-ESLQDKIK----------S-AN.............----------------------.....GT--IINELT-------
YAER_ECOLI/6-126-DAAVAHLE----------S-HN.............----------------------.....VK--CETIRV-------
O86906_SPHSX/146-261-GFALDRLY----------A-ST.............----------------------.....WQ--LKETLG-------
O28796_ARCFU/50-170-YRDYERLK----------Q-KG.............----------------------.....VK--FRGEPQ-------
O05205_STRLA/4-125-DKKYAELV----------D-AG.............----------------------.....YE--GHLKPW-------
I7MMZ2_TETTS/194-350-INTVEGLR----------A-RG.............----------------------.....VE--FLSIPT-------
Q9I5D5_PSEAE/8-139-DALFRSAQ----------A-AG.............----------------------.....AE--IVIDIK-------
O87625_PSEAI/152-264-EIGAQTLL----------R-AG.............----------------------.....YK--DGFGLG-------
Q50912_SPHXE/13-131-RRNYAFFA----------E-RG.............----------------------.....VK--IAEILD-------
A5W4G6_PSEP1/11-255-GKALYRIK----------Q-HD.............----------------------.....IK--VVFGPG-------
Q59770_RHORH/162-279-LRAVDTFV----------E-EG.............----------------------.....TP--IDVGPG-------
YWBC_BACSU/4-123-AAEYTKAE----------K-MN.............----------------------.....AK--FIDEEI-------
Q9KEK2_BACHD/4-140-TEVFQKLA----------S-GG.............----------------------......E--EIAPLE-------
O28065_ARCFU/4-128-EEALNKAK----------E-AG.............----------------------.....LR--LIDEKP-------
A2YS08_ORYSI/24-146-YKLAEKIK----------S-SC.............----------------------....CCK--ITREPG-------

PF13669

A9C2R0_DELAS/14-124-PLAVQWLT----------A-QG----------------------------------------VR..FA..PG-------
A2SEJ1_METPP/12-122-PKAVQWMS----------E-NG----------------------------------------VR..FA..PG-------
D0LXQ3_HALO1/13-123-AAAVAWLS----------E-RG----------------------------------------VR..FT..PG-------
Q5P377_AROAE/12-122-PVAVEWLT----------A-QG----------------------------------------VR..FA..PG-------
Q1D6F8_MYXXD/37-147-PVAVQWLE----------S-QG----------------------------------------LR..FA..PG-------
B8BYE7_THAPS/75-187-PAAVEWMA----------N-QG----------------------------------------VR..FT..PG-------
B5Y3L3_PHATC/38-148-PKAVEWMT----------S-EG----------------------------------------VR..FT..PG-------
A4HEL0_LEIBR/19-133-SAAMLTCK----------E-AN----------------------------------------IR..CL..GA-------
D4J6L0_9FIRM/18-126-NAVSEEIK----------A-MG----------------------------------------YE..LL..EK-------
D2RXZ8_HALTV/10-118-ERAVDVLD----------A-HD----------------------------------------VP..VA..DY-------
Q39TG0_GEOMG/11-132-EETMASMQ----------K-KD----------------------------------------IK..VL..LE-------
D3F6C9_CONWI/9-133-DGGIARMA----------A-QG----------------------------------------FD..LM..QS-------
A6LI20_PARD8/8-119-EGAVADLR----------K-MK----------------------------------------YI..VV..SK-------
Q97H22_CLOAB/4-114-QKSIEEMS----------Q-IG----------------------------------------YT..LF..KK-------
B9JM51_AGRRK/6-125-DAAAAMMD----------E-RG----------------------------------------YR..AV..QK-------
C5CVE4_VARPS/9-131-DADLARLT----------A-QG----------------------------------------FK..PV..MS-------
Q13K82_BURXL/9-131-DADLARLQ----------E-QG----------------------------------------FK..VA..MS-------
Q13I71_BURXL/19-140-DAEIARLQ----------E-GG----------------------------------------AA..IA..FK-------
Q5UWE3_HALMA/10-117-DAVKAVLE----------R-NG----------------------------------------YS..VI..E.-------
C0ZEG8_BREBN/1496-1609-NHFLKRLV----------D-FG----------------------------------------FKYDLV..SA-------
D4M9A6_9BACT/4-116-ERDIAAMQ----------E-QG----------------------------------------FM..LL..ER-------
Q12HJ2_POLSJ/9-131-DADLARLL----------G-QG----------------------------------------FK..PV..MS-------
D2RQ64_HALTV/17-139-HAVVDEFE----------S-AG----------------------------------------LP..VL..QS-------
A5VBF6_SPHWW/10-129-DAAVAAAQ----------A-GG----------------------------------------MA..LV..FV-------
A1TCL4_MYCVP/8-130-EGTMGSVA----------E-AG----------------------------------------WP..VV.WNG-------
C7PR30_CHIPD/14-138-GQITSNLR----------E-QG----------------------------------------YA..VI..SE-------
A4XEN6_NOVAD/16-137-DACRQRYV----------D-QG----------------------------------------FA..VA..I.-------
A5G6D6_GEOUR/8-118-DSAINWAR----------A-KR----------------------------------------AK..MI..VE-------
Q2YCD2_NITMU/13-126-KASLEALK----------A-GG----------------------------------------FR..VI..CV-------
B1MB48_MYCA9/17-139-DVALDHAT----------S-QG----------------------------------------ME..VV..QD-------
A0R1J5_MYCS2/10-129-DAAVADLE----------D-AG----------------------------------------WP..EV..WS-------
C7RS60_ACCPU/18-128-EASLDWAR----------G-QR----------------------------------------AR..VT..VM-------
D5URS6_TSUPD/111-214-DATSARLT----------D-QG----------------------------------------VT..V...SE-------
D0LDW1_GORB4/120-238-ERTRTRLL----------D-AG----------------------------------------LS..VT..P.-------
A5V4C1_SPHWW/15-137-DADVAHYQ----------A-LG----------------------------------------HE..MA..LY-------
E0UKN1_CYAP2/120-235-KARIEALE----------K-EG----------------------------------------IA...I..DA-------
Q2G768_NOVAD/15-136-EAALRDYL----------S-RG----------------------------------------YE..LA..FK-------
Q744Q1_MYCPA/12-125-AQSAQLLE----------D-NG----------------------------------------FA..FE..AT-------
D2AXE6_STRRD/3-112-DALVAAAP----------E-HG----------------------------------------WT..LMFTDR-------
B8FMX2_DESAA/10-131-DAKSQLLL----------D-LG----------------------------------------YV...A..GH-------
C5C099_BEUC1/20-129-DALCREAP----------N-HG----------------------------------------WR..LLFTDR-------
Q15VI5_PSEA6/7-112-DAVEKCVI----------A-LG----------------------------------------FE..TF..NH-------
A2QUW1_ASPNC/11-144-DERIEEMR----------K-RG----------------------------------------FR..PS..TQ-------
Q28K59_JANSC/19-130-LPELGLSD----------A-KG----------------------------------------GP..VT..AA-------
A1SVB5_PSYIN/4-112-NKAIDVHL----------D-CG----------------------------------------AI..LV..SE-------
C7NIJ3_KYTSD/10-119-DEFADTAH----------A-NG----------------------------------------WT..LLFADK-------
A4SXB6_POLSQ/12-122-PKAVEWLS----------A-NG----------------------------------------LR..FA..PG-------
A4XGA4_CALS8/13-134-DEKIENLK----------K-EG----------------------------------------IE..VI..QK-------
B0RG81_CLAMS/8-115-DRLWAAAP----------D-HG----------------------------------------WA..RL..YA-------
B2HSW2_MYCMM/9-134-EIALAEAA----------D-HG----------------------------------------AS..VV..QR-------
B8E0B0_DICTD/13-133-DEIVRRFK----------N-YG----------------------------------------IE..VA..QK-------
F3Z5I0_9ACTN/9-118-DALTDKAL----------A-HG----------------------------------------WT..LLFPDR-------
R5SQY8_9FIRM/9-124-VEALAALP----------E-D.----------------------------------------AK...L..DK-------

PF13468

C5BVV5_BEUC1/6-191.ADLEEVAR..........R.LG..........GDV..VVARGA........NRPD.....GTHA--TTIMAP..GNAAT
Q3IZS4_RHOS4/4-171.DAALALLP..........E.AG..........RPL..ELRR............GD.....LRWR--MAVPED..GRLPF
Q28LV8_JANSC/4-176.EAAIAAAP..........DGIG..........VPW..RLER............AD.....LRWT--MAVPRD..GKLPF
D7BGN4_MEISD/10-187.HRVLQRVP..........R.LG..........RVH..RMHR............GD.....LSWD--ITIPDD..GNLLE
D3PMM6_MEIRD/4-173.ERYAAL............G.LG..........PVT..KASR............GD.....LEWH--ITLPED..GRLHW
Q1IXF9_DEIGD/4-178.SGL..DLA..........P.FG..........EAL..DLSR............GE.....HRWT--LTVPPD..GTLPF
A9HYM0_BORPD/5-178.AAAVQACA..........A.AG..........QIE..PMTR............GE.....LSWR--ITIPAD..GSLPA
Q47D15_DECAR/6-180.RATVAASS..........E.PL..........GNV.EPMSR............GA.....LNWF--ITIPAD..GSVPL
A9B642_HERA2/8-182.QAASELLH..........Q.QL..........GVV.TPMRR............GD.....LAWQ--ITIPAD..GSLPF
D2QC41_SPILD/11-185.QQAVRQSR.........WQ.HG..........TIE..SLQR............GM.....YHWQ--IAIAED..GQLPM
B8IP73_METNO/4-183.EAVLARHG..........DSLG..........RST..RVSR............GA.....RSWL--FSLRPD..GALPA
B1LV77_METRJ/4-183.DGVLAAHG..........ALLG..........AAA..TMTR............GD.....LSWR--FAVPPG..GAWPA
C5CLJ8_VARPS/5-199.HAALQALAREE...HAHID.RG..........QLL..EASRDT........PAGR.....LEWQ--ITVRND..GQRLF
D3Q0J0_STANL/2-177.DASVTAAG..........K.SGYD......PGTPW..TMARDT.......VDGRK.....LQWR--LTVDRS..E..GH
B5HRA1_9ACTN/8-184.DAAVATAR..........I.RGYDP....GEIRPM..SRRR............PDG..TLLEWR--LTNGDT..Q.HP.
A4FK05_SACEN/2-174.DADVRAAR..........D.GGWD......PGTPE..SMSR............RTPGGELLEWR--LTPFSH......A
C7MHL9_BRAFD/7-186.EQVRDRAL..........A.QGVDLG.EVQDLSRR..TPEG............TE.....LQWR--LTQAPQ..PR...
A6WBM6_KINRD/7-183.DAVVAGSR..........E.RGYDPG.PVETLSRR..TPDG............TL.....LRWR--LTHSRP......D
B7FUP4_PHATC/255-429.EALKEEVT..........K.WGYTP....DHITMFGAKPDG............TP.....RKWE--MLYLYG....HKI
B7FSM2_PHATC/69-245.MKTIKSETLPNL..GYGFD.QI..........TMV..AKDR............GM....PWQWD--MVILED..HS..D
C0ZG21_BREBN/5-195.DAWAERLR..........S.QGLQVT.GPVAGSRT..RDDG............TT.....LRWR--MLFLED..ADST.
Q8ELK5_OCEIH/5-195.QADAQRFA..........S.LGFEVN.GPTDFSRT..RPDG............SI.....IKWK--LLFIGR..E..GI
B1HV56_LYSSC/5-194.EEEGQRLR..........A.LGFDVY.GPDACSRT..RPDG............TI.....IEWK--LLHFGR..ADLAL
Q5WBL3_BACSK/5-198.NKLAQTFK..........Q.KGLNVN.GPVPLSRK..RPDG............KL.....LEWS--LLFVGE..EGS..
B9DM11_STACT/6-192.EKLKTELE..........E.KGID......TVGPI..QMGREN.......KRGEQ.....TSWQ--LLYLNQ..P..HA
B9E9H1_MACCJ/8-191.NALKQHFE..........Q.IGVKTI.GPSRMQRV..TPEG............EV.....IAWQ--LLYIDE..ERN..
D1CHQ7_THET1/9-194.DEVAERLR..........R.LGKS......FEGPF..AMSRQR.......PDGTR.....LSWR--LLIPE...G.TPW
D1C9M3_SPHTD/5-190.EEDAERLK..........Q.GGLAAV.GPFAMERL..RPDG............RL.....LSWR--LLVPE...G.VSW
A5UPV1_ROSS1/5-179.DDDVTAAR..........M.RGLDMT.GPFSGGRE..RPDG............VR.....IAWK--TARPAT..PDLPF
B0D2X2_LACBS/11-211.INDRAKKDGGEA.FYEAEE.DG..........GRK..RTDG............KV.....VSWL--ISAPQENKETLPF
B9L3L2_THERP/5-180.EAECQRLE..........R.AGFTYQ..LAAGSRT..RPDG............FT.....IAWK--NATPPD..E...L
Q0UPP1_PHANO/6-192.PEENYNSIKET...HDKPV.HG..........GRK..RADG............VD.....VKWA--VTFLKGENGGQKT
A7I5C5_METB6/53-255LSAAQADAG..........Q.QGIILA.GPIPMSRT..RPDG............ID.....VKWH--VDVPVS..GDTA.
Q11EY7_CHESB/5-184.DSDKARLD..........A.AG..........IPS.NRPADYT.......KSLAD....GRPWT--VALLQA..GRGTG
C7N101_SLAHD/3-183.KREVAILQ..........K.HGIKSC..GMPSRRI..DTHG............RD.....LRFR--IVSPAA....L..
Q215A9_RHOPB/5-194.AADARDFA..........A.AGFGDFDVFDFARDG.RRPDGS..........VAK.....LAFS--LAFAVD..PASPE
A7IN29_XANP2/5-195.QAEKAVFDIENFGGFDTFE.FG..........RTA.RRPDG............QEV...EVGFT--LAFARD..PLSPD
Q92KD8_RHIME/11-203.AEDHIRFR..........S.RGISGGEMLEFSRPL..RLPD............GRE..GLGSFR--LSFAAD..LRSPD
B9JW73_AGRVS/9-199.KADHAAFV..........A.AGMTGGDMLEFSRPM..RLPD............GSE..TVARFH--LAFSAR..EVEPF
Q2W045_MAGSA/8-179.AADSARLG..........V.E...........PPG..DLSRS.........IEGD....VARFK--AGILPP..ETTP.
Q7VS77_BORPE/8-188.QESYQAGL..........A.AG..........LEI..EPPRHLNRKLVLEDRTLD.....LHFE--TVMLGH...DLYP
Q2KVI0_BORA1/6-182.EASYERLR..........S.AGF.......AVNPV.QDLSRPAQ......VGGREI...MARFH--TVRFAE..PPIPG
Q13QK5_BURXL/9-186.QGTYARLI..........D.AGVRASDPQSFTRPV..DIDG............VEQ...IARFR--TTRLAA..EELSA
B1M8D4_METRJ/14-190.DATHARLA..........A.LGLAAGPPVAFSRPV..TVDG............REA...AARFR--TVRVPA..DRFPA
E6WJ36_PANSA/10-188.DAVWRYLE..........S.QDIDGDPPASFYRPV..TLPDG.........SQQQ.....ARFR--TVRLRR..DLVPN
Q213B5_RHOPB/15-192.ELVYSTLK..........T.RGVP......VQP......PISFARPVVLADGTHD.....ARFK--VVRVSG..EQVEN
B9JHP8_AGRRK/10-187.ATLRGELA..........A.AGKPVTDWKDFSRPV..DVDG............VQK...PASFR--TFQLGQ..DAISN
Q0K796_CUPNH/8-187.FATAARLR..........A.AGWHTSDPIEFSRPV..RLDD............GSE..HPATFR--VTALDDAPG...A
Q89RQ5_BRADU/9-192.AAGAEEIR..........A.RGLT......PIGPT..DFERPVT......LPDGTV..SAAKFR--TFMWPT..AEAP.
A6X474_OCHA4/8-190.RDAKAELG..........V.LGIKTGEVGAFQRPV..ELPGG.........GEGV.....AAFE--TVSFAE..SEVP.
Q7VV42_BORPE/8-199.DAMHPQLT..........A.AGVPAP.APATLE.......RDAAFG.PANDQTRR.....ARFR--NINLDG..EAYPE
Q7VZU9_BORPE/17-205.GQRIAALR..........E.AGF.......AAEPG..VLQRYID.....TADGPR....LARFS--QVRTPR..QAMPE
D3PXN5_STANL/9-232.DKTAARLA..........D.VGVAHTGARPAQRPI..TTAE............GTS...LAAIK--YLEISD..D.DPS
C5C9I8_MICLC/6-186.GRFERRLG..........R.EAV.......PGNRR..FPDG............RE.....LSWR--QIGIK...GTL.A
A6WG27_KINRD/3-181.PAYAARLGE.......TAE.EG..........VRR..RPDG............VE.....LRWH--QIGAP....ALSE
C7Q7Z4_CATAD/3-184.TPWEQRLGR.......PAA.AG..........HRV..RPDG............FD.....LRWK--QLGVLD....LMA
D3Q658_STANL/7-189.DATAERLR..........R.QGHD.....VEVTTF..SFDG............SP.....VSFR--EAILTD..A.P..
A4X9C2_SALTO/3-192.AATARRVEQ........VT..GTDPG..LLRGESV..RADG............QR.....VPWA--EAAFDL..S...W
A0JUJ0_ARTS2/1-173.APFEERLG..........R.SAV.......NGNRK..FPDG............RE.....LVWK--QIGILG....LIA
A5VHI4_LACRD/7-201.EETHQRLE..........G.LGLNVG.DITDGKRV..DPAG............KL.....IQWK--IFYVND..E.LVN
A6T918_KLEP7/6-197.DATHDQLR..........R.TGVTVS.PIVDGQRN..DPQG............NI.....IRWR--IFTIDG..DT..A
D0IV05_COMT2/5-180.GAVVAAAQ..........A.RGLDYE.APYEGGRL..RPDG............EQ.....LRWR--NARAHS..QDLPF
F2KGG4_PSEBN/11-197.NADHGRMV..........E.AGLD......SQGRI..DFRRRMTL...PDGRHDE.....AVVS--LALFID..PALPD
G8PVJ3_PSEUV/4-182.DPVLTKHP..........NIFG..........EHV..PLPQ............DD.....PEFA--FSIAKD..GSLPL
Q2FVZ2_STAA8/5-191.EAVKNKLQ..........S.EQVE......VVGPI..QMERDT.......HKDGK.....VKWQ--LLYIMN..QDD.D
Q5HLY5_STAEQ/5-190.NQVKSTLE..........N.RGVD......VIGPI..DMEREN.......KKGHQ.....IRWR--LLYIAN..PDY..
Q5L3B6_GEOKA/5-192.GAVAAHLK..........R.NGFTPI.GPLPGSRE..RDDG............KR.....LTWS--MLFIED..DTDG.
Q63W09_BURPS/8-197.GLWQRQYP..........A.RI.........ARVV..PMTR............GD.....FGWR--LTVPDD..GALPA
Q6AAZ6_PROAC/4-172.APYEKRLE..........R.QSV.......PGKRT..FPDG............RH.....LEWR--QIGIKG....LMA
Q6N6G7_RHOPA/5-180.DADVAAAQ..........S.RGLDFE.NPEDGGRE..RPDG............ER.....LIWK--TARSKQ..SDTPF
Q81NU9_BACAN/4-191.EELADKFS..........K.YGLQTI.GPFEGKRM..RKDG............RL.....LEWK--MLFVKQ..EE..N
U5LCG2_9BACI/5-192.GKLQEQMA..........S.NGIKTV..IHKGRRT..RKDG............KL.....IKWK--MLFAEG..GG...
V6F093_9PROT/9-176.DRLRQPDE..........P.AL...............DMQR............GD.....FRWR--FAAPFD..GQPRL
V6F8Z3_9PROT/8-187.AAVVERLQ..........A.AGFDVPLPRSLSRRI.ETPDG...........TAT.....LMFS--ETLLPA..AATPG

PF14506

Q5M2X6_STRT2/13-137-PLEIEYLL----------A-RD----------------------------------------DNQAKAIFQG-------
Q8DP81_STRR6/14-136-PLEIEGIL----------S-KT----------------------------------------D.SIHRLYKG-------
Q8DVS0_STRMU/9-132-TEEIAALL----------A-NG----------------------------------------A.QADKVFKG-------
Q8DXW5_STRA5/9-132-AKDIEKLL----------A-NG----------------------------------------A.QAIQVYQG-------
Q99Y63_STRP1/9-131-PKEIEQLL----------A-HG----------------------------------------A.HYDALFKG-------

PF06983

Q7CRK9_AGRFC/2-118-DRYWNAIV----------G-NG----------------------------------------G.--......-------
Q92TY1_RHIME/2-118-DRIWHAFL----------D-NG----------------------------------------G.--......-------
Q837B9_ENTFA/2-127-ETLWKNLT----------A-DG----------------------------------------QI--LMP.FG-------
Q73WJ2_MYCPA/2-116-DYYWDRLS----------D-GG----------------------------------------..--......-------
Q82NZ5_STRAW/4-119-DHYWNRLT----------E-GG----------------------------------------G.--......-------
Q82XJ9_NITEU/2-119-DRYWNAII----------E-NG----------------------------------------G.--......-------
Q6MLW9_BDEBA/2-119-DRYWNAIL----------E-NG----------------------------------------G.--......-------
Q9X7R8_STRCO/4-119-DHYWTRLT----------E-GG----------------------------------------G.--......-------
Q97DK8_CLOAB/2-123-KRLWNAFS----------E-GG----------------------------------------TV--LMP.LD-------
Q97DK8_CLOAB/132-253-DYYSEKLS----------H-V.----------------------------------------..--......-------
Q89SJ1_BRADU/2-118-DSVWNAFI----------A-HG----------------------------------------G.--......-------
Q6N1I9_RHOPA/2-118-DRLWDALL----------A-EG----------------------------------------G.--......-------
Q9CEE8_LACLA/17-136-DDYWSKLS----------H-V.----------------------------------------..--......-------
Q88GT8_PSEPK/3-119-DRLWDAIV----------G-ND----------------------------------------G.--......-------
Q74AD9_GEOSL/5-121-DRYWNAIV----------G-NG----------------------------------------G.--......-------
Q98C01_RHILO/2-116-DHFWTRLT----------E-DG----------------------------------------G.--......-------
Q2G1U2_STAA8/5-129-ERLFNGLK----------D-EG----------------------------------------AI--LMPKTN-------
Q81QE2_BACAN/6-132-ETAFNKLA----------E-DG----------------------------------------AV--LMP.LG-------
Q8F7U5_LEPIN/2-119-EKIWASLS----------Q-EG----------------------------------------IV--LME.LQ-------
Q8NP25_CORGL/152-272-DAIWNALS----------A-V.----------------------------------------..--......-------

PF14696

Q124D7_POLSJ/13-161-KAAYERAI----------A-LG--------------------------------------------AWGYAH-------
A5WE99_PSYWF/5-143-RQAYKRAI----------E-QG--------------------------------------------AQPVEI-------
B6IWM9_RHOCS/19-161-AAALRRAV----------E-MG--------------------------------------------ATPVAP-------
Q2NAB6_ERYLH/5-147-AAAWDHLM----------D-AG--------------------------------------------AEPVQV-------
D0J5T0_COMT2/5-143-HKAYKRAL----------E-LG--------------------------------------------AQPVDI-------
Q2SND1_HAHCH/5-146-QKAFEYAV----------S-QG--------------------------------------------AKPFDQ-------
Q0ASV8_MARMM/5-143-AQAYDECL----------E-RG--------------------------------------------AEPVMT-------
A6VYX1_MARMS/5-143-HKAYEYVL----------S-KG--------------------------------------------AKPMDI-------
Q0BY65_HYPNA/5-146-RKAYDHLL----------T-QG--------------------------------------------AEPVQV-------
B2FKN2_STRMK/6-147-QEVYQTAL----------G-NG--------------------------------------------AEAIAF-------
D5VC74_MORCR/28-166-QYAYHRAI----------E-LG--------------------------------------------AKPVEI-------
Q63PY5_BURPS/6-154-AKAYRHAL----------E-LG--------------------------------------------AWGFDN-------
Q87Z77_PSESM/10-148-QHAYNRAL----------E-LG--------------------------------------------AQPLEI-------
Q8PDA4_XANCP/6-147-DTVLQTVL----------G-NG--------------------------------------------GEAVQK-------

PF06185

Q9CN85_PASMU/28-211FPKN.KSYP----------V-EG----------------------------------------WEHIEIVMPFLPH....
E6WA61_PANSA/8-184WPGE.KLYR----------H-EG----------------------------------------WEHVEIVLEGEPE....
Q7VP39_HAEDU/11-195FPKG.KTYL----------T-EG----------------------------------------WEHIEIVVAMQEA....
A1S7G3_SHEAM/3-184YPGS.KQYP----------S-EG----------------------------------------WEHIELVLACNAT....
H2ITZ6_RAHAC/6-182YPGD.KRYP----------H-EG----------------------------------------WEHIEIVLPGAED....
F4PTK1_DICFS/6-204SPKP.SKPQ----------V-DG----------------------------------------LEHVEFVTTQEFQ....
B2VJB7_ERWT9/11-187WPGQ.RLYR----------H-EG----------------------------------------WEHVEVVLRGDAS....
Q54MZ6_DICDI/4-182APKK.NRIN----------Y-DG----------------------------------------LEHIEMVINEPFQ....
C9R3D1_AGGAD/12-194LLKD.KHYP----------Q-ET----------------------------------------WEHIEVVVPFWAN....
E0SAV0_DICD3/24-197WPGS.KHYP----------H-EG----------------------------------------WEHVELVLPGDPT....
Y1581_HAEIN/7-187LPKN.KKYP----------I-EG----------------------------------------WEHIEIVMPFLPK....
I0DZQ5_PROSM/9-183FPKG.KMYP----------Q-ET----------------------------------------WEHVEMVINVAPE....
B7VI23_VIBTL/11-196YPAEGKIYP----------S-QD----------------------------------------WEHVEFVIPSHAQ....
Q7N560_PHOLL/9-183YPGK.KTYL----------H-QG----------------------------------------WEHVELVLPVAPE....
Q5E6L1_VIBF1/12-196YPGD.KSYP----------Q-QG----------------------------------------WEHVEWVIPCDVD....
YECM_ECOLI/9-185WPGE.KRYP----------H-EG----------------------------------------WEHIEIVLPGDPE....
A6VND1_ACTSZ/15-196FPKD.KIYR----------Y-ET----------------------------------------WEHIEFVIPLLAK....
B0UUF0_HISS2/18-194FPKD.KVYP----------V-EN----------------------------------------WEHIEVVIPFEVN....
D3VET8_XENNA/9-183YPTQ.KHYI----------H-QG----------------------------------------WEHVEIVLPAQAE....
A3QD08_SHELP/12-194YPGD.KRYP----------V-EG----------------------------------------WEHIELVLPGGAT....
F4HCP7_GALAU/9-190FPNQ.KRYP----------Q-QG----------------------------------------WEHIELVLPFLKN....
Q12LL9_SHEDO/6-186YPSD.KVYP----------N-EG----------------------------------------WEHVELVFNCEAK....
D3V176_XENBS/22-196YPSQ.KHYV----------H-QG----------------------------------------WEHVELVLSVPPE....
M9WWR4_MANHA/3-184FPKN.KVYL----------E-EG----------------------------------------WEHIELVFPMLDN....
F4QBC6_DICFS/15-213SHKP.SKPQ----------L-DG----------------------------------------LEHFYFVTSQSFQ....
Q87RD4_VIBPA/11-196YPAEGKTYP----------T-ES----------------------------------------WEHVEFVIPSHAE....
I2BA68_SHIBC/9-185WPGE.KRYP----------H-EG----------------------------------------WEHVEIVLPGDPL....
D8MT98_ERWBE/11-187WPGN.RLYR----------H-EG----------------------------------------WEHIEVVLRGDPD....
B8F673_HAEPS/18-196FPKG.KSYP----------E-EG----------------------------------------WEHIEIIIPMYEN....
W0HX46_9ENTR/9-183WPGE.RRYP----------H-EG----------------------------------------WEHIEMVLPGETD....
Q65SX5_MANSM/18-195FPKN.KHYP----------V-ES----------------------------------------WEHIEFVIPFLPN....
Q6LTA0_PHOPR/10-194YPSD.KTYP----------Q-EG----------------------------------------WEHVEFVIPGKAN....
Q8EF20_SHEON/12-196YPGD.THYP----------Q-EG----------------------------------------WEHIELVLPSTAQ....
E1SQM9_FERBD/4-183FPDGKKR..----------R-DG----------------------------------------WEHVELVMPCGATDKVQ
J7TZ01_MORMO/9-183FPKD.KQYA----------H-QG----------------------------------------WEHIELVLPGDPQ....
D4GGT7_PANAM/8-184WPGE.KRYR----------H-EG----------------------------------------WEHVEVVLRGEPE....
F7YNG9_VIBA7/11-196YPAEGKIYP----------E-QS----------------------------------------WEHVEFVVPSEAQ....
F0LNL8_VIBFN/11-196YPAPGKTYP----------Q-QS----------------------------------------WEHVEFVIPSQAQ....
W0L3M1_9ENTR/9-185YPGD.KRYP----------H-EG----------------------------------------WEHIELVLSGDPA....
C5B833_EDWI9/9-185YPGE.KCYP----------H-QG----------------------------------------WQHVELVLAGPPD....
Q7CIB5_YERPE/9-180YPGK.KHYP----------H-EG----------------------------------------WEHIELVLPGDPQ....
D4ZJ81_SHEVD/8-188YPGN.KQYP----------V-EG----------------------------------------WEHIELVLACTAT....
B4ETN6_PROMH/11-183YPTD.KKYQ----------Y-QG----------------------------------------WEHIEQVINVAPE....
A3MYB0_ACTP2/11-194FPKD.KVYP----------Q-QG----------------------------------------WEHIEIVYPMKPN....
Q083X6_SHEFN/2-197FPSD.KAYP----------I-EG----------------------------------------WEHIELVFPSQAQ....
Q9KQC7_VIBCH/11-196YPAQGKTYP----------E-QS----------------------------------------WEHVEFVIPSQAL....
Q6D475_PECAS/16-190WPGK.KYYP----------H-EG----------------------------------------WEHVELVLSGDTE....
Q7MMM2_VIBVY/16-201YPAEGKAYP----------Q-EG----------------------------------------WEHVEFVVPSHAQ....
M4RAR0_BIBTR/11-192FPKG.KTYP----------Q-EG----------------------------------------WEHIEIVVPMQEN....

PF12681

Q187Q5_PEPD6/3-120-----------EYPWGQR---TFR------------------------------FYDF--D---------K-NIIEISES
Q8TUF9_METAC/12-132-----------EQPWGQR---VIR------------------------------FYDP--D---------M-HIVEIGEP
Q97LL1_CLOAB/3-123-----------EHPWGQR---VIR------------------------------FYDP--D---------M-HIIEVGES
A5HYY7_CLOBH/3-121-----------KYKWKQR---VVR------------------------------IYDP--D---------H-HIIEIGES
A9CII6_AGRFC/3-123-----------RQAWGQR---VFR------------------------------FYDP--D---------G-HAIEVGES
Q81BZ3_BACCR/5-127-----------VKPWGQT---IAY------------------------------IADP--D---------G-NYIEICSS

PF00903

CADE_BACSU/9-123-----------HAVSEAL---Y..........-...............------LSDP-.D---------G-NGIEM---
YQCK_BACSU/2-115-----------TTCCYAV---QDKF.......-..............W------ITDP-.D---------G-NEWEF---
YQJC_BACSU/3-128-----------RQGANGK---KIAF.......-.............IS------PRET-.N---------G-VLVEL---
LGUL_HUMAN/31-174-----------DGKMKGL---AF.........-...............------IQDP-.D---------G-YWIEI---
D5T7F4_LEGP2/151-300-----------DTYYEMI---NDRLPWHKEPL-NQ...LHAEKILIDG------EADP-KD---------G-LLLQI---
CADI_MYCTU/2-114-----------TTCCFAT---QDKV.......-..............W------VTGP-.G---------G-ERWEV---
CF30_MYCTU/11-126-----------DIGDAGR---MSF........-...............------ITDP-.T---------G-AAVGL---
I7B4U0_PSEPT/143-261-----------RHTNDHM---ISF........-..............Y------GATP-.S---------G-FAVEY---
BPHC2_RHOGO/6-121-----------HGVTTSL---Y..........-...............------YQDP-.D---------G-NFVEL---
LGUL_PSEPU/24-167-----------DGRMNHL---AF.........-...............------IKDP-.D---------G-YWVEV---
HPPD_RAT/180-335-----------SYYRLLR---E..NLKTSKIQ-VKENMDVLEELKILV------DYDE-.K---------G-YLLQI---
BPHC3_RHOGO/6-122-----------HGVTTSL---Y..........-...............------YRDP-.D---------G-NMVEL---
LGUL_BRAJU/27-171-----------DGKMKNI---AF.........-...............------IKDP-.D---------G-YWIEI---
O24828_9GAMM/150-266-----------RHGLTHG---QTI........-..............Y------FFDP-.S---------G-NRNEV---
LGUL_SYNY3/2-123-----------PMKHGTT---VIA........-..............F------VEDP-.D---------G-YKIEL---
O26852_METTH/2-112-----------PITVGLL---AF.........-...............------IEDP-.N---------G-VRIAL---
P95571_9PSED/143-280-----------RHVNDHM---ISF........-..............Y------AETP-.S---------G-FELEF---
LGUL_NEIMB/2-123-----------PMKHGTT---VIA........-..............F------VEDP-.D---------G-YKIEF---
Q98LB0_RHILO/89-205-----------TEPWGAR---TFI........-...............------VKDP-.D---------G-NLICF---
Q98HZ4_RHILO/7-135-----------VMFWGDR---WGQ........-...............------LNDP-.F---------G-VAWAM---
FOSB_BACSU/5-117-----------RDERDRK---SIY........-...............------FTDP-.D---------G-HKFEF---
Q9KZ01_STRCO/31-158-----------AAPWAPL---YGM........-...............------LRDR-.F---------G-VTWVL---
MHQE_BACSU/5-263-----------REYFTSV---Y..........-...............------FREK-.G---------G-ILFEI---
P72786_SYNY3/14-143-----------TRPTGRG---IY.........-...............------FYDP-.D---------G-FQVEI---
O53680_MYCTU/15-163-----------HDDSETQ---VSAVVHPGV..-.........YVRSFY------FQDP-.D---------G-ITLEF---
YRAH_BACSU/2-124-----------DRKEWSA---RVA........-..............H------FRDP-.D---------H-NLIEI---
FOSB_STAEP/4-116-----------RDIRDKK---SIY........-...............------FTDL-.D---------G-HKLEL---
O68311_GEOTH/148-265-----------RHGITRG---QTI........-..............Y------YFDP-.S---------G-NRNEV---
YYAH_BACSU/2-124-----------TTGDGYY---ESV........-...............------IEDD-.E---------G-NLIEI---
YETH_BACSU/4-118-----------QMEWGTF---VQ.........-...............------FKDE-.D---------G-NVFLL---
Q9ZNP0_COMTE/147-272-----------RHGITRG---ETI........-..............Y------FFDP-.S---------G-NRNET---
Q9ZAY0_9SPHN/150-267-----------RHGITRG---QTI........-..............Y------FFDP-.S---------G-NRNET---
O06412_MYCTU/4-113-----------REPWGLH---EMH........-...............------VTDP-.D---------G-ITLIF---
LGUL_HAEIN/2-123-----------PVKGGST---VIA........-..............F------VEDP-.D---------G-YKIEF---
D5AV60_RHOCB/8-122-----------LRAYHPG---YYAA.......-..............F------VLDP-.D---------G-NNIEA---
YYCE_BACSU/11-130-----------PYWSNGG---VT.........-...............------IEDP-.D---------G-WRIVF---
C3JUU8_RHOER/142-267-----------RHVNDEM---LSF........-..............Y------MKTP-.G---------G-FDIEF---
MHQO_BACSU/7-266-----------RNYFNAI---Y..........-...............------FREH-.G---------E-ILFEI---
HPPD_PSEUJ/158-310-----------DTYYEML---EGRLPNHGEPV-GEL.QARGILLDGSS------ESGD-.K---------R-LLLQI---
Q45135_9MICO/152-268-----------RHGVSNA---FYL........-..............Y------ILDP-.D---------N-HRIEI---
N9VUR8_PSEPU/150-266-----------RHGLTHG---KTI........-..............Y------FFDP-.S---------G-NRNEV---
LGUL_BRAOG/17-138-----------PVKGGGS---VIA........-..............F------VKDP-.D---------G-YTFEL---
Q9I3Z1_PSEAE/3-131-----------PTFWAAS---FGM........-...............------FTDR-.F---------G-VAWMV---
Q9KYP6_STRCO/2-118-----------TMPWGNR---ALL........-...............------FRDP-.D---------G-NLVNF---
MHQA_BACSU/5-275-----------RYYFKAL---Y..........-...............------FREP-.N---------G-ILFEL---
Q59693_PSEPU/147-272-----------RHGITRG---ETV........-..............Y------FFDP-.S---------G-NRNET---
LGUL_SCHPO/11-150-----------DGKMKHI---AF.........-...............------ALDP-.D---------N-YWIEL---
LGUL_SALTY/2-123-----------PVKGGST---IIA........-..............F------VEDP-.D---------G-YKIEL---
Y3691_SHEFN/4-116-----------.......---...........-...............------PQEQ-DY---------G-TVAVF---
Q9KZG9_STRCO/4-130-----------KQMWGDV---FGM........-...............------CTDR-.F---------G-VTWMV---
YURT_BACSU/2-124-----------KMGEVTI---AV.........-...............------FDDT-.C---------G-NLIQI---
YWKD_BACSU/5-125-----------DPLTGKR---FTF........-...............------FFDP-.D---------Q-LPLEL---
Q52533_PSESP/147-267-----------HHPNDQM---TSF........-..............Y------VETP-.S---------G-FSIEY---
MCE_PYRHO/7-131-----------RVGAGGA---KIAF.......-.............IH------PKSV-.T---------G-VLLEL---
P97099_CUPNE/143-262-----------RHTNDHT---ISF........-..............Y------ADTP-SP---------M-IEVEF---
DNRV_STRPE/8-133-----------DVLGLGR---MAV........-...............------FADP-.A---------G-AAFAV---
P73508_SYNY3/5-122-----------LRFAGEL---TEHRT......-.............FF------LADP-.F---------H-NYLEF---
HMAS_AMYOR/158-306-----------AYYDLLG---ERITLQTHSLD-......DLRATNVLA------DEDH-.G---------G-QLFQI---
O86701_STRCO/4-132-----------DQPYGVR---DCA........-...............------FRDP-.A---------G-NMVRL---
Q7AQ90_MYCLE/20-150-----------RQGTSNA---RINF.......-.............IH------PKDA-.G---------G-VLIEL---
LGUL_YEAST/22-164-----------EGRQKDI---AF.........-...............------ALGP-.D---------G-YWIEL---
C1KH52_SERMA/4-114-----------SEGASFY---...........-...............------FLDP-.D---------G-HKLEL---
C3LUW7_VIBCM/6-113-----------EFPGGCR---FH.........-...............------FTEP-.S---------G-NEFAV---
Q9Z549_STRCO/4-125-----------DAPWGQR---YAV........-...............------LGDP-.D---------G-HGVDL---
Q48341_STRLI/5-125-----------DDAFGQR---GGR........-...............------IKDP-.F---------G-NIWWV---
O32376_COMTE/143-262-----------RHTNDHM---VSF........-..............Y------AATP-CA---------G-VEVEY---
O69350_RHOER/145-267-----------RHTNDKM---ISF........-..............Y------VRAP-.G---------G-WDIEF---
GLOD4_CAEEL/132-248-----------TLETPGK---ADVQV......-.............VI------LADP-.D---------E-HEICF---
YAER_ECOLI/6-126-----------DPYTQKR---FTF........-...............------FNDP-.D---------G-LPLEL---
O86906_SPHSX/146-261-----------RHTNDRM---LSF........-..............Y------CENP-.S---------G-SQTEF---
O28796_ARCFU/50-170-----------KTEWGLQ---VD.........-...............------FEDT-.C---------G-NLIRF---
O05205_STRLA/4-125-----------NAVWGQR---YAI........-...............------VKDP-.D---------G-NVVDL---
I7MMZ2_TETTS/194-350-----------SYYDNLR---KALTAQTSITV-KED.LDVLQKNHILV------DYDE-.K---------G-YLLQI---
Q9I5D5_PSEAE/8-139-----------DEDYGGR---GFT........-...............------CRDP-.E---------G-HVWSF---
O87625_PSEAI/152-264-----------RHIGGSN---YFH........-..............Y------IRDP-.W---------G-SLVEY---
Q50912_SPHXE/13-131-----------HGVSTGI---Y..........-...............------FYDP-.D---------G-HMLEV---
A5W4G6_PSEP1/11-255-----------RHPPSDS---VFF........-..............Y------FLDP-.D---------G-ITVEY---
Q59770_RHORH/162-279-----------KHGLTQA---FYV........-..............Y------VFEP-.G---------G-NRVEL---
YWBC_BACSU/4-123-----------TTLPNGY---RYF........-..............Y------IEGP-.D---------G-EWIEF---
Q9KEK2_BACHD/4-140-----------KTFFSPL---YGQ........-...............------VTDK-.F---------G-ITWHV---
O28065_ARCFU/4-128-----------RVGAGGK---KVAF.......-.............VH------PKST-.H---------G-VLLEF---
A2YS08_ORYSI/24-146-----------PVKGGST---VIA........-..............F------AQDP-.D---------G-YMFEL---

PF13669

A9C2R0_DELAS/14-124-----------..G.IRQ---G..------------------------------.A.A--.---------G.YDICF---
A2SEJ1_METPP/12-122-----------..G.IRK---G..------------------------------.A.A--.---------G.HDICF---
D0LXQ3_HALO1/13-123-----------..G.IRA---G..------------------------------.A.A--.---------G.HDVCF---
Q5P377_AROAE/12-122-----------..G.IRR---G..------------------------------.A.A--.---------G.FDITF---
Q1D6F8_MYXXD/37-147-----------..G.IRK---G..------------------------------.A.A--.---------G.FDICF---
B8BYE7_THAPS/75-187-----------..G.IRK---G..------------------------------.A.A--.---------G.HDVTF---
B5Y3L3_PHATC/38-148-----------..G.IRR---G..------------------------------.A.A--.---------G.HDVAF---
A4HEL0_LEIBR/19-133-----------..K.PKI---G..------------------------------.A.H--.---------G.NPVIF---
D4J6L0_9FIRM/18-126-----------..E.PQE---G..------------------------------.T.E--.---------D.IIVNF---
D2RXZ8_HALTV/10-118-----------..A..E.---...------------------------------.F.E--.---------H.WGEAF---
Q39TG0_GEOMG/11-132-----------..G.TTS---...------------------------------...A--.---------G.MGYVY---
D3F6C9_CONWI/9-133-----------..G.RGY---G..------------------------------.R.D--.---------GDGGFLY---
A6LI20_PARD8/8-119-----------..P.VEA---P..------------------------------.AIH--.---------N.SKVAF---
Q97H22_CLOAB/4-114-----------.AE.IAP---A..------------------------------.I.D--.---------N.RKVAF---
B9JM51_AGRRK/6-125-----------..G..SF---...------------------------------...G--.---------D.TRFNY---
C5CVE4_VARPS/9-131-----------..G..EV---G..------------------------------.E.R--.---------G.RFIYF---
Q13K82_BURXL/9-131-----------..G..EV---G..------------------------------.R.N--.---------G.RFVYF---
Q13I71_BURXL/19-140-----------..A..RS---...------------------------------.P.R--.---------G.PRVTY---
Q5UWE3_HALMA/10-117-----------....YRE---Y..------------------------------.Q..--.---------D.WTEAF---
C0ZEG8_BREBN/1496-1609-----------..PKPAV---L..------------------------------.F.N--.---------H.RLVAF---
D4M9A6_9BACT/4-116-----------..P.APA---P..------------------------------.AMG--.---------Q.RRVAF---
Q12HJ2_POLSJ/9-131-----------..G..EV---G..------------------------------.E.K--.---------G.RFIYF---
D2RQ64_HALTV/17-139-----------..G.NFD---G..------------------------------.T..--.---------...EFWY---
A5VBF6_SPHWW/10-129-----------..A..RN---...------------------------------...P--.---------S.TRVAY---
A1TCL4_MYCVP/8-130-----------..A.SGP---G..------------------------------.G.A--.---------V.TRFAY---
C7PR30_CHIPD/14-138-----------..V.DHP---I..------------------------------.A..--.---------...RMAF---
A4XEN6_NOVAD/16-137-----------..D.GKF---G..------------------------------.A..--.---------..MRFCY---
A5G6D6_GEOUR/8-118-----------..Q.VPA---V..------------------------------.AFD--.---------L.CRIGF---
Q2YCD2_NITMU/13-126-----------..S.PPK---PAI------------------------------LF.D--.---------D.RRVSF---
B1MB48_MYCA9/17-139-----------..G.VMP---G..------------------------------....--.---------G.MRFAY---
A0R1J5_MYCS2/10-129-----------..G...G---E..------------------------------.A.E--.---------G.VRFAY---
C7RS60_ACCPU/18-128-----------..P.VAA---V..------------------------------.AFG--.---------G.RRISF---
D5URS6_TSUPD/111-214-----------....VRR---G..------------------------------.A.K--P---------G.TRVAT---
D0LDW1_GORB4/120-238-----------....IRA---G..------------------------------.R.K--P---------G.TRIAT---
A5V4C1_SPHWW/15-137-----------..G.VA.---G..------------------------------...V--.---------G.ARAAY---
E0UKN1_CYAP2/120-235-----------..W.FRN---Q..------------------------------.E.G--.---------S.IPFTV---
Q2G768_NOVAD/15-136-----------..A.AVP---T..------------------------------....--.---------G.GSVAY---
Q744Q1_MYCPA/12-125-----------.....AD---T..------------------------------.A.A--.---------P.DLALF---
D2AXE6_STRRD/3-112-----------..H.PHA---G..------------------------------.G.T--.---------D.QYAGY---
B8FMX2_DESAA/10-131-----------..S.GNI---G..------------------------------.D.N--.---------G.RFAYY---
C5C099_BEUC1/20-129-----------..Y.PYA---G..------------------------------.G.P--.---------D.HYACY---
Q15VI5_PSEA6/7-112-----------..G.YY.---...------------------------------.E.P--.---------G.RRFYF---
A2QUW1_ASPNC/11-144-----------..G.YFL---G..------------------------------KR.G--.---------G.TKFCF---
Q28K59_JANSC/19-130-----------..D.VVD---H..------------------------------.A.L--.---------S.WSIYF---
A1SVB5_PSYIN/4-112-----------..P.KKA---V..------------------------------LF.N--.---------D.RKVAF---
C7NIJ3_KYTSD/10-119-----------..H.PHA---G..------------------------------.G.A--.---------D.SYAAY---
A4SXB6_POLSQ/12-122-----------..G.IRK---G..------------------------------.A.A--.---------G.FDITF---
A4XGA4_CALS8/13-134-----------..G.DYT---G..------------------------------.G..--.---------...RYAY---
B0RG81_CLAMS/8-115-----------DWH.PHA---G..------------------------------.G.P--.---------D.HHAAF---
B2HSW2_MYCMM/9-134-----------..G.SMP---G..------------------------------....--.---------G.IQFAY---
B8E0B0_DICTD/13-133-----------..G.DYT---G..------------------------------.G..--.---------...KYT.---
F3Z5I0_9ACTN/9-118-----------..H.PHA---G..------------------------------.G.P--.---------D.QYAAY---
R5SQY8_9FIRM/9-124-----------..H.WRV---G..------------------------------.A.G--.---------G.CHIAF---

PF13468

C5BVV5_BEUC1/6-191T.........WARGLPNF...YFHEDAP..DH.PAR........ARVE......HEPP.VT---------EVAWLEIGAR
Q3IZS4_RHOS4/4-171...........DNLFPAL...IEWQGS....P.P.............S......LPDA.GL---------RLARIEIRHP
Q28LV8_JANSC/4-176...........DGLFPAL...IQWHGT...AH.PA...........PR......LQDT.GV---------RLKELRLHSP
D7BGN4_MEISD/10-187...........GGLIPSL...ICWGET...PH.PT...........TR......LPDV.GC---------QLVGLYGVHP
D3PMM6_MEIRD/4-173...........GGVVPYL...IEWGAR....H.PT...........DT......LPDT.GC---------RLLAWKLLHP
Q1IXF9_DEIGD/4-178...........GGALPSL...ITWHTP....P.PP...........TR......LPDA.GV---------RLEKLTLGTP
A9HYM0_BORPD/5-178...........AGAAPTL...IQWDAL...PH.PA...........TK......LDDL.GC---------HLEALQVFHP
Q47D15_DECAR/6-180...........DGIAPAL...IEWHTD...VH.PA...........AK......LEDK.GL---------SLVKLEIMHP
A9B642_HERA2/8-182...........AGVAPML...IEWPRE...QH.PI...........QR......LTDQ.GC---------RLLQLELHHP
D2QC41_SPILD/11-185...........QGLAPTV...IQWAGD...AH.PA...........YG......LSPS.DV---------TLTAIEARHP
B8IP73_METNO/4-183...........GGVAPSV...IDWEGQ....PGPA...........GG......MNDV.GA---------RLLSFTVAHP
B1LV77_METRJ/4-183...........DGAAPCA...MDWGPR...GN.PA...........TT......MPDL.GA---------DLEALVLTHP
C5CLJ8_VARPS/5-199...........YGALPTL...IQWGPV....H.PT...........DA......MPAS.GL---------AMRSLRATHP
D3Q0J0_STANL/2-177...........RGLIPFL...IDWGDT...PH.P.............A......AELP.KV---------SLRELSAVHP
B5HRA1_9ACTN/8-184...........SGLVPFL...IDWGAT...AH.P............TA......SGLP.TT---------VLRSLTATAP
A4FK05_SACEN/2-174...........DGPVPFL...IDWGDS...RH.P.............S......EGLP.VV---------PLRSMFGVHP
C7MHL9_BRAFD/7-186...........NYGLPFL...IDWGPT...TQ.P.............G......LGDLPSL---------ELVSFERIEV
A6WBM6_KINRD/7-183...........RPDVPFL...IDWGGT....P.Q.............P......GFTV.DA---------TLELLDLTHV
B7FUP4_PHATC/255-429...........GGICPFF...INWANS...DH.PC...........AT......LPVV.G.---------KLKKVYVRAP
B7FSM2_PHATC/69-245...........GGLAPIY...CHWGKS...TH.GA...........SK......LPQV.G.---------RLVSVKVRVR
C0ZG21_BREBN/5-195............LLPPFL...IEWSQT...DA.ERREDL.TNRGIINA......HPNG.AA---------DLKSVGYAVT
Q8ELK5_OCEIH/5-195...........SPELPFF...IEWDES....D.EWRKKDLEKSNAIAD......HPIG.DI---------ALESIGFAVN
B1HV56_LYSSC/5-194.............DFPFL...IEWADE....D.EKRL.....AQLKASG...AIDETQ.AI---------TMESIQFYVR
Q5WBL3_BACSK/5-198...........ELPLPFF...IDWHET....N.QERL.....NELKEAQV.VAPHSAG.QW---------KIDSFLMAVH
B9DM11_STACT/6-192...........DLKPPFF...IQWSKS....E.EERE......EALKS......KFQP.EF---------EIKAIEVQTT
B9E9H1_MACCJ/8-191............YELPFF...IQWGAS...DD.ER..........MQSL...SPYFQG.NL---------KIEGIDIETT
D1CHQ7_THET1/9-194...........RRPWPFV...ISWDMS....D.EERLA....LEAPGD......HPNG.AT---------RIACLSVVVK
D1C9M3_SPHTD/5-190...........RRPWPFL...IQWDQS....D.EQRLS....WEQPGS......HPNG.AT---------TVLGVSVVVA
A5UPV1_ROSS1/5-179L.........CGDVTPRD...LRVPTG....A.A............RL......HLNG.VT---------GIARVRVATR
B0D2X2_LACBS/11-211F.........CGDITPRD...LRVPTK....P.PA..........NVQ......HPST.TQ---------GIAHIRIVTD
B9L3L2_THERP/5-180...........TGQLPFL...IEDVTP....R.QERVP....HGQQAE......HPNG.AR---------GVAEVVIAVR
Q0UPP1_PHANO/6-192...........RGRIPFFCHDITHRST....RVPLS.......KENTT......HPCG.AL---------GITQLSIIAR
A7I5C5_METB6/53-255.............AVPFL...IADDTP....R.SYRVP....GGADAM......QPNN.VT---------GIKRIVIRTQ
Q11EY7_CHESB/5-184RVEL...PFIAADLTPRN...IRIPDD....N.I.............R......HANT.AK---------GIVGLSIVTD
C7N101_SLAHD/3-183.............DVPFL...MTYFST....D.PKP........VDFV......HPNG.IA---------GIDKIVYGTD
Q215A9_RHOPB/5-194AGF.....AVCQHHFPEN...F.WNAA....F.Q.............R......HDNG.AR---------SVRAAVLVAD
A7IN29_XANP2/5-195FSL.....FTCTQKLPEN...F.WSAD....L.Q.............R......HSNQ.VT---------GVAGVVLVAD
Q92KD8_RHIME/11-203.............FFLFA...CQRLRA....L.PVDS......SSLHR......HGNG.VL---------GIAEVVLSEQ
B9JW73_AGRVS/9-199.................F...LFACER...VN.PLPAD....RTALET......HTNG.VI---------GLTRVFFYAP
Q2W045_MAGSA/8-179............GIASFL...CQHLTP....E.KLRR......PGWTE......HANS.AT---------GMLSVTALMA
Q7VS77_BORPE/8-188...........GLTHANL...CQHLTA....D.TLRQ......PGWTD......HPNG.VV---------AFGRLVGMVS
Q2KVI0_BORA1/6-182LRM.....YFCRHLTPEC...V.WAPE....F.M.............N......HPNQ.TR---------SLARIDVRSA
Q13QK5_BURXL/9-186GRV.....YFCEHLTPEW...V.FRAE....W.A.............K......HPNG.AQ---------RLKECVIVSD
B1M8D4_METRJ/14-190GRL.....YHCEHRTPDL...V.WRPE....W.L.............D......HPNG.FS---------GIDALTIESP
E6WJ36_PANSA/10-188GRS.....FFCQHETPQA...V.WQPA....W.Q.............Q......HPNG.VN---------NIVEFVVVAQ
Q213B5_RHOPB/15-192GRT.....FFCHHDTPEL...V.WRPE....W.Q.............A......HRNG.VT---------GIAEFVIAAR
B9JHP8_AGRRK/10-187GRF.....FFCQHNTPEL...V.WRPV....D.Q.............D......HPNS.VL---------DISDVFIVSR
Q0K796_CUPNH/8-187RY......FVCEHRTPEL...L.WRPE....W.T.............R......HANG.AH---------SIATMFLVVA
Q89RQ5_BRADU/9-192...........GGVRIFA...CQHKTR....E.TVWI......PELMK......HANA.AK---------RIKQTLIATP
A6X474_OCHA4/8-190............QGMVFM...CQHKTR....E.TVWL......PELIE......HANG.AN---------GLSAIVAISS
Q7VV42_BORPE/8-199..............ARFI..VIEHGTRDVLWQ.PH..........LLD......HPNG.AT---------GLAAMYFAAA
Q7VZU9_BORPE/17-205GLI.....LTLRHETPEL...L.WQAR....Y.M.............D......HPNG.AR---------ALAAAIVAVE
D3PXN5_STANL/9-232GMPPEGRVGAAEDAPPEL...L..DA.......QL..........GLD......HPNG.AL---------GLTECVLCVS
C5C9I8_MICLC/6-186...........DPQLPFI...LRWADGQEDMH.P............SQ......AAEP.QA---------TIERLNIAGS
A6WG27_KINRD/3-181...........EPQLPLL...IEWDGPP.TQH.PS...........AI......SSAG.GA---------RLAGLTIAGQ
C7Q7Z4_CATAD/3-184...........DPQLPYF...LAWEIS...AD.QR.........PGAG......AVNG.VP---------AFERLEISGD
D3Q658_STANL/7-189............PWAPFF...ITYTPS....R.EEIWT....KLAADR......VNRG.TH---------DLTGIVIETP
A4X9C2_SALTO/3-192..........RSRVLPFF...LSYGNP....A.DRADR....VAGDLRA...AGHRVR.PT---------ALAGLVTGPA
A0JUJ0_ARTS2/1-173...........DPQVPYM...LKWEGDP.ELH.P............SN......AYPS.NV---------KMSSLTIAGS
A5VHI4_LACRD/7-201...........HLPAPFF...IQWGNN...DD.QRRE......DLK.KQGLIKFHPAG.DL---------FVKQAIFNVS
A6T918_KLEP7/6-197...........GLVYPFV...LQWGED....D.ATRLTRLRAQRLDAP......HPLG.DI---------TLEQAVFEVV
D0IV05_COMT2/5-180L.........CGDLTPRA...LRVPEG....Q.A............RV......HPNG.VT---------GVARLEVAVK
F2KGG4_PSEBN/11-197ASN.....FICHQHRPEL...I.WVPG....W.Q.............N......HPNG.AD---------GILAITYLAD
G8PVJ3_PSEUV/4-182...........EGAAPSL...IDRYGV....P.EN..........PSD......IPDL.GA---------RLETFTLEHP
Q2FVZ2_STAA8/5-191...........EIKPPFF...IQWEES....D.SMRT......KKLQK......YFQK.QF---------SIETVIVKSK
Q5HLY5_STAEQ/5-190...........TVKPPFF...IEWDNN....K.KQNL......SQIHN......FNLS.SF---------KIKEVIITST
Q5L3B6_GEOKA/5-192...........AFRYPFF...IQWGDG....D.DVRMN...ELAPLMR......HPIG.SV---------SLSSISLYTL
Q63W09_BURPS/8-197WQ......GAGDGVLPSL...IQWSDA...RH.PC...........DA......LPHG.DV---------ALTALKAAHP
Q6AAZ6_PROAC/4-172...........DPQLPFF...IKWTSP....T.EL..........LPS......SLSG.NV---------TLTSVEMSGS
Q6N6G7_RHOPA/5-180F.........CGDVTPRA...LRVPEG....A.V............RQ......HPNG.AL---------GIGSVVVAVK
Q81NU9_BACAN/4-191...........GPKLPFF...IQWNET....D.EERRKDLRNIGTITE......HKNK.VQ---------QIETVHYAVK
U5LCG2_9BACI/5-192...........RLPYPFF...IEWEQK....D.EERF......NDL.RNTGILLPSQE.SH---------AVKTIKILTE
V6F093_9PROT/9-176...........GGTVPAL...IQWQDG...GH.PC...........NR......LPDH.GL---------RLKRLTLSYA
V6F8Z3_9PROT/8-187..........IHTRVTQH...ITAERE...RF.PE..........WLD......HPNT.AI---------GIASVTAIVA

PF14506

Q5M2X6_STRT2/13-137-----------ENGYAFE------------------------------------TISP--E---------N-DLILVHAE
Q8DP81_STRR6/14-136-----------QNGYAFE------------------------------------IFSP--E---------D-DLILIHAE
Q8DVS0_STRMU/9-132-----------ANGYAFE------------------------------------AISP--E---------K-DRFLIHAE
Q8DXW5_STRA5/9-132-----------QNGYAYE------------------------------------TVSP--E---------G-DL